data_3GIZ
# 
_entry.id   3GIZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GIZ         
RCSB  RCSB051919   
WWPDB D_1000051919 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GIZ 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Du, J.'   1 
'Yang, H.' 2 
'Ding, J.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Fab fragment of therapeutic antibody Ofatumumab provides insights into the recognition mechanism with CD20' 
_citation.journal_abbrev            Mol.Immunol. 
_citation.journal_volume            46 
_citation.page_first                2419 
_citation.page_last                 2423 
_citation.year                      2009 
_citation.journal_id_ASTM           MOIMD5 
_citation.country                   UK 
_citation.journal_id_ISSN           0161-5890 
_citation.journal_id_CSD            0921 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19427037 
_citation.pdbx_database_id_DOI      10.1016/j.molimm.2009.04.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Du, J.'   1 
primary 'Yang, H.' 2 
primary 'Guo, Y.'  3 
primary 'Ding, J.' 4 
# 
_cell.entry_id           3GIZ 
_cell.length_a           136.330 
_cell.length_b           55.944 
_cell.length_c           79.780 
_cell.angle_alpha        90.00 
_cell.angle_beta         122.17 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GIZ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fab fragment of anti-CD20 antibody Ofatumumab, light chain' 23174.719 1   ? ? ? ? 
2 polymer     man 'Fab fragment of anti-CD20 antibody Ofatumumab, heavy chain' 23717.531 1   ? ? ? ? 
3 non-polymer syn 'ZINC ION'                                                   65.409    3   ? ? ? ? 
4 water       nat water                                                        18.015    221 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
;EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQRSNWPITFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
;
L ? 
2 'polypeptide(L)' no no 
;EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLY
LQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPGSSKSTSGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
;
;EVQLVESGGGLVQPGRSLRLSCAASGFTFNDYAMHWVRQAPGKGLEWVSTISWNSGSIGYADSVKGRFTISRDNAKKSLY
LQMNSLRAEDTALYYCAKDIQYGNYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPGSSKSTSGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  THR n 
1 11  LEU n 
1 12  SER n 
1 13  LEU n 
1 14  SER n 
1 15  PRO n 
1 16  GLY n 
1 17  GLU n 
1 18  ARG n 
1 19  ALA n 
1 20  THR n 
1 21  LEU n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  VAL n 
1 30  SER n 
1 31  SER n 
1 32  TYR n 
1 33  LEU n 
1 34  ALA n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  GLY n 
1 42  GLN n 
1 43  ALA n 
1 44  PRO n 
1 45  ARG n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  TYR n 
1 50  ASP n 
1 51  ALA n 
1 52  SER n 
1 53  ASN n 
1 54  ARG n 
1 55  ALA n 
1 56  THR n 
1 57  GLY n 
1 58  ILE n 
1 59  PRO n 
1 60  ALA n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  THR n 
1 73  LEU n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  SER n 
1 78  LEU n 
1 79  GLU n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  PHE n 
1 84  ALA n 
1 85  VAL n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  ARG n 
1 92  SER n 
1 93  ASN n 
1 94  TRP n 
1 95  PRO n 
1 96  ILE n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLN n 
1 101 GLY n 
1 102 THR n 
1 103 ARG n 
1 104 LEU n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
1 108 ARG n 
1 109 THR n 
1 110 VAL n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 SER n 
1 115 VAL n 
1 116 PHE n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 ASP n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 LYS n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 LEU n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 ARG n 
1 143 GLU n 
1 144 ALA n 
1 145 LYS n 
1 146 VAL n 
1 147 GLN n 
1 148 TRP n 
1 149 LYS n 
1 150 VAL n 
1 151 ASP n 
1 152 ASN n 
1 153 ALA n 
1 154 LEU n 
1 155 GLN n 
1 156 SER n 
1 157 GLY n 
1 158 ASN n 
1 159 SER n 
1 160 GLN n 
1 161 GLU n 
1 162 SER n 
1 163 VAL n 
1 164 THR n 
1 165 GLU n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 LEU n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 SER n 
1 183 LYS n 
1 184 ALA n 
1 185 ASP n 
1 186 TYR n 
1 187 GLU n 
1 188 LYS n 
1 189 HIS n 
1 190 LYS n 
1 191 VAL n 
1 192 TYR n 
1 193 ALA n 
1 194 CYS n 
1 195 GLU n 
1 196 VAL n 
1 197 THR n 
1 198 HIS n 
1 199 GLN n 
1 200 GLY n 
1 201 LEU n 
1 202 SER n 
1 203 SER n 
1 204 PRO n 
1 205 VAL n 
1 206 THR n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   VAL n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  GLN n 
2 14  PRO n 
2 15  GLY n 
2 16  ARG n 
2 17  SER n 
2 18  LEU n 
2 19  ARG n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  ALA n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  ASN n 
2 31  ASP n 
2 32  TYR n 
2 33  ALA n 
2 34  MET n 
2 35  HIS n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  VAL n 
2 49  SER n 
2 50  THR n 
2 51  ILE n 
2 52  SER n 
2 53  TRP n 
2 54  ASN n 
2 55  SER n 
2 56  GLY n 
2 57  SER n 
2 58  ILE n 
2 59  GLY n 
2 60  TYR n 
2 61  ALA n 
2 62  ASP n 
2 63  SER n 
2 64  VAL n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  THR n 
2 70  ILE n 
2 71  SER n 
2 72  ARG n 
2 73  ASP n 
2 74  ASN n 
2 75  ALA n 
2 76  LYS n 
2 77  LYS n 
2 78  SER n 
2 79  LEU n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  MET n 
2 84  ASN n 
2 85  SER n 
2 86  LEU n 
2 87  ARG n 
2 88  ALA n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  LEU n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  LYS n 
2 99  ASP n 
2 100 ILE n 
2 101 GLN n 
2 102 TYR n 
2 103 GLY n 
2 104 ASN n 
2 105 TYR n 
2 106 TYR n 
2 107 TYR n 
2 108 GLY n 
2 109 MET n 
2 110 ASP n 
2 111 VAL n 
2 112 TRP n 
2 113 GLY n 
2 114 GLN n 
2 115 GLY n 
2 116 THR n 
2 117 THR n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 SER n 
2 123 ALA n 
2 124 SER n 
2 125 THR n 
2 126 LYS n 
2 127 GLY n 
2 128 PRO n 
2 129 SER n 
2 130 VAL n 
2 131 PHE n 
2 132 PRO n 
2 133 LEU n 
2 134 ALA n 
2 135 PRO n 
2 136 GLY n 
2 137 SER n 
2 138 SER n 
2 139 LYS n 
2 140 SER n 
2 141 THR n 
2 142 SER n 
2 143 GLY n 
2 144 THR n 
2 145 ALA n 
2 146 ALA n 
2 147 LEU n 
2 148 GLY n 
2 149 CYS n 
2 150 LEU n 
2 151 VAL n 
2 152 LYS n 
2 153 ASP n 
2 154 TYR n 
2 155 PHE n 
2 156 PRO n 
2 157 GLU n 
2 158 PRO n 
2 159 VAL n 
2 160 THR n 
2 161 VAL n 
2 162 SER n 
2 163 TRP n 
2 164 ASN n 
2 165 SER n 
2 166 GLY n 
2 167 ALA n 
2 168 LEU n 
2 169 THR n 
2 170 SER n 
2 171 GLY n 
2 172 VAL n 
2 173 HIS n 
2 174 THR n 
2 175 PHE n 
2 176 PRO n 
2 177 ALA n 
2 178 VAL n 
2 179 LEU n 
2 180 GLN n 
2 181 SER n 
2 182 SER n 
2 183 GLY n 
2 184 LEU n 
2 185 TYR n 
2 186 SER n 
2 187 LEU n 
2 188 SER n 
2 189 SER n 
2 190 VAL n 
2 191 VAL n 
2 192 THR n 
2 193 VAL n 
2 194 PRO n 
2 195 SER n 
2 196 SER n 
2 197 SER n 
2 198 LEU n 
2 199 GLY n 
2 200 THR n 
2 201 GLN n 
2 202 THR n 
2 203 TYR n 
2 204 ILE n 
2 205 CYS n 
2 206 ASN n 
2 207 VAL n 
2 208 ASN n 
2 209 HIS n 
2 210 LYS n 
2 211 PRO n 
2 212 SER n 
2 213 ASN n 
2 214 THR n 
2 215 LYS n 
2 216 VAL n 
2 217 ASP n 
2 218 LYS n 
2 219 LYS n 
2 220 VAL n 
2 221 GLU n 
2 222 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? 
K1 ? 'ovary (CHO) cells' ? ? ? ? ? plasmid ? ? ? pcDNA3.1 ? ? 
2 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? 
K1 ? 'ovary (CHO) cells' ? ? ? ? ? plasmid ? ? ? pcDNA3.1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 PDB 3GIZ 3GIZ 1 ? ? ? 
2 PDB 3GIZ 3GIZ 2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GIZ L 1 ? 211 ? 3GIZ 1 ? 211 ? 1 211 
2 2 3GIZ H 1 ? 222 ? 3GIZ 1 ? 222 ? 1 222 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3GIZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    '0.2 M zinc acetate, 20% PEG3350, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2008-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3GIZ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   26051 
_reflns.number_all                   26208 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              0.083 
_reflns.pdbx_netI_over_sigmaI        7.0 
_reflns.B_iso_Wilson_estimate        35.0 
_reflns.pdbx_redundancy              5.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.325 
_reflns_shell.pdbx_Rsym_value        0.325 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        4.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2618 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3GIZ 
_refine.ls_number_reflns_obs                     24611 
_refine.ls_number_reflns_all                     25899 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.42 
_refine.ls_R_factor_obs                          0.19752 
_refine.ls_R_factor_all                          0.19752 
_refine.ls_R_factor_R_work                       0.19477 
_refine.ls_R_factor_R_free                       0.24957 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1288 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               28.506 
_refine.aniso_B[1][1]                            -0.24 
_refine.aniso_B[2][2]                            1.20 
_refine.aniso_B[3][3]                            -1.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.17 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1U6A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.211 
_refine.overall_SU_ML                            0.154 
_refine.overall_SU_B                             13.528 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3261 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             221 
_refine_hist.number_atoms_total               3485 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 3341 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.375  1.953  ? 4550 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.977  5.000  ? 424  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.650 24.074 ? 135  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.682 15.000 ? 527  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       24.796 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.093  0.200  ? 508  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2536 'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.196  0.200  ? 1341 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.300  0.200  ? 2179 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.138  0.200  ? 221  'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.053  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.315  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.095  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 0.294  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.696  1.500  ? 2179 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.175  2.000  ? 3429 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.563  3.000  ? 1352 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.318  4.500  ? 1121 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           1.144  3.000  ? 3531 'X-RAY DIFFRACTION' ? 
r_sphericity_free            3.956  3.000  ? 224  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          1.337  3.000  ? 3261 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.256 
_refine_ls_shell.number_reflns_R_work             1792 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               99.26 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1792 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GIZ 
_struct.title                     'Crystal structure of the Fab fragment of anti-CD20 antibody Ofatumumab' 
_struct.pdbx_descriptor           
'Fab fragment of anti-CD20 antibody Ofatumumab, light chain, Fab fragment of anti-CD20 antibody Ofatumumab, heavy chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GIZ 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'CD20, 2F2, Ofatumumab, Hu-MaxCD20, Fab, antibody, fully human antibody, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 79  ? PHE A 83  ? GLU L 79  PHE L 83  5 ? 5 
HELX_P HELX_P2 2 SER A 121 ? LYS A 126 ? SER L 121 LYS L 126 1 ? 6 
HELX_P HELX_P3 3 LYS A 183 ? GLU A 187 ? LYS L 183 GLU L 187 1 ? 5 
HELX_P HELX_P4 4 THR B 28  ? TYR B 32  ? THR H 28  TYR H 32  5 ? 5 
HELX_P HELX_P5 5 ARG B 87  ? THR B 91  ? ARG H 87  THR H 91  5 ? 5 
HELX_P HELX_P6 6 SER B 165 ? ALA B 167 ? SER H 165 ALA H 167 5 ? 3 
HELX_P HELX_P7 7 SER B 196 ? LEU B 198 ? SER H 196 LEU H 198 5 ? 3 
HELX_P HELX_P8 8 LYS B 210 ? ASN B 213 ? LYS H 210 ASN H 213 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG  ? ? ? 1_555 A CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2 disulf ? ? A CYS 134 SG  ? ? ? 1_555 A CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf3 disulf ? ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf4 disulf ? ? B CYS 149 SG  ? ? ? 1_555 B CYS 205 SG ? ? H CYS 149 H CYS 205 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc1 metalc ? ? A GLU 1   N   ? ? ? 1_555 E ZN  .   ZN ? ? L GLU 1   L ZN  214 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc2 metalc ? ? A GLU 1   O   ? ? ? 1_555 E ZN  .   ZN ? ? L GLU 1   L ZN  214 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc3 metalc ? ? A GLU 79  OE1 ? ? ? 1_555 C ZN  .   ZN ? ? L GLU 79  L ZN  212 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc4 metalc ? ? A ASN 137 ND2 ? ? ? 1_555 D ZN  .   ZN ? ? L ASN 137 L ZN  213 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc5 metalc ? ? A ASN 138 OD1 ? ? ? 1_555 D ZN  .   ZN ? ? L ASN 138 L ZN  213 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc6 metalc ? ? B HIS 173 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? H HIS 173 L ZN  213 1_555 ? ? ? ? ? ? ? 2.150 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   L PRO 8   A ? PRO 8   L 1 -3.35 
2 TRP 94  A . ? TRP 94  L PRO 95  A ? PRO 95  L 1 -8.79 
3 TYR 140 A . ? TYR 140 L PRO 141 A ? PRO 141 L 1 0.06  
4 PHE 155 B . ? PHE 155 H PRO 156 B ? PRO 156 H 1 -7.60 
5 GLU 157 B . ? GLU 157 H PRO 158 B ? PRO 158 H 1 1.18  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? SER A 7   ? LEU L 4   SER L 7   
A 2 ALA A 19  ? ALA A 25  ? ALA L 19  ALA L 25  
A 3 ASP A 70  ? ILE A 75  ? ASP L 70  ILE L 75  
A 4 PHE A 62  ? SER A 67  ? PHE L 62  SER L 67  
B 1 THR A 10  ? LEU A 13  ? THR L 10  LEU L 13  
B 2 THR A 102 ? ILE A 106 ? THR L 102 ILE L 106 
B 3 VAL A 85  ? GLN A 90  ? VAL L 85  GLN L 90  
B 4 LEU A 33  ? GLN A 38  ? LEU L 33  GLN L 38  
B 5 ARG A 45  ? TYR A 49  ? ARG L 45  TYR L 49  
B 6 ASN A 53  ? ARG A 54  ? ASN L 53  ARG L 54  
C 1 THR A 10  ? LEU A 13  ? THR L 10  LEU L 13  
C 2 THR A 102 ? ILE A 106 ? THR L 102 ILE L 106 
C 3 VAL A 85  ? GLN A 90  ? VAL L 85  GLN L 90  
C 4 THR A 97  ? PHE A 98  ? THR L 97  PHE L 98  
D 1 SER A 114 ? PHE A 118 ? SER L 114 PHE L 118 
D 2 THR A 129 ? PHE A 139 ? THR L 129 PHE L 139 
D 3 TYR A 173 ? SER A 182 ? TYR L 173 SER L 182 
D 4 SER A 159 ? VAL A 163 ? SER L 159 VAL L 163 
E 1 ALA A 153 ? LEU A 154 ? ALA L 153 LEU L 154 
E 2 LYS A 145 ? VAL A 150 ? LYS L 145 VAL L 150 
E 3 VAL A 191 ? THR A 197 ? VAL L 191 THR L 197 
E 4 VAL A 205 ? ASN A 210 ? VAL L 205 ASN L 210 
F 1 GLN B 3   ? SER B 7   ? GLN H 3   SER H 7   
F 2 LEU B 18  ? SER B 25  ? LEU H 18  SER H 25  
F 3 SER B 78  ? MET B 83  ? SER H 78  MET H 83  
F 4 PHE B 68  ? ASP B 73  ? PHE H 68  ASP H 73  
G 1 LEU B 11  ? VAL B 12  ? LEU H 11  VAL H 12  
G 2 THR B 116 ? VAL B 120 ? THR H 116 VAL H 120 
G 3 ALA B 92  ? ASP B 99  ? ALA H 92  ASP H 99  
G 4 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
G 5 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
G 6 ILE B 58  ? TYR B 60  ? ILE H 58  TYR H 60  
H 1 LEU B 11  ? VAL B 12  ? LEU H 11  VAL H 12  
H 2 THR B 116 ? VAL B 120 ? THR H 116 VAL H 120 
H 3 ALA B 92  ? ASP B 99  ? ALA H 92  ASP H 99  
H 4 MET B 109 ? TRP B 112 ? MET H 109 TRP H 112 
I 1 SER B 129 ? LEU B 133 ? SER H 129 LEU H 133 
I 2 THR B 144 ? TYR B 154 ? THR H 144 TYR H 154 
I 3 TYR B 185 ? PRO B 194 ? TYR H 185 PRO H 194 
I 4 VAL B 172 ? THR B 174 ? VAL H 172 THR H 174 
J 1 SER B 129 ? LEU B 133 ? SER H 129 LEU H 133 
J 2 THR B 144 ? TYR B 154 ? THR H 144 TYR H 154 
J 3 TYR B 185 ? PRO B 194 ? TYR H 185 PRO H 194 
J 4 VAL B 178 ? LEU B 179 ? VAL H 178 LEU H 179 
K 1 THR B 160 ? TRP B 163 ? THR H 160 TRP H 163 
K 2 ILE B 204 ? HIS B 209 ? ILE H 204 HIS H 209 
K 3 THR B 214 ? LYS B 219 ? THR H 214 LYS H 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR L 5   O ARG A 24  ? O ARG L 24  
A 2 3 N LEU A 21  ? N LEU L 21  O LEU A 73  ? O LEU L 73  
A 3 4 O THR A 74  ? O THR L 74  N SER A 63  ? N SER L 63  
B 1 2 N LEU A 11  ? N LEU L 11  O GLU A 105 ? O GLU L 105 
B 2 3 O THR A 102 ? O THR L 102 N TYR A 86  ? N TYR L 86  
B 3 4 O GLN A 89  ? O GLN L 89  N ALA A 34  ? N ALA L 34  
B 4 5 N TRP A 35  ? N TRP L 35  O LEU A 47  ? O LEU L 47  
B 5 6 N TYR A 49  ? N TYR L 49  O ASN A 53  ? O ASN L 53  
C 1 2 N LEU A 11  ? N LEU L 11  O GLU A 105 ? O GLU L 105 
C 2 3 O THR A 102 ? O THR L 102 N TYR A 86  ? N TYR L 86  
C 3 4 N GLN A 90  ? N GLN L 90  O THR A 97  ? O THR L 97  
D 1 2 N PHE A 116 ? N PHE L 116 O LEU A 135 ? O LEU L 135 
D 2 3 N VAL A 132 ? N VAL L 132 O LEU A 179 ? O LEU L 179 
D 3 4 O THR A 178 ? O THR L 178 N GLN A 160 ? N GLN L 160 
E 1 2 O ALA A 153 ? O ALA L 153 N VAL A 150 ? N VAL L 150 
E 2 3 N GLN A 147 ? N GLN L 147 O GLU A 195 ? O GLU L 195 
E 3 4 N CYS A 194 ? N CYS L 194 O LYS A 207 ? O LYS L 207 
F 1 2 N VAL B 5   ? N VAL H 5   O ALA B 23  ? O ALA H 23  
F 2 3 N LEU B 18  ? N LEU H 18  O MET B 83  ? O MET H 83  
F 3 4 O TYR B 80  ? O TYR H 80  N SER B 71  ? N SER H 71  
G 1 2 N VAL B 12  ? N VAL H 12  O THR B 119 ? O THR H 119 
G 2 3 O VAL B 118 ? O VAL H 118 N ALA B 92  ? N ALA H 92  
G 3 4 O TYR B 95  ? O TYR H 95  N VAL B 37  ? N VAL H 37  
G 4 5 N ARG B 38  ? N ARG H 38  O GLU B 46  ? O GLU H 46  
G 5 6 N THR B 50  ? N THR H 50  O GLY B 59  ? O GLY H 59  
H 1 2 N VAL B 12  ? N VAL H 12  O THR B 119 ? O THR H 119 
H 2 3 O VAL B 118 ? O VAL H 118 N ALA B 92  ? N ALA H 92  
H 3 4 N LYS B 98  ? N LYS H 98  O VAL B 111 ? O VAL H 111 
I 1 2 N SER B 129 ? N SER H 129 O LYS B 152 ? O LYS H 152 
I 2 3 N ALA B 145 ? N ALA H 145 O VAL B 193 ? O VAL H 193 
I 3 4 O VAL B 190 ? O VAL H 190 N HIS B 173 ? N HIS H 173 
J 1 2 N SER B 129 ? N SER H 129 O LYS B 152 ? O LYS H 152 
J 2 3 N ALA B 145 ? N ALA H 145 O VAL B 193 ? O VAL H 193 
J 3 4 O SER B 186 ? O SER H 186 N VAL B 178 ? N VAL H 178 
K 1 2 N SER B 162 ? N SER H 162 O ASN B 206 ? O ASN H 206 
K 2 3 N HIS B 209 ? N HIS H 209 O THR B 214 ? O THR H 214 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 212' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 213' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN L 214' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLU A 79  ? GLU L 79  . ? 1_555 ? 
2  AC1 4 GLU A 79  ? GLU L 79  . ? 2_656 ? 
3  AC1 4 GLU A 81  ? GLU L 81  . ? 2_656 ? 
4  AC1 4 GLU A 81  ? GLU L 81  . ? 1_555 ? 
5  AC2 4 GLU B 1   ? GLU H 1   . ? 2_656 ? 
6  AC2 4 HIS B 173 ? HIS H 173 . ? 1_555 ? 
7  AC2 4 ASN A 137 ? ASN L 137 . ? 1_555 ? 
8  AC2 4 ASN A 138 ? ASN L 138 . ? 1_555 ? 
9  AC3 3 GLU A 1   ? GLU L 1   . ? 1_555 ? 
10 AC3 3 ASP A 185 ? ASP L 185 . ? 4_556 ? 
11 AC3 3 HIS A 189 ? HIS L 189 . ? 4_556 ? 
# 
_database_PDB_matrix.entry_id          3GIZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GIZ 
_atom_sites.fract_transf_matrix[1][1]   0.007335 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004614 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017875 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014808 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 1   ? 15.431 28.302  55.468 1.00 28.18 ? 1   GLU L N   1 
ATOM   2    C  CA  . GLU A 1 1   ? 16.841 28.563  55.059 1.00 27.98 ? 1   GLU L CA  1 
ATOM   3    C  C   . GLU A 1 1   ? 16.919 29.870  54.250 1.00 27.66 ? 1   GLU L C   1 
ATOM   4    O  O   . GLU A 1 1   ? 15.885 30.388  53.800 1.00 28.36 ? 1   GLU L O   1 
ATOM   5    C  CB  . GLU A 1 1   ? 17.371 27.362  54.265 1.00 28.01 ? 1   GLU L CB  1 
ATOM   6    C  CG  . GLU A 1 1   ? 17.262 27.493  52.759 1.00 30.37 ? 1   GLU L CG  1 
ATOM   7    C  CD  . GLU A 1 1   ? 16.281 26.540  52.119 1.00 32.41 ? 1   GLU L CD  1 
ATOM   8    O  OE1 . GLU A 1 1   ? 15.410 25.963  52.814 1.00 34.23 ? 1   GLU L OE1 1 
ATOM   9    O  OE2 . GLU A 1 1   ? 16.389 26.373  50.893 1.00 33.90 ? 1   GLU L OE2 1 
ATOM   10   N  N   . ILE A 1 2   ? 18.119 30.423  54.082 1.00 26.71 ? 2   ILE L N   1 
ATOM   11   C  CA  . ILE A 1 2   ? 18.308 31.535  53.154 1.00 25.76 ? 2   ILE L CA  1 
ATOM   12   C  C   . ILE A 1 2   ? 18.659 31.019  51.757 1.00 25.86 ? 2   ILE L C   1 
ATOM   13   O  O   . ILE A 1 2   ? 19.621 30.286  51.578 1.00 26.00 ? 2   ILE L O   1 
ATOM   14   C  CB  . ILE A 1 2   ? 19.377 32.533  53.627 1.00 25.34 ? 2   ILE L CB  1 
ATOM   15   C  CG1 . ILE A 1 2   ? 19.010 33.097  54.994 1.00 24.55 ? 2   ILE L CG1 1 
ATOM   16   C  CG2 . ILE A 1 2   ? 19.523 33.684  52.626 1.00 24.67 ? 2   ILE L CG2 1 
ATOM   17   C  CD1 . ILE A 1 2   ? 20.149 33.842  55.677 1.00 23.67 ? 2   ILE L CD1 1 
ATOM   18   N  N   . VAL A 1 3   ? 17.873 31.432  50.772 1.00 25.70 ? 3   VAL L N   1 
ATOM   19   C  CA  . VAL A 1 3   ? 18.064 31.023  49.395 1.00 25.58 ? 3   VAL L CA  1 
ATOM   20   C  C   . VAL A 1 3   ? 18.894 32.080  48.681 1.00 25.52 ? 3   VAL L C   1 
ATOM   21   O  O   . VAL A 1 3   ? 18.628 33.278  48.805 1.00 26.03 ? 3   VAL L O   1 
ATOM   22   C  CB  . VAL A 1 3   ? 16.710 30.814  48.689 1.00 25.58 ? 3   VAL L CB  1 
ATOM   23   C  CG1 . VAL A 1 3   ? 16.896 30.486  47.196 1.00 26.43 ? 3   VAL L CG1 1 
ATOM   24   C  CG2 . VAL A 1 3   ? 15.888 29.727  49.422 1.00 24.75 ? 3   VAL L CG2 1 
ATOM   25   N  N   . LEU A 1 4   ? 19.917 31.619  47.960 1.00 24.95 ? 4   LEU L N   1 
ATOM   26   C  CA  . LEU A 1 4   ? 20.788 32.489  47.186 1.00 24.38 ? 4   LEU L CA  1 
ATOM   27   C  C   . LEU A 1 4   ? 20.568 32.187  45.703 1.00 24.56 ? 4   LEU L C   1 
ATOM   28   O  O   . LEU A 1 4   ? 20.630 31.020  45.263 1.00 24.36 ? 4   LEU L O   1 
ATOM   29   C  CB  . LEU A 1 4   ? 22.253 32.274  47.585 1.00 24.11 ? 4   LEU L CB  1 
ATOM   30   C  CG  . LEU A 1 4   ? 22.643 32.346  49.071 1.00 24.34 ? 4   LEU L CG  1 
ATOM   31   C  CD1 . LEU A 1 4   ? 24.059 31.832  49.322 1.00 23.01 ? 4   LEU L CD1 1 
ATOM   32   C  CD2 . LEU A 1 4   ? 22.499 33.784  49.609 1.00 25.03 ? 4   LEU L CD2 1 
ATOM   33   N  N   . THR A 1 5   ? 20.272 33.239  44.949 1.00 24.39 ? 5   THR L N   1 
ATOM   34   C  CA  . THR A 1 5   ? 20.043 33.135  43.510 1.00 24.40 ? 5   THR L CA  1 
ATOM   35   C  C   . THR A 1 5   ? 21.186 33.803  42.774 1.00 23.98 ? 5   THR L C   1 
ATOM   36   O  O   . THR A 1 5   ? 21.513 34.972  43.034 1.00 23.49 ? 5   THR L O   1 
ATOM   37   C  CB  . THR A 1 5   ? 18.715 33.802  43.093 1.00 24.76 ? 5   THR L CB  1 
ATOM   38   O  OG1 . THR A 1 5   ? 17.649 33.319  43.931 1.00 25.18 ? 5   THR L OG1 1 
ATOM   39   C  CG2 . THR A 1 5   ? 18.395 33.532  41.600 1.00 23.92 ? 5   THR L CG2 1 
ATOM   40   N  N   . GLN A 1 6   ? 21.799 33.037  41.869 1.00 23.92 ? 6   GLN L N   1 
ATOM   41   C  CA  . GLN A 1 6   ? 22.930 33.506  41.080 1.00 24.03 ? 6   GLN L CA  1 
ATOM   42   C  C   . GLN A 1 6   ? 22.546 33.781  39.641 1.00 25.00 ? 6   GLN L C   1 
ATOM   43   O  O   . GLN A 1 6   ? 21.896 32.955  38.977 1.00 25.07 ? 6   GLN L O   1 
ATOM   44   C  CB  . GLN A 1 6   ? 24.091 32.499  41.130 1.00 23.25 ? 6   GLN L CB  1 
ATOM   45   C  CG  . GLN A 1 6   ? 24.789 32.454  42.487 1.00 22.04 ? 6   GLN L CG  1 
ATOM   46   C  CD  . GLN A 1 6   ? 26.095 31.704  42.451 1.00 19.70 ? 6   GLN L CD  1 
ATOM   47   O  OE1 . GLN A 1 6   ? 26.218 30.654  43.069 1.00 20.97 ? 6   GLN L OE1 1 
ATOM   48   N  NE2 . GLN A 1 6   ? 27.074 32.224  41.719 1.00 16.99 ? 6   GLN L NE2 1 
ATOM   49   N  N   . SER A 1 7   ? 22.982 34.931  39.150 1.00 25.93 ? 7   SER L N   1 
ATOM   50   C  CA  . SER A 1 7   ? 22.781 35.275  37.755 1.00 27.38 ? 7   SER L CA  1 
ATOM   51   C  C   . SER A 1 7   ? 24.013 35.971  37.157 1.00 27.63 ? 7   SER L C   1 
ATOM   52   O  O   . SER A 1 7   ? 24.743 36.683  37.861 1.00 27.73 ? 7   SER L O   1 
ATOM   53   C  CB  . SER A 1 7   ? 21.530 36.142  37.586 1.00 27.63 ? 7   SER L CB  1 
ATOM   54   O  OG  . SER A 1 7   ? 21.775 37.428  38.116 1.00 29.33 ? 7   SER L OG  1 
ATOM   55   N  N   . PRO A 1 8   ? 24.260 35.742  35.852 1.00 28.05 ? 8   PRO L N   1 
ATOM   56   C  CA  . PRO A 1 8   ? 23.438 34.822  35.083 1.00 27.90 ? 8   PRO L CA  1 
ATOM   57   C  C   . PRO A 1 8   ? 23.908 33.395  35.310 1.00 28.11 ? 8   PRO L C   1 
ATOM   58   O  O   . PRO A 1 8   ? 24.983 33.189  35.874 1.00 27.76 ? 8   PRO L O   1 
ATOM   59   C  CB  . PRO A 1 8   ? 23.677 35.264  33.639 1.00 27.78 ? 8   PRO L CB  1 
ATOM   60   C  CG  . PRO A 1 8   ? 25.035 35.860  33.639 1.00 27.79 ? 8   PRO L CG  1 
ATOM   61   C  CD  . PRO A 1 8   ? 25.333 36.349  35.034 1.00 28.04 ? 8   PRO L CD  1 
ATOM   62   N  N   . ALA A 1 9   ? 23.093 32.431  34.887 1.00 28.34 ? 9   ALA L N   1 
ATOM   63   C  CA  . ALA A 1 9   ? 23.431 31.022  34.938 1.00 28.33 ? 9   ALA L CA  1 
ATOM   64   C  C   . ALA A 1 9   ? 24.695 30.724  34.122 1.00 28.34 ? 9   ALA L C   1 
ATOM   65   O  O   . ALA A 1 9   ? 25.561 29.949  34.557 1.00 28.17 ? 9   ALA L O   1 
ATOM   66   C  CB  . ALA A 1 9   ? 22.236 30.189  34.425 1.00 28.73 ? 9   ALA L CB  1 
ATOM   67   N  N   . THR A 1 10  ? 24.780 31.327  32.935 1.00 28.23 ? 10  THR L N   1 
ATOM   68   C  CA  . THR A 1 10  ? 25.955 31.216  32.062 1.00 28.12 ? 10  THR L CA  1 
ATOM   69   C  C   . THR A 1 10  ? 26.385 32.596  31.563 1.00 27.63 ? 10  THR L C   1 
ATOM   70   O  O   . THR A 1 10  ? 25.570 33.497  31.383 1.00 27.53 ? 10  THR L O   1 
ATOM   71   C  CB  . THR A 1 10  ? 25.737 30.257  30.836 1.00 28.57 ? 10  THR L CB  1 
ATOM   72   O  OG1 . THR A 1 10  ? 25.330 28.958  31.290 1.00 29.10 ? 10  THR L OG1 1 
ATOM   73   C  CG2 . THR A 1 10  ? 27.043 30.098  30.011 1.00 28.92 ? 10  THR L CG2 1 
ATOM   74   N  N   . LEU A 1 11  ? 27.681 32.731  31.333 1.00 26.99 ? 11  LEU L N   1 
ATOM   75   C  CA  . LEU A 1 11  ? 28.276 33.968  30.897 1.00 26.56 ? 11  LEU L CA  1 
ATOM   76   C  C   . LEU A 1 11  ? 29.381 33.611  29.908 1.00 26.57 ? 11  LEU L C   1 
ATOM   77   O  O   . LEU A 1 11  ? 30.244 32.776  30.221 1.00 26.50 ? 11  LEU L O   1 
ATOM   78   C  CB  . LEU A 1 11  ? 28.831 34.703  32.125 1.00 26.46 ? 11  LEU L CB  1 
ATOM   79   C  CG  . LEU A 1 11  ? 29.391 36.130  32.107 1.00 26.52 ? 11  LEU L CG  1 
ATOM   80   C  CD1 . LEU A 1 11  ? 28.505 37.123  31.337 1.00 25.26 ? 11  LEU L CD1 1 
ATOM   81   C  CD2 . LEU A 1 11  ? 29.607 36.587  33.562 1.00 26.00 ? 11  LEU L CD2 1 
ATOM   82   N  N   . SER A 1 12  ? 29.334 34.211  28.714 1.00 26.51 ? 12  SER L N   1 
ATOM   83   C  CA  . SER A 1 12  ? 30.375 34.028  27.692 1.00 26.51 ? 12  SER L CA  1 
ATOM   84   C  C   . SER A 1 12  ? 31.187 35.292  27.489 1.00 26.33 ? 12  SER L C   1 
ATOM   85   O  O   . SER A 1 12  ? 30.648 36.320  27.126 1.00 26.58 ? 12  SER L O   1 
ATOM   86   C  CB  . SER A 1 12  ? 29.772 33.624  26.357 1.00 26.38 ? 12  SER L CB  1 
ATOM   87   O  OG  . SER A 1 12  ? 29.313 32.301  26.407 1.00 27.38 ? 12  SER L OG  1 
ATOM   88   N  N   . LEU A 1 13  ? 32.491 35.195  27.694 1.00 26.48 ? 13  LEU L N   1 
ATOM   89   C  CA  . LEU A 1 13  ? 33.376 36.354  27.627 1.00 26.54 ? 13  LEU L CA  1 
ATOM   90   C  C   . LEU A 1 13  ? 34.739 35.940  27.097 1.00 26.83 ? 13  LEU L C   1 
ATOM   91   O  O   . LEU A 1 13  ? 35.109 34.762  27.170 1.00 26.41 ? 13  LEU L O   1 
ATOM   92   C  CB  . LEU A 1 13  ? 33.511 37.035  29.007 1.00 26.12 ? 13  LEU L CB  1 
ATOM   93   C  CG  . LEU A 1 13  ? 32.256 37.683  29.628 1.00 26.23 ? 13  LEU L CG  1 
ATOM   94   C  CD1 . LEU A 1 13  ? 32.552 38.194  31.001 1.00 25.98 ? 13  LEU L CD1 1 
ATOM   95   C  CD2 . LEU A 1 13  ? 31.634 38.808  28.766 1.00 26.57 ? 13  LEU L CD2 1 
ATOM   96   N  N   . SER A 1 14  ? 35.462 36.914  26.545 1.00 27.31 ? 14  SER L N   1 
ATOM   97   C  CA  . SER A 1 14  ? 36.825 36.718  26.055 1.00 27.95 ? 14  SER L CA  1 
ATOM   98   C  C   . SER A 1 14  ? 37.854 37.087  27.122 1.00 28.01 ? 14  SER L C   1 
ATOM   99   O  O   . SER A 1 14  ? 37.596 37.946  27.967 1.00 27.99 ? 14  SER L O   1 
ATOM   100  C  CB  . SER A 1 14  ? 37.073 37.566  24.802 1.00 28.09 ? 14  SER L CB  1 
ATOM   101  O  OG  . SER A 1 14  ? 36.084 37.316  23.814 1.00 28.75 ? 14  SER L OG  1 
ATOM   102  N  N   . PRO A 1 15  ? 39.027 36.429  27.099 1.00 28.43 ? 15  PRO L N   1 
ATOM   103  C  CA  . PRO A 1 15  ? 40.101 36.879  27.978 1.00 28.58 ? 15  PRO L CA  1 
ATOM   104  C  C   . PRO A 1 15  ? 40.358 38.391  27.844 1.00 28.66 ? 15  PRO L C   1 
ATOM   105  O  O   . PRO A 1 15  ? 40.304 38.940  26.746 1.00 29.15 ? 15  PRO L O   1 
ATOM   106  C  CB  . PRO A 1 15  ? 41.300 36.060  27.499 1.00 28.21 ? 15  PRO L CB  1 
ATOM   107  C  CG  . PRO A 1 15  ? 40.700 34.815  26.997 1.00 28.61 ? 15  PRO L CG  1 
ATOM   108  C  CD  . PRO A 1 15  ? 39.427 35.244  26.318 1.00 28.15 ? 15  PRO L CD  1 
ATOM   109  N  N   . GLY A 1 16  ? 40.606 39.061  28.962 1.00 28.60 ? 16  GLY L N   1 
ATOM   110  C  CA  . GLY A 1 16  ? 40.747 40.506  28.950 1.00 28.31 ? 16  GLY L CA  1 
ATOM   111  C  C   . GLY A 1 16  ? 39.485 41.277  29.279 1.00 28.25 ? 16  GLY L C   1 
ATOM   112  O  O   . GLY A 1 16  ? 39.575 42.412  29.703 1.00 28.71 ? 16  GLY L O   1 
ATOM   113  N  N   . GLU A 1 17  ? 38.311 40.674  29.097 1.00 28.46 ? 17  GLU L N   1 
ATOM   114  C  CA  . GLU A 1 17  ? 37.040 41.351  29.379 1.00 28.53 ? 17  GLU L CA  1 
ATOM   115  C  C   . GLU A 1 17  ? 36.705 41.297  30.866 1.00 28.41 ? 17  GLU L C   1 
ATOM   116  O  O   . GLU A 1 17  ? 37.321 40.563  31.611 1.00 27.96 ? 17  GLU L O   1 
ATOM   117  C  CB  . GLU A 1 17  ? 35.900 40.742  28.571 1.00 28.58 ? 17  GLU L CB  1 
ATOM   118  C  CG  . GLU A 1 17  ? 35.999 40.953  27.076 1.00 29.87 ? 17  GLU L CG  1 
ATOM   119  C  CD  . GLU A 1 17  ? 34.755 40.493  26.351 1.00 30.84 ? 17  GLU L CD  1 
ATOM   120  O  OE1 . GLU A 1 17  ? 34.414 39.306  26.403 1.00 32.17 ? 17  GLU L OE1 1 
ATOM   121  O  OE2 . GLU A 1 17  ? 34.102 41.320  25.711 1.00 34.54 ? 17  GLU L OE2 1 
ATOM   122  N  N   . ARG A 1 18  ? 35.739 42.106  31.292 1.00 28.72 ? 18  ARG L N   1 
ATOM   123  C  CA  . ARG A 1 18  ? 35.319 42.127  32.693 1.00 28.68 ? 18  ARG L CA  1 
ATOM   124  C  C   . ARG A 1 18  ? 34.108 41.221  32.923 1.00 28.02 ? 18  ARG L C   1 
ATOM   125  O  O   . ARG A 1 18  ? 33.165 41.228  32.141 1.00 28.32 ? 18  ARG L O   1 
ATOM   126  C  CB  . ARG A 1 18  ? 35.008 43.550  33.172 1.00 28.67 ? 18  ARG L CB  1 
ATOM   127  C  CG  . ARG A 1 18  ? 34.662 43.583  34.649 1.00 30.69 ? 18  ARG L CG  1 
ATOM   128  C  CD  . ARG A 1 18  ? 33.862 44.781  35.030 1.00 34.73 ? 18  ARG L CD  1 
ATOM   129  N  NE  . ARG A 1 18  ? 34.717 45.942  35.197 1.00 38.18 ? 18  ARG L NE  1 
ATOM   130  C  CZ  . ARG A 1 18  ? 34.505 46.914  36.080 1.00 40.16 ? 18  ARG L CZ  1 
ATOM   131  N  NH1 . ARG A 1 18  ? 33.461 46.871  36.911 1.00 39.63 ? 18  ARG L NH1 1 
ATOM   132  N  NH2 . ARG A 1 18  ? 35.362 47.923  36.144 1.00 40.60 ? 18  ARG L NH2 1 
ATOM   133  N  N   . ALA A 1 19  ? 34.160 40.443  34.000 1.00 27.15 ? 19  ALA L N   1 
ATOM   134  C  CA  . ALA A 1 19  ? 33.063 39.590  34.414 1.00 26.44 ? 19  ALA L CA  1 
ATOM   135  C  C   . ALA A 1 19  ? 32.405 40.143  35.681 1.00 26.06 ? 19  ALA L C   1 
ATOM   136  O  O   . ALA A 1 19  ? 33.095 40.522  36.635 1.00 25.57 ? 19  ALA L O   1 
ATOM   137  C  CB  . ALA A 1 19  ? 33.558 38.153  34.644 1.00 26.31 ? 19  ALA L CB  1 
ATOM   138  N  N   . THR A 1 20  ? 31.070 40.171  35.663 1.00 25.61 ? 20  THR L N   1 
ATOM   139  C  CA  . THR A 1 20  ? 30.234 40.715  36.725 1.00 25.60 ? 20  THR L CA  1 
ATOM   140  C  C   . THR A 1 20  ? 29.229 39.631  37.152 1.00 25.54 ? 20  THR L C   1 
ATOM   141  O  O   . THR A 1 20  ? 28.255 39.370  36.445 1.00 25.38 ? 20  THR L O   1 
ATOM   142  C  CB  . THR A 1 20  ? 29.484 41.990  36.230 1.00 25.43 ? 20  THR L CB  1 
ATOM   143  O  OG1 . THR A 1 20  ? 30.424 43.050  36.025 1.00 26.03 ? 20  THR L OG1 1 
ATOM   144  C  CG2 . THR A 1 20  ? 28.451 42.452  37.230 1.00 25.97 ? 20  THR L CG2 1 
ATOM   145  N  N   . LEU A 1 21  ? 29.468 38.995  38.303 1.00 25.56 ? 21  LEU L N   1 
ATOM   146  C  CA  . LEU A 1 21  ? 28.605 37.880  38.751 1.00 25.14 ? 21  LEU L CA  1 
ATOM   147  C  C   . LEU A 1 21  ? 27.778 38.304  39.953 1.00 25.07 ? 21  LEU L C   1 
ATOM   148  O  O   . LEU A 1 21  ? 28.302 38.874  40.904 1.00 25.19 ? 21  LEU L O   1 
ATOM   149  C  CB  . LEU A 1 21  ? 29.420 36.614  39.071 1.00 24.85 ? 21  LEU L CB  1 
ATOM   150  C  CG  . LEU A 1 21  ? 30.112 35.747  38.005 1.00 24.97 ? 21  LEU L CG  1 
ATOM   151  C  CD1 . LEU A 1 21  ? 31.155 36.527  37.204 1.00 24.95 ? 21  LEU L CD1 1 
ATOM   152  C  CD2 . LEU A 1 21  ? 30.792 34.569  38.680 1.00 23.73 ? 21  LEU L CD2 1 
ATOM   153  N  N   . SER A 1 22  ? 26.483 38.020  39.895 1.00 25.06 ? 22  SER L N   1 
ATOM   154  C  CA  . SER A 1 22  ? 25.542 38.464  40.911 1.00 25.26 ? 22  SER L CA  1 
ATOM   155  C  C   . SER A 1 22  ? 25.100 37.321  41.821 1.00 24.84 ? 22  SER L C   1 
ATOM   156  O  O   . SER A 1 22  ? 24.878 36.191  41.370 1.00 24.09 ? 22  SER L O   1 
ATOM   157  C  CB  . SER A 1 22  ? 24.314 39.091  40.237 1.00 25.78 ? 22  SER L CB  1 
ATOM   158  O  OG  . SER A 1 22  ? 23.360 39.528  41.198 1.00 28.55 ? 22  SER L OG  1 
ATOM   159  N  N   . CYS A 1 23  ? 24.976 37.640  43.109 1.00 24.64 ? 23  CYS L N   1 
ATOM   160  C  CA  . CYS A 1 23  ? 24.413 36.728  44.107 1.00 24.66 ? 23  CYS L CA  1 
ATOM   161  C  C   . CYS A 1 23  ? 23.398 37.506  44.921 1.00 24.68 ? 23  CYS L C   1 
ATOM   162  O  O   . CYS A 1 23  ? 23.721 38.535  45.500 1.00 25.01 ? 23  CYS L O   1 
ATOM   163  C  CB  . CYS A 1 23  ? 25.515 36.175  45.024 1.00 24.34 ? 23  CYS L CB  1 
ATOM   164  S  SG  . CYS A 1 23  ? 24.968 35.017  46.310 1.00 23.69 ? 23  CYS L SG  1 
ATOM   165  N  N   . ARG A 1 24  ? 22.173 37.006  44.975 1.00 25.01 ? 24  ARG L N   1 
ATOM   166  C  CA  . ARG A 1 24  ? 21.119 37.678  45.728 1.00 25.59 ? 24  ARG L CA  1 
ATOM   167  C  C   . ARG A 1 24  ? 20.529 36.758  46.791 1.00 25.12 ? 24  ARG L C   1 
ATOM   168  O  O   . ARG A 1 24  ? 20.225 35.594  46.508 1.00 25.29 ? 24  ARG L O   1 
ATOM   169  C  CB  . ARG A 1 24  ? 20.047 38.248  44.786 1.00 25.93 ? 24  ARG L CB  1 
ATOM   170  C  CG  . ARG A 1 24  ? 20.440 39.630  44.240 1.00 29.31 ? 24  ARG L CG  1 
ATOM   171  C  CD  . ARG A 1 24  ? 19.841 39.960  42.885 1.00 34.02 ? 24  ARG L CD  1 
ATOM   172  N  NE  . ARG A 1 24  ? 20.551 41.095  42.272 1.00 38.60 ? 24  ARG L NE  1 
ATOM   173  C  CZ  . ARG A 1 24  ? 20.619 41.357  40.959 1.00 39.12 ? 24  ARG L CZ  1 
ATOM   174  N  NH1 . ARG A 1 24  ? 21.312 42.407  40.533 1.00 39.33 ? 24  ARG L NH1 1 
ATOM   175  N  NH2 . ARG A 1 24  ? 20.017 40.571  40.064 1.00 40.17 ? 24  ARG L NH2 1 
ATOM   176  N  N   . ALA A 1 25  ? 20.410 37.267  48.013 1.00 24.33 ? 25  ALA L N   1 
ATOM   177  C  CA  . ALA A 1 25  ? 19.861 36.484  49.122 1.00 24.38 ? 25  ALA L CA  1 
ATOM   178  C  C   . ALA A 1 25  ? 18.393 36.806  49.323 1.00 24.64 ? 25  ALA L C   1 
ATOM   179  O  O   . ALA A 1 25  ? 17.957 37.933  49.039 1.00 24.59 ? 25  ALA L O   1 
ATOM   180  C  CB  . ALA A 1 25  ? 20.629 36.740  50.391 1.00 23.81 ? 25  ALA L CB  1 
ATOM   181  N  N   . SER A 1 26  ? 17.643 35.810  49.800 1.00 24.75 ? 26  SER L N   1 
ATOM   182  C  CA  . SER A 1 26  ? 16.220 35.963  50.126 1.00 25.41 ? 26  SER L CA  1 
ATOM   183  C  C   . SER A 1 26  ? 15.970 36.826  51.384 1.00 25.86 ? 26  SER L C   1 
ATOM   184  O  O   . SER A 1 26  ? 14.878 37.377  51.566 1.00 25.84 ? 26  SER L O   1 
ATOM   185  C  CB  . SER A 1 26  ? 15.572 34.589  50.290 1.00 25.47 ? 26  SER L CB  1 
ATOM   186  O  OG  . SER A 1 26  ? 16.199 33.863  51.337 1.00 25.80 ? 26  SER L OG  1 
ATOM   187  N  N   . GLN A 1 27  ? 16.980 36.917  52.252 1.00 26.11 ? 27  GLN L N   1 
ATOM   188  C  CA  . GLN A 1 27  ? 16.979 37.846  53.385 1.00 26.12 ? 27  GLN L CA  1 
ATOM   189  C  C   . GLN A 1 27  ? 18.419 38.267  53.653 1.00 26.56 ? 27  GLN L C   1 
ATOM   190  O  O   . GLN A 1 27  ? 19.348 37.674  53.088 1.00 26.30 ? 27  GLN L O   1 
ATOM   191  C  CB  . GLN A 1 27  ? 16.350 37.198  54.627 1.00 26.16 ? 27  GLN L CB  1 
ATOM   192  C  CG  . GLN A 1 27  ? 16.963 35.855  55.000 1.00 25.69 ? 27  GLN L CG  1 
ATOM   193  C  CD  . GLN A 1 27  ? 16.221 35.147  56.112 1.00 25.72 ? 27  GLN L CD  1 
ATOM   194  O  OE1 . GLN A 1 27  ? 16.670 35.141  57.265 1.00 25.71 ? 27  GLN L OE1 1 
ATOM   195  N  NE2 . GLN A 1 27  ? 15.091 34.530  55.774 1.00 23.84 ? 27  GLN L NE2 1 
ATOM   196  N  N   . SER A 1 28  ? 18.602 39.284  54.505 1.00 27.15 ? 28  SER L N   1 
ATOM   197  C  CA  . SER A 1 28  ? 19.925 39.843  54.795 1.00 27.32 ? 28  SER L CA  1 
ATOM   198  C  C   . SER A 1 28  ? 20.877 38.788  55.317 1.00 27.70 ? 28  SER L C   1 
ATOM   199  O  O   . SER A 1 28  ? 20.504 37.971  56.153 1.00 28.66 ? 28  SER L O   1 
ATOM   200  C  CB  . SER A 1 28  ? 19.844 41.003  55.797 1.00 27.38 ? 28  SER L CB  1 
ATOM   201  O  OG  . SER A 1 28  ? 21.137 41.518  56.084 1.00 26.89 ? 28  SER L OG  1 
ATOM   202  N  N   . VAL A 1 29  ? 22.101 38.791  54.800 1.00 27.48 ? 29  VAL L N   1 
ATOM   203  C  CA  . VAL A 1 29  ? 23.156 37.948  55.363 1.00 27.37 ? 29  VAL L CA  1 
ATOM   204  C  C   . VAL A 1 29  ? 24.263 38.830  55.909 1.00 27.26 ? 29  VAL L C   1 
ATOM   205  O  O   . VAL A 1 29  ? 25.311 38.343  56.302 1.00 27.51 ? 29  VAL L O   1 
ATOM   206  C  CB  . VAL A 1 29  ? 23.728 36.884  54.346 1.00 27.19 ? 29  VAL L CB  1 
ATOM   207  C  CG1 . VAL A 1 29  ? 22.675 35.846  54.002 1.00 26.67 ? 29  VAL L CG1 1 
ATOM   208  C  CG2 . VAL A 1 29  ? 24.306 37.534  53.103 1.00 25.95 ? 29  VAL L CG2 1 
ATOM   209  N  N   . SER A 1 30  ? 24.008 40.138  55.919 1.00 27.67 ? 30  SER L N   1 
ATOM   210  C  CA  . SER A 1 30  ? 24.957 41.128  56.399 1.00 27.94 ? 30  SER L CA  1 
ATOM   211  C  C   . SER A 1 30  ? 26.188 41.097  55.473 1.00 27.94 ? 30  SER L C   1 
ATOM   212  O  O   . SER A 1 30  ? 26.046 41.311  54.267 1.00 28.67 ? 30  SER L O   1 
ATOM   213  C  CB  . SER A 1 30  ? 25.255 40.881  57.891 1.00 27.99 ? 30  SER L CB  1 
ATOM   214  O  OG  . SER A 1 30  ? 26.315 41.675  58.378 1.00 29.84 ? 30  SER L OG  1 
ATOM   215  N  N   . SER A 1 31  ? 27.375 40.827  56.013 1.00 27.73 ? 31  SER L N   1 
ATOM   216  C  CA  . SER A 1 31  ? 28.575 40.677  55.194 1.00 27.30 ? 31  SER L CA  1 
ATOM   217  C  C   . SER A 1 31  ? 29.018 39.216  55.031 1.00 26.76 ? 31  SER L C   1 
ATOM   218  O  O   . SER A 1 31  ? 29.974 38.955  54.314 1.00 26.81 ? 31  SER L O   1 
ATOM   219  C  CB  . SER A 1 31  ? 29.727 41.503  55.774 1.00 27.60 ? 31  SER L CB  1 
ATOM   220  O  OG  . SER A 1 31  ? 30.168 40.934  56.995 1.00 28.05 ? 31  SER L OG  1 
ATOM   221  N  N   . TYR A 1 32  ? 28.329 38.277  55.682 1.00 26.12 ? 32  TYR L N   1 
ATOM   222  C  CA  . TYR A 1 32  ? 28.751 36.864  55.701 1.00 25.92 ? 32  TYR L CA  1 
ATOM   223  C  C   . TYR A 1 32  ? 28.440 36.119  54.379 1.00 24.75 ? 32  TYR L C   1 
ATOM   224  O  O   . TYR A 1 32  ? 27.568 35.242  54.321 1.00 24.24 ? 32  TYR L O   1 
ATOM   225  C  CB  . TYR A 1 32  ? 28.173 36.137  56.931 1.00 26.85 ? 32  TYR L CB  1 
ATOM   226  C  CG  . TYR A 1 32  ? 28.390 36.907  58.214 1.00 27.83 ? 32  TYR L CG  1 
ATOM   227  C  CD1 . TYR A 1 32  ? 29.674 37.027  58.773 1.00 28.58 ? 32  TYR L CD1 1 
ATOM   228  C  CD2 . TYR A 1 32  ? 27.327 37.550  58.850 1.00 28.48 ? 32  TYR L CD2 1 
ATOM   229  C  CE1 . TYR A 1 32  ? 29.888 37.757  59.946 1.00 28.80 ? 32  TYR L CE1 1 
ATOM   230  C  CE2 . TYR A 1 32  ? 27.531 38.286  60.031 1.00 30.01 ? 32  TYR L CE2 1 
ATOM   231  C  CZ  . TYR A 1 32  ? 28.814 38.385  60.567 1.00 29.35 ? 32  TYR L CZ  1 
ATOM   232  O  OH  . TYR A 1 32  ? 29.014 39.109  61.731 1.00 29.66 ? 32  TYR L OH  1 
ATOM   233  N  N   . LEU A 1 33  ? 29.175 36.506  53.336 1.00 23.13 ? 33  LEU L N   1 
ATOM   234  C  CA  . LEU A 1 33  ? 29.018 35.990  51.983 1.00 22.50 ? 33  LEU L CA  1 
ATOM   235  C  C   . LEU A 1 33  ? 30.410 35.697  51.416 1.00 21.77 ? 33  LEU L C   1 
ATOM   236  O  O   . LEU A 1 33  ? 31.276 36.568  51.351 1.00 21.37 ? 33  LEU L O   1 
ATOM   237  C  CB  . LEU A 1 33  ? 28.244 36.990  51.088 1.00 22.04 ? 33  LEU L CB  1 
ATOM   238  C  CG  . LEU A 1 33  ? 27.562 36.581  49.762 1.00 21.86 ? 33  LEU L CG  1 
ATOM   239  C  CD1 . LEU A 1 33  ? 28.521 36.367  48.582 1.00 20.10 ? 33  LEU L CD1 1 
ATOM   240  C  CD2 . LEU A 1 33  ? 26.628 35.390  49.913 1.00 20.11 ? 33  LEU L CD2 1 
ATOM   241  N  N   . ALA A 1 34  ? 30.604 34.442  51.034 1.00 21.21 ? 34  ALA L N   1 
ATOM   242  C  CA  . ALA A 1 34  ? 31.846 33.967  50.484 1.00 20.57 ? 34  ALA L CA  1 
ATOM   243  C  C   . ALA A 1 34  ? 31.647 33.558  49.011 1.00 19.85 ? 34  ALA L C   1 
ATOM   244  O  O   . ALA A 1 34  ? 30.539 33.217  48.609 1.00 19.46 ? 34  ALA L O   1 
ATOM   245  C  CB  . ALA A 1 34  ? 32.351 32.778  51.339 1.00 20.37 ? 34  ALA L CB  1 
ATOM   246  N  N   . TRP A 1 35  ? 32.721 33.602  48.225 1.00 19.41 ? 35  TRP L N   1 
ATOM   247  C  CA  . TRP A 1 35  ? 32.705 33.180  46.823 1.00 19.27 ? 35  TRP L CA  1 
ATOM   248  C  C   . TRP A 1 35  ? 33.728 32.091  46.573 1.00 18.98 ? 35  TRP L C   1 
ATOM   249  O  O   . TRP A 1 35  ? 34.855 32.173  47.059 1.00 18.67 ? 35  TRP L O   1 
ATOM   250  C  CB  . TRP A 1 35  ? 33.046 34.346  45.891 1.00 19.37 ? 35  TRP L CB  1 
ATOM   251  C  CG  . TRP A 1 35  ? 31.971 35.386  45.725 1.00 19.47 ? 35  TRP L CG  1 
ATOM   252  C  CD1 . TRP A 1 35  ? 31.846 36.570  46.425 1.00 18.93 ? 35  TRP L CD1 1 
ATOM   253  C  CD2 . TRP A 1 35  ? 30.894 35.365  44.780 1.00 19.75 ? 35  TRP L CD2 1 
ATOM   254  N  NE1 . TRP A 1 35  ? 30.757 37.268  45.980 1.00 18.52 ? 35  TRP L NE1 1 
ATOM   255  C  CE2 . TRP A 1 35  ? 30.154 36.565  44.968 1.00 19.89 ? 35  TRP L CE2 1 
ATOM   256  C  CE3 . TRP A 1 35  ? 30.487 34.459  43.782 1.00 19.24 ? 35  TRP L CE3 1 
ATOM   257  C  CZ2 . TRP A 1 35  ? 29.010 36.873  44.200 1.00 20.25 ? 35  TRP L CZ2 1 
ATOM   258  C  CZ3 . TRP A 1 35  ? 29.355 34.768  43.012 1.00 19.04 ? 35  TRP L CZ3 1 
ATOM   259  C  CH2 . TRP A 1 35  ? 28.636 35.968  43.222 1.00 19.45 ? 35  TRP L CH2 1 
ATOM   260  N  N   . TYR A 1 36  ? 33.320 31.101  45.780 1.00 18.78 ? 36  TYR L N   1 
ATOM   261  C  CA  . TYR A 1 36  ? 34.134 29.939  45.409 1.00 18.52 ? 36  TYR L CA  1 
ATOM   262  C  C   . TYR A 1 36  ? 34.209 29.782  43.903 1.00 18.34 ? 36  TYR L C   1 
ATOM   263  O  O   . TYR A 1 36  ? 33.259 30.078  43.192 1.00 18.11 ? 36  TYR L O   1 
ATOM   264  C  CB  . TYR A 1 36  ? 33.577 28.634  46.014 1.00 17.99 ? 36  TYR L CB  1 
ATOM   265  C  CG  . TYR A 1 36  ? 33.585 28.655  47.522 1.00 17.76 ? 36  TYR L CG  1 
ATOM   266  C  CD1 . TYR A 1 36  ? 32.510 29.200  48.218 1.00 17.91 ? 36  TYR L CD1 1 
ATOM   267  C  CD2 . TYR A 1 36  ? 34.683 28.192  48.251 1.00 16.37 ? 36  TYR L CD2 1 
ATOM   268  C  CE1 . TYR A 1 36  ? 32.492 29.261  49.591 1.00 17.75 ? 36  TYR L CE1 1 
ATOM   269  C  CE2 . TYR A 1 36  ? 34.672 28.237  49.650 1.00 18.56 ? 36  TYR L CE2 1 
ATOM   270  C  CZ  . TYR A 1 36  ? 33.554 28.772  50.312 1.00 18.20 ? 36  TYR L CZ  1 
ATOM   271  O  OH  . TYR A 1 36  ? 33.497 28.880  51.687 1.00 18.98 ? 36  TYR L OH  1 
ATOM   272  N  N   . GLN A 1 37  ? 35.365 29.304  43.456 1.00 18.43 ? 37  GLN L N   1 
ATOM   273  C  CA  . GLN A 1 37  ? 35.608 28.859  42.100 1.00 18.38 ? 37  GLN L CA  1 
ATOM   274  C  C   . GLN A 1 37  ? 35.720 27.335  42.090 1.00 18.66 ? 37  GLN L C   1 
ATOM   275  O  O   . GLN A 1 37  ? 36.383 26.739  42.965 1.00 18.32 ? 37  GLN L O   1 
ATOM   276  C  CB  . GLN A 1 37  ? 36.926 29.453  41.611 1.00 18.12 ? 37  GLN L CB  1 
ATOM   277  C  CG  . GLN A 1 37  ? 37.263 29.137  40.173 1.00 19.09 ? 37  GLN L CG  1 
ATOM   278  C  CD  . GLN A 1 37  ? 38.660 29.547  39.806 1.00 19.38 ? 37  GLN L CD  1 
ATOM   279  O  OE1 . GLN A 1 37  ? 39.636 28.942  40.253 1.00 19.82 ? 37  GLN L OE1 1 
ATOM   280  N  NE2 . GLN A 1 37  ? 38.771 30.571  38.980 1.00 19.75 ? 37  GLN L NE2 1 
ATOM   281  N  N   . GLN A 1 38  ? 35.097 26.704  41.094 1.00 18.48 ? 38  GLN L N   1 
ATOM   282  C  CA  . GLN A 1 38  ? 35.265 25.273  40.917 1.00 18.72 ? 38  GLN L CA  1 
ATOM   283  C  C   . GLN A 1 38  ? 35.427 24.843  39.458 1.00 18.77 ? 38  GLN L C   1 
ATOM   284  O  O   . GLN A 1 38  ? 34.567 25.113  38.620 1.00 19.22 ? 38  GLN L O   1 
ATOM   285  C  CB  . GLN A 1 38  ? 34.135 24.508  41.592 1.00 18.57 ? 38  GLN L CB  1 
ATOM   286  C  CG  . GLN A 1 38  ? 34.475 23.054  41.773 1.00 18.11 ? 38  GLN L CG  1 
ATOM   287  C  CD  . GLN A 1 38  ? 33.304 22.222  42.283 1.00 18.14 ? 38  GLN L CD  1 
ATOM   288  O  OE1 . GLN A 1 38  ? 32.136 22.545  42.047 1.00 17.87 ? 38  GLN L OE1 1 
ATOM   289  N  NE2 . GLN A 1 38  ? 33.625 21.137  42.984 1.00 17.00 ? 38  GLN L NE2 1 
ATOM   290  N  N   . LYS A 1 39  ? 36.558 24.210  39.167 1.00 18.56 ? 39  LYS L N   1 
ATOM   291  C  CA  . LYS A 1 39  ? 36.812 23.614  37.849 1.00 18.97 ? 39  LYS L CA  1 
ATOM   292  C  C   . LYS A 1 39  ? 36.327 22.152  37.828 1.00 19.54 ? 39  LYS L C   1 
ATOM   293  O  O   . LYS A 1 39  ? 36.183 21.547  38.891 1.00 19.15 ? 39  LYS L O   1 
ATOM   294  C  CB  . LYS A 1 39  ? 38.298 23.760  37.485 1.00 18.38 ? 39  LYS L CB  1 
ATOM   295  C  CG  . LYS A 1 39  ? 38.714 25.220  37.519 1.00 18.55 ? 39  LYS L CG  1 
ATOM   296  C  CD  . LYS A 1 39  ? 40.185 25.483  37.252 1.00 18.69 ? 39  LYS L CD  1 
ATOM   297  C  CE  . LYS A 1 39  ? 40.393 26.995  37.109 1.00 19.45 ? 39  LYS L CE  1 
ATOM   298  N  NZ  . LYS A 1 39  ? 41.806 27.425  37.216 1.00 19.54 ? 39  LYS L NZ  1 
ATOM   299  N  N   . PRO A 1 40  ? 36.024 21.601  36.628 1.00 20.45 ? 40  PRO L N   1 
ATOM   300  C  CA  . PRO A 1 40  ? 35.601 20.211  36.493 1.00 21.43 ? 40  PRO L CA  1 
ATOM   301  C  C   . PRO A 1 40  ? 36.650 19.267  37.048 1.00 22.55 ? 40  PRO L C   1 
ATOM   302  O  O   . PRO A 1 40  ? 37.848 19.443  36.786 1.00 23.36 ? 40  PRO L O   1 
ATOM   303  C  CB  . PRO A 1 40  ? 35.479 20.025  34.961 1.00 21.45 ? 40  PRO L CB  1 
ATOM   304  C  CG  . PRO A 1 40  ? 35.175 21.373  34.460 1.00 20.79 ? 40  PRO L CG  1 
ATOM   305  C  CD  . PRO A 1 40  ? 36.043 22.276  35.315 1.00 21.09 ? 40  PRO L CD  1 
ATOM   306  N  N   . GLY A 1 41  ? 36.206 18.287  37.828 1.00 23.60 ? 41  GLY L N   1 
ATOM   307  C  CA  . GLY A 1 41  ? 37.113 17.308  38.437 1.00 24.14 ? 41  GLY L CA  1 
ATOM   308  C  C   . GLY A 1 41  ? 37.832 17.800  39.680 1.00 24.32 ? 41  GLY L C   1 
ATOM   309  O  O   . GLY A 1 41  ? 38.496 17.031  40.364 1.00 24.66 ? 41  GLY L O   1 
ATOM   310  N  N   . GLN A 1 42  ? 37.685 19.078  39.985 1.00 24.71 ? 42  GLN L N   1 
ATOM   311  C  CA  . GLN A 1 42  ? 38.427 19.687  41.075 1.00 24.96 ? 42  GLN L CA  1 
ATOM   312  C  C   . GLN A 1 42  ? 37.527 20.139  42.218 1.00 24.43 ? 42  GLN L C   1 
ATOM   313  O  O   . GLN A 1 42  ? 36.371 20.484  42.007 1.00 24.61 ? 42  GLN L O   1 
ATOM   314  C  CB  . GLN A 1 42  ? 39.201 20.899  40.566 1.00 25.71 ? 42  GLN L CB  1 
ATOM   315  C  CG  . GLN A 1 42  ? 40.279 20.595  39.564 1.00 27.28 ? 42  GLN L CG  1 
ATOM   316  C  CD  . GLN A 1 42  ? 41.158 21.796  39.308 1.00 29.79 ? 42  GLN L CD  1 
ATOM   317  O  OE1 . GLN A 1 42  ? 41.918 21.813  38.344 1.00 31.09 ? 42  GLN L OE1 1 
ATOM   318  N  NE2 . GLN A 1 42  ? 41.048 22.826  40.162 1.00 30.38 ? 42  GLN L NE2 1 
ATOM   319  N  N   . ALA A 1 43  ? 38.085 20.138  43.427 1.00 23.84 ? 43  ALA L N   1 
ATOM   320  C  CA  . ALA A 1 43  ? 37.438 20.706  44.600 1.00 23.22 ? 43  ALA L CA  1 
ATOM   321  C  C   . ALA A 1 43  ? 37.243 22.231  44.453 1.00 22.86 ? 43  ALA L C   1 
ATOM   322  O  O   . ALA A 1 43  ? 37.991 22.892  43.703 1.00 23.06 ? 43  ALA L O   1 
ATOM   323  C  CB  . ALA A 1 43  ? 38.267 20.392  45.832 1.00 23.24 ? 43  ALA L CB  1 
ATOM   324  N  N   . PRO A 1 44  ? 36.250 22.801  45.171 1.00 22.32 ? 44  PRO L N   1 
ATOM   325  C  CA  . PRO A 1 44  ? 36.093 24.265  45.176 1.00 21.91 ? 44  PRO L CA  1 
ATOM   326  C  C   . PRO A 1 44  ? 37.302 25.013  45.768 1.00 21.66 ? 44  PRO L C   1 
ATOM   327  O  O   . PRO A 1 44  ? 38.066 24.439  46.540 1.00 21.63 ? 44  PRO L O   1 
ATOM   328  C  CB  . PRO A 1 44  ? 34.819 24.492  46.019 1.00 21.73 ? 44  PRO L CB  1 
ATOM   329  C  CG  . PRO A 1 44  ? 34.141 23.158  46.098 1.00 21.46 ? 44  PRO L CG  1 
ATOM   330  C  CD  . PRO A 1 44  ? 35.224 22.129  45.998 1.00 21.86 ? 44  PRO L CD  1 
ATOM   331  N  N   . ARG A 1 45  ? 37.478 26.268  45.353 1.00 21.70 ? 45  ARG L N   1 
ATOM   332  C  CA  . ARG A 1 45  ? 38.568 27.140  45.797 1.00 22.55 ? 45  ARG L CA  1 
ATOM   333  C  C   . ARG A 1 45  ? 37.999 28.469  46.320 1.00 21.50 ? 45  ARG L C   1 
ATOM   334  O  O   . ARG A 1 45  ? 37.292 29.190  45.597 1.00 20.60 ? 45  ARG L O   1 
ATOM   335  C  CB  . ARG A 1 45  ? 39.588 27.394  44.653 1.00 22.91 ? 45  ARG L CB  1 
ATOM   336  C  CG  . ARG A 1 45  ? 40.476 28.645  44.825 1.00 24.00 ? 45  ARG L CG  1 
ATOM   337  C  CD  . ARG A 1 45  ? 41.677 28.713  43.849 1.00 25.29 ? 45  ARG L CD  1 
ATOM   338  N  NE  . ARG A 1 45  ? 41.426 29.527  42.655 1.00 31.37 ? 45  ARG L NE  1 
ATOM   339  C  CZ  . ARG A 1 45  ? 42.196 30.516  42.175 1.00 29.15 ? 45  ARG L CZ  1 
ATOM   340  N  NH1 . ARG A 1 45  ? 43.324 30.886  42.761 1.00 32.23 ? 45  ARG L NH1 1 
ATOM   341  N  NH2 . ARG A 1 45  ? 41.816 31.147  41.070 1.00 32.67 ? 45  ARG L NH2 1 
ATOM   342  N  N   . LEU A 1 46  ? 38.289 28.761  47.588 1.00 20.89 ? 46  LEU L N   1 
ATOM   343  C  CA  . LEU A 1 46  ? 37.884 30.017  48.199 1.00 20.73 ? 46  LEU L CA  1 
ATOM   344  C  C   . LEU A 1 46  ? 38.562 31.215  47.544 1.00 20.73 ? 46  LEU L C   1 
ATOM   345  O  O   . LEU A 1 46  ? 39.795 31.294  47.487 1.00 20.85 ? 46  LEU L O   1 
ATOM   346  C  CB  . LEU A 1 46  ? 38.176 30.016  49.709 1.00 20.81 ? 46  LEU L CB  1 
ATOM   347  C  CG  . LEU A 1 46  ? 37.710 31.252  50.492 1.00 20.71 ? 46  LEU L CG  1 
ATOM   348  C  CD1 . LEU A 1 46  ? 36.163 31.331  50.526 1.00 20.39 ? 46  LEU L CD1 1 
ATOM   349  C  CD2 . LEU A 1 46  ? 38.291 31.253  51.893 1.00 20.85 ? 46  LEU L CD2 1 
ATOM   350  N  N   . LEU A 1 47  ? 37.737 32.156  47.085 1.00 20.72 ? 47  LEU L N   1 
ATOM   351  C  CA  . LEU A 1 47  ? 38.195 33.398  46.466 1.00 20.46 ? 47  LEU L CA  1 
ATOM   352  C  C   . LEU A 1 47  ? 38.021 34.589  47.398 1.00 20.80 ? 47  LEU L C   1 
ATOM   353  O  O   . LEU A 1 47  ? 38.974 35.341  47.643 1.00 20.66 ? 47  LEU L O   1 
ATOM   354  C  CB  . LEU A 1 47  ? 37.408 33.670  45.179 1.00 19.85 ? 47  LEU L CB  1 
ATOM   355  C  CG  . LEU A 1 47  ? 37.468 32.659  44.040 1.00 19.41 ? 47  LEU L CG  1 
ATOM   356  C  CD1 . LEU A 1 47  ? 36.404 33.013  43.030 1.00 19.81 ? 47  LEU L CD1 1 
ATOM   357  C  CD2 . LEU A 1 47  ? 38.838 32.630  43.385 1.00 17.02 ? 47  LEU L CD2 1 
ATOM   358  N  N   . ILE A 1 48  ? 36.784 34.755  47.872 1.00 20.82 ? 48  ILE L N   1 
ATOM   359  C  CA  . ILE A 1 48  ? 36.355 35.884  48.690 1.00 21.22 ? 48  ILE L CA  1 
ATOM   360  C  C   . ILE A 1 48  ? 35.658 35.361  49.955 1.00 21.83 ? 48  ILE L C   1 
ATOM   361  O  O   . ILE A 1 48  ? 34.922 34.380  49.898 1.00 21.32 ? 48  ILE L O   1 
ATOM   362  C  CB  . ILE A 1 48  ? 35.351 36.822  47.912 1.00 21.37 ? 48  ILE L CB  1 
ATOM   363  C  CG1 . ILE A 1 48  ? 35.968 37.404  46.623 1.00 20.28 ? 48  ILE L CG1 1 
ATOM   364  C  CG2 . ILE A 1 48  ? 34.783 37.944  48.818 1.00 21.37 ? 48  ILE L CG2 1 
ATOM   365  C  CD1 . ILE A 1 48  ? 37.215 38.202  46.805 1.00 19.23 ? 48  ILE L CD1 1 
ATOM   366  N  N   . TYR A 1 49  ? 35.900 36.030  51.086 1.00 22.78 ? 49  TYR L N   1 
ATOM   367  C  CA  . TYR A 1 49  ? 35.133 35.819  52.328 1.00 23.58 ? 49  TYR L CA  1 
ATOM   368  C  C   . TYR A 1 49  ? 34.741 37.187  52.921 1.00 23.89 ? 49  TYR L C   1 
ATOM   369  O  O   . TYR A 1 49  ? 35.360 38.196  52.594 1.00 22.92 ? 49  TYR L O   1 
ATOM   370  C  CB  . TYR A 1 49  ? 35.943 34.985  53.339 1.00 23.94 ? 49  TYR L CB  1 
ATOM   371  C  CG  . TYR A 1 49  ? 37.167 35.706  53.860 1.00 24.70 ? 49  TYR L CG  1 
ATOM   372  C  CD1 . TYR A 1 49  ? 37.102 36.482  55.021 1.00 24.04 ? 49  TYR L CD1 1 
ATOM   373  C  CD2 . TYR A 1 49  ? 38.393 35.629  53.172 1.00 25.01 ? 49  TYR L CD2 1 
ATOM   374  C  CE1 . TYR A 1 49  ? 38.231 37.172  55.483 1.00 25.23 ? 49  TYR L CE1 1 
ATOM   375  C  CE2 . TYR A 1 49  ? 39.514 36.309  53.621 1.00 25.17 ? 49  TYR L CE2 1 
ATOM   376  C  CZ  . TYR A 1 49  ? 39.428 37.082  54.772 1.00 25.32 ? 49  TYR L CZ  1 
ATOM   377  O  OH  . TYR A 1 49  ? 40.538 37.747  55.222 1.00 25.84 ? 49  TYR L OH  1 
ATOM   378  N  N   . ASP A 1 50  ? 33.728 37.215  53.796 1.00 24.99 ? 50  ASP L N   1 
ATOM   379  C  CA  . ASP A 1 50  ? 33.187 38.482  54.339 1.00 26.08 ? 50  ASP L CA  1 
ATOM   380  C  C   . ASP A 1 50  ? 32.833 39.497  53.235 1.00 26.41 ? 50  ASP L C   1 
ATOM   381  O  O   . ASP A 1 50  ? 33.179 40.685  53.327 1.00 26.22 ? 50  ASP L O   1 
ATOM   382  C  CB  . ASP A 1 50  ? 34.152 39.121  55.349 1.00 26.70 ? 50  ASP L CB  1 
ATOM   383  C  CG  . ASP A 1 50  ? 33.435 39.918  56.421 1.00 28.20 ? 50  ASP L CG  1 
ATOM   384  O  OD1 . ASP A 1 50  ? 32.432 39.406  56.979 1.00 27.92 ? 50  ASP L OD1 1 
ATOM   385  O  OD2 . ASP A 1 50  ? 33.892 41.054  56.722 1.00 31.34 ? 50  ASP L OD2 1 
ATOM   386  N  N   . ALA A 1 51  ? 32.153 39.002  52.197 1.00 26.30 ? 51  ALA L N   1 
ATOM   387  C  CA  . ALA A 1 51  ? 31.715 39.788  51.041 1.00 26.74 ? 51  ALA L CA  1 
ATOM   388  C  C   . ALA A 1 51  ? 32.841 40.401  50.195 1.00 26.74 ? 51  ALA L C   1 
ATOM   389  O  O   . ALA A 1 51  ? 32.740 40.437  48.971 1.00 26.70 ? 51  ALA L O   1 
ATOM   390  C  CB  . ALA A 1 51  ? 30.678 40.851  51.438 1.00 26.86 ? 51  ALA L CB  1 
ATOM   391  N  N   . SER A 1 52  ? 33.908 40.876  50.830 1.00 26.89 ? 52  SER L N   1 
ATOM   392  C  CA  . SER A 1 52  ? 34.887 41.689  50.107 1.00 26.99 ? 52  SER L CA  1 
ATOM   393  C  C   . SER A 1 52  ? 36.360 41.398  50.419 1.00 26.95 ? 52  SER L C   1 
ATOM   394  O  O   . SER A 1 52  ? 37.242 42.047  49.853 1.00 26.92 ? 52  SER L O   1 
ATOM   395  C  CB  . SER A 1 52  ? 34.584 43.186  50.273 1.00 26.74 ? 52  SER L CB  1 
ATOM   396  O  OG  . SER A 1 52  ? 34.823 43.584  51.606 1.00 26.87 ? 52  SER L OG  1 
ATOM   397  N  N   . ASN A 1 53  ? 36.642 40.428  51.284 1.00 27.19 ? 53  ASN L N   1 
ATOM   398  C  CA  . ASN A 1 53  ? 38.047 40.094  51.549 1.00 27.81 ? 53  ASN L CA  1 
ATOM   399  C  C   . ASN A 1 53  ? 38.554 38.943  50.693 1.00 27.38 ? 53  ASN L C   1 
ATOM   400  O  O   . ASN A 1 53  ? 37.999 37.852  50.717 1.00 27.33 ? 53  ASN L O   1 
ATOM   401  C  CB  . ASN A 1 53  ? 38.291 39.825  53.035 1.00 28.04 ? 53  ASN L CB  1 
ATOM   402  C  CG  . ASN A 1 53  ? 37.912 41.003  53.902 1.00 30.15 ? 53  ASN L CG  1 
ATOM   403  O  OD1 . ASN A 1 53  ? 38.296 42.143  53.625 1.00 33.17 ? 53  ASN L OD1 1 
ATOM   404  N  ND2 . ASN A 1 53  ? 37.133 40.746  54.942 1.00 32.23 ? 53  ASN L ND2 1 
ATOM   405  N  N   . ARG A 1 54  ? 39.600 39.207  49.922 1.00 27.68 ? 54  ARG L N   1 
ATOM   406  C  CA  . ARG A 1 54  ? 40.279 38.164  49.150 1.00 27.78 ? 54  ARG L CA  1 
ATOM   407  C  C   . ARG A 1 54  ? 40.984 37.166  50.049 1.00 27.14 ? 54  ARG L C   1 
ATOM   408  O  O   . ARG A 1 54  ? 41.720 37.545  50.951 1.00 26.67 ? 54  ARG L O   1 
ATOM   409  C  CB  . ARG A 1 54  ? 41.307 38.769  48.206 1.00 27.83 ? 54  ARG L CB  1 
ATOM   410  C  CG  . ARG A 1 54  ? 40.810 38.959  46.797 1.00 29.40 ? 54  ARG L CG  1 
ATOM   411  C  CD  . ARG A 1 54  ? 41.900 39.537  45.946 1.00 30.61 ? 54  ARG L CD  1 
ATOM   412  N  NE  . ARG A 1 54  ? 42.162 40.916  46.312 1.00 32.27 ? 54  ARG L NE  1 
ATOM   413  C  CZ  . ARG A 1 54  ? 43.374 41.449  46.377 1.00 34.63 ? 54  ARG L CZ  1 
ATOM   414  N  NH1 . ARG A 1 54  ? 44.451 40.705  46.120 1.00 35.57 ? 54  ARG L NH1 1 
ATOM   415  N  NH2 . ARG A 1 54  ? 43.508 42.729  46.712 1.00 35.59 ? 54  ARG L NH2 1 
ATOM   416  N  N   . ALA A 1 55  ? 40.758 35.888  49.787 1.00 26.95 ? 55  ALA L N   1 
ATOM   417  C  CA  . ALA A 1 55  ? 41.511 34.840  50.450 1.00 27.15 ? 55  ALA L CA  1 
ATOM   418  C  C   . ALA A 1 55  ? 42.993 34.941  50.064 1.00 27.24 ? 55  ALA L C   1 
ATOM   419  O  O   . ALA A 1 55  ? 43.336 35.531  49.022 1.00 26.81 ? 55  ALA L O   1 
ATOM   420  C  CB  . ALA A 1 55  ? 40.926 33.448  50.101 1.00 26.75 ? 55  ALA L CB  1 
ATOM   421  N  N   . THR A 1 56  ? 43.863 34.377  50.909 1.00 27.60 ? 56  THR L N   1 
ATOM   422  C  CA  . THR A 1 56  ? 45.314 34.404  50.694 1.00 28.09 ? 56  THR L CA  1 
ATOM   423  C  C   . THR A 1 56  ? 45.681 33.965  49.282 1.00 28.03 ? 56  THR L C   1 
ATOM   424  O  O   . THR A 1 56  ? 45.230 32.911  48.809 1.00 28.48 ? 56  THR L O   1 
ATOM   425  C  CB  . THR A 1 56  ? 46.068 33.512  51.712 1.00 28.34 ? 56  THR L CB  1 
ATOM   426  O  OG1 . THR A 1 56  ? 45.730 33.920  53.041 1.00 29.84 ? 56  THR L OG1 1 
ATOM   427  C  CG2 . THR A 1 56  ? 47.582 33.632  51.527 1.00 28.47 ? 56  THR L CG2 1 
ATOM   428  N  N   . GLY A 1 57  ? 46.475 34.798  48.617 1.00 27.91 ? 57  GLY L N   1 
ATOM   429  C  CA  . GLY A 1 57  ? 47.099 34.461  47.336 1.00 27.69 ? 57  GLY L CA  1 
ATOM   430  C  C   . GLY A 1 57  ? 46.212 34.619  46.119 1.00 27.30 ? 57  GLY L C   1 
ATOM   431  O  O   . GLY A 1 57  ? 46.618 34.281  45.018 1.00 27.34 ? 57  GLY L O   1 
ATOM   432  N  N   . ILE A 1 58  ? 44.999 35.128  46.315 1.00 27.05 ? 58  ILE L N   1 
ATOM   433  C  CA  . ILE A 1 58  ? 44.057 35.318  45.213 1.00 26.41 ? 58  ILE L CA  1 
ATOM   434  C  C   . ILE A 1 58  ? 44.409 36.603  44.465 1.00 26.48 ? 58  ILE L C   1 
ATOM   435  O  O   . ILE A 1 58  ? 44.537 37.653  45.090 1.00 27.15 ? 58  ILE L O   1 
ATOM   436  C  CB  . ILE A 1 58  ? 42.578 35.336  45.713 1.00 25.92 ? 58  ILE L CB  1 
ATOM   437  C  CG1 . ILE A 1 58  ? 42.192 33.985  46.355 1.00 25.25 ? 58  ILE L CG1 1 
ATOM   438  C  CG2 . ILE A 1 58  ? 41.612 35.744  44.595 1.00 25.23 ? 58  ILE L CG2 1 
ATOM   439  C  CD1 . ILE A 1 58  ? 42.237 32.765  45.433 1.00 23.89 ? 58  ILE L CD1 1 
ATOM   440  N  N   . PRO A 1 59  ? 44.605 36.516  43.128 1.00 26.33 ? 59  PRO L N   1 
ATOM   441  C  CA  . PRO A 1 59  ? 44.954 37.676  42.299 1.00 25.93 ? 59  PRO L CA  1 
ATOM   442  C  C   . PRO A 1 59  ? 44.008 38.854  42.493 1.00 25.88 ? 59  PRO L C   1 
ATOM   443  O  O   . PRO A 1 59  ? 42.829 38.657  42.783 1.00 26.56 ? 59  PRO L O   1 
ATOM   444  C  CB  . PRO A 1 59  ? 44.842 37.127  40.878 1.00 25.94 ? 59  PRO L CB  1 
ATOM   445  C  CG  . PRO A 1 59  ? 45.198 35.679  41.026 1.00 26.06 ? 59  PRO L CG  1 
ATOM   446  C  CD  . PRO A 1 59  ? 44.558 35.273  42.328 1.00 26.17 ? 59  PRO L CD  1 
ATOM   447  N  N   . ALA A 1 60  ? 44.533 40.061  42.324 1.00 25.52 ? 60  ALA L N   1 
ATOM   448  C  CA  . ALA A 1 60  ? 43.835 41.295  42.645 1.00 25.35 ? 60  ALA L CA  1 
ATOM   449  C  C   . ALA A 1 60  ? 42.699 41.592  41.692 1.00 25.07 ? 60  ALA L C   1 
ATOM   450  O  O   . ALA A 1 60  ? 41.848 42.436  41.999 1.00 25.36 ? 60  ALA L O   1 
ATOM   451  C  CB  . ALA A 1 60  ? 44.811 42.457  42.672 1.00 25.48 ? 60  ALA L CB  1 
ATOM   452  N  N   . ARG A 1 61  ? 42.682 40.900  40.550 1.00 24.60 ? 61  ARG L N   1 
ATOM   453  C  CA  . ARG A 1 61  ? 41.597 41.042  39.560 1.00 23.91 ? 61  ARG L CA  1 
ATOM   454  C  C   . ARG A 1 61  ? 40.241 40.536  40.082 1.00 23.78 ? 61  ARG L C   1 
ATOM   455  O  O   . ARG A 1 61  ? 39.193 40.887  39.533 1.00 23.34 ? 61  ARG L O   1 
ATOM   456  C  CB  . ARG A 1 61  ? 41.974 40.398  38.214 1.00 23.52 ? 61  ARG L CB  1 
ATOM   457  C  CG  . ARG A 1 61  ? 42.090 38.879  38.216 1.00 22.98 ? 61  ARG L CG  1 
ATOM   458  C  CD  . ARG A 1 61  ? 42.392 38.344  36.829 1.00 23.60 ? 61  ARG L CD  1 
ATOM   459  N  NE  . ARG A 1 61  ? 42.490 36.888  36.834 1.00 23.55 ? 61  ARG L NE  1 
ATOM   460  C  CZ  . ARG A 1 61  ? 43.582 36.210  37.199 1.00 23.00 ? 61  ARG L CZ  1 
ATOM   461  N  NH1 . ARG A 1 61  ? 44.674 36.874  37.573 1.00 22.76 ? 61  ARG L NH1 1 
ATOM   462  N  NH2 . ARG A 1 61  ? 43.583 34.873  37.185 1.00 21.85 ? 61  ARG L NH2 1 
ATOM   463  N  N   . PHE A 1 62  ? 40.274 39.720  41.144 1.00 24.03 ? 62  PHE L N   1 
ATOM   464  C  CA  . PHE A 1 62  ? 39.056 39.288  41.857 1.00 24.59 ? 62  PHE L CA  1 
ATOM   465  C  C   . PHE A 1 62  ? 38.679 40.302  42.927 1.00 25.41 ? 62  PHE L C   1 
ATOM   466  O  O   . PHE A 1 62  ? 39.483 40.602  43.808 1.00 25.81 ? 62  PHE L O   1 
ATOM   467  C  CB  . PHE A 1 62  ? 39.247 37.903  42.499 1.00 24.27 ? 62  PHE L CB  1 
ATOM   468  C  CG  . PHE A 1 62  ? 39.440 36.798  41.499 1.00 23.87 ? 62  PHE L CG  1 
ATOM   469  C  CD1 . PHE A 1 62  ? 38.347 36.129  40.964 1.00 23.27 ? 62  PHE L CD1 1 
ATOM   470  C  CD2 . PHE A 1 62  ? 40.718 36.443  41.076 1.00 23.35 ? 62  PHE L CD2 1 
ATOM   471  C  CE1 . PHE A 1 62  ? 38.530 35.118  40.016 1.00 23.03 ? 62  PHE L CE1 1 
ATOM   472  C  CE2 . PHE A 1 62  ? 40.907 35.444  40.140 1.00 22.73 ? 62  PHE L CE2 1 
ATOM   473  C  CZ  . PHE A 1 62  ? 39.806 34.781  39.605 1.00 22.74 ? 62  PHE L CZ  1 
ATOM   474  N  N   . SER A 1 63  ? 37.463 40.841  42.846 1.00 26.39 ? 63  SER L N   1 
ATOM   475  C  CA  . SER A 1 63  ? 36.961 41.723  43.896 1.00 27.10 ? 63  SER L CA  1 
ATOM   476  C  C   . SER A 1 63  ? 35.487 41.480  44.185 1.00 27.29 ? 63  SER L C   1 
ATOM   477  O  O   . SER A 1 63  ? 34.684 41.309  43.281 1.00 27.96 ? 63  SER L O   1 
ATOM   478  C  CB  . SER A 1 63  ? 37.221 43.195  43.564 1.00 27.26 ? 63  SER L CB  1 
ATOM   479  O  OG  . SER A 1 63  ? 36.456 43.606  42.455 1.00 28.34 ? 63  SER L OG  1 
ATOM   480  N  N   . GLY A 1 64  ? 35.147 41.439  45.464 1.00 27.47 ? 64  GLY L N   1 
ATOM   481  C  CA  . GLY A 1 64  ? 33.771 41.256  45.886 1.00 26.94 ? 64  GLY L CA  1 
ATOM   482  C  C   . GLY A 1 64  ? 33.232 42.531  46.501 1.00 26.68 ? 64  GLY L C   1 
ATOM   483  O  O   . GLY A 1 64  ? 33.976 43.313  47.085 1.00 25.94 ? 64  GLY L O   1 
ATOM   484  N  N   . SER A 1 65  ? 31.926 42.730  46.355 1.00 26.83 ? 65  SER L N   1 
ATOM   485  C  CA  . SER A 1 65  ? 31.239 43.867  46.941 1.00 27.24 ? 65  SER L CA  1 
ATOM   486  C  C   . SER A 1 65  ? 29.803 43.499  47.301 1.00 27.22 ? 65  SER L C   1 
ATOM   487  O  O   . SER A 1 65  ? 29.237 42.530  46.778 1.00 26.78 ? 65  SER L O   1 
ATOM   488  C  CB  . SER A 1 65  ? 31.269 45.082  45.995 1.00 27.23 ? 65  SER L CB  1 
ATOM   489  O  OG  . SER A 1 65  ? 30.628 44.790  44.760 1.00 28.67 ? 65  SER L OG  1 
ATOM   490  N  N   . GLY A 1 66  ? 29.224 44.286  48.199 1.00 27.37 ? 66  GLY L N   1 
ATOM   491  C  CA  . GLY A 1 66  ? 27.836 44.119  48.574 1.00 27.70 ? 66  GLY L CA  1 
ATOM   492  C  C   . GLY A 1 66  ? 27.676 43.908  50.059 1.00 28.28 ? 66  GLY L C   1 
ATOM   493  O  O   . GLY A 1 66  ? 28.653 43.702  50.800 1.00 28.56 ? 66  GLY L O   1 
ATOM   494  N  N   . SER A 1 67  ? 26.420 43.931  50.473 1.00 28.46 ? 67  SER L N   1 
ATOM   495  C  CA  . SER A 1 67  ? 26.023 43.965  51.864 1.00 29.05 ? 67  SER L CA  1 
ATOM   496  C  C   . SER A 1 67  ? 24.532 43.644  51.847 1.00 28.81 ? 67  SER L C   1 
ATOM   497  O  O   . SER A 1 67  ? 23.851 43.955  50.861 1.00 28.64 ? 67  SER L O   1 
ATOM   498  C  CB  . SER A 1 67  ? 26.250 45.378  52.433 1.00 29.44 ? 67  SER L CB  1 
ATOM   499  O  OG  . SER A 1 67  ? 26.343 45.340  53.848 1.00 31.03 ? 67  SER L OG  1 
ATOM   500  N  N   . GLY A 1 68  ? 24.030 43.012  52.909 1.00 28.58 ? 68  GLY L N   1 
ATOM   501  C  CA  . GLY A 1 68  ? 22.607 42.710  53.017 1.00 28.13 ? 68  GLY L CA  1 
ATOM   502  C  C   . GLY A 1 68  ? 22.171 41.559  52.127 1.00 27.99 ? 68  GLY L C   1 
ATOM   503  O  O   . GLY A 1 68  ? 22.357 40.382  52.474 1.00 28.15 ? 68  GLY L O   1 
ATOM   504  N  N   . THR A 1 69  ? 21.594 41.899  50.977 1.00 27.77 ? 69  THR L N   1 
ATOM   505  C  CA  . THR A 1 69  ? 20.986 40.908  50.085 1.00 27.93 ? 69  THR L CA  1 
ATOM   506  C  C   . THR A 1 69  ? 21.600 40.854  48.676 1.00 28.46 ? 69  THR L C   1 
ATOM   507  O  O   . THR A 1 69  ? 21.341 39.914  47.928 1.00 28.51 ? 69  THR L O   1 
ATOM   508  C  CB  . THR A 1 69  ? 19.467 41.165  49.900 1.00 27.70 ? 69  THR L CB  1 
ATOM   509  O  OG1 . THR A 1 69  ? 19.278 42.447  49.290 1.00 27.28 ? 69  THR L OG1 1 
ATOM   510  C  CG2 . THR A 1 69  ? 18.685 41.078  51.230 1.00 26.63 ? 69  THR L CG2 1 
ATOM   511  N  N   . ASP A 1 70  ? 22.377 41.869  48.309 1.00 28.68 ? 70  ASP L N   1 
ATOM   512  C  CA  . ASP A 1 70  ? 22.866 42.008  46.945 1.00 29.46 ? 70  ASP L CA  1 
ATOM   513  C  C   . ASP A 1 70  ? 24.405 42.038  46.896 1.00 28.81 ? 70  ASP L C   1 
ATOM   514  O  O   . ASP A 1 70  ? 25.047 42.931  47.462 1.00 28.98 ? 70  ASP L O   1 
ATOM   515  C  CB  . ASP A 1 70  ? 22.267 43.269  46.299 1.00 30.57 ? 70  ASP L CB  1 
ATOM   516  C  CG  . ASP A 1 70  ? 22.640 43.415  44.826 1.00 33.56 ? 70  ASP L CG  1 
ATOM   517  O  OD1 . ASP A 1 70  ? 22.003 42.757  43.960 1.00 37.57 ? 70  ASP L OD1 1 
ATOM   518  O  OD2 . ASP A 1 70  ? 23.570 44.195  44.527 1.00 36.13 ? 70  ASP L OD2 1 
ATOM   519  N  N   . PHE A 1 71  ? 24.981 41.048  46.217 1.00 27.62 ? 71  PHE L N   1 
ATOM   520  C  CA  . PHE A 1 71  ? 26.425 40.871  46.169 1.00 26.17 ? 71  PHE L CA  1 
ATOM   521  C  C   . PHE A 1 71  ? 26.924 40.674  44.747 1.00 25.60 ? 71  PHE L C   1 
ATOM   522  O  O   . PHE A 1 71  ? 26.196 40.214  43.874 1.00 25.73 ? 71  PHE L O   1 
ATOM   523  C  CB  . PHE A 1 71  ? 26.840 39.681  47.044 1.00 25.63 ? 71  PHE L CB  1 
ATOM   524  C  CG  . PHE A 1 71  ? 26.451 39.830  48.479 1.00 24.87 ? 71  PHE L CG  1 
ATOM   525  C  CD1 . PHE A 1 71  ? 25.202 39.388  48.928 1.00 24.19 ? 71  PHE L CD1 1 
ATOM   526  C  CD2 . PHE A 1 71  ? 27.317 40.440  49.385 1.00 23.64 ? 71  PHE L CD2 1 
ATOM   527  C  CE1 . PHE A 1 71  ? 24.824 39.542  50.267 1.00 22.97 ? 71  PHE L CE1 1 
ATOM   528  C  CE2 . PHE A 1 71  ? 26.957 40.582  50.721 1.00 23.74 ? 71  PHE L CE2 1 
ATOM   529  C  CZ  . PHE A 1 71  ? 25.704 40.141  51.163 1.00 23.72 ? 71  PHE L CZ  1 
ATOM   530  N  N   . THR A 1 72  ? 28.188 41.008  44.531 1.00 25.03 ? 72  THR L N   1 
ATOM   531  C  CA  . THR A 1 72  ? 28.786 40.964  43.208 1.00 24.04 ? 72  THR L CA  1 
ATOM   532  C  C   . THR A 1 72  ? 30.227 40.543  43.333 1.00 23.63 ? 72  THR L C   1 
ATOM   533  O  O   . THR A 1 72  ? 30.964 41.084  44.161 1.00 23.46 ? 72  THR L O   1 
ATOM   534  C  CB  . THR A 1 72  ? 28.695 42.351  42.515 1.00 23.91 ? 72  THR L CB  1 
ATOM   535  O  OG1 . THR A 1 72  ? 27.321 42.720  42.435 1.00 23.85 ? 72  THR L OG1 1 
ATOM   536  C  CG2 . THR A 1 72  ? 29.271 42.332  41.106 1.00 23.39 ? 72  THR L CG2 1 
ATOM   537  N  N   . LEU A 1 73  ? 30.598 39.543  42.534 1.00 23.29 ? 73  LEU L N   1 
ATOM   538  C  CA  . LEU A 1 73  ? 31.988 39.235  42.234 1.00 23.01 ? 73  LEU L CA  1 
ATOM   539  C  C   . LEU A 1 73  ? 32.337 39.828  40.860 1.00 23.55 ? 73  LEU L C   1 
ATOM   540  O  O   . LEU A 1 73  ? 31.678 39.544  39.844 1.00 23.27 ? 73  LEU L O   1 
ATOM   541  C  CB  . LEU A 1 73  ? 32.237 37.728  42.252 1.00 22.69 ? 73  LEU L CB  1 
ATOM   542  C  CG  . LEU A 1 73  ? 33.681 37.229  42.076 1.00 23.27 ? 73  LEU L CG  1 
ATOM   543  C  CD1 . LEU A 1 73  ? 34.593 37.654  43.240 1.00 21.62 ? 73  LEU L CD1 1 
ATOM   544  C  CD2 . LEU A 1 73  ? 33.717 35.710  41.872 1.00 22.44 ? 73  LEU L CD2 1 
ATOM   545  N  N   . THR A 1 74  ? 33.360 40.677  40.858 1.00 23.83 ? 74  THR L N   1 
ATOM   546  C  CA  . THR A 1 74  ? 33.893 41.282  39.651 1.00 24.69 ? 74  THR L CA  1 
ATOM   547  C  C   . THR A 1 74  ? 35.293 40.747  39.347 1.00 24.82 ? 74  THR L C   1 
ATOM   548  O  O   . THR A 1 74  ? 36.179 40.777  40.194 1.00 24.57 ? 74  THR L O   1 
ATOM   549  C  CB  . THR A 1 74  ? 33.914 42.830  39.795 1.00 24.91 ? 74  THR L CB  1 
ATOM   550  O  OG1 . THR A 1 74  ? 32.581 43.288  40.038 1.00 26.19 ? 74  THR L OG1 1 
ATOM   551  C  CG2 . THR A 1 74  ? 34.458 43.518  38.544 1.00 24.67 ? 74  THR L CG2 1 
ATOM   552  N  N   . ILE A 1 75  ? 35.468 40.229  38.135 1.00 25.70 ? 75  ILE L N   1 
ATOM   553  C  CA  . ILE A 1 75  ? 36.781 39.853  37.630 1.00 26.28 ? 75  ILE L CA  1 
ATOM   554  C  C   . ILE A 1 75  ? 37.121 40.865  36.538 1.00 26.41 ? 75  ILE L C   1 
ATOM   555  O  O   . ILE A 1 75  ? 36.521 40.858  35.472 1.00 26.48 ? 75  ILE L O   1 
ATOM   556  C  CB  . ILE A 1 75  ? 36.822 38.371  37.146 1.00 26.56 ? 75  ILE L CB  1 
ATOM   557  C  CG1 . ILE A 1 75  ? 36.067 37.473  38.142 1.00 27.15 ? 75  ILE L CG1 1 
ATOM   558  C  CG2 . ILE A 1 75  ? 38.279 37.901  36.994 1.00 26.22 ? 75  ILE L CG2 1 
ATOM   559  C  CD1 . ILE A 1 75  ? 35.753 36.037  37.682 1.00 26.73 ? 75  ILE L CD1 1 
ATOM   560  N  N   . SER A 1 76  ? 38.066 41.758  36.825 1.00 26.87 ? 76  SER L N   1 
ATOM   561  C  CA  . SER A 1 76  ? 38.185 43.016  36.066 1.00 27.57 ? 76  SER L CA  1 
ATOM   562  C  C   . SER A 1 76  ? 38.781 42.874  34.660 1.00 27.52 ? 76  SER L C   1 
ATOM   563  O  O   . SER A 1 76  ? 38.489 43.691  33.761 1.00 27.36 ? 76  SER L O   1 
ATOM   564  C  CB  . SER A 1 76  ? 38.992 44.032  36.855 1.00 27.65 ? 76  SER L CB  1 
ATOM   565  O  OG  . SER A 1 76  ? 40.367 43.676  36.834 1.00 29.91 ? 76  SER L OG  1 
ATOM   566  N  N   . SER A 1 77  ? 39.634 41.860  34.494 1.00 27.37 ? 77  SER L N   1 
ATOM   567  C  CA  . SER A 1 77  ? 40.261 41.554  33.214 1.00 27.27 ? 77  SER L CA  1 
ATOM   568  C  C   . SER A 1 77  ? 40.541 40.051  33.117 1.00 26.85 ? 77  SER L C   1 
ATOM   569  O  O   . SER A 1 77  ? 41.579 39.561  33.568 1.00 26.89 ? 77  SER L O   1 
ATOM   570  C  CB  . SER A 1 77  ? 41.550 42.356  33.039 1.00 27.64 ? 77  SER L CB  1 
ATOM   571  O  OG  . SER A 1 77  ? 42.102 42.089  31.756 1.00 30.24 ? 77  SER L OG  1 
ATOM   572  N  N   . LEU A 1 78  ? 39.602 39.332  32.515 1.00 26.28 ? 78  LEU L N   1 
ATOM   573  C  CA  . LEU A 1 78  ? 39.601 37.872  32.492 1.00 25.93 ? 78  LEU L CA  1 
ATOM   574  C  C   . LEU A 1 78  ? 40.881 37.215  31.951 1.00 25.69 ? 78  LEU L C   1 
ATOM   575  O  O   . LEU A 1 78  ? 41.448 37.609  30.908 1.00 24.83 ? 78  LEU L O   1 
ATOM   576  C  CB  . LEU A 1 78  ? 38.412 37.358  31.679 1.00 26.02 ? 78  LEU L CB  1 
ATOM   577  C  CG  . LEU A 1 78  ? 37.106 36.842  32.277 1.00 27.08 ? 78  LEU L CG  1 
ATOM   578  C  CD1 . LEU A 1 78  ? 37.185 36.517  33.772 1.00 26.42 ? 78  LEU L CD1 1 
ATOM   579  C  CD2 . LEU A 1 78  ? 35.954 37.767  31.975 1.00 28.55 ? 78  LEU L CD2 1 
ATOM   580  N  N   . GLU A 1 79  ? 41.291 36.182  32.676 1.00 25.14 ? 79  GLU L N   1 
ATOM   581  C  CA  . GLU A 1 79  ? 42.380 35.310  32.297 1.00 25.40 ? 79  GLU L CA  1 
ATOM   582  C  C   . GLU A 1 79  ? 41.856 33.957  31.874 1.00 24.97 ? 79  GLU L C   1 
ATOM   583  O  O   . GLU A 1 79  ? 40.759 33.606  32.268 1.00 25.42 ? 79  GLU L O   1 
ATOM   584  C  CB  . GLU A 1 79  ? 43.248 35.152  33.499 1.00 25.76 ? 79  GLU L CB  1 
ATOM   585  C  CG  . GLU A 1 79  ? 43.855 36.438  33.824 1.00 27.45 ? 79  GLU L CG  1 
ATOM   586  C  CD  . GLU A 1 79  ? 45.030 36.624  32.970 1.00 31.41 ? 79  GLU L CD  1 
ATOM   587  O  OE1 . GLU A 1 79  ? 45.732 35.603  32.834 1.00 35.99 ? 79  GLU L OE1 1 
ATOM   588  O  OE2 . GLU A 1 79  ? 45.215 37.695  32.349 1.00 28.62 ? 79  GLU L OE2 1 
ATOM   589  N  N   . PRO A 1 80  ? 42.609 33.204  31.035 1.00 24.71 ? 80  PRO L N   1 
ATOM   590  C  CA  . PRO A 1 80  ? 42.146 31.843  30.667 1.00 24.02 ? 80  PRO L CA  1 
ATOM   591  C  C   . PRO A 1 80  ? 41.869 30.908  31.864 1.00 23.55 ? 80  PRO L C   1 
ATOM   592  O  O   . PRO A 1 80  ? 40.953 30.100  31.792 1.00 23.79 ? 80  PRO L O   1 
ATOM   593  C  CB  . PRO A 1 80  ? 43.289 31.298  29.791 1.00 23.84 ? 80  PRO L CB  1 
ATOM   594  C  CG  . PRO A 1 80  ? 43.962 32.507  29.239 1.00 24.42 ? 80  PRO L CG  1 
ATOM   595  C  CD  . PRO A 1 80  ? 43.880 33.541  30.362 1.00 24.53 ? 80  PRO L CD  1 
ATOM   596  N  N   . GLU A 1 81  ? 42.638 31.022  32.952 1.00 23.14 ? 81  GLU L N   1 
ATOM   597  C  CA  . GLU A 1 81  ? 42.406 30.206  34.158 1.00 22.53 ? 81  GLU L CA  1 
ATOM   598  C  C   . GLU A 1 81  ? 41.148 30.601  34.932 1.00 22.02 ? 81  GLU L C   1 
ATOM   599  O  O   . GLU A 1 81  ? 40.839 29.978  35.934 1.00 21.11 ? 81  GLU L O   1 
ATOM   600  C  CB  . GLU A 1 81  ? 43.548 30.311  35.178 1.00 22.40 ? 81  GLU L CB  1 
ATOM   601  C  CG  . GLU A 1 81  ? 44.895 30.624  34.682 1.00 23.11 ? 81  GLU L CG  1 
ATOM   602  C  CD  . GLU A 1 81  ? 45.061 32.066  34.280 1.00 20.92 ? 81  GLU L CD  1 
ATOM   603  O  OE1 . GLU A 1 81  ? 45.315 32.931  35.130 1.00 20.43 ? 81  GLU L OE1 1 
ATOM   604  O  OE2 . GLU A 1 81  ? 44.989 32.313  33.082 1.00 20.70 ? 81  GLU L OE2 1 
ATOM   605  N  N   . ASP A 1 82  ? 40.465 31.664  34.518 1.00 22.38 ? 82  ASP L N   1 
ATOM   606  C  CA  . ASP A 1 82  ? 39.309 32.176  35.285 1.00 22.52 ? 82  ASP L CA  1 
ATOM   607  C  C   . ASP A 1 82  ? 37.999 31.551  34.848 1.00 22.97 ? 82  ASP L C   1 
ATOM   608  O  O   . ASP A 1 82  ? 36.961 31.717  35.497 1.00 23.39 ? 82  ASP L O   1 
ATOM   609  C  CB  . ASP A 1 82  ? 39.218 33.692  35.184 1.00 21.88 ? 82  ASP L CB  1 
ATOM   610  C  CG  . ASP A 1 82  ? 40.420 34.372  35.749 1.00 21.16 ? 82  ASP L CG  1 
ATOM   611  O  OD1 . ASP A 1 82  ? 41.183 33.730  36.502 1.00 20.83 ? 82  ASP L OD1 1 
ATOM   612  O  OD2 . ASP A 1 82  ? 40.619 35.554  35.433 1.00 20.45 ? 82  ASP L OD2 1 
ATOM   613  N  N   . PHE A 1 83  ? 38.058 30.809  33.752 1.00 23.11 ? 83  PHE L N   1 
ATOM   614  C  CA  . PHE A 1 83  ? 36.864 30.213  33.181 1.00 23.26 ? 83  PHE L CA  1 
ATOM   615  C  C   . PHE A 1 83  ? 36.573 28.898  33.886 1.00 23.16 ? 83  PHE L C   1 
ATOM   616  O  O   . PHE A 1 83  ? 37.349 27.936  33.808 1.00 23.49 ? 83  PHE L O   1 
ATOM   617  C  CB  . PHE A 1 83  ? 36.985 30.149  31.655 1.00 22.98 ? 83  PHE L CB  1 
ATOM   618  C  CG  . PHE A 1 83  ? 37.074 31.533  31.019 1.00 23.31 ? 83  PHE L CG  1 
ATOM   619  C  CD1 . PHE A 1 83  ? 38.308 32.193  30.899 1.00 23.63 ? 83  PHE L CD1 1 
ATOM   620  C  CD2 . PHE A 1 83  ? 35.922 32.196  30.599 1.00 23.03 ? 83  PHE L CD2 1 
ATOM   621  C  CE1 . PHE A 1 83  ? 38.386 33.481  30.343 1.00 23.99 ? 83  PHE L CE1 1 
ATOM   622  C  CE2 . PHE A 1 83  ? 35.985 33.487  30.025 1.00 23.16 ? 83  PHE L CE2 1 
ATOM   623  C  CZ  . PHE A 1 83  ? 37.213 34.131  29.893 1.00 23.22 ? 83  PHE L CZ  1 
ATOM   624  N  N   . ALA A 1 84  ? 35.464 28.922  34.628 1.00 22.72 ? 84  ALA L N   1 
ATOM   625  C  CA  . ALA A 1 84  ? 35.114 27.931  35.645 1.00 22.05 ? 84  ALA L CA  1 
ATOM   626  C  C   . ALA A 1 84  ? 33.687 28.229  36.087 1.00 21.64 ? 84  ALA L C   1 
ATOM   627  O  O   . ALA A 1 84  ? 33.068 29.150  35.552 1.00 21.04 ? 84  ALA L O   1 
ATOM   628  C  CB  . ALA A 1 84  ? 36.066 28.041  36.828 1.00 21.78 ? 84  ALA L CB  1 
ATOM   629  N  N   . VAL A 1 85  ? 33.177 27.453  37.052 1.00 21.23 ? 85  VAL L N   1 
ATOM   630  C  CA  . VAL A 1 85  ? 31.894 27.726  37.714 1.00 21.14 ? 85  VAL L CA  1 
ATOM   631  C  C   . VAL A 1 85  ? 32.134 28.488  39.036 1.00 20.96 ? 85  VAL L C   1 
ATOM   632  O  O   . VAL A 1 85  ? 33.101 28.228  39.743 1.00 21.38 ? 85  VAL L O   1 
ATOM   633  C  CB  . VAL A 1 85  ? 31.075 26.423  37.976 1.00 21.18 ? 85  VAL L CB  1 
ATOM   634  C  CG1 . VAL A 1 85  ? 29.797 26.705  38.778 1.00 20.86 ? 85  VAL L CG1 1 
ATOM   635  C  CG2 . VAL A 1 85  ? 30.746 25.714  36.678 1.00 21.08 ? 85  VAL L CG2 1 
ATOM   636  N  N   . TYR A 1 86  ? 31.263 29.443  39.340 1.00 20.45 ? 86  TYR L N   1 
ATOM   637  C  CA  . TYR A 1 86  ? 31.404 30.274  40.533 1.00 20.01 ? 86  TYR L CA  1 
ATOM   638  C  C   . TYR A 1 86  ? 30.167 30.158  41.404 1.00 19.81 ? 86  TYR L C   1 
ATOM   639  O  O   . TYR A 1 86  ? 29.049 30.325  40.923 1.00 19.51 ? 86  TYR L O   1 
ATOM   640  C  CB  . TYR A 1 86  ? 31.661 31.748  40.157 1.00 19.88 ? 86  TYR L CB  1 
ATOM   641  C  CG  . TYR A 1 86  ? 33.035 31.975  39.560 1.00 18.91 ? 86  TYR L CG  1 
ATOM   642  C  CD1 . TYR A 1 86  ? 33.279 31.714  38.199 1.00 18.32 ? 86  TYR L CD1 1 
ATOM   643  C  CD2 . TYR A 1 86  ? 34.088 32.438  40.343 1.00 18.24 ? 86  TYR L CD2 1 
ATOM   644  C  CE1 . TYR A 1 86  ? 34.547 31.892  37.635 1.00 17.61 ? 86  TYR L CE1 1 
ATOM   645  C  CE2 . TYR A 1 86  ? 35.376 32.634  39.782 1.00 18.56 ? 86  TYR L CE2 1 
ATOM   646  C  CZ  . TYR A 1 86  ? 35.585 32.354  38.424 1.00 18.86 ? 86  TYR L CZ  1 
ATOM   647  O  OH  . TYR A 1 86  ? 36.835 32.515  37.868 1.00 19.39 ? 86  TYR L OH  1 
ATOM   648  N  N   . TYR A 1 87  ? 30.388 29.872  42.684 1.00 20.24 ? 87  TYR L N   1 
ATOM   649  C  CA  . TYR A 1 87  ? 29.309 29.734  43.674 1.00 20.34 ? 87  TYR L CA  1 
ATOM   650  C  C   . TYR A 1 87  ? 29.460 30.793  44.744 1.00 20.59 ? 87  TYR L C   1 
ATOM   651  O  O   . TYR A 1 87  ? 30.572 31.143  45.113 1.00 20.17 ? 87  TYR L O   1 
ATOM   652  C  CB  . TYR A 1 87  ? 29.368 28.362  44.364 1.00 20.28 ? 87  TYR L CB  1 
ATOM   653  C  CG  . TYR A 1 87  ? 29.111 27.166  43.471 1.00 20.34 ? 87  TYR L CG  1 
ATOM   654  C  CD1 . TYR A 1 87  ? 30.172 26.378  42.997 1.00 20.66 ? 87  TYR L CD1 1 
ATOM   655  C  CD2 . TYR A 1 87  ? 27.812 26.803  43.119 1.00 20.19 ? 87  TYR L CD2 1 
ATOM   656  C  CE1 . TYR A 1 87  ? 29.936 25.250  42.185 1.00 20.33 ? 87  TYR L CE1 1 
ATOM   657  C  CE2 . TYR A 1 87  ? 27.562 25.689  42.317 1.00 21.10 ? 87  TYR L CE2 1 
ATOM   658  C  CZ  . TYR A 1 87  ? 28.628 24.909  41.854 1.00 20.79 ? 87  TYR L CZ  1 
ATOM   659  O  OH  . TYR A 1 87  ? 28.366 23.799  41.056 1.00 20.83 ? 87  TYR L OH  1 
ATOM   660  N  N   . CYS A 1 88  ? 28.331 31.297  45.240 1.00 21.31 ? 88  CYS L N   1 
ATOM   661  C  CA  . CYS A 1 88  ? 28.329 32.118  46.439 1.00 21.26 ? 88  CYS L CA  1 
ATOM   662  C  C   . CYS A 1 88  ? 27.827 31.262  47.588 1.00 21.01 ? 88  CYS L C   1 
ATOM   663  O  O   . CYS A 1 88  ? 27.174 30.255  47.371 1.00 20.55 ? 88  CYS L O   1 
ATOM   664  C  CB  . CYS A 1 88  ? 27.524 33.406  46.267 1.00 21.33 ? 88  CYS L CB  1 
ATOM   665  S  SG  . CYS A 1 88  ? 25.801 33.229  45.792 1.00 22.49 ? 88  CYS L SG  1 
ATOM   666  N  N   . GLN A 1 89  ? 28.209 31.636  48.799 1.00 20.94 ? 89  GLN L N   1 
ATOM   667  C  CA  . GLN A 1 89  ? 27.846 30.902  49.994 1.00 21.49 ? 89  GLN L CA  1 
ATOM   668  C  C   . GLN A 1 89  ? 27.599 31.893  51.132 1.00 22.16 ? 89  GLN L C   1 
ATOM   669  O  O   . GLN A 1 89  ? 28.381 32.827  51.346 1.00 21.45 ? 89  GLN L O   1 
ATOM   670  C  CB  . GLN A 1 89  ? 28.959 29.919  50.364 1.00 21.44 ? 89  GLN L CB  1 
ATOM   671  C  CG  . GLN A 1 89  ? 28.709 29.047  51.585 1.00 21.34 ? 89  GLN L CG  1 
ATOM   672  C  CD  . GLN A 1 89  ? 30.016 28.532  52.182 1.00 22.01 ? 89  GLN L CD  1 
ATOM   673  O  OE1 . GLN A 1 89  ? 30.240 27.324  52.265 1.00 24.00 ? 89  GLN L OE1 1 
ATOM   674  N  NE2 . GLN A 1 89  ? 30.899 29.440  52.550 1.00 20.17 ? 89  GLN L NE2 1 
ATOM   675  N  N   . GLN A 1 90  ? 26.501 31.693  51.854 1.00 23.43 ? 90  GLN L N   1 
ATOM   676  C  CA  . GLN A 1 90  ? 26.245 32.530  53.023 1.00 24.44 ? 90  GLN L CA  1 
ATOM   677  C  C   . GLN A 1 90  ? 26.558 31.808  54.327 1.00 25.67 ? 90  GLN L C   1 
ATOM   678  O  O   . GLN A 1 90  ? 26.393 30.583  54.445 1.00 24.79 ? 90  GLN L O   1 
ATOM   679  C  CB  . GLN A 1 90  ? 24.847 33.167  53.002 1.00 24.03 ? 90  GLN L CB  1 
ATOM   680  C  CG  . GLN A 1 90  ? 23.656 32.218  53.169 1.00 23.51 ? 90  GLN L CG  1 
ATOM   681  C  CD  . GLN A 1 90  ? 23.354 31.878  54.618 1.00 22.88 ? 90  GLN L CD  1 
ATOM   682  O  OE1 . GLN A 1 90  ? 23.716 32.619  55.537 1.00 23.30 ? 90  GLN L OE1 1 
ATOM   683  N  NE2 . GLN A 1 90  ? 22.683 30.754  54.827 1.00 21.36 ? 90  GLN L NE2 1 
ATOM   684  N  N   . ARG A 1 91  ? 27.045 32.588  55.286 1.00 27.79 ? 91  ARG L N   1 
ATOM   685  C  CA  . ARG A 1 91  ? 27.463 32.075  56.585 1.00 29.92 ? 91  ARG L CA  1 
ATOM   686  C  C   . ARG A 1 91  ? 26.807 32.891  57.704 1.00 31.51 ? 91  ARG L C   1 
ATOM   687  O  O   . ARG A 1 91  ? 27.366 33.066  58.787 1.00 31.45 ? 91  ARG L O   1 
ATOM   688  C  CB  . ARG A 1 91  ? 28.988 32.131  56.689 1.00 29.83 ? 91  ARG L CB  1 
ATOM   689  C  CG  . ARG A 1 91  ? 29.746 31.376  55.563 1.00 30.14 ? 91  ARG L CG  1 
ATOM   690  C  CD  . ARG A 1 91  ? 29.508 29.866  55.656 1.00 30.29 ? 91  ARG L CD  1 
ATOM   691  N  NE  . ARG A 1 91  ? 29.965 29.342  56.944 1.00 30.28 ? 91  ARG L NE  1 
ATOM   692  C  CZ  . ARG A 1 91  ? 31.176 28.835  57.144 1.00 31.05 ? 91  ARG L CZ  1 
ATOM   693  N  NH1 . ARG A 1 91  ? 31.521 28.381  58.342 1.00 30.36 ? 91  ARG L NH1 1 
ATOM   694  N  NH2 . ARG A 1 91  ? 32.036 28.776  56.134 1.00 29.63 ? 91  ARG L NH2 1 
ATOM   695  N  N   . SER A 1 92  ? 25.607 33.385  57.424 1.00 33.29 ? 92  SER L N   1 
ATOM   696  C  CA  . SER A 1 92  ? 24.865 34.210  58.374 1.00 35.29 ? 92  SER L CA  1 
ATOM   697  C  C   . SER A 1 92  ? 23.988 33.388  59.321 1.00 36.72 ? 92  SER L C   1 
ATOM   698  O  O   . SER A 1 92  ? 23.790 33.760  60.478 1.00 36.93 ? 92  SER L O   1 
ATOM   699  C  CB  . SER A 1 92  ? 24.000 35.203  57.598 1.00 35.12 ? 92  SER L CB  1 
ATOM   700  O  OG  . SER A 1 92  ? 23.221 36.004  58.453 1.00 34.86 ? 92  SER L OG  1 
ATOM   701  N  N   . ASN A 1 93  ? 23.518 32.247  58.822 1.00 38.54 ? 93  ASN L N   1 
ATOM   702  C  CA  . ASN A 1 93  ? 22.270 31.627  59.258 1.00 40.19 ? 93  ASN L CA  1 
ATOM   703  C  C   . ASN A 1 93  ? 22.359 30.118  59.023 1.00 40.47 ? 93  ASN L C   1 
ATOM   704  O  O   . ASN A 1 93  ? 22.784 29.699  57.949 1.00 40.77 ? 93  ASN L O   1 
ATOM   705  C  CB  . ASN A 1 93  ? 21.160 32.252  58.388 1.00 40.76 ? 93  ASN L CB  1 
ATOM   706  C  CG  . ASN A 1 93  ? 19.761 31.814  58.758 1.00 42.08 ? 93  ASN L CG  1 
ATOM   707  O  OD1 . ASN A 1 93  ? 19.311 30.742  58.357 1.00 43.85 ? 93  ASN L OD1 1 
ATOM   708  N  ND2 . ASN A 1 93  ? 19.030 32.683  59.463 1.00 42.34 ? 93  ASN L ND2 1 
ATOM   709  N  N   . TRP A 1 94  ? 21.989 29.305  60.016 1.00 40.47 ? 94  TRP L N   1 
ATOM   710  C  CA  . TRP A 1 94  ? 21.768 27.878  59.777 1.00 40.05 ? 94  TRP L CA  1 
ATOM   711  C  C   . TRP A 1 94  ? 20.562 27.721  58.857 1.00 38.30 ? 94  TRP L C   1 
ATOM   712  O  O   . TRP A 1 94  ? 19.572 28.427  59.029 1.00 38.76 ? 94  TRP L O   1 
ATOM   713  C  CB  . TRP A 1 94  ? 21.503 27.105  61.079 1.00 42.05 ? 94  TRP L CB  1 
ATOM   714  C  CG  . TRP A 1 94  ? 21.124 25.635  60.838 1.00 43.33 ? 94  TRP L CG  1 
ATOM   715  C  CD1 . TRP A 1 94  ? 21.977 24.559  60.820 1.00 44.99 ? 94  TRP L CD1 1 
ATOM   716  C  CD2 . TRP A 1 94  ? 19.814 25.107  60.551 1.00 44.28 ? 94  TRP L CD2 1 
ATOM   717  N  NE1 . TRP A 1 94  ? 21.281 23.403  60.547 1.00 44.21 ? 94  TRP L NE1 1 
ATOM   718  C  CE2 . TRP A 1 94  ? 19.957 23.707  60.369 1.00 44.34 ? 94  TRP L CE2 1 
ATOM   719  C  CE3 . TRP A 1 94  ? 18.537 25.680  60.424 1.00 44.90 ? 94  TRP L CE3 1 
ATOM   720  C  CZ2 . TRP A 1 94  ? 18.871 22.869  60.080 1.00 43.77 ? 94  TRP L CZ2 1 
ATOM   721  C  CZ3 . TRP A 1 94  ? 17.452 24.844  60.118 1.00 44.26 ? 94  TRP L CZ3 1 
ATOM   722  C  CH2 . TRP A 1 94  ? 17.631 23.453  59.958 1.00 43.95 ? 94  TRP L CH2 1 
ATOM   723  N  N   . PRO A 1 95  ? 20.630 26.802  57.873 1.00 35.99 ? 95  PRO L N   1 
ATOM   724  C  CA  . PRO A 1 95  ? 21.800 26.034  57.451 1.00 33.71 ? 95  PRO L CA  1 
ATOM   725  C  C   . PRO A 1 95  ? 22.688 26.845  56.501 1.00 31.46 ? 95  PRO L C   1 
ATOM   726  O  O   . PRO A 1 95  ? 22.243 27.861  55.945 1.00 30.73 ? 95  PRO L O   1 
ATOM   727  C  CB  . PRO A 1 95  ? 21.193 24.822  56.720 1.00 34.03 ? 95  PRO L CB  1 
ATOM   728  C  CG  . PRO A 1 95  ? 19.697 25.068  56.626 1.00 34.83 ? 95  PRO L CG  1 
ATOM   729  C  CD  . PRO A 1 95  ? 19.425 26.453  57.095 1.00 35.98 ? 95  PRO L CD  1 
ATOM   730  N  N   . ILE A 1 96  ? 23.943 26.423  56.355 1.00 28.72 ? 96  ILE L N   1 
ATOM   731  C  CA  . ILE A 1 96  ? 24.825 26.970  55.327 1.00 26.23 ? 96  ILE L CA  1 
ATOM   732  C  C   . ILE A 1 96  ? 24.238 26.618  53.953 1.00 25.18 ? 96  ILE L C   1 
ATOM   733  O  O   . ILE A 1 96  ? 23.929 25.463  53.677 1.00 24.29 ? 96  ILE L O   1 
ATOM   734  C  CB  . ILE A 1 96  ? 26.289 26.450  55.467 1.00 26.30 ? 96  ILE L CB  1 
ATOM   735  C  CG1 . ILE A 1 96  ? 26.874 26.815  56.848 1.00 25.75 ? 96  ILE L CG1 1 
ATOM   736  C  CG2 . ILE A 1 96  ? 27.166 26.980  54.329 1.00 25.51 ? 96  ILE L CG2 1 
ATOM   737  C  CD1 . ILE A 1 96  ? 28.313 26.351  57.102 1.00 25.41 ? 96  ILE L CD1 1 
ATOM   738  N  N   . THR A 1 97  ? 24.043 27.635  53.114 1.00 24.40 ? 97  THR L N   1 
ATOM   739  C  CA  . THR A 1 97  ? 23.487 27.444  51.775 1.00 23.15 ? 97  THR L CA  1 
ATOM   740  C  C   . THR A 1 97  ? 24.401 28.043  50.701 1.00 22.88 ? 97  THR L C   1 
ATOM   741  O  O   . THR A 1 97  ? 25.194 28.947  50.967 1.00 22.25 ? 97  THR L O   1 
ATOM   742  C  CB  . THR A 1 97  ? 22.102 28.106  51.655 1.00 23.23 ? 97  THR L CB  1 
ATOM   743  O  OG1 . THR A 1 97  ? 22.196 29.441  52.159 1.00 22.72 ? 97  THR L OG1 1 
ATOM   744  C  CG2 . THR A 1 97  ? 21.020 27.318  52.442 1.00 21.88 ? 97  THR L CG2 1 
ATOM   745  N  N   . PHE A 1 98  ? 24.257 27.517  49.486 1.00 22.74 ? 98  PHE L N   1 
ATOM   746  C  CA  . PHE A 1 98  ? 25.009 27.940  48.312 1.00 22.29 ? 98  PHE L CA  1 
ATOM   747  C  C   . PHE A 1 98  ? 24.053 28.390  47.224 1.00 22.10 ? 98  PHE L C   1 
ATOM   748  O  O   . PHE A 1 98  ? 22.928 27.913  47.155 1.00 22.52 ? 98  PHE L O   1 
ATOM   749  C  CB  . PHE A 1 98  ? 25.797 26.752  47.743 1.00 21.93 ? 98  PHE L CB  1 
ATOM   750  C  CG  . PHE A 1 98  ? 26.910 26.255  48.622 1.00 20.58 ? 98  PHE L CG  1 
ATOM   751  C  CD1 . PHE A 1 98  ? 26.658 25.323  49.624 1.00 19.25 ? 98  PHE L CD1 1 
ATOM   752  C  CD2 . PHE A 1 98  ? 28.228 26.669  48.402 1.00 19.89 ? 98  PHE L CD2 1 
ATOM   753  C  CE1 . PHE A 1 98  ? 27.702 24.823  50.422 1.00 19.10 ? 98  PHE L CE1 1 
ATOM   754  C  CE2 . PHE A 1 98  ? 29.280 26.161  49.201 1.00 19.89 ? 98  PHE L CE2 1 
ATOM   755  C  CZ  . PHE A 1 98  ? 29.007 25.237  50.207 1.00 19.51 ? 98  PHE L CZ  1 
ATOM   756  N  N   . GLY A 1 99  ? 24.500 29.312  46.379 1.00 22.04 ? 99  GLY L N   1 
ATOM   757  C  CA  . GLY A 1 99  ? 23.835 29.564  45.114 1.00 22.28 ? 99  GLY L CA  1 
ATOM   758  C  C   . GLY A 1 99  ? 24.035 28.359  44.210 1.00 22.43 ? 99  GLY L C   1 
ATOM   759  O  O   . GLY A 1 99  ? 24.861 27.502  44.500 1.00 22.26 ? 99  GLY L O   1 
ATOM   760  N  N   . GLN A 1 100 ? 23.288 28.285  43.113 1.00 22.95 ? 100 GLN L N   1 
ATOM   761  C  CA  . GLN A 1 100 ? 23.393 27.133  42.198 1.00 23.41 ? 100 GLN L CA  1 
ATOM   762  C  C   . GLN A 1 100 ? 24.442 27.334  41.094 1.00 22.77 ? 100 GLN L C   1 
ATOM   763  O  O   . GLN A 1 100 ? 24.609 26.481  40.223 1.00 22.38 ? 100 GLN L O   1 
ATOM   764  C  CB  . GLN A 1 100 ? 22.017 26.752  41.610 1.00 23.77 ? 100 GLN L CB  1 
ATOM   765  C  CG  . GLN A 1 100 ? 20.976 26.278  42.667 1.00 27.34 ? 100 GLN L CG  1 
ATOM   766  C  CD  . GLN A 1 100 ? 21.525 25.240  43.665 1.00 30.54 ? 100 GLN L CD  1 
ATOM   767  O  OE1 . GLN A 1 100 ? 21.630 25.516  44.876 1.00 32.46 ? 100 GLN L OE1 1 
ATOM   768  N  NE2 . GLN A 1 100 ? 21.869 24.050  43.163 1.00 30.80 ? 100 GLN L NE2 1 
ATOM   769  N  N   . GLY A 1 101 ? 25.129 28.475  41.137 1.00 22.35 ? 101 GLY L N   1 
ATOM   770  C  CA  . GLY A 1 101 ? 26.305 28.697  40.311 1.00 21.84 ? 101 GLY L CA  1 
ATOM   771  C  C   . GLY A 1 101 ? 26.092 29.546  39.076 1.00 21.79 ? 101 GLY L C   1 
ATOM   772  O  O   . GLY A 1 101 ? 24.989 29.633  38.530 1.00 21.38 ? 101 GLY L O   1 
ATOM   773  N  N   . THR A 1 102 ? 27.170 30.206  38.678 1.00 21.77 ? 102 THR L N   1 
ATOM   774  C  CA  . THR A 1 102 ? 27.297 30.822  37.368 1.00 21.60 ? 102 THR L CA  1 
ATOM   775  C  C   . THR A 1 102 ? 28.462 30.151  36.632 1.00 21.77 ? 102 THR L C   1 
ATOM   776  O  O   . THR A 1 102 ? 29.603 30.185  37.098 1.00 21.42 ? 102 THR L O   1 
ATOM   777  C  CB  . THR A 1 102 ? 27.554 32.333  37.479 1.00 21.31 ? 102 THR L CB  1 
ATOM   778  O  OG1 . THR A 1 102 ? 26.398 32.975  38.044 1.00 20.83 ? 102 THR L OG1 1 
ATOM   779  C  CG2 . THR A 1 102 ? 27.844 32.926  36.118 1.00 20.50 ? 102 THR L CG2 1 
ATOM   780  N  N   . ARG A 1 103 ? 28.160 29.538  35.490 1.00 22.26 ? 103 ARG L N   1 
ATOM   781  C  CA  . ARG A 1 103 ? 29.189 28.992  34.621 1.00 23.36 ? 103 ARG L CA  1 
ATOM   782  C  C   . ARG A 1 103 ? 29.769 30.078  33.701 1.00 23.65 ? 103 ARG L C   1 
ATOM   783  O  O   . ARG A 1 103 ? 29.042 30.707  32.943 1.00 23.48 ? 103 ARG L O   1 
ATOM   784  C  CB  . ARG A 1 103 ? 28.657 27.807  33.811 1.00 23.60 ? 103 ARG L CB  1 
ATOM   785  C  CG  . ARG A 1 103 ? 29.766 27.078  33.084 1.00 25.58 ? 103 ARG L CG  1 
ATOM   786  C  CD  . ARG A 1 103 ? 29.308 25.799  32.403 1.00 28.07 ? 103 ARG L CD  1 
ATOM   787  N  NE  . ARG A 1 103 ? 30.316 25.402  31.421 1.00 30.71 ? 103 ARG L NE  1 
ATOM   788  C  CZ  . ARG A 1 103 ? 30.291 25.757  30.135 1.00 31.17 ? 103 ARG L CZ  1 
ATOM   789  N  NH1 . ARG A 1 103 ? 31.261 25.368  29.319 1.00 31.23 ? 103 ARG L NH1 1 
ATOM   790  N  NH2 . ARG A 1 103 ? 29.292 26.492  29.662 1.00 32.54 ? 103 ARG L NH2 1 
ATOM   791  N  N   . LEU A 1 104 ? 31.082 30.294  33.807 1.00 24.25 ? 104 LEU L N   1 
ATOM   792  C  CA  . LEU A 1 104 ? 31.802 31.292  33.030 1.00 24.82 ? 104 LEU L CA  1 
ATOM   793  C  C   . LEU A 1 104 ? 32.594 30.608  31.916 1.00 25.22 ? 104 LEU L C   1 
ATOM   794  O  O   . LEU A 1 104 ? 33.557 29.879  32.169 1.00 25.28 ? 104 LEU L O   1 
ATOM   795  C  CB  . LEU A 1 104 ? 32.753 32.068  33.941 1.00 25.23 ? 104 LEU L CB  1 
ATOM   796  C  CG  . LEU A 1 104 ? 33.057 33.560  33.766 1.00 25.61 ? 104 LEU L CG  1 
ATOM   797  C  CD1 . LEU A 1 104 ? 34.268 33.928  34.615 1.00 25.89 ? 104 LEU L CD1 1 
ATOM   798  C  CD2 . LEU A 1 104 ? 33.275 33.986  32.330 1.00 26.20 ? 104 LEU L CD2 1 
ATOM   799  N  N   . GLU A 1 105 ? 32.188 30.873  30.677 1.00 25.72 ? 105 GLU L N   1 
ATOM   800  C  CA  . GLU A 1 105 ? 32.719 30.205  29.491 1.00 26.01 ? 105 GLU L CA  1 
ATOM   801  C  C   . GLU A 1 105 ? 33.492 31.161  28.558 1.00 25.71 ? 105 GLU L C   1 
ATOM   802  O  O   . GLU A 1 105 ? 33.127 32.329  28.413 1.00 25.60 ? 105 GLU L O   1 
ATOM   803  C  CB  . GLU A 1 105 ? 31.527 29.614  28.743 1.00 26.54 ? 105 GLU L CB  1 
ATOM   804  C  CG  . GLU A 1 105 ? 31.902 28.754  27.604 1.00 28.26 ? 105 GLU L CG  1 
ATOM   805  C  CD  . GLU A 1 105 ? 31.222 29.163  26.334 1.00 29.14 ? 105 GLU L CD  1 
ATOM   806  O  OE1 . GLU A 1 105 ? 31.080 30.372  26.065 1.00 28.43 ? 105 GLU L OE1 1 
ATOM   807  O  OE2 . GLU A 1 105 ? 30.838 28.249  25.588 1.00 33.18 ? 105 GLU L OE2 1 
ATOM   808  N  N   . ILE A 1 106 ? 34.545 30.660  27.917 1.00 26.05 ? 106 ILE L N   1 
ATOM   809  C  CA  . ILE A 1 106 ? 35.338 31.452  26.955 1.00 26.14 ? 106 ILE L CA  1 
ATOM   810  C  C   . ILE A 1 106 ? 34.626 31.710  25.611 1.00 26.38 ? 106 ILE L C   1 
ATOM   811  O  O   . ILE A 1 106 ? 34.298 30.783  24.876 1.00 26.44 ? 106 ILE L O   1 
ATOM   812  C  CB  . ILE A 1 106 ? 36.748 30.846  26.677 1.00 26.21 ? 106 ILE L CB  1 
ATOM   813  C  CG1 . ILE A 1 106 ? 37.466 30.514  27.984 1.00 25.78 ? 106 ILE L CG1 1 
ATOM   814  C  CG2 . ILE A 1 106 ? 37.599 31.804  25.792 1.00 25.96 ? 106 ILE L CG2 1 
ATOM   815  C  CD1 . ILE A 1 106 ? 38.949 30.159  27.847 1.00 26.12 ? 106 ILE L CD1 1 
ATOM   816  N  N   . LYS A 1 107 ? 34.393 32.985  25.326 1.00 26.61 ? 107 LYS L N   1 
ATOM   817  C  CA  . LYS A 1 107 ? 33.920 33.436  24.029 1.00 27.74 ? 107 LYS L CA  1 
ATOM   818  C  C   . LYS A 1 107 ? 35.105 33.469  23.069 1.00 27.40 ? 107 LYS L C   1 
ATOM   819  O  O   . LYS A 1 107 ? 36.179 34.000  23.381 1.00 27.42 ? 107 LYS L O   1 
ATOM   820  C  CB  . LYS A 1 107 ? 33.237 34.806  24.121 1.00 27.76 ? 107 LYS L CB  1 
ATOM   821  C  CG  . LYS A 1 107 ? 32.713 35.337  22.794 1.00 29.16 ? 107 LYS L CG  1 
ATOM   822  C  CD  . LYS A 1 107 ? 32.117 36.738  22.936 1.00 29.65 ? 107 LYS L CD  1 
ATOM   823  C  CE  . LYS A 1 107 ? 30.676 36.682  23.449 1.00 34.29 ? 107 LYS L CE  1 
ATOM   824  N  NZ  . LYS A 1 107 ? 30.015 38.034  23.401 1.00 36.60 ? 107 LYS L NZ  1 
ATOM   825  N  N   . ARG A 1 108 ? 34.861 32.892  21.900 1.00 27.11 ? 108 ARG L N   1 
ATOM   826  C  CA  . ARG A 1 108 ? 35.863 32.428  20.961 1.00 27.03 ? 108 ARG L CA  1 
ATOM   827  C  C   . ARG A 1 108 ? 35.261 32.800  19.609 1.00 26.87 ? 108 ARG L C   1 
ATOM   828  O  O   . ARG A 1 108 ? 34.043 33.031  19.538 1.00 26.89 ? 108 ARG L O   1 
ATOM   829  C  CB  . ARG A 1 108 ? 35.851 30.909  21.081 1.00 27.02 ? 108 ARG L CB  1 
ATOM   830  C  CG  . ARG A 1 108 ? 37.126 30.193  20.883 1.00 27.71 ? 108 ARG L CG  1 
ATOM   831  C  CD  . ARG A 1 108 ? 36.859 28.950  20.058 1.00 26.55 ? 108 ARG L CD  1 
ATOM   832  N  NE  . ARG A 1 108 ? 36.987 29.285  18.637 1.00 26.38 ? 108 ARG L NE  1 
ATOM   833  C  CZ  . ARG A 1 108 ? 37.942 28.837  17.830 1.00 25.80 ? 108 ARG L CZ  1 
ATOM   834  N  NH1 . ARG A 1 108 ? 37.959 29.221  16.557 1.00 24.73 ? 108 ARG L NH1 1 
ATOM   835  N  NH2 . ARG A 1 108 ? 38.859 27.988  18.281 1.00 26.49 ? 108 ARG L NH2 1 
ATOM   836  N  N   . THR A 1 109 ? 36.054 32.866  18.538 1.00 26.65 ? 109 THR L N   1 
ATOM   837  C  CA  . THR A 1 109 ? 35.426 32.938  17.199 1.00 26.96 ? 109 THR L CA  1 
ATOM   838  C  C   . THR A 1 109 ? 34.680 31.629  16.879 1.00 26.63 ? 109 THR L C   1 
ATOM   839  O  O   . THR A 1 109 ? 35.034 30.561  17.377 1.00 26.46 ? 109 THR L O   1 
ATOM   840  C  CB  . THR A 1 109 ? 36.407 33.278  16.012 1.00 26.92 ? 109 THR L CB  1 
ATOM   841  O  OG1 . THR A 1 109 ? 37.332 32.201  15.817 1.00 28.08 ? 109 THR L OG1 1 
ATOM   842  C  CG2 . THR A 1 109 ? 37.159 34.577  16.253 1.00 26.18 ? 109 THR L CG2 1 
ATOM   843  N  N   . VAL A 1 110 ? 33.653 31.745  16.043 1.00 26.59 ? 110 VAL L N   1 
ATOM   844  C  CA  . VAL A 1 110 ? 32.868 30.625  15.536 1.00 26.65 ? 110 VAL L CA  1 
ATOM   845  C  C   . VAL A 1 110 ? 33.727 29.586  14.811 1.00 26.44 ? 110 VAL L C   1 
ATOM   846  O  O   . VAL A 1 110 ? 34.538 29.913  13.951 1.00 26.20 ? 110 VAL L O   1 
ATOM   847  C  CB  . VAL A 1 110 ? 31.740 31.142  14.595 1.00 27.02 ? 110 VAL L CB  1 
ATOM   848  C  CG1 . VAL A 1 110 ? 30.910 29.989  13.995 1.00 27.24 ? 110 VAL L CG1 1 
ATOM   849  C  CG2 . VAL A 1 110 ? 30.840 32.118  15.346 1.00 26.86 ? 110 VAL L CG2 1 
ATOM   850  N  N   . ALA A 1 111 ? 33.542 28.330  15.198 1.00 26.40 ? 111 ALA L N   1 
ATOM   851  C  CA  . ALA A 1 111 ? 34.188 27.202  14.555 1.00 26.17 ? 111 ALA L CA  1 
ATOM   852  C  C   . ALA A 1 111 ? 33.136 26.127  14.267 1.00 26.40 ? 111 ALA L C   1 
ATOM   853  O  O   . ALA A 1 111 ? 32.377 25.718  15.163 1.00 25.95 ? 111 ALA L O   1 
ATOM   854  C  CB  . ALA A 1 111 ? 35.315 26.660  15.417 1.00 26.08 ? 111 ALA L CB  1 
ATOM   855  N  N   . ALA A 1 112 ? 33.078 25.709  12.999 1.00 26.32 ? 112 ALA L N   1 
ATOM   856  C  CA  . ALA A 1 112 ? 32.161 24.674  12.556 1.00 26.44 ? 112 ALA L CA  1 
ATOM   857  C  C   . ALA A 1 112 ? 32.712 23.321  12.969 1.00 26.49 ? 112 ALA L C   1 
ATOM   858  O  O   . ALA A 1 112 ? 33.930 23.103  12.908 1.00 27.18 ? 112 ALA L O   1 
ATOM   859  C  CB  . ALA A 1 112 ? 31.982 24.736  11.051 1.00 26.70 ? 112 ALA L CB  1 
ATOM   860  N  N   . PRO A 1 113 ? 31.829 22.406  13.404 1.00 26.37 ? 113 PRO L N   1 
ATOM   861  C  CA  . PRO A 1 113 ? 32.275 21.053  13.734 1.00 26.27 ? 113 PRO L CA  1 
ATOM   862  C  C   . PRO A 1 113 ? 32.563 20.218  12.487 1.00 26.26 ? 113 PRO L C   1 
ATOM   863  O  O   . PRO A 1 113 ? 31.973 20.450  11.426 1.00 25.76 ? 113 PRO L O   1 
ATOM   864  C  CB  . PRO A 1 113 ? 31.058 20.460  14.462 1.00 25.99 ? 113 PRO L CB  1 
ATOM   865  C  CG  . PRO A 1 113 ? 29.903 21.165  13.879 1.00 25.66 ? 113 PRO L CG  1 
ATOM   866  C  CD  . PRO A 1 113 ? 30.377 22.570  13.625 1.00 26.28 ? 113 PRO L CD  1 
ATOM   867  N  N   . SER A 1 114 ? 33.467 19.255  12.621 1.00 26.65 ? 114 SER L N   1 
ATOM   868  C  CA  . SER A 1 114 ? 33.536 18.151  11.663 1.00 26.55 ? 114 SER L CA  1 
ATOM   869  C  C   . SER A 1 114 ? 32.686 17.014  12.216 1.00 25.84 ? 114 SER L C   1 
ATOM   870  O  O   . SER A 1 114 ? 32.673 16.770  13.421 1.00 26.00 ? 114 SER L O   1 
ATOM   871  C  CB  . SER A 1 114 ? 34.973 17.714  11.414 1.00 26.86 ? 114 SER L CB  1 
ATOM   872  O  OG  . SER A 1 114 ? 35.587 17.353  12.629 1.00 28.58 ? 114 SER L OG  1 
ATOM   873  N  N   . VAL A 1 115 ? 31.956 16.345  11.325 1.00 25.17 ? 115 VAL L N   1 
ATOM   874  C  CA  . VAL A 1 115 ? 30.893 15.416  11.707 1.00 24.31 ? 115 VAL L CA  1 
ATOM   875  C  C   . VAL A 1 115 ? 31.218 14.012  11.204 1.00 23.82 ? 115 VAL L C   1 
ATOM   876  O  O   . VAL A 1 115 ? 31.700 13.837  10.084 1.00 23.16 ? 115 VAL L O   1 
ATOM   877  C  CB  . VAL A 1 115 ? 29.482 15.891  11.213 1.00 24.44 ? 115 VAL L CB  1 
ATOM   878  C  CG1 . VAL A 1 115 ? 28.370 14.980  11.723 1.00 24.43 ? 115 VAL L CG1 1 
ATOM   879  C  CG2 . VAL A 1 115 ? 29.206 17.332  11.637 1.00 23.24 ? 115 VAL L CG2 1 
ATOM   880  N  N   . PHE A 1 116 ? 30.964 13.037  12.073 1.00 23.21 ? 116 PHE L N   1 
ATOM   881  C  CA  . PHE A 1 116 ? 31.216 11.629  11.824 1.00 22.84 ? 116 PHE L CA  1 
ATOM   882  C  C   . PHE A 1 116 ? 29.999 10.828  12.306 1.00 23.09 ? 116 PHE L C   1 
ATOM   883  O  O   . PHE A 1 116 ? 29.436 11.115  13.366 1.00 22.85 ? 116 PHE L O   1 
ATOM   884  C  CB  . PHE A 1 116 ? 32.473 11.159  12.586 1.00 22.33 ? 116 PHE L CB  1 
ATOM   885  C  CG  . PHE A 1 116 ? 33.717 11.991  12.311 1.00 22.25 ? 116 PHE L CG  1 
ATOM   886  C  CD1 . PHE A 1 116 ? 34.018 13.105  13.097 1.00 21.93 ? 116 PHE L CD1 1 
ATOM   887  C  CD2 . PHE A 1 116 ? 34.598 11.646  11.274 1.00 22.31 ? 116 PHE L CD2 1 
ATOM   888  C  CE1 . PHE A 1 116 ? 35.166 13.882  12.851 1.00 22.53 ? 116 PHE L CE1 1 
ATOM   889  C  CE2 . PHE A 1 116 ? 35.750 12.416  11.008 1.00 22.43 ? 116 PHE L CE2 1 
ATOM   890  C  CZ  . PHE A 1 116 ? 36.034 13.535  11.804 1.00 22.59 ? 116 PHE L CZ  1 
ATOM   891  N  N   . ILE A 1 117 ? 29.610 9.812   11.533 1.00 23.50 ? 117 ILE L N   1 
ATOM   892  C  CA  . ILE A 1 117 ? 28.577 8.858   11.935 1.00 23.18 ? 117 ILE L CA  1 
ATOM   893  C  C   . ILE A 1 117 ? 29.186 7.450   12.053 1.00 23.44 ? 117 ILE L C   1 
ATOM   894  O  O   . ILE A 1 117 ? 30.038 7.066   11.254 1.00 23.57 ? 117 ILE L O   1 
ATOM   895  C  CB  . ILE A 1 117 ? 27.351 8.914   10.960 1.00 23.47 ? 117 ILE L CB  1 
ATOM   896  C  CG1 . ILE A 1 117 ? 26.122 8.200   11.562 1.00 23.21 ? 117 ILE L CG1 1 
ATOM   897  C  CG2 . ILE A 1 117 ? 27.730 8.395   9.532  1.00 23.85 ? 117 ILE L CG2 1 
ATOM   898  C  CD1 . ILE A 1 117 ? 24.796 8.538   10.895 1.00 22.71 ? 117 ILE L CD1 1 
ATOM   899  N  N   . PHE A 1 118 ? 28.774 6.701   13.074 1.00 23.66 ? 118 PHE L N   1 
ATOM   900  C  CA  . PHE A 1 118 ? 29.232 5.328   13.270 1.00 23.98 ? 118 PHE L CA  1 
ATOM   901  C  C   . PHE A 1 118 ? 28.031 4.403   13.346 1.00 24.62 ? 118 PHE L C   1 
ATOM   902  O  O   . PHE A 1 118 ? 27.138 4.654   14.147 1.00 24.74 ? 118 PHE L O   1 
ATOM   903  C  CB  . PHE A 1 118 ? 30.017 5.168   14.578 1.00 23.70 ? 118 PHE L CB  1 
ATOM   904  C  CG  . PHE A 1 118 ? 31.165 6.110   14.721 1.00 22.90 ? 118 PHE L CG  1 
ATOM   905  C  CD1 . PHE A 1 118 ? 30.998 7.329   15.379 1.00 21.39 ? 118 PHE L CD1 1 
ATOM   906  C  CD2 . PHE A 1 118 ? 32.421 5.773   14.210 1.00 21.88 ? 118 PHE L CD2 1 
ATOM   907  C  CE1 . PHE A 1 118 ? 32.054 8.203   15.518 1.00 22.22 ? 118 PHE L CE1 1 
ATOM   908  C  CE2 . PHE A 1 118 ? 33.487 6.635   14.348 1.00 22.75 ? 118 PHE L CE2 1 
ATOM   909  C  CZ  . PHE A 1 118 ? 33.305 7.865   14.999 1.00 23.37 ? 118 PHE L CZ  1 
ATOM   910  N  N   . PRO A 1 119 ? 28.011 3.324   12.530 1.00 25.23 ? 119 PRO L N   1 
ATOM   911  C  CA  . PRO A 1 119 ? 26.968 2.304   12.694 1.00 25.68 ? 119 PRO L CA  1 
ATOM   912  C  C   . PRO A 1 119 ? 27.213 1.456   13.946 1.00 26.53 ? 119 PRO L C   1 
ATOM   913  O  O   . PRO A 1 119 ? 28.340 1.431   14.459 1.00 26.43 ? 119 PRO L O   1 
ATOM   914  C  CB  . PRO A 1 119 ? 27.110 1.414   11.438 1.00 25.59 ? 119 PRO L CB  1 
ATOM   915  C  CG  . PRO A 1 119 ? 28.235 1.980   10.615 1.00 25.96 ? 119 PRO L CG  1 
ATOM   916  C  CD  . PRO A 1 119 ? 28.969 2.995   11.455 1.00 25.18 ? 119 PRO L CD  1 
ATOM   917  N  N   . PRO A 1 120 ? 26.185 0.724   14.417 1.00 27.51 ? 120 PRO L N   1 
ATOM   918  C  CA  . PRO A 1 120 ? 26.443 -0.231  15.493 1.00 28.57 ? 120 PRO L CA  1 
ATOM   919  C  C   . PRO A 1 120 ? 27.437 -1.307  15.046 1.00 29.69 ? 120 PRO L C   1 
ATOM   920  O  O   . PRO A 1 120 ? 27.575 -1.563  13.842 1.00 29.55 ? 120 PRO L O   1 
ATOM   921  C  CB  . PRO A 1 120 ? 25.058 -0.856  15.765 1.00 28.43 ? 120 PRO L CB  1 
ATOM   922  C  CG  . PRO A 1 120 ? 24.245 -0.567  14.584 1.00 27.81 ? 120 PRO L CG  1 
ATOM   923  C  CD  . PRO A 1 120 ? 24.771 0.709   13.990 1.00 27.71 ? 120 PRO L CD  1 
ATOM   924  N  N   . SER A 1 121 ? 28.142 -1.903  16.002 1.00 30.92 ? 121 SER L N   1 
ATOM   925  C  CA  . SER A 1 121 ? 29.099 -2.971  15.699 1.00 32.54 ? 121 SER L CA  1 
ATOM   926  C  C   . SER A 1 121 ? 28.356 -4.299  15.549 1.00 33.99 ? 121 SER L C   1 
ATOM   927  O  O   . SER A 1 121 ? 27.231 -4.448  16.040 1.00 34.23 ? 121 SER L O   1 
ATOM   928  C  CB  . SER A 1 121 ? 30.155 -3.073  16.802 1.00 32.02 ? 121 SER L CB  1 
ATOM   929  O  OG  . SER A 1 121 ? 29.588 -3.526  18.019 1.00 31.94 ? 121 SER L OG  1 
ATOM   930  N  N   . ASP A 1 122 ? 28.971 -5.266  14.873 1.00 35.91 ? 122 ASP L N   1 
ATOM   931  C  CA  . ASP A 1 122 ? 28.363 -6.599  14.761 1.00 37.52 ? 122 ASP L CA  1 
ATOM   932  C  C   . ASP A 1 122 ? 28.319 -7.320  16.095 1.00 38.26 ? 122 ASP L C   1 
ATOM   933  O  O   . ASP A 1 122 ? 27.377 -8.075  16.370 1.00 38.50 ? 122 ASP L O   1 
ATOM   934  C  CB  . ASP A 1 122 ? 29.062 -7.443  13.700 1.00 37.69 ? 122 ASP L CB  1 
ATOM   935  C  CG  . ASP A 1 122 ? 28.720 -6.998  12.306 1.00 38.45 ? 122 ASP L CG  1 
ATOM   936  O  OD1 . ASP A 1 122 ? 27.554 -6.597  12.082 1.00 39.61 ? 122 ASP L OD1 1 
ATOM   937  O  OD2 . ASP A 1 122 ? 29.615 -7.041  11.436 1.00 39.07 ? 122 ASP L OD2 1 
ATOM   938  N  N   . GLU A 1 123 ? 29.329 -7.060  16.923 1.00 39.43 ? 123 GLU L N   1 
ATOM   939  C  CA  . GLU A 1 123 ? 29.378 -7.550  18.305 1.00 40.63 ? 123 GLU L CA  1 
ATOM   940  C  C   . GLU A 1 123 ? 28.148 -7.119  19.131 1.00 40.30 ? 123 GLU L C   1 
ATOM   941  O  O   . GLU A 1 123 ? 27.608 -7.923  19.898 1.00 40.83 ? 123 GLU L O   1 
ATOM   942  C  CB  . GLU A 1 123 ? 30.687 -7.096  18.983 1.00 40.83 ? 123 GLU L CB  1 
ATOM   943  C  CG  . GLU A 1 123 ? 31.009 -7.790  20.333 1.00 42.20 ? 123 GLU L CG  1 
ATOM   944  C  CD  . GLU A 1 123 ? 32.092 -7.063  21.150 1.00 42.66 ? 123 GLU L CD  1 
ATOM   945  O  OE1 . GLU A 1 123 ? 32.299 -7.422  22.336 1.00 44.55 ? 123 GLU L OE1 1 
ATOM   946  O  OE2 . GLU A 1 123 ? 32.735 -6.126  20.617 1.00 45.30 ? 123 GLU L OE2 1 
ATOM   947  N  N   . GLN A 1 124 ? 27.709 -5.866  18.976 1.00 39.98 ? 124 GLN L N   1 
ATOM   948  C  CA  . GLN A 1 124 ? 26.553 -5.351  19.723 1.00 39.37 ? 124 GLN L CA  1 
ATOM   949  C  C   . GLN A 1 124 ? 25.226 -5.894  19.201 1.00 40.72 ? 124 GLN L C   1 
ATOM   950  O  O   . GLN A 1 124 ? 24.325 -6.202  19.987 1.00 41.01 ? 124 GLN L O   1 
ATOM   951  C  CB  . GLN A 1 124 ? 26.513 -3.810  19.756 1.00 39.09 ? 124 GLN L CB  1 
ATOM   952  C  CG  . GLN A 1 124 ? 25.355 -3.257  20.604 1.00 37.55 ? 124 GLN L CG  1 
ATOM   953  C  CD  . GLN A 1 124 ? 25.128 -1.752  20.494 1.00 36.69 ? 124 GLN L CD  1 
ATOM   954  O  OE1 . GLN A 1 124 ? 25.479 -1.122  19.500 1.00 33.88 ? 124 GLN L OE1 1 
ATOM   955  N  NE2 . GLN A 1 124 ? 24.516 -1.177  21.523 1.00 31.87 ? 124 GLN L NE2 1 
ATOM   956  N  N   . LEU A 1 125 ? 25.105 -6.002  17.881 1.00 41.74 ? 125 LEU L N   1 
ATOM   957  C  CA  . LEU A 1 125 ? 23.863 -6.463  17.257 1.00 42.70 ? 125 LEU L CA  1 
ATOM   958  C  C   . LEU A 1 125 ? 23.413 -7.841  17.734 1.00 43.40 ? 125 LEU L C   1 
ATOM   959  O  O   . LEU A 1 125 ? 22.216 -8.070  17.889 1.00 43.95 ? 125 LEU L O   1 
ATOM   960  C  CB  . LEU A 1 125 ? 23.953 -6.407  15.728 1.00 42.63 ? 125 LEU L CB  1 
ATOM   961  C  CG  . LEU A 1 125 ? 23.798 -4.995  15.144 1.00 42.35 ? 125 LEU L CG  1 
ATOM   962  C  CD1 . LEU A 1 125 ? 24.372 -4.915  13.736 1.00 42.11 ? 125 LEU L CD1 1 
ATOM   963  C  CD2 . LEU A 1 125 ? 22.337 -4.545  15.176 1.00 42.28 ? 125 LEU L CD2 1 
ATOM   964  N  N   . LYS A 1 126 ? 24.359 -8.740  17.998 1.00 44.19 ? 126 LYS L N   1 
ATOM   965  C  CA  . LYS A 1 126 ? 24.034 -10.069 18.566 1.00 44.78 ? 126 LYS L CA  1 
ATOM   966  C  C   . LYS A 1 126 ? 23.283 -9.988  19.907 1.00 44.40 ? 126 LYS L C   1 
ATOM   967  O  O   . LYS A 1 126 ? 22.447 -10.851 20.216 1.00 44.64 ? 126 LYS L O   1 
ATOM   968  C  CB  . LYS A 1 126 ? 25.292 -10.937 18.715 1.00 44.93 ? 126 LYS L CB  1 
ATOM   969  C  CG  . LYS A 1 126 ? 26.140 -11.046 17.441 1.00 45.45 ? 126 LYS L CG  1 
ATOM   970  C  CD  . LYS A 1 126 ? 27.099 -12.248 17.454 1.00 46.32 ? 126 LYS L CD  1 
ATOM   971  C  CE  . LYS A 1 126 ? 28.065 -12.258 18.649 1.00 47.04 ? 126 LYS L CE  1 
ATOM   972  N  NZ  . LYS A 1 126 ? 28.725 -10.936 18.906 1.00 50.23 ? 126 LYS L NZ  1 
ATOM   973  N  N   . SER A 1 127 ? 23.575 -8.949  20.689 1.00 43.62 ? 127 SER L N   1 
ATOM   974  C  CA  . SER A 1 127 ? 22.919 -8.740  21.979 1.00 42.84 ? 127 SER L CA  1 
ATOM   975  C  C   . SER A 1 127 ? 21.492 -8.189  21.827 1.00 41.94 ? 127 SER L C   1 
ATOM   976  O  O   . SER A 1 127 ? 20.739 -8.127  22.805 1.00 42.08 ? 127 SER L O   1 
ATOM   977  C  CB  . SER A 1 127 ? 23.764 -7.819  22.882 1.00 43.12 ? 127 SER L CB  1 
ATOM   978  O  OG  . SER A 1 127 ? 25.141 -8.184  22.863 1.00 43.85 ? 127 SER L OG  1 
ATOM   979  N  N   . GLY A 1 128 ? 21.132 -7.773  20.612 1.00 40.69 ? 128 GLY L N   1 
ATOM   980  C  CA  . GLY A 1 128 ? 19.769 -7.320  20.313 1.00 39.19 ? 128 GLY L CA  1 
ATOM   981  C  C   . GLY A 1 128 ? 19.503 -5.834  20.467 1.00 38.00 ? 128 GLY L C   1 
ATOM   982  O  O   . GLY A 1 128 ? 18.353 -5.421  20.553 1.00 38.05 ? 128 GLY L O   1 
ATOM   983  N  N   . THR A 1 129 ? 20.568 -5.037  20.514 1.00 36.91 ? 129 THR L N   1 
ATOM   984  C  CA  . THR A 1 129 ? 20.478 -3.571  20.554 1.00 35.34 ? 129 THR L CA  1 
ATOM   985  C  C   . THR A 1 129 ? 21.459 -2.940  19.550 1.00 33.96 ? 129 THR L C   1 
ATOM   986  O  O   . THR A 1 129 ? 22.518 -3.501  19.244 1.00 33.04 ? 129 THR L O   1 
ATOM   987  C  CB  . THR A 1 129 ? 20.661 -2.996  21.993 1.00 35.62 ? 129 THR L CB  1 
ATOM   988  O  OG1 . THR A 1 129 ? 19.659 -3.542  22.859 1.00 36.03 ? 129 THR L OG1 1 
ATOM   989  C  CG2 . THR A 1 129 ? 20.528 -1.464  22.026 1.00 35.76 ? 129 THR L CG2 1 
ATOM   990  N  N   . ALA A 1 130 ? 21.053 -1.785  19.023 1.00 32.49 ? 130 ALA L N   1 
ATOM   991  C  CA  . ALA A 1 130 ? 21.796 -1.042  18.026 1.00 30.84 ? 130 ALA L CA  1 
ATOM   992  C  C   . ALA A 1 130 ? 21.989 0.385   18.524 1.00 30.10 ? 130 ALA L C   1 
ATOM   993  O  O   . ALA A 1 130 ? 21.016 1.126   18.701 1.00 30.00 ? 130 ALA L O   1 
ATOM   994  C  CB  . ALA A 1 130 ? 21.048 -1.033  16.720 1.00 30.47 ? 130 ALA L CB  1 
ATOM   995  N  N   . SER A 1 131 ? 23.246 0.757   18.758 1.00 28.59 ? 131 SER L N   1 
ATOM   996  C  CA  . SER A 1 131 ? 23.589 2.130   19.065 1.00 27.26 ? 131 SER L CA  1 
ATOM   997  C  C   . SER A 1 131 ? 24.239 2.774   17.851 1.00 26.22 ? 131 SER L C   1 
ATOM   998  O  O   . SER A 1 131 ? 25.270 2.325   17.366 1.00 26.28 ? 131 SER L O   1 
ATOM   999  C  CB  . SER A 1 131 ? 24.518 2.198   20.281 1.00 27.28 ? 131 SER L CB  1 
ATOM   1000 O  OG  . SER A 1 131 ? 23.946 1.553   21.412 1.00 26.52 ? 131 SER L OG  1 
ATOM   1001 N  N   . VAL A 1 132 ? 23.611 3.819   17.346 1.00 25.42 ? 132 VAL L N   1 
ATOM   1002 C  CA  . VAL A 1 132 ? 24.158 4.582   16.233 1.00 24.75 ? 132 VAL L CA  1 
ATOM   1003 C  C   . VAL A 1 132 ? 24.713 5.856   16.853 1.00 23.98 ? 132 VAL L C   1 
ATOM   1004 O  O   . VAL A 1 132 ? 23.995 6.548   17.584 1.00 23.86 ? 132 VAL L O   1 
ATOM   1005 C  CB  . VAL A 1 132 ? 23.071 4.958   15.170 1.00 24.52 ? 132 VAL L CB  1 
ATOM   1006 C  CG1 . VAL A 1 132 ? 23.720 5.175   13.807 1.00 25.09 ? 132 VAL L CG1 1 
ATOM   1007 C  CG2 . VAL A 1 132 ? 21.992 3.905   15.079 1.00 25.00 ? 132 VAL L CG2 1 
ATOM   1008 N  N   . VAL A 1 133 ? 25.978 6.164   16.577 1.00 23.39 ? 133 VAL L N   1 
ATOM   1009 C  CA  . VAL A 1 133 ? 26.625 7.314   17.207 1.00 22.98 ? 133 VAL L CA  1 
ATOM   1010 C  C   . VAL A 1 133 ? 26.970 8.387   16.181 1.00 22.98 ? 133 VAL L C   1 
ATOM   1011 O  O   . VAL A 1 133 ? 27.417 8.088   15.071 1.00 22.79 ? 133 VAL L O   1 
ATOM   1012 C  CB  . VAL A 1 133 ? 27.881 6.910   18.100 1.00 22.92 ? 133 VAL L CB  1 
ATOM   1013 C  CG1 . VAL A 1 133 ? 28.469 8.102   18.791 1.00 21.14 ? 133 VAL L CG1 1 
ATOM   1014 C  CG2 . VAL A 1 133 ? 27.495 5.869   19.160 1.00 23.13 ? 133 VAL L CG2 1 
ATOM   1015 N  N   . CYS A 1 134 ? 26.698 9.637   16.558 1.00 23.19 ? 134 CYS L N   1 
ATOM   1016 C  CA  . CYS A 1 134 ? 27.082 10.794  15.772 1.00 22.90 ? 134 CYS L CA  1 
ATOM   1017 C  C   . CYS A 1 134 ? 28.021 11.682  16.588 1.00 22.31 ? 134 CYS L C   1 
ATOM   1018 O  O   . CYS A 1 134 ? 27.727 12.041  17.726 1.00 22.12 ? 134 CYS L O   1 
ATOM   1019 C  CB  . CYS A 1 134 ? 25.873 11.580  15.299 1.00 22.97 ? 134 CYS L CB  1 
ATOM   1020 S  SG  . CYS A 1 134 ? 26.319 12.886  14.130 1.00 24.53 ? 134 CYS L SG  1 
ATOM   1021 N  N   . LEU A 1 135 ? 29.160 12.014  15.984 1.00 21.95 ? 135 LEU L N   1 
ATOM   1022 C  CA  . LEU A 1 135 ? 30.183 12.828  16.616 1.00 21.34 ? 135 LEU L CA  1 
ATOM   1023 C  C   . LEU A 1 135 ? 30.292 14.192  15.949 1.00 21.50 ? 135 LEU L C   1 
ATOM   1024 O  O   . LEU A 1 135 ? 30.444 14.289  14.722 1.00 21.54 ? 135 LEU L O   1 
ATOM   1025 C  CB  . LEU A 1 135 ? 31.540 12.116  16.562 1.00 21.17 ? 135 LEU L CB  1 
ATOM   1026 C  CG  . LEU A 1 135 ? 32.786 12.899  17.022 1.00 20.89 ? 135 LEU L CG  1 
ATOM   1027 C  CD1 . LEU A 1 135 ? 32.732 13.291  18.519 1.00 18.63 ? 135 LEU L CD1 1 
ATOM   1028 C  CD2 . LEU A 1 135 ? 34.061 12.133  16.697 1.00 20.85 ? 135 LEU L CD2 1 
ATOM   1029 N  N   . LEU A 1 136 ? 30.195 15.246  16.755 1.00 21.24 ? 136 LEU L N   1 
ATOM   1030 C  CA  . LEU A 1 136 ? 30.606 16.564  16.301 1.00 21.27 ? 136 LEU L CA  1 
ATOM   1031 C  C   . LEU A 1 136 ? 31.905 16.907  17.033 1.00 21.32 ? 136 LEU L C   1 
ATOM   1032 O  O   . LEU A 1 136 ? 31.972 16.838  18.259 1.00 21.06 ? 136 LEU L O   1 
ATOM   1033 C  CB  . LEU A 1 136 ? 29.551 17.644  16.573 1.00 21.40 ? 136 LEU L CB  1 
ATOM   1034 C  CG  . LEU A 1 136 ? 28.035 17.468  16.638 1.00 21.31 ? 136 LEU L CG  1 
ATOM   1035 C  CD1 . LEU A 1 136 ? 27.407 18.811  16.323 1.00 21.19 ? 136 LEU L CD1 1 
ATOM   1036 C  CD2 . LEU A 1 136 ? 27.474 16.358  15.750 1.00 19.99 ? 136 LEU L CD2 1 
ATOM   1037 N  N   . ASN A 1 137 ? 32.935 17.261  16.275 1.00 21.46 ? 137 ASN L N   1 
ATOM   1038 C  CA  . ASN A 1 137 ? 34.247 17.493  16.847 1.00 21.77 ? 137 ASN L CA  1 
ATOM   1039 C  C   . ASN A 1 137 ? 34.659 18.968  16.781 1.00 22.27 ? 137 ASN L C   1 
ATOM   1040 O  O   . ASN A 1 137 ? 34.507 19.617  15.736 1.00 22.56 ? 137 ASN L O   1 
ATOM   1041 C  CB  . ASN A 1 137 ? 35.260 16.590  16.138 1.00 22.20 ? 137 ASN L CB  1 
ATOM   1042 C  CG  . ASN A 1 137 ? 36.678 16.893  16.520 1.00 21.47 ? 137 ASN L CG  1 
ATOM   1043 O  OD1 . ASN A 1 137 ? 37.434 17.474  15.734 1.00 21.23 ? 137 ASN L OD1 1 
ATOM   1044 N  ND2 . ASN A 1 137 ? 37.050 16.522  17.734 1.00 20.21 ? 137 ASN L ND2 1 
ATOM   1045 N  N   . ASN A 1 138 ? 35.144 19.485  17.915 1.00 22.46 ? 138 ASN L N   1 
ATOM   1046 C  CA  . ASN A 1 138 ? 35.789 20.814  18.025 1.00 22.57 ? 138 ASN L CA  1 
ATOM   1047 C  C   . ASN A 1 138 ? 35.057 21.997  17.389 1.00 22.29 ? 138 ASN L C   1 
ATOM   1048 O  O   . ASN A 1 138 ? 35.518 22.577  16.412 1.00 22.02 ? 138 ASN L O   1 
ATOM   1049 C  CB  . ASN A 1 138 ? 37.275 20.772  17.598 1.00 23.18 ? 138 ASN L CB  1 
ATOM   1050 C  CG  . ASN A 1 138 ? 38.161 20.080  18.640 1.00 24.84 ? 138 ASN L CG  1 
ATOM   1051 O  OD1 . ASN A 1 138 ? 37.813 19.031  19.154 1.00 28.31 ? 138 ASN L OD1 1 
ATOM   1052 N  ND2 . ASN A 1 138 ? 39.303 20.672  18.950 1.00 26.42 ? 138 ASN L ND2 1 
ATOM   1053 N  N   . PHE A 1 139 ? 33.921 22.358  17.984 1.00 22.08 ? 139 PHE L N   1 
ATOM   1054 C  CA  . PHE A 1 139 ? 33.098 23.449  17.499 1.00 21.71 ? 139 PHE L CA  1 
ATOM   1055 C  C   . PHE A 1 139 ? 32.854 24.505  18.581 1.00 22.54 ? 139 PHE L C   1 
ATOM   1056 O  O   . PHE A 1 139 ? 32.935 24.218  19.782 1.00 22.69 ? 139 PHE L O   1 
ATOM   1057 C  CB  . PHE A 1 139 ? 31.768 22.916  16.943 1.00 20.72 ? 139 PHE L CB  1 
ATOM   1058 C  CG  . PHE A 1 139 ? 30.919 22.175  17.954 1.00 20.20 ? 139 PHE L CG  1 
ATOM   1059 C  CD1 . PHE A 1 139 ? 29.964 22.850  18.717 1.00 19.82 ? 139 PHE L CD1 1 
ATOM   1060 C  CD2 . PHE A 1 139 ? 31.060 20.792  18.135 1.00 18.21 ? 139 PHE L CD2 1 
ATOM   1061 C  CE1 . PHE A 1 139 ? 29.161 22.159  19.651 1.00 18.76 ? 139 PHE L CE1 1 
ATOM   1062 C  CE2 . PHE A 1 139 ? 30.282 20.100  19.071 1.00 16.49 ? 139 PHE L CE2 1 
ATOM   1063 C  CZ  . PHE A 1 139 ? 29.329 20.777  19.825 1.00 18.42 ? 139 PHE L CZ  1 
ATOM   1064 N  N   . TYR A 1 140 ? 32.543 25.716  18.129 1.00 23.13 ? 140 TYR L N   1 
ATOM   1065 C  CA  . TYR A 1 140 ? 32.122 26.814  18.981 1.00 23.94 ? 140 TYR L CA  1 
ATOM   1066 C  C   . TYR A 1 140 ? 31.109 27.687  18.208 1.00 25.13 ? 140 TYR L C   1 
ATOM   1067 O  O   . TYR A 1 140 ? 31.287 27.902  17.012 1.00 25.84 ? 140 TYR L O   1 
ATOM   1068 C  CB  . TYR A 1 140 ? 33.328 27.648  19.477 1.00 23.34 ? 140 TYR L CB  1 
ATOM   1069 C  CG  . TYR A 1 140 ? 32.869 28.652  20.492 1.00 22.64 ? 140 TYR L CG  1 
ATOM   1070 C  CD1 . TYR A 1 140 ? 32.741 28.302  21.836 1.00 21.19 ? 140 TYR L CD1 1 
ATOM   1071 C  CD2 . TYR A 1 140 ? 32.476 29.931  20.094 1.00 21.60 ? 140 TYR L CD2 1 
ATOM   1072 C  CE1 . TYR A 1 140 ? 32.251 29.226  22.753 1.00 22.23 ? 140 TYR L CE1 1 
ATOM   1073 C  CE2 . TYR A 1 140 ? 31.994 30.845  20.992 1.00 20.22 ? 140 TYR L CE2 1 
ATOM   1074 C  CZ  . TYR A 1 140 ? 31.880 30.500  22.308 1.00 21.62 ? 140 TYR L CZ  1 
ATOM   1075 O  OH  . TYR A 1 140 ? 31.389 31.430  23.174 1.00 22.17 ? 140 TYR L OH  1 
ATOM   1076 N  N   . PRO A 1 141 ? 30.026 28.167  18.865 1.00 26.02 ? 141 PRO L N   1 
ATOM   1077 C  CA  . PRO A 1 141 ? 29.599 28.009  20.265 1.00 26.93 ? 141 PRO L CA  1 
ATOM   1078 C  C   . PRO A 1 141 ? 29.014 26.633  20.564 1.00 28.12 ? 141 PRO L C   1 
ATOM   1079 O  O   . PRO A 1 141 ? 28.821 25.831  19.642 1.00 27.42 ? 141 PRO L O   1 
ATOM   1080 C  CB  . PRO A 1 141 ? 28.524 29.086  20.421 1.00 26.64 ? 141 PRO L CB  1 
ATOM   1081 C  CG  . PRO A 1 141 ? 27.928 29.203  19.082 1.00 26.28 ? 141 PRO L CG  1 
ATOM   1082 C  CD  . PRO A 1 141 ? 29.070 28.998  18.108 1.00 25.92 ? 141 PRO L CD  1 
ATOM   1083 N  N   . ARG A 1 142 ? 28.757 26.373  21.851 1.00 30.07 ? 142 ARG L N   1 
ATOM   1084 C  CA  . ARG A 1 142 ? 28.163 25.107  22.327 1.00 32.16 ? 142 ARG L CA  1 
ATOM   1085 C  C   . ARG A 1 142 ? 26.839 24.765  21.640 1.00 32.42 ? 142 ARG L C   1 
ATOM   1086 O  O   . ARG A 1 142 ? 26.551 23.588  21.413 1.00 32.83 ? 142 ARG L O   1 
ATOM   1087 C  CB  . ARG A 1 142 ? 27.984 25.097  23.861 1.00 31.95 ? 142 ARG L CB  1 
ATOM   1088 C  CG  . ARG A 1 142 ? 27.713 23.685  24.434 1.00 33.47 ? 142 ARG L CG  1 
ATOM   1089 C  CD  . ARG A 1 142 ? 27.476 23.659  25.962 1.00 34.51 ? 142 ARG L CD  1 
ATOM   1090 N  NE  . ARG A 1 142 ? 28.642 23.158  26.685 1.00 37.59 ? 142 ARG L NE  1 
ATOM   1091 C  CZ  . ARG A 1 142 ? 28.595 22.335  27.737 1.00 43.08 ? 142 ARG L CZ  1 
ATOM   1092 N  NH1 . ARG A 1 142 ? 27.410 21.917  28.204 1.00 43.39 ? 142 ARG L NH1 1 
ATOM   1093 N  NH2 . ARG A 1 142 ? 29.733 21.914  28.319 1.00 40.30 ? 142 ARG L NH2 1 
ATOM   1094 N  N   . GLU A 1 143 ? 26.048 25.783  21.308 1.00 33.07 ? 143 GLU L N   1 
ATOM   1095 C  CA  . GLU A 1 143 ? 24.753 25.582  20.648 1.00 34.23 ? 143 GLU L CA  1 
ATOM   1096 C  C   . GLU A 1 143 ? 24.877 24.836  19.313 1.00 33.62 ? 143 GLU L C   1 
ATOM   1097 O  O   . GLU A 1 143 ? 25.472 25.342  18.351 1.00 33.61 ? 143 GLU L O   1 
ATOM   1098 C  CB  . GLU A 1 143 ? 24.040 26.922  20.424 1.00 34.34 ? 143 GLU L CB  1 
ATOM   1099 C  CG  . GLU A 1 143 ? 22.628 26.777  19.803 1.00 36.09 ? 143 GLU L CG  1 
ATOM   1100 C  CD  . GLU A 1 143 ? 22.113 28.042  19.112 1.00 36.84 ? 143 GLU L CD  1 
ATOM   1101 O  OE1 . GLU A 1 143 ? 21.405 27.905  18.082 1.00 39.21 ? 143 GLU L OE1 1 
ATOM   1102 O  OE2 . GLU A 1 143 ? 22.398 29.169  19.602 1.00 40.68 ? 143 GLU L OE2 1 
ATOM   1103 N  N   . ALA A 1 144 ? 24.306 23.636  19.266 1.00 33.32 ? 144 ALA L N   1 
ATOM   1104 C  CA  . ALA A 1 144 ? 24.162 22.868  18.019 1.00 32.90 ? 144 ALA L CA  1 
ATOM   1105 C  C   . ALA A 1 144 ? 22.819 22.119  17.975 1.00 32.75 ? 144 ALA L C   1 
ATOM   1106 O  O   . ALA A 1 144 ? 22.310 21.689  19.008 1.00 32.41 ? 144 ALA L O   1 
ATOM   1107 C  CB  . ALA A 1 144 ? 25.319 21.892  17.858 1.00 32.73 ? 144 ALA L CB  1 
ATOM   1108 N  N   . LYS A 1 145 ? 22.237 21.999  16.784 1.00 32.63 ? 145 LYS L N   1 
ATOM   1109 C  CA  . LYS A 1 145 ? 21.083 21.117  16.567 1.00 32.68 ? 145 LYS L CA  1 
ATOM   1110 C  C   . LYS A 1 145 ? 21.527 19.859  15.811 1.00 31.96 ? 145 LYS L C   1 
ATOM   1111 O  O   . LYS A 1 145 ? 21.961 19.922  14.659 1.00 31.46 ? 145 LYS L O   1 
ATOM   1112 C  CB  . LYS A 1 145 ? 19.932 21.829  15.833 1.00 32.64 ? 145 LYS L CB  1 
ATOM   1113 C  CG  . LYS A 1 145 ? 18.619 21.007  15.783 1.00 33.96 ? 145 LYS L CG  1 
ATOM   1114 C  CD  . LYS A 1 145 ? 17.415 21.808  15.213 1.00 34.30 ? 145 LYS L CD  1 
ATOM   1115 C  CE  . LYS A 1 145 ? 17.438 21.919  13.682 1.00 35.89 ? 145 LYS L CE  1 
ATOM   1116 N  NZ  . LYS A 1 145 ? 16.463 22.937  13.183 1.00 36.46 ? 145 LYS L NZ  1 
ATOM   1117 N  N   . VAL A 1 146 ? 21.447 18.721  16.486 1.00 31.48 ? 146 VAL L N   1 
ATOM   1118 C  CA  . VAL A 1 146 ? 21.743 17.459  15.839 1.00 31.18 ? 146 VAL L CA  1 
ATOM   1119 C  C   . VAL A 1 146 ? 20.514 16.546  15.814 1.00 30.66 ? 146 VAL L C   1 
ATOM   1120 O  O   . VAL A 1 146 ? 19.979 16.123  16.844 1.00 30.47 ? 146 VAL L O   1 
ATOM   1121 C  CB  . VAL A 1 146 ? 23.118 16.827  16.294 1.00 31.07 ? 146 VAL L CB  1 
ATOM   1122 C  CG1 . VAL A 1 146 ? 23.662 17.491  17.532 1.00 31.50 ? 146 VAL L CG1 1 
ATOM   1123 C  CG2 . VAL A 1 146 ? 23.065 15.313  16.404 1.00 31.74 ? 146 VAL L CG2 1 
ATOM   1124 N  N   . GLN A 1 147 ? 20.057 16.288  14.596 1.00 30.17 ? 147 GLN L N   1 
ATOM   1125 C  CA  . GLN A 1 147 ? 18.864 15.501  14.359 1.00 29.55 ? 147 GLN L CA  1 
ATOM   1126 C  C   . GLN A 1 147 ? 19.225 14.198  13.676 1.00 29.22 ? 147 GLN L C   1 
ATOM   1127 O  O   . GLN A 1 147 ? 20.152 14.157  12.854 1.00 29.01 ? 147 GLN L O   1 
ATOM   1128 C  CB  . GLN A 1 147 ? 17.888 16.290  13.498 1.00 29.53 ? 147 GLN L CB  1 
ATOM   1129 C  CG  . GLN A 1 147 ? 17.531 17.644  14.092 1.00 29.93 ? 147 GLN L CG  1 
ATOM   1130 C  CD  . GLN A 1 147 ? 16.454 18.364  13.321 1.00 31.02 ? 147 GLN L CD  1 
ATOM   1131 O  OE1 . GLN A 1 147 ? 16.592 18.630  12.131 1.00 31.30 ? 147 GLN L OE1 1 
ATOM   1132 N  NE2 . GLN A 1 147 ? 15.366 18.689  14.004 1.00 33.00 ? 147 GLN L NE2 1 
ATOM   1133 N  N   . TRP A 1 148 ? 18.489 13.143  14.031 1.00 28.55 ? 148 TRP L N   1 
ATOM   1134 C  CA  . TRP A 1 148 ? 18.593 11.856  13.373 1.00 28.22 ? 148 TRP L CA  1 
ATOM   1135 C  C   . TRP A 1 148 ? 17.470 11.639  12.366 1.00 28.22 ? 148 TRP L C   1 
ATOM   1136 O  O   . TRP A 1 148 ? 16.303 11.932  12.635 1.00 28.41 ? 148 TRP L O   1 
ATOM   1137 C  CB  . TRP A 1 148 ? 18.572 10.719  14.386 1.00 27.91 ? 148 TRP L CB  1 
ATOM   1138 C  CG  . TRP A 1 148 ? 19.779 10.644  15.238 1.00 27.87 ? 148 TRP L CG  1 
ATOM   1139 C  CD1 . TRP A 1 148 ? 19.952 11.217  16.468 1.00 27.48 ? 148 TRP L CD1 1 
ATOM   1140 C  CD2 . TRP A 1 148 ? 20.991 9.932   14.948 1.00 27.60 ? 148 TRP L CD2 1 
ATOM   1141 N  NE1 . TRP A 1 148 ? 21.199 10.909  16.964 1.00 27.71 ? 148 TRP L NE1 1 
ATOM   1142 C  CE2 . TRP A 1 148 ? 21.858 10.119  16.053 1.00 28.02 ? 148 TRP L CE2 1 
ATOM   1143 C  CE3 . TRP A 1 148 ? 21.427 9.146   13.864 1.00 26.98 ? 148 TRP L CE3 1 
ATOM   1144 C  CZ2 . TRP A 1 148 ? 23.139 9.558   16.104 1.00 27.27 ? 148 TRP L CZ2 1 
ATOM   1145 C  CZ3 . TRP A 1 148 ? 22.698 8.591   13.915 1.00 28.09 ? 148 TRP L CZ3 1 
ATOM   1146 C  CH2 . TRP A 1 148 ? 23.543 8.802   15.029 1.00 27.58 ? 148 TRP L CH2 1 
ATOM   1147 N  N   . LYS A 1 149 ? 17.834 11.111  11.205 1.00 27.88 ? 149 LYS L N   1 
ATOM   1148 C  CA  . LYS A 1 149 ? 16.865 10.721  10.197 1.00 27.36 ? 149 LYS L CA  1 
ATOM   1149 C  C   . LYS A 1 149 ? 17.093 9.265   9.877  1.00 27.16 ? 149 LYS L C   1 
ATOM   1150 O  O   . LYS A 1 149 ? 18.239 8.826   9.716  1.00 27.40 ? 149 LYS L O   1 
ATOM   1151 C  CB  . LYS A 1 149 ? 16.995 11.582  8.948  1.00 27.42 ? 149 LYS L CB  1 
ATOM   1152 C  CG  . LYS A 1 149 ? 16.076 12.772  8.971  1.00 28.31 ? 149 LYS L CG  1 
ATOM   1153 C  CD  . LYS A 1 149 ? 16.613 13.946  8.183  1.00 29.58 ? 149 LYS L CD  1 
ATOM   1154 C  CE  . LYS A 1 149 ? 15.815 15.203  8.527  1.00 30.75 ? 149 LYS L CE  1 
ATOM   1155 N  NZ  . LYS A 1 149 ? 16.154 16.366  7.639  1.00 32.50 ? 149 LYS L NZ  1 
ATOM   1156 N  N   . VAL A 1 150 ? 16.007 8.506   9.836  1.00 26.70 ? 150 VAL L N   1 
ATOM   1157 C  CA  . VAL A 1 150 ? 16.076 7.084   9.497  1.00 26.40 ? 150 VAL L CA  1 
ATOM   1158 C  C   . VAL A 1 150 ? 15.118 6.866   8.326  1.00 26.45 ? 150 VAL L C   1 
ATOM   1159 O  O   . VAL A 1 150 ? 13.926 7.106   8.447  1.00 26.09 ? 150 VAL L O   1 
ATOM   1160 C  CB  . VAL A 1 150 ? 15.749 6.186   10.733 1.00 26.22 ? 150 VAL L CB  1 
ATOM   1161 C  CG1 . VAL A 1 150 ? 15.818 4.729   10.387 1.00 24.81 ? 150 VAL L CG1 1 
ATOM   1162 C  CG2 . VAL A 1 150 ? 16.710 6.499   11.891 1.00 25.91 ? 150 VAL L CG2 1 
ATOM   1163 N  N   . ASP A 1 151 ? 15.665 6.441   7.185  1.00 26.86 ? 151 ASP L N   1 
ATOM   1164 C  CA  . ASP A 1 151 ? 14.924 6.402   5.920  1.00 27.50 ? 151 ASP L CA  1 
ATOM   1165 C  C   . ASP A 1 151 ? 14.316 7.783   5.658  1.00 28.05 ? 151 ASP L C   1 
ATOM   1166 O  O   . ASP A 1 151 ? 13.179 7.910   5.201  1.00 28.06 ? 151 ASP L O   1 
ATOM   1167 C  CB  . ASP A 1 151 ? 13.869 5.272   5.910  1.00 27.11 ? 151 ASP L CB  1 
ATOM   1168 C  CG  . ASP A 1 151 ? 14.501 3.893   5.926  1.00 26.65 ? 151 ASP L CG  1 
ATOM   1169 O  OD1 . ASP A 1 151 ? 15.641 3.771   5.466  1.00 24.67 ? 151 ASP L OD1 1 
ATOM   1170 O  OD2 . ASP A 1 151 ? 13.873 2.925   6.407  1.00 28.77 ? 151 ASP L OD2 1 
ATOM   1171 N  N   . ASN A 1 152 ? 15.103 8.807   5.984  1.00 28.95 ? 152 ASN L N   1 
ATOM   1172 C  CA  . ASN A 1 152 ? 14.736 10.224  5.816  1.00 30.05 ? 152 ASN L CA  1 
ATOM   1173 C  C   . ASN A 1 152 ? 13.649 10.845  6.708  1.00 29.58 ? 152 ASN L C   1 
ATOM   1174 O  O   . ASN A 1 152 ? 13.219 11.987  6.463  1.00 29.84 ? 152 ASN L O   1 
ATOM   1175 C  CB  . ASN A 1 152 ? 14.457 10.537  4.349  1.00 30.80 ? 152 ASN L CB  1 
ATOM   1176 C  CG  . ASN A 1 152 ? 15.487 11.453  3.772  1.00 33.65 ? 152 ASN L CG  1 
ATOM   1177 O  OD1 . ASN A 1 152 ? 16.328 11.031  2.965  1.00 37.53 ? 152 ASN L OD1 1 
ATOM   1178 N  ND2 . ASN A 1 152 ? 15.465 12.719  4.209  1.00 34.96 ? 152 ASN L ND2 1 
ATOM   1179 N  N   . ALA A 1 153 ? 13.223 10.114  7.737  1.00 28.83 ? 153 ALA L N   1 
ATOM   1180 C  CA  . ALA A 1 153 ? 12.174 10.591  8.630  1.00 28.13 ? 153 ALA L CA  1 
ATOM   1181 C  C   . ALA A 1 153 ? 12.811 11.027  9.937  1.00 28.00 ? 153 ALA L C   1 
ATOM   1182 O  O   . ALA A 1 153 ? 13.560 10.252  10.565 1.00 27.82 ? 153 ALA L O   1 
ATOM   1183 C  CB  . ALA A 1 153 ? 11.140 9.500   8.868  1.00 28.10 ? 153 ALA L CB  1 
ATOM   1184 N  N   . LEU A 1 154 ? 12.537 12.279  10.319 1.00 27.44 ? 154 LEU L N   1 
ATOM   1185 C  CA  . LEU A 1 154 ? 13.094 12.892  11.512 1.00 27.14 ? 154 LEU L CA  1 
ATOM   1186 C  C   . LEU A 1 154 ? 12.686 12.095  12.754 1.00 26.24 ? 154 LEU L C   1 
ATOM   1187 O  O   . LEU A 1 154 ? 11.525 11.733  12.915 1.00 25.60 ? 154 LEU L O   1 
ATOM   1188 C  CB  . LEU A 1 154 ? 12.625 14.351  11.594 1.00 27.53 ? 154 LEU L CB  1 
ATOM   1189 C  CG  . LEU A 1 154 ? 12.806 15.239  12.826 1.00 28.37 ? 154 LEU L CG  1 
ATOM   1190 C  CD1 . LEU A 1 154 ? 14.279 15.450  13.185 1.00 30.49 ? 154 LEU L CD1 1 
ATOM   1191 C  CD2 . LEU A 1 154 ? 12.124 16.564  12.583 1.00 28.07 ? 154 LEU L CD2 1 
ATOM   1192 N  N   . GLN A 1 155 ? 13.660 11.802  13.605 1.00 25.93 ? 155 GLN L N   1 
ATOM   1193 C  CA  . GLN A 1 155 ? 13.422 11.013  14.814 1.00 25.83 ? 155 GLN L CA  1 
ATOM   1194 C  C   . GLN A 1 155 ? 13.169 11.892  16.028 1.00 26.19 ? 155 GLN L C   1 
ATOM   1195 O  O   . GLN A 1 155 ? 13.593 13.054  16.076 1.00 25.82 ? 155 GLN L O   1 
ATOM   1196 C  CB  . GLN A 1 155 ? 14.569 10.037  15.101 1.00 25.47 ? 155 GLN L CB  1 
ATOM   1197 C  CG  . GLN A 1 155 ? 14.852 9.033   13.992 1.00 24.27 ? 155 GLN L CG  1 
ATOM   1198 C  CD  . GLN A 1 155 ? 13.716 8.029   13.796 1.00 24.29 ? 155 GLN L CD  1 
ATOM   1199 O  OE1 . GLN A 1 155 ? 13.462 7.189   14.664 1.00 25.15 ? 155 GLN L OE1 1 
ATOM   1200 N  NE2 . GLN A 1 155 ? 13.037 8.109   12.652 1.00 21.61 ? 155 GLN L NE2 1 
ATOM   1201 N  N   . SER A 1 156 ? 12.484 11.305  17.007 1.00 26.62 ? 156 SER L N   1 
ATOM   1202 C  CA  . SER A 1 156 ? 12.019 12.000  18.186 1.00 27.25 ? 156 SER L CA  1 
ATOM   1203 C  C   . SER A 1 156 ? 12.046 11.044  19.377 1.00 27.64 ? 156 SER L C   1 
ATOM   1204 O  O   . SER A 1 156 ? 11.532 9.915   19.300 1.00 28.06 ? 156 SER L O   1 
ATOM   1205 C  CB  . SER A 1 156 ? 10.600 12.515  17.956 1.00 27.35 ? 156 SER L CB  1 
ATOM   1206 O  OG  . SER A 1 156 ? 10.189 13.356  19.019 1.00 28.46 ? 156 SER L OG  1 
ATOM   1207 N  N   . GLY A 1 157 ? 12.704 11.484  20.444 1.00 27.63 ? 157 GLY L N   1 
ATOM   1208 C  CA  . GLY A 1 157 ? 12.629 10.845  21.746 1.00 28.07 ? 157 GLY L CA  1 
ATOM   1209 C  C   . GLY A 1 157 ? 13.561 9.676   21.968 1.00 28.39 ? 157 GLY L C   1 
ATOM   1210 O  O   . GLY A 1 157 ? 13.632 9.155   23.080 1.00 28.42 ? 157 GLY L O   1 
ATOM   1211 N  N   . ASN A 1 158 ? 14.277 9.264   20.919 1.00 28.33 ? 158 ASN L N   1 
ATOM   1212 C  CA  . ASN A 1 158 ? 15.061 8.022   20.957 1.00 28.26 ? 158 ASN L CA  1 
ATOM   1213 C  C   . ASN A 1 158 ? 16.583 8.188   20.858 1.00 28.38 ? 158 ASN L C   1 
ATOM   1214 O  O   . ASN A 1 158 ? 17.298 7.244   20.499 1.00 28.23 ? 158 ASN L O   1 
ATOM   1215 C  CB  . ASN A 1 158 ? 14.534 6.978   19.944 1.00 27.90 ? 158 ASN L CB  1 
ATOM   1216 C  CG  . ASN A 1 158 ? 14.474 7.492   18.500 1.00 27.63 ? 158 ASN L CG  1 
ATOM   1217 O  OD1 . ASN A 1 158 ? 14.011 6.772   17.601 1.00 27.65 ? 158 ASN L OD1 1 
ATOM   1218 N  ND2 . ASN A 1 158 ? 14.935 8.715   18.265 1.00 25.87 ? 158 ASN L ND2 1 
ATOM   1219 N  N   . SER A 1 159 ? 17.060 9.394   21.160 1.00 28.24 ? 159 SER L N   1 
ATOM   1220 C  CA  . SER A 1 159 ? 18.485 9.674   21.222 1.00 28.46 ? 159 SER L CA  1 
ATOM   1221 C  C   . SER A 1 159 ? 18.833 10.523  22.441 1.00 28.73 ? 159 SER L C   1 
ATOM   1222 O  O   . SER A 1 159 ? 17.982 11.253  22.953 1.00 29.03 ? 159 SER L O   1 
ATOM   1223 C  CB  . SER A 1 159 ? 18.964 10.356  19.942 1.00 28.29 ? 159 SER L CB  1 
ATOM   1224 O  OG  . SER A 1 159 ? 18.365 11.624  19.792 1.00 27.80 ? 159 SER L OG  1 
ATOM   1225 N  N   . GLN A 1 160 ? 20.077 10.403  22.912 1.00 28.96 ? 160 GLN L N   1 
ATOM   1226 C  CA  . GLN A 1 160 ? 20.598 11.223  24.009 1.00 28.55 ? 160 GLN L CA  1 
ATOM   1227 C  C   . GLN A 1 160 ? 21.937 11.796  23.574 1.00 28.77 ? 160 GLN L C   1 
ATOM   1228 O  O   . GLN A 1 160 ? 22.704 11.142  22.848 1.00 28.36 ? 160 GLN L O   1 
ATOM   1229 C  CB  . GLN A 1 160 ? 20.786 10.402  25.299 1.00 28.69 ? 160 GLN L CB  1 
ATOM   1230 C  CG  . GLN A 1 160 ? 19.495 9.839   25.941 1.00 28.81 ? 160 GLN L CG  1 
ATOM   1231 C  CD  . GLN A 1 160 ? 19.748 8.952   27.176 1.00 28.94 ? 160 GLN L CD  1 
ATOM   1232 O  OE1 . GLN A 1 160 ? 20.345 7.859   27.085 1.00 27.18 ? 160 GLN L OE1 1 
ATOM   1233 N  NE2 . GLN A 1 160 ? 19.265 9.413   28.338 1.00 29.58 ? 160 GLN L NE2 1 
ATOM   1234 N  N   . GLU A 1 161 ? 22.221 13.019  24.015 1.00 28.58 ? 161 GLU L N   1 
ATOM   1235 C  CA  . GLU A 1 161 ? 23.498 13.635  23.729 1.00 28.20 ? 161 GLU L CA  1 
ATOM   1236 C  C   . GLU A 1 161 ? 24.304 14.024  24.975 1.00 28.10 ? 161 GLU L C   1 
ATOM   1237 O  O   . GLU A 1 161 ? 23.778 14.140  26.088 1.00 27.52 ? 161 GLU L O   1 
ATOM   1238 C  CB  . GLU A 1 161 ? 23.368 14.787  22.708 1.00 28.82 ? 161 GLU L CB  1 
ATOM   1239 C  CG  . GLU A 1 161 ? 22.486 15.957  23.071 1.00 28.54 ? 161 GLU L CG  1 
ATOM   1240 C  CD  . GLU A 1 161 ? 22.380 16.981  21.931 1.00 28.32 ? 161 GLU L CD  1 
ATOM   1241 O  OE1 . GLU A 1 161 ? 22.471 18.195  22.217 1.00 27.74 ? 161 GLU L OE1 1 
ATOM   1242 O  OE2 . GLU A 1 161 ? 22.191 16.577  20.760 1.00 27.66 ? 161 GLU L OE2 1 
ATOM   1243 N  N   . SER A 1 162 ? 25.601 14.203  24.750 1.00 27.48 ? 162 SER L N   1 
ATOM   1244 C  CA  . SER A 1 162 ? 26.574 14.424  25.792 1.00 26.50 ? 162 SER L CA  1 
ATOM   1245 C  C   . SER A 1 162 ? 27.679 15.308  25.210 1.00 26.02 ? 162 SER L C   1 
ATOM   1246 O  O   . SER A 1 162 ? 28.121 15.086  24.086 1.00 25.49 ? 162 SER L O   1 
ATOM   1247 C  CB  . SER A 1 162 ? 27.129 13.079  26.245 1.00 26.56 ? 162 SER L CB  1 
ATOM   1248 O  OG  . SER A 1 162 ? 28.140 13.244  27.204 1.00 26.48 ? 162 SER L OG  1 
ATOM   1249 N  N   . VAL A 1 163 ? 28.096 16.317  25.973 1.00 25.34 ? 163 VAL L N   1 
ATOM   1250 C  CA  . VAL A 1 163 ? 29.038 17.330  25.502 1.00 24.87 ? 163 VAL L CA  1 
ATOM   1251 C  C   . VAL A 1 163 ? 30.262 17.357  26.416 1.00 24.79 ? 163 VAL L C   1 
ATOM   1252 O  O   . VAL A 1 163 ? 30.132 17.210  27.624 1.00 24.80 ? 163 VAL L O   1 
ATOM   1253 C  CB  . VAL A 1 163 ? 28.393 18.754  25.489 1.00 24.69 ? 163 VAL L CB  1 
ATOM   1254 C  CG1 . VAL A 1 163 ? 29.280 19.766  24.739 1.00 23.99 ? 163 VAL L CG1 1 
ATOM   1255 C  CG2 . VAL A 1 163 ? 27.002 18.720  24.889 1.00 24.32 ? 163 VAL L CG2 1 
ATOM   1256 N  N   . THR A 1 164 ? 31.444 17.549  25.846 1.00 24.72 ? 164 THR L N   1 
ATOM   1257 C  CA  . THR A 1 164 ? 32.658 17.689  26.658 1.00 24.63 ? 164 THR L CA  1 
ATOM   1258 C  C   . THR A 1 164 ? 32.746 19.094  27.294 1.00 24.89 ? 164 THR L C   1 
ATOM   1259 O  O   . THR A 1 164 ? 32.034 20.030  26.898 1.00 24.34 ? 164 THR L O   1 
ATOM   1260 C  CB  . THR A 1 164 ? 33.949 17.415  25.837 1.00 24.43 ? 164 THR L CB  1 
ATOM   1261 O  OG1 . THR A 1 164 ? 33.988 18.272  24.692 1.00 23.00 ? 164 THR L OG1 1 
ATOM   1262 C  CG2 . THR A 1 164 ? 34.020 15.958  25.381 1.00 24.92 ? 164 THR L CG2 1 
ATOM   1263 N  N   . GLU A 1 165 ? 33.627 19.220  28.282 1.00 25.33 ? 165 GLU L N   1 
ATOM   1264 C  CA  . GLU A 1 165 ? 34.010 20.509  28.833 1.00 25.65 ? 165 GLU L CA  1 
ATOM   1265 C  C   . GLU A 1 165 ? 34.752 21.292  27.751 1.00 25.92 ? 165 GLU L C   1 
ATOM   1266 O  O   . GLU A 1 165 ? 35.299 20.695  26.806 1.00 25.58 ? 165 GLU L O   1 
ATOM   1267 C  CB  . GLU A 1 165 ? 34.918 20.315  30.053 1.00 25.99 ? 165 GLU L CB  1 
ATOM   1268 C  CG  . GLU A 1 165 ? 34.260 19.626  31.262 1.00 26.68 ? 165 GLU L CG  1 
ATOM   1269 C  CD  . GLU A 1 165 ? 33.106 20.420  31.889 1.00 29.14 ? 165 GLU L CD  1 
ATOM   1270 O  OE1 . GLU A 1 165 ? 33.087 21.682  31.812 1.00 29.84 ? 165 GLU L OE1 1 
ATOM   1271 O  OE2 . GLU A 1 165 ? 32.227 19.770  32.499 1.00 29.83 ? 165 GLU L OE2 1 
ATOM   1272 N  N   . GLN A 1 166 ? 34.770 22.617  27.879 1.00 26.02 ? 166 GLN L N   1 
ATOM   1273 C  CA  . GLN A 1 166 ? 35.465 23.456  26.918 1.00 26.39 ? 166 GLN L CA  1 
ATOM   1274 C  C   . GLN A 1 166 ? 36.942 23.036  26.842 1.00 27.20 ? 166 GLN L C   1 
ATOM   1275 O  O   . GLN A 1 166 ? 37.580 22.811  27.872 1.00 27.14 ? 166 GLN L O   1 
ATOM   1276 C  CB  . GLN A 1 166 ? 35.298 24.929  27.293 1.00 25.95 ? 166 GLN L CB  1 
ATOM   1277 C  CG  . GLN A 1 166 ? 35.639 25.868  26.170 1.00 26.09 ? 166 GLN L CG  1 
ATOM   1278 C  CD  . GLN A 1 166 ? 35.149 27.294  26.377 1.00 25.77 ? 166 GLN L CD  1 
ATOM   1279 O  OE1 . GLN A 1 166 ? 34.847 27.996  25.411 1.00 25.93 ? 166 GLN L OE1 1 
ATOM   1280 N  NE2 . GLN A 1 166 ? 35.077 27.730  27.625 1.00 24.87 ? 166 GLN L NE2 1 
ATOM   1281 N  N   . ASP A 1 167 ? 37.468 22.898  25.624 1.00 28.20 ? 167 ASP L N   1 
ATOM   1282 C  CA  . ASP A 1 167 ? 38.825 22.410  25.413 1.00 29.96 ? 167 ASP L CA  1 
ATOM   1283 C  C   . ASP A 1 167 ? 39.847 23.425  25.930 1.00 30.68 ? 167 ASP L C   1 
ATOM   1284 O  O   . ASP A 1 167 ? 39.723 24.611  25.657 1.00 30.74 ? 167 ASP L O   1 
ATOM   1285 C  CB  . ASP A 1 167 ? 39.044 22.097  23.929 1.00 30.13 ? 167 ASP L CB  1 
ATOM   1286 C  CG  . ASP A 1 167 ? 40.392 21.456  23.653 1.00 31.50 ? 167 ASP L CG  1 
ATOM   1287 O  OD1 . ASP A 1 167 ? 40.465 20.215  23.565 1.00 34.25 ? 167 ASP L OD1 1 
ATOM   1288 O  OD2 . ASP A 1 167 ? 41.391 22.188  23.514 1.00 32.72 ? 167 ASP L OD2 1 
ATOM   1289 N  N   . SER A 1 168 ? 40.847 22.957  26.678 1.00 32.15 ? 168 SER L N   1 
ATOM   1290 C  CA  . SER A 1 168 ? 41.867 23.857  27.261 1.00 33.78 ? 168 SER L CA  1 
ATOM   1291 C  C   . SER A 1 168 ? 42.832 24.440  26.222 1.00 34.07 ? 168 SER L C   1 
ATOM   1292 O  O   . SER A 1 168 ? 43.450 25.468  26.463 1.00 34.33 ? 168 SER L O   1 
ATOM   1293 C  CB  . SER A 1 168 ? 42.648 23.167  28.394 1.00 34.33 ? 168 SER L CB  1 
ATOM   1294 O  OG  . SER A 1 168 ? 43.714 22.361  27.895 1.00 35.81 ? 168 SER L OG  1 
ATOM   1295 N  N   . LYS A 1 169 ? 42.940 23.788  25.068 1.00 34.46 ? 169 LYS L N   1 
ATOM   1296 C  CA  . LYS A 1 169 ? 43.797 24.256  23.979 1.00 34.77 ? 169 LYS L CA  1 
ATOM   1297 C  C   . LYS A 1 169 ? 43.081 25.244  23.042 1.00 33.81 ? 169 LYS L C   1 
ATOM   1298 O  O   . LYS A 1 169 ? 43.586 26.343  22.804 1.00 34.03 ? 169 LYS L O   1 
ATOM   1299 C  CB  . LYS A 1 169 ? 44.358 23.053  23.196 1.00 35.02 ? 169 LYS L CB  1 
ATOM   1300 C  CG  . LYS A 1 169 ? 45.418 23.387  22.151 1.00 36.35 ? 169 LYS L CG  1 
ATOM   1301 C  CD  . LYS A 1 169 ? 45.850 22.130  21.402 1.00 36.64 ? 169 LYS L CD  1 
ATOM   1302 C  CE  . LYS A 1 169 ? 47.156 22.343  20.619 1.00 37.17 ? 169 LYS L CE  1 
ATOM   1303 N  NZ  . LYS A 1 169 ? 47.852 21.027  20.385 1.00 39.26 ? 169 LYS L NZ  1 
ATOM   1304 N  N   . ASP A 1 170 ? 41.917 24.870  22.509 1.00 32.34 ? 170 ASP L N   1 
ATOM   1305 C  CA  . ASP A 1 170 ? 41.281 25.709  21.476 1.00 30.62 ? 170 ASP L CA  1 
ATOM   1306 C  C   . ASP A 1 170 ? 39.894 26.271  21.821 1.00 29.09 ? 170 ASP L C   1 
ATOM   1307 O  O   . ASP A 1 170 ? 39.242 26.860  20.952 1.00 28.66 ? 170 ASP L O   1 
ATOM   1308 C  CB  . ASP A 1 170 ? 41.281 25.020  20.090 1.00 30.36 ? 170 ASP L CB  1 
ATOM   1309 C  CG  . ASP A 1 170 ? 40.359 23.785  20.025 1.00 31.66 ? 170 ASP L CG  1 
ATOM   1310 O  OD1 . ASP A 1 170 ? 39.472 23.622  20.895 1.00 31.85 ? 170 ASP L OD1 1 
ATOM   1311 O  OD2 . ASP A 1 170 ? 40.521 22.969  19.082 1.00 32.46 ? 170 ASP L OD2 1 
ATOM   1312 N  N   . SER A 1 171 ? 39.459 26.088  23.074 1.00 27.69 ? 171 SER L N   1 
ATOM   1313 C  CA  . SER A 1 171 ? 38.162 26.617  23.593 1.00 25.62 ? 171 SER L CA  1 
ATOM   1314 C  C   . SER A 1 171 ? 36.881 26.118  22.876 1.00 24.61 ? 171 SER L C   1 
ATOM   1315 O  O   . SER A 1 171 ? 35.806 26.751  22.968 1.00 23.93 ? 171 SER L O   1 
ATOM   1316 C  CB  . SER A 1 171 ? 38.184 28.162  23.668 1.00 25.55 ? 171 SER L CB  1 
ATOM   1317 O  OG  . SER A 1 171 ? 39.222 28.606  24.511 1.00 24.73 ? 171 SER L OG  1 
ATOM   1318 N  N   . THR A 1 172 ? 36.999 24.980  22.183 1.00 23.52 ? 172 THR L N   1 
ATOM   1319 C  CA  . THR A 1 172 ? 35.875 24.360  21.483 1.00 22.37 ? 172 THR L CA  1 
ATOM   1320 C  C   . THR A 1 172 ? 35.196 23.255  22.301 1.00 22.04 ? 172 THR L C   1 
ATOM   1321 O  O   . THR A 1 172 ? 35.667 22.864  23.371 1.00 21.61 ? 172 THR L O   1 
ATOM   1322 C  CB  . THR A 1 172 ? 36.290 23.742  20.111 1.00 22.23 ? 172 THR L CB  1 
ATOM   1323 O  OG1 . THR A 1 172 ? 37.250 22.699  20.318 1.00 22.63 ? 172 THR L OG1 1 
ATOM   1324 C  CG2 . THR A 1 172 ? 36.835 24.802  19.122 1.00 21.00 ? 172 THR L CG2 1 
ATOM   1325 N  N   . TYR A 1 173 ? 34.083 22.757  21.766 1.00 21.39 ? 173 TYR L N   1 
ATOM   1326 C  CA  . TYR A 1 173 ? 33.346 21.667  22.358 1.00 20.91 ? 173 TYR L CA  1 
ATOM   1327 C  C   . TYR A 1 173 ? 33.311 20.503  21.415 1.00 20.85 ? 173 TYR L C   1 
ATOM   1328 O  O   . TYR A 1 173 ? 33.461 20.655  20.201 1.00 20.60 ? 173 TYR L O   1 
ATOM   1329 C  CB  . TYR A 1 173 ? 31.907 22.095  22.651 1.00 20.78 ? 173 TYR L CB  1 
ATOM   1330 C  CG  . TYR A 1 173 ? 31.820 23.158  23.719 1.00 20.49 ? 173 TYR L CG  1 
ATOM   1331 C  CD1 . TYR A 1 173 ? 31.726 24.512  23.379 1.00 20.34 ? 173 TYR L CD1 1 
ATOM   1332 C  CD2 . TYR A 1 173 ? 31.859 22.814  25.064 1.00 20.41 ? 173 TYR L CD2 1 
ATOM   1333 C  CE1 . TYR A 1 173 ? 31.662 25.474  24.347 1.00 19.50 ? 173 TYR L CE1 1 
ATOM   1334 C  CE2 . TYR A 1 173 ? 31.783 23.779  26.045 1.00 19.63 ? 173 TYR L CE2 1 
ATOM   1335 C  CZ  . TYR A 1 173 ? 31.684 25.099  25.681 1.00 19.79 ? 173 TYR L CZ  1 
ATOM   1336 O  OH  . TYR A 1 173 ? 31.609 26.049  26.669 1.00 20.33 ? 173 TYR L OH  1 
ATOM   1337 N  N   . SER A 1 174 ? 33.106 19.331  21.991 1.00 20.49 ? 174 SER L N   1 
ATOM   1338 C  CA  . SER A 1 174 ? 32.794 18.150  21.218 1.00 20.31 ? 174 SER L CA  1 
ATOM   1339 C  C   . SER A 1 174 ? 31.524 17.545  21.775 1.00 20.88 ? 174 SER L C   1 
ATOM   1340 O  O   . SER A 1 174 ? 31.209 17.717  22.954 1.00 21.19 ? 174 SER L O   1 
ATOM   1341 C  CB  . SER A 1 174 ? 33.965 17.165  21.219 1.00 19.83 ? 174 SER L CB  1 
ATOM   1342 O  OG  . SER A 1 174 ? 35.008 17.707  20.447 1.00 18.00 ? 174 SER L OG  1 
ATOM   1343 N  N   . LEU A 1 175 ? 30.777 16.872  20.912 1.00 21.42 ? 175 LEU L N   1 
ATOM   1344 C  CA  . LEU A 1 175 ? 29.455 16.378  21.266 1.00 21.79 ? 175 LEU L CA  1 
ATOM   1345 C  C   . LEU A 1 175 ? 29.240 15.001  20.668 1.00 22.46 ? 175 LEU L C   1 
ATOM   1346 O  O   . LEU A 1 175 ? 29.716 14.710  19.574 1.00 22.16 ? 175 LEU L O   1 
ATOM   1347 C  CB  . LEU A 1 175 ? 28.379 17.364  20.795 1.00 21.64 ? 175 LEU L CB  1 
ATOM   1348 C  CG  . LEU A 1 175 ? 26.892 17.160  21.089 1.00 21.57 ? 175 LEU L CG  1 
ATOM   1349 C  CD1 . LEU A 1 175 ? 26.244 18.474  21.437 1.00 23.02 ? 175 LEU L CD1 1 
ATOM   1350 C  CD2 . LEU A 1 175 ? 26.188 16.518  19.909 1.00 21.20 ? 175 LEU L CD2 1 
ATOM   1351 N  N   . SER A 1 176 ? 28.557 14.151  21.429 1.00 23.58 ? 176 SER L N   1 
ATOM   1352 C  CA  . SER A 1 176 ? 28.072 12.863  20.947 1.00 24.74 ? 176 SER L CA  1 
ATOM   1353 C  C   . SER A 1 176 ? 26.546 12.844  21.012 1.00 24.98 ? 176 SER L C   1 
ATOM   1354 O  O   . SER A 1 176 ? 25.939 13.399  21.938 1.00 24.87 ? 176 SER L O   1 
ATOM   1355 C  CB  . SER A 1 176 ? 28.657 11.706  21.767 1.00 24.95 ? 176 SER L CB  1 
ATOM   1356 O  OG  . SER A 1 176 ? 28.098 11.692  23.071 1.00 26.36 ? 176 SER L OG  1 
ATOM   1357 N  N   . SER A 1 177 ? 25.934 12.262  19.985 1.00 25.28 ? 177 SER L N   1 
ATOM   1358 C  CA  . SER A 1 177 ? 24.516 11.950  20.010 1.00 25.25 ? 177 SER L CA  1 
ATOM   1359 C  C   . SER A 1 177 ? 24.402 10.457  19.720 1.00 25.33 ? 177 SER L C   1 
ATOM   1360 O  O   . SER A 1 177 ? 25.036 9.942   18.796 1.00 25.50 ? 177 SER L O   1 
ATOM   1361 C  CB  . SER A 1 177 ? 23.759 12.790  18.988 1.00 25.37 ? 177 SER L CB  1 
ATOM   1362 O  OG  . SER A 1 177 ? 22.361 12.625  19.120 1.00 26.03 ? 177 SER L OG  1 
ATOM   1363 N  N   . THR A 1 178 ? 23.632 9.758   20.545 1.00 25.15 ? 178 THR L N   1 
ATOM   1364 C  CA  . THR A 1 178 ? 23.494 8.326   20.434 1.00 24.39 ? 178 THR L CA  1 
ATOM   1365 C  C   . THR A 1 178 ? 22.053 7.948   20.172 1.00 24.16 ? 178 THR L C   1 
ATOM   1366 O  O   . THR A 1 178 ? 21.182 8.201   20.986 1.00 24.21 ? 178 THR L O   1 
ATOM   1367 C  CB  . THR A 1 178 ? 24.058 7.620   21.682 1.00 24.34 ? 178 THR L CB  1 
ATOM   1368 O  OG1 . THR A 1 178 ? 25.399 8.073   21.895 1.00 25.06 ? 178 THR L OG1 1 
ATOM   1369 C  CG2 . THR A 1 178 ? 24.084 6.108   21.505 1.00 23.25 ? 178 THR L CG2 1 
ATOM   1370 N  N   . LEU A 1 179 ? 21.819 7.348   19.008 1.00 24.27 ? 179 LEU L N   1 
ATOM   1371 C  CA  . LEU A 1 179 ? 20.515 6.800   18.644 1.00 23.96 ? 179 LEU L CA  1 
ATOM   1372 C  C   . LEU A 1 179 ? 20.421 5.333   19.082 1.00 24.34 ? 179 LEU L C   1 
ATOM   1373 O  O   . LEU A 1 179 ? 21.249 4.504   18.692 1.00 23.91 ? 179 LEU L O   1 
ATOM   1374 C  CB  . LEU A 1 179 ? 20.290 6.936   17.137 1.00 23.29 ? 179 LEU L CB  1 
ATOM   1375 C  CG  . LEU A 1 179 ? 18.974 6.424   16.541 1.00 23.68 ? 179 LEU L CG  1 
ATOM   1376 C  CD1 . LEU A 1 179 ? 17.756 7.281   16.909 1.00 21.80 ? 179 LEU L CD1 1 
ATOM   1377 C  CD2 . LEU A 1 179 ? 19.117 6.298   15.036 1.00 23.96 ? 179 LEU L CD2 1 
ATOM   1378 N  N   . THR A 1 180 ? 19.412 5.020   19.889 1.00 24.72 ? 180 THR L N   1 
ATOM   1379 C  CA  . THR A 1 180 ? 19.225 3.658   20.361 1.00 25.73 ? 180 THR L CA  1 
ATOM   1380 C  C   . THR A 1 180 ? 17.931 3.037   19.827 1.00 26.23 ? 180 THR L C   1 
ATOM   1381 O  O   . THR A 1 180 ? 16.843 3.595   19.995 1.00 27.11 ? 180 THR L O   1 
ATOM   1382 C  CB  . THR A 1 180 ? 19.304 3.590   21.900 1.00 25.63 ? 180 THR L CB  1 
ATOM   1383 O  OG1 . THR A 1 180 ? 20.516 4.207   22.335 1.00 25.04 ? 180 THR L OG1 1 
ATOM   1384 C  CG2 . THR A 1 180 ? 19.283 2.142   22.390 1.00 26.14 ? 180 THR L CG2 1 
ATOM   1385 N  N   . LEU A 1 181 ? 18.067 1.894   19.166 1.00 26.47 ? 181 LEU L N   1 
ATOM   1386 C  CA  . LEU A 1 181 ? 16.921 1.124   18.662 1.00 27.05 ? 181 LEU L CA  1 
ATOM   1387 C  C   . LEU A 1 181 ? 17.096 -0.344  19.060 1.00 27.37 ? 181 LEU L C   1 
ATOM   1388 O  O   . LEU A 1 181 ? 18.179 -0.753  19.476 1.00 27.24 ? 181 LEU L O   1 
ATOM   1389 C  CB  . LEU A 1 181 ? 16.798 1.227   17.126 1.00 26.78 ? 181 LEU L CB  1 
ATOM   1390 C  CG  . LEU A 1 181 ? 16.888 2.540   16.338 1.00 26.32 ? 181 LEU L CG  1 
ATOM   1391 C  CD1 . LEU A 1 181 ? 16.838 2.242   14.846 1.00 26.28 ? 181 LEU L CD1 1 
ATOM   1392 C  CD2 . LEU A 1 181 ? 15.803 3.558   16.712 1.00 25.63 ? 181 LEU L CD2 1 
ATOM   1393 N  N   . SER A 1 182 ? 16.039 -1.142  18.943 1.00 28.02 ? 182 SER L N   1 
ATOM   1394 C  CA  . SER A 1 182 ? 16.217 -2.593  19.019 1.00 28.80 ? 182 SER L CA  1 
ATOM   1395 C  C   . SER A 1 182 ? 16.902 -3.072  17.726 1.00 29.31 ? 182 SER L C   1 
ATOM   1396 O  O   . SER A 1 182 ? 16.811 -2.403  16.684 1.00 28.99 ? 182 SER L O   1 
ATOM   1397 C  CB  . SER A 1 182 ? 14.871 -3.300  19.220 1.00 28.88 ? 182 SER L CB  1 
ATOM   1398 O  OG  . SER A 1 182 ? 14.056 -3.193  18.062 1.00 28.01 ? 182 SER L OG  1 
ATOM   1399 N  N   . LYS A 1 183 ? 17.608 -4.204  17.793 1.00 30.02 ? 183 LYS L N   1 
ATOM   1400 C  CA  . LYS A 1 183 ? 18.180 -4.793  16.590 1.00 30.98 ? 183 LYS L CA  1 
ATOM   1401 C  C   . LYS A 1 183 ? 17.085 -4.917  15.530 1.00 31.20 ? 183 LYS L C   1 
ATOM   1402 O  O   . LYS A 1 183 ? 17.282 -4.508  14.380 1.00 30.86 ? 183 LYS L O   1 
ATOM   1403 C  CB  . LYS A 1 183 ? 18.807 -6.161  16.882 1.00 31.23 ? 183 LYS L CB  1 
ATOM   1404 C  CG  . LYS A 1 183 ? 19.094 -7.019  15.632 1.00 31.82 ? 183 LYS L CG  1 
ATOM   1405 C  CD  . LYS A 1 183 ? 19.813 -8.333  15.972 1.00 32.33 ? 183 LYS L CD  1 
ATOM   1406 C  CE  . LYS A 1 183 ? 19.681 -9.334  14.823 1.00 35.16 ? 183 LYS L CE  1 
ATOM   1407 N  NZ  . LYS A 1 183 ? 20.758 -10.393 14.810 1.00 35.44 ? 183 LYS L NZ  1 
ATOM   1408 N  N   . ALA A 1 184 ? 15.936 -5.465  15.950 1.00 31.64 ? 184 ALA L N   1 
ATOM   1409 C  CA  . ALA A 1 184 ? 14.759 -5.701  15.098 1.00 31.76 ? 184 ALA L CA  1 
ATOM   1410 C  C   . ALA A 1 184 ? 14.339 -4.473  14.311 1.00 31.76 ? 184 ALA L C   1 
ATOM   1411 O  O   . ALA A 1 184 ? 14.235 -4.530  13.085 1.00 32.22 ? 184 ALA L O   1 
ATOM   1412 C  CB  . ALA A 1 184 ? 13.589 -6.209  15.942 1.00 31.69 ? 184 ALA L CB  1 
ATOM   1413 N  N   . ASP A 1 185 ? 14.095 -3.376  15.023 1.00 31.62 ? 185 ASP L N   1 
ATOM   1414 C  CA  . ASP A 1 185 ? 13.760 -2.077  14.420 1.00 31.74 ? 185 ASP L CA  1 
ATOM   1415 C  C   . ASP A 1 185 ? 14.883 -1.584  13.477 1.00 32.03 ? 185 ASP L C   1 
ATOM   1416 O  O   . ASP A 1 185 ? 14.627 -1.159  12.340 1.00 31.60 ? 185 ASP L O   1 
ATOM   1417 C  CB  . ASP A 1 185 ? 13.475 -1.052  15.540 1.00 31.41 ? 185 ASP L CB  1 
ATOM   1418 C  CG  . ASP A 1 185 ? 12.943 0.286   15.015 1.00 30.80 ? 185 ASP L CG  1 
ATOM   1419 O  OD1 . ASP A 1 185 ? 12.484 0.346   13.866 1.00 30.62 ? 185 ASP L OD1 1 
ATOM   1420 O  OD2 . ASP A 1 185 ? 12.971 1.292   15.758 1.00 30.71 ? 185 ASP L OD2 1 
ATOM   1421 N  N   . TYR A 1 186 ? 16.120 -1.656  13.969 1.00 32.43 ? 186 TYR L N   1 
ATOM   1422 C  CA  . TYR A 1 186 ? 17.304 -1.253  13.211 1.00 32.80 ? 186 TYR L CA  1 
ATOM   1423 C  C   . TYR A 1 186 ? 17.382 -1.909  11.819 1.00 32.72 ? 186 TYR L C   1 
ATOM   1424 O  O   . TYR A 1 186 ? 17.653 -1.237  10.821 1.00 32.58 ? 186 TYR L O   1 
ATOM   1425 C  CB  . TYR A 1 186 ? 18.587 -1.500  14.035 1.00 32.52 ? 186 TYR L CB  1 
ATOM   1426 C  CG  . TYR A 1 186 ? 19.865 -1.225  13.274 1.00 32.64 ? 186 TYR L CG  1 
ATOM   1427 C  CD1 . TYR A 1 186 ? 20.239 0.085   12.941 1.00 32.17 ? 186 TYR L CD1 1 
ATOM   1428 C  CD2 . TYR A 1 186 ? 20.706 -2.273  12.886 1.00 32.87 ? 186 TYR L CD2 1 
ATOM   1429 C  CE1 . TYR A 1 186 ? 21.408 0.341   12.218 1.00 32.42 ? 186 TYR L CE1 1 
ATOM   1430 C  CE2 . TYR A 1 186 ? 21.884 -2.027  12.171 1.00 33.27 ? 186 TYR L CE2 1 
ATOM   1431 C  CZ  . TYR A 1 186 ? 22.222 -0.720  11.835 1.00 32.55 ? 186 TYR L CZ  1 
ATOM   1432 O  OH  . TYR A 1 186 ? 23.377 -0.480  11.132 1.00 32.29 ? 186 TYR L OH  1 
ATOM   1433 N  N   . GLU A 1 187 ? 17.109 -3.210  11.765 1.00 33.00 ? 187 GLU L N   1 
ATOM   1434 C  CA  . GLU A 1 187 ? 17.169 -3.995  10.525 1.00 32.93 ? 187 GLU L CA  1 
ATOM   1435 C  C   . GLU A 1 187 ? 15.965 -3.831  9.588  1.00 32.60 ? 187 GLU L C   1 
ATOM   1436 O  O   . GLU A 1 187 ? 15.930 -4.426  8.504  1.00 32.61 ? 187 GLU L O   1 
ATOM   1437 C  CB  . GLU A 1 187 ? 17.419 -5.464  10.849 1.00 33.23 ? 187 GLU L CB  1 
ATOM   1438 C  CG  . GLU A 1 187 ? 18.812 -5.680  11.412 1.00 34.82 ? 187 GLU L CG  1 
ATOM   1439 C  CD  . GLU A 1 187 ? 19.130 -7.134  11.728 1.00 35.74 ? 187 GLU L CD  1 
ATOM   1440 O  OE1 . GLU A 1 187 ? 20.333 -7.469  11.722 1.00 37.76 ? 187 GLU L OE1 1 
ATOM   1441 O  OE2 . GLU A 1 187 ? 18.199 -7.938  11.981 1.00 37.70 ? 187 GLU L OE2 1 
ATOM   1442 N  N   . LYS A 1 188 ? 14.993 -3.023  10.009 1.00 31.85 ? 188 LYS L N   1 
ATOM   1443 C  CA  . LYS A 1 188 ? 13.839 -2.681  9.194  1.00 31.18 ? 188 LYS L CA  1 
ATOM   1444 C  C   . LYS A 1 188 ? 14.091 -1.461  8.317  1.00 30.44 ? 188 LYS L C   1 
ATOM   1445 O  O   . LYS A 1 188 ? 13.310 -1.174  7.411  1.00 30.76 ? 188 LYS L O   1 
ATOM   1446 C  CB  . LYS A 1 188 ? 12.607 -2.442  10.068 1.00 31.27 ? 188 LYS L CB  1 
ATOM   1447 C  CG  . LYS A 1 188 ? 11.990 -3.727  10.554 1.00 32.22 ? 188 LYS L CG  1 
ATOM   1448 C  CD  . LYS A 1 188 ? 10.889 -3.503  11.569 1.00 32.81 ? 188 LYS L CD  1 
ATOM   1449 C  CE  . LYS A 1 188 ? 10.649 -4.788  12.319 1.00 33.24 ? 188 LYS L CE  1 
ATOM   1450 N  NZ  . LYS A 1 188 ? 9.888  -4.516  13.549 1.00 35.46 ? 188 LYS L NZ  1 
ATOM   1451 N  N   . HIS A 1 189 ? 15.181 -0.750  8.577  1.00 29.18 ? 189 HIS L N   1 
ATOM   1452 C  CA  . HIS A 1 189 ? 15.456 0.472   7.850  1.00 28.15 ? 189 HIS L CA  1 
ATOM   1453 C  C   . HIS A 1 189 ? 16.678 0.382   6.941  1.00 27.57 ? 189 HIS L C   1 
ATOM   1454 O  O   . HIS A 1 189 ? 17.489 -0.539  7.020  1.00 27.31 ? 189 HIS L O   1 
ATOM   1455 C  CB  . HIS A 1 189 ? 15.539 1.662   8.809  1.00 28.06 ? 189 HIS L CB  1 
ATOM   1456 C  CG  . HIS A 1 189 ? 14.237 1.968   9.491  1.00 27.86 ? 189 HIS L CG  1 
ATOM   1457 N  ND1 . HIS A 1 189 ? 13.252 2.738   8.909  1.00 27.94 ? 189 HIS L ND1 1 
ATOM   1458 C  CD2 . HIS A 1 189 ? 13.758 1.599   10.703 1.00 26.81 ? 189 HIS L CD2 1 
ATOM   1459 C  CE1 . HIS A 1 189 ? 12.226 2.839   9.739  1.00 27.31 ? 189 HIS L CE1 1 
ATOM   1460 N  NE2 . HIS A 1 189 ? 12.507 2.154   10.832 1.00 25.79 ? 189 HIS L NE2 1 
ATOM   1461 N  N   . LYS A 1 190 ? 16.791 1.354   6.056  1.00 27.22 ? 190 LYS L N   1 
ATOM   1462 C  CA  . LYS A 1 190 ? 17.821 1.305   5.046  1.00 27.13 ? 190 LYS L CA  1 
ATOM   1463 C  C   . LYS A 1 190 ? 18.915 2.329   5.320  1.00 26.68 ? 190 LYS L C   1 
ATOM   1464 O  O   . LYS A 1 190 ? 20.078 1.970   5.389  1.00 27.05 ? 190 LYS L O   1 
ATOM   1465 C  CB  . LYS A 1 190 ? 17.210 1.463   3.636  1.00 26.72 ? 190 LYS L CB  1 
ATOM   1466 C  CG  . LYS A 1 190 ? 16.394 0.250   3.167  1.00 26.07 ? 190 LYS L CG  1 
ATOM   1467 C  CD  . LYS A 1 190 ? 17.296 -0.914  2.760  1.00 24.43 ? 190 LYS L CD  1 
ATOM   1468 C  CE  . LYS A 1 190 ? 16.527 -1.973  1.999  1.00 23.51 ? 190 LYS L CE  1 
ATOM   1469 N  NZ  . LYS A 1 190 ? 17.372 -3.173  1.631  1.00 22.87 ? 190 LYS L NZ  1 
ATOM   1470 N  N   . VAL A 1 191 ? 18.542 3.591   5.485  1.00 26.70 ? 191 VAL L N   1 
ATOM   1471 C  CA  . VAL A 1 191 ? 19.544 4.659   5.637  1.00 27.03 ? 191 VAL L CA  1 
ATOM   1472 C  C   . VAL A 1 191 ? 19.464 5.406   6.979  1.00 26.74 ? 191 VAL L C   1 
ATOM   1473 O  O   . VAL A 1 191 ? 18.386 5.795   7.443  1.00 27.16 ? 191 VAL L O   1 
ATOM   1474 C  CB  . VAL A 1 191 ? 19.663 5.595   4.361  1.00 26.99 ? 191 VAL L CB  1 
ATOM   1475 C  CG1 . VAL A 1 191 ? 18.327 5.756   3.637  1.00 27.51 ? 191 VAL L CG1 1 
ATOM   1476 C  CG2 . VAL A 1 191 ? 20.329 6.937   4.674  1.00 26.54 ? 191 VAL L CG2 1 
ATOM   1477 N  N   . TYR A 1 192 ? 20.632 5.556   7.597  1.00 26.42 ? 192 TYR L N   1 
ATOM   1478 C  CA  . TYR A 1 192 ? 20.780 6.207   8.891  1.00 26.06 ? 192 TYR L CA  1 
ATOM   1479 C  C   . TYR A 1 192 ? 21.621 7.462   8.718  1.00 26.39 ? 192 TYR L C   1 
ATOM   1480 O  O   . TYR A 1 192 ? 22.765 7.397   8.249  1.00 25.85 ? 192 TYR L O   1 
ATOM   1481 C  CB  . TYR A 1 192 ? 21.423 5.242   9.891  1.00 25.57 ? 192 TYR L CB  1 
ATOM   1482 C  CG  . TYR A 1 192 ? 20.479 4.141   10.277 1.00 25.87 ? 192 TYR L CG  1 
ATOM   1483 C  CD1 . TYR A 1 192 ? 20.290 3.030   9.443  1.00 26.02 ? 192 TYR L CD1 1 
ATOM   1484 C  CD2 . TYR A 1 192 ? 19.728 4.228   11.448 1.00 24.38 ? 192 TYR L CD2 1 
ATOM   1485 C  CE1 . TYR A 1 192 ? 19.391 2.031   9.780  1.00 25.61 ? 192 TYR L CE1 1 
ATOM   1486 C  CE2 . TYR A 1 192 ? 18.821 3.243   11.780 1.00 24.58 ? 192 TYR L CE2 1 
ATOM   1487 C  CZ  . TYR A 1 192 ? 18.656 2.152   10.946 1.00 25.39 ? 192 TYR L CZ  1 
ATOM   1488 O  OH  . TYR A 1 192 ? 17.776 1.160   11.296 1.00 25.44 ? 192 TYR L OH  1 
ATOM   1489 N  N   . ALA A 1 193 ? 21.040 8.598   9.105  1.00 26.58 ? 193 ALA L N   1 
ATOM   1490 C  CA  . ALA A 1 193 ? 21.635 9.899   8.869  1.00 26.41 ? 193 ALA L CA  1 
ATOM   1491 C  C   . ALA A 1 193 ? 21.648 10.790  10.107 1.00 26.80 ? 193 ALA L C   1 
ATOM   1492 O  O   . ALA A 1 193 ? 20.663 10.885  10.843 1.00 26.91 ? 193 ALA L O   1 
ATOM   1493 C  CB  . ALA A 1 193 ? 20.920 10.606  7.731  1.00 26.33 ? 193 ALA L CB  1 
ATOM   1494 N  N   . CYS A 1 194 ? 22.781 11.459  10.296 1.00 27.10 ? 194 CYS L N   1 
ATOM   1495 C  CA  . CYS A 1 194 ? 22.951 12.492  11.289 1.00 26.83 ? 194 CYS L CA  1 
ATOM   1496 C  C   . CYS A 1 194 ? 22.986 13.871  10.587 1.00 26.56 ? 194 CYS L C   1 
ATOM   1497 O  O   . CYS A 1 194 ? 23.919 14.187  9.852  1.00 25.41 ? 194 CYS L O   1 
ATOM   1498 C  CB  . CYS A 1 194 ? 24.251 12.232  12.059 1.00 26.86 ? 194 CYS L CB  1 
ATOM   1499 S  SG  . CYS A 1 194 ? 24.550 13.444  13.352 1.00 28.93 ? 194 CYS L SG  1 
ATOM   1500 N  N   . GLU A 1 195 ? 21.950 14.674  10.800 1.00 27.02 ? 195 GLU L N   1 
ATOM   1501 C  CA  . GLU A 1 195 ? 21.939 16.046  10.305 1.00 27.47 ? 195 GLU L CA  1 
ATOM   1502 C  C   . GLU A 1 195 ? 22.260 17.071  11.408 1.00 27.25 ? 195 GLU L C   1 
ATOM   1503 O  O   . GLU A 1 195 ? 21.573 17.135  12.422 1.00 27.06 ? 195 GLU L O   1 
ATOM   1504 C  CB  . GLU A 1 195 ? 20.606 16.373  9.643  1.00 27.62 ? 195 GLU L CB  1 
ATOM   1505 C  CG  . GLU A 1 195 ? 20.549 17.776  9.056  1.00 29.71 ? 195 GLU L CG  1 
ATOM   1506 C  CD  . GLU A 1 195 ? 19.161 18.154  8.590  1.00 33.75 ? 195 GLU L CD  1 
ATOM   1507 O  OE1 . GLU A 1 195 ? 18.246 18.264  9.436  1.00 36.67 ? 195 GLU L OE1 1 
ATOM   1508 O  OE2 . GLU A 1 195 ? 18.983 18.344  7.373  1.00 36.38 ? 195 GLU L OE2 1 
ATOM   1509 N  N   . VAL A 1 196 ? 23.285 17.887  11.153 1.00 27.41 ? 196 VAL L N   1 
ATOM   1510 C  CA  . VAL A 1 196 ? 23.864 18.840  12.110 1.00 27.22 ? 196 VAL L CA  1 
ATOM   1511 C  C   . VAL A 1 196 ? 23.705 20.286  11.629 1.00 27.53 ? 196 VAL L C   1 
ATOM   1512 O  O   . VAL A 1 196 ? 24.115 20.639  10.514 1.00 27.00 ? 196 VAL L O   1 
ATOM   1513 C  CB  . VAL A 1 196 ? 25.361 18.526  12.355 1.00 27.00 ? 196 VAL L CB  1 
ATOM   1514 C  CG1 . VAL A 1 196 ? 26.026 19.612  13.190 1.00 26.56 ? 196 VAL L CG1 1 
ATOM   1515 C  CG2 . VAL A 1 196 ? 25.507 17.179  13.032 1.00 27.19 ? 196 VAL L CG2 1 
ATOM   1516 N  N   . THR A 1 197 ? 23.105 21.109  12.488 1.00 28.13 ? 197 THR L N   1 
ATOM   1517 C  CA  . THR A 1 197 ? 22.866 22.531  12.218 1.00 28.71 ? 197 THR L CA  1 
ATOM   1518 C  C   . THR A 1 197 ? 23.670 23.356  13.211 1.00 29.13 ? 197 THR L C   1 
ATOM   1519 O  O   . THR A 1 197 ? 23.500 23.195  14.422 1.00 29.08 ? 197 THR L O   1 
ATOM   1520 C  CB  . THR A 1 197 ? 21.358 22.900  12.367 1.00 29.04 ? 197 THR L CB  1 
ATOM   1521 O  OG1 . THR A 1 197 ? 20.562 22.015  11.570 1.00 28.81 ? 197 THR L OG1 1 
ATOM   1522 C  CG2 . THR A 1 197 ? 21.085 24.359  11.940 1.00 28.88 ? 197 THR L CG2 1 
ATOM   1523 N  N   . HIS A 1 198 ? 24.538 24.241  12.705 1.00 29.73 ? 198 HIS L N   1 
ATOM   1524 C  CA  . HIS A 1 198 ? 25.428 25.024  13.562 1.00 30.13 ? 198 HIS L CA  1 
ATOM   1525 C  C   . HIS A 1 198 ? 25.738 26.394  12.951 1.00 31.11 ? 198 HIS L C   1 
ATOM   1526 O  O   . HIS A 1 198 ? 25.846 26.526  11.735 1.00 31.19 ? 198 HIS L O   1 
ATOM   1527 C  CB  . HIS A 1 198 ? 26.730 24.236  13.834 1.00 29.73 ? 198 HIS L CB  1 
ATOM   1528 C  CG  . HIS A 1 198 ? 27.658 24.910  14.803 1.00 28.99 ? 198 HIS L CG  1 
ATOM   1529 N  ND1 . HIS A 1 198 ? 27.528 24.787  16.169 1.00 27.59 ? 198 HIS L ND1 1 
ATOM   1530 C  CD2 . HIS A 1 198 ? 28.726 25.717  14.600 1.00 28.06 ? 198 HIS L CD2 1 
ATOM   1531 C  CE1 . HIS A 1 198 ? 28.466 25.497  16.767 1.00 26.73 ? 198 HIS L CE1 1 
ATOM   1532 N  NE2 . HIS A 1 198 ? 29.203 26.077  15.838 1.00 28.07 ? 198 HIS L NE2 1 
ATOM   1533 N  N   . GLN A 1 199 ? 25.891 27.406  13.802 1.00 32.07 ? 199 GLN L N   1 
ATOM   1534 C  CA  . GLN A 1 199 ? 26.281 28.750  13.368 1.00 33.25 ? 199 GLN L CA  1 
ATOM   1535 C  C   . GLN A 1 199 ? 27.455 28.755  12.394 1.00 33.51 ? 199 GLN L C   1 
ATOM   1536 O  O   . GLN A 1 199 ? 27.497 29.588  11.485 1.00 34.06 ? 199 GLN L O   1 
ATOM   1537 C  CB  . GLN A 1 199 ? 26.623 29.639  14.573 1.00 33.28 ? 199 GLN L CB  1 
ATOM   1538 C  CG  . GLN A 1 199 ? 26.657 31.138  14.263 1.00 33.80 ? 199 GLN L CG  1 
ATOM   1539 C  CD  . GLN A 1 199 ? 26.959 31.990  15.481 1.00 34.62 ? 199 GLN L CD  1 
ATOM   1540 O  OE1 . GLN A 1 199 ? 26.686 31.596  16.615 1.00 36.80 ? 199 GLN L OE1 1 
ATOM   1541 N  NE2 . GLN A 1 199 ? 27.522 33.172  15.252 1.00 36.52 ? 199 GLN L NE2 1 
ATOM   1542 N  N   . GLY A 1 200 ? 28.408 27.844  12.584 1.00 33.80 ? 200 GLY L N   1 
ATOM   1543 C  CA  . GLY A 1 200 ? 29.569 27.748  11.690 1.00 34.18 ? 200 GLY L CA  1 
ATOM   1544 C  C   . GLY A 1 200 ? 29.301 27.093  10.341 1.00 34.54 ? 200 GLY L C   1 
ATOM   1545 O  O   . GLY A 1 200 ? 30.196 27.033  9.500  1.00 34.73 ? 200 GLY L O   1 
ATOM   1546 N  N   . LEU A 1 201 ? 28.083 26.590  10.135 1.00 35.02 ? 201 LEU L N   1 
ATOM   1547 C  CA  . LEU A 1 201 ? 27.717 25.882  8.899  1.00 35.45 ? 201 LEU L CA  1 
ATOM   1548 C  C   . LEU A 1 201 ? 26.702 26.688  8.093  1.00 35.94 ? 201 LEU L C   1 
ATOM   1549 O  O   . LEU A 1 201 ? 25.628 27.023  8.603  1.00 36.30 ? 201 LEU L O   1 
ATOM   1550 C  CB  . LEU A 1 201 ? 27.171 24.478  9.208  1.00 35.09 ? 201 LEU L CB  1 
ATOM   1551 C  CG  . LEU A 1 201 ? 28.080 23.495  9.961  1.00 35.06 ? 201 LEU L CG  1 
ATOM   1552 C  CD1 . LEU A 1 201 ? 27.326 22.233  10.366 1.00 34.98 ? 201 LEU L CD1 1 
ATOM   1553 C  CD2 . LEU A 1 201 ? 29.320 23.130  9.153  1.00 35.06 ? 201 LEU L CD2 1 
ATOM   1554 N  N   . SER A 1 202 ? 27.040 27.003  6.840  1.00 36.04 ? 202 SER L N   1 
ATOM   1555 C  CA  . SER A 1 202 ? 26.172 27.868  6.017  1.00 36.40 ? 202 SER L CA  1 
ATOM   1556 C  C   . SER A 1 202 ? 24.824 27.203  5.774  1.00 36.23 ? 202 SER L C   1 
ATOM   1557 O  O   . SER A 1 202 ? 23.789 27.868  5.764  1.00 36.34 ? 202 SER L O   1 
ATOM   1558 C  CB  . SER A 1 202 ? 26.844 28.265  4.695  1.00 36.49 ? 202 SER L CB  1 
ATOM   1559 O  OG  . SER A 1 202 ? 27.411 27.146  4.051  1.00 36.96 ? 202 SER L OG  1 
ATOM   1560 N  N   . SER A 1 203 ? 24.864 25.882  5.605  1.00 35.89 ? 203 SER L N   1 
ATOM   1561 C  CA  . SER A 1 203 ? 23.683 25.034  5.563  1.00 35.31 ? 203 SER L CA  1 
ATOM   1562 C  C   . SER A 1 203 ? 24.000 23.731  6.328  1.00 34.86 ? 203 SER L C   1 
ATOM   1563 O  O   . SER A 1 203 ? 25.178 23.431  6.559  1.00 34.51 ? 203 SER L O   1 
ATOM   1564 C  CB  . SER A 1 203 ? 23.295 24.750  4.106  1.00 35.43 ? 203 SER L CB  1 
ATOM   1565 O  OG  . SER A 1 203 ? 24.398 24.227  3.384  1.00 35.56 ? 203 SER L OG  1 
ATOM   1566 N  N   . PRO A 1 204 ? 22.954 22.966  6.741  1.00 34.25 ? 204 PRO L N   1 
ATOM   1567 C  CA  . PRO A 1 204 ? 23.178 21.745  7.520  1.00 33.59 ? 204 PRO L CA  1 
ATOM   1568 C  C   . PRO A 1 204 ? 24.065 20.712  6.840  1.00 32.93 ? 204 PRO L C   1 
ATOM   1569 O  O   . PRO A 1 204 ? 23.925 20.451  5.646  1.00 32.98 ? 204 PRO L O   1 
ATOM   1570 C  CB  . PRO A 1 204 ? 21.763 21.193  7.721  1.00 33.73 ? 204 PRO L CB  1 
ATOM   1571 C  CG  . PRO A 1 204 ? 20.892 22.410  7.665  1.00 33.80 ? 204 PRO L CG  1 
ATOM   1572 C  CD  . PRO A 1 204 ? 21.512 23.213  6.554  1.00 34.21 ? 204 PRO L CD  1 
ATOM   1573 N  N   . VAL A 1 205 ? 24.984 20.148  7.619  1.00 32.12 ? 205 VAL L N   1 
ATOM   1574 C  CA  . VAL A 1 205 ? 25.799 19.027  7.187  1.00 31.47 ? 205 VAL L CA  1 
ATOM   1575 C  C   . VAL A 1 205 ? 25.112 17.700  7.584  1.00 30.62 ? 205 VAL L C   1 
ATOM   1576 O  O   . VAL A 1 205 ? 24.563 17.578  8.681  1.00 30.76 ? 205 VAL L O   1 
ATOM   1577 C  CB  . VAL A 1 205 ? 27.247 19.169  7.742  1.00 31.66 ? 205 VAL L CB  1 
ATOM   1578 C  CG1 . VAL A 1 205 ? 28.052 17.851  7.650  1.00 32.14 ? 205 VAL L CG1 1 
ATOM   1579 C  CG2 . VAL A 1 205 ? 27.971 20.301  7.007  1.00 31.64 ? 205 VAL L CG2 1 
ATOM   1580 N  N   . THR A 1 206 ? 25.124 16.735  6.667  1.00 29.48 ? 206 THR L N   1 
ATOM   1581 C  CA  . THR A 1 206 ? 24.539 15.414  6.880  1.00 28.18 ? 206 THR L CA  1 
ATOM   1582 C  C   . THR A 1 206 ? 25.580 14.340  6.610  1.00 27.70 ? 206 THR L C   1 
ATOM   1583 O  O   . THR A 1 206 ? 26.275 14.381  5.603  1.00 27.52 ? 206 THR L O   1 
ATOM   1584 C  CB  . THR A 1 206 ? 23.302 15.164  5.957  1.00 28.34 ? 206 THR L CB  1 
ATOM   1585 O  OG1 . THR A 1 206 ? 22.292 16.145  6.217  1.00 27.33 ? 206 THR L OG1 1 
ATOM   1586 C  CG2 . THR A 1 206 ? 22.706 13.745  6.168  1.00 27.32 ? 206 THR L CG2 1 
ATOM   1587 N  N   . LYS A 1 207 ? 25.681 13.386  7.528  1.00 27.26 ? 207 LYS L N   1 
ATOM   1588 C  CA  . LYS A 1 207 ? 26.531 12.229  7.378  1.00 27.18 ? 207 LYS L CA  1 
ATOM   1589 C  C   . LYS A 1 207 ? 25.613 11.035  7.518  1.00 27.35 ? 207 LYS L C   1 
ATOM   1590 O  O   . LYS A 1 207 ? 24.736 11.025  8.379  1.00 27.25 ? 207 LYS L O   1 
ATOM   1591 C  CB  . LYS A 1 207 ? 27.628 12.195  8.448  1.00 26.91 ? 207 LYS L CB  1 
ATOM   1592 C  CG  . LYS A 1 207 ? 28.592 13.374  8.398  1.00 27.53 ? 207 LYS L CG  1 
ATOM   1593 C  CD  . LYS A 1 207 ? 29.533 13.280  7.198  1.00 28.87 ? 207 LYS L CD  1 
ATOM   1594 C  CE  . LYS A 1 207 ? 30.425 14.501  7.067  1.00 29.52 ? 207 LYS L CE  1 
ATOM   1595 N  NZ  . LYS A 1 207 ? 31.463 14.259  6.012  1.00 31.37 ? 207 LYS L NZ  1 
ATOM   1596 N  N   . SER A 1 208 ? 25.804 10.044  6.654  1.00 27.44 ? 208 SER L N   1 
ATOM   1597 C  CA  . SER A 1 208 ? 24.916 8.910   6.605  1.00 27.91 ? 208 SER L CA  1 
ATOM   1598 C  C   . SER A 1 208 ? 25.649 7.621   6.273  1.00 28.16 ? 208 SER L C   1 
ATOM   1599 O  O   . SER A 1 208 ? 26.759 7.636   5.725  1.00 28.28 ? 208 SER L O   1 
ATOM   1600 C  CB  . SER A 1 208 ? 23.811 9.168   5.576  1.00 27.81 ? 208 SER L CB  1 
ATOM   1601 O  OG  . SER A 1 208 ? 24.397 9.428   4.322  1.00 28.73 ? 208 SER L OG  1 
ATOM   1602 N  N   . PHE A 1 209 ? 25.021 6.502   6.610  1.00 28.24 ? 209 PHE L N   1 
ATOM   1603 C  CA  . PHE A 1 209 ? 25.424 5.218   6.047  1.00 28.53 ? 209 PHE L CA  1 
ATOM   1604 C  C   . PHE A 1 209 ? 24.179 4.419   5.632  1.00 29.27 ? 209 PHE L C   1 
ATOM   1605 O  O   . PHE A 1 209 ? 23.073 4.679   6.119  1.00 29.22 ? 209 PHE L O   1 
ATOM   1606 C  CB  . PHE A 1 209 ? 26.296 4.429   7.038  1.00 27.78 ? 209 PHE L CB  1 
ATOM   1607 C  CG  . PHE A 1 209 ? 25.593 4.106   8.325  1.00 26.67 ? 209 PHE L CG  1 
ATOM   1608 C  CD1 . PHE A 1 209 ? 24.797 2.958   8.430  1.00 25.46 ? 209 PHE L CD1 1 
ATOM   1609 C  CD2 . PHE A 1 209 ? 25.702 4.955   9.421  1.00 25.05 ? 209 PHE L CD2 1 
ATOM   1610 C  CE1 . PHE A 1 209 ? 24.130 2.657   9.600  1.00 24.55 ? 209 PHE L CE1 1 
ATOM   1611 C  CE2 . PHE A 1 209 ? 25.022 4.674   10.601 1.00 25.03 ? 209 PHE L CE2 1 
ATOM   1612 C  CZ  . PHE A 1 209 ? 24.240 3.513   10.692 1.00 26.19 ? 209 PHE L CZ  1 
ATOM   1613 N  N   . ASN A 1 210 ? 24.363 3.452   4.736  1.00 30.24 ? 210 ASN L N   1 
ATOM   1614 C  CA  . ASN A 1 210 ? 23.303 2.494   4.414  1.00 31.07 ? 210 ASN L CA  1 
ATOM   1615 C  C   . ASN A 1 210 ? 23.585 1.212   5.174  1.00 31.39 ? 210 ASN L C   1 
ATOM   1616 O  O   . ASN A 1 210 ? 24.676 0.638   5.040  1.00 31.60 ? 210 ASN L O   1 
ATOM   1617 C  CB  . ASN A 1 210 ? 23.264 2.172   2.915  1.00 31.32 ? 210 ASN L CB  1 
ATOM   1618 C  CG  . ASN A 1 210 ? 23.092 3.391   2.050  1.00 32.15 ? 210 ASN L CG  1 
ATOM   1619 O  OD1 . ASN A 1 210 ? 22.301 4.279   2.346  1.00 32.57 ? 210 ASN L OD1 1 
ATOM   1620 N  ND2 . ASN A 1 210 ? 23.821 3.424   0.944  1.00 33.79 ? 210 ASN L ND2 1 
ATOM   1621 N  N   . ARG A 1 211 ? 22.612 0.747   5.957  1.00 31.43 ? 211 ARG L N   1 
ATOM   1622 C  CA  . ARG A 1 211 ? 22.815 -0.439  6.782  1.00 31.33 ? 211 ARG L CA  1 
ATOM   1623 C  C   . ARG A 1 211 ? 23.207 -1.635  5.894  1.00 31.86 ? 211 ARG L C   1 
ATOM   1624 O  O   . ARG A 1 211 ? 24.192 -2.373  6.111  1.00 31.87 ? 211 ARG L O   1 
ATOM   1625 C  CB  . ARG A 1 211 ? 21.548 -0.734  7.586  1.00 30.98 ? 211 ARG L CB  1 
ATOM   1626 C  CG  . ARG A 1 211 ? 21.672 -1.910  8.540  1.00 30.00 ? 211 ARG L CG  1 
ATOM   1627 C  CD  . ARG A 1 211 ? 20.318 -2.364  9.068  1.00 29.15 ? 211 ARG L CD  1 
ATOM   1628 N  NE  . ARG A 1 211 ? 19.317 -2.401  8.004  1.00 27.91 ? 211 ARG L NE  1 
ATOM   1629 C  CZ  . ARG A 1 211 ? 19.175 -3.398  7.138  1.00 26.84 ? 211 ARG L CZ  1 
ATOM   1630 N  NH1 . ARG A 1 211 ? 19.967 -4.471  7.208  1.00 25.82 ? 211 ARG L NH1 1 
ATOM   1631 N  NH2 . ARG A 1 211 ? 18.240 -3.312  6.194  1.00 26.49 ? 211 ARG L NH2 1 
ATOM   1632 O  OXT . ARG A 1 211 ? 22.526 -1.871  4.893  1.00 32.07 ? 211 ARG L OXT 1 
ATOM   1633 N  N   . GLU B 2 1   ? 53.329 19.922  53.490 1.00 33.34 ? 1   GLU H N   1 
ATOM   1634 C  CA  . GLU B 2 1   ? 52.171 20.202  52.593 1.00 32.68 ? 1   GLU H CA  1 
ATOM   1635 C  C   . GLU B 2 1   ? 50.920 20.264  53.445 1.00 32.14 ? 1   GLU H C   1 
ATOM   1636 O  O   . GLU B 2 1   ? 50.814 19.531  54.428 1.00 32.09 ? 1   GLU H O   1 
ATOM   1637 C  CB  . GLU B 2 1   ? 51.952 19.057  51.615 1.00 32.66 ? 1   GLU H CB  1 
ATOM   1638 C  CG  . GLU B 2 1   ? 53.172 18.463  50.956 1.00 33.21 ? 1   GLU H CG  1 
ATOM   1639 C  CD  . GLU B 2 1   ? 52.802 17.886  49.624 1.00 32.95 ? 1   GLU H CD  1 
ATOM   1640 O  OE1 . GLU B 2 1   ? 51.589 17.721  49.368 1.00 33.26 ? 1   GLU H OE1 1 
ATOM   1641 O  OE2 . GLU B 2 1   ? 53.708 17.621  48.809 1.00 36.80 ? 1   GLU H OE2 1 
ATOM   1642 N  N   . VAL B 2 2   ? 49.963 21.088  53.037 1.00 31.84 ? 2   VAL H N   1 
ATOM   1643 C  CA  . VAL B 2 2   ? 48.619 21.083  53.642 1.00 31.90 ? 2   VAL H CA  1 
ATOM   1644 C  C   . VAL B 2 2   ? 47.727 20.095  52.877 1.00 31.68 ? 2   VAL H C   1 
ATOM   1645 O  O   . VAL B 2 2   ? 47.542 20.241  51.664 1.00 32.02 ? 2   VAL H O   1 
ATOM   1646 C  CB  . VAL B 2 2   ? 47.989 22.491  53.641 1.00 31.80 ? 2   VAL H CB  1 
ATOM   1647 C  CG1 . VAL B 2 2   ? 46.563 22.442  54.158 1.00 31.42 ? 2   VAL H CG1 1 
ATOM   1648 C  CG2 . VAL B 2 2   ? 48.835 23.450  54.469 1.00 31.78 ? 2   VAL H CG2 1 
ATOM   1649 N  N   . GLN B 2 3   ? 47.215 19.078  53.578 1.00 31.38 ? 3   GLN H N   1 
ATOM   1650 C  CA  . GLN B 2 3   ? 46.357 18.042  52.962 1.00 30.87 ? 3   GLN H CA  1 
ATOM   1651 C  C   . GLN B 2 3   ? 45.111 17.727  53.803 1.00 29.91 ? 3   GLN H C   1 
ATOM   1652 O  O   . GLN B 2 3   ? 45.156 17.767  55.034 1.00 29.90 ? 3   GLN H O   1 
ATOM   1653 C  CB  . GLN B 2 3   ? 47.123 16.719  52.699 1.00 30.79 ? 3   GLN H CB  1 
ATOM   1654 C  CG  . GLN B 2 3   ? 48.653 16.808  52.529 1.00 31.72 ? 3   GLN H CG  1 
ATOM   1655 C  CD  . GLN B 2 3   ? 49.265 15.644  51.718 1.00 32.12 ? 3   GLN H CD  1 
ATOM   1656 O  OE1 . GLN B 2 3   ? 50.079 14.852  52.232 1.00 31.65 ? 3   GLN H OE1 1 
ATOM   1657 N  NE2 . GLN B 2 3   ? 48.903 15.571  50.435 1.00 33.62 ? 3   GLN H NE2 1 
ATOM   1658 N  N   . LEU B 2 4   ? 44.010 17.415  53.112 1.00 28.82 ? 4   LEU H N   1 
ATOM   1659 C  CA  . LEU B 2 4   ? 42.841 16.744  53.681 1.00 27.32 ? 4   LEU H CA  1 
ATOM   1660 C  C   . LEU B 2 4   ? 42.554 15.555  52.795 1.00 27.03 ? 4   LEU H C   1 
ATOM   1661 O  O   . LEU B 2 4   ? 42.499 15.689  51.574 1.00 26.53 ? 4   LEU H O   1 
ATOM   1662 C  CB  . LEU B 2 4   ? 41.611 17.656  53.699 1.00 26.99 ? 4   LEU H CB  1 
ATOM   1663 C  CG  . LEU B 2 4   ? 41.615 18.863  54.642 1.00 25.82 ? 4   LEU H CG  1 
ATOM   1664 C  CD1 . LEU B 2 4   ? 40.380 19.708  54.420 1.00 23.40 ? 4   LEU H CD1 1 
ATOM   1665 C  CD2 . LEU B 2 4   ? 41.695 18.385  56.082 1.00 24.41 ? 4   LEU H CD2 1 
ATOM   1666 N  N   . VAL B 2 5   ? 42.380 14.385  53.397 1.00 26.69 ? 5   VAL H N   1 
ATOM   1667 C  CA  . VAL B 2 5   ? 42.153 13.174  52.605 1.00 26.66 ? 5   VAL H CA  1 
ATOM   1668 C  C   . VAL B 2 5   ? 40.993 12.359  53.157 1.00 26.43 ? 5   VAL H C   1 
ATOM   1669 O  O   . VAL B 2 5   ? 41.094 11.772  54.243 1.00 26.09 ? 5   VAL H O   1 
ATOM   1670 C  CB  . VAL B 2 5   ? 43.439 12.281  52.480 1.00 26.49 ? 5   VAL H CB  1 
ATOM   1671 C  CG1 . VAL B 2 5   ? 43.160 11.058  51.628 1.00 25.58 ? 5   VAL H CG1 1 
ATOM   1672 C  CG2 . VAL B 2 5   ? 44.593 13.074  51.877 1.00 26.40 ? 5   VAL H CG2 1 
ATOM   1673 N  N   . GLU B 2 6   ? 39.908 12.310  52.387 1.00 26.23 ? 6   GLU H N   1 
ATOM   1674 C  CA  . GLU B 2 6   ? 38.759 11.504  52.758 1.00 26.36 ? 6   GLU H CA  1 
ATOM   1675 C  C   . GLU B 2 6   ? 38.697 10.094  52.149 1.00 26.62 ? 6   GLU H C   1 
ATOM   1676 O  O   . GLU B 2 6   ? 39.299 9.808   51.103 1.00 26.71 ? 6   GLU H O   1 
ATOM   1677 C  CB  . GLU B 2 6   ? 37.435 12.286  52.657 1.00 26.49 ? 6   GLU H CB  1 
ATOM   1678 C  CG  . GLU B 2 6   ? 37.090 12.965  51.365 1.00 26.40 ? 6   GLU H CG  1 
ATOM   1679 C  CD  . GLU B 2 6   ? 37.938 14.192  51.024 1.00 24.68 ? 6   GLU H CD  1 
ATOM   1680 O  OE1 . GLU B 2 6   ? 37.456 15.341  51.134 1.00 23.34 ? 6   GLU H OE1 1 
ATOM   1681 O  OE2 . GLU B 2 6   ? 39.072 13.990  50.563 1.00 25.92 ? 6   GLU H OE2 1 
ATOM   1682 N  N   . SER B 2 7   ? 38.012 9.205   52.866 1.00 26.38 ? 7   SER H N   1 
ATOM   1683 C  CA  . SER B 2 7   ? 37.873 7.803   52.491 1.00 26.67 ? 7   SER H CA  1 
ATOM   1684 C  C   . SER B 2 7   ? 36.624 7.178   53.148 1.00 26.76 ? 7   SER H C   1 
ATOM   1685 O  O   . SER B 2 7   ? 35.990 7.785   54.016 1.00 26.04 ? 7   SER H O   1 
ATOM   1686 C  CB  . SER B 2 7   ? 39.126 7.023   52.893 1.00 26.54 ? 7   SER H CB  1 
ATOM   1687 O  OG  . SER B 2 7   ? 39.443 7.291   54.241 1.00 26.83 ? 7   SER H OG  1 
ATOM   1688 N  N   . GLY B 2 8   ? 36.280 5.969   52.719 1.00 27.18 ? 8   GLY H N   1 
ATOM   1689 C  CA  . GLY B 2 8   ? 35.174 5.224   53.309 1.00 27.94 ? 8   GLY H CA  1 
ATOM   1690 C  C   . GLY B 2 8   ? 33.950 5.184   52.419 1.00 28.52 ? 8   GLY H C   1 
ATOM   1691 O  O   . GLY B 2 8   ? 32.990 4.458   52.702 1.00 28.49 ? 8   GLY H O   1 
ATOM   1692 N  N   . GLY B 2 9   ? 33.981 5.961   51.337 1.00 29.30 ? 9   GLY H N   1 
ATOM   1693 C  CA  . GLY B 2 9   ? 32.879 5.981   50.363 1.00 29.71 ? 9   GLY H CA  1 
ATOM   1694 C  C   . GLY B 2 9   ? 32.746 4.598   49.764 1.00 29.86 ? 9   GLY H C   1 
ATOM   1695 O  O   . GLY B 2 9   ? 33.670 3.791   49.822 1.00 30.00 ? 9   GLY H O   1 
ATOM   1696 N  N   . GLY B 2 10  ? 31.589 4.310   49.200 1.00 30.18 ? 10  GLY H N   1 
ATOM   1697 C  CA  . GLY B 2 10  ? 31.362 3.010   48.605 1.00 30.21 ? 10  GLY H CA  1 
ATOM   1698 C  C   . GLY B 2 10  ? 29.943 2.923   48.127 1.00 30.36 ? 10  GLY H C   1 
ATOM   1699 O  O   . GLY B 2 10  ? 29.166 3.879   48.259 1.00 30.28 ? 10  GLY H O   1 
ATOM   1700 N  N   . LEU B 2 11  ? 29.609 1.766   47.574 1.00 30.51 ? 11  LEU H N   1 
ATOM   1701 C  CA  . LEU B 2 11  ? 28.254 1.481   47.129 1.00 30.78 ? 11  LEU H CA  1 
ATOM   1702 C  C   . LEU B 2 11  ? 27.544 0.641   48.194 1.00 31.10 ? 11  LEU H C   1 
ATOM   1703 O  O   . LEU B 2 11  ? 28.007 -0.437  48.576 1.00 31.17 ? 11  LEU H O   1 
ATOM   1704 C  CB  . LEU B 2 11  ? 28.273 0.792   45.757 1.00 30.50 ? 11  LEU H CB  1 
ATOM   1705 C  CG  . LEU B 2 11  ? 26.991 0.137   45.244 1.00 30.97 ? 11  LEU H CG  1 
ATOM   1706 C  CD1 . LEU B 2 11  ? 25.862 1.132   44.995 1.00 30.56 ? 11  LEU H CD1 1 
ATOM   1707 C  CD2 . LEU B 2 11  ? 27.342 -0.610  43.979 1.00 32.44 ? 11  LEU H CD2 1 
ATOM   1708 N  N   . VAL B 2 12  ? 26.434 1.169   48.690 1.00 31.67 ? 12  VAL H N   1 
ATOM   1709 C  CA  . VAL B 2 12  ? 25.631 0.505   49.711 1.00 32.18 ? 12  VAL H CA  1 
ATOM   1710 C  C   . VAL B 2 12  ? 24.154 0.598   49.345 1.00 32.64 ? 12  VAL H C   1 
ATOM   1711 O  O   . VAL B 2 12  ? 23.753 1.429   48.532 1.00 32.25 ? 12  VAL H O   1 
ATOM   1712 C  CB  . VAL B 2 12  ? 25.876 1.110   51.117 1.00 32.34 ? 12  VAL H CB  1 
ATOM   1713 C  CG1 . VAL B 2 12  ? 27.257 0.709   51.628 1.00 32.69 ? 12  VAL H CG1 1 
ATOM   1714 C  CG2 . VAL B 2 12  ? 25.698 2.645   51.102 1.00 31.72 ? 12  VAL H CG2 1 
ATOM   1715 N  N   . GLN B 2 13  ? 23.344 -0.273  49.930 1.00 33.60 ? 13  GLN H N   1 
ATOM   1716 C  CA  . GLN B 2 13  ? 21.920 -0.269  49.621 1.00 34.26 ? 13  GLN H CA  1 
ATOM   1717 C  C   . GLN B 2 13  ? 21.212 0.725   50.532 1.00 33.64 ? 13  GLN H C   1 
ATOM   1718 O  O   . GLN B 2 13  ? 21.766 1.089   51.584 1.00 33.38 ? 13  GLN H O   1 
ATOM   1719 C  CB  . GLN B 2 13  ? 21.330 -1.671  49.774 1.00 35.02 ? 13  GLN H CB  1 
ATOM   1720 C  CG  . GLN B 2 13  ? 21.942 -2.694  48.853 1.00 37.53 ? 13  GLN H CG  1 
ATOM   1721 C  CD  . GLN B 2 13  ? 20.974 -3.806  48.525 1.00 41.76 ? 13  GLN H CD  1 
ATOM   1722 O  OE1 . GLN B 2 13  ? 19.981 -3.592  47.816 1.00 43.87 ? 13  GLN H OE1 1 
ATOM   1723 N  NE2 . GLN B 2 13  ? 21.254 -5.008  49.034 1.00 42.71 ? 13  GLN H NE2 1 
ATOM   1724 N  N   . PRO B 2 14  ? 20.013 1.198   50.115 1.00 33.03 ? 14  PRO H N   1 
ATOM   1725 C  CA  . PRO B 2 14  ? 19.163 2.017   50.969 1.00 32.88 ? 14  PRO H CA  1 
ATOM   1726 C  C   . PRO B 2 14  ? 18.920 1.380   52.357 1.00 33.00 ? 14  PRO H C   1 
ATOM   1727 O  O   . PRO B 2 14  ? 18.703 0.167   52.461 1.00 32.96 ? 14  PRO H O   1 
ATOM   1728 C  CB  . PRO B 2 14  ? 17.868 2.112   50.165 1.00 32.91 ? 14  PRO H CB  1 
ATOM   1729 C  CG  . PRO B 2 14  ? 18.332 2.027   48.743 1.00 32.56 ? 14  PRO H CG  1 
ATOM   1730 C  CD  . PRO B 2 14  ? 19.410 1.010   48.779 1.00 32.78 ? 14  PRO H CD  1 
ATOM   1731 N  N   . GLY B 2 15  ? 19.002 2.195   53.406 1.00 32.65 ? 15  GLY H N   1 
ATOM   1732 C  CA  . GLY B 2 15  ? 18.836 1.719   54.767 1.00 32.80 ? 15  GLY H CA  1 
ATOM   1733 C  C   . GLY B 2 15  ? 20.119 1.282   55.450 1.00 33.01 ? 15  GLY H C   1 
ATOM   1734 O  O   . GLY B 2 15  ? 20.155 1.159   56.667 1.00 32.69 ? 15  GLY H O   1 
ATOM   1735 N  N   . ARG B 2 16  ? 21.171 1.032   54.672 1.00 33.84 ? 16  ARG H N   1 
ATOM   1736 C  CA  . ARG B 2 16  ? 22.463 0.638   55.236 1.00 34.69 ? 16  ARG H CA  1 
ATOM   1737 C  C   . ARG B 2 16  ? 23.314 1.831   55.679 1.00 34.52 ? 16  ARG H C   1 
ATOM   1738 O  O   . ARG B 2 16  ? 22.919 2.985   55.508 1.00 34.18 ? 16  ARG H O   1 
ATOM   1739 C  CB  . ARG B 2 16  ? 23.240 -0.302  54.298 1.00 35.33 ? 16  ARG H CB  1 
ATOM   1740 C  CG  . ARG B 2 16  ? 22.988 -1.800  54.559 1.00 38.26 ? 16  ARG H CG  1 
ATOM   1741 C  CD  . ARG B 2 16  ? 21.702 -2.311  53.881 1.00 42.84 ? 16  ARG H CD  1 
ATOM   1742 N  NE  . ARG B 2 16  ? 21.720 -3.766  53.680 1.00 46.52 ? 16  ARG H NE  1 
ATOM   1743 C  CZ  . ARG B 2 16  ? 22.458 -4.406  52.765 1.00 47.49 ? 16  ARG H CZ  1 
ATOM   1744 N  NH1 . ARG B 2 16  ? 23.256 -3.737  51.936 1.00 48.66 ? 16  ARG H NH1 1 
ATOM   1745 N  NH2 . ARG B 2 16  ? 22.403 -5.732  52.683 1.00 48.22 ? 16  ARG H NH2 1 
ATOM   1746 N  N   . SER B 2 17  ? 24.467 1.524   56.274 1.00 34.70 ? 17  SER H N   1 
ATOM   1747 C  CA  . SER B 2 17  ? 25.344 2.508   56.901 1.00 34.57 ? 17  SER H CA  1 
ATOM   1748 C  C   . SER B 2 17  ? 26.702 2.625   56.199 1.00 34.27 ? 17  SER H C   1 
ATOM   1749 O  O   . SER B 2 17  ? 27.153 1.681   55.547 1.00 34.22 ? 17  SER H O   1 
ATOM   1750 C  CB  . SER B 2 17  ? 25.556 2.156   58.385 1.00 34.61 ? 17  SER H CB  1 
ATOM   1751 O  OG  . SER B 2 17  ? 24.455 2.566   59.177 1.00 34.61 ? 17  SER H OG  1 
ATOM   1752 N  N   . LEU B 2 18  ? 27.326 3.800   56.344 1.00 33.79 ? 18  LEU H N   1 
ATOM   1753 C  CA  . LEU B 2 18  ? 28.721 4.057   55.939 1.00 33.38 ? 18  LEU H CA  1 
ATOM   1754 C  C   . LEU B 2 18  ? 29.388 5.028   56.905 1.00 32.85 ? 18  LEU H C   1 
ATOM   1755 O  O   . LEU B 2 18  ? 28.755 5.983   57.373 1.00 32.72 ? 18  LEU H O   1 
ATOM   1756 C  CB  . LEU B 2 18  ? 28.807 4.669   54.534 1.00 33.26 ? 18  LEU H CB  1 
ATOM   1757 C  CG  . LEU B 2 18  ? 28.798 3.813   53.271 1.00 33.91 ? 18  LEU H CG  1 
ATOM   1758 C  CD1 . LEU B 2 18  ? 28.759 4.711   52.029 1.00 33.93 ? 18  LEU H CD1 1 
ATOM   1759 C  CD2 . LEU B 2 18  ? 29.988 2.877   53.206 1.00 33.77 ? 18  LEU H CD2 1 
ATOM   1760 N  N   . ARG B 2 19  ? 30.670 4.789   57.177 1.00 32.27 ? 19  ARG H N   1 
ATOM   1761 C  CA  . ARG B 2 19  ? 31.488 5.709   57.973 1.00 31.86 ? 19  ARG H CA  1 
ATOM   1762 C  C   . ARG B 2 19  ? 32.586 6.336   57.111 1.00 30.33 ? 19  ARG H C   1 
ATOM   1763 O  O   . ARG B 2 19  ? 33.402 5.628   56.536 1.00 29.76 ? 19  ARG H O   1 
ATOM   1764 C  CB  . ARG B 2 19  ? 32.094 5.004   59.198 1.00 31.71 ? 19  ARG H CB  1 
ATOM   1765 C  CG  . ARG B 2 19  ? 32.774 5.951   60.194 1.00 32.84 ? 19  ARG H CG  1 
ATOM   1766 C  CD  . ARG B 2 19  ? 33.187 5.213   61.462 1.00 33.76 ? 19  ARG H CD  1 
ATOM   1767 N  NE  . ARG B 2 19  ? 33.749 6.072   62.517 1.00 36.56 ? 19  ARG H NE  1 
ATOM   1768 C  CZ  . ARG B 2 19  ? 35.056 6.246   62.732 1.00 37.67 ? 19  ARG H CZ  1 
ATOM   1769 N  NH1 . ARG B 2 19  ? 35.954 5.648   61.952 1.00 38.50 ? 19  ARG H NH1 1 
ATOM   1770 N  NH2 . ARG B 2 19  ? 35.474 7.023   63.731 1.00 38.63 ? 19  ARG H NH2 1 
ATOM   1771 N  N   . LEU B 2 20  ? 32.585 7.665   57.032 1.00 29.15 ? 20  LEU H N   1 
ATOM   1772 C  CA  . LEU B 2 20  ? 33.614 8.408   56.302 1.00 28.02 ? 20  LEU H CA  1 
ATOM   1773 C  C   . LEU B 2 20  ? 34.675 8.958   57.241 1.00 27.61 ? 20  LEU H C   1 
ATOM   1774 O  O   . LEU B 2 20  ? 34.361 9.396   58.349 1.00 27.13 ? 20  LEU H O   1 
ATOM   1775 C  CB  . LEU B 2 20  ? 33.012 9.565   55.488 1.00 27.56 ? 20  LEU H CB  1 
ATOM   1776 C  CG  . LEU B 2 20  ? 31.760 9.317   54.650 1.00 26.33 ? 20  LEU H CG  1 
ATOM   1777 C  CD1 . LEU B 2 20  ? 31.421 10.589  53.864 1.00 24.48 ? 20  LEU H CD1 1 
ATOM   1778 C  CD2 . LEU B 2 20  ? 31.879 8.080   53.735 1.00 23.89 ? 20  LEU H CD2 1 
ATOM   1779 N  N   . SER B 2 21  ? 35.928 8.921   56.780 1.00 27.27 ? 21  SER H N   1 
ATOM   1780 C  CA  . SER B 2 21  ? 37.053 9.530   57.480 1.00 26.84 ? 21  SER H CA  1 
ATOM   1781 C  C   . SER B 2 21  ? 37.632 10.642  56.627 1.00 26.45 ? 21  SER H C   1 
ATOM   1782 O  O   . SER B 2 21  ? 37.592 10.583  55.399 1.00 26.18 ? 21  SER H O   1 
ATOM   1783 C  CB  . SER B 2 21  ? 38.156 8.507   57.752 1.00 26.82 ? 21  SER H CB  1 
ATOM   1784 O  OG  . SER B 2 21  ? 37.643 7.340   58.340 1.00 27.63 ? 21  SER H OG  1 
ATOM   1785 N  N   . CYS B 2 22  ? 38.175 11.647  57.299 1.00 26.08 ? 22  CYS H N   1 
ATOM   1786 C  CA  . CYS B 2 22  ? 38.895 12.728  56.666 1.00 25.81 ? 22  CYS H CA  1 
ATOM   1787 C  C   . CYS B 2 22  ? 40.173 13.024  57.460 1.00 25.77 ? 22  CYS H C   1 
ATOM   1788 O  O   . CYS B 2 22  ? 40.127 13.661  58.517 1.00 25.29 ? 22  CYS H O   1 
ATOM   1789 C  CB  . CYS B 2 22  ? 38.014 13.963  56.593 1.00 26.07 ? 22  CYS H CB  1 
ATOM   1790 S  SG  . CYS B 2 22  ? 38.913 15.481  56.311 1.00 25.63 ? 22  CYS H SG  1 
ATOM   1791 N  N   . ALA B 2 23  ? 41.302 12.555  56.927 1.00 25.66 ? 23  ALA H N   1 
ATOM   1792 C  CA  . ALA B 2 23  ? 42.595 12.658  57.590 1.00 25.88 ? 23  ALA H CA  1 
ATOM   1793 C  C   . ALA B 2 23  ? 43.295 13.937  57.171 1.00 25.89 ? 23  ALA H C   1 
ATOM   1794 O  O   . ALA B 2 23  ? 43.472 14.175  55.986 1.00 26.02 ? 23  ALA H O   1 
ATOM   1795 C  CB  . ALA B 2 23  ? 43.468 11.416  57.265 1.00 25.60 ? 23  ALA H CB  1 
ATOM   1796 N  N   . ALA B 2 24  ? 43.673 14.760  58.147 1.00 26.30 ? 24  ALA H N   1 
ATOM   1797 C  CA  . ALA B 2 24  ? 44.364 16.018  57.890 1.00 26.89 ? 24  ALA H CA  1 
ATOM   1798 C  C   . ALA B 2 24  ? 45.827 15.927  58.282 1.00 27.54 ? 24  ALA H C   1 
ATOM   1799 O  O   . ALA B 2 24  ? 46.174 15.203  59.211 1.00 27.67 ? 24  ALA H O   1 
ATOM   1800 C  CB  . ALA B 2 24  ? 43.712 17.148  58.654 1.00 26.72 ? 24  ALA H CB  1 
ATOM   1801 N  N   . SER B 2 25  ? 46.679 16.663  57.566 1.00 28.46 ? 25  SER H N   1 
ATOM   1802 C  CA  . SER B 2 25  ? 48.066 16.888  57.994 1.00 29.35 ? 25  SER H CA  1 
ATOM   1803 C  C   . SER B 2 25  ? 48.618 18.190  57.403 1.00 29.14 ? 25  SER H C   1 
ATOM   1804 O  O   . SER B 2 25  ? 48.073 18.716  56.432 1.00 29.11 ? 25  SER H O   1 
ATOM   1805 C  CB  . SER B 2 25  ? 48.951 15.671  57.655 1.00 29.76 ? 25  SER H CB  1 
ATOM   1806 O  OG  . SER B 2 25  ? 48.862 15.347  56.275 1.00 31.51 ? 25  SER H OG  1 
ATOM   1807 N  N   . GLY B 2 26  ? 49.678 18.725  58.010 1.00 29.33 ? 26  GLY H N   1 
ATOM   1808 C  CA  . GLY B 2 26  ? 50.320 19.940  57.496 1.00 29.31 ? 26  GLY H CA  1 
ATOM   1809 C  C   . GLY B 2 26  ? 49.774 21.286  57.956 1.00 29.32 ? 26  GLY H C   1 
ATOM   1810 O  O   . GLY B 2 26  ? 50.275 22.341  57.552 1.00 29.39 ? 26  GLY H O   1 
ATOM   1811 N  N   . PHE B 2 27  ? 48.739 21.264  58.792 1.00 29.54 ? 27  PHE H N   1 
ATOM   1812 C  CA  . PHE B 2 27  ? 48.198 22.498  59.404 1.00 29.10 ? 27  PHE H CA  1 
ATOM   1813 C  C   . PHE B 2 27  ? 47.681 22.144  60.786 1.00 28.91 ? 27  PHE H C   1 
ATOM   1814 O  O   . PHE B 2 27  ? 47.518 20.967  61.093 1.00 29.03 ? 27  PHE H O   1 
ATOM   1815 C  CB  . PHE B 2 27  ? 47.115 23.170  58.528 1.00 28.92 ? 27  PHE H CB  1 
ATOM   1816 C  CG  . PHE B 2 27  ? 45.797 22.423  58.476 1.00 28.92 ? 27  PHE H CG  1 
ATOM   1817 C  CD1 . PHE B 2 27  ? 45.614 21.356  57.588 1.00 28.26 ? 27  PHE H CD1 1 
ATOM   1818 C  CD2 . PHE B 2 27  ? 44.736 22.786  59.321 1.00 27.99 ? 27  PHE H CD2 1 
ATOM   1819 C  CE1 . PHE B 2 27  ? 44.413 20.658  57.546 1.00 27.86 ? 27  PHE H CE1 1 
ATOM   1820 C  CE2 . PHE B 2 27  ? 43.522 22.096  59.276 1.00 27.69 ? 27  PHE H CE2 1 
ATOM   1821 C  CZ  . PHE B 2 27  ? 43.358 21.029  58.384 1.00 28.05 ? 27  PHE H CZ  1 
ATOM   1822 N  N   . THR B 2 28  ? 47.449 23.152  61.624 1.00 28.64 ? 28  THR H N   1 
ATOM   1823 C  CA  . THR B 2 28  ? 47.008 22.911  63.000 1.00 28.25 ? 28  THR H CA  1 
ATOM   1824 C  C   . THR B 2 28  ? 45.521 22.546  63.025 1.00 27.84 ? 28  THR H C   1 
ATOM   1825 O  O   . THR B 2 28  ? 44.667 23.411  63.183 1.00 28.15 ? 28  THR H O   1 
ATOM   1826 C  CB  . THR B 2 28  ? 47.314 24.117  63.924 1.00 28.15 ? 28  THR H CB  1 
ATOM   1827 O  OG1 . THR B 2 28  ? 48.662 24.540  63.711 1.00 28.28 ? 28  THR H OG1 1 
ATOM   1828 C  CG2 . THR B 2 28  ? 47.176 23.726  65.375 1.00 28.17 ? 28  THR H CG2 1 
ATOM   1829 N  N   . PHE B 2 29  ? 45.236 21.255  62.858 1.00 27.22 ? 29  PHE H N   1 
ATOM   1830 C  CA  . PHE B 2 29  ? 43.861 20.741  62.770 1.00 26.85 ? 29  PHE H CA  1 
ATOM   1831 C  C   . PHE B 2 29  ? 42.995 21.153  63.981 1.00 26.72 ? 29  PHE H C   1 
ATOM   1832 O  O   . PHE B 2 29  ? 41.845 21.558  63.806 1.00 27.11 ? 29  PHE H O   1 
ATOM   1833 C  CB  . PHE B 2 29  ? 43.890 19.215  62.561 1.00 26.45 ? 29  PHE H CB  1 
ATOM   1834 C  CG  . PHE B 2 29  ? 42.536 18.558  62.538 1.00 26.62 ? 29  PHE H CG  1 
ATOM   1835 C  CD1 . PHE B 2 29  ? 41.980 18.040  63.699 1.00 25.99 ? 29  PHE H CD1 1 
ATOM   1836 C  CD2 . PHE B 2 29  ? 41.829 18.428  61.341 1.00 26.62 ? 29  PHE H CD2 1 
ATOM   1837 C  CE1 . PHE B 2 29  ? 40.736 17.427  63.667 1.00 26.82 ? 29  PHE H CE1 1 
ATOM   1838 C  CE2 . PHE B 2 29  ? 40.596 17.814  61.299 1.00 26.39 ? 29  PHE H CE2 1 
ATOM   1839 C  CZ  . PHE B 2 29  ? 40.040 17.318  62.462 1.00 26.45 ? 29  PHE H CZ  1 
ATOM   1840 N  N   . ASN B 2 30  ? 43.570 21.097  65.183 1.00 26.09 ? 30  ASN H N   1 
ATOM   1841 C  CA  . ASN B 2 30  ? 42.845 21.412  66.411 1.00 25.81 ? 30  ASN H CA  1 
ATOM   1842 C  C   . ASN B 2 30  ? 42.380 22.863  66.598 1.00 25.54 ? 30  ASN H C   1 
ATOM   1843 O  O   . ASN B 2 30  ? 41.570 23.124  67.485 1.00 25.80 ? 30  ASN H O   1 
ATOM   1844 C  CB  . ASN B 2 30  ? 43.572 20.866  67.673 1.00 25.58 ? 30  ASN H CB  1 
ATOM   1845 C  CG  . ASN B 2 30  ? 44.901 21.569  67.983 1.00 25.75 ? 30  ASN H CG  1 
ATOM   1846 O  OD1 . ASN B 2 30  ? 45.719 21.014  68.689 1.00 27.20 ? 30  ASN H OD1 1 
ATOM   1847 N  ND2 . ASN B 2 30  ? 45.110 22.775  67.478 1.00 25.31 ? 30  ASN H ND2 1 
ATOM   1848 N  N   . ASP B 2 31  ? 42.869 23.778  65.755 1.00 24.87 ? 31  ASP H N   1 
ATOM   1849 C  CA  . ASP B 2 31  ? 42.512 25.195  65.805 1.00 24.70 ? 31  ASP H CA  1 
ATOM   1850 C  C   . ASP B 2 31  ? 41.230 25.543  65.040 1.00 24.19 ? 31  ASP H C   1 
ATOM   1851 O  O   . ASP B 2 31  ? 40.679 26.626  65.226 1.00 24.54 ? 31  ASP H O   1 
ATOM   1852 C  CB  . ASP B 2 31  ? 43.670 26.092  65.265 1.00 25.07 ? 31  ASP H CB  1 
ATOM   1853 C  CG  . ASP B 2 31  ? 44.797 26.294  66.275 1.00 25.45 ? 31  ASP H CG  1 
ATOM   1854 O  OD1 . ASP B 2 31  ? 44.664 25.776  67.390 1.00 23.85 ? 31  ASP H OD1 1 
ATOM   1855 O  OD2 . ASP B 2 31  ? 45.829 26.972  65.971 1.00 28.73 ? 31  ASP H OD2 1 
ATOM   1856 N  N   . TYR B 2 32  ? 40.763 24.636  64.187 1.00 23.79 ? 32  TYR H N   1 
ATOM   1857 C  CA  . TYR B 2 32  ? 39.767 24.983  63.174 1.00 23.34 ? 32  TYR H CA  1 
ATOM   1858 C  C   . TYR B 2 32  ? 38.489 24.162  63.214 1.00 23.04 ? 32  TYR H C   1 
ATOM   1859 O  O   . TYR B 2 32  ? 38.499 22.971  63.565 1.00 22.80 ? 32  TYR H O   1 
ATOM   1860 C  CB  . TYR B 2 32  ? 40.371 24.894  61.751 1.00 23.68 ? 32  TYR H CB  1 
ATOM   1861 C  CG  . TYR B 2 32  ? 41.610 25.731  61.587 1.00 23.13 ? 32  TYR H CG  1 
ATOM   1862 C  CD1 . TYR B 2 32  ? 42.876 25.153  61.689 1.00 22.74 ? 32  TYR H CD1 1 
ATOM   1863 C  CD2 . TYR B 2 32  ? 41.519 27.106  61.373 1.00 22.98 ? 32  TYR H CD2 1 
ATOM   1864 C  CE1 . TYR B 2 32  ? 44.027 25.919  61.565 1.00 23.79 ? 32  TYR H CE1 1 
ATOM   1865 C  CE2 . TYR B 2 32  ? 42.674 27.891  61.241 1.00 24.19 ? 32  TYR H CE2 1 
ATOM   1866 C  CZ  . TYR B 2 32  ? 43.919 27.278  61.342 1.00 24.20 ? 32  TYR H CZ  1 
ATOM   1867 O  OH  . TYR B 2 32  ? 45.066 28.030  61.225 1.00 25.39 ? 32  TYR H OH  1 
ATOM   1868 N  N   . ALA B 2 33  ? 37.398 24.833  62.828 1.00 22.38 ? 33  ALA H N   1 
ATOM   1869 C  CA  . ALA B 2 33  ? 36.140 24.203  62.502 1.00 21.37 ? 33  ALA H CA  1 
ATOM   1870 C  C   . ALA B 2 33  ? 36.266 23.364  61.225 1.00 21.03 ? 33  ALA H C   1 
ATOM   1871 O  O   . ALA B 2 33  ? 36.973 23.715  60.274 1.00 20.58 ? 33  ALA H O   1 
ATOM   1872 C  CB  . ALA B 2 33  ? 35.039 25.260  62.367 1.00 21.51 ? 33  ALA H CB  1 
ATOM   1873 N  N   . MET B 2 34  ? 35.582 22.228  61.232 1.00 20.65 ? 34  MET H N   1 
ATOM   1874 C  CA  . MET B 2 34  ? 35.613 21.307  60.132 1.00 20.20 ? 34  MET H CA  1 
ATOM   1875 C  C   . MET B 2 34  ? 34.187 21.081  59.615 1.00 19.75 ? 34  MET H C   1 
ATOM   1876 O  O   . MET B 2 34  ? 33.227 21.224  60.356 1.00 18.84 ? 34  MET H O   1 
ATOM   1877 C  CB  . MET B 2 34  ? 36.305 20.005  60.545 1.00 20.59 ? 34  MET H CB  1 
ATOM   1878 C  CG  . MET B 2 34  ? 37.837 20.095  60.717 1.00 21.71 ? 34  MET H CG  1 
ATOM   1879 S  SD  . MET B 2 34  ? 38.807 20.664  59.281 1.00 24.61 ? 34  MET H SD  1 
ATOM   1880 C  CE  . MET B 2 34  ? 38.538 19.313  58.117 1.00 21.83 ? 34  MET H CE  1 
ATOM   1881 N  N   . HIS B 2 35  ? 34.084 20.752  58.327 1.00 19.48 ? 35  HIS H N   1 
ATOM   1882 C  CA  . HIS B 2 35  ? 32.825 20.647  57.616 1.00 19.46 ? 35  HIS H CA  1 
ATOM   1883 C  C   . HIS B 2 35  ? 32.859 19.404  56.784 1.00 19.58 ? 35  HIS H C   1 
ATOM   1884 O  O   . HIS B 2 35  ? 33.923 19.011  56.292 1.00 19.65 ? 35  HIS H O   1 
ATOM   1885 C  CB  . HIS B 2 35  ? 32.639 21.797  56.621 1.00 19.01 ? 35  HIS H CB  1 
ATOM   1886 C  CG  . HIS B 2 35  ? 32.627 23.158  57.236 1.00 20.19 ? 35  HIS H CG  1 
ATOM   1887 N  ND1 . HIS B 2 35  ? 33.684 24.039  57.117 1.00 21.94 ? 35  HIS H ND1 1 
ATOM   1888 C  CD2 . HIS B 2 35  ? 31.668 23.815  57.923 1.00 19.82 ? 35  HIS H CD2 1 
ATOM   1889 C  CE1 . HIS B 2 35  ? 33.382 25.169  57.725 1.00 21.29 ? 35  HIS H CE1 1 
ATOM   1890 N  NE2 . HIS B 2 35  ? 32.163 25.060  58.221 1.00 21.93 ? 35  HIS H NE2 1 
ATOM   1891 N  N   . TRP B 2 36  ? 31.680 18.813  56.605 1.00 19.93 ? 36  TRP H N   1 
ATOM   1892 C  CA  . TRP B 2 36  ? 31.396 17.919  55.480 1.00 19.92 ? 36  TRP H CA  1 
ATOM   1893 C  C   . TRP B 2 36  ? 30.460 18.622  54.479 1.00 19.86 ? 36  TRP H C   1 
ATOM   1894 O  O   . TRP B 2 36  ? 29.434 19.181  54.859 1.00 19.49 ? 36  TRP H O   1 
ATOM   1895 C  CB  . TRP B 2 36  ? 30.754 16.629  55.983 1.00 20.14 ? 36  TRP H CB  1 
ATOM   1896 C  CG  . TRP B 2 36  ? 31.713 15.697  56.649 1.00 20.09 ? 36  TRP H CG  1 
ATOM   1897 C  CD1 . TRP B 2 36  ? 31.868 15.511  57.989 1.00 20.06 ? 36  TRP H CD1 1 
ATOM   1898 C  CD2 . TRP B 2 36  ? 32.642 14.812  56.006 1.00 20.84 ? 36  TRP H CD2 1 
ATOM   1899 N  NE1 . TRP B 2 36  ? 32.835 14.557  58.226 1.00 21.13 ? 36  TRP H NE1 1 
ATOM   1900 C  CE2 . TRP B 2 36  ? 33.336 14.123  57.026 1.00 21.04 ? 36  TRP H CE2 1 
ATOM   1901 C  CE3 . TRP B 2 36  ? 32.966 14.540  54.662 1.00 21.61 ? 36  TRP H CE3 1 
ATOM   1902 C  CZ2 . TRP B 2 36  ? 34.332 13.168  56.748 1.00 20.02 ? 36  TRP H CZ2 1 
ATOM   1903 C  CZ3 . TRP B 2 36  ? 33.971 13.580  54.386 1.00 20.55 ? 36  TRP H CZ3 1 
ATOM   1904 C  CH2 . TRP B 2 36  ? 34.631 12.916  55.428 1.00 19.83 ? 36  TRP H CH2 1 
ATOM   1905 N  N   . VAL B 2 37  ? 30.840 18.618  53.205 1.00 20.27 ? 37  VAL H N   1 
ATOM   1906 C  CA  . VAL B 2 37  ? 30.046 19.214  52.129 1.00 20.58 ? 37  VAL H CA  1 
ATOM   1907 C  C   . VAL B 2 37  ? 29.954 18.180  51.012 1.00 21.24 ? 37  VAL H C   1 
ATOM   1908 O  O   . VAL B 2 37  ? 30.949 17.552  50.655 1.00 21.70 ? 37  VAL H O   1 
ATOM   1909 C  CB  . VAL B 2 37  ? 30.671 20.552  51.596 1.00 20.69 ? 37  VAL H CB  1 
ATOM   1910 C  CG1 . VAL B 2 37  ? 29.918 21.080  50.358 1.00 19.55 ? 37  VAL H CG1 1 
ATOM   1911 C  CG2 . VAL B 2 37  ? 30.721 21.635  52.710 1.00 20.58 ? 37  VAL H CG2 1 
ATOM   1912 N  N   . ARG B 2 38  ? 28.757 17.973  50.475 1.00 21.63 ? 38  ARG H N   1 
ATOM   1913 C  CA  . ARG B 2 38  ? 28.584 16.960  49.451 1.00 21.56 ? 38  ARG H CA  1 
ATOM   1914 C  C   . ARG B 2 38  ? 28.149 17.618  48.140 1.00 22.13 ? 38  ARG H C   1 
ATOM   1915 O  O   . ARG B 2 38  ? 27.688 18.755  48.149 1.00 22.33 ? 38  ARG H O   1 
ATOM   1916 C  CB  . ARG B 2 38  ? 27.592 15.889  49.918 1.00 21.23 ? 38  ARG H CB  1 
ATOM   1917 C  CG  . ARG B 2 38  ? 26.153 16.339  49.930 1.00 20.72 ? 38  ARG H CG  1 
ATOM   1918 C  CD  . ARG B 2 38  ? 25.297 15.251  50.439 1.00 21.47 ? 38  ARG H CD  1 
ATOM   1919 N  NE  . ARG B 2 38  ? 23.879 15.580  50.371 1.00 22.78 ? 38  ARG H NE  1 
ATOM   1920 C  CZ  . ARG B 2 38  ? 22.936 14.965  51.085 1.00 23.49 ? 38  ARG H CZ  1 
ATOM   1921 N  NH1 . ARG B 2 38  ? 23.261 13.991  51.942 1.00 23.59 ? 38  ARG H NH1 1 
ATOM   1922 N  NH2 . ARG B 2 38  ? 21.670 15.325  50.944 1.00 22.73 ? 38  ARG H NH2 1 
ATOM   1923 N  N   . GLN B 2 39  ? 28.317 16.895  47.031 1.00 22.52 ? 39  GLN H N   1 
ATOM   1924 C  CA  . GLN B 2 39  ? 27.986 17.374  45.694 1.00 23.13 ? 39  GLN H CA  1 
ATOM   1925 C  C   . GLN B 2 39  ? 27.508 16.200  44.814 1.00 24.06 ? 39  GLN H C   1 
ATOM   1926 O  O   . GLN B 2 39  ? 28.280 15.271  44.503 1.00 23.20 ? 39  GLN H O   1 
ATOM   1927 C  CB  . GLN B 2 39  ? 29.201 18.076  45.056 1.00 23.10 ? 39  GLN H CB  1 
ATOM   1928 C  CG  . GLN B 2 39  ? 28.944 18.741  43.686 1.00 22.98 ? 39  GLN H CG  1 
ATOM   1929 C  CD  . GLN B 2 39  ? 30.079 19.662  43.234 1.00 22.73 ? 39  GLN H CD  1 
ATOM   1930 O  OE1 . GLN B 2 39  ? 31.263 19.371  43.428 1.00 21.98 ? 39  GLN H OE1 1 
ATOM   1931 N  NE2 . GLN B 2 39  ? 29.716 20.776  42.617 1.00 21.71 ? 39  GLN H NE2 1 
ATOM   1932 N  N   . ALA B 2 40  ? 26.234 16.241  44.422 1.00 25.43 ? 40  ALA H N   1 
ATOM   1933 C  CA  . ALA B 2 40  ? 25.696 15.255  43.470 1.00 27.18 ? 40  ALA H CA  1 
ATOM   1934 C  C   . ALA B 2 40  ? 26.263 15.491  42.060 1.00 28.59 ? 40  ALA H C   1 
ATOM   1935 O  O   . ALA B 2 40  ? 26.502 16.637  41.661 1.00 27.99 ? 40  ALA H O   1 
ATOM   1936 C  CB  . ALA B 2 40  ? 24.179 15.281  43.461 1.00 26.92 ? 40  ALA H CB  1 
ATOM   1937 N  N   . PRO B 2 41  ? 26.504 14.397  41.308 1.00 30.37 ? 41  PRO H N   1 
ATOM   1938 C  CA  . PRO B 2 41  ? 27.047 14.481  39.944 1.00 30.87 ? 41  PRO H CA  1 
ATOM   1939 C  C   . PRO B 2 41  ? 26.222 15.432  39.091 1.00 31.39 ? 41  PRO H C   1 
ATOM   1940 O  O   . PRO B 2 41  ? 24.993 15.305  39.040 1.00 31.82 ? 41  PRO H O   1 
ATOM   1941 C  CB  . PRO B 2 41  ? 26.910 13.045  39.415 1.00 31.40 ? 41  PRO H CB  1 
ATOM   1942 C  CG  . PRO B 2 41  ? 25.998 12.315  40.442 1.00 31.43 ? 41  PRO H CG  1 
ATOM   1943 C  CD  . PRO B 2 41  ? 26.264 13.001  41.729 1.00 30.56 ? 41  PRO H CD  1 
ATOM   1944 N  N   . GLY B 2 42  ? 26.897 16.390  38.454 1.00 31.30 ? 42  GLY H N   1 
ATOM   1945 C  CA  . GLY B 2 42  ? 26.230 17.466  37.725 1.00 31.09 ? 42  GLY H CA  1 
ATOM   1946 C  C   . GLY B 2 42  ? 25.540 18.551  38.552 1.00 30.64 ? 42  GLY H C   1 
ATOM   1947 O  O   . GLY B 2 42  ? 24.959 19.483  37.995 1.00 30.61 ? 42  GLY H O   1 
ATOM   1948 N  N   . LYS B 2 43  ? 25.588 18.461  39.876 1.00 30.10 ? 43  LYS H N   1 
ATOM   1949 C  CA  . LYS B 2 43  ? 24.842 19.438  40.690 1.00 29.52 ? 43  LYS H CA  1 
ATOM   1950 C  C   . LYS B 2 43  ? 25.769 20.363  41.484 1.00 28.10 ? 43  LYS H C   1 
ATOM   1951 O  O   . LYS B 2 43  ? 26.989 20.277  41.352 1.00 27.53 ? 43  LYS H O   1 
ATOM   1952 C  CB  . LYS B 2 43  ? 23.774 18.755  41.578 1.00 30.25 ? 43  LYS H CB  1 
ATOM   1953 C  CG  . LYS B 2 43  ? 22.847 17.768  40.829 1.00 30.93 ? 43  LYS H CG  1 
ATOM   1954 C  CD  . LYS B 2 43  ? 21.707 18.469  40.088 1.00 34.11 ? 43  LYS H CD  1 
ATOM   1955 C  CE  . LYS B 2 43  ? 20.885 17.497  39.215 1.00 32.80 ? 43  LYS H CE  1 
ATOM   1956 N  NZ  . LYS B 2 43  ? 21.525 17.187  37.876 1.00 34.41 ? 43  LYS H NZ  1 
ATOM   1957 N  N   . GLY B 2 44  ? 25.178 21.261  42.269 1.00 26.70 ? 44  GLY H N   1 
ATOM   1958 C  CA  . GLY B 2 44  ? 25.938 22.177  43.109 1.00 25.93 ? 44  GLY H CA  1 
ATOM   1959 C  C   . GLY B 2 44  ? 26.304 21.602  44.474 1.00 25.51 ? 44  GLY H C   1 
ATOM   1960 O  O   . GLY B 2 44  ? 25.988 20.448  44.792 1.00 25.37 ? 44  GLY H O   1 
ATOM   1961 N  N   . LEU B 2 45  ? 26.976 22.422  45.276 1.00 24.97 ? 45  LEU H N   1 
ATOM   1962 C  CA  . LEU B 2 45  ? 27.442 22.028  46.605 1.00 24.06 ? 45  LEU H CA  1 
ATOM   1963 C  C   . LEU B 2 45  ? 26.320 22.120  47.629 1.00 24.14 ? 45  LEU H C   1 
ATOM   1964 O  O   . LEU B 2 45  ? 25.495 23.034  47.585 1.00 23.79 ? 45  LEU H O   1 
ATOM   1965 C  CB  . LEU B 2 45  ? 28.604 22.916  47.039 1.00 23.77 ? 45  LEU H CB  1 
ATOM   1966 C  CG  . LEU B 2 45  ? 29.809 22.870  46.098 1.00 22.83 ? 45  LEU H CG  1 
ATOM   1967 C  CD1 . LEU B 2 45  ? 30.533 24.216  46.111 1.00 21.63 ? 45  LEU H CD1 1 
ATOM   1968 C  CD2 . LEU B 2 45  ? 30.735 21.691  46.454 1.00 21.25 ? 45  LEU H CD2 1 
ATOM   1969 N  N   . GLU B 2 46  ? 26.295 21.152  48.537 1.00 24.13 ? 46  GLU H N   1 
ATOM   1970 C  CA  . GLU B 2 46  ? 25.312 21.107  49.598 1.00 24.94 ? 46  GLU H CA  1 
ATOM   1971 C  C   . GLU B 2 46  ? 26.026 20.784  50.891 1.00 24.40 ? 46  GLU H C   1 
ATOM   1972 O  O   . GLU B 2 46  ? 26.671 19.751  50.997 1.00 24.00 ? 46  GLU H O   1 
ATOM   1973 C  CB  . GLU B 2 46  ? 24.250 20.040  49.319 1.00 24.83 ? 46  GLU H CB  1 
ATOM   1974 C  CG  . GLU B 2 46  ? 23.162 19.948  50.391 1.00 26.25 ? 46  GLU H CG  1 
ATOM   1975 C  CD  . GLU B 2 46  ? 22.193 18.802  50.149 1.00 27.88 ? 46  GLU H CD  1 
ATOM   1976 O  OE1 . GLU B 2 46  ? 21.085 18.834  50.730 1.00 31.09 ? 46  GLU H OE1 1 
ATOM   1977 O  OE2 . GLU B 2 46  ? 22.533 17.859  49.384 1.00 31.98 ? 46  GLU H OE2 1 
ATOM   1978 N  N   . TRP B 2 47  ? 25.899 21.686  51.862 1.00 24.25 ? 47  TRP H N   1 
ATOM   1979 C  CA  . TRP B 2 47  ? 26.462 21.517  53.193 1.00 23.92 ? 47  TRP H CA  1 
ATOM   1980 C  C   . TRP B 2 47  ? 25.788 20.390  53.998 1.00 23.67 ? 47  TRP H C   1 
ATOM   1981 O  O   . TRP B 2 47  ? 24.561 20.318  54.082 1.00 23.54 ? 47  TRP H O   1 
ATOM   1982 C  CB  . TRP B 2 47  ? 26.356 22.839  53.945 1.00 23.90 ? 47  TRP H CB  1 
ATOM   1983 C  CG  . TRP B 2 47  ? 26.727 22.730  55.386 1.00 23.97 ? 47  TRP H CG  1 
ATOM   1984 C  CD1 . TRP B 2 47  ? 27.980 22.559  55.899 1.00 23.05 ? 47  TRP H CD1 1 
ATOM   1985 C  CD2 . TRP B 2 47  ? 25.830 22.798  56.512 1.00 22.90 ? 47  TRP H CD2 1 
ATOM   1986 N  NE1 . TRP B 2 47  ? 27.916 22.515  57.267 1.00 23.41 ? 47  TRP H NE1 1 
ATOM   1987 C  CE2 . TRP B 2 47  ? 26.611 22.661  57.670 1.00 22.75 ? 47  TRP H CE2 1 
ATOM   1988 C  CE3 . TRP B 2 47  ? 24.444 22.960  56.644 1.00 23.12 ? 47  TRP H CE3 1 
ATOM   1989 C  CZ2 . TRP B 2 47  ? 26.054 22.671  58.960 1.00 23.65 ? 47  TRP H CZ2 1 
ATOM   1990 C  CZ3 . TRP B 2 47  ? 23.888 22.978  57.933 1.00 23.65 ? 47  TRP H CZ3 1 
ATOM   1991 C  CH2 . TRP B 2 47  ? 24.696 22.836  59.068 1.00 23.55 ? 47  TRP H CH2 1 
ATOM   1992 N  N   . VAL B 2 48  ? 26.603 19.532  54.605 1.00 23.44 ? 48  VAL H N   1 
ATOM   1993 C  CA  . VAL B 2 48  ? 26.101 18.399  55.391 1.00 23.25 ? 48  VAL H CA  1 
ATOM   1994 C  C   . VAL B 2 48  ? 26.169 18.655  56.899 1.00 23.20 ? 48  VAL H C   1 
ATOM   1995 O  O   . VAL B 2 48  ? 25.161 18.558  57.600 1.00 22.76 ? 48  VAL H O   1 
ATOM   1996 C  CB  . VAL B 2 48  ? 26.865 17.090  55.057 1.00 23.44 ? 48  VAL H CB  1 
ATOM   1997 C  CG1 . VAL B 2 48  ? 26.346 15.904  55.901 1.00 22.78 ? 48  VAL H CG1 1 
ATOM   1998 C  CG2 . VAL B 2 48  ? 26.777 16.791  53.552 1.00 23.61 ? 48  VAL H CG2 1 
ATOM   1999 N  N   . SER B 2 49  ? 27.363 18.987  57.383 1.00 23.07 ? 49  SER H N   1 
ATOM   2000 C  CA  . SER B 2 49  ? 27.605 19.093  58.811 1.00 23.10 ? 49  SER H CA  1 
ATOM   2001 C  C   . SER B 2 49  ? 28.818 19.955  59.134 1.00 22.83 ? 49  SER H C   1 
ATOM   2002 O  O   . SER B 2 49  ? 29.677 20.193  58.280 1.00 22.47 ? 49  SER H O   1 
ATOM   2003 C  CB  . SER B 2 49  ? 27.769 17.693  59.414 1.00 23.22 ? 49  SER H CB  1 
ATOM   2004 O  OG  . SER B 2 49  ? 27.564 17.746  60.813 1.00 24.00 ? 49  SER H OG  1 
ATOM   2005 N  N   . THR B 2 50  ? 28.875 20.418  60.379 1.00 22.80 ? 50  THR H N   1 
ATOM   2006 C  CA  . THR B 2 50  ? 29.996 21.213  60.886 1.00 23.16 ? 50  THR H CA  1 
ATOM   2007 C  C   . THR B 2 50  ? 30.259 20.873  62.340 1.00 22.96 ? 50  THR H C   1 
ATOM   2008 O  O   . THR B 2 50  ? 29.335 20.618  63.090 1.00 23.03 ? 50  THR H O   1 
ATOM   2009 C  CB  . THR B 2 50  ? 29.709 22.729  60.811 1.00 23.17 ? 50  THR H CB  1 
ATOM   2010 O  OG1 . THR B 2 50  ? 29.330 23.066  59.481 1.00 23.45 ? 50  THR H OG1 1 
ATOM   2011 C  CG2 . THR B 2 50  ? 30.955 23.548  61.223 1.00 23.73 ? 50  THR H CG2 1 
ATOM   2012 N  N   . ILE B 2 51  ? 31.528 20.906  62.728 1.00 22.88 ? 51  ILE H N   1 
ATOM   2013 C  CA  . ILE B 2 51  ? 31.937 20.684  64.109 1.00 21.92 ? 51  ILE H CA  1 
ATOM   2014 C  C   . ILE B 2 51  ? 33.048 21.674  64.448 1.00 22.34 ? 51  ILE H C   1 
ATOM   2015 O  O   . ILE B 2 51  ? 34.035 21.810  63.694 1.00 21.81 ? 51  ILE H O   1 
ATOM   2016 C  CB  . ILE B 2 51  ? 32.383 19.221  64.322 1.00 21.99 ? 51  ILE H CB  1 
ATOM   2017 C  CG1 . ILE B 2 51  ? 32.591 18.899  65.816 1.00 21.34 ? 51  ILE H CG1 1 
ATOM   2018 C  CG2 . ILE B 2 51  ? 33.590 18.884  63.439 1.00 21.18 ? 51  ILE H CG2 1 
ATOM   2019 C  CD1 . ILE B 2 51  ? 32.877 17.399  66.085 1.00 20.97 ? 51  ILE H CD1 1 
ATOM   2020 N  N   . SER B 2 52  ? 32.877 22.387  65.569 1.00 22.43 ? 52  SER H N   1 
ATOM   2021 C  CA  . SER B 2 52  ? 33.889 23.330  66.048 1.00 22.34 ? 52  SER H CA  1 
ATOM   2022 C  C   . SER B 2 52  ? 35.133 22.590  66.554 1.00 22.91 ? 52  SER H C   1 
ATOM   2023 O  O   . SER B 2 52  ? 35.088 21.374  66.782 1.00 23.66 ? 52  SER H O   1 
ATOM   2024 C  CB  . SER B 2 52  ? 33.314 24.243  67.139 1.00 22.31 ? 52  SER H CB  1 
ATOM   2025 O  OG  . SER B 2 52  ? 32.956 23.509  68.289 1.00 20.95 ? 52  SER H OG  1 
ATOM   2026 N  N   . TRP B 2 53  ? 36.236 23.319  66.726 1.00 23.31 ? 53  TRP H N   1 
ATOM   2027 C  CA  . TRP B 2 53  ? 37.525 22.722  67.084 1.00 23.96 ? 53  TRP H CA  1 
ATOM   2028 C  C   . TRP B 2 53  ? 37.443 21.827  68.319 1.00 24.89 ? 53  TRP H C   1 
ATOM   2029 O  O   . TRP B 2 53  ? 38.058 20.758  68.362 1.00 24.99 ? 53  TRP H O   1 
ATOM   2030 C  CB  . TRP B 2 53  ? 38.590 23.816  67.246 1.00 23.88 ? 53  TRP H CB  1 
ATOM   2031 C  CG  . TRP B 2 53  ? 38.522 24.634  68.532 1.00 24.14 ? 53  TRP H CG  1 
ATOM   2032 C  CD1 . TRP B 2 53  ? 37.883 25.840  68.714 1.00 24.04 ? 53  TRP H CD1 1 
ATOM   2033 C  CD2 . TRP B 2 53  ? 39.134 24.313  69.797 1.00 23.17 ? 53  TRP H CD2 1 
ATOM   2034 N  NE1 . TRP B 2 53  ? 38.054 26.275  70.005 1.00 24.07 ? 53  TRP H NE1 1 
ATOM   2035 C  CE2 . TRP B 2 53  ? 38.814 25.362  70.693 1.00 23.89 ? 53  TRP H CE2 1 
ATOM   2036 C  CE3 . TRP B 2 53  ? 39.911 23.238  70.258 1.00 22.52 ? 53  TRP H CE3 1 
ATOM   2037 C  CZ2 . TRP B 2 53  ? 39.244 25.369  72.032 1.00 23.92 ? 53  TRP H CZ2 1 
ATOM   2038 C  CZ3 . TRP B 2 53  ? 40.350 23.246  71.583 1.00 23.91 ? 53  TRP H CZ3 1 
ATOM   2039 C  CH2 . TRP B 2 53  ? 40.011 24.309  72.458 1.00 24.02 ? 53  TRP H CH2 1 
ATOM   2040 N  N   . ASN B 2 54  ? 36.661 22.270  69.310 1.00 25.67 ? 54  ASN H N   1 
ATOM   2041 C  CA  . ASN B 2 54  ? 36.528 21.580  70.597 1.00 26.14 ? 54  ASN H CA  1 
ATOM   2042 C  C   . ASN B 2 54  ? 35.369 20.601  70.692 1.00 26.24 ? 54  ASN H C   1 
ATOM   2043 O  O   . ASN B 2 54  ? 35.126 20.072  71.782 1.00 26.63 ? 54  ASN H O   1 
ATOM   2044 C  CB  . ASN B 2 54  ? 36.456 22.570  71.780 1.00 26.29 ? 54  ASN H CB  1 
ATOM   2045 C  CG  . ASN B 2 54  ? 35.345 23.614  71.641 1.00 28.22 ? 54  ASN H CG  1 
ATOM   2046 O  OD1 . ASN B 2 54  ? 35.452 24.710  72.191 1.00 31.32 ? 54  ASN H OD1 1 
ATOM   2047 N  ND2 . ASN B 2 54  ? 34.290 23.294  70.906 1.00 29.94 ? 54  ASN H ND2 1 
ATOM   2048 N  N   . SER B 2 55  ? 34.661 20.368  69.571 1.00 25.94 ? 55  SER H N   1 
ATOM   2049 C  CA  . SER B 2 55  ? 33.545 19.410  69.499 1.00 25.38 ? 55  SER H CA  1 
ATOM   2050 C  C   . SER B 2 55  ? 32.341 19.824  70.338 1.00 25.38 ? 55  SER H C   1 
ATOM   2051 O  O   . SER B 2 55  ? 31.451 19.014  70.588 1.00 25.53 ? 55  SER H O   1 
ATOM   2052 C  CB  . SER B 2 55  ? 33.975 18.012  69.956 1.00 25.40 ? 55  SER H CB  1 
ATOM   2053 O  OG  . SER B 2 55  ? 34.658 17.292  68.964 1.00 24.86 ? 55  SER H OG  1 
ATOM   2054 N  N   . GLY B 2 56  ? 32.321 21.067  70.796 1.00 25.26 ? 56  GLY H N   1 
ATOM   2055 C  CA  . GLY B 2 56  ? 31.289 21.501  71.720 1.00 25.92 ? 56  GLY H CA  1 
ATOM   2056 C  C   . GLY B 2 56  ? 30.082 22.093  71.026 1.00 26.31 ? 56  GLY H C   1 
ATOM   2057 O  O   . GLY B 2 56  ? 29.003 22.185  71.608 1.00 26.58 ? 56  GLY H O   1 
ATOM   2058 N  N   . SER B 2 57  ? 30.287 22.521  69.787 1.00 26.33 ? 57  SER H N   1 
ATOM   2059 C  CA  . SER B 2 57  ? 29.230 23.056  68.954 1.00 27.09 ? 57  SER H CA  1 
ATOM   2060 C  C   . SER B 2 57  ? 29.145 22.240  67.648 1.00 26.88 ? 57  SER H C   1 
ATOM   2061 O  O   . SER B 2 57  ? 30.163 21.934  67.027 1.00 26.79 ? 57  SER H O   1 
ATOM   2062 C  CB  . SER B 2 57  ? 29.484 24.550  68.691 1.00 27.55 ? 57  SER H CB  1 
ATOM   2063 O  OG  . SER B 2 57  ? 28.362 25.161  68.059 1.00 30.17 ? 57  SER H OG  1 
ATOM   2064 N  N   . ILE B 2 58  ? 27.929 21.841  67.273 1.00 26.54 ? 58  ILE H N   1 
ATOM   2065 C  CA  . ILE B 2 58  ? 27.705 21.046  66.069 1.00 25.86 ? 58  ILE H CA  1 
ATOM   2066 C  C   . ILE B 2 58  ? 26.483 21.558  65.286 1.00 25.82 ? 58  ILE H C   1 
ATOM   2067 O  O   . ILE B 2 58  ? 25.508 22.040  65.879 1.00 25.26 ? 58  ILE H O   1 
ATOM   2068 C  CB  . ILE B 2 58  ? 27.541 19.541  66.402 1.00 26.03 ? 58  ILE H CB  1 
ATOM   2069 C  CG1 . ILE B 2 58  ? 28.888 18.941  66.825 1.00 25.83 ? 58  ILE H CG1 1 
ATOM   2070 C  CG2 . ILE B 2 58  ? 26.934 18.781  65.208 1.00 25.72 ? 58  ILE H CG2 1 
ATOM   2071 C  CD1 . ILE B 2 58  ? 28.819 17.578  67.462 1.00 25.68 ? 58  ILE H CD1 1 
ATOM   2072 N  N   . GLY B 2 59  ? 26.567 21.471  63.956 1.00 25.72 ? 59  GLY H N   1 
ATOM   2073 C  CA  . GLY B 2 59  ? 25.460 21.822  63.055 1.00 25.80 ? 59  GLY H CA  1 
ATOM   2074 C  C   . GLY B 2 59  ? 25.199 20.710  62.054 1.00 25.97 ? 59  GLY H C   1 
ATOM   2075 O  O   . GLY B 2 59  ? 26.120 19.993  61.665 1.00 25.70 ? 59  GLY H O   1 
ATOM   2076 N  N   . TYR B 2 60  ? 23.936 20.548  61.661 1.00 26.43 ? 60  TYR H N   1 
ATOM   2077 C  CA  . TYR B 2 60  ? 23.536 19.573  60.632 1.00 26.82 ? 60  TYR H CA  1 
ATOM   2078 C  C   . TYR B 2 60  ? 22.560 20.168  59.613 1.00 27.25 ? 60  TYR H C   1 
ATOM   2079 O  O   . TYR B 2 60  ? 21.720 21.020  59.947 1.00 27.18 ? 60  TYR H O   1 
ATOM   2080 C  CB  . TYR B 2 60  ? 22.861 18.350  61.256 1.00 26.79 ? 60  TYR H CB  1 
ATOM   2081 C  CG  . TYR B 2 60  ? 23.745 17.506  62.141 1.00 26.14 ? 60  TYR H CG  1 
ATOM   2082 C  CD1 . TYR B 2 60  ? 24.662 16.621  61.591 1.00 26.31 ? 60  TYR H CD1 1 
ATOM   2083 C  CD2 . TYR B 2 60  ? 23.648 17.580  63.531 1.00 26.38 ? 60  TYR H CD2 1 
ATOM   2084 C  CE1 . TYR B 2 60  ? 25.479 15.845  62.388 1.00 27.22 ? 60  TYR H CE1 1 
ATOM   2085 C  CE2 . TYR B 2 60  ? 24.460 16.798  64.346 1.00 26.80 ? 60  TYR H CE2 1 
ATOM   2086 C  CZ  . TYR B 2 60  ? 25.373 15.923  63.768 1.00 26.21 ? 60  TYR H CZ  1 
ATOM   2087 O  OH  . TYR B 2 60  ? 26.183 15.123  64.558 1.00 26.74 ? 60  TYR H OH  1 
ATOM   2088 N  N   . ALA B 2 61  ? 22.678 19.698  58.376 1.00 27.64 ? 61  ALA H N   1 
ATOM   2089 C  CA  . ALA B 2 61  ? 21.720 19.990  57.318 1.00 28.36 ? 61  ALA H CA  1 
ATOM   2090 C  C   . ALA B 2 61  ? 20.384 19.343  57.663 1.00 29.32 ? 61  ALA H C   1 
ATOM   2091 O  O   . ALA B 2 61  ? 20.325 18.389  58.441 1.00 29.10 ? 61  ALA H O   1 
ATOM   2092 C  CB  . ALA B 2 61  ? 22.230 19.462  56.000 1.00 27.81 ? 61  ALA H CB  1 
ATOM   2093 N  N   . ASP B 2 62  ? 19.310 19.853  57.078 1.00 30.81 ? 62  ASP H N   1 
ATOM   2094 C  CA  . ASP B 2 62  ? 17.983 19.386  57.432 1.00 32.73 ? 62  ASP H CA  1 
ATOM   2095 C  C   . ASP B 2 62  ? 17.661 17.955  57.001 1.00 33.32 ? 62  ASP H C   1 
ATOM   2096 O  O   . ASP B 2 62  ? 16.983 17.232  57.722 1.00 33.56 ? 62  ASP H O   1 
ATOM   2097 C  CB  . ASP B 2 62  ? 16.927 20.341  56.892 1.00 33.37 ? 62  ASP H CB  1 
ATOM   2098 C  CG  . ASP B 2 62  ? 15.932 20.733  57.947 1.00 35.35 ? 62  ASP H CG  1 
ATOM   2099 O  OD1 . ASP B 2 62  ? 15.344 19.833  58.591 1.00 35.17 ? 62  ASP H OD1 1 
ATOM   2100 O  OD2 . ASP B 2 62  ? 15.771 21.959  58.152 1.00 39.92 ? 62  ASP H OD2 1 
ATOM   2101 N  N   . SER B 2 63  ? 18.162 17.555  55.838 1.00 34.23 ? 63  SER H N   1 
ATOM   2102 C  CA  . SER B 2 63  ? 17.893 16.237  55.255 1.00 35.25 ? 63  SER H CA  1 
ATOM   2103 C  C   . SER B 2 63  ? 18.696 15.125  55.929 1.00 35.45 ? 63  SER H C   1 
ATOM   2104 O  O   . SER B 2 63  ? 18.554 13.934  55.619 1.00 35.32 ? 63  SER H O   1 
ATOM   2105 C  CB  . SER B 2 63  ? 18.241 16.286  53.766 1.00 35.48 ? 63  SER H CB  1 
ATOM   2106 O  OG  . SER B 2 63  ? 19.479 16.962  53.581 1.00 36.56 ? 63  SER H OG  1 
ATOM   2107 N  N   . VAL B 2 64  ? 19.521 15.534  56.877 1.00 35.86 ? 64  VAL H N   1 
ATOM   2108 C  CA  . VAL B 2 64  ? 20.627 14.731  57.354 1.00 36.46 ? 64  VAL H CA  1 
ATOM   2109 C  C   . VAL B 2 64  ? 20.471 14.458  58.846 1.00 37.17 ? 64  VAL H C   1 
ATOM   2110 O  O   . VAL B 2 64  ? 21.010 13.474  59.372 1.00 37.57 ? 64  VAL H O   1 
ATOM   2111 C  CB  . VAL B 2 64  ? 21.944 15.483  57.000 1.00 36.26 ? 64  VAL H CB  1 
ATOM   2112 C  CG1 . VAL B 2 64  ? 22.962 15.479  58.122 1.00 35.70 ? 64  VAL H CG1 1 
ATOM   2113 C  CG2 . VAL B 2 64  ? 22.491 14.998  55.647 1.00 35.60 ? 64  VAL H CG2 1 
ATOM   2114 N  N   . LYS B 2 65  ? 19.707 15.327  59.507 1.00 37.50 ? 65  LYS H N   1 
ATOM   2115 C  CA  . LYS B 2 65  ? 19.529 15.302  60.964 1.00 37.99 ? 65  LYS H CA  1 
ATOM   2116 C  C   . LYS B 2 65  ? 18.944 13.974  61.464 1.00 37.26 ? 65  LYS H C   1 
ATOM   2117 O  O   . LYS B 2 65  ? 18.051 13.383  60.833 1.00 37.27 ? 65  LYS H O   1 
ATOM   2118 C  CB  . LYS B 2 65  ? 18.688 16.503  61.433 1.00 37.89 ? 65  LYS H CB  1 
ATOM   2119 C  CG  . LYS B 2 65  ? 17.229 16.453  60.984 1.00 38.71 ? 65  LYS H CG  1 
ATOM   2120 C  CD  . LYS B 2 65  ? 16.416 17.605  61.537 1.00 39.20 ? 65  LYS H CD  1 
ATOM   2121 C  CE  . LYS B 2 65  ? 14.927 17.265  61.548 1.00 41.98 ? 65  LYS H CE  1 
ATOM   2122 N  NZ  . LYS B 2 65  ? 14.063 18.402  62.005 1.00 42.54 ? 65  LYS H NZ  1 
ATOM   2123 N  N   . GLY B 2 66  ? 19.488 13.504  62.583 1.00 36.31 ? 66  GLY H N   1 
ATOM   2124 C  CA  . GLY B 2 66  ? 19.073 12.248  63.181 1.00 35.06 ? 66  GLY H CA  1 
ATOM   2125 C  C   . GLY B 2 66  ? 19.617 11.003  62.508 1.00 34.03 ? 66  GLY H C   1 
ATOM   2126 O  O   . GLY B 2 66  ? 19.429 9.903   63.015 1.00 34.56 ? 66  GLY H O   1 
ATOM   2127 N  N   . ARG B 2 67  ? 20.279 11.160  61.362 1.00 32.61 ? 67  ARG H N   1 
ATOM   2128 C  CA  . ARG B 2 67  ? 20.796 10.017  60.602 1.00 30.99 ? 67  ARG H CA  1 
ATOM   2129 C  C   . ARG B 2 67  ? 22.312 10.050  60.533 1.00 30.06 ? 67  ARG H C   1 
ATOM   2130 O  O   . ARG B 2 67  ? 22.961 9.013   60.518 1.00 29.64 ? 67  ARG H O   1 
ATOM   2131 C  CB  . ARG B 2 67  ? 20.242 10.003  59.168 1.00 30.89 ? 67  ARG H CB  1 
ATOM   2132 C  CG  . ARG B 2 67  ? 18.753 9.725   59.021 1.00 30.72 ? 67  ARG H CG  1 
ATOM   2133 C  CD  . ARG B 2 67  ? 18.359 9.524   57.545 1.00 30.71 ? 67  ARG H CD  1 
ATOM   2134 N  NE  . ARG B 2 67  ? 18.684 10.661  56.660 1.00 29.52 ? 67  ARG H NE  1 
ATOM   2135 C  CZ  . ARG B 2 67  ? 19.415 10.580  55.544 1.00 28.00 ? 67  ARG H CZ  1 
ATOM   2136 N  NH1 . ARG B 2 67  ? 19.925 9.423   55.145 1.00 28.08 ? 67  ARG H NH1 1 
ATOM   2137 N  NH2 . ARG B 2 67  ? 19.642 11.661  54.821 1.00 26.39 ? 67  ARG H NH2 1 
ATOM   2138 N  N   . PHE B 2 68  ? 22.862 11.260  60.446 1.00 29.40 ? 68  PHE H N   1 
ATOM   2139 C  CA  . PHE B 2 68  ? 24.307 11.476  60.298 1.00 28.49 ? 68  PHE H CA  1 
ATOM   2140 C  C   . PHE B 2 68  ? 24.861 12.048  61.597 1.00 27.95 ? 68  PHE H C   1 
ATOM   2141 O  O   . PHE B 2 68  ? 24.220 12.904  62.219 1.00 27.51 ? 68  PHE H O   1 
ATOM   2142 C  CB  . PHE B 2 68  ? 24.601 12.461  59.150 1.00 28.36 ? 68  PHE H CB  1 
ATOM   2143 C  CG  . PHE B 2 68  ? 24.328 11.917  57.754 1.00 28.28 ? 68  PHE H CG  1 
ATOM   2144 C  CD1 . PHE B 2 68  ? 24.841 12.582  56.635 1.00 27.94 ? 68  PHE H CD1 1 
ATOM   2145 C  CD2 . PHE B 2 68  ? 23.558 10.767  57.547 1.00 27.99 ? 68  PHE H CD2 1 
ATOM   2146 C  CE1 . PHE B 2 68  ? 24.600 12.117  55.338 1.00 26.68 ? 68  PHE H CE1 1 
ATOM   2147 C  CE2 . PHE B 2 68  ? 23.308 10.294  56.260 1.00 27.58 ? 68  PHE H CE2 1 
ATOM   2148 C  CZ  . PHE B 2 68  ? 23.836 10.973  55.152 1.00 27.37 ? 68  PHE H CZ  1 
ATOM   2149 N  N   . THR B 2 69  ? 26.042 11.565  61.991 1.00 27.27 ? 69  THR H N   1 
ATOM   2150 C  CA  . THR B 2 69  ? 26.770 12.052  63.175 1.00 26.99 ? 69  THR H CA  1 
ATOM   2151 C  C   . THR B 2 69  ? 28.185 12.475  62.772 1.00 26.37 ? 69  THR H C   1 
ATOM   2152 O  O   . THR B 2 69  ? 28.952 11.662  62.276 1.00 26.23 ? 69  THR H O   1 
ATOM   2153 C  CB  . THR B 2 69  ? 26.860 10.958  64.296 1.00 26.96 ? 69  THR H CB  1 
ATOM   2154 O  OG1 . THR B 2 69  ? 25.543 10.579  64.713 1.00 27.73 ? 69  THR H OG1 1 
ATOM   2155 C  CG2 . THR B 2 69  ? 27.640 11.451  65.505 1.00 26.49 ? 69  THR H CG2 1 
ATOM   2156 N  N   . ILE B 2 70  ? 28.510 13.750  62.977 1.00 26.14 ? 70  ILE H N   1 
ATOM   2157 C  CA  . ILE B 2 70  ? 29.871 14.258  62.766 1.00 25.59 ? 70  ILE H CA  1 
ATOM   2158 C  C   . ILE B 2 70  ? 30.650 14.085  64.073 1.00 25.68 ? 70  ILE H C   1 
ATOM   2159 O  O   . ILE B 2 70  ? 30.065 14.182  65.148 1.00 25.28 ? 70  ILE H O   1 
ATOM   2160 C  CB  . ILE B 2 70  ? 29.880 15.750  62.296 1.00 25.69 ? 70  ILE H CB  1 
ATOM   2161 C  CG1 . ILE B 2 70  ? 31.250 16.168  61.735 1.00 25.10 ? 70  ILE H CG1 1 
ATOM   2162 C  CG2 . ILE B 2 70  ? 29.406 16.703  63.411 1.00 25.52 ? 70  ILE H CG2 1 
ATOM   2163 C  CD1 . ILE B 2 70  ? 31.237 17.530  61.027 1.00 24.87 ? 70  ILE H CD1 1 
ATOM   2164 N  N   . SER B 2 71  ? 31.952 13.807  63.962 1.00 25.60 ? 71  SER H N   1 
ATOM   2165 C  CA  . SER B 2 71  ? 32.860 13.735  65.109 1.00 25.55 ? 71  SER H CA  1 
ATOM   2166 C  C   . SER B 2 71  ? 34.291 13.980  64.635 1.00 25.43 ? 71  SER H C   1 
ATOM   2167 O  O   . SER B 2 71  ? 34.573 13.895  63.437 1.00 25.58 ? 71  SER H O   1 
ATOM   2168 C  CB  . SER B 2 71  ? 32.743 12.375  65.837 1.00 25.90 ? 71  SER H CB  1 
ATOM   2169 O  OG  . SER B 2 71  ? 33.321 11.317  65.083 1.00 25.84 ? 71  SER H OG  1 
ATOM   2170 N  N   . ARG B 2 72  ? 35.187 14.305  65.569 1.00 25.26 ? 72  ARG H N   1 
ATOM   2171 C  CA  . ARG B 2 72  ? 36.615 14.504  65.263 1.00 24.48 ? 72  ARG H CA  1 
ATOM   2172 C  C   . ARG B 2 72  ? 37.532 13.961  66.367 1.00 25.41 ? 72  ARG H C   1 
ATOM   2173 O  O   . ARG B 2 72  ? 37.112 13.802  67.527 1.00 24.96 ? 72  ARG H O   1 
ATOM   2174 C  CB  . ARG B 2 72  ? 36.935 15.990  65.001 1.00 24.39 ? 72  ARG H CB  1 
ATOM   2175 C  CG  . ARG B 2 72  ? 36.784 16.923  66.215 1.00 22.85 ? 72  ARG H CG  1 
ATOM   2176 C  CD  . ARG B 2 72  ? 36.706 18.375  65.772 1.00 22.78 ? 72  ARG H CD  1 
ATOM   2177 N  NE  . ARG B 2 72  ? 37.996 18.906  65.340 1.00 19.92 ? 72  ARG H NE  1 
ATOM   2178 C  CZ  . ARG B 2 72  ? 38.162 20.052  64.673 1.00 19.97 ? 72  ARG H CZ  1 
ATOM   2179 N  NH1 . ARG B 2 72  ? 39.379 20.470  64.338 1.00 18.61 ? 72  ARG H NH1 1 
ATOM   2180 N  NH2 . ARG B 2 72  ? 37.118 20.799  64.344 1.00 20.54 ? 72  ARG H NH2 1 
ATOM   2181 N  N   . ASP B 2 73  ? 38.784 13.698  65.980 1.00 25.76 ? 73  ASP H N   1 
ATOM   2182 C  CA  . ASP B 2 73  ? 39.846 13.262  66.867 1.00 26.03 ? 73  ASP H CA  1 
ATOM   2183 C  C   . ASP B 2 73  ? 41.032 14.164  66.582 1.00 26.62 ? 73  ASP H C   1 
ATOM   2184 O  O   . ASP B 2 73  ? 41.770 13.942  65.612 1.00 27.03 ? 73  ASP H O   1 
ATOM   2185 C  CB  . ASP B 2 73  ? 40.211 11.809  66.557 1.00 26.23 ? 73  ASP H CB  1 
ATOM   2186 C  CG  . ASP B 2 73  ? 41.074 11.168  67.641 1.00 26.21 ? 73  ASP H CG  1 
ATOM   2187 O  OD1 . ASP B 2 73  ? 40.886 9.957   67.874 1.00 28.02 ? 73  ASP H OD1 1 
ATOM   2188 O  OD2 . ASP B 2 73  ? 41.924 11.850  68.246 1.00 24.93 ? 73  ASP H OD2 1 
ATOM   2189 N  N   . ASN B 2 74  ? 41.205 15.189  67.409 1.00 27.24 ? 74  ASN H N   1 
ATOM   2190 C  CA  . ASN B 2 74  ? 42.245 16.199  67.207 1.00 28.11 ? 74  ASN H CA  1 
ATOM   2191 C  C   . ASN B 2 74  ? 43.676 15.691  67.235 1.00 28.70 ? 74  ASN H C   1 
ATOM   2192 O  O   . ASN B 2 74  ? 44.518 16.182  66.473 1.00 29.13 ? 74  ASN H O   1 
ATOM   2193 C  CB  . ASN B 2 74  ? 42.073 17.354  68.192 1.00 28.33 ? 74  ASN H CB  1 
ATOM   2194 C  CG  . ASN B 2 74  ? 41.008 18.314  67.746 1.00 28.79 ? 74  ASN H CG  1 
ATOM   2195 O  OD1 . ASN B 2 74  ? 40.524 18.204  66.627 1.00 30.20 ? 74  ASN H OD1 1 
ATOM   2196 N  ND2 . ASN B 2 74  ? 40.633 19.258  68.607 1.00 28.29 ? 74  ASN H ND2 1 
ATOM   2197 N  N   . ALA B 2 75  ? 43.935 14.715  68.110 1.00 29.11 ? 75  ALA H N   1 
ATOM   2198 C  CA  . ALA B 2 75  ? 45.242 14.081  68.250 1.00 29.30 ? 75  ALA H CA  1 
ATOM   2199 C  C   . ALA B 2 75  ? 45.613 13.273  67.008 1.00 29.39 ? 75  ALA H C   1 
ATOM   2200 O  O   . ALA B 2 75  ? 46.783 13.217  66.626 1.00 29.24 ? 75  ALA H O   1 
ATOM   2201 C  CB  . ALA B 2 75  ? 45.265 13.196  69.495 1.00 29.56 ? 75  ALA H CB  1 
ATOM   2202 N  N   . LYS B 2 76  ? 44.614 12.643  66.388 1.00 29.65 ? 76  LYS H N   1 
ATOM   2203 C  CA  . LYS B 2 76  ? 44.807 11.938  65.112 1.00 29.91 ? 76  LYS H CA  1 
ATOM   2204 C  C   . LYS B 2 76  ? 44.571 12.859  63.912 1.00 29.60 ? 76  LYS H C   1 
ATOM   2205 O  O   . LYS B 2 76  ? 44.735 12.434  62.772 1.00 30.22 ? 76  LYS H O   1 
ATOM   2206 C  CB  . LYS B 2 76  ? 43.880 10.723  65.002 1.00 29.99 ? 76  LYS H CB  1 
ATOM   2207 C  CG  . LYS B 2 76  ? 44.228 9.539   65.879 1.00 31.61 ? 76  LYS H CG  1 
ATOM   2208 C  CD  . LYS B 2 76  ? 43.218 8.423   65.607 1.00 34.92 ? 76  LYS H CD  1 
ATOM   2209 C  CE  . LYS B 2 76  ? 43.333 7.262   66.603 1.00 38.25 ? 76  LYS H CE  1 
ATOM   2210 N  NZ  . LYS B 2 76  ? 42.680 7.557   67.929 1.00 38.97 ? 76  LYS H NZ  1 
ATOM   2211 N  N   . LYS B 2 77  ? 44.190 14.107  64.185 1.00 29.39 ? 77  LYS H N   1 
ATOM   2212 C  CA  . LYS B 2 77  ? 43.838 15.111  63.175 1.00 29.49 ? 77  LYS H CA  1 
ATOM   2213 C  C   . LYS B 2 77  ? 42.843 14.541  62.164 1.00 28.92 ? 77  LYS H C   1 
ATOM   2214 O  O   . LYS B 2 77  ? 43.049 14.649  60.957 1.00 28.70 ? 77  LYS H O   1 
ATOM   2215 C  CB  . LYS B 2 77  ? 45.075 15.630  62.426 1.00 30.05 ? 77  LYS H CB  1 
ATOM   2216 C  CG  . LYS B 2 77  ? 46.116 16.349  63.244 1.00 30.99 ? 77  LYS H CG  1 
ATOM   2217 C  CD  . LYS B 2 77  ? 47.017 17.136  62.296 1.00 33.29 ? 77  LYS H CD  1 
ATOM   2218 C  CE  . LYS B 2 77  ? 48.051 17.945  63.034 1.00 34.70 ? 77  LYS H CE  1 
ATOM   2219 N  NZ  . LYS B 2 77  ? 48.878 17.002  63.822 1.00 36.97 ? 77  LYS H NZ  1 
ATOM   2220 N  N   . SER B 2 78  ? 41.781 13.918  62.667 1.00 28.39 ? 78  SER H N   1 
ATOM   2221 C  CA  . SER B 2 78  ? 40.804 13.272  61.814 1.00 27.60 ? 78  SER H CA  1 
ATOM   2222 C  C   . SER B 2 78  ? 39.385 13.719  62.116 1.00 26.99 ? 78  SER H C   1 
ATOM   2223 O  O   . SER B 2 78  ? 39.046 14.011  63.249 1.00 26.70 ? 78  SER H O   1 
ATOM   2224 C  CB  . SER B 2 78  ? 40.915 11.757  61.928 1.00 27.74 ? 78  SER H CB  1 
ATOM   2225 O  OG  . SER B 2 78  ? 42.152 11.316  61.397 1.00 28.78 ? 78  SER H OG  1 
ATOM   2226 N  N   . LEU B 2 79  ? 38.573 13.748  61.065 1.00 26.12 ? 79  LEU H N   1 
ATOM   2227 C  CA  . LEU B 2 79  ? 37.188 14.147  61.112 1.00 25.27 ? 79  LEU H CA  1 
ATOM   2228 C  C   . LEU B 2 79  ? 36.408 12.959  60.556 1.00 24.87 ? 79  LEU H C   1 
ATOM   2229 O  O   . LEU B 2 79  ? 36.864 12.320  59.613 1.00 24.79 ? 79  LEU H O   1 
ATOM   2230 C  CB  . LEU B 2 79  ? 36.984 15.401  60.241 1.00 24.70 ? 79  LEU H CB  1 
ATOM   2231 C  CG  . LEU B 2 79  ? 35.562 15.926  60.005 1.00 24.70 ? 79  LEU H CG  1 
ATOM   2232 C  CD1 . LEU B 2 79  ? 35.013 16.639  61.228 1.00 22.50 ? 79  LEU H CD1 1 
ATOM   2233 C  CD2 . LEU B 2 79  ? 35.530 16.862  58.789 1.00 25.18 ? 79  LEU H CD2 1 
ATOM   2234 N  N   . TYR B 2 80  ? 35.264 12.651  61.159 1.00 24.54 ? 80  TYR H N   1 
ATOM   2235 C  CA  . TYR B 2 80  ? 34.453 11.496  60.765 1.00 24.73 ? 80  TYR H CA  1 
ATOM   2236 C  C   . TYR B 2 80  ? 33.000 11.864  60.452 1.00 24.77 ? 80  TYR H C   1 
ATOM   2237 O  O   . TYR B 2 80  ? 32.498 12.903  60.898 1.00 24.18 ? 80  TYR H O   1 
ATOM   2238 C  CB  . TYR B 2 80  ? 34.487 10.391  61.846 1.00 24.95 ? 80  TYR H CB  1 
ATOM   2239 C  CG  . TYR B 2 80  ? 35.883 10.064  62.319 1.00 25.60 ? 80  TYR H CG  1 
ATOM   2240 C  CD1 . TYR B 2 80  ? 36.350 10.543  63.539 1.00 25.33 ? 80  TYR H CD1 1 
ATOM   2241 C  CD2 . TYR B 2 80  ? 36.750 9.305   61.529 1.00 25.78 ? 80  TYR H CD2 1 
ATOM   2242 C  CE1 . TYR B 2 80  ? 37.643 10.266  63.974 1.00 25.96 ? 80  TYR H CE1 1 
ATOM   2243 C  CE2 . TYR B 2 80  ? 38.057 9.031   61.949 1.00 26.11 ? 80  TYR H CE2 1 
ATOM   2244 C  CZ  . TYR B 2 80  ? 38.490 9.513   63.175 1.00 25.87 ? 80  TYR H CZ  1 
ATOM   2245 O  OH  . TYR B 2 80  ? 39.770 9.240   63.609 1.00 26.32 ? 80  TYR H OH  1 
ATOM   2246 N  N   . LEU B 2 81  ? 32.346 11.005  59.667 1.00 25.00 ? 81  LEU H N   1 
ATOM   2247 C  CA  . LEU B 2 81  ? 30.904 11.089  59.445 1.00 25.26 ? 81  LEU H CA  1 
ATOM   2248 C  C   . LEU B 2 81  ? 30.278 9.704   59.469 1.00 25.97 ? 81  LEU H C   1 
ATOM   2249 O  O   . LEU B 2 81  ? 30.463 8.911   58.540 1.00 25.99 ? 81  LEU H O   1 
ATOM   2250 C  CB  . LEU B 2 81  ? 30.559 11.811  58.125 1.00 25.04 ? 81  LEU H CB  1 
ATOM   2251 C  CG  . LEU B 2 81  ? 29.094 12.244  57.947 1.00 24.47 ? 81  LEU H CG  1 
ATOM   2252 C  CD1 . LEU B 2 81  ? 28.765 13.470  58.812 1.00 24.06 ? 81  LEU H CD1 1 
ATOM   2253 C  CD2 . LEU B 2 81  ? 28.767 12.509  56.496 1.00 24.26 ? 81  LEU H CD2 1 
ATOM   2254 N  N   . GLN B 2 82  ? 29.544 9.415   60.541 1.00 26.71 ? 82  GLN H N   1 
ATOM   2255 C  CA  . GLN B 2 82  ? 28.715 8.221   60.592 1.00 27.67 ? 82  GLN H CA  1 
ATOM   2256 C  C   . GLN B 2 82  ? 27.400 8.527   59.871 1.00 28.07 ? 82  GLN H C   1 
ATOM   2257 O  O   . GLN B 2 82  ? 26.657 9.429   60.267 1.00 27.93 ? 82  GLN H O   1 
ATOM   2258 C  CB  . GLN B 2 82  ? 28.453 7.777   62.042 1.00 27.99 ? 82  GLN H CB  1 
ATOM   2259 C  CG  . GLN B 2 82  ? 27.699 6.437   62.180 1.00 28.93 ? 82  GLN H CG  1 
ATOM   2260 C  CD  . GLN B 2 82  ? 28.425 5.266   61.514 1.00 30.43 ? 82  GLN H CD  1 
ATOM   2261 O  OE1 . GLN B 2 82  ? 29.593 4.993   61.805 1.00 30.90 ? 82  GLN H OE1 1 
ATOM   2262 N  NE2 . GLN B 2 82  ? 27.735 4.578   60.604 1.00 31.42 ? 82  GLN H NE2 1 
ATOM   2263 N  N   . MET B 2 83  ? 27.141 7.777   58.802 1.00 28.33 ? 83  MET H N   1 
ATOM   2264 C  CA  . MET B 2 83  ? 25.950 7.946   57.989 1.00 28.68 ? 83  MET H CA  1 
ATOM   2265 C  C   . MET B 2 83  ? 25.046 6.733   58.177 1.00 28.71 ? 83  MET H C   1 
ATOM   2266 O  O   . MET B 2 83  ? 25.390 5.623   57.773 1.00 28.26 ? 83  MET H O   1 
ATOM   2267 C  CB  . MET B 2 83  ? 26.331 8.134   56.504 1.00 28.62 ? 83  MET H CB  1 
ATOM   2268 C  CG  . MET B 2 83  ? 27.312 9.302   56.216 1.00 28.98 ? 83  MET H CG  1 
ATOM   2269 S  SD  . MET B 2 83  ? 27.574 9.700   54.449 1.00 29.68 ? 83  MET H SD  1 
ATOM   2270 C  CE  . MET B 2 83  ? 28.307 8.183   53.889 1.00 30.29 ? 83  MET H CE  1 
ATOM   2271 N  N   . ASN B 2 84  ? 23.892 6.946   58.802 1.00 29.50 ? 84  ASN H N   1 
ATOM   2272 C  CA  . ASN B 2 84  ? 22.954 5.845   59.071 1.00 30.21 ? 84  ASN H CA  1 
ATOM   2273 C  C   . ASN B 2 84  ? 21.682 5.956   58.235 1.00 30.64 ? 84  ASN H C   1 
ATOM   2274 O  O   . ASN B 2 84  ? 21.298 7.050   57.820 1.00 30.51 ? 84  ASN H O   1 
ATOM   2275 C  CB  . ASN B 2 84  ? 22.621 5.729   60.571 1.00 29.77 ? 84  ASN H CB  1 
ATOM   2276 C  CG  . ASN B 2 84  ? 23.825 5.326   61.419 1.00 29.74 ? 84  ASN H CG  1 
ATOM   2277 O  OD1 . ASN B 2 84  ? 24.698 4.574   60.985 1.00 30.08 ? 84  ASN H OD1 1 
ATOM   2278 N  ND2 . ASN B 2 84  ? 23.864 5.822   62.645 1.00 29.39 ? 84  ASN H ND2 1 
ATOM   2279 N  N   . SER B 2 85  ? 21.042 4.807   58.011 1.00 31.59 ? 85  SER H N   1 
ATOM   2280 C  CA  . SER B 2 85  ? 19.845 4.671   57.166 1.00 32.30 ? 85  SER H CA  1 
ATOM   2281 C  C   . SER B 2 85  ? 19.894 5.543   55.904 1.00 32.52 ? 85  SER H C   1 
ATOM   2282 O  O   . SER B 2 85  ? 19.121 6.497   55.735 1.00 32.68 ? 85  SER H O   1 
ATOM   2283 C  CB  . SER B 2 85  ? 18.550 4.850   57.977 1.00 32.57 ? 85  SER H CB  1 
ATOM   2284 O  OG  . SER B 2 85  ? 18.446 6.143   58.540 1.00 33.36 ? 85  SER H OG  1 
ATOM   2285 N  N   . LEU B 2 86  ? 20.835 5.187   55.034 1.00 32.72 ? 86  LEU H N   1 
ATOM   2286 C  CA  . LEU B 2 86  ? 21.129 5.931   53.816 1.00 32.77 ? 86  LEU H CA  1 
ATOM   2287 C  C   . LEU B 2 86  ? 20.032 5.824   52.750 1.00 33.26 ? 86  LEU H C   1 
ATOM   2288 O  O   . LEU B 2 86  ? 19.356 4.802   52.636 1.00 33.35 ? 86  LEU H O   1 
ATOM   2289 C  CB  . LEU B 2 86  ? 22.479 5.479   53.256 1.00 32.43 ? 86  LEU H CB  1 
ATOM   2290 C  CG  . LEU B 2 86  ? 23.715 6.025   53.985 1.00 31.29 ? 86  LEU H CG  1 
ATOM   2291 C  CD1 . LEU B 2 86  ? 24.960 5.270   53.553 1.00 29.41 ? 86  LEU H CD1 1 
ATOM   2292 C  CD2 . LEU B 2 86  ? 23.881 7.540   53.746 1.00 28.95 ? 86  LEU H CD2 1 
ATOM   2293 N  N   . ARG B 2 87  ? 19.862 6.901   51.990 1.00 33.45 ? 87  ARG H N   1 
ATOM   2294 C  CA  . ARG B 2 87  ? 18.851 6.991   50.947 1.00 33.72 ? 87  ARG H CA  1 
ATOM   2295 C  C   . ARG B 2 87  ? 19.511 7.256   49.604 1.00 33.53 ? 87  ARG H C   1 
ATOM   2296 O  O   . ARG B 2 87  ? 20.617 7.788   49.546 1.00 34.09 ? 87  ARG H O   1 
ATOM   2297 C  CB  . ARG B 2 87  ? 17.882 8.128   51.240 1.00 34.00 ? 87  ARG H CB  1 
ATOM   2298 C  CG  . ARG B 2 87  ? 16.620 7.721   51.963 1.00 35.97 ? 87  ARG H CG  1 
ATOM   2299 C  CD  . ARG B 2 87  ? 16.557 8.276   53.372 1.00 39.13 ? 87  ARG H CD  1 
ATOM   2300 N  NE  . ARG B 2 87  ? 16.517 9.737   53.380 1.00 40.56 ? 87  ARG H NE  1 
ATOM   2301 C  CZ  . ARG B 2 87  ? 16.019 10.469  54.370 1.00 40.97 ? 87  ARG H CZ  1 
ATOM   2302 N  NH1 . ARG B 2 87  ? 15.494 9.883   55.441 1.00 41.69 ? 87  ARG H NH1 1 
ATOM   2303 N  NH2 . ARG B 2 87  ? 16.036 11.794  54.279 1.00 41.98 ? 87  ARG H NH2 1 
ATOM   2304 N  N   . ALA B 2 88  ? 18.826 6.888   48.528 1.00 33.11 ? 88  ALA H N   1 
ATOM   2305 C  CA  . ALA B 2 88  ? 19.301 7.137   47.167 1.00 32.68 ? 88  ALA H CA  1 
ATOM   2306 C  C   . ALA B 2 88  ? 19.807 8.570   46.985 1.00 32.02 ? 88  ALA H C   1 
ATOM   2307 O  O   . ALA B 2 88  ? 20.875 8.785   46.417 1.00 31.34 ? 88  ALA H O   1 
ATOM   2308 C  CB  . ALA B 2 88  ? 18.204 6.811   46.148 1.00 32.82 ? 88  ALA H CB  1 
ATOM   2309 N  N   . GLU B 2 89  ? 19.061 9.536   47.513 1.00 31.75 ? 89  GLU H N   1 
ATOM   2310 C  CA  . GLU B 2 89  ? 19.411 10.949  47.366 1.00 31.73 ? 89  GLU H CA  1 
ATOM   2311 C  C   . GLU B 2 89  ? 20.568 11.444  48.269 1.00 30.67 ? 89  GLU H C   1 
ATOM   2312 O  O   . GLU B 2 89  ? 20.861 12.631  48.308 1.00 30.38 ? 89  GLU H O   1 
ATOM   2313 C  CB  . GLU B 2 89  ? 18.158 11.833  47.480 1.00 32.19 ? 89  GLU H CB  1 
ATOM   2314 C  CG  . GLU B 2 89  ? 17.633 12.005  48.887 1.00 35.27 ? 89  GLU H CG  1 
ATOM   2315 C  CD  . GLU B 2 89  ? 16.395 11.187  49.179 1.00 36.72 ? 89  GLU H CD  1 
ATOM   2316 O  OE1 . GLU B 2 89  ? 16.275 10.030  48.684 1.00 38.90 ? 89  GLU H OE1 1 
ATOM   2317 O  OE2 . GLU B 2 89  ? 15.544 11.728  49.918 1.00 40.29 ? 89  GLU H OE2 1 
ATOM   2318 N  N   . ASP B 2 90  ? 21.215 10.525  48.985 1.00 29.87 ? 90  ASP H N   1 
ATOM   2319 C  CA  . ASP B 2 90  ? 22.453 10.818  49.704 1.00 29.00 ? 90  ASP H CA  1 
ATOM   2320 C  C   . ASP B 2 90  ? 23.664 10.526  48.815 1.00 28.29 ? 90  ASP H C   1 
ATOM   2321 O  O   . ASP B 2 90  ? 24.813 10.777  49.203 1.00 28.45 ? 90  ASP H O   1 
ATOM   2322 C  CB  . ASP B 2 90  ? 22.549 9.975   50.982 1.00 29.19 ? 90  ASP H CB  1 
ATOM   2323 C  CG  . ASP B 2 90  ? 21.508 10.347  52.019 1.00 29.45 ? 90  ASP H CG  1 
ATOM   2324 O  OD1 . ASP B 2 90  ? 21.347 11.552  52.334 1.00 29.31 ? 90  ASP H OD1 1 
ATOM   2325 O  OD2 . ASP B 2 90  ? 20.864 9.415   52.544 1.00 30.14 ? 90  ASP H OD2 1 
ATOM   2326 N  N   . THR B 2 91  ? 23.405 9.947   47.643 1.00 26.96 ? 91  THR H N   1 
ATOM   2327 C  CA  . THR B 2 91  ? 24.433 9.681   46.647 1.00 25.89 ? 91  THR H CA  1 
ATOM   2328 C  C   . THR B 2 91  ? 25.120 10.993  46.282 1.00 24.90 ? 91  THR H C   1 
ATOM   2329 O  O   . THR B 2 91  ? 24.451 11.940  45.870 1.00 25.01 ? 91  THR H O   1 
ATOM   2330 C  CB  . THR B 2 91  ? 23.803 9.004   45.390 1.00 26.17 ? 91  THR H CB  1 
ATOM   2331 O  OG1 . THR B 2 91  ? 23.328 7.696   45.749 1.00 26.02 ? 91  THR H OG1 1 
ATOM   2332 C  CG2 . THR B 2 91  ? 24.824 8.894   44.229 1.00 25.61 ? 91  THR H CG2 1 
ATOM   2333 N  N   . ALA B 2 92  ? 26.437 11.058  46.469 1.00 23.93 ? 92  ALA H N   1 
ATOM   2334 C  CA  . ALA B 2 92  ? 27.220 12.275  46.183 1.00 23.08 ? 92  ALA H CA  1 
ATOM   2335 C  C   . ALA B 2 92  ? 28.709 12.043  46.351 1.00 22.56 ? 92  ALA H C   1 
ATOM   2336 O  O   . ALA B 2 92  ? 29.133 11.013  46.882 1.00 22.58 ? 92  ALA H O   1 
ATOM   2337 C  CB  . ALA B 2 92  ? 26.772 13.451  47.099 1.00 22.72 ? 92  ALA H CB  1 
ATOM   2338 N  N   . LEU B 2 93  ? 29.496 13.014  45.887 1.00 22.00 ? 93  LEU H N   1 
ATOM   2339 C  CA  . LEU B 2 93  ? 30.889 13.149  46.277 1.00 21.74 ? 93  LEU H CA  1 
ATOM   2340 C  C   . LEU B 2 93  ? 30.869 13.886  47.598 1.00 21.79 ? 93  LEU H C   1 
ATOM   2341 O  O   . LEU B 2 93  ? 30.279 14.965  47.691 1.00 21.98 ? 93  LEU H O   1 
ATOM   2342 C  CB  . LEU B 2 93  ? 31.632 14.020  45.277 1.00 21.35 ? 93  LEU H CB  1 
ATOM   2343 C  CG  . LEU B 2 93  ? 33.058 13.749  44.809 1.00 21.88 ? 93  LEU H CG  1 
ATOM   2344 C  CD1 . LEU B 2 93  ? 33.793 15.073  44.539 1.00 21.29 ? 93  LEU H CD1 1 
ATOM   2345 C  CD2 . LEU B 2 93  ? 33.842 12.866  45.729 1.00 20.52 ? 93  LEU H CD2 1 
ATOM   2346 N  N   . TYR B 2 94  ? 31.513 13.317  48.612 1.00 22.07 ? 94  TYR H N   1 
ATOM   2347 C  CA  . TYR B 2 94  ? 31.574 13.931  49.941 1.00 22.20 ? 94  TYR H CA  1 
ATOM   2348 C  C   . TYR B 2 94  ? 32.943 14.525  50.227 1.00 22.22 ? 94  TYR H C   1 
ATOM   2349 O  O   . TYR B 2 94  ? 33.947 13.797  50.212 1.00 22.89 ? 94  TYR H O   1 
ATOM   2350 C  CB  . TYR B 2 94  ? 31.220 12.906  51.016 1.00 21.64 ? 94  TYR H CB  1 
ATOM   2351 C  CG  . TYR B 2 94  ? 29.755 12.643  51.101 1.00 21.47 ? 94  TYR H CG  1 
ATOM   2352 C  CD1 . TYR B 2 94  ? 29.104 11.912  50.102 1.00 21.26 ? 94  TYR H CD1 1 
ATOM   2353 C  CD2 . TYR B 2 94  ? 29.000 13.123  52.180 1.00 20.85 ? 94  TYR H CD2 1 
ATOM   2354 C  CE1 . TYR B 2 94  ? 27.746 11.687  50.159 1.00 20.30 ? 94  TYR H CE1 1 
ATOM   2355 C  CE2 . TYR B 2 94  ? 27.629 12.885  52.256 1.00 19.73 ? 94  TYR H CE2 1 
ATOM   2356 C  CZ  . TYR B 2 94  ? 27.012 12.162  51.242 1.00 20.50 ? 94  TYR H CZ  1 
ATOM   2357 O  OH  . TYR B 2 94  ? 25.660 11.917  51.288 1.00 20.80 ? 94  TYR H OH  1 
ATOM   2358 N  N   . TYR B 2 95  ? 32.964 15.837  50.483 1.00 21.91 ? 95  TYR H N   1 
ATOM   2359 C  CA  . TYR B 2 95  ? 34.182 16.571  50.835 1.00 22.72 ? 95  TYR H CA  1 
ATOM   2360 C  C   . TYR B 2 95  ? 34.260 16.876  52.321 1.00 22.45 ? 95  TYR H C   1 
ATOM   2361 O  O   . TYR B 2 95  ? 33.259 17.210  52.940 1.00 22.57 ? 95  TYR H O   1 
ATOM   2362 C  CB  . TYR B 2 95  ? 34.219 17.947  50.149 1.00 23.14 ? 95  TYR H CB  1 
ATOM   2363 C  CG  . TYR B 2 95  ? 34.392 17.964  48.650 1.00 23.65 ? 95  TYR H CG  1 
ATOM   2364 C  CD1 . TYR B 2 95  ? 33.302 18.214  47.812 1.00 23.49 ? 95  TYR H CD1 1 
ATOM   2365 C  CD2 . TYR B 2 95  ? 35.650 17.782  48.073 1.00 23.57 ? 95  TYR H CD2 1 
ATOM   2366 C  CE1 . TYR B 2 95  ? 33.455 18.267  46.436 1.00 23.99 ? 95  TYR H CE1 1 
ATOM   2367 C  CE2 . TYR B 2 95  ? 35.813 17.826  46.697 1.00 24.00 ? 95  TYR H CE2 1 
ATOM   2368 C  CZ  . TYR B 2 95  ? 34.709 18.070  45.889 1.00 24.22 ? 95  TYR H CZ  1 
ATOM   2369 O  OH  . TYR B 2 95  ? 34.870 18.115  44.524 1.00 25.99 ? 95  TYR H OH  1 
ATOM   2370 N  N   . CYS B 2 96  ? 35.457 16.812  52.881 1.00 22.39 ? 96  CYS H N   1 
ATOM   2371 C  CA  . CYS B 2 96  ? 35.716 17.568  54.103 1.00 22.47 ? 96  CYS H CA  1 
ATOM   2372 C  C   . CYS B 2 96  ? 36.440 18.885  53.770 1.00 21.89 ? 96  CYS H C   1 
ATOM   2373 O  O   . CYS B 2 96  ? 37.187 18.992  52.781 1.00 20.91 ? 96  CYS H O   1 
ATOM   2374 C  CB  . CYS B 2 96  ? 36.453 16.738  55.153 1.00 22.82 ? 96  CYS H CB  1 
ATOM   2375 S  SG  . CYS B 2 96  ? 38.067 16.173  54.627 1.00 25.45 ? 96  CYS H SG  1 
ATOM   2376 N  N   . ALA B 2 97  ? 36.175 19.901  54.580 1.00 22.14 ? 97  ALA H N   1 
ATOM   2377 C  CA  . ALA B 2 97  ? 36.739 21.218  54.331 1.00 22.43 ? 97  ALA H CA  1 
ATOM   2378 C  C   . ALA B 2 97  ? 37.018 21.956  55.630 1.00 22.69 ? 97  ALA H C   1 
ATOM   2379 O  O   . ALA B 2 97  ? 36.232 21.903  56.574 1.00 23.10 ? 97  ALA H O   1 
ATOM   2380 C  CB  . ALA B 2 97  ? 35.831 22.059  53.369 1.00 21.85 ? 97  ALA H CB  1 
ATOM   2381 N  N   . LYS B 2 98  ? 38.155 22.636  55.652 1.00 23.10 ? 98  LYS H N   1 
ATOM   2382 C  CA  . LYS B 2 98  ? 38.601 23.409  56.787 1.00 23.83 ? 98  LYS H CA  1 
ATOM   2383 C  C   . LYS B 2 98  ? 38.099 24.855  56.678 1.00 24.53 ? 98  LYS H C   1 
ATOM   2384 O  O   . LYS B 2 98  ? 38.188 25.475  55.619 1.00 24.55 ? 98  LYS H O   1 
ATOM   2385 C  CB  . LYS B 2 98  ? 40.144 23.367  56.826 1.00 23.94 ? 98  LYS H CB  1 
ATOM   2386 C  CG  . LYS B 2 98  ? 40.823 24.332  57.781 1.00 22.63 ? 98  LYS H CG  1 
ATOM   2387 C  CD  . LYS B 2 98  ? 42.163 24.787  57.219 1.00 21.70 ? 98  LYS H CD  1 
ATOM   2388 C  CE  . LYS B 2 98  ? 42.697 26.003  57.956 1.00 20.66 ? 98  LYS H CE  1 
ATOM   2389 N  NZ  . LYS B 2 98  ? 42.257 27.294  57.356 1.00 20.73 ? 98  LYS H NZ  1 
ATOM   2390 N  N   . ASP B 2 99  ? 37.584 25.396  57.778 1.00 25.63 ? 99  ASP H N   1 
ATOM   2391 C  CA  . ASP B 2 99  ? 37.258 26.814  57.815 1.00 26.75 ? 99  ASP H CA  1 
ATOM   2392 C  C   . ASP B 2 99  ? 38.468 27.636  58.217 1.00 27.46 ? 99  ASP H C   1 
ATOM   2393 O  O   . ASP B 2 99  ? 39.335 27.160  58.933 1.00 27.75 ? 99  ASP H O   1 
ATOM   2394 C  CB  . ASP B 2 99  ? 36.063 27.127  58.746 1.00 26.65 ? 99  ASP H CB  1 
ATOM   2395 C  CG  . ASP B 2 99  ? 35.167 28.226  58.179 1.00 27.53 ? 99  ASP H CG  1 
ATOM   2396 O  OD1 . ASP B 2 99  ? 34.249 27.883  57.397 1.00 28.22 ? 99  ASP H OD1 1 
ATOM   2397 O  OD2 . ASP B 2 99  ? 35.386 29.431  58.475 1.00 27.70 ? 99  ASP H OD2 1 
ATOM   2398 N  N   . ILE B 2 100 ? 38.498 28.875  57.736 1.00 28.88 ? 100 ILE H N   1 
ATOM   2399 C  CA  . ILE B 2 100 ? 39.449 29.907  58.139 1.00 29.89 ? 100 ILE H CA  1 
ATOM   2400 C  C   . ILE B 2 100 ? 39.067 30.572  59.468 1.00 31.67 ? 100 ILE H C   1 
ATOM   2401 O  O   . ILE B 2 100 ? 39.880 31.289  60.057 1.00 31.64 ? 100 ILE H O   1 
ATOM   2402 C  CB  . ILE B 2 100 ? 39.501 31.054  57.092 1.00 29.62 ? 100 ILE H CB  1 
ATOM   2403 C  CG1 . ILE B 2 100 ? 38.162 31.809  57.046 1.00 29.39 ? 100 ILE H CG1 1 
ATOM   2404 C  CG2 . ILE B 2 100 ? 39.894 30.527  55.737 1.00 28.91 ? 100 ILE H CG2 1 
ATOM   2405 C  CD1 . ILE B 2 100 ? 38.209 33.207  56.437 1.00 29.45 ? 100 ILE H CD1 1 
ATOM   2406 N  N   . GLN B 2 101 ? 37.818 30.384  59.908 1.00 33.72 ? 101 GLN H N   1 
ATOM   2407 C  CA  . GLN B 2 101 ? 37.333 31.008  61.139 1.00 35.83 ? 101 GLN H CA  1 
ATOM   2408 C  C   . GLN B 2 101 ? 38.256 30.670  62.310 1.00 37.01 ? 101 GLN H C   1 
ATOM   2409 O  O   . GLN B 2 101 ? 38.554 29.498  62.558 1.00 37.12 ? 101 GLN H O   1 
ATOM   2410 C  CB  . GLN B 2 101 ? 35.907 30.559  61.455 1.00 36.03 ? 101 GLN H CB  1 
ATOM   2411 C  CG  . GLN B 2 101 ? 35.261 31.329  62.596 1.00 36.99 ? 101 GLN H CG  1 
ATOM   2412 C  CD  . GLN B 2 101 ? 34.163 30.552  63.290 1.00 39.54 ? 101 GLN H CD  1 
ATOM   2413 O  OE1 . GLN B 2 101 ? 33.577 31.036  64.262 1.00 41.08 ? 101 GLN H OE1 1 
ATOM   2414 N  NE2 . GLN B 2 101 ? 33.864 29.347  62.795 1.00 38.98 ? 101 GLN H NE2 1 
ATOM   2415 N  N   . TYR B 2 102 ? 38.710 31.705  63.005 1.00 38.56 ? 102 TYR H N   1 
ATOM   2416 C  CA  . TYR B 2 102 ? 39.584 31.538  64.159 1.00 40.38 ? 102 TYR H CA  1 
ATOM   2417 C  C   . TYR B 2 102 ? 39.365 32.677  65.173 1.00 41.40 ? 102 TYR H C   1 
ATOM   2418 O  O   . TYR B 2 102 ? 39.984 33.748  65.064 1.00 41.53 ? 102 TYR H O   1 
ATOM   2419 C  CB  . TYR B 2 102 ? 41.054 31.457  63.714 1.00 40.73 ? 102 TYR H CB  1 
ATOM   2420 C  CG  . TYR B 2 102 ? 42.023 31.307  64.867 1.00 40.97 ? 102 TYR H CG  1 
ATOM   2421 C  CD1 . TYR B 2 102 ? 42.719 32.419  65.377 1.00 41.63 ? 102 TYR H CD1 1 
ATOM   2422 C  CD2 . TYR B 2 102 ? 42.228 30.065  65.466 1.00 41.01 ? 102 TYR H CD2 1 
ATOM   2423 C  CE1 . TYR B 2 102 ? 43.601 32.290  66.452 1.00 41.64 ? 102 TYR H CE1 1 
ATOM   2424 C  CE2 . TYR B 2 102 ? 43.103 29.920  66.539 1.00 42.06 ? 102 TYR H CE2 1 
ATOM   2425 C  CZ  . TYR B 2 102 ? 43.791 31.031  67.028 1.00 41.28 ? 102 TYR H CZ  1 
ATOM   2426 O  OH  . TYR B 2 102 ? 44.660 30.872  68.089 1.00 41.71 ? 102 TYR H OH  1 
ATOM   2427 N  N   . GLY B 2 103 ? 38.482 32.434  66.148 1.00 42.44 ? 103 GLY H N   1 
ATOM   2428 C  CA  . GLY B 2 103 ? 38.136 33.426  67.175 1.00 43.53 ? 103 GLY H CA  1 
ATOM   2429 C  C   . GLY B 2 103 ? 37.482 34.694  66.633 1.00 44.49 ? 103 GLY H C   1 
ATOM   2430 O  O   . GLY B 2 103 ? 37.506 35.745  67.283 1.00 44.48 ? 103 GLY H O   1 
ATOM   2431 N  N   . ASN B 2 104 ? 36.902 34.596  65.437 1.00 45.11 ? 104 ASN H N   1 
ATOM   2432 C  CA  . ASN B 2 104 ? 36.242 35.725  64.780 1.00 45.49 ? 104 ASN H CA  1 
ATOM   2433 C  C   . ASN B 2 104 ? 35.019 35.261  64.005 1.00 45.92 ? 104 ASN H C   1 
ATOM   2434 O  O   . ASN B 2 104 ? 34.619 34.091  64.098 1.00 46.08 ? 104 ASN H O   1 
ATOM   2435 C  CB  . ASN B 2 104 ? 37.217 36.456  63.852 1.00 45.39 ? 104 ASN H CB  1 
ATOM   2436 C  CG  . ASN B 2 104 ? 37.904 35.521  62.861 1.00 45.10 ? 104 ASN H CG  1 
ATOM   2437 O  OD1 . ASN B 2 104 ? 37.408 34.434  62.556 1.00 45.57 ? 104 ASN H OD1 1 
ATOM   2438 N  ND2 . ASN B 2 104 ? 39.051 35.944  62.359 1.00 44.34 ? 104 ASN H ND2 1 
ATOM   2439 N  N   . TYR B 2 105 ? 34.432 36.175  63.237 1.00 46.31 ? 105 TYR H N   1 
ATOM   2440 C  CA  . TYR B 2 105 ? 33.299 35.836  62.372 1.00 46.69 ? 105 TYR H CA  1 
ATOM   2441 C  C   . TYR B 2 105 ? 33.640 35.833  60.868 1.00 45.68 ? 105 TYR H C   1 
ATOM   2442 O  O   . TYR B 2 105 ? 32.768 36.076  60.021 1.00 45.81 ? 105 TYR H O   1 
ATOM   2443 C  CB  . TYR B 2 105 ? 32.094 36.735  62.679 1.00 48.22 ? 105 TYR H CB  1 
ATOM   2444 C  CG  . TYR B 2 105 ? 31.671 36.707  64.131 1.00 49.55 ? 105 TYR H CG  1 
ATOM   2445 C  CD1 . TYR B 2 105 ? 31.381 35.495  64.773 1.00 51.26 ? 105 TYR H CD1 1 
ATOM   2446 C  CD2 . TYR B 2 105 ? 31.555 37.891  64.862 1.00 50.48 ? 105 TYR H CD2 1 
ATOM   2447 C  CE1 . TYR B 2 105 ? 30.984 35.467  66.121 1.00 52.12 ? 105 TYR H CE1 1 
ATOM   2448 C  CE2 . TYR B 2 105 ? 31.157 37.881  66.198 1.00 51.38 ? 105 TYR H CE2 1 
ATOM   2449 C  CZ  . TYR B 2 105 ? 30.875 36.669  66.824 1.00 50.93 ? 105 TYR H CZ  1 
ATOM   2450 O  OH  . TYR B 2 105 ? 30.490 36.659  68.150 1.00 51.03 ? 105 TYR H OH  1 
ATOM   2451 N  N   . TYR B 2 106 ? 34.910 35.566  60.555 1.00 43.89 ? 106 TYR H N   1 
ATOM   2452 C  CA  . TYR B 2 106 ? 35.361 35.357  59.183 1.00 41.91 ? 106 TYR H CA  1 
ATOM   2453 C  C   . TYR B 2 106 ? 35.079 33.916  58.805 1.00 39.97 ? 106 TYR H C   1 
ATOM   2454 O  O   . TYR B 2 106 ? 35.578 32.988  59.439 1.00 39.81 ? 106 TYR H O   1 
ATOM   2455 C  CB  . TYR B 2 106 ? 36.855 35.645  59.041 1.00 42.54 ? 106 TYR H CB  1 
ATOM   2456 C  CG  . TYR B 2 106 ? 37.218 37.113  59.001 1.00 43.21 ? 106 TYR H CG  1 
ATOM   2457 C  CD1 . TYR B 2 106 ? 36.250 38.088  58.766 1.00 43.75 ? 106 TYR H CD1 1 
ATOM   2458 C  CD2 . TYR B 2 106 ? 38.544 37.523  59.161 1.00 43.91 ? 106 TYR H CD2 1 
ATOM   2459 C  CE1 . TYR B 2 106 ? 36.582 39.443  58.719 1.00 44.49 ? 106 TYR H CE1 1 
ATOM   2460 C  CE2 . TYR B 2 106 ? 38.893 38.884  59.103 1.00 44.50 ? 106 TYR H CE2 1 
ATOM   2461 C  CZ  . TYR B 2 106 ? 37.904 39.832  58.884 1.00 44.10 ? 106 TYR H CZ  1 
ATOM   2462 O  OH  . TYR B 2 106 ? 38.229 41.163  58.831 1.00 43.91 ? 106 TYR H OH  1 
ATOM   2463 N  N   . TYR B 2 107 ? 34.266 33.732  57.777 1.00 37.49 ? 107 TYR H N   1 
ATOM   2464 C  CA  . TYR B 2 107 ? 33.855 32.398  57.379 1.00 35.23 ? 107 TYR H CA  1 
ATOM   2465 C  C   . TYR B 2 107 ? 34.222 32.110  55.930 1.00 33.13 ? 107 TYR H C   1 
ATOM   2466 O  O   . TYR B 2 107 ? 33.972 32.916  55.037 1.00 32.49 ? 107 TYR H O   1 
ATOM   2467 C  CB  . TYR B 2 107 ? 32.358 32.199  57.602 1.00 35.42 ? 107 TYR H CB  1 
ATOM   2468 C  CG  . TYR B 2 107 ? 31.899 32.331  59.028 1.00 36.00 ? 107 TYR H CG  1 
ATOM   2469 C  CD1 . TYR B 2 107 ? 31.217 33.464  59.450 1.00 36.55 ? 107 TYR H CD1 1 
ATOM   2470 C  CD2 . TYR B 2 107 ? 32.122 31.312  59.955 1.00 37.09 ? 107 TYR H CD2 1 
ATOM   2471 C  CE1 . TYR B 2 107 ? 30.784 33.592  60.752 1.00 37.31 ? 107 TYR H CE1 1 
ATOM   2472 C  CE2 . TYR B 2 107 ? 31.687 31.428  61.272 1.00 36.89 ? 107 TYR H CE2 1 
ATOM   2473 C  CZ  . TYR B 2 107 ? 31.020 32.571  61.662 1.00 36.82 ? 107 TYR H CZ  1 
ATOM   2474 O  OH  . TYR B 2 107 ? 30.583 32.709  62.959 1.00 36.36 ? 107 TYR H OH  1 
ATOM   2475 N  N   . GLY B 2 108 ? 34.805 30.937  55.721 1.00 31.30 ? 108 GLY H N   1 
ATOM   2476 C  CA  . GLY B 2 108 ? 35.342 30.546  54.436 1.00 29.04 ? 108 GLY H CA  1 
ATOM   2477 C  C   . GLY B 2 108 ? 35.971 29.176  54.537 1.00 27.87 ? 108 GLY H C   1 
ATOM   2478 O  O   . GLY B 2 108 ? 36.676 28.876  55.501 1.00 27.64 ? 108 GLY H O   1 
ATOM   2479 N  N   . MET B 2 109 ? 35.704 28.341  53.536 1.00 26.43 ? 109 MET H N   1 
ATOM   2480 C  CA  . MET B 2 109 ? 36.276 27.008  53.458 1.00 25.32 ? 109 MET H CA  1 
ATOM   2481 C  C   . MET B 2 109 ? 37.429 27.070  52.454 1.00 24.67 ? 109 MET H C   1 
ATOM   2482 O  O   . MET B 2 109 ? 37.214 27.027  51.240 1.00 24.05 ? 109 MET H O   1 
ATOM   2483 C  CB  . MET B 2 109 ? 35.201 25.989  53.056 1.00 25.25 ? 109 MET H CB  1 
ATOM   2484 C  CG  . MET B 2 109 ? 33.935 26.039  53.931 1.00 24.90 ? 109 MET H CG  1 
ATOM   2485 S  SD  . MET B 2 109 ? 32.583 25.057  53.261 1.00 25.54 ? 109 MET H SD  1 
ATOM   2486 C  CE  . MET B 2 109 ? 31.306 25.335  54.487 1.00 25.30 ? 109 MET H CE  1 
ATOM   2487 N  N   . ASP B 2 110 ? 38.646 27.208  52.989 1.00 24.05 ? 110 ASP H N   1 
ATOM   2488 C  CA  . ASP B 2 110 ? 39.863 27.442  52.211 1.00 23.45 ? 110 ASP H CA  1 
ATOM   2489 C  C   . ASP B 2 110 ? 40.651 26.179  51.813 1.00 22.88 ? 110 ASP H C   1 
ATOM   2490 O  O   . ASP B 2 110 ? 41.381 26.195  50.828 1.00 22.20 ? 110 ASP H O   1 
ATOM   2491 C  CB  . ASP B 2 110 ? 40.775 28.461  52.922 1.00 23.79 ? 110 ASP H CB  1 
ATOM   2492 C  CG  . ASP B 2 110 ? 41.317 27.969  54.272 1.00 25.03 ? 110 ASP H CG  1 
ATOM   2493 O  OD1 . ASP B 2 110 ? 42.378 28.492  54.692 1.00 28.64 ? 110 ASP H OD1 1 
ATOM   2494 O  OD2 . ASP B 2 110 ? 40.711 27.095  54.934 1.00 24.98 ? 110 ASP H OD2 1 
ATOM   2495 N  N   . VAL B 2 111 ? 40.507 25.099  52.576 1.00 22.54 ? 111 VAL H N   1 
ATOM   2496 C  CA  . VAL B 2 111 ? 41.183 23.840  52.250 1.00 22.44 ? 111 VAL H CA  1 
ATOM   2497 C  C   . VAL B 2 111 ? 40.120 22.766  52.124 1.00 22.77 ? 111 VAL H C   1 
ATOM   2498 O  O   . VAL B 2 111 ? 39.277 22.634  52.988 1.00 23.33 ? 111 VAL H O   1 
ATOM   2499 C  CB  . VAL B 2 111 ? 42.290 23.439  53.291 1.00 22.11 ? 111 VAL H CB  1 
ATOM   2500 C  CG1 . VAL B 2 111 ? 43.002 22.101  52.875 1.00 22.62 ? 111 VAL H CG1 1 
ATOM   2501 C  CG2 . VAL B 2 111 ? 43.326 24.582  53.483 1.00 20.21 ? 111 VAL H CG2 1 
ATOM   2502 N  N   . TRP B 2 112 ? 40.151 22.038  51.016 1.00 23.39 ? 112 TRP H N   1 
ATOM   2503 C  CA  . TRP B 2 112 ? 39.204 20.985  50.711 1.00 23.81 ? 112 TRP H CA  1 
ATOM   2504 C  C   . TRP B 2 112 ? 39.970 19.708  50.406 1.00 24.88 ? 112 TRP H C   1 
ATOM   2505 O  O   . TRP B 2 112 ? 41.143 19.760  50.016 1.00 25.59 ? 112 TRP H O   1 
ATOM   2506 C  CB  . TRP B 2 112 ? 38.388 21.375  49.476 1.00 23.36 ? 112 TRP H CB  1 
ATOM   2507 C  CG  . TRP B 2 112 ? 37.449 22.546  49.666 1.00 22.46 ? 112 TRP H CG  1 
ATOM   2508 C  CD1 . TRP B 2 112 ? 37.787 23.867  49.816 1.00 21.22 ? 112 TRP H CD1 1 
ATOM   2509 C  CD2 . TRP B 2 112 ? 36.017 22.494  49.685 1.00 21.50 ? 112 TRP H CD2 1 
ATOM   2510 N  NE1 . TRP B 2 112 ? 36.654 24.633  49.955 1.00 21.41 ? 112 TRP H NE1 1 
ATOM   2511 C  CE2 . TRP B 2 112 ? 35.552 23.817  49.870 1.00 21.89 ? 112 TRP H CE2 1 
ATOM   2512 C  CE3 . TRP B 2 112 ? 35.080 21.455  49.567 1.00 21.09 ? 112 TRP H CE3 1 
ATOM   2513 C  CZ2 . TRP B 2 112 ? 34.175 24.130  49.941 1.00 22.40 ? 112 TRP H CZ2 1 
ATOM   2514 C  CZ3 . TRP B 2 112 ? 33.725 21.762  49.633 1.00 21.35 ? 112 TRP H CZ3 1 
ATOM   2515 C  CH2 . TRP B 2 112 ? 33.285 23.091  49.816 1.00 21.68 ? 112 TRP H CH2 1 
ATOM   2516 N  N   . GLY B 2 113 ? 39.322 18.562  50.576 1.00 25.85 ? 113 GLY H N   1 
ATOM   2517 C  CA  . GLY B 2 113 ? 39.894 17.292  50.126 1.00 26.60 ? 113 GLY H CA  1 
ATOM   2518 C  C   . GLY B 2 113 ? 39.552 17.058  48.661 1.00 27.26 ? 113 GLY H C   1 
ATOM   2519 O  O   . GLY B 2 113 ? 39.104 17.964  47.972 1.00 27.66 ? 113 GLY H O   1 
ATOM   2520 N  N   . GLN B 2 114 ? 39.738 15.830  48.198 1.00 27.95 ? 114 GLN H N   1 
ATOM   2521 C  CA  . GLN B 2 114 ? 39.467 15.454  46.818 1.00 28.74 ? 114 GLN H CA  1 
ATOM   2522 C  C   . GLN B 2 114 ? 38.071 14.840  46.748 1.00 28.20 ? 114 GLN H C   1 
ATOM   2523 O  O   . GLN B 2 114 ? 37.433 14.836  45.696 1.00 28.42 ? 114 GLN H O   1 
ATOM   2524 C  CB  . GLN B 2 114 ? 40.540 14.457  46.328 1.00 28.90 ? 114 GLN H CB  1 
ATOM   2525 C  CG  . GLN B 2 114 ? 40.837 14.503  44.826 1.00 30.53 ? 114 GLN H CG  1 
ATOM   2526 C  CD  . GLN B 2 114 ? 42.287 14.100  44.464 1.00 30.90 ? 114 GLN H CD  1 
ATOM   2527 O  OE1 . GLN B 2 114 ? 42.722 12.980  44.730 1.00 31.56 ? 114 GLN H OE1 1 
ATOM   2528 N  NE2 . GLN B 2 114 ? 43.024 15.028  43.827 1.00 34.19 ? 114 GLN H NE2 1 
ATOM   2529 N  N   . GLY B 2 115 ? 37.601 14.330  47.882 1.00 27.71 ? 115 GLY H N   1 
ATOM   2530 C  CA  . GLY B 2 115 ? 36.266 13.762  47.988 1.00 27.04 ? 115 GLY H CA  1 
ATOM   2531 C  C   . GLY B 2 115 ? 36.260 12.252  47.943 1.00 26.92 ? 115 GLY H C   1 
ATOM   2532 O  O   . GLY B 2 115 ? 37.132 11.625  47.338 1.00 27.02 ? 115 GLY H O   1 
ATOM   2533 N  N   . THR B 2 116 ? 35.269 11.668  48.602 1.00 26.66 ? 116 THR H N   1 
ATOM   2534 C  CA  . THR B 2 116 ? 35.024 10.228  48.528 1.00 26.03 ? 116 THR H CA  1 
ATOM   2535 C  C   . THR B 2 116 ? 33.607 10.048  47.985 1.00 25.93 ? 116 THR H C   1 
ATOM   2536 O  O   . THR B 2 116 ? 32.706 10.777  48.391 1.00 25.34 ? 116 THR H O   1 
ATOM   2537 C  CB  . THR B 2 116 ? 35.274 9.510   49.905 1.00 25.72 ? 116 THR H CB  1 
ATOM   2538 O  OG1 . THR B 2 116 ? 35.284 8.097   49.711 1.00 25.43 ? 116 THR H OG1 1 
ATOM   2539 C  CG2 . THR B 2 116 ? 34.230 9.888   50.995 1.00 24.97 ? 116 THR H CG2 1 
ATOM   2540 N  N   . THR B 2 117 ? 33.405 9.138   47.031 1.00 26.30 ? 117 THR H N   1 
ATOM   2541 C  CA  . THR B 2 117 ? 32.057 9.045   46.440 1.00 26.45 ? 117 THR H CA  1 
ATOM   2542 C  C   . THR B 2 117 ? 31.198 7.981   47.096 1.00 26.31 ? 117 THR H C   1 
ATOM   2543 O  O   . THR B 2 117 ? 31.621 6.844   47.309 1.00 26.99 ? 117 THR H O   1 
ATOM   2544 C  CB  . THR B 2 117 ? 31.977 9.033   44.855 1.00 26.57 ? 117 THR H CB  1 
ATOM   2545 O  OG1 . THR B 2 117 ? 31.438 7.792   44.363 1.00 27.95 ? 117 THR H OG1 1 
ATOM   2546 C  CG2 . THR B 2 117 ? 33.292 9.362   44.207 1.00 26.59 ? 117 THR H CG2 1 
ATOM   2547 N  N   . VAL B 2 118 ? 29.986 8.394   47.432 1.00 25.84 ? 118 VAL H N   1 
ATOM   2548 C  CA  . VAL B 2 118 ? 29.022 7.550   48.095 1.00 25.17 ? 118 VAL H CA  1 
ATOM   2549 C  C   . VAL B 2 118 ? 27.904 7.249   47.092 1.00 25.59 ? 118 VAL H C   1 
ATOM   2550 O  O   . VAL B 2 118 ? 27.291 8.166   46.546 1.00 25.05 ? 118 VAL H O   1 
ATOM   2551 C  CB  . VAL B 2 118 ? 28.471 8.249   49.368 1.00 24.46 ? 118 VAL H CB  1 
ATOM   2552 C  CG1 . VAL B 2 118 ? 27.266 7.506   49.942 1.00 23.84 ? 118 VAL H CG1 1 
ATOM   2553 C  CG2 . VAL B 2 118 ? 29.566 8.388   50.395 1.00 23.11 ? 118 VAL H CG2 1 
ATOM   2554 N  N   . THR B 2 119 ? 27.657 5.963   46.847 1.00 26.09 ? 119 THR H N   1 
ATOM   2555 C  CA  . THR B 2 119 ? 26.559 5.553   45.967 1.00 26.83 ? 119 THR H CA  1 
ATOM   2556 C  C   . THR B 2 119 ? 25.537 4.727   46.736 1.00 27.46 ? 119 THR H C   1 
ATOM   2557 O  O   . THR B 2 119 ? 25.833 3.631   47.211 1.00 27.49 ? 119 THR H O   1 
ATOM   2558 C  CB  . THR B 2 119 ? 27.053 4.749   44.727 1.00 26.61 ? 119 THR H CB  1 
ATOM   2559 O  OG1 . THR B 2 119 ? 28.267 5.328   44.223 1.00 27.15 ? 119 THR H OG1 1 
ATOM   2560 C  CG2 . THR B 2 119 ? 25.979 4.720   43.630 1.00 25.22 ? 119 THR H CG2 1 
ATOM   2561 N  N   . VAL B 2 120 ? 24.325 5.256   46.849 1.00 28.59 ? 120 VAL H N   1 
ATOM   2562 C  CA  . VAL B 2 120 ? 23.240 4.526   47.525 1.00 29.30 ? 120 VAL H CA  1 
ATOM   2563 C  C   . VAL B 2 120 ? 22.208 4.015   46.518 1.00 29.73 ? 120 VAL H C   1 
ATOM   2564 O  O   . VAL B 2 120 ? 21.431 4.792   45.959 1.00 29.67 ? 120 VAL H O   1 
ATOM   2565 C  CB  . VAL B 2 120 ? 22.538 5.376   48.611 1.00 29.04 ? 120 VAL H CB  1 
ATOM   2566 C  CG1 . VAL B 2 120 ? 21.586 4.503   49.387 1.00 29.25 ? 120 VAL H CG1 1 
ATOM   2567 C  CG2 . VAL B 2 120 ? 23.563 6.017   49.531 1.00 28.60 ? 120 VAL H CG2 1 
ATOM   2568 N  N   . SER B 2 121 ? 22.211 2.703   46.301 1.00 30.64 ? 121 SER H N   1 
ATOM   2569 C  CA  . SER B 2 121 ? 21.353 2.096   45.286 1.00 31.48 ? 121 SER H CA  1 
ATOM   2570 C  C   . SER B 2 121 ? 21.006 0.645   45.596 1.00 32.09 ? 121 SER H C   1 
ATOM   2571 O  O   . SER B 2 121 ? 21.792 -0.084  46.198 1.00 31.82 ? 121 SER H O   1 
ATOM   2572 C  CB  . SER B 2 121 ? 22.032 2.182   43.911 1.00 31.38 ? 121 SER H CB  1 
ATOM   2573 O  OG  . SER B 2 121 ? 21.261 1.521   42.926 1.00 30.99 ? 121 SER H OG  1 
ATOM   2574 N  N   . SER B 2 122 ? 19.815 0.233   45.170 1.00 33.46 ? 122 SER H N   1 
ATOM   2575 C  CA  . SER B 2 122 ? 19.445 -1.181  45.191 1.00 34.58 ? 122 SER H CA  1 
ATOM   2576 C  C   . SER B 2 122 ? 20.131 -1.970  44.067 1.00 34.83 ? 122 SER H C   1 
ATOM   2577 O  O   . SER B 2 122 ? 20.388 -3.177  44.215 1.00 35.20 ? 122 SER H O   1 
ATOM   2578 C  CB  . SER B 2 122 ? 17.928 -1.332  45.102 1.00 35.00 ? 122 SER H CB  1 
ATOM   2579 O  OG  . SER B 2 122 ? 17.337 -1.002  46.345 1.00 36.33 ? 122 SER H OG  1 
ATOM   2580 N  N   . ALA B 2 123 ? 20.431 -1.278  42.965 1.00 34.70 ? 123 ALA H N   1 
ATOM   2581 C  CA  . ALA B 2 123 ? 21.034 -1.883  41.764 1.00 34.85 ? 123 ALA H CA  1 
ATOM   2582 C  C   . ALA B 2 123 ? 22.447 -2.446  41.977 1.00 34.82 ? 123 ALA H C   1 
ATOM   2583 O  O   . ALA B 2 123 ? 23.319 -1.777  42.518 1.00 34.74 ? 123 ALA H O   1 
ATOM   2584 C  CB  . ALA B 2 123 ? 21.027 -0.874  40.595 1.00 34.67 ? 123 ALA H CB  1 
ATOM   2585 N  N   . SER B 2 124 ? 22.657 -3.678  41.522 1.00 35.05 ? 124 SER H N   1 
ATOM   2586 C  CA  . SER B 2 124 ? 23.926 -4.392  41.685 1.00 35.12 ? 124 SER H CA  1 
ATOM   2587 C  C   . SER B 2 124 ? 24.992 -3.855  40.731 1.00 35.04 ? 124 SER H C   1 
ATOM   2588 O  O   . SER B 2 124 ? 24.661 -3.310  39.675 1.00 35.48 ? 124 SER H O   1 
ATOM   2589 C  CB  . SER B 2 124 ? 23.700 -5.895  41.470 1.00 35.39 ? 124 SER H CB  1 
ATOM   2590 O  OG  . SER B 2 124 ? 22.631 -6.114  40.560 1.00 35.87 ? 124 SER H OG  1 
ATOM   2591 N  N   . THR B 2 125 ? 26.266 -3.987  41.097 1.00 34.62 ? 125 THR H N   1 
ATOM   2592 C  CA  . THR B 2 125 ? 27.336 -3.506  40.221 1.00 34.28 ? 125 THR H CA  1 
ATOM   2593 C  C   . THR B 2 125 ? 27.429 -4.367  38.961 1.00 33.90 ? 125 THR H C   1 
ATOM   2594 O  O   . THR B 2 125 ? 27.289 -5.594  39.023 1.00 33.72 ? 125 THR H O   1 
ATOM   2595 C  CB  . THR B 2 125 ? 28.742 -3.393  40.912 1.00 34.32 ? 125 THR H CB  1 
ATOM   2596 O  OG1 . THR B 2 125 ? 29.524 -4.552  40.628 1.00 35.44 ? 125 THR H OG1 1 
ATOM   2597 C  CG2 . THR B 2 125 ? 28.630 -3.210  42.403 1.00 33.91 ? 125 THR H CG2 1 
ATOM   2598 N  N   . LYS B 2 126 ? 27.663 -3.711  37.821 1.00 33.37 ? 126 LYS H N   1 
ATOM   2599 C  CA  . LYS B 2 126 ? 27.670 -4.376  36.522 1.00 32.29 ? 126 LYS H CA  1 
ATOM   2600 C  C   . LYS B 2 126 ? 28.757 -3.780  35.643 1.00 31.54 ? 126 LYS H C   1 
ATOM   2601 O  O   . LYS B 2 126 ? 28.793 -2.572  35.426 1.00 31.58 ? 126 LYS H O   1 
ATOM   2602 C  CB  . LYS B 2 126 ? 26.292 -4.239  35.858 1.00 32.35 ? 126 LYS H CB  1 
ATOM   2603 C  CG  . LYS B 2 126 ? 26.140 -4.976  34.545 1.00 32.80 ? 126 LYS H CG  1 
ATOM   2604 C  CD  . LYS B 2 126 ? 24.839 -4.578  33.881 1.00 34.52 ? 126 LYS H CD  1 
ATOM   2605 C  CE  . LYS B 2 126 ? 24.411 -5.588  32.827 1.00 35.92 ? 126 LYS H CE  1 
ATOM   2606 N  NZ  . LYS B 2 126 ? 25.178 -5.433  31.564 1.00 36.02 ? 126 LYS H NZ  1 
ATOM   2607 N  N   . GLY B 2 127 ? 29.642 -4.637  35.141 1.00 30.76 ? 127 GLY H N   1 
ATOM   2608 C  CA  . GLY B 2 127 ? 30.702 -4.217  34.218 1.00 29.63 ? 127 GLY H CA  1 
ATOM   2609 C  C   . GLY B 2 127 ? 30.183 -3.820  32.849 1.00 28.64 ? 127 GLY H C   1 
ATOM   2610 O  O   . GLY B 2 127 ? 29.110 -4.270  32.434 1.00 29.25 ? 127 GLY H O   1 
ATOM   2611 N  N   . PRO B 2 128 ? 30.922 -2.953  32.148 1.00 27.82 ? 128 PRO H N   1 
ATOM   2612 C  CA  . PRO B 2 128 ? 30.547 -2.526  30.796 1.00 27.34 ? 128 PRO H CA  1 
ATOM   2613 C  C   . PRO B 2 128 ? 30.740 -3.568  29.686 1.00 27.25 ? 128 PRO H C   1 
ATOM   2614 O  O   . PRO B 2 128 ? 31.518 -4.520  29.823 1.00 26.74 ? 128 PRO H O   1 
ATOM   2615 C  CB  . PRO B 2 128 ? 31.491 -1.347  30.539 1.00 27.26 ? 128 PRO H CB  1 
ATOM   2616 C  CG  . PRO B 2 128 ? 32.705 -1.650  31.372 1.00 26.62 ? 128 PRO H CG  1 
ATOM   2617 C  CD  . PRO B 2 128 ? 32.149 -2.274  32.622 1.00 27.52 ? 128 PRO H CD  1 
ATOM   2618 N  N   . SER B 2 129 ? 30.017 -3.367  28.591 1.00 26.93 ? 129 SER H N   1 
ATOM   2619 C  CA  . SER B 2 129 ? 30.352 -3.994  27.323 1.00 26.74 ? 129 SER H CA  1 
ATOM   2620 C  C   . SER B 2 129 ? 31.061 -2.936  26.512 1.00 25.98 ? 129 SER H C   1 
ATOM   2621 O  O   . SER B 2 129 ? 30.658 -1.764  26.502 1.00 25.17 ? 129 SER H O   1 
ATOM   2622 C  CB  . SER B 2 129 ? 29.101 -4.448  26.570 1.00 26.81 ? 129 SER H CB  1 
ATOM   2623 O  OG  . SER B 2 129 ? 28.425 -5.461  27.279 1.00 28.99 ? 129 SER H OG  1 
ATOM   2624 N  N   . VAL B 2 130 ? 32.114 -3.356  25.825 1.00 25.85 ? 130 VAL H N   1 
ATOM   2625 C  CA  . VAL B 2 130 ? 32.903 -2.441  25.009 1.00 25.75 ? 130 VAL H CA  1 
ATOM   2626 C  C   . VAL B 2 130 ? 32.772 -2.806  23.530 1.00 25.67 ? 130 VAL H C   1 
ATOM   2627 O  O   . VAL B 2 130 ? 33.127 -3.919  23.124 1.00 25.04 ? 130 VAL H O   1 
ATOM   2628 C  CB  . VAL B 2 130 ? 34.398 -2.387  25.484 1.00 26.09 ? 130 VAL H CB  1 
ATOM   2629 C  CG1 . VAL B 2 130 ? 35.205 -1.401  24.632 1.00 25.38 ? 130 VAL H CG1 1 
ATOM   2630 C  CG2 . VAL B 2 130 ? 34.479 -2.006  26.975 1.00 25.08 ? 130 VAL H CG2 1 
ATOM   2631 N  N   . PHE B 2 131 ? 32.221 -1.867  22.751 1.00 25.92 ? 131 PHE H N   1 
ATOM   2632 C  CA  . PHE B 2 131 ? 32.036 -2.012  21.299 1.00 25.91 ? 131 PHE H CA  1 
ATOM   2633 C  C   . PHE B 2 131 ? 32.887 -1.009  20.501 1.00 26.39 ? 131 PHE H C   1 
ATOM   2634 O  O   . PHE B 2 131 ? 33.065 0.139   20.920 1.00 26.10 ? 131 PHE H O   1 
ATOM   2635 C  CB  . PHE B 2 131 ? 30.562 -1.850  20.917 1.00 25.68 ? 131 PHE H CB  1 
ATOM   2636 C  CG  . PHE B 2 131 ? 29.613 -2.685  21.750 1.00 25.74 ? 131 PHE H CG  1 
ATOM   2637 C  CD1 . PHE B 2 131 ? 29.622 -4.071  21.665 1.00 26.47 ? 131 PHE H CD1 1 
ATOM   2638 C  CD2 . PHE B 2 131 ? 28.696 -2.078  22.598 1.00 25.72 ? 131 PHE H CD2 1 
ATOM   2639 C  CE1 . PHE B 2 131 ? 28.740 -4.846  22.433 1.00 25.93 ? 131 PHE H CE1 1 
ATOM   2640 C  CE2 . PHE B 2 131 ? 27.805 -2.838  23.358 1.00 25.80 ? 131 PHE H CE2 1 
ATOM   2641 C  CZ  . PHE B 2 131 ? 27.825 -4.221  23.269 1.00 25.46 ? 131 PHE H CZ  1 
ATOM   2642 N  N   . PRO B 2 132 ? 33.432 -1.439  19.350 1.00 26.94 ? 132 PRO H N   1 
ATOM   2643 C  CA  . PRO B 2 132 ? 34.190 -0.462  18.569 1.00 27.26 ? 132 PRO H CA  1 
ATOM   2644 C  C   . PRO B 2 132 ? 33.307 0.532   17.814 1.00 27.67 ? 132 PRO H C   1 
ATOM   2645 O  O   . PRO B 2 132 ? 32.206 0.194   17.381 1.00 27.24 ? 132 PRO H O   1 
ATOM   2646 C  CB  . PRO B 2 132 ? 34.963 -1.330  17.574 1.00 27.08 ? 132 PRO H CB  1 
ATOM   2647 C  CG  . PRO B 2 132 ? 34.106 -2.523  17.392 1.00 27.39 ? 132 PRO H CG  1 
ATOM   2648 C  CD  . PRO B 2 132 ? 33.437 -2.776  18.726 1.00 26.75 ? 132 PRO H CD  1 
ATOM   2649 N  N   . LEU B 2 133 ? 33.800 1.758   17.697 1.00 28.39 ? 133 LEU H N   1 
ATOM   2650 C  CA  . LEU B 2 133 ? 33.270 2.722   16.762 1.00 29.22 ? 133 LEU H CA  1 
ATOM   2651 C  C   . LEU B 2 133 ? 34.367 2.817   15.711 1.00 30.24 ? 133 LEU H C   1 
ATOM   2652 O  O   . LEU B 2 133 ? 35.343 3.553   15.873 1.00 29.83 ? 133 LEU H O   1 
ATOM   2653 C  CB  . LEU B 2 133 ? 33.000 4.070   17.446 1.00 29.01 ? 133 LEU H CB  1 
ATOM   2654 C  CG  . LEU B 2 133 ? 32.021 4.111   18.640 1.00 28.80 ? 133 LEU H CG  1 
ATOM   2655 C  CD1 . LEU B 2 133 ? 32.215 5.349   19.518 1.00 27.92 ? 133 LEU H CD1 1 
ATOM   2656 C  CD2 . LEU B 2 133 ? 30.582 4.023   18.187 1.00 27.89 ? 133 LEU H CD2 1 
ATOM   2657 N  N   . ALA B 2 134 ? 34.214 2.019   14.654 1.00 31.53 ? 134 ALA H N   1 
ATOM   2658 C  CA  . ALA B 2 134 ? 35.237 1.859   13.620 1.00 32.90 ? 134 ALA H CA  1 
ATOM   2659 C  C   . ALA B 2 134 ? 35.357 3.080   12.707 1.00 33.98 ? 134 ALA H C   1 
ATOM   2660 O  O   . ALA B 2 134 ? 34.339 3.697   12.358 1.00 33.89 ? 134 ALA H O   1 
ATOM   2661 C  CB  . ALA B 2 134 ? 34.962 0.591   12.787 1.00 32.65 ? 134 ALA H CB  1 
ATOM   2662 N  N   . PRO B 2 135 ? 36.603 3.427   12.314 1.00 35.21 ? 135 PRO H N   1 
ATOM   2663 C  CA  . PRO B 2 135 ? 36.856 4.505   11.358 1.00 36.17 ? 135 PRO H CA  1 
ATOM   2664 C  C   . PRO B 2 135 ? 36.208 4.223   10.010 1.00 37.36 ? 135 PRO H C   1 
ATOM   2665 O  O   . PRO B 2 135 ? 36.215 3.076   9.551  1.00 37.69 ? 135 PRO H O   1 
ATOM   2666 C  CB  . PRO B 2 135 ? 38.386 4.524   11.229 1.00 35.96 ? 135 PRO H CB  1 
ATOM   2667 C  CG  . PRO B 2 135 ? 38.845 3.210   11.746 1.00 35.73 ? 135 PRO H CG  1 
ATOM   2668 C  CD  . PRO B 2 135 ? 37.858 2.802   12.783 1.00 35.40 ? 135 PRO H CD  1 
ATOM   2669 N  N   . GLY B 2 136 ? 35.635 5.265   9.408  1.00 38.36 ? 136 GLY H N   1 
ATOM   2670 C  CA  . GLY B 2 136 ? 34.948 5.173   8.113  1.00 39.57 ? 136 GLY H CA  1 
ATOM   2671 C  C   . GLY B 2 136 ? 35.879 4.870   6.948  1.00 39.97 ? 136 GLY H C   1 
ATOM   2672 O  O   . GLY B 2 136 ? 35.548 4.043   6.091  1.00 40.32 ? 136 GLY H O   1 
ATOM   2673 N  N   . GLY B 2 143 ? 43.668 13.906  5.096  1.00 34.67 ? 143 GLY H N   1 
ATOM   2674 C  CA  . GLY B 2 143 ? 42.420 14.127  5.849  1.00 34.24 ? 143 GLY H CA  1 
ATOM   2675 C  C   . GLY B 2 143 ? 42.397 13.540  7.262  1.00 33.58 ? 143 GLY H C   1 
ATOM   2676 O  O   . GLY B 2 143 ? 43.370 12.927  7.728  1.00 33.67 ? 143 GLY H O   1 
ATOM   2677 N  N   . THR B 2 144 ? 41.274 13.725  7.943  1.00 32.68 ? 144 THR H N   1 
ATOM   2678 C  CA  . THR B 2 144 ? 41.143 13.260  9.313  1.00 31.99 ? 144 THR H CA  1 
ATOM   2679 C  C   . THR B 2 144 ? 39.998 12.254  9.528  1.00 31.45 ? 144 THR H C   1 
ATOM   2680 O  O   . THR B 2 144 ? 38.872 12.439  9.057  1.00 31.44 ? 144 THR H O   1 
ATOM   2681 C  CB  . THR B 2 144 ? 41.186 14.445  10.360 1.00 31.95 ? 144 THR H CB  1 
ATOM   2682 O  OG1 . THR B 2 144 ? 40.311 14.181  11.465 1.00 32.67 ? 144 THR H OG1 1 
ATOM   2683 C  CG2 . THR B 2 144 ? 40.832 15.768  9.742  1.00 31.32 ? 144 THR H CG2 1 
ATOM   2684 N  N   . ALA B 2 145 ? 40.327 11.167  10.220 1.00 30.53 ? 145 ALA H N   1 
ATOM   2685 C  CA  . ALA B 2 145 ? 39.371 10.113  10.554 1.00 29.42 ? 145 ALA H CA  1 
ATOM   2686 C  C   . ALA B 2 145 ? 38.987 10.180  12.034 1.00 28.66 ? 145 ALA H C   1 
ATOM   2687 O  O   . ALA B 2 145 ? 39.663 10.816  12.825 1.00 28.39 ? 145 ALA H O   1 
ATOM   2688 C  CB  . ALA B 2 145 ? 39.971 8.759   10.231 1.00 29.42 ? 145 ALA H CB  1 
ATOM   2689 N  N   . ALA B 2 146 ? 37.891 9.520   12.398 1.00 28.01 ? 146 ALA H N   1 
ATOM   2690 C  CA  . ALA B 2 146 ? 37.488 9.383   13.795 1.00 27.25 ? 146 ALA H CA  1 
ATOM   2691 C  C   . ALA B 2 146 ? 37.206 7.921   14.107 1.00 26.73 ? 146 ALA H C   1 
ATOM   2692 O  O   . ALA B 2 146 ? 36.721 7.177   13.275 1.00 26.79 ? 146 ALA H O   1 
ATOM   2693 C  CB  . ALA B 2 146 ? 36.265 10.232  14.093 1.00 27.14 ? 146 ALA H CB  1 
ATOM   2694 N  N   . LEU B 2 147 ? 37.534 7.516   15.321 1.00 26.39 ? 147 LEU H N   1 
ATOM   2695 C  CA  . LEU B 2 147 ? 37.286 6.164   15.773 1.00 25.79 ? 147 LEU H CA  1 
ATOM   2696 C  C   . LEU B 2 147 ? 36.972 6.262   17.262 1.00 25.41 ? 147 LEU H C   1 
ATOM   2697 O  O   . LEU B 2 147 ? 37.142 7.323   17.877 1.00 24.81 ? 147 LEU H O   1 
ATOM   2698 C  CB  . LEU B 2 147 ? 38.501 5.267   15.479 1.00 26.05 ? 147 LEU H CB  1 
ATOM   2699 C  CG  . LEU B 2 147 ? 39.865 5.657   16.085 1.00 26.37 ? 147 LEU H CG  1 
ATOM   2700 C  CD1 . LEU B 2 147 ? 40.116 4.841   17.324 1.00 27.25 ? 147 LEU H CD1 1 
ATOM   2701 C  CD2 . LEU B 2 147 ? 40.998 5.467   15.099 1.00 25.44 ? 147 LEU H CD2 1 
ATOM   2702 N  N   . GLY B 2 148 ? 36.509 5.169   17.847 1.00 25.20 ? 148 GLY H N   1 
ATOM   2703 C  CA  . GLY B 2 148 ? 36.227 5.197   19.260 1.00 25.14 ? 148 GLY H CA  1 
ATOM   2704 C  C   . GLY B 2 148 ? 35.824 3.879   19.857 1.00 25.02 ? 148 GLY H C   1 
ATOM   2705 O  O   . GLY B 2 148 ? 35.913 2.836   19.208 1.00 25.29 ? 148 GLY H O   1 
ATOM   2706 N  N   . CYS B 2 149 ? 35.397 3.959   21.112 1.00 24.61 ? 149 CYS H N   1 
ATOM   2707 C  CA  . CYS B 2 149 ? 34.827 2.848   21.852 1.00 24.54 ? 149 CYS H CA  1 
ATOM   2708 C  C   . CYS B 2 149 ? 33.552 3.314   22.537 1.00 23.99 ? 149 CYS H C   1 
ATOM   2709 O  O   . CYS B 2 149 ? 33.514 4.410   23.106 1.00 24.23 ? 149 CYS H O   1 
ATOM   2710 C  CB  . CYS B 2 149 ? 35.821 2.315   22.884 1.00 24.79 ? 149 CYS H CB  1 
ATOM   2711 S  SG  . CYS B 2 149 ? 37.118 1.326   22.135 1.00 26.00 ? 149 CYS H SG  1 
ATOM   2712 N  N   . LEU B 2 150 ? 32.500 2.503   22.413 1.00 23.19 ? 150 LEU H N   1 
ATOM   2713 C  CA  . LEU B 2 150 ? 31.252 2.693   23.144 1.00 22.51 ? 150 LEU H CA  1 
ATOM   2714 C  C   . LEU B 2 150 ? 31.308 1.801   24.369 1.00 22.83 ? 150 LEU H C   1 
ATOM   2715 O  O   . LEU B 2 150 ? 31.491 0.587   24.262 1.00 22.23 ? 150 LEU H O   1 
ATOM   2716 C  CB  . LEU B 2 150 ? 30.037 2.350   22.274 1.00 22.40 ? 150 LEU H CB  1 
ATOM   2717 C  CG  . LEU B 2 150 ? 28.607 2.386   22.848 1.00 22.67 ? 150 LEU H CG  1 
ATOM   2718 C  CD1 . LEU B 2 150 ? 28.135 3.803   23.261 1.00 22.33 ? 150 LEU H CD1 1 
ATOM   2719 C  CD2 . LEU B 2 150 ? 27.626 1.769   21.860 1.00 21.18 ? 150 LEU H CD2 1 
ATOM   2720 N  N   . VAL B 2 151 ? 31.169 2.429   25.536 1.00 23.44 ? 151 VAL H N   1 
ATOM   2721 C  CA  . VAL B 2 151 ? 31.269 1.753   26.814 1.00 23.82 ? 151 VAL H CA  1 
ATOM   2722 C  C   . VAL B 2 151 ? 29.872 1.704   27.397 1.00 24.44 ? 151 VAL H C   1 
ATOM   2723 O  O   . VAL B 2 151 ? 29.391 2.684   27.976 1.00 24.53 ? 151 VAL H O   1 
ATOM   2724 C  CB  . VAL B 2 151 ? 32.295 2.467   27.772 1.00 24.05 ? 151 VAL H CB  1 
ATOM   2725 C  CG1 . VAL B 2 151 ? 32.496 1.664   29.077 1.00 23.45 ? 151 VAL H CG1 1 
ATOM   2726 C  CG2 . VAL B 2 151 ? 33.633 2.682   27.064 1.00 23.07 ? 151 VAL H CG2 1 
ATOM   2727 N  N   . LYS B 2 152 ? 29.227 0.546   27.255 1.00 25.11 ? 152 LYS H N   1 
ATOM   2728 C  CA  . LYS B 2 152 ? 27.785 0.463   27.461 1.00 25.63 ? 152 LYS H CA  1 
ATOM   2729 C  C   . LYS B 2 152 ? 27.368 -0.395  28.659 1.00 25.61 ? 152 LYS H C   1 
ATOM   2730 O  O   . LYS B 2 152 ? 27.952 -1.459  28.924 1.00 25.53 ? 152 LYS H O   1 
ATOM   2731 C  CB  . LYS B 2 152 ? 27.107 -0.045  26.174 1.00 26.10 ? 152 LYS H CB  1 
ATOM   2732 C  CG  . LYS B 2 152 ? 25.833 0.703   25.793 1.00 26.95 ? 152 LYS H CG  1 
ATOM   2733 C  CD  . LYS B 2 152 ? 24.993 -0.092  24.846 1.00 28.83 ? 152 LYS H CD  1 
ATOM   2734 C  CE  . LYS B 2 152 ? 23.659 0.609   24.565 1.00 30.20 ? 152 LYS H CE  1 
ATOM   2735 N  NZ  . LYS B 2 152 ? 22.585 0.238   25.513 1.00 30.74 ? 152 LYS H NZ  1 
ATOM   2736 N  N   . ASP B 2 153 ? 26.356 0.090   29.383 1.00 25.28 ? 153 ASP H N   1 
ATOM   2737 C  CA  . ASP B 2 153 ? 25.618 -0.723  30.354 1.00 25.19 ? 153 ASP H CA  1 
ATOM   2738 C  C   . ASP B 2 153 ? 26.424 -1.163  31.563 1.00 25.02 ? 153 ASP H C   1 
ATOM   2739 O  O   . ASP B 2 153 ? 26.579 -2.354  31.812 1.00 24.95 ? 153 ASP H O   1 
ATOM   2740 C  CB  . ASP B 2 153 ? 25.002 -1.963  29.682 1.00 25.07 ? 153 ASP H CB  1 
ATOM   2741 C  CG  . ASP B 2 153 ? 23.936 -1.610  28.701 1.00 24.38 ? 153 ASP H CG  1 
ATOM   2742 O  OD1 . ASP B 2 153 ? 23.364 -0.494  28.788 1.00 24.09 ? 153 ASP H OD1 1 
ATOM   2743 O  OD2 . ASP B 2 153 ? 23.679 -2.452  27.833 1.00 24.47 ? 153 ASP H OD2 1 
ATOM   2744 N  N   . TYR B 2 154 ? 26.905 -0.183  32.317 1.00 24.85 ? 154 TYR H N   1 
ATOM   2745 C  CA  . TYR B 2 154 ? 27.620 -0.426  33.545 1.00 24.34 ? 154 TYR H CA  1 
ATOM   2746 C  C   . TYR B 2 154 ? 26.963 0.326   34.700 1.00 24.59 ? 154 TYR H C   1 
ATOM   2747 O  O   . TYR B 2 154 ? 26.250 1.335   34.513 1.00 24.80 ? 154 TYR H O   1 
ATOM   2748 C  CB  . TYR B 2 154 ? 29.101 -0.048  33.391 1.00 24.19 ? 154 TYR H CB  1 
ATOM   2749 C  CG  . TYR B 2 154 ? 29.373 1.428   33.106 1.00 23.31 ? 154 TYR H CG  1 
ATOM   2750 C  CD1 . TYR B 2 154 ? 29.632 2.324   34.143 1.00 22.54 ? 154 TYR H CD1 1 
ATOM   2751 C  CD2 . TYR B 2 154 ? 29.397 1.909   31.801 1.00 22.09 ? 154 TYR H CD2 1 
ATOM   2752 C  CE1 . TYR B 2 154 ? 29.893 3.675   33.887 1.00 22.58 ? 154 TYR H CE1 1 
ATOM   2753 C  CE2 . TYR B 2 154 ? 29.650 3.245   31.529 1.00 22.15 ? 154 TYR H CE2 1 
ATOM   2754 C  CZ  . TYR B 2 154 ? 29.901 4.126   32.576 1.00 22.99 ? 154 TYR H CZ  1 
ATOM   2755 O  OH  . TYR B 2 154 ? 30.152 5.452   32.308 1.00 23.37 ? 154 TYR H OH  1 
ATOM   2756 N  N   . PHE B 2 155 ? 27.184 -0.189  35.900 1.00 24.45 ? 155 PHE H N   1 
ATOM   2757 C  CA  . PHE B 2 155 ? 26.722 0.467   37.112 1.00 24.36 ? 155 PHE H CA  1 
ATOM   2758 C  C   . PHE B 2 155 ? 27.650 0.057   38.257 1.00 24.30 ? 155 PHE H C   1 
ATOM   2759 O  O   . PHE B 2 155 ? 28.053 -1.097  38.326 1.00 24.51 ? 155 PHE H O   1 
ATOM   2760 C  CB  . PHE B 2 155 ? 25.242 0.134   37.433 1.00 24.17 ? 155 PHE H CB  1 
ATOM   2761 C  CG  . PHE B 2 155 ? 24.714 0.898   38.610 1.00 23.98 ? 155 PHE H CG  1 
ATOM   2762 C  CD1 . PHE B 2 155 ? 24.271 2.211   38.457 1.00 23.58 ? 155 PHE H CD1 1 
ATOM   2763 C  CD2 . PHE B 2 155 ? 24.744 0.342   39.889 1.00 23.65 ? 155 PHE H CD2 1 
ATOM   2764 C  CE1 . PHE B 2 155 ? 23.818 2.950   39.559 1.00 23.98 ? 155 PHE H CE1 1 
ATOM   2765 C  CE2 . PHE B 2 155 ? 24.305 1.066   40.996 1.00 24.04 ? 155 PHE H CE2 1 
ATOM   2766 C  CZ  . PHE B 2 155 ? 23.837 2.381   40.829 1.00 23.90 ? 155 PHE H CZ  1 
ATOM   2767 N  N   . PRO B 2 156 ? 28.042 1.013   39.123 1.00 24.29 ? 156 PRO H N   1 
ATOM   2768 C  CA  . PRO B 2 156 ? 27.793 2.445   38.992 1.00 24.45 ? 156 PRO H CA  1 
ATOM   2769 C  C   . PRO B 2 156 ? 28.930 3.160   38.263 1.00 24.94 ? 156 PRO H C   1 
ATOM   2770 O  O   . PRO B 2 156 ? 29.828 2.516   37.699 1.00 25.00 ? 156 PRO H O   1 
ATOM   2771 C  CB  . PRO B 2 156 ? 27.731 2.904   40.450 1.00 24.38 ? 156 PRO H CB  1 
ATOM   2772 C  CG  . PRO B 2 156 ? 28.660 1.975   41.173 1.00 24.07 ? 156 PRO H CG  1 
ATOM   2773 C  CD  . PRO B 2 156 ? 28.785 0.707   40.359 1.00 24.22 ? 156 PRO H CD  1 
ATOM   2774 N  N   . GLU B 2 157 ? 28.885 4.487   38.272 1.00 25.73 ? 157 GLU H N   1 
ATOM   2775 C  CA  . GLU B 2 157 ? 30.034 5.297   37.877 1.00 26.40 ? 157 GLU H CA  1 
ATOM   2776 C  C   . GLU B 2 157 ? 31.152 5.180   38.925 1.00 26.55 ? 157 GLU H C   1 
ATOM   2777 O  O   . GLU B 2 157 ? 30.883 4.884   40.090 1.00 26.95 ? 157 GLU H O   1 
ATOM   2778 C  CB  . GLU B 2 157 ? 29.611 6.755   37.666 1.00 26.54 ? 157 GLU H CB  1 
ATOM   2779 C  CG  . GLU B 2 157 ? 28.724 6.954   36.451 1.00 28.05 ? 157 GLU H CG  1 
ATOM   2780 C  CD  . GLU B 2 157 ? 28.866 8.341   35.858 1.00 29.86 ? 157 GLU H CD  1 
ATOM   2781 O  OE1 . GLU B 2 157 ? 29.903 8.608   35.197 1.00 31.38 ? 157 GLU H OE1 1 
ATOM   2782 O  OE2 . GLU B 2 157 ? 27.949 9.161   36.068 1.00 29.97 ? 157 GLU H OE2 1 
ATOM   2783 N  N   . PRO B 2 158 ? 32.415 5.406   38.516 1.00 26.97 ? 158 PRO H N   1 
ATOM   2784 C  CA  . PRO B 2 158 ? 32.833 5.777   37.174 1.00 27.28 ? 158 PRO H CA  1 
ATOM   2785 C  C   . PRO B 2 158 ? 33.445 4.647   36.337 1.00 27.76 ? 158 PRO H C   1 
ATOM   2786 O  O   . PRO B 2 158 ? 33.776 3.573   36.846 1.00 27.89 ? 158 PRO H O   1 
ATOM   2787 C  CB  . PRO B 2 158 ? 33.910 6.827   37.460 1.00 27.34 ? 158 PRO H CB  1 
ATOM   2788 C  CG  . PRO B 2 158 ? 34.557 6.346   38.762 1.00 26.75 ? 158 PRO H CG  1 
ATOM   2789 C  CD  . PRO B 2 158 ? 33.570 5.380   39.427 1.00 26.94 ? 158 PRO H CD  1 
ATOM   2790 N  N   . VAL B 2 159 ? 33.597 4.930   35.051 1.00 28.23 ? 159 VAL H N   1 
ATOM   2791 C  CA  . VAL B 2 159 ? 34.471 4.188   34.162 1.00 28.71 ? 159 VAL H CA  1 
ATOM   2792 C  C   . VAL B 2 159 ? 35.566 5.186   33.736 1.00 28.98 ? 159 VAL H C   1 
ATOM   2793 O  O   . VAL B 2 159 ? 35.273 6.376   33.573 1.00 29.25 ? 159 VAL H O   1 
ATOM   2794 C  CB  . VAL B 2 159 ? 33.648 3.625   32.951 1.00 28.51 ? 159 VAL H CB  1 
ATOM   2795 C  CG1 . VAL B 2 159 ? 34.338 3.837   31.626 1.00 29.25 ? 159 VAL H CG1 1 
ATOM   2796 C  CG2 . VAL B 2 159 ? 33.280 2.164   33.168 1.00 28.71 ? 159 VAL H CG2 1 
ATOM   2797 N  N   . THR B 2 160 ? 36.814 4.721   33.593 1.00 29.15 ? 160 THR H N   1 
ATOM   2798 C  CA  . THR B 2 160 ? 37.878 5.523   32.959 1.00 29.19 ? 160 THR H CA  1 
ATOM   2799 C  C   . THR B 2 160 ? 38.347 4.894   31.650 1.00 28.97 ? 160 THR H C   1 
ATOM   2800 O  O   . THR B 2 160 ? 38.416 3.668   31.530 1.00 28.99 ? 160 THR H O   1 
ATOM   2801 C  CB  . THR B 2 160 ? 39.115 5.743   33.877 1.00 29.42 ? 160 THR H CB  1 
ATOM   2802 O  OG1 . THR B 2 160 ? 39.785 4.499   34.105 1.00 28.99 ? 160 THR H OG1 1 
ATOM   2803 C  CG2 . THR B 2 160 ? 38.717 6.369   35.213 1.00 30.24 ? 160 THR H CG2 1 
ATOM   2804 N  N   . VAL B 2 161 ? 38.663 5.738   30.670 1.00 28.71 ? 161 VAL H N   1 
ATOM   2805 C  CA  . VAL B 2 161 ? 39.170 5.275   29.383 1.00 28.39 ? 161 VAL H CA  1 
ATOM   2806 C  C   . VAL B 2 161 ? 40.517 5.934   29.036 1.00 28.95 ? 161 VAL H C   1 
ATOM   2807 O  O   . VAL B 2 161 ? 40.682 7.161   29.161 1.00 29.09 ? 161 VAL H O   1 
ATOM   2808 C  CB  . VAL B 2 161 ? 38.141 5.536   28.239 1.00 28.19 ? 161 VAL H CB  1 
ATOM   2809 C  CG1 . VAL B 2 161 ? 38.544 4.823   26.937 1.00 27.35 ? 161 VAL H CG1 1 
ATOM   2810 C  CG2 . VAL B 2 161 ? 36.752 5.106   28.665 1.00 27.75 ? 161 VAL H CG2 1 
ATOM   2811 N  N   . SER B 2 162 ? 41.473 5.120   28.587 1.00 29.06 ? 162 SER H N   1 
ATOM   2812 C  CA  . SER B 2 162 ? 42.685 5.647   27.963 1.00 29.36 ? 162 SER H CA  1 
ATOM   2813 C  C   . SER B 2 162 ? 42.914 5.011   26.585 1.00 29.67 ? 162 SER H C   1 
ATOM   2814 O  O   . SER B 2 162 ? 42.317 3.983   26.249 1.00 29.93 ? 162 SER H O   1 
ATOM   2815 C  CB  . SER B 2 162 ? 43.919 5.473   28.869 1.00 29.28 ? 162 SER H CB  1 
ATOM   2816 O  OG  . SER B 2 162 ? 44.427 4.151   28.807 1.00 29.07 ? 162 SER H OG  1 
ATOM   2817 N  N   . TRP B 2 163 ? 43.780 5.628   25.790 1.00 29.80 ? 163 TRP H N   1 
ATOM   2818 C  CA  . TRP B 2 163 ? 44.079 5.114   24.466 1.00 30.36 ? 163 TRP H CA  1 
ATOM   2819 C  C   . TRP B 2 163 ? 45.545 4.737   24.322 1.00 31.02 ? 163 TRP H C   1 
ATOM   2820 O  O   . TRP B 2 163 ? 46.415 5.501   24.721 1.00 30.80 ? 163 TRP H O   1 
ATOM   2821 C  CB  . TRP B 2 163 ? 43.669 6.137   23.416 1.00 29.03 ? 163 TRP H CB  1 
ATOM   2822 C  CG  . TRP B 2 163 ? 42.171 6.207   23.244 1.00 28.31 ? 163 TRP H CG  1 
ATOM   2823 C  CD1 . TRP B 2 163 ? 41.296 7.015   23.929 1.00 25.02 ? 163 TRP H CD1 1 
ATOM   2824 C  CD2 . TRP B 2 163 ? 41.382 5.422   22.345 1.00 28.60 ? 163 TRP H CD2 1 
ATOM   2825 N  NE1 . TRP B 2 163 ? 40.005 6.789   23.485 1.00 26.70 ? 163 TRP H NE1 1 
ATOM   2826 C  CE2 . TRP B 2 163 ? 40.030 5.817   22.517 1.00 28.81 ? 163 TRP H CE2 1 
ATOM   2827 C  CE3 . TRP B 2 163 ? 41.685 4.430   21.396 1.00 26.22 ? 163 TRP H CE3 1 
ATOM   2828 C  CZ2 . TRP B 2 163 ? 38.986 5.258   21.776 1.00 27.90 ? 163 TRP H CZ2 1 
ATOM   2829 C  CZ3 . TRP B 2 163 ? 40.649 3.871   20.670 1.00 31.11 ? 163 TRP H CZ3 1 
ATOM   2830 C  CH2 . TRP B 2 163 ? 39.313 4.287   20.865 1.00 29.63 ? 163 TRP H CH2 1 
ATOM   2831 N  N   . ASN B 2 164 ? 45.798 3.552   23.761 1.00 32.19 ? 164 ASN H N   1 
ATOM   2832 C  CA  . ASN B 2 164 ? 47.157 3.002   23.607 1.00 33.26 ? 164 ASN H CA  1 
ATOM   2833 C  C   . ASN B 2 164 ? 47.981 3.062   24.897 1.00 34.46 ? 164 ASN H C   1 
ATOM   2834 O  O   . ASN B 2 164 ? 49.128 3.517   24.892 1.00 34.96 ? 164 ASN H O   1 
ATOM   2835 C  CB  . ASN B 2 164 ? 47.907 3.673   22.430 1.00 32.92 ? 164 ASN H CB  1 
ATOM   2836 C  CG  . ASN B 2 164 ? 47.277 3.355   21.069 1.00 31.98 ? 164 ASN H CG  1 
ATOM   2837 O  OD1 . ASN B 2 164 ? 46.444 2.464   20.951 1.00 31.16 ? 164 ASN H OD1 1 
ATOM   2838 N  ND2 . ASN B 2 164 ? 47.674 4.090   20.047 1.00 30.68 ? 164 ASN H ND2 1 
ATOM   2839 N  N   . SER B 2 165 ? 47.366 2.601   25.996 1.00 35.76 ? 165 SER H N   1 
ATOM   2840 C  CA  . SER B 2 165 ? 47.975 2.521   27.334 1.00 36.13 ? 165 SER H CA  1 
ATOM   2841 C  C   . SER B 2 165 ? 48.531 3.850   27.800 1.00 36.65 ? 165 SER H C   1 
ATOM   2842 O  O   . SER B 2 165 ? 49.503 3.890   28.569 1.00 36.84 ? 165 SER H O   1 
ATOM   2843 C  CB  . SER B 2 165 ? 49.056 1.426   27.409 1.00 36.08 ? 165 SER H CB  1 
ATOM   2844 O  OG  . SER B 2 165 ? 48.493 0.132   27.359 1.00 35.85 ? 165 SER H OG  1 
ATOM   2845 N  N   . GLY B 2 166 ? 47.912 4.930   27.327 1.00 36.75 ? 166 GLY H N   1 
ATOM   2846 C  CA  . GLY B 2 166 ? 48.280 6.279   27.730 1.00 37.09 ? 166 GLY H CA  1 
ATOM   2847 C  C   . GLY B 2 166 ? 49.170 7.030   26.762 1.00 37.34 ? 166 GLY H C   1 
ATOM   2848 O  O   . GLY B 2 166 ? 49.460 8.220   26.968 1.00 37.79 ? 166 GLY H O   1 
ATOM   2849 N  N   . ALA B 2 167 ? 49.613 6.352   25.708 1.00 37.09 ? 167 ALA H N   1 
ATOM   2850 C  CA  . ALA B 2 167 ? 50.476 6.983   24.718 1.00 36.83 ? 167 ALA H CA  1 
ATOM   2851 C  C   . ALA B 2 167 ? 49.704 7.899   23.737 1.00 36.60 ? 167 ALA H C   1 
ATOM   2852 O  O   . ALA B 2 167 ? 50.306 8.740   23.057 1.00 36.60 ? 167 ALA H O   1 
ATOM   2853 C  CB  . ALA B 2 167 ? 51.301 5.928   23.971 1.00 36.96 ? 167 ALA H CB  1 
ATOM   2854 N  N   . LEU B 2 168 ? 48.381 7.731   23.659 1.00 35.77 ? 168 LEU H N   1 
ATOM   2855 C  CA  . LEU B 2 168 ? 47.534 8.605   22.844 1.00 35.11 ? 168 LEU H CA  1 
ATOM   2856 C  C   . LEU B 2 168 ? 46.631 9.459   23.737 1.00 34.39 ? 168 LEU H C   1 
ATOM   2857 O  O   . LEU B 2 168 ? 45.843 8.935   24.524 1.00 34.57 ? 168 LEU H O   1 
ATOM   2858 C  CB  . LEU B 2 168 ? 46.711 7.794   21.826 1.00 35.29 ? 168 LEU H CB  1 
ATOM   2859 C  CG  . LEU B 2 168 ? 45.798 8.546   20.845 1.00 35.34 ? 168 LEU H CG  1 
ATOM   2860 C  CD1 . LEU B 2 168 ? 46.515 9.660   20.087 1.00 33.89 ? 168 LEU H CD1 1 
ATOM   2861 C  CD2 . LEU B 2 168 ? 45.173 7.566   19.861 1.00 35.04 ? 168 LEU H CD2 1 
ATOM   2862 N  N   . THR B 2 169 ? 46.780 10.776  23.637 1.00 33.31 ? 169 THR H N   1 
ATOM   2863 C  CA  . THR B 2 169 ? 46.023 11.704  24.470 1.00 32.21 ? 169 THR H CA  1 
ATOM   2864 C  C   . THR B 2 169 ? 45.466 12.860  23.638 1.00 31.61 ? 169 THR H C   1 
ATOM   2865 O  O   . THR B 2 169 ? 44.364 13.351  23.897 1.00 31.02 ? 169 THR H O   1 
ATOM   2866 C  CB  . THR B 2 169 ? 46.873 12.269  25.667 1.00 32.44 ? 169 THR H CB  1 
ATOM   2867 O  OG1 . THR B 2 169 ? 48.033 12.954  25.174 1.00 31.34 ? 169 THR H OG1 1 
ATOM   2868 C  CG2 . THR B 2 169 ? 47.304 11.148  26.638 1.00 32.30 ? 169 THR H CG2 1 
ATOM   2869 N  N   . SER B 2 170 ? 46.240 13.284  22.639 1.00 31.18 ? 170 SER H N   1 
ATOM   2870 C  CA  . SER B 2 170 ? 45.855 14.385  21.757 1.00 30.35 ? 170 SER H CA  1 
ATOM   2871 C  C   . SER B 2 170 ? 44.689 13.947  20.866 1.00 28.99 ? 170 SER H C   1 
ATOM   2872 O  O   . SER B 2 170 ? 44.691 12.831  20.355 1.00 28.96 ? 170 SER H O   1 
ATOM   2873 C  CB  . SER B 2 170 ? 47.053 14.837  20.920 1.00 30.80 ? 170 SER H CB  1 
ATOM   2874 O  OG  . SER B 2 170 ? 46.809 16.121  20.336 1.00 33.20 ? 170 SER H OG  1 
ATOM   2875 N  N   . GLY B 2 171 ? 43.685 14.814  20.721 1.00 27.58 ? 171 GLY H N   1 
ATOM   2876 C  CA  . GLY B 2 171 ? 42.472 14.485  19.970 1.00 25.98 ? 171 GLY H CA  1 
ATOM   2877 C  C   . GLY B 2 171 ? 41.437 13.579  20.645 1.00 24.92 ? 171 GLY H C   1 
ATOM   2878 O  O   . GLY B 2 171 ? 40.371 13.326  20.086 1.00 24.09 ? 171 GLY H O   1 
ATOM   2879 N  N   . VAL B 2 172 ? 41.749 13.092  21.843 1.00 24.54 ? 172 VAL H N   1 
ATOM   2880 C  CA  . VAL B 2 172 ? 40.820 12.260  22.623 1.00 23.54 ? 172 VAL H CA  1 
ATOM   2881 C  C   . VAL B 2 172 ? 39.688 13.088  23.250 1.00 23.00 ? 172 VAL H C   1 
ATOM   2882 O  O   . VAL B 2 172 ? 39.928 14.158  23.820 1.00 22.67 ? 172 VAL H O   1 
ATOM   2883 C  CB  . VAL B 2 172 ? 41.559 11.444  23.738 1.00 23.49 ? 172 VAL H CB  1 
ATOM   2884 C  CG1 . VAL B 2 172 ? 40.590 10.618  24.561 1.00 22.82 ? 172 VAL H CG1 1 
ATOM   2885 C  CG2 . VAL B 2 172 ? 42.633 10.544  23.139 1.00 23.58 ? 172 VAL H CG2 1 
ATOM   2886 N  N   . HIS B 2 173 ? 38.463 12.574  23.121 1.00 22.52 ? 173 HIS H N   1 
ATOM   2887 C  CA  . HIS B 2 173 ? 37.298 13.060  23.840 1.00 21.56 ? 173 HIS H CA  1 
ATOM   2888 C  C   . HIS B 2 173 ? 36.564 11.896  24.473 1.00 21.38 ? 173 HIS H C   1 
ATOM   2889 O  O   . HIS B 2 173 ? 35.914 11.114  23.780 1.00 21.09 ? 173 HIS H O   1 
ATOM   2890 C  CB  . HIS B 2 173 ? 36.353 13.810  22.904 1.00 21.57 ? 173 HIS H CB  1 
ATOM   2891 C  CG  . HIS B 2 173 ? 36.981 15.009  22.271 1.00 22.02 ? 173 HIS H CG  1 
ATOM   2892 N  ND1 . HIS B 2 173 ? 37.363 16.118  22.998 1.00 21.08 ? 173 HIS H ND1 1 
ATOM   2893 C  CD2 . HIS B 2 173 ? 37.335 15.255  20.988 1.00 20.97 ? 173 HIS H CD2 1 
ATOM   2894 C  CE1 . HIS B 2 173 ? 37.917 16.997  22.185 1.00 21.51 ? 173 HIS H CE1 1 
ATOM   2895 N  NE2 . HIS B 2 173 ? 37.904 16.501  20.961 1.00 21.26 ? 173 HIS H NE2 1 
ATOM   2896 N  N   . THR B 2 174 ? 36.678 11.787  25.793 1.00 21.14 ? 174 THR H N   1 
ATOM   2897 C  CA  . THR B 2 174 ? 35.910 10.818  26.564 1.00 21.08 ? 174 THR H CA  1 
ATOM   2898 C  C   . THR B 2 174 ? 34.747 11.563  27.199 1.00 21.17 ? 174 THR H C   1 
ATOM   2899 O  O   . THR B 2 174 ? 34.945 12.430  28.062 1.00 20.93 ? 174 THR H O   1 
ATOM   2900 C  CB  . THR B 2 174 ? 36.781 10.100  27.604 1.00 21.23 ? 174 THR H CB  1 
ATOM   2901 O  OG1 . THR B 2 174 ? 37.835 9.411   26.919 1.00 22.03 ? 174 THR H OG1 1 
ATOM   2902 C  CG2 . THR B 2 174 ? 35.961 9.084   28.397 1.00 20.80 ? 174 THR H CG2 1 
ATOM   2903 N  N   . PHE B 2 175 ? 33.540 11.231  26.734 1.00 21.07 ? 175 PHE H N   1 
ATOM   2904 C  CA  . PHE B 2 175 ? 32.341 11.989  27.031 1.00 21.49 ? 175 PHE H CA  1 
ATOM   2905 C  C   . PHE B 2 175 ? 31.771 11.667  28.392 1.00 22.23 ? 175 PHE H C   1 
ATOM   2906 O  O   . PHE B 2 175 ? 31.896 10.527  28.856 1.00 22.88 ? 175 PHE H O   1 
ATOM   2907 C  CB  . PHE B 2 175 ? 31.282 11.766  25.939 1.00 20.91 ? 175 PHE H CB  1 
ATOM   2908 C  CG  . PHE B 2 175 ? 31.621 12.428  24.653 1.00 19.86 ? 175 PHE H CG  1 
ATOM   2909 C  CD1 . PHE B 2 175 ? 32.263 11.718  23.648 1.00 18.89 ? 175 PHE H CD1 1 
ATOM   2910 C  CD2 . PHE B 2 175 ? 31.329 13.780  24.459 1.00 19.14 ? 175 PHE H CD2 1 
ATOM   2911 C  CE1 . PHE B 2 175 ? 32.599 12.334  22.459 1.00 19.55 ? 175 PHE H CE1 1 
ATOM   2912 C  CE2 . PHE B 2 175 ? 31.661 14.416  23.276 1.00 18.95 ? 175 PHE H CE2 1 
ATOM   2913 C  CZ  . PHE B 2 175 ? 32.304 13.706  22.269 1.00 19.37 ? 175 PHE H CZ  1 
ATOM   2914 N  N   . PRO B 2 176 ? 31.151 12.674  29.044 1.00 22.96 ? 176 PRO H N   1 
ATOM   2915 C  CA  . PRO B 2 176 ? 30.439 12.408  30.303 1.00 23.49 ? 176 PRO H CA  1 
ATOM   2916 C  C   . PRO B 2 176 ? 29.410 11.294  30.114 1.00 24.07 ? 176 PRO H C   1 
ATOM   2917 O  O   . PRO B 2 176 ? 28.756 11.219  29.074 1.00 24.07 ? 176 PRO H O   1 
ATOM   2918 C  CB  . PRO B 2 176 ? 29.768 13.751  30.648 1.00 23.29 ? 176 PRO H CB  1 
ATOM   2919 C  CG  . PRO B 2 176 ? 29.929 14.619  29.427 1.00 23.41 ? 176 PRO H CG  1 
ATOM   2920 C  CD  . PRO B 2 176 ? 31.104 14.100  28.657 1.00 22.61 ? 176 PRO H CD  1 
ATOM   2921 N  N   . ALA B 2 177 ? 29.299 10.413  31.104 1.00 25.00 ? 177 ALA H N   1 
ATOM   2922 C  CA  . ALA B 2 177 ? 28.343 9.322   31.026 1.00 25.78 ? 177 ALA H CA  1 
ATOM   2923 C  C   . ALA B 2 177 ? 26.893 9.844   30.993 1.00 26.58 ? 177 ALA H C   1 
ATOM   2924 O  O   . ALA B 2 177 ? 26.596 10.949  31.451 1.00 26.62 ? 177 ALA H O   1 
ATOM   2925 C  CB  . ALA B 2 177 ? 28.549 8.346   32.181 1.00 25.38 ? 177 ALA H CB  1 
ATOM   2926 N  N   . VAL B 2 178 ? 26.003 9.031   30.435 1.00 27.39 ? 178 VAL H N   1 
ATOM   2927 C  CA  . VAL B 2 178 ? 24.589 9.323   30.416 1.00 28.35 ? 178 VAL H CA  1 
ATOM   2928 C  C   . VAL B 2 178 ? 23.869 8.183   31.132 1.00 28.55 ? 178 VAL H C   1 
ATOM   2929 O  O   . VAL B 2 178 ? 24.208 7.013   30.950 1.00 28.19 ? 178 VAL H O   1 
ATOM   2930 C  CB  . VAL B 2 178 ? 24.062 9.486   28.962 1.00 28.65 ? 178 VAL H CB  1 
ATOM   2931 C  CG1 . VAL B 2 178 ? 22.569 9.665   28.948 1.00 29.52 ? 178 VAL H CG1 1 
ATOM   2932 C  CG2 . VAL B 2 178 ? 24.695 10.687  28.279 1.00 29.62 ? 178 VAL H CG2 1 
ATOM   2933 N  N   . LEU B 2 179 ? 22.896 8.531   31.971 1.00 29.53 ? 179 LEU H N   1 
ATOM   2934 C  CA  . LEU B 2 179 ? 22.079 7.526   32.642 1.00 30.23 ? 179 LEU H CA  1 
ATOM   2935 C  C   . LEU B 2 179 ? 20.905 7.148   31.742 1.00 30.68 ? 179 LEU H C   1 
ATOM   2936 O  O   . LEU B 2 179 ? 20.003 7.957   31.509 1.00 31.52 ? 179 LEU H O   1 
ATOM   2937 C  CB  . LEU B 2 179 ? 21.601 8.009   34.021 1.00 30.20 ? 179 LEU H CB  1 
ATOM   2938 C  CG  . LEU B 2 179 ? 20.664 7.063   34.800 1.00 29.92 ? 179 LEU H CG  1 
ATOM   2939 C  CD1 . LEU B 2 179 ? 21.348 5.752   35.108 1.00 28.07 ? 179 LEU H CD1 1 
ATOM   2940 C  CD2 . LEU B 2 179 ? 20.160 7.724   36.074 1.00 30.08 ? 179 LEU H CD2 1 
ATOM   2941 N  N   . GLN B 2 180 ? 20.947 5.921   31.227 1.00 30.84 ? 180 GLN H N   1 
ATOM   2942 C  CA  . GLN B 2 180 ? 19.905 5.375   30.363 1.00 31.03 ? 180 GLN H CA  1 
ATOM   2943 C  C   . GLN B 2 180 ? 18.669 5.011   31.189 1.00 31.74 ? 180 GLN H C   1 
ATOM   2944 O  O   . GLN B 2 180 ? 18.769 4.794   32.405 1.00 31.54 ? 180 GLN H O   1 
ATOM   2945 C  CB  . GLN B 2 180 ? 20.426 4.134   29.619 1.00 31.17 ? 180 GLN H CB  1 
ATOM   2946 C  CG  . GLN B 2 180 ? 21.646 4.373   28.713 1.00 30.28 ? 180 GLN H CG  1 
ATOM   2947 C  CD  . GLN B 2 180 ? 22.336 3.074   28.298 1.00 30.24 ? 180 GLN H CD  1 
ATOM   2948 O  OE1 . GLN B 2 180 ? 23.004 2.416   29.109 1.00 29.46 ? 180 GLN H OE1 1 
ATOM   2949 N  NE2 . GLN B 2 180 ? 22.195 2.710   27.031 1.00 27.98 ? 180 GLN H NE2 1 
ATOM   2950 N  N   . SER B 2 181 ? 17.512 4.942   30.522 1.00 32.52 ? 181 SER H N   1 
ATOM   2951 C  CA  . SER B 2 181 ? 16.238 4.604   31.168 1.00 33.29 ? 181 SER H CA  1 
ATOM   2952 C  C   . SER B 2 181 ? 16.290 3.248   31.886 1.00 33.30 ? 181 SER H C   1 
ATOM   2953 O  O   . SER B 2 181 ? 15.453 2.954   32.733 1.00 33.65 ? 181 SER H O   1 
ATOM   2954 C  CB  . SER B 2 181 ? 15.092 4.617   30.147 1.00 33.64 ? 181 SER H CB  1 
ATOM   2955 O  OG  . SER B 2 181 ? 14.957 3.348   29.519 1.00 35.00 ? 181 SER H OG  1 
ATOM   2956 N  N   . SER B 2 182 ? 17.294 2.441   31.552 1.00 33.05 ? 182 SER H N   1 
ATOM   2957 C  CA  . SER B 2 182 ? 17.491 1.122   32.152 1.00 32.62 ? 182 SER H CA  1 
ATOM   2958 C  C   . SER B 2 182 ? 18.117 1.161   33.560 1.00 32.25 ? 182 SER H C   1 
ATOM   2959 O  O   . SER B 2 182 ? 18.221 0.118   34.226 1.00 31.85 ? 182 SER H O   1 
ATOM   2960 C  CB  . SER B 2 182 ? 18.381 0.277   31.236 1.00 32.76 ? 182 SER H CB  1 
ATOM   2961 O  OG  . SER B 2 182 ? 19.692 0.826   31.135 1.00 32.35 ? 182 SER H OG  1 
ATOM   2962 N  N   . GLY B 2 183 ? 18.554 2.350   33.995 1.00 31.63 ? 183 GLY H N   1 
ATOM   2963 C  CA  . GLY B 2 183 ? 19.343 2.488   35.224 1.00 30.53 ? 183 GLY H CA  1 
ATOM   2964 C  C   . GLY B 2 183 ? 20.831 2.214   35.043 1.00 30.04 ? 183 GLY H C   1 
ATOM   2965 O  O   . GLY B 2 183 ? 21.599 2.268   36.006 1.00 30.20 ? 183 GLY H O   1 
ATOM   2966 N  N   . LEU B 2 184 ? 21.245 1.921   33.810 1.00 29.14 ? 184 LEU H N   1 
ATOM   2967 C  CA  . LEU B 2 184 ? 22.659 1.690   33.501 1.00 27.79 ? 184 LEU H CA  1 
ATOM   2968 C  C   . LEU B 2 184 ? 23.292 2.879   32.762 1.00 27.40 ? 184 LEU H C   1 
ATOM   2969 O  O   . LEU B 2 184 ? 22.613 3.600   32.022 1.00 26.76 ? 184 LEU H O   1 
ATOM   2970 C  CB  . LEU B 2 184 ? 22.831 0.390   32.711 1.00 27.83 ? 184 LEU H CB  1 
ATOM   2971 C  CG  . LEU B 2 184 ? 22.186 -0.859  33.345 1.00 27.53 ? 184 LEU H CG  1 
ATOM   2972 C  CD1 . LEU B 2 184 ? 22.087 -2.038  32.354 1.00 26.63 ? 184 LEU H CD1 1 
ATOM   2973 C  CD2 . LEU B 2 184 ? 22.889 -1.274  34.641 1.00 26.00 ? 184 LEU H CD2 1 
ATOM   2974 N  N   . TYR B 2 185 ? 24.594 3.078   32.983 1.00 26.97 ? 185 TYR H N   1 
ATOM   2975 C  CA  . TYR B 2 185 ? 25.340 4.151   32.337 1.00 26.54 ? 185 TYR H CA  1 
ATOM   2976 C  C   . TYR B 2 185 ? 25.937 3.742   31.005 1.00 26.28 ? 185 TYR H C   1 
ATOM   2977 O  O   . TYR B 2 185 ? 26.160 2.557   30.742 1.00 26.40 ? 185 TYR H O   1 
ATOM   2978 C  CB  . TYR B 2 185 ? 26.441 4.697   33.260 1.00 26.47 ? 185 TYR H CB  1 
ATOM   2979 C  CG  . TYR B 2 185 ? 25.884 5.400   34.474 1.00 27.15 ? 185 TYR H CG  1 
ATOM   2980 C  CD1 . TYR B 2 185 ? 25.777 4.739   35.705 1.00 26.05 ? 185 TYR H CD1 1 
ATOM   2981 C  CD2 . TYR B 2 185 ? 25.427 6.721   34.383 1.00 27.08 ? 185 TYR H CD2 1 
ATOM   2982 C  CE1 . TYR B 2 185 ? 25.246 5.381   36.799 1.00 26.40 ? 185 TYR H CE1 1 
ATOM   2983 C  CE2 . TYR B 2 185 ? 24.903 7.374   35.479 1.00 25.76 ? 185 TYR H CE2 1 
ATOM   2984 C  CZ  . TYR B 2 185 ? 24.815 6.704   36.679 1.00 26.23 ? 185 TYR H CZ  1 
ATOM   2985 O  OH  . TYR B 2 185 ? 24.277 7.360   37.757 1.00 26.73 ? 185 TYR H OH  1 
ATOM   2986 N  N   . SER B 2 186 ? 26.198 4.752   30.179 1.00 25.83 ? 186 SER H N   1 
ATOM   2987 C  CA  . SER B 2 186 ? 26.820 4.595   28.881 1.00 25.31 ? 186 SER H CA  1 
ATOM   2988 C  C   . SER B 2 186 ? 27.683 5.828   28.574 1.00 25.06 ? 186 SER H C   1 
ATOM   2989 O  O   . SER B 2 186 ? 27.262 6.973   28.812 1.00 24.76 ? 186 SER H O   1 
ATOM   2990 C  CB  . SER B 2 186 ? 25.733 4.457   27.816 1.00 25.73 ? 186 SER H CB  1 
ATOM   2991 O  OG  . SER B 2 186 ? 26.241 3.855   26.649 1.00 27.06 ? 186 SER H OG  1 
ATOM   2992 N  N   . LEU B 2 187 ? 28.896 5.604   28.064 1.00 24.59 ? 187 LEU H N   1 
ATOM   2993 C  CA  . LEU B 2 187 ? 29.660 6.694   27.448 1.00 24.15 ? 187 LEU H CA  1 
ATOM   2994 C  C   . LEU B 2 187 ? 30.371 6.211   26.199 1.00 24.33 ? 187 LEU H C   1 
ATOM   2995 O  O   . LEU B 2 187 ? 30.583 5.001   26.025 1.00 24.18 ? 187 LEU H O   1 
ATOM   2996 C  CB  . LEU B 2 187 ? 30.657 7.354   28.433 1.00 23.72 ? 187 LEU H CB  1 
ATOM   2997 C  CG  . LEU B 2 187 ? 31.747 6.584   29.194 1.00 23.76 ? 187 LEU H CG  1 
ATOM   2998 C  CD1 . LEU B 2 187 ? 32.956 6.217   28.323 1.00 22.63 ? 187 LEU H CD1 1 
ATOM   2999 C  CD2 . LEU B 2 187 ? 32.211 7.402   30.385 1.00 23.73 ? 187 LEU H CD2 1 
ATOM   3000 N  N   . SER B 2 188 ? 30.719 7.161   25.328 1.00 24.26 ? 188 SER H N   1 
ATOM   3001 C  CA  . SER B 2 188 ? 31.690 6.919   24.271 1.00 24.49 ? 188 SER H CA  1 
ATOM   3002 C  C   . SER B 2 188 ? 32.983 7.657   24.548 1.00 24.01 ? 188 SER H C   1 
ATOM   3003 O  O   . SER B 2 188 ? 32.987 8.724   25.175 1.00 24.40 ? 188 SER H O   1 
ATOM   3004 C  CB  . SER B 2 188 ? 31.144 7.317   22.897 1.00 24.94 ? 188 SER H CB  1 
ATOM   3005 O  OG  . SER B 2 188 ? 30.097 6.435   22.518 1.00 27.08 ? 188 SER H OG  1 
ATOM   3006 N  N   . SER B 2 189 ? 34.079 7.060   24.093 1.00 23.73 ? 189 SER H N   1 
ATOM   3007 C  CA  . SER B 2 189 ? 35.375 7.721   24.033 1.00 23.32 ? 189 SER H CA  1 
ATOM   3008 C  C   . SER B 2 189 ? 35.842 7.726   22.590 1.00 23.26 ? 189 SER H C   1 
ATOM   3009 O  O   . SER B 2 189 ? 35.900 6.684   21.943 1.00 23.11 ? 189 SER H O   1 
ATOM   3010 C  CB  . SER B 2 189 ? 36.404 7.001   24.909 1.00 22.83 ? 189 SER H CB  1 
ATOM   3011 O  OG  . SER B 2 189 ? 37.629 7.713   24.907 1.00 22.90 ? 189 SER H OG  1 
ATOM   3012 N  N   . VAL B 2 190 ? 36.168 8.907   22.083 1.00 23.46 ? 190 VAL H N   1 
ATOM   3013 C  CA  . VAL B 2 190 ? 36.623 9.033   20.697 1.00 22.93 ? 190 VAL H CA  1 
ATOM   3014 C  C   . VAL B 2 190 ? 37.997 9.706   20.613 1.00 23.00 ? 190 VAL H C   1 
ATOM   3015 O  O   . VAL B 2 190 ? 38.466 10.341  21.561 1.00 21.59 ? 190 VAL H O   1 
ATOM   3016 C  CB  . VAL B 2 190 ? 35.580 9.756   19.789 1.00 22.56 ? 190 VAL H CB  1 
ATOM   3017 C  CG1 . VAL B 2 190 ? 34.209 9.118   19.914 1.00 22.23 ? 190 VAL H CG1 1 
ATOM   3018 C  CG2 . VAL B 2 190 ? 35.487 11.253  20.115 1.00 22.29 ? 190 VAL H CG2 1 
ATOM   3019 N  N   . VAL B 2 191 ? 38.628 9.526   19.459 1.00 23.87 ? 191 VAL H N   1 
ATOM   3020 C  CA  . VAL B 2 191 ? 39.856 10.213  19.084 1.00 24.31 ? 191 VAL H CA  1 
ATOM   3021 C  C   . VAL B 2 191 ? 39.790 10.397  17.569 1.00 25.16 ? 191 VAL H C   1 
ATOM   3022 O  O   . VAL B 2 191 ? 39.375 9.492   16.841 1.00 25.42 ? 191 VAL H O   1 
ATOM   3023 C  CB  . VAL B 2 191 ? 41.137 9.441   19.563 1.00 24.28 ? 191 VAL H CB  1 
ATOM   3024 C  CG1 . VAL B 2 191 ? 41.202 8.030   18.980 1.00 23.71 ? 191 VAL H CG1 1 
ATOM   3025 C  CG2 . VAL B 2 191 ? 42.415 10.234  19.273 1.00 23.39 ? 191 VAL H CG2 1 
ATOM   3026 N  N   . THR B 2 192 ? 40.117 11.602  17.111 1.00 26.01 ? 192 THR H N   1 
ATOM   3027 C  CA  . THR B 2 192 ? 40.297 11.865  15.684 1.00 26.65 ? 192 THR H CA  1 
ATOM   3028 C  C   . THR B 2 192 ? 41.757 11.669  15.309 1.00 27.09 ? 192 THR H C   1 
ATOM   3029 O  O   . THR B 2 192 ? 42.662 12.029  16.066 1.00 27.13 ? 192 THR H O   1 
ATOM   3030 C  CB  . THR B 2 192 ? 39.843 13.282  15.264 1.00 26.45 ? 192 THR H CB  1 
ATOM   3031 O  OG1 . THR B 2 192 ? 40.495 14.265  16.073 1.00 25.78 ? 192 THR H OG1 1 
ATOM   3032 C  CG2 . THR B 2 192 ? 38.346 13.416  15.408 1.00 27.23 ? 192 THR H CG2 1 
ATOM   3033 N  N   . VAL B 2 193 ? 41.975 11.078  14.140 1.00 28.05 ? 193 VAL H N   1 
ATOM   3034 C  CA  . VAL B 2 193 ? 43.318 10.729  13.679 1.00 28.89 ? 193 VAL H CA  1 
ATOM   3035 C  C   . VAL B 2 193 ? 43.473 11.079  12.204 1.00 29.65 ? 193 VAL H C   1 
ATOM   3036 O  O   . VAL B 2 193 ? 42.481 11.139  11.482 1.00 29.47 ? 193 VAL H O   1 
ATOM   3037 C  CB  . VAL B 2 193 ? 43.645 9.226   13.907 1.00 28.51 ? 193 VAL H CB  1 
ATOM   3038 C  CG1 . VAL B 2 193 ? 43.503 8.858   15.379 1.00 28.72 ? 193 VAL H CG1 1 
ATOM   3039 C  CG2 . VAL B 2 193 ? 42.776 8.332   13.025 1.00 29.14 ? 193 VAL H CG2 1 
ATOM   3040 N  N   . PRO B 2 194 ? 44.717 11.339  11.756 1.00 30.82 ? 194 PRO H N   1 
ATOM   3041 C  CA  . PRO B 2 194 ? 44.988 11.414  10.320 1.00 31.91 ? 194 PRO H CA  1 
ATOM   3042 C  C   . PRO B 2 194 ? 44.597 10.095  9.627  1.00 32.86 ? 194 PRO H C   1 
ATOM   3043 O  O   . PRO B 2 194 ? 44.969 9.008   10.096 1.00 32.41 ? 194 PRO H O   1 
ATOM   3044 C  CB  . PRO B 2 194 ? 46.509 11.637  10.255 1.00 32.20 ? 194 PRO H CB  1 
ATOM   3045 C  CG  . PRO B 2 194 ? 47.027 11.259  11.626 1.00 32.00 ? 194 PRO H CG  1 
ATOM   3046 C  CD  . PRO B 2 194 ? 45.924 11.592  12.564 1.00 31.03 ? 194 PRO H CD  1 
ATOM   3047 N  N   . SER B 2 195 ? 43.831 10.207  8.543  1.00 34.35 ? 195 SER H N   1 
ATOM   3048 C  CA  . SER B 2 195 ? 43.373 9.052   7.766  1.00 36.29 ? 195 SER H CA  1 
ATOM   3049 C  C   . SER B 2 195 ? 44.537 8.208   7.283  1.00 37.47 ? 195 SER H C   1 
ATOM   3050 O  O   . SER B 2 195 ? 44.452 6.980   7.279  1.00 37.61 ? 195 SER H O   1 
ATOM   3051 C  CB  . SER B 2 195 ? 42.560 9.498   6.552  1.00 36.03 ? 195 SER H CB  1 
ATOM   3052 O  OG  . SER B 2 195 ? 41.459 10.283  6.949  1.00 37.05 ? 195 SER H OG  1 
ATOM   3053 N  N   . SER B 2 196 ? 45.617 8.885   6.882  1.00 38.96 ? 196 SER H N   1 
ATOM   3054 C  CA  . SER B 2 196 ? 46.819 8.243   6.341  1.00 40.28 ? 196 SER H CA  1 
ATOM   3055 C  C   . SER B 2 196 ? 47.416 7.183   7.275  1.00 41.04 ? 196 SER H C   1 
ATOM   3056 O  O   . SER B 2 196 ? 48.067 6.235   6.818  1.00 41.38 ? 196 SER H O   1 
ATOM   3057 C  CB  . SER B 2 196 ? 47.876 9.302   5.997  1.00 40.24 ? 196 SER H CB  1 
ATOM   3058 O  OG  . SER B 2 196 ? 48.312 10.000  7.158  1.00 40.50 ? 196 SER H OG  1 
ATOM   3059 N  N   . SER B 2 197 ? 47.185 7.339   8.575  1.00 41.90 ? 197 SER H N   1 
ATOM   3060 C  CA  . SER B 2 197 ? 47.797 6.453   9.565  1.00 42.97 ? 197 SER H CA  1 
ATOM   3061 C  C   . SER B 2 197 ? 46.956 5.216   9.861  1.00 43.17 ? 197 SER H C   1 
ATOM   3062 O  O   . SER B 2 197 ? 47.387 4.359   10.617 1.00 43.30 ? 197 SER H O   1 
ATOM   3063 C  CB  . SER B 2 197 ? 48.073 7.202   10.878 1.00 42.98 ? 197 SER H CB  1 
ATOM   3064 O  OG  . SER B 2 197 ? 48.786 8.407   10.670 1.00 44.25 ? 197 SER H OG  1 
ATOM   3065 N  N   . LEU B 2 198 ? 45.764 5.121   9.276  1.00 43.70 ? 198 LEU H N   1 
ATOM   3066 C  CA  . LEU B 2 198 ? 44.836 4.035   9.628  1.00 44.31 ? 198 LEU H CA  1 
ATOM   3067 C  C   . LEU B 2 198 ? 45.346 2.632   9.281  1.00 45.02 ? 198 LEU H C   1 
ATOM   3068 O  O   . LEU B 2 198 ? 44.995 1.660   9.960  1.00 45.19 ? 198 LEU H O   1 
ATOM   3069 C  CB  . LEU B 2 198 ? 43.441 4.267   9.031  1.00 44.14 ? 198 LEU H CB  1 
ATOM   3070 C  CG  . LEU B 2 198 ? 42.546 5.343   9.669  1.00 43.73 ? 198 LEU H CG  1 
ATOM   3071 C  CD1 . LEU B 2 198 ? 41.280 5.537   8.842  1.00 43.19 ? 198 LEU H CD1 1 
ATOM   3072 C  CD2 . LEU B 2 198 ? 42.198 5.026   11.123 1.00 42.50 ? 198 LEU H CD2 1 
ATOM   3073 N  N   . GLY B 2 199 ? 46.172 2.528   8.237  1.00 45.53 ? 199 GLY H N   1 
ATOM   3074 C  CA  . GLY B 2 199 ? 46.730 1.236   7.822  1.00 46.04 ? 199 GLY H CA  1 
ATOM   3075 C  C   . GLY B 2 199 ? 47.981 0.864   8.591  1.00 46.46 ? 199 GLY H C   1 
ATOM   3076 O  O   . GLY B 2 199 ? 48.427 -0.286  8.565  1.00 46.46 ? 199 GLY H O   1 
ATOM   3077 N  N   . THR B 2 200 ? 48.523 1.845   9.304  1.00 46.77 ? 200 THR H N   1 
ATOM   3078 C  CA  . THR B 2 200 ? 49.855 1.770   9.885  1.00 46.75 ? 200 THR H CA  1 
ATOM   3079 C  C   . THR B 2 200 ? 49.841 1.832   11.415 1.00 46.45 ? 200 THR H C   1 
ATOM   3080 O  O   . THR B 2 200 ? 50.718 1.264   12.077 1.00 46.84 ? 200 THR H O   1 
ATOM   3081 C  CB  . THR B 2 200 ? 50.737 2.876   9.262  1.00 47.04 ? 200 THR H CB  1 
ATOM   3082 O  OG1 . THR B 2 200 ? 51.589 2.284   8.277  1.00 48.25 ? 200 THR H OG1 1 
ATOM   3083 C  CG2 . THR B 2 200 ? 51.588 3.612   10.287 1.00 47.38 ? 200 THR H CG2 1 
ATOM   3084 N  N   . GLN B 2 201 ? 48.835 2.505   11.970 1.00 45.59 ? 201 GLN H N   1 
ATOM   3085 C  CA  . GLN B 2 201 ? 48.762 2.738   13.408 1.00 44.57 ? 201 GLN H CA  1 
ATOM   3086 C  C   . GLN B 2 201 ? 47.705 1.880   14.057 1.00 43.12 ? 201 GLN H C   1 
ATOM   3087 O  O   . GLN B 2 201 ? 46.593 1.768   13.541 1.00 42.95 ? 201 GLN H O   1 
ATOM   3088 C  CB  . GLN B 2 201 ? 48.479 4.212   13.699 1.00 44.87 ? 201 GLN H CB  1 
ATOM   3089 C  CG  . GLN B 2 201 ? 49.604 5.128   13.291 1.00 46.47 ? 201 GLN H CG  1 
ATOM   3090 C  CD  . GLN B 2 201 ? 50.878 4.860   14.067 1.00 47.94 ? 201 GLN H CD  1 
ATOM   3091 O  OE1 . GLN B 2 201 ? 50.888 4.926   15.297 1.00 48.66 ? 201 GLN H OE1 1 
ATOM   3092 N  NE2 . GLN B 2 201 ? 51.963 4.560   13.352 1.00 48.04 ? 201 GLN H NE2 1 
ATOM   3093 N  N   . THR B 2 202 ? 48.074 1.282   15.188 1.00 41.50 ? 202 THR H N   1 
ATOM   3094 C  CA  . THR B 2 202 ? 47.167 0.483   16.017 1.00 39.86 ? 202 THR H CA  1 
ATOM   3095 C  C   . THR B 2 202 ? 46.502 1.362   17.073 1.00 38.35 ? 202 THR H C   1 
ATOM   3096 O  O   . THR B 2 202 ? 47.179 2.139   17.767 1.00 38.36 ? 202 THR H O   1 
ATOM   3097 C  CB  . THR B 2 202 ? 47.911 -0.689  16.713 1.00 39.95 ? 202 THR H CB  1 
ATOM   3098 O  OG1 . THR B 2 202 ? 48.291 -1.663  15.735 1.00 40.52 ? 202 THR H OG1 1 
ATOM   3099 C  CG2 . THR B 2 202 ? 47.024 -1.368  17.753 1.00 40.03 ? 202 THR H CG2 1 
ATOM   3100 N  N   . TYR B 2 203 ? 45.179 1.232   17.177 1.00 36.11 ? 203 TYR H N   1 
ATOM   3101 C  CA  . TYR B 2 203 ? 44.398 1.934   18.191 1.00 33.92 ? 203 TYR H CA  1 
ATOM   3102 C  C   . TYR B 2 203 ? 43.654 0.980   19.121 1.00 33.12 ? 203 TYR H C   1 
ATOM   3103 O  O   . TYR B 2 203 ? 42.828 0.179   18.683 1.00 33.13 ? 203 TYR H O   1 
ATOM   3104 C  CB  . TYR B 2 203 ? 43.440 2.931   17.537 1.00 32.87 ? 203 TYR H CB  1 
ATOM   3105 C  CG  . TYR B 2 203 ? 44.160 3.972   16.721 1.00 32.20 ? 203 TYR H CG  1 
ATOM   3106 C  CD1 . TYR B 2 203 ? 44.238 3.867   15.331 1.00 30.82 ? 203 TYR H CD1 1 
ATOM   3107 C  CD2 . TYR B 2 203 ? 44.789 5.053   17.338 1.00 30.67 ? 203 TYR H CD2 1 
ATOM   3108 C  CE1 . TYR B 2 203 ? 44.910 4.823   14.568 1.00 29.44 ? 203 TYR H CE1 1 
ATOM   3109 C  CE2 . TYR B 2 203 ? 45.465 6.010   16.581 1.00 30.80 ? 203 TYR H CE2 1 
ATOM   3110 C  CZ  . TYR B 2 203 ? 45.525 5.880   15.198 1.00 31.06 ? 203 TYR H CZ  1 
ATOM   3111 O  OH  . TYR B 2 203 ? 46.196 6.820   14.456 1.00 30.46 ? 203 TYR H OH  1 
ATOM   3112 N  N   . ILE B 2 204 ? 43.987 1.065   20.406 1.00 31.95 ? 204 ILE H N   1 
ATOM   3113 C  CA  . ILE B 2 204 ? 43.359 0.272   21.454 1.00 30.93 ? 204 ILE H CA  1 
ATOM   3114 C  C   . ILE B 2 204 ? 42.798 1.201   22.536 1.00 30.27 ? 204 ILE H C   1 
ATOM   3115 O  O   . ILE B 2 204 ? 43.514 2.050   23.065 1.00 30.32 ? 204 ILE H O   1 
ATOM   3116 C  CB  . ILE B 2 204 ? 44.375 -0.757  22.077 1.00 31.09 ? 204 ILE H CB  1 
ATOM   3117 C  CG1 . ILE B 2 204 ? 44.904 -1.723  21.000 1.00 30.68 ? 204 ILE H CG1 1 
ATOM   3118 C  CG2 . ILE B 2 204 ? 43.738 -1.544  23.235 1.00 30.15 ? 204 ILE H CG2 1 
ATOM   3119 C  CD1 . ILE B 2 204 ? 46.226 -2.401  21.338 1.00 31.20 ? 204 ILE H CD1 1 
ATOM   3120 N  N   . CYS B 2 205 ? 41.511 1.050   22.851 1.00 29.34 ? 205 CYS H N   1 
ATOM   3121 C  CA  . CYS B 2 205 ? 40.949 1.692   24.030 1.00 28.64 ? 205 CYS H CA  1 
ATOM   3122 C  C   . CYS B 2 205 ? 41.091 0.767   25.246 1.00 28.51 ? 205 CYS H C   1 
ATOM   3123 O  O   . CYS B 2 205 ? 40.781 -0.432  25.176 1.00 27.96 ? 205 CYS H O   1 
ATOM   3124 C  CB  . CYS B 2 205 ? 39.491 2.097   23.811 1.00 28.59 ? 205 CYS H CB  1 
ATOM   3125 S  SG  . CYS B 2 205 ? 38.255 0.744   23.689 1.00 28.44 ? 205 CYS H SG  1 
ATOM   3126 N  N   . ASN B 2 206 ? 41.598 1.334   26.342 1.00 28.15 ? 206 ASN H N   1 
ATOM   3127 C  CA  . ASN B 2 206 ? 41.723 0.625   27.607 1.00 27.76 ? 206 ASN H CA  1 
ATOM   3128 C  C   . ASN B 2 206 ? 40.640 1.126   28.562 1.00 27.74 ? 206 ASN H C   1 
ATOM   3129 O  O   . ASN B 2 206 ? 40.724 2.213   29.123 1.00 27.24 ? 206 ASN H O   1 
ATOM   3130 C  CB  . ASN B 2 206 ? 43.117 0.802   28.226 1.00 27.52 ? 206 ASN H CB  1 
ATOM   3131 C  CG  . ASN B 2 206 ? 44.225 0.941   27.187 1.00 27.69 ? 206 ASN H CG  1 
ATOM   3132 O  OD1 . ASN B 2 206 ? 44.750 2.035   26.982 1.00 26.51 ? 206 ASN H OD1 1 
ATOM   3133 N  ND2 . ASN B 2 206 ? 44.591 -0.170  26.535 1.00 28.37 ? 206 ASN H ND2 1 
ATOM   3134 N  N   . VAL B 2 207 ? 39.602 0.321   28.716 1.00 28.32 ? 207 VAL H N   1 
ATOM   3135 C  CA  . VAL B 2 207 ? 38.496 0.640   29.601 1.00 28.57 ? 207 VAL H CA  1 
ATOM   3136 C  C   . VAL B 2 207 ? 38.723 -0.008  30.966 1.00 29.09 ? 207 VAL H C   1 
ATOM   3137 O  O   . VAL B 2 207 ? 39.125 -1.171  31.055 1.00 28.47 ? 207 VAL H O   1 
ATOM   3138 C  CB  . VAL B 2 207 ? 37.152 0.196   28.972 1.00 28.70 ? 207 VAL H CB  1 
ATOM   3139 C  CG1 . VAL B 2 207 ? 35.966 0.567   29.873 1.00 28.23 ? 207 VAL H CG1 1 
ATOM   3140 C  CG2 . VAL B 2 207 ? 37.000 0.814   27.578 1.00 28.51 ? 207 VAL H CG2 1 
ATOM   3141 N  N   . ASN B 2 208 ? 38.484 0.763   32.027 1.00 29.99 ? 208 ASN H N   1 
ATOM   3142 C  CA  . ASN B 2 208 ? 38.537 0.227   33.384 1.00 30.88 ? 208 ASN H CA  1 
ATOM   3143 C  C   . ASN B 2 208 ? 37.306 0.619   34.220 1.00 30.35 ? 208 ASN H C   1 
ATOM   3144 O  O   . ASN B 2 208 ? 36.929 1.779   34.281 1.00 29.85 ? 208 ASN H O   1 
ATOM   3145 C  CB  . ASN B 2 208 ? 39.858 0.622   34.064 1.00 32.10 ? 208 ASN H CB  1 
ATOM   3146 C  CG  . ASN B 2 208 ? 40.098 -0.110  35.395 1.00 34.29 ? 208 ASN H CG  1 
ATOM   3147 O  OD1 . ASN B 2 208 ? 39.431 -1.098  35.736 1.00 37.53 ? 208 ASN H OD1 1 
ATOM   3148 N  ND2 . ASN B 2 208 ? 41.069 0.378   36.146 1.00 36.27 ? 208 ASN H ND2 1 
ATOM   3149 N  N   . HIS B 2 209 ? 36.672 -0.384  34.821 1.00 30.51 ? 209 HIS H N   1 
ATOM   3150 C  CA  . HIS B 2 209 ? 35.521 -0.197  35.703 1.00 30.51 ? 209 HIS H CA  1 
ATOM   3151 C  C   . HIS B 2 209 ? 35.887 -0.834  37.021 1.00 30.53 ? 209 HIS H C   1 
ATOM   3152 O  O   . HIS B 2 209 ? 35.746 -2.049  37.203 1.00 30.37 ? 209 HIS H O   1 
ATOM   3153 C  CB  . HIS B 2 209 ? 34.259 -0.848  35.119 1.00 30.37 ? 209 HIS H CB  1 
ATOM   3154 C  CG  . HIS B 2 209 ? 33.007 -0.600  35.911 1.00 29.86 ? 209 HIS H CG  1 
ATOM   3155 N  ND1 . HIS B 2 209 ? 32.562 0.665   36.235 1.00 30.75 ? 209 HIS H ND1 1 
ATOM   3156 C  CD2 . HIS B 2 209 ? 32.085 -1.455  36.409 1.00 28.60 ? 209 HIS H CD2 1 
ATOM   3157 C  CE1 . HIS B 2 209 ? 31.428 0.575   36.909 1.00 28.40 ? 209 HIS H CE1 1 
ATOM   3158 N  NE2 . HIS B 2 209 ? 31.119 -0.700  37.030 1.00 27.63 ? 209 HIS H NE2 1 
ATOM   3159 N  N   . LYS B 2 210 ? 36.389 -0.014  37.932 1.00 30.53 ? 210 LYS H N   1 
ATOM   3160 C  CA  . LYS B 2 210 ? 36.844 -0.524  39.213 1.00 30.91 ? 210 LYS H CA  1 
ATOM   3161 C  C   . LYS B 2 210 ? 35.767 -1.275  40.000 1.00 30.91 ? 210 LYS H C   1 
ATOM   3162 O  O   . LYS B 2 210 ? 36.023 -2.406  40.419 1.00 31.18 ? 210 LYS H O   1 
ATOM   3163 C  CB  . LYS B 2 210 ? 37.525 0.568   40.038 1.00 31.31 ? 210 LYS H CB  1 
ATOM   3164 C  CG  . LYS B 2 210 ? 38.889 0.950   39.470 1.00 32.20 ? 210 LYS H CG  1 
ATOM   3165 C  CD  . LYS B 2 210 ? 39.685 1.819   40.411 1.00 33.65 ? 210 LYS H CD  1 
ATOM   3166 C  CE  . LYS B 2 210 ? 41.097 2.029   39.866 1.00 35.70 ? 210 LYS H CE  1 
ATOM   3167 N  NZ  . LYS B 2 210 ? 41.167 3.104   38.831 1.00 35.33 ? 210 LYS H NZ  1 
ATOM   3168 N  N   . PRO B 2 211 ? 34.546 -0.702  40.142 1.00 30.80 ? 211 PRO H N   1 
ATOM   3169 C  CA  . PRO B 2 211 ? 33.537 -1.369  40.980 1.00 30.88 ? 211 PRO H CA  1 
ATOM   3170 C  C   . PRO B 2 211 ? 33.239 -2.842  40.645 1.00 31.47 ? 211 PRO H C   1 
ATOM   3171 O  O   . PRO B 2 211 ? 32.815 -3.594  41.533 1.00 31.50 ? 211 PRO H O   1 
ATOM   3172 C  CB  . PRO B 2 211 ? 32.285 -0.499  40.776 1.00 30.48 ? 211 PRO H CB  1 
ATOM   3173 C  CG  . PRO B 2 211 ? 32.816 0.838   40.485 1.00 29.91 ? 211 PRO H CG  1 
ATOM   3174 C  CD  . PRO B 2 211 ? 34.002 0.553   39.580 1.00 30.69 ? 211 PRO H CD  1 
ATOM   3175 N  N   . SER B 2 212 ? 33.459 -3.248  39.395 1.00 31.62 ? 212 SER H N   1 
ATOM   3176 C  CA  . SER B 2 212 ? 33.213 -4.624  38.975 1.00 31.57 ? 212 SER H CA  1 
ATOM   3177 C  C   . SER B 2 212 ? 34.509 -5.388  38.686 1.00 32.35 ? 212 SER H C   1 
ATOM   3178 O  O   . SER B 2 212 ? 34.468 -6.550  38.282 1.00 32.60 ? 212 SER H O   1 
ATOM   3179 C  CB  . SER B 2 212 ? 32.295 -4.656  37.749 1.00 31.40 ? 212 SER H CB  1 
ATOM   3180 O  OG  . SER B 2 212 ? 32.894 -4.007  36.636 1.00 29.29 ? 212 SER H OG  1 
ATOM   3181 N  N   . ASN B 2 213 ? 35.648 -4.731  38.897 1.00 33.00 ? 213 ASN H N   1 
ATOM   3182 C  CA  . ASN B 2 213 ? 36.973 -5.270  38.546 1.00 33.97 ? 213 ASN H CA  1 
ATOM   3183 C  C   . ASN B 2 213 ? 37.140 -5.589  37.053 1.00 33.84 ? 213 ASN H C   1 
ATOM   3184 O  O   . ASN B 2 213 ? 37.742 -6.608  36.668 1.00 33.36 ? 213 ASN H O   1 
ATOM   3185 C  CB  . ASN B 2 213 ? 37.326 -6.491  39.414 1.00 34.73 ? 213 ASN H CB  1 
ATOM   3186 C  CG  . ASN B 2 213 ? 38.828 -6.669  39.601 1.00 36.99 ? 213 ASN H CG  1 
ATOM   3187 O  OD1 . ASN B 2 213 ? 39.608 -5.751  39.350 1.00 39.75 ? 213 ASN H OD1 1 
ATOM   3188 N  ND2 . ASN B 2 213 ? 39.238 -7.852  40.068 1.00 39.23 ? 213 ASN H ND2 1 
ATOM   3189 N  N   . THR B 2 214 ? 36.623 -4.695  36.215 1.00 33.83 ? 214 THR H N   1 
ATOM   3190 C  CA  . THR B 2 214 ? 36.604 -4.919  34.780 1.00 33.93 ? 214 THR H CA  1 
ATOM   3191 C  C   . THR B 2 214 ? 37.672 -4.084  34.086 1.00 34.17 ? 214 THR H C   1 
ATOM   3192 O  O   . THR B 2 214 ? 37.674 -2.857  34.196 1.00 34.06 ? 214 THR H O   1 
ATOM   3193 C  CB  . THR B 2 214 ? 35.194 -4.623  34.193 1.00 33.93 ? 214 THR H CB  1 
ATOM   3194 O  OG1 . THR B 2 214 ? 34.210 -5.319  34.964 1.00 33.76 ? 214 THR H OG1 1 
ATOM   3195 C  CG2 . THR B 2 214 ? 35.078 -5.077  32.731 1.00 33.67 ? 214 THR H CG2 1 
ATOM   3196 N  N   . LYS B 2 215 ? 38.591 -4.764  33.398 1.00 34.42 ? 215 LYS H N   1 
ATOM   3197 C  CA  . LYS B 2 215 ? 39.505 -4.119  32.466 1.00 34.87 ? 215 LYS H CA  1 
ATOM   3198 C  C   . LYS B 2 215 ? 39.262 -4.726  31.082 1.00 35.10 ? 215 LYS H C   1 
ATOM   3199 O  O   . LYS B 2 215 ? 39.256 -5.950  30.927 1.00 35.00 ? 215 LYS H O   1 
ATOM   3200 C  CB  . LYS B 2 215 ? 40.975 -4.278  32.873 1.00 35.20 ? 215 LYS H CB  1 
ATOM   3201 C  CG  . LYS B 2 215 ? 41.271 -4.317  34.379 1.00 37.12 ? 215 LYS H CG  1 
ATOM   3202 C  CD  . LYS B 2 215 ? 41.623 -5.747  34.838 1.00 39.09 ? 215 LYS H CD  1 
ATOM   3203 C  CE  . LYS B 2 215 ? 41.152 -6.070  36.269 1.00 41.08 ? 215 LYS H CE  1 
ATOM   3204 N  NZ  . LYS B 2 215 ? 41.552 -5.041  37.286 1.00 42.05 ? 215 LYS H NZ  1 
ATOM   3205 N  N   . VAL B 2 216 ? 39.017 -3.874  30.084 1.00 35.24 ? 216 VAL H N   1 
ATOM   3206 C  CA  . VAL B 2 216 ? 38.820 -4.340  28.707 1.00 35.37 ? 216 VAL H CA  1 
ATOM   3207 C  C   . VAL B 2 216 ? 39.713 -3.544  27.766 1.00 35.33 ? 216 VAL H C   1 
ATOM   3208 O  O   . VAL B 2 216 ? 39.776 -2.311  27.840 1.00 35.14 ? 216 VAL H O   1 
ATOM   3209 C  CB  . VAL B 2 216 ? 37.311 -4.291  28.228 1.00 35.61 ? 216 VAL H CB  1 
ATOM   3210 C  CG1 . VAL B 2 216 ? 37.145 -4.905  26.827 1.00 35.55 ? 216 VAL H CG1 1 
ATOM   3211 C  CG2 . VAL B 2 216 ? 36.385 -5.015  29.198 1.00 35.73 ? 216 VAL H CG2 1 
ATOM   3212 N  N   . ASP B 2 217 ? 40.426 -4.264  26.902 1.00 35.31 ? 217 ASP H N   1 
ATOM   3213 C  CA  . ASP B 2 217 ? 41.198 -3.641  25.832 1.00 35.38 ? 217 ASP H CA  1 
ATOM   3214 C  C   . ASP B 2 217 ? 40.544 -4.002  24.514 1.00 35.57 ? 217 ASP H C   1 
ATOM   3215 O  O   . ASP B 2 217 ? 40.439 -5.175  24.168 1.00 35.60 ? 217 ASP H O   1 
ATOM   3216 C  CB  . ASP B 2 217 ? 42.661 -4.103  25.853 1.00 35.16 ? 217 ASP H CB  1 
ATOM   3217 C  CG  . ASP B 2 217 ? 43.371 -3.752  27.151 1.00 34.89 ? 217 ASP H CG  1 
ATOM   3218 O  OD1 . ASP B 2 217 ? 43.291 -2.591  27.602 1.00 34.29 ? 217 ASP H OD1 1 
ATOM   3219 O  OD2 . ASP B 2 217 ? 44.015 -4.645  27.728 1.00 35.63 ? 217 ASP H OD2 1 
ATOM   3220 N  N   . LYS B 2 218 ? 40.074 -2.989  23.796 1.00 36.06 ? 218 LYS H N   1 
ATOM   3221 C  CA  . LYS B 2 218 ? 39.454 -3.197  22.503 1.00 36.76 ? 218 LYS H CA  1 
ATOM   3222 C  C   . LYS B 2 218 ? 40.287 -2.534  21.418 1.00 36.90 ? 218 LYS H C   1 
ATOM   3223 O  O   . LYS B 2 218 ? 40.468 -1.316  21.416 1.00 36.59 ? 218 LYS H O   1 
ATOM   3224 C  CB  . LYS B 2 218 ? 38.010 -2.671  22.500 1.00 36.97 ? 218 LYS H CB  1 
ATOM   3225 C  CG  . LYS B 2 218 ? 37.183 -3.001  21.246 1.00 38.39 ? 218 LYS H CG  1 
ATOM   3226 C  CD  . LYS B 2 218 ? 36.937 -4.514  21.067 1.00 41.36 ? 218 LYS H CD  1 
ATOM   3227 C  CE  . LYS B 2 218 ? 36.214 -5.136  22.268 1.00 42.60 ? 218 LYS H CE  1 
ATOM   3228 N  NZ  . LYS B 2 218 ? 35.655 -6.489  21.966 1.00 44.66 ? 218 LYS H NZ  1 
ATOM   3229 N  N   . LYS B 2 219 ? 40.808 -3.350  20.508 1.00 37.38 ? 219 LYS H N   1 
ATOM   3230 C  CA  . LYS B 2 219 ? 41.461 -2.843  19.312 1.00 38.40 ? 219 LYS H CA  1 
ATOM   3231 C  C   . LYS B 2 219 ? 40.383 -2.375  18.339 1.00 38.29 ? 219 LYS H C   1 
ATOM   3232 O  O   . LYS B 2 219 ? 39.425 -3.100  18.064 1.00 38.36 ? 219 LYS H O   1 
ATOM   3233 C  CB  . LYS B 2 219 ? 42.356 -3.920  18.676 1.00 38.36 ? 219 LYS H CB  1 
ATOM   3234 C  CG  . LYS B 2 219 ? 43.253 -3.408  17.542 1.00 39.06 ? 219 LYS H CG  1 
ATOM   3235 C  CD  . LYS B 2 219 ? 44.230 -4.469  17.016 1.00 39.92 ? 219 LYS H CD  1 
ATOM   3236 C  CE  . LYS B 2 219 ? 45.401 -4.752  17.985 1.00 43.89 ? 219 LYS H CE  1 
ATOM   3237 N  NZ  . LYS B 2 219 ? 45.031 -5.678  19.121 1.00 42.57 ? 219 LYS H NZ  1 
ATOM   3238 N  N   . VAL B 2 220 ? 40.538 -1.154  17.838 1.00 38.72 ? 220 VAL H N   1 
ATOM   3239 C  CA  . VAL B 2 220 ? 39.555 -0.552  16.929 1.00 39.16 ? 220 VAL H CA  1 
ATOM   3240 C  C   . VAL B 2 220 ? 40.124 -0.428  15.503 1.00 40.20 ? 220 VAL H C   1 
ATOM   3241 O  O   . VAL B 2 220 ? 41.111 0.277   15.268 1.00 39.89 ? 220 VAL H O   1 
ATOM   3242 C  CB  . VAL B 2 220 ? 39.038 0.822   17.461 1.00 38.86 ? 220 VAL H CB  1 
ATOM   3243 C  CG1 . VAL B 2 220 ? 38.008 1.425   16.505 1.00 38.46 ? 220 VAL H CG1 1 
ATOM   3244 C  CG2 . VAL B 2 220 ? 38.467 0.676   18.874 1.00 37.39 ? 220 VAL H CG2 1 
ATOM   3245 N  N   . GLU B 2 221 ? 39.479 -1.118  14.562 1.00 41.61 ? 221 GLU H N   1 
ATOM   3246 C  CA  . GLU B 2 221 ? 40.001 -1.283  13.202 1.00 43.07 ? 221 GLU H CA  1 
ATOM   3247 C  C   . GLU B 2 221 ? 38.972 -0.937  12.132 1.00 43.71 ? 221 GLU H C   1 
ATOM   3248 O  O   . GLU B 2 221 ? 37.770 -1.065  12.380 1.00 43.93 ? 221 GLU H O   1 
ATOM   3249 C  CB  . GLU B 2 221 ? 40.466 -2.722  12.996 1.00 43.26 ? 221 GLU H CB  1 
ATOM   3250 C  CG  . GLU B 2 221 ? 41.701 -3.069  13.794 1.00 45.57 ? 221 GLU H CG  1 
ATOM   3251 C  CD  . GLU B 2 221 ? 42.156 -4.494  13.591 1.00 46.60 ? 221 GLU H CD  1 
ATOM   3252 O  OE1 . GLU B 2 221 ? 41.317 -5.328  13.169 1.00 48.88 ? 221 GLU H OE1 1 
ATOM   3253 O  OE2 . GLU B 2 221 ? 43.355 -4.771  13.867 1.00 49.38 ? 221 GLU H OE2 1 
ATOM   3254 N  N   . PRO B 2 222 ? 39.442 -0.494  10.940 1.00 44.35 ? 222 PRO H N   1 
ATOM   3255 C  CA  . PRO B 2 222 ? 38.606 -0.398  9.739  1.00 44.76 ? 222 PRO H CA  1 
ATOM   3256 C  C   . PRO B 2 222 ? 37.597 -1.538  9.615  1.00 45.06 ? 222 PRO H C   1 
ATOM   3257 O  O   . PRO B 2 222 ? 37.901 -2.708  9.839  1.00 45.04 ? 222 PRO H O   1 
ATOM   3258 C  CB  . PRO B 2 222 ? 39.636 -0.493  8.617  1.00 45.01 ? 222 PRO H CB  1 
ATOM   3259 C  CG  . PRO B 2 222 ? 40.819 0.269   9.180  1.00 44.75 ? 222 PRO H CG  1 
ATOM   3260 C  CD  . PRO B 2 222 ? 40.821 -0.026  10.670 1.00 44.28 ? 222 PRO H CD  1 
ATOM   3261 O  OXT . PRO B 2 222 ? 36.430 -1.314  9.297  1.00 45.52 ? 222 PRO H OXT 1 
HETATM 3262 ZN ZN  . ZN  C 3 .   ? 46.870 34.075  33.663 0.50 28.33 ? 212 ZN  L ZN  1 
HETATM 3263 ZN ZN  . ZN  D 3 .   ? 38.574 16.948  18.968 1.00 28.92 ? 213 ZN  L ZN  1 
HETATM 3264 ZN ZN  . ZN  E 3 .   ? 14.032 29.808  54.754 1.00 34.56 ? 214 ZN  L ZN  1 
HETATM 3265 O  O   . HOH F 4 .   ? 26.857 34.519  40.010 1.00 18.18 ? 215 HOH L O   1 
HETATM 3266 O  O   . HOH F 4 .   ? 14.464 33.564  53.282 1.00 20.84 ? 216 HOH L O   1 
HETATM 3267 O  O   . HOH F 4 .   ? 21.851 6.933   25.089 1.00 20.70 ? 217 HOH L O   1 
HETATM 3268 O  O   . HOH F 4 .   ? 36.575 20.019  21.607 1.00 22.88 ? 218 HOH L O   1 
HETATM 3269 O  O   . HOH F 4 .   ? 41.676 31.645  38.336 1.00 19.52 ? 219 HOH L O   1 
HETATM 3270 O  O   . HOH F 4 .   ? 30.401 39.733  47.479 1.00 21.30 ? 220 HOH L O   1 
HETATM 3271 O  O   . HOH F 4 .   ? 18.187 -4.600  3.939  1.00 18.82 ? 221 HOH L O   1 
HETATM 3272 O  O   . HOH F 4 .   ? 23.619 -3.106  23.598 1.00 23.58 ? 222 HOH L O   1 
HETATM 3273 O  O   . HOH F 4 .   ? 16.199 11.164  18.241 1.00 26.81 ? 223 HOH L O   1 
HETATM 3274 O  O   . HOH F 4 .   ? 20.158 19.706  12.297 1.00 15.88 ? 224 HOH L O   1 
HETATM 3275 O  O   . HOH F 4 .   ? 47.324 29.893  35.649 1.00 27.60 ? 225 HOH L O   1 
HETATM 3276 O  O   . HOH F 4 .   ? 22.676 3.078   22.993 1.00 26.77 ? 226 HOH L O   1 
HETATM 3277 O  O   . HOH F 4 .   ? 26.654 16.623  28.492 1.00 25.67 ? 227 HOH L O   1 
HETATM 3278 O  O   . HOH F 4 .   ? 41.788 29.911  48.230 1.00 16.13 ? 228 HOH L O   1 
HETATM 3279 O  O   . HOH F 4 .   ? 22.502 25.196  49.517 1.00 17.88 ? 229 HOH L O   1 
HETATM 3280 O  O   . HOH F 4 .   ? 24.501 27.585  23.801 1.00 26.38 ? 230 HOH L O   1 
HETATM 3281 O  O   . HOH F 4 .   ? 23.856 23.800  51.650 1.00 21.37 ? 231 HOH L O   1 
HETATM 3282 O  O   . HOH F 4 .   ? 38.639 24.133  41.509 1.00 18.68 ? 232 HOH L O   1 
HETATM 3283 O  O   . HOH F 4 .   ? 45.669 31.425  46.731 1.00 26.33 ? 233 HOH L O   1 
HETATM 3284 O  O   . HOH F 4 .   ? 47.798 32.847  28.746 1.00 21.85 ? 234 HOH L O   1 
HETATM 3285 O  O   . HOH F 4 .   ? 34.214 45.277  43.151 1.00 31.83 ? 235 HOH L O   1 
HETATM 3286 O  O   . HOH F 4 .   ? 27.878 -0.948  18.779 1.00 23.40 ? 236 HOH L O   1 
HETATM 3287 O  O   . HOH F 4 .   ? 33.454 23.903  30.036 1.00 32.07 ? 237 HOH L O   1 
HETATM 3288 O  O   . HOH F 4 .   ? 43.510 30.926  50.070 1.00 23.75 ? 238 HOH L O   1 
HETATM 3289 O  O   . HOH F 4 .   ? 42.190 26.265  34.095 1.00 27.77 ? 239 HOH L O   1 
HETATM 3290 O  O   . HOH F 4 .   ? 29.798 40.398  32.822 1.00 28.56 ? 240 HOH L O   1 
HETATM 3291 O  O   . HOH F 4 .   ? 8.417  11.532  20.661 1.00 27.68 ? 241 HOH L O   1 
HETATM 3292 O  O   . HOH F 4 .   ? 17.683 8.820   6.582  1.00 27.30 ? 242 HOH L O   1 
HETATM 3293 O  O   . HOH F 4 .   ? 29.716 20.881  30.617 1.00 36.17 ? 243 HOH L O   1 
HETATM 3294 O  O   . HOH F 4 .   ? 17.430 7.258   24.018 1.00 29.15 ? 244 HOH L O   1 
HETATM 3295 O  O   . HOH F 4 .   ? 25.187 24.909  44.921 1.00 26.50 ? 245 HOH L O   1 
HETATM 3296 O  O   . HOH F 4 .   ? 25.577 -1.110  2.008  1.00 25.27 ? 246 HOH L O   1 
HETATM 3297 O  O   . HOH F 4 .   ? 20.866 14.773  18.977 1.00 32.08 ? 247 HOH L O   1 
HETATM 3298 O  O   . HOH F 4 .   ? 38.831 33.184  18.869 1.00 29.12 ? 248 HOH L O   1 
HETATM 3299 O  O   . HOH F 4 .   ? 26.327 23.313  39.298 1.00 34.89 ? 249 HOH L O   1 
HETATM 3300 O  O   . HOH F 4 .   ? 23.601 -0.303  0.425  1.00 25.37 ? 250 HOH L O   1 
HETATM 3301 O  O   . HOH F 4 .   ? 20.237 18.720  19.220 1.00 34.48 ? 251 HOH L O   1 
HETATM 3302 O  O   . HOH F 4 .   ? 20.242 6.739   23.167 1.00 26.87 ? 252 HOH L O   1 
HETATM 3303 O  O   . HOH F 4 .   ? 34.620 27.016  10.820 1.00 27.65 ? 253 HOH L O   1 
HETATM 3304 O  O   . HOH F 4 .   ? 28.484 10.709  4.881  1.00 29.66 ? 254 HOH L O   1 
HETATM 3305 O  O   . HOH F 4 .   ? 34.040 19.194  40.506 1.00 31.35 ? 255 HOH L O   1 
HETATM 3306 O  O   . HOH F 4 .   ? 27.878 2.571   17.286 1.00 17.01 ? 256 HOH L O   1 
HETATM 3307 O  O   . HOH F 4 .   ? 16.561 13.244  16.272 1.00 18.72 ? 257 HOH L O   1 
HETATM 3308 O  O   . HOH F 4 .   ? 32.251 43.625  42.809 1.00 33.25 ? 258 HOH L O   1 
HETATM 3309 O  O   . HOH F 4 .   ? 32.735 12.060  8.225  1.00 29.56 ? 259 HOH L O   1 
HETATM 3310 O  O   . HOH F 4 .   ? 33.634 27.128  31.840 1.00 19.86 ? 260 HOH L O   1 
HETATM 3311 O  O   . HOH F 4 .   ? 37.464 42.287  47.343 1.00 20.51 ? 261 HOH L O   1 
HETATM 3312 O  O   . HOH F 4 .   ? 37.081 25.237  34.070 1.00 20.78 ? 262 HOH L O   1 
HETATM 3313 O  O   . HOH F 4 .   ? 31.220 44.572  38.215 1.00 29.88 ? 263 HOH L O   1 
HETATM 3314 O  O   . HOH F 4 .   ? 22.232 32.564  31.452 1.00 30.36 ? 264 HOH L O   1 
HETATM 3315 O  O   . HOH F 4 .   ? 33.789 40.407  23.291 1.00 37.01 ? 265 HOH L O   1 
HETATM 3316 O  O   . HOH F 4 .   ? 20.486 28.535  48.127 1.00 24.67 ? 266 HOH L O   1 
HETATM 3317 O  O   . HOH F 4 .   ? 44.771 36.132  28.222 1.00 24.43 ? 267 HOH L O   1 
HETATM 3318 O  O   . HOH F 4 .   ? 30.616 22.967  39.719 1.00 26.83 ? 268 HOH L O   1 
HETATM 3319 O  O   . HOH F 4 .   ? 43.645 29.342  45.989 1.00 24.56 ? 269 HOH L O   1 
HETATM 3320 O  O   . HOH F 4 .   ? 27.084 3.166   3.926  1.00 30.48 ? 270 HOH L O   1 
HETATM 3321 O  O   . HOH F 4 .   ? 22.395 18.323  4.921  1.00 24.79 ? 271 HOH L O   1 
HETATM 3322 O  O   . HOH F 4 .   ? 13.880 2.688   20.038 1.00 28.35 ? 272 HOH L O   1 
HETATM 3323 O  O   . HOH F 4 .   ? 34.032 25.331  33.924 1.00 27.64 ? 273 HOH L O   1 
HETATM 3324 O  O   . HOH F 4 .   ? 38.743 33.887  23.077 1.00 21.80 ? 274 HOH L O   1 
HETATM 3325 O  O   . HOH F 4 .   ? 32.405 22.832  37.551 1.00 32.33 ? 275 HOH L O   1 
HETATM 3326 O  O   . HOH F 4 .   ? 31.674 41.136  60.825 1.00 44.60 ? 276 HOH L O   1 
HETATM 3327 O  O   . HOH F 4 .   ? 39.301 20.849  35.161 1.00 26.22 ? 277 HOH L O   1 
HETATM 3328 O  O   . HOH F 4 .   ? 25.008 26.516  61.213 1.00 44.14 ? 278 HOH L O   1 
HETATM 3329 O  O   . HOH F 4 .   ? 31.354 10.051  9.054  1.00 19.18 ? 279 HOH L O   1 
HETATM 3330 O  O   . HOH F 4 .   ? 43.247 29.494  38.278 1.00 18.02 ? 280 HOH L O   1 
HETATM 3331 O  O   . HOH F 4 .   ? 39.848 26.430  40.932 1.00 27.68 ? 281 HOH L O   1 
HETATM 3332 O  O   . HOH F 4 .   ? 33.057 27.812  60.538 1.00 32.38 ? 282 HOH L O   1 
HETATM 3333 O  O   . HOH F 4 .   ? 21.149 37.322  40.927 1.00 30.95 ? 283 HOH L O   1 
HETATM 3334 O  O   . HOH F 4 .   ? 30.282 46.835  49.019 1.00 40.35 ? 284 HOH L O   1 
HETATM 3335 O  O   . HOH F 4 .   ? 16.037 4.816   22.507 1.00 29.06 ? 285 HOH L O   1 
HETATM 3336 O  O   . HOH F 4 .   ? 40.216 44.055  40.884 1.00 25.86 ? 286 HOH L O   1 
HETATM 3337 O  O   . HOH F 4 .   ? 40.484 18.615  43.801 1.00 35.01 ? 287 HOH L O   1 
HETATM 3338 O  O   . HOH F 4 .   ? 14.611 15.495  5.206  1.00 44.24 ? 288 HOH L O   1 
HETATM 3339 O  O   . HOH F 4 .   ? 18.840 37.066  58.020 1.00 26.70 ? 289 HOH L O   1 
HETATM 3340 O  O   . HOH F 4 .   ? 36.259 19.541  24.458 1.00 30.92 ? 290 HOH L O   1 
HETATM 3341 O  O   . HOH F 4 .   ? 19.583 14.992  6.230  1.00 36.22 ? 291 HOH L O   1 
HETATM 3342 O  O   . HOH F 4 .   ? 32.273 42.631  29.512 1.00 31.75 ? 292 HOH L O   1 
HETATM 3343 O  O   . HOH F 4 .   ? 23.900 25.382  9.641  1.00 27.85 ? 293 HOH L O   1 
HETATM 3344 O  O   . HOH F 4 .   ? 29.120 32.498  22.756 1.00 22.14 ? 294 HOH L O   1 
HETATM 3345 O  O   . HOH F 4 .   ? 40.928 23.950  16.638 1.00 37.39 ? 295 HOH L O   1 
HETATM 3346 O  O   . HOH F 4 .   ? 25.387 27.277  16.639 1.00 23.76 ? 296 HOH L O   1 
HETATM 3347 O  O   . HOH F 4 .   ? 42.584 33.397  53.031 1.00 39.63 ? 297 HOH L O   1 
HETATM 3348 O  O   . HOH F 4 .   ? 35.585 27.044  30.120 1.00 24.86 ? 298 HOH L O   1 
HETATM 3349 O  O   . HOH F 4 .   ? 13.087 15.511  16.613 1.00 30.01 ? 299 HOH L O   1 
HETATM 3350 O  O   . HOH F 4 .   ? 21.286 30.414  62.575 1.00 28.26 ? 300 HOH L O   1 
HETATM 3351 O  O   . HOH F 4 .   ? 9.840  -7.620  14.141 1.00 51.37 ? 301 HOH L O   1 
HETATM 3352 O  O   . HOH F 4 .   ? 28.786 9.746   24.597 1.00 24.71 ? 302 HOH L O   1 
HETATM 3353 O  O   . HOH F 4 .   ? 18.894 26.432  40.492 1.00 41.83 ? 303 HOH L O   1 
HETATM 3354 O  O   . HOH F 4 .   ? 13.484 0.591   18.333 1.00 28.86 ? 304 HOH L O   1 
HETATM 3355 O  O   . HOH F 4 .   ? 41.175 42.054  49.808 1.00 31.71 ? 305 HOH L O   1 
HETATM 3356 O  O   . HOH F 4 .   ? 38.671 24.829  29.299 1.00 35.74 ? 306 HOH L O   1 
HETATM 3357 O  O   . HOH F 4 .   ? 37.887 43.262  40.014 1.00 22.39 ? 307 HOH L O   1 
HETATM 3358 O  O   . HOH F 4 .   ? 14.518 13.654  20.154 1.00 29.96 ? 308 HOH L O   1 
HETATM 3359 O  O   . HOH F 4 .   ? 12.511 6.219   23.243 1.00 36.12 ? 309 HOH L O   1 
HETATM 3360 O  O   . HOH F 4 .   ? 42.864 23.463  36.599 1.00 39.61 ? 310 HOH L O   1 
HETATM 3361 O  O   . HOH F 4 .   ? 30.965 5.178   9.437  1.00 37.07 ? 311 HOH L O   1 
HETATM 3362 O  O   . HOH F 4 .   ? 24.775 27.651  35.732 1.00 37.58 ? 312 HOH L O   1 
HETATM 3363 O  O   . HOH F 4 .   ? 19.970 29.595  55.886 1.00 31.45 ? 313 HOH L O   1 
HETATM 3364 O  O   . HOH F 4 .   ? 40.126 27.496  32.881 1.00 25.67 ? 314 HOH L O   1 
HETATM 3365 O  O   . HOH F 4 .   ? 11.054 14.154  8.186  1.00 29.05 ? 315 HOH L O   1 
HETATM 3366 O  O   . HOH F 4 .   ? 36.184 21.712  13.751 1.00 33.36 ? 316 HOH L O   1 
HETATM 3367 O  O   . HOH F 4 .   ? 32.330 17.250  8.516  1.00 28.77 ? 317 HOH L O   1 
HETATM 3368 O  O   . HOH F 4 .   ? 32.794 8.080   10.678 1.00 38.26 ? 318 HOH L O   1 
HETATM 3369 O  O   . HOH F 4 .   ? 35.225 17.058  28.875 1.00 29.34 ? 319 HOH L O   1 
HETATM 3370 O  O   . HOH F 4 .   ? 37.893 13.941  39.129 1.00 47.38 ? 320 HOH L O   1 
HETATM 3371 O  O   . HOH F 4 .   ? 40.469 30.386  20.674 1.00 36.95 ? 321 HOH L O   1 
HETATM 3372 O  O   . HOH F 4 .   ? 27.185 35.690  28.211 1.00 30.05 ? 322 HOH L O   1 
HETATM 3373 O  O   . HOH F 4 .   ? 24.934 35.583  29.802 1.00 27.70 ? 323 HOH L O   1 
HETATM 3374 O  O   . HOH F 4 .   ? 34.531 43.976  29.326 1.00 41.11 ? 324 HOH L O   1 
HETATM 3375 O  O   . HOH F 4 .   ? 16.064 27.842  58.259 1.00 34.54 ? 325 HOH L O   1 
HETATM 3376 O  O   . HOH F 4 .   ? 21.545 30.118  41.851 1.00 24.95 ? 326 HOH L O   1 
HETATM 3377 O  O   . HOH F 4 .   ? 19.643 28.188  45.161 1.00 33.50 ? 327 HOH L O   1 
HETATM 3378 O  O   . HOH F 4 .   ? 21.878 29.612  39.132 1.00 35.93 ? 328 HOH L O   1 
HETATM 3379 O  O   . HOH F 4 .   ? 29.175 28.305  23.886 1.00 26.27 ? 329 HOH L O   1 
HETATM 3380 O  O   . HOH F 4 .   ? 29.735 27.197  60.551 1.00 35.52 ? 330 HOH L O   1 
HETATM 3381 O  O   . HOH F 4 .   ? 28.207 30.002  59.119 1.00 34.84 ? 331 HOH L O   1 
HETATM 3382 O  O   . HOH F 4 .   ? 48.199 37.530  43.410 1.00 33.43 ? 332 HOH L O   1 
HETATM 3383 O  O   . HOH F 4 .   ? 26.585 44.624  44.738 1.00 36.19 ? 333 HOH L O   1 
HETATM 3384 O  O   . HOH F 4 .   ? 37.406 32.143  12.713 1.00 40.54 ? 334 HOH L O   1 
HETATM 3385 O  O   . HOH F 4 .   ? 31.906 -5.467  15.680 1.00 42.25 ? 335 HOH L O   1 
HETATM 3386 O  O   . HOH F 4 .   ? 11.848 5.874   9.286  1.00 41.38 ? 336 HOH L O   1 
HETATM 3387 O  O   . HOH F 4 .   ? 15.476 -6.757  18.765 1.00 35.52 ? 337 HOH L O   1 
HETATM 3388 O  O   . HOH G 4 .   ? 24.556 18.439  45.517 1.00 26.22 ? 223 HOH H O   1 
HETATM 3389 O  O   . HOH G 4 .   ? 40.758 27.490  48.707 1.00 22.79 ? 224 HOH H O   1 
HETATM 3390 O  O   . HOH G 4 .   ? 45.692 12.012  6.858  1.00 29.27 ? 225 HOH H O   1 
HETATM 3391 O  O   . HOH G 4 .   ? 29.222 -7.739  35.505 1.00 30.55 ? 226 HOH H O   1 
HETATM 3392 O  O   . HOH G 4 .   ? 47.323 24.261  68.611 1.00 27.68 ? 227 HOH H O   1 
HETATM 3393 O  O   . HOH G 4 .   ? 37.542 18.054  69.445 1.00 24.71 ? 228 HOH H O   1 
HETATM 3394 O  O   . HOH G 4 .   ? 44.843 8.324   26.831 1.00 31.05 ? 229 HOH H O   1 
HETATM 3395 O  O   . HOH G 4 .   ? 37.254 12.071  44.197 1.00 32.28 ? 230 HOH H O   1 
HETATM 3396 O  O   . HOH G 4 .   ? 42.261 22.760  49.095 1.00 19.47 ? 231 HOH H O   1 
HETATM 3397 O  O   . HOH G 4 .   ? 35.734 26.204  65.628 1.00 25.51 ? 232 HOH H O   1 
HETATM 3398 O  O   . HOH G 4 .   ? 32.351 9.891   36.652 1.00 27.76 ? 233 HOH H O   1 
HETATM 3399 O  O   . HOH G 4 .   ? 43.632 19.181  50.252 1.00 29.33 ? 234 HOH H O   1 
HETATM 3400 O  O   . HOH G 4 .   ? 20.445 2.855   40.753 1.00 33.49 ? 235 HOH H O   1 
HETATM 3401 O  O   . HOH G 4 .   ? 41.506 19.156  71.442 1.00 33.80 ? 236 HOH H O   1 
HETATM 3402 O  O   . HOH G 4 .   ? 37.021 -10.060 39.682 1.00 33.74 ? 237 HOH H O   1 
HETATM 3403 O  O   . HOH G 4 .   ? 46.425 17.545  66.400 1.00 24.22 ? 238 HOH H O   1 
HETATM 3404 O  O   . HOH G 4 .   ? 27.720 -7.198  32.360 1.00 30.62 ? 239 HOH H O   1 
HETATM 3405 O  O   . HOH G 4 .   ? 31.554 8.761   40.195 1.00 34.98 ? 240 HOH H O   1 
HETATM 3406 O  O   . HOH G 4 .   ? 19.373 13.643  51.848 1.00 23.92 ? 241 HOH H O   1 
HETATM 3407 O  O   . HOH G 4 .   ? 30.522 4.002   44.828 1.00 30.89 ? 242 HOH H O   1 
HETATM 3408 O  O   . HOH G 4 .   ? 29.069 19.773  39.663 1.00 27.50 ? 243 HOH H O   1 
HETATM 3409 O  O   . HOH G 4 .   ? 33.363 10.410  31.252 1.00 25.21 ? 244 HOH H O   1 
HETATM 3410 O  O   . HOH G 4 .   ? 35.836 7.309   46.131 1.00 32.17 ? 245 HOH H O   1 
HETATM 3411 O  O   . HOH G 4 .   ? 38.200 13.635  27.397 1.00 25.11 ? 246 HOH H O   1 
HETATM 3412 O  O   . HOH G 4 .   ? 44.391 1.574   12.428 1.00 25.27 ? 247 HOH H O   1 
HETATM 3413 O  O   . HOH G 4 .   ? 34.216 14.782  68.080 1.00 31.24 ? 248 HOH H O   1 
HETATM 3414 O  O   . HOH G 4 .   ? 27.812 29.654  63.258 1.00 31.78 ? 249 HOH H O   1 
HETATM 3415 O  O   . HOH G 4 .   ? 37.396 16.200  25.818 1.00 23.40 ? 250 HOH H O   1 
HETATM 3416 O  O   . HOH G 4 .   ? 35.871 5.355   57.078 1.00 26.04 ? 251 HOH H O   1 
HETATM 3417 O  O   . HOH G 4 .   ? 13.194 21.845  60.170 1.00 32.38 ? 252 HOH H O   1 
HETATM 3418 O  O   . HOH G 4 .   ? 49.364 3.856   16.887 1.00 30.47 ? 253 HOH H O   1 
HETATM 3419 O  O   . HOH G 4 .   ? 48.308 12.814  7.343  1.00 26.80 ? 254 HOH H O   1 
HETATM 3420 O  O   . HOH G 4 .   ? 32.105 4.168   42.242 1.00 27.55 ? 255 HOH H O   1 
HETATM 3421 O  O   . HOH G 4 .   ? 16.435 5.507   48.695 1.00 37.36 ? 256 HOH H O   1 
HETATM 3422 O  O   . HOH G 4 .   ? 40.085 9.532   28.319 1.00 28.44 ? 257 HOH H O   1 
HETATM 3423 O  O   . HOH G 4 .   ? 44.543 30.690  60.853 1.00 34.25 ? 258 HOH H O   1 
HETATM 3424 O  O   . HOH G 4 .   ? 35.278 7.673   11.073 1.00 29.29 ? 259 HOH H O   1 
HETATM 3425 O  O   . HOH G 4 .   ? 43.792 -0.409  15.602 1.00 25.32 ? 260 HOH H O   1 
HETATM 3426 O  O   . HOH G 4 .   ? 24.183 10.084  37.866 1.00 29.95 ? 261 HOH H O   1 
HETATM 3427 O  O   . HOH G 4 .   ? 38.454 8.531   31.581 1.00 31.64 ? 262 HOH H O   1 
HETATM 3428 O  O   . HOH G 4 .   ? 21.508 6.195   43.232 1.00 32.54 ? 263 HOH H O   1 
HETATM 3429 O  O   . HOH G 4 .   ? 41.263 19.012  46.693 1.00 28.62 ? 264 HOH H O   1 
HETATM 3430 O  O   . HOH G 4 .   ? 19.914 0.501   25.970 1.00 32.07 ? 265 HOH H O   1 
HETATM 3431 O  O   . HOH G 4 .   ? 35.969 2.711   37.719 1.00 32.62 ? 266 HOH H O   1 
HETATM 3432 O  O   . HOH G 4 .   ? 41.029 16.469  23.162 1.00 29.71 ? 267 HOH H O   1 
HETATM 3433 O  O   . HOH G 4 .   ? 17.848 5.444   27.726 1.00 39.58 ? 268 HOH H O   1 
HETATM 3434 O  O   . HOH G 4 .   ? 49.690 6.075   20.564 1.00 35.66 ? 269 HOH H O   1 
HETATM 3435 O  O   . HOH G 4 .   ? 41.015 13.965  26.227 1.00 33.98 ? 270 HOH H O   1 
HETATM 3436 O  O   . HOH G 4 .   ? 37.747 16.454  43.729 1.00 28.31 ? 271 HOH H O   1 
HETATM 3437 O  O   . HOH G 4 .   ? 32.714 4.601   46.063 1.00 28.90 ? 272 HOH H O   1 
HETATM 3438 O  O   . HOH G 4 .   ? 20.567 -0.228  28.878 1.00 30.71 ? 273 HOH H O   1 
HETATM 3439 O  O   . HOH G 4 .   ? 52.977 22.152  55.814 1.00 45.50 ? 274 HOH H O   1 
HETATM 3440 O  O   . HOH G 4 .   ? 40.502 11.818  49.099 1.00 31.58 ? 275 HOH H O   1 
HETATM 3441 O  O   . HOH G 4 .   ? 40.541 38.609  62.352 1.00 38.64 ? 276 HOH H O   1 
HETATM 3442 O  O   . HOH G 4 .   ? 22.389 11.241  32.410 1.00 33.94 ? 277 HOH H O   1 
HETATM 3443 O  O   . HOH G 4 .   ? 22.144 6.100   38.849 1.00 28.17 ? 278 HOH H O   1 
HETATM 3444 O  O   . HOH G 4 .   ? 29.808 14.187  42.010 1.00 31.37 ? 279 HOH H O   1 
HETATM 3445 O  O   . HOH G 4 .   ? 48.724 12.314  21.993 1.00 34.39 ? 280 HOH H O   1 
HETATM 3446 O  O   . HOH G 4 .   ? 43.470 12.894  26.516 1.00 29.75 ? 281 HOH H O   1 
HETATM 3447 O  O   . HOH G 4 .   ? 36.093 -2.859  7.352  1.00 35.60 ? 282 HOH H O   1 
HETATM 3448 O  O   . HOH G 4 .   ? 41.502 8.368   57.673 1.00 29.71 ? 283 HOH H O   1 
HETATM 3449 O  O   . HOH G 4 .   ? 39.651 7.718   66.031 1.00 43.63 ? 284 HOH H O   1 
HETATM 3450 O  O   . HOH G 4 .   ? 47.215 -2.114  13.040 1.00 36.21 ? 285 HOH H O   1 
HETATM 3451 O  O   . HOH G 4 .   ? 47.783 15.820  24.536 1.00 40.74 ? 286 HOH H O   1 
HETATM 3452 O  O   . HOH G 4 .   ? 47.266 9.235   15.333 1.00 35.15 ? 287 HOH H O   1 
HETATM 3453 O  O   . HOH G 4 .   ? 22.281 13.888  63.756 1.00 28.73 ? 288 HOH H O   1 
HETATM 3454 O  O   . HOH G 4 .   ? 37.335 -2.749  15.551 1.00 23.02 ? 289 HOH H O   1 
HETATM 3455 O  O   . HOH G 4 .   ? 42.807 30.673  52.931 1.00 35.91 ? 290 HOH H O   1 
HETATM 3456 O  O   . HOH G 4 .   ? 23.405 13.928  47.655 1.00 22.98 ? 291 HOH H O   1 
HETATM 3457 O  O   . HOH G 4 .   ? 21.603 -2.401  25.954 1.00 39.99 ? 292 HOH H O   1 
HETATM 3458 O  O   . HOH G 4 .   ? 41.272 9.170   54.935 1.00 32.15 ? 293 HOH H O   1 
HETATM 3459 O  O   . HOH G 4 .   ? 50.094 16.919  19.841 1.00 35.72 ? 294 HOH H O   1 
HETATM 3460 O  O   . HOH G 4 .   ? 31.756 -0.009  47.109 1.00 30.31 ? 295 HOH H O   1 
HETATM 3461 O  O   . HOH G 4 .   ? 20.064 22.064  55.308 1.00 35.43 ? 296 HOH H O   1 
HETATM 3462 O  O   . HOH G 4 .   ? 37.170 -5.304  41.902 1.00 41.44 ? 297 HOH H O   1 
HETATM 3463 O  O   . HOH G 4 .   ? 27.834 7.411   23.260 1.00 23.94 ? 298 HOH H O   1 
HETATM 3464 O  O   . HOH G 4 .   ? 44.032 1.570   36.032 1.00 36.48 ? 299 HOH H O   1 
HETATM 3465 O  O   . HOH G 4 .   ? 55.054 22.627  52.228 1.00 43.76 ? 300 HOH H O   1 
HETATM 3466 O  O   . HOH G 4 .   ? 22.076 12.122  44.393 1.00 34.32 ? 301 HOH H O   1 
HETATM 3467 O  O   . HOH G 4 .   ? 29.278 1.592   59.466 1.00 34.67 ? 302 HOH H O   1 
HETATM 3468 O  O   . HOH G 4 .   ? 21.411 14.181  41.173 1.00 40.68 ? 303 HOH H O   1 
HETATM 3469 O  O   . HOH G 4 .   ? 34.438 9.107   66.602 1.00 39.89 ? 304 HOH H O   1 
HETATM 3470 O  O   . HOH G 4 .   ? 21.740 7.809   63.463 1.00 37.47 ? 305 HOH H O   1 
HETATM 3471 O  O   . HOH G 4 .   ? 27.548 34.848  62.631 1.00 33.19 ? 306 HOH H O   1 
HETATM 3472 O  O   . HOH G 4 .   ? 31.044 25.934  64.437 1.00 38.55 ? 307 HOH H O   1 
HETATM 3473 O  O   . HOH G 4 .   ? 44.961 24.064  49.917 1.00 42.24 ? 308 HOH H O   1 
HETATM 3474 O  O   . HOH G 4 .   ? 46.184 26.153  56.567 1.00 34.91 ? 309 HOH H O   1 
HETATM 3475 O  O   . HOH G 4 .   ? 45.955 19.821  65.342 1.00 34.98 ? 310 HOH H O   1 
HETATM 3476 O  O   . HOH G 4 .   ? 47.907 25.758  61.096 1.00 38.83 ? 311 HOH H O   1 
HETATM 3477 O  O   . HOH G 4 .   ? 25.719 14.499  67.488 0.50 28.24 ? 312 HOH H O   1 
HETATM 3478 O  O   . HOH G 4 .   ? 36.165 6.999   3.666  1.00 38.75 ? 313 HOH H O   1 
HETATM 3479 O  O   . HOH G 4 .   ? 20.637 3.908   38.218 1.00 32.07 ? 314 HOH H O   1 
HETATM 3480 O  O   . HOH G 4 .   ? 26.532 5.909   39.876 1.00 31.05 ? 315 HOH H O   1 
HETATM 3481 O  O   . HOH G 4 .   ? 31.309 6.857   34.298 1.00 45.39 ? 316 HOH H O   1 
HETATM 3482 O  O   . HOH G 4 .   ? 45.920 7.046   12.234 1.00 38.78 ? 317 HOH H O   1 
HETATM 3483 O  O   . HOH G 4 .   ? 45.139 12.406  3.535  1.00 38.36 ? 318 HOH H O   1 
HETATM 3484 O  O   . HOH G 4 .   ? 39.351 15.792  69.705 1.00 34.99 ? 319 HOH H O   1 
HETATM 3485 O  O   . HOH G 4 .   ? 36.439 9.090   9.229  1.00 28.93 ? 320 HOH H O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLU A 1   ? 0.3506 0.3582 0.3617 0.0024  0.0029  0.0030  1   GLU L N   
2    C  CA  . GLU A 1   ? 0.3476 0.3583 0.3572 0.0033  0.0005  0.0049  1   GLU L CA  
3    C  C   . GLU A 1   ? 0.3402 0.3541 0.3563 0.0037  0.0001  0.0011  1   GLU L C   
4    O  O   . GLU A 1   ? 0.3462 0.3655 0.3658 0.0034  -0.0043 -0.0010 1   GLU L O   
5    C  CB  . GLU A 1   ? 0.3508 0.3598 0.3533 0.0012  0.0026  0.0039  1   GLU L CB  
6    C  CG  . GLU A 1   ? 0.3816 0.3912 0.3809 -0.0036 -0.0013 0.0039  1   GLU L CG  
7    C  CD  . GLU A 1   ? 0.4156 0.4122 0.4035 -0.0078 -0.0018 -0.0036 1   GLU L CD  
8    O  OE1 . GLU A 1   ? 0.4388 0.4350 0.4265 -0.0028 0.0046  0.0053  1   GLU L OE1 
9    O  OE2 . GLU A 1   ? 0.4457 0.4305 0.4118 -0.0050 0.0063  0.0020  1   GLU L OE2 
10   N  N   . ILE A 2   ? 0.3269 0.3418 0.3462 0.0072  0.0001  0.0012  2   ILE L N   
11   C  CA  . ILE A 2   ? 0.3194 0.3291 0.3301 0.0077  -0.0016 0.0027  2   ILE L CA  
12   C  C   . ILE A 2   ? 0.3216 0.3280 0.3327 0.0085  -0.0001 0.0013  2   ILE L C   
13   O  O   . ILE A 2   ? 0.3285 0.3282 0.3309 0.0096  0.0033  0.0046  2   ILE L O   
14   C  CB  . ILE A 2   ? 0.3135 0.3233 0.3259 0.0056  -0.0037 0.0028  2   ILE L CB  
15   C  CG1 . ILE A 2   ? 0.3062 0.3107 0.3158 0.0062  -0.0017 0.0049  2   ILE L CG1 
16   C  CG2 . ILE A 2   ? 0.3009 0.3233 0.3131 0.0075  -0.0075 0.0007  2   ILE L CG2 
17   C  CD1 . ILE A 2   ? 0.2886 0.2876 0.3230 0.0089  0.0028  0.0019  2   ILE L CD1 
18   N  N   . VAL A 3   ? 0.3216 0.3281 0.3265 0.0064  -0.0009 -0.0018 3   VAL L N   
19   C  CA  . VAL A 3   ? 0.3167 0.3264 0.3287 0.0053  0.0041  -0.0020 3   VAL L CA  
20   C  C   . VAL A 3   ? 0.3195 0.3231 0.3267 0.0051  0.0023  -0.0018 3   VAL L C   
21   O  O   . VAL A 3   ? 0.3240 0.3264 0.3386 0.0036  0.0034  -0.0005 3   VAL L O   
22   C  CB  . VAL A 3   ? 0.3182 0.3263 0.3274 0.0054  0.0010  -0.0052 3   VAL L CB  
23   C  CG1 . VAL A 3   ? 0.3210 0.3453 0.3379 0.0028  0.0091  -0.0032 3   VAL L CG1 
24   C  CG2 . VAL A 3   ? 0.3067 0.3120 0.3214 0.0050  0.0004  0.0021  3   VAL L CG2 
25   N  N   . LEU A 4   ? 0.3133 0.3206 0.3140 0.0029  0.0026  -0.0025 4   LEU L N   
26   C  CA  . LEU A 4   ? 0.3095 0.3090 0.3077 0.0021  0.0021  -0.0054 4   LEU L CA  
27   C  C   . LEU A 4   ? 0.3114 0.3132 0.3082 0.0036  0.0044  -0.0009 4   LEU L C   
28   O  O   . LEU A 4   ? 0.3108 0.3125 0.3019 -0.0028 0.0035  -0.0062 4   LEU L O   
29   C  CB  . LEU A 4   ? 0.3055 0.3016 0.3089 0.0005  0.0046  -0.0082 4   LEU L CB  
30   C  CG  . LEU A 4   ? 0.3076 0.3060 0.3111 0.0054  0.0008  -0.0045 4   LEU L CG  
31   C  CD1 . LEU A 4   ? 0.2957 0.2839 0.2948 -0.0011 0.0092  -0.0052 4   LEU L CD1 
32   C  CD2 . LEU A 4   ? 0.3162 0.3189 0.3158 0.0088  0.0000  -0.0163 4   LEU L CD2 
33   N  N   . THR A 5   ? 0.3091 0.3113 0.3062 0.0056  0.0026  -0.0007 5   THR L N   
34   C  CA  . THR A 5   ? 0.3061 0.3139 0.3070 0.0058  0.0011  -0.0003 5   THR L CA  
35   C  C   . THR A 5   ? 0.3008 0.3093 0.3008 0.0054  -0.0003 -0.0007 5   THR L C   
36   O  O   . THR A 5   ? 0.2964 0.3023 0.2937 0.0164  0.0027  -0.0053 5   THR L O   
37   C  CB  . THR A 5   ? 0.3097 0.3195 0.3113 0.0037  -0.0014 0.0024  5   THR L CB  
38   O  OG1 . THR A 5   ? 0.3180 0.3252 0.3134 0.0048  0.0058  0.0143  5   THR L OG1 
39   C  CG2 . THR A 5   ? 0.3110 0.2996 0.2980 -0.0031 0.0048  -0.0014 5   THR L CG2 
40   N  N   . GLN A 6   ? 0.3003 0.3083 0.3001 0.0036  -0.0047 -0.0046 6   GLN L N   
41   C  CA  . GLN A 6   ? 0.3012 0.3107 0.3010 0.0019  -0.0047 -0.0045 6   GLN L CA  
42   C  C   . GLN A 6   ? 0.3120 0.3218 0.3160 0.0026  -0.0048 -0.0017 6   GLN L C   
43   O  O   . GLN A 6   ? 0.3057 0.3294 0.3173 0.0011  -0.0084 -0.0023 6   GLN L O   
44   C  CB  . GLN A 6   ? 0.2927 0.2996 0.2909 0.0010  -0.0064 -0.0041 6   GLN L CB  
45   C  CG  . GLN A 6   ? 0.2805 0.2769 0.2800 0.0050  -0.0061 0.0018  6   GLN L CG  
46   C  CD  . GLN A 6   ? 0.2593 0.2558 0.2332 -0.0035 -0.0098 0.0027  6   GLN L CD  
47   O  OE1 . GLN A 6   ? 0.2852 0.2629 0.2483 -0.0021 -0.0094 -0.0041 6   GLN L OE1 
48   N  NE2 . GLN A 6   ? 0.2234 0.2234 0.1987 -0.0082 -0.0359 0.0028  6   GLN L NE2 
49   N  N   . SER A 7   ? 0.3274 0.3265 0.3311 0.0020  -0.0039 -0.0011 7   SER L N   
50   C  CA  . SER A 7   ? 0.3493 0.3468 0.3439 0.0024  0.0004  -0.0015 7   SER L CA  
51   C  C   . SER A 7   ? 0.3524 0.3524 0.3449 0.0006  0.0018  -0.0006 7   SER L C   
52   O  O   . SER A 7   ? 0.3595 0.3512 0.3427 -0.0003 0.0029  -0.0025 7   SER L O   
53   C  CB  . SER A 7   ? 0.3512 0.3486 0.3498 0.0046  0.0003  -0.0021 7   SER L CB  
54   O  OG  . SER A 7   ? 0.3792 0.3588 0.3764 0.0044  0.0081  -0.0028 7   SER L OG  
55   N  N   . PRO A 8   ? 0.3583 0.3588 0.3484 -0.0005 0.0013  -0.0004 8   PRO L N   
56   C  CA  . PRO A 8   ? 0.3563 0.3558 0.3481 -0.0025 0.0016  -0.0016 8   PRO L CA  
57   C  C   . PRO A 8   ? 0.3587 0.3603 0.3491 -0.0024 0.0011  0.0000  8   PRO L C   
58   O  O   . PRO A 8   ? 0.3583 0.3570 0.3395 -0.0033 0.0034  -0.0002 8   PRO L O   
59   C  CB  . PRO A 8   ? 0.3571 0.3544 0.3439 -0.0010 0.0009  -0.0009 8   PRO L CB  
60   C  CG  . PRO A 8   ? 0.3536 0.3583 0.3440 -0.0020 0.0013  0.0002  8   PRO L CG  
61   C  CD  . PRO A 8   ? 0.3562 0.3608 0.3484 0.0006  0.0048  -0.0006 8   PRO L CD  
62   N  N   . ALA A 9   ? 0.3595 0.3604 0.3567 -0.0051 -0.0006 -0.0011 9   ALA L N   
63   C  CA  . ALA A 9   ? 0.3600 0.3579 0.3585 -0.0046 -0.0009 -0.0034 9   ALA L CA  
64   C  C   . ALA A 9   ? 0.3595 0.3589 0.3582 -0.0066 -0.0031 -0.0035 9   ALA L C   
65   O  O   . ALA A 9   ? 0.3586 0.3573 0.3542 -0.0081 -0.0053 -0.0067 9   ALA L O   
66   C  CB  . ALA A 9   ? 0.3629 0.3675 0.3611 -0.0030 -0.0004 -0.0030 9   ALA L CB  
67   N  N   . THR A 10  ? 0.3605 0.3529 0.3590 -0.0062 -0.0015 -0.0006 10  THR L N   
68   C  CA  . THR A 10  ? 0.3600 0.3497 0.3587 -0.0049 -0.0009 -0.0018 10  THR L CA  
69   C  C   . THR A 10  ? 0.3502 0.3453 0.3544 -0.0025 -0.0016 -0.0019 10  THR L C   
70   O  O   . THR A 10  ? 0.3484 0.3374 0.3600 -0.0008 -0.0039 -0.0005 10  THR L O   
71   C  CB  . THR A 10  ? 0.3665 0.3561 0.3628 -0.0057 0.0009  -0.0012 10  THR L CB  
72   O  OG1 . THR A 10  ? 0.3808 0.3596 0.3650 -0.0155 0.0000  -0.0028 10  THR L OG1 
73   C  CG2 . THR A 10  ? 0.3766 0.3596 0.3627 -0.0065 0.0049  -0.0035 10  THR L CG2 
74   N  N   . LEU A 11  ? 0.3421 0.3376 0.3455 -0.0019 -0.0021 -0.0022 11  LEU L N   
75   C  CA  . LEU A 11  ? 0.3359 0.3328 0.3403 0.0000  -0.0009 -0.0005 11  LEU L CA  
76   C  C   . LEU A 11  ? 0.3375 0.3341 0.3376 -0.0013 -0.0003 -0.0011 11  LEU L C   
77   O  O   . LEU A 11  ? 0.3379 0.3302 0.3387 -0.0009 0.0031  -0.0017 11  LEU L O   
78   C  CB  . LEU A 11  ? 0.3345 0.3289 0.3417 0.0011  -0.0025 -0.0008 11  LEU L CB  
79   C  CG  . LEU A 11  ? 0.3289 0.3340 0.3444 -0.0016 -0.0021 -0.0010 11  LEU L CG  
80   C  CD1 . LEU A 11  ? 0.3270 0.3083 0.3242 -0.0049 0.0025  0.0018  11  LEU L CD1 
81   C  CD2 . LEU A 11  ? 0.3250 0.3296 0.3333 -0.0072 0.0015  0.0019  11  LEU L CD2 
82   N  N   . SER A 12  ? 0.3374 0.3338 0.3360 -0.0014 -0.0015 -0.0017 12  SER L N   
83   C  CA  . SER A 12  ? 0.3451 0.3357 0.3264 -0.0014 0.0000  -0.0002 12  SER L CA  
84   C  C   . SER A 12  ? 0.3446 0.3343 0.3215 0.0013  0.0000  -0.0016 12  SER L C   
85   O  O   . SER A 12  ? 0.3548 0.3371 0.3179 0.0040  0.0017  -0.0012 12  SER L O   
86   C  CB  . SER A 12  ? 0.3392 0.3349 0.3279 -0.0031 -0.0033 0.0016  12  SER L CB  
87   O  OG  . SER A 12  ? 0.3690 0.3364 0.3348 0.0035  -0.0065 0.0009  12  SER L OG  
88   N  N   . LEU A 13  ? 0.3449 0.3370 0.3242 -0.0019 -0.0037 -0.0009 13  LEU L N   
89   C  CA  . LEU A 13  ? 0.3456 0.3331 0.3294 0.0001  0.0002  0.0035  13  LEU L CA  
90   C  C   . LEU A 13  ? 0.3456 0.3400 0.3336 0.0001  -0.0038 0.0025  13  LEU L C   
91   O  O   . LEU A 13  ? 0.3441 0.3333 0.3260 -0.0007 -0.0061 0.0018  13  LEU L O   
92   C  CB  . LEU A 13  ? 0.3365 0.3250 0.3308 -0.0005 -0.0031 0.0028  13  LEU L CB  
93   C  CG  . LEU A 13  ? 0.3443 0.3281 0.3242 -0.0024 0.0053  0.0043  13  LEU L CG  
94   C  CD1 . LEU A 13  ? 0.3319 0.3256 0.3294 -0.0088 -0.0015 -0.0025 13  LEU L CD1 
95   C  CD2 . LEU A 13  ? 0.3376 0.3305 0.3415 0.0088  0.0020  0.0007  13  LEU L CD2 
96   N  N   . SER A 14  ? 0.3510 0.3456 0.3410 -0.0009 -0.0022 0.0055  14  SER L N   
97   C  CA  . SER A 14  ? 0.3601 0.3547 0.3471 0.0017  -0.0003 0.0036  14  SER L CA  
98   C  C   . SER A 14  ? 0.3596 0.3552 0.3494 0.0011  -0.0006 0.0036  14  SER L C   
99   O  O   . SER A 14  ? 0.3636 0.3532 0.3466 -0.0003 -0.0034 0.0055  14  SER L O   
100  C  CB  . SER A 14  ? 0.3623 0.3560 0.3489 0.0007  -0.0002 0.0039  14  SER L CB  
101  O  OG  . SER A 14  ? 0.3708 0.3687 0.3527 0.0025  -0.0017 -0.0002 14  SER L OG  
102  N  N   . PRO A 15  ? 0.3646 0.3621 0.3533 -0.0008 0.0000  0.0030  15  PRO L N   
103  C  CA  . PRO A 15  ? 0.3657 0.3632 0.3567 -0.0020 -0.0004 0.0011  15  PRO L CA  
104  C  C   . PRO A 15  ? 0.3697 0.3632 0.3558 0.0013  0.0014  0.0012  15  PRO L C   
105  O  O   . PRO A 15  ? 0.3777 0.3706 0.3590 0.0001  0.0031  0.0000  15  PRO L O   
106  C  CB  . PRO A 15  ? 0.3622 0.3564 0.3531 -0.0003 0.0013  0.0008  15  PRO L CB  
107  C  CG  . PRO A 15  ? 0.3666 0.3648 0.3554 -0.0023 -0.0016 0.0020  15  PRO L CG  
108  C  CD  . PRO A 15  ? 0.3594 0.3545 0.3556 0.0000  0.0007  0.0004  15  PRO L CD  
109  N  N   . GLY A 16  ? 0.3666 0.3617 0.3581 -0.0002 0.0010  -0.0005 16  GLY L N   
110  C  CA  . GLY A 16  ? 0.3647 0.3557 0.3552 -0.0020 0.0020  0.0035  16  GLY L CA  
111  C  C   . GLY A 16  ? 0.3678 0.3515 0.3538 -0.0001 -0.0002 0.0031  16  GLY L C   
112  O  O   . GLY A 16  ? 0.3759 0.3554 0.3595 0.0006  0.0018  0.0074  16  GLY L O   
113  N  N   . GLU A 17  ? 0.3701 0.3522 0.3591 0.0019  0.0013  0.0039  17  GLU L N   
114  C  CA  . GLU A 17  ? 0.3687 0.3536 0.3616 0.0002  0.0017  0.0028  17  GLU L CA  
115  C  C   . GLU A 17  ? 0.3651 0.3522 0.3621 0.0005  0.0000  0.0032  17  GLU L C   
116  O  O   . GLU A 17  ? 0.3621 0.3409 0.3593 0.0000  -0.0010 0.0097  17  GLU L O   
117  C  CB  . GLU A 17  ? 0.3702 0.3528 0.3627 -0.0012 0.0008  0.0028  17  GLU L CB  
118  C  CG  . GLU A 17  ? 0.3916 0.3642 0.3788 0.0035  0.0038  0.0049  17  GLU L CG  
119  C  CD  . GLU A 17  ? 0.4038 0.3752 0.3926 0.0009  -0.0077 0.0035  17  GLU L CD  
120  O  OE1 . GLU A 17  ? 0.4155 0.4080 0.3988 -0.0056 -0.0020 0.0068  17  GLU L OE1 
121  O  OE2 . GLU A 17  ? 0.4512 0.4249 0.4363 0.0081  -0.0025 -0.0010 17  GLU L OE2 
122  N  N   . ARG A 18  ? 0.3655 0.3612 0.3643 0.0016  0.0011  0.0018  18  ARG L N   
123  C  CA  . ARG A 18  ? 0.3670 0.3610 0.3615 0.0006  -0.0015 0.0005  18  ARG L CA  
124  C  C   . ARG A 18  ? 0.3579 0.3517 0.3548 0.0033  -0.0018 -0.0025 18  ARG L C   
125  O  O   . ARG A 18  ? 0.3599 0.3527 0.3635 0.0038  -0.0051 -0.0071 18  ARG L O   
126  C  CB  . ARG A 18  ? 0.3632 0.3617 0.3641 0.0023  -0.0046 -0.0012 18  ARG L CB  
127  C  CG  . ARG A 18  ? 0.3880 0.3919 0.3860 0.0017  -0.0019 0.0024  18  ARG L CG  
128  C  CD  . ARG A 18  ? 0.4413 0.4359 0.4424 0.0059  0.0025  -0.0047 18  ARG L CD  
129  N  NE  . ARG A 18  ? 0.4845 0.4812 0.4847 -0.0137 0.0043  -0.0063 18  ARG L NE  
130  C  CZ  . ARG A 18  ? 0.5129 0.5008 0.5120 0.0000  0.0042  -0.0071 18  ARG L CZ  
131  N  NH1 . ARG A 18  ? 0.4931 0.5073 0.5053 0.0041  -0.0008 0.0034  18  ARG L NH1 
132  N  NH2 . ARG A 18  ? 0.5158 0.5016 0.5251 -0.0088 0.0049  -0.0088 18  ARG L NH2 
133  N  N   . ALA A 19  ? 0.3511 0.3357 0.3446 0.0025  0.0016  -0.0037 19  ALA L N   
134  C  CA  . ALA A 19  ? 0.3398 0.3288 0.3357 0.0015  0.0013  -0.0025 19  ALA L CA  
135  C  C   . ALA A 19  ? 0.3380 0.3210 0.3311 0.0001  -0.0002 0.0005  19  ALA L C   
136  O  O   . ALA A 19  ? 0.3309 0.3186 0.3219 0.0013  -0.0012 0.0028  19  ALA L O   
137  C  CB  . ALA A 19  ? 0.3400 0.3282 0.3312 0.0025  0.0018  -0.0024 19  ALA L CB  
138  N  N   . THR A 20  ? 0.3307 0.3171 0.3251 0.0000  -0.0012 0.0026  20  THR L N   
139  C  CA  . THR A 20  ? 0.3324 0.3155 0.3245 -0.0019 0.0001  0.0037  20  THR L CA  
140  C  C   . THR A 20  ? 0.3334 0.3152 0.3218 -0.0030 -0.0020 0.0068  20  THR L C   
141  O  O   . THR A 20  ? 0.3321 0.3151 0.3171 -0.0058 -0.0045 0.0117  20  THR L O   
142  C  CB  . THR A 20  ? 0.3297 0.3140 0.3225 -0.0028 0.0006  0.0016  20  THR L CB  
143  O  OG1 . THR A 20  ? 0.3405 0.3105 0.3379 0.0054  0.0045  0.0019  20  THR L OG1 
144  C  CG2 . THR A 20  ? 0.3314 0.3141 0.3409 -0.0017 -0.0012 -0.0020 20  THR L CG2 
145  N  N   . LEU A 21  ? 0.3350 0.3149 0.3209 -0.0018 0.0008  0.0050  21  LEU L N   
146  C  CA  . LEU A 21  ? 0.3262 0.3143 0.3146 0.0004  0.0025  0.0060  21  LEU L CA  
147  C  C   . LEU A 21  ? 0.3237 0.3138 0.3147 0.0015  0.0012  0.0055  21  LEU L C   
148  O  O   . LEU A 21  ? 0.3271 0.3132 0.3167 -0.0017 0.0029  0.0006  21  LEU L O   
149  C  CB  . LEU A 21  ? 0.3245 0.3094 0.3100 0.0013  0.0038  0.0072  21  LEU L CB  
150  C  CG  . LEU A 21  ? 0.3273 0.3071 0.3143 0.0054  0.0027  0.0073  21  LEU L CG  
151  C  CD1 . LEU A 21  ? 0.3205 0.3040 0.3232 0.0159  0.0071  0.0058  21  LEU L CD1 
152  C  CD2 . LEU A 21  ? 0.3133 0.2894 0.2988 0.0025  0.0072  -0.0016 21  LEU L CD2 
153  N  N   . SER A 22  ? 0.3211 0.3148 0.3160 0.0037  0.0015  0.0058  22  SER L N   
154  C  CA  . SER A 22  ? 0.3189 0.3223 0.3184 0.0064  0.0009  0.0047  22  SER L CA  
155  C  C   . SER A 22  ? 0.3118 0.3202 0.3115 0.0074  0.0009  0.0040  22  SER L C   
156  O  O   . SER A 22  ? 0.2979 0.3123 0.3051 0.0078  0.0001  0.0007  22  SER L O   
157  C  CB  . SER A 22  ? 0.3264 0.3279 0.3250 0.0067  0.0011  0.0044  22  SER L CB  
158  O  OG  . SER A 22  ? 0.3523 0.3751 0.3573 0.0102  -0.0014 0.0005  22  SER L OG  
159  N  N   . CYS A 23  ? 0.3111 0.3176 0.3075 0.0070  -0.0009 0.0064  23  CYS L N   
160  C  CA  . CYS A 23  ? 0.3121 0.3175 0.3072 0.0057  0.0009  0.0072  23  CYS L CA  
161  C  C   . CYS A 23  ? 0.3124 0.3146 0.3106 0.0056  -0.0017 0.0077  23  CYS L C   
162  O  O   . CYS A 23  ? 0.3162 0.3141 0.3200 0.0077  0.0013  0.0066  23  CYS L O   
163  C  CB  . CYS A 23  ? 0.3063 0.3140 0.3043 0.0054  0.0011  0.0085  23  CYS L CB  
164  S  SG  . CYS A 23  ? 0.2965 0.3133 0.2902 0.0134  0.0048  0.0066  23  CYS L SG  
165  N  N   . ARG A 24  ? 0.3158 0.3201 0.3141 0.0041  -0.0041 0.0080  24  ARG L N   
166  C  CA  . ARG A 24  ? 0.3256 0.3224 0.3242 0.0023  -0.0011 0.0042  24  ARG L CA  
167  C  C   . ARG A 24  ? 0.3171 0.3181 0.3192 0.0025  -0.0023 0.0038  24  ARG L C   
168  O  O   . ARG A 24  ? 0.3201 0.3198 0.3207 0.0000  -0.0022 0.0042  24  ARG L O   
169  C  CB  . ARG A 24  ? 0.3253 0.3307 0.3290 0.0024  -0.0056 0.0014  24  ARG L CB  
170  C  CG  . ARG A 24  ? 0.3699 0.3683 0.3752 0.0000  0.0034  0.0071  24  ARG L CG  
171  C  CD  . ARG A 24  ? 0.4434 0.4428 0.4063 0.0006  -0.0054 0.0088  24  ARG L CD  
172  N  NE  . ARG A 24  ? 0.4891 0.4878 0.4895 -0.0134 0.0024  0.0078  24  ARG L NE  
173  C  CZ  . ARG A 24  ? 0.5104 0.4913 0.4846 -0.0119 -0.0033 0.0098  24  ARG L CZ  
174  N  NH1 . ARG A 24  ? 0.5102 0.4977 0.4861 -0.0030 0.0000  0.0139  24  ARG L NH1 
175  N  NH2 . ARG A 24  ? 0.5158 0.5147 0.4955 -0.0025 -0.0067 0.0076  24  ARG L NH2 
176  N  N   . ALA A 25  ? 0.3086 0.3053 0.3103 0.0054  -0.0006 0.0019  25  ALA L N   
177  C  CA  . ALA A 25  ? 0.3062 0.3074 0.3125 0.0041  0.0008  -0.0009 25  ALA L CA  
178  C  C   . ALA A 25  ? 0.3092 0.3150 0.3118 0.0025  0.0000  -0.0008 25  ALA L C   
179  O  O   . ALA A 25  ? 0.3006 0.3155 0.3179 0.0048  0.0025  -0.0018 25  ALA L O   
180  C  CB  . ALA A 25  ? 0.3026 0.2984 0.3036 0.0028  0.0019  0.0028  25  ALA L CB  
181  N  N   . SER A 26  ? 0.3138 0.3187 0.3080 0.0010  -0.0009 0.0010  26  SER L N   
182  C  CA  . SER A 26  ? 0.3204 0.3257 0.3195 0.0017  -0.0016 0.0011  26  SER L CA  
183  C  C   . SER A 26  ? 0.3255 0.3330 0.3240 0.0023  -0.0006 0.0001  26  SER L C   
184  O  O   . SER A 26  ? 0.3245 0.3332 0.3239 0.0028  0.0009  0.0006  26  SER L O   
185  C  CB  . SER A 26  ? 0.3192 0.3258 0.3227 0.0007  -0.0018 0.0024  26  SER L CB  
186  O  OG  . SER A 26  ? 0.3234 0.3292 0.3273 0.0002  -0.0036 0.0031  26  SER L OG  
187  N  N   . GLN A 27  ? 0.3317 0.3359 0.3245 0.0001  0.0011  -0.0006 27  GLN L N   
188  C  CA  . GLN A 27  ? 0.3333 0.3317 0.3273 0.0008  0.0015  -0.0004 27  GLN L CA  
189  C  C   . GLN A 27  ? 0.3378 0.3366 0.3344 -0.0003 0.0019  -0.0019 27  GLN L C   
190  O  O   . GLN A 27  ? 0.3401 0.3295 0.3296 -0.0013 -0.0006 -0.0014 27  GLN L O   
191  C  CB  . GLN A 27  ? 0.3313 0.3345 0.3280 0.0030  0.0029  0.0000  27  GLN L CB  
192  C  CG  . GLN A 27  ? 0.3313 0.3230 0.3215 -0.0004 0.0037  0.0062  27  GLN L CG  
193  C  CD  . GLN A 27  ? 0.3259 0.3269 0.3241 0.0042  0.0035  -0.0035 27  GLN L CD  
194  O  OE1 . GLN A 27  ? 0.3369 0.3302 0.3094 0.0136  0.0064  0.0047  27  GLN L OE1 
195  N  NE2 . GLN A 27  ? 0.2934 0.2964 0.3158 0.0089  0.0073  -0.0049 27  GLN L NE2 
196  N  N   . SER A 28  ? 0.3441 0.3458 0.3418 0.0000  0.0043  -0.0053 28  SER L N   
197  C  CA  . SER A 28  ? 0.3458 0.3471 0.3451 -0.0009 0.0014  -0.0066 28  SER L CA  
198  C  C   . SER A 28  ? 0.3529 0.3529 0.3466 -0.0018 0.0015  -0.0040 28  SER L C   
199  O  O   . SER A 28  ? 0.3623 0.3703 0.3562 -0.0060 0.0063  -0.0028 28  SER L O   
200  C  CB  . SER A 28  ? 0.3416 0.3521 0.3464 -0.0013 0.0047  -0.0057 28  SER L CB  
201  O  OG  . SER A 28  ? 0.3460 0.3312 0.3442 0.0042  -0.0037 -0.0145 28  SER L OG  
202  N  N   . VAL A 29  ? 0.3477 0.3503 0.3460 0.0005  -0.0006 -0.0061 29  VAL L N   
203  C  CA  . VAL A 29  ? 0.3507 0.3484 0.3407 0.0024  -0.0002 -0.0029 29  VAL L CA  
204  C  C   . VAL A 29  ? 0.3520 0.3499 0.3339 0.0029  -0.0010 -0.0037 29  VAL L C   
205  O  O   . VAL A 29  ? 0.3564 0.3554 0.3335 0.0057  0.0026  -0.0049 29  VAL L O   
206  C  CB  . VAL A 29  ? 0.3472 0.3466 0.3390 0.0039  -0.0033 -0.0024 29  VAL L CB  
207  C  CG1 . VAL A 29  ? 0.3404 0.3367 0.3360 0.0031  -0.0041 -0.0016 29  VAL L CG1 
208  C  CG2 . VAL A 29  ? 0.3289 0.3312 0.3259 0.0005  -0.0007 -0.0035 29  VAL L CG2 
209  N  N   . SER A 30  ? 0.3583 0.3565 0.3363 0.0020  0.0002  -0.0053 30  SER L N   
210  C  CA  . SER A 30  ? 0.3596 0.3548 0.3469 -0.0012 0.0005  -0.0028 30  SER L CA  
211  C  C   . SER A 30  ? 0.3627 0.3534 0.3453 0.0015  -0.0008 -0.0045 30  SER L C   
212  O  O   . SER A 30  ? 0.3724 0.3618 0.3549 -0.0011 0.0036  -0.0032 30  SER L O   
213  C  CB  . SER A 30  ? 0.3598 0.3561 0.3473 -0.0021 -0.0003 -0.0031 30  SER L CB  
214  O  OG  . SER A 30  ? 0.3948 0.3772 0.3616 -0.0053 0.0020  -0.0057 30  SER L OG  
215  N  N   . SER A 31  ? 0.3579 0.3499 0.3459 0.0019  0.0028  -0.0066 31  SER L N   
216  C  CA  . SER A 31  ? 0.3526 0.3481 0.3365 0.0017  -0.0019 -0.0063 31  SER L CA  
217  C  C   . SER A 31  ? 0.3427 0.3439 0.3298 0.0028  -0.0022 -0.0071 31  SER L C   
218  O  O   . SER A 31  ? 0.3451 0.3460 0.3275 0.0023  -0.0069 -0.0095 31  SER L O   
219  C  CB  . SER A 31  ? 0.3527 0.3543 0.3414 0.0045  -0.0002 -0.0065 31  SER L CB  
220  O  OG  . SER A 31  ? 0.3671 0.3633 0.3351 0.0116  -0.0068 -0.0102 31  SER L OG  
221  N  N   . TYR A 32  ? 0.3387 0.3309 0.3228 0.0034  -0.0041 -0.0081 32  TYR L N   
222  C  CA  . TYR A 32  ? 0.3318 0.3334 0.3193 0.0030  -0.0042 -0.0060 32  TYR L CA  
223  C  C   . TYR A 32  ? 0.3160 0.3171 0.3073 0.0036  -0.0023 -0.0047 32  TYR L C   
224  O  O   . TYR A 32  ? 0.3098 0.3131 0.2979 0.0077  -0.0082 -0.0125 32  TYR L O   
225  C  CB  . TYR A 32  ? 0.3426 0.3428 0.3348 0.0030  -0.0034 -0.0015 32  TYR L CB  
226  C  CG  . TYR A 32  ? 0.3580 0.3537 0.3455 0.0002  -0.0048 -0.0029 32  TYR L CG  
227  C  CD1 . TYR A 32  ? 0.3704 0.3608 0.3545 -0.0037 -0.0060 0.0023  32  TYR L CD1 
228  C  CD2 . TYR A 32  ? 0.3701 0.3597 0.3524 -0.0047 -0.0028 -0.0044 32  TYR L CD2 
229  C  CE1 . TYR A 32  ? 0.3687 0.3654 0.3600 -0.0028 -0.0051 -0.0079 32  TYR L CE1 
230  C  CE2 . TYR A 32  ? 0.3858 0.3825 0.3716 0.0019  -0.0094 -0.0079 32  TYR L CE2 
231  C  CZ  . TYR A 32  ? 0.3755 0.3790 0.3606 -0.0017 -0.0070 -0.0135 32  TYR L CZ  
232  O  OH  . TYR A 32  ? 0.3790 0.3823 0.3653 0.0050  -0.0083 -0.0157 32  TYR L OH  
233  N  N   . LEU A 33  ? 0.2897 0.3012 0.2880 0.0075  -0.0030 -0.0063 33  LEU L N   
234  C  CA  . LEU A 33  ? 0.2793 0.2913 0.2841 0.0088  -0.0005 -0.0027 33  LEU L CA  
235  C  C   . LEU A 33  ? 0.2718 0.2807 0.2745 0.0058  -0.0033 0.0000  33  LEU L C   
236  O  O   . LEU A 33  ? 0.2639 0.2738 0.2743 0.0118  -0.0010 0.0020  33  LEU L O   
237  C  CB  . LEU A 33  ? 0.2732 0.2877 0.2763 0.0047  0.0000  0.0017  33  LEU L CB  
238  C  CG  . LEU A 33  ? 0.2695 0.2816 0.2793 0.0081  0.0020  -0.0028 33  LEU L CG  
239  C  CD1 . LEU A 33  ? 0.2452 0.2620 0.2563 0.0042  -0.0085 0.0014  33  LEU L CD1 
240  C  CD2 . LEU A 33  ? 0.2541 0.2564 0.2533 0.0132  0.0061  -0.0042 33  LEU L CD2 
241  N  N   . ALA A 34  ? 0.2640 0.2729 0.2690 0.0073  -0.0021 0.0000  34  ALA L N   
242  C  CA  . ALA A 34  ? 0.2603 0.2621 0.2589 0.0045  -0.0027 0.0033  34  ALA L CA  
243  C  C   . ALA A 34  ? 0.2551 0.2532 0.2458 0.0045  -0.0032 0.0097  34  ALA L C   
244  O  O   . ALA A 34  ? 0.2627 0.2451 0.2314 0.0057  -0.0019 0.0107  34  ALA L O   
245  C  CB  . ALA A 34  ? 0.2546 0.2633 0.2560 0.0001  -0.0054 0.0113  34  ALA L CB  
246  N  N   . TRP A 35  ? 0.2526 0.2486 0.2361 0.0054  -0.0017 0.0093  35  TRP L N   
247  C  CA  . TRP A 35  ? 0.2479 0.2448 0.2392 0.0042  0.0002  0.0044  35  TRP L CA  
248  C  C   . TRP A 35  ? 0.2429 0.2444 0.2336 0.0020  0.0013  0.0059  35  TRP L C   
249  O  O   . TRP A 35  ? 0.2366 0.2452 0.2275 0.0031  0.0089  0.0073  35  TRP L O   
250  C  CB  . TRP A 35  ? 0.2507 0.2482 0.2370 0.0014  0.0016  0.0038  35  TRP L CB  
251  C  CG  . TRP A 35  ? 0.2475 0.2558 0.2365 0.0033  0.0025  0.0059  35  TRP L CG  
252  C  CD1 . TRP A 35  ? 0.2358 0.2464 0.2371 -0.0046 0.0013  0.0014  35  TRP L CD1 
253  C  CD2 . TRP A 35  ? 0.2405 0.2621 0.2477 0.0009  0.0021  -0.0029 35  TRP L CD2 
254  N  NE1 . TRP A 35  ? 0.2455 0.2224 0.2356 0.0034  0.0120  0.0018  35  TRP L NE1 
255  C  CE2 . TRP A 35  ? 0.2509 0.2531 0.2516 -0.0017 -0.0023 0.0018  35  TRP L CE2 
256  C  CE3 . TRP A 35  ? 0.2366 0.2416 0.2526 -0.0018 0.0027  0.0020  35  TRP L CE3 
257  C  CZ2 . TRP A 35  ? 0.2576 0.2546 0.2573 -0.0031 -0.0028 0.0070  35  TRP L CZ2 
258  C  CZ3 . TRP A 35  ? 0.2377 0.2495 0.2360 -0.0028 0.0087  0.0005  35  TRP L CZ3 
259  C  CH2 . TRP A 35  ? 0.2459 0.2495 0.2433 -0.0037 -0.0008 0.0046  35  TRP L CH2 
260  N  N   . TYR A 36  ? 0.2394 0.2364 0.2375 0.0009  0.0024  0.0055  36  TYR L N   
261  C  CA  . TYR A 36  ? 0.2357 0.2359 0.2318 0.0019  0.0028  0.0089  36  TYR L CA  
262  C  C   . TYR A 36  ? 0.2366 0.2301 0.2300 0.0005  -0.0011 0.0085  36  TYR L C   
263  O  O   . TYR A 36  ? 0.2388 0.2267 0.2223 0.0009  -0.0040 0.0195  36  TYR L O   
264  C  CB  . TYR A 36  ? 0.2282 0.2255 0.2295 0.0003  0.0010  0.0060  36  TYR L CB  
265  C  CG  . TYR A 36  ? 0.2267 0.2217 0.2263 0.0009  0.0084  0.0127  36  TYR L CG  
266  C  CD1 . TYR A 36  ? 0.2227 0.2297 0.2279 -0.0024 0.0061  0.0115  36  TYR L CD1 
267  C  CD2 . TYR A 36  ? 0.2172 0.2033 0.2014 0.0018  0.0116  0.0082  36  TYR L CD2 
268  C  CE1 . TYR A 36  ? 0.2095 0.2424 0.2224 -0.0014 0.0030  -0.0026 36  TYR L CE1 
269  C  CE2 . TYR A 36  ? 0.2422 0.2259 0.2370 0.0111  -0.0012 -0.0050 36  TYR L CE2 
270  C  CZ  . TYR A 36  ? 0.2282 0.2340 0.2293 -0.0019 0.0073  0.0070  36  TYR L CZ  
271  O  OH  . TYR A 36  ? 0.2434 0.2441 0.2337 -0.0014 0.0047  0.0179  36  TYR L OH  
272  N  N   . GLN A 37  ? 0.2404 0.2288 0.2309 0.0011  0.0010  0.0088  37  GLN L N   
273  C  CA  . GLN A 37  ? 0.2437 0.2251 0.2293 0.0000  -0.0024 0.0035  37  GLN L CA  
274  C  C   . GLN A 37  ? 0.2466 0.2296 0.2328 -0.0030 -0.0026 0.0027  37  GLN L C   
275  O  O   . GLN A 37  ? 0.2488 0.2151 0.2321 -0.0029 -0.0041 0.0022  37  GLN L O   
276  C  CB  . GLN A 37  ? 0.2373 0.2227 0.2284 0.0003  -0.0031 0.0020  37  GLN L CB  
277  C  CG  . GLN A 37  ? 0.2407 0.2441 0.2405 -0.0020 -0.0031 0.0051  37  GLN L CG  
278  C  CD  . GLN A 37  ? 0.2409 0.2455 0.2496 -0.0088 -0.0047 0.0013  37  GLN L CD  
279  O  OE1 . GLN A 37  ? 0.2425 0.2519 0.2583 -0.0146 0.0004  -0.0100 37  GLN L OE1 
280  N  NE2 . GLN A 37  ? 0.2465 0.2615 0.2422 -0.0155 -0.0105 0.0072  37  GLN L NE2 
281  N  N   . GLN A 38  ? 0.2454 0.2288 0.2278 -0.0029 -0.0018 -0.0002 38  GLN L N   
282  C  CA  . GLN A 38  ? 0.2461 0.2343 0.2309 -0.0037 -0.0021 -0.0005 38  GLN L CA  
283  C  C   . GLN A 38  ? 0.2449 0.2331 0.2350 -0.0023 -0.0043 -0.0026 38  GLN L C   
284  O  O   . GLN A 38  ? 0.2417 0.2470 0.2413 0.0006  -0.0071 -0.0094 38  GLN L O   
285  C  CB  . GLN A 38  ? 0.2399 0.2318 0.2338 -0.0068 -0.0025 -0.0026 38  GLN L CB  
286  C  CG  . GLN A 38  ? 0.2424 0.2283 0.2174 -0.0065 -0.0042 0.0023  38  GLN L CG  
287  C  CD  . GLN A 38  ? 0.2370 0.2234 0.2286 -0.0077 -0.0033 0.0033  38  GLN L CD  
288  O  OE1 . GLN A 38  ? 0.2293 0.2092 0.2402 -0.0122 0.0017  0.0066  38  GLN L OE1 
289  N  NE2 . GLN A 38  ? 0.2419 0.1859 0.2179 -0.0146 -0.0027 -0.0046 38  GLN L NE2 
290  N  N   . LYS A 39  ? 0.2409 0.2298 0.2345 0.0008  -0.0036 -0.0009 39  LYS L N   
291  C  CA  . LYS A 39  ? 0.2436 0.2397 0.2376 -0.0001 -0.0054 0.0002  39  LYS L CA  
292  C  C   . LYS A 39  ? 0.2494 0.2486 0.2444 -0.0017 -0.0046 -0.0007 39  LYS L C   
293  O  O   . LYS A 39  ? 0.2488 0.2394 0.2395 -0.0106 -0.0106 -0.0085 39  LYS L O   
294  C  CB  . LYS A 39  ? 0.2408 0.2306 0.2268 -0.0024 -0.0034 -0.0010 39  LYS L CB  
295  C  CG  . LYS A 39  ? 0.2399 0.2328 0.2318 -0.0003 -0.0035 0.0066  39  LYS L CG  
296  C  CD  . LYS A 39  ? 0.2372 0.2374 0.2354 0.0014  -0.0055 0.0025  39  LYS L CD  
297  C  CE  . LYS A 39  ? 0.2384 0.2410 0.2594 -0.0041 -0.0015 -0.0107 39  LYS L CE  
298  N  NZ  . LYS A 39  ? 0.2461 0.2266 0.2697 -0.0028 0.0013  -0.0089 39  LYS L NZ  
299  N  N   . PRO A 40  ? 0.2626 0.2632 0.2509 0.0010  -0.0020 -0.0022 40  PRO L N   
300  C  CA  . PRO A 40  ? 0.2745 0.2765 0.2630 -0.0013 -0.0007 0.0001  40  PRO L CA  
301  C  C   . PRO A 40  ? 0.2900 0.2896 0.2771 0.0004  -0.0022 0.0045  40  PRO L C   
302  O  O   . PRO A 40  ? 0.3039 0.2984 0.2850 0.0021  -0.0056 0.0057  40  PRO L O   
303  C  CB  . PRO A 40  ? 0.2754 0.2754 0.2641 -0.0034 -0.0027 0.0008  40  PRO L CB  
304  C  CG  . PRO A 40  ? 0.2691 0.2679 0.2530 -0.0025 -0.0056 0.0001  40  PRO L CG  
305  C  CD  . PRO A 40  ? 0.2714 0.2707 0.2592 0.0039  -0.0024 -0.0012 40  PRO L CD  
306  N  N   . GLY A 41  ? 0.3051 0.2987 0.2926 -0.0001 -0.0012 0.0025  41  GLY L N   
307  C  CA  . GLY A 41  ? 0.3094 0.3070 0.3006 0.0013  -0.0042 0.0032  41  GLY L CA  
308  C  C   . GLY A 41  ? 0.3129 0.3096 0.3013 -0.0006 -0.0007 0.0023  41  GLY L C   
309  O  O   . GLY A 41  ? 0.3126 0.3191 0.3050 -0.0011 -0.0061 0.0022  41  GLY L O   
310  N  N   . GLN A 42  ? 0.3199 0.3141 0.3047 -0.0047 0.0023  0.0035  42  GLN L N   
311  C  CA  . GLN A 42  ? 0.3214 0.3185 0.3084 -0.0038 -0.0010 0.0025  42  GLN L CA  
312  C  C   . GLN A 42  ? 0.3126 0.3105 0.3050 -0.0036 -0.0001 0.0018  42  GLN L C   
313  O  O   . GLN A 42  ? 0.3202 0.3095 0.3052 -0.0001 0.0000  0.0054  42  GLN L O   
314  C  CB  . GLN A 42  ? 0.3272 0.3290 0.3207 -0.0038 0.0001  0.0010  42  GLN L CB  
315  C  CG  . GLN A 42  ? 0.3469 0.3554 0.3343 0.0009  0.0036  -0.0031 42  GLN L CG  
316  C  CD  . GLN A 42  ? 0.3842 0.3747 0.3728 -0.0033 0.0008  0.0009  42  GLN L CD  
317  O  OE1 . GLN A 42  ? 0.3802 0.3962 0.4048 0.0084  0.0040  -0.0121 42  GLN L OE1 
318  N  NE2 . GLN A 42  ? 0.3994 0.3882 0.3665 0.0028  -0.0040 -0.0023 42  GLN L NE2 
319  N  N   . ALA A 43  ? 0.3086 0.2999 0.2973 -0.0036 0.0021  -0.0009 43  ALA L N   
320  C  CA  . ALA A 43  ? 0.2975 0.2932 0.2913 -0.0032 -0.0007 -0.0010 43  ALA L CA  
321  C  C   . ALA A 43  ? 0.2920 0.2935 0.2831 -0.0006 0.0006  -0.0015 43  ALA L C   
322  O  O   . ALA A 43  ? 0.2949 0.2957 0.2855 0.0006  -0.0063 0.0010  43  ALA L O   
323  C  CB  . ALA A 43  ? 0.3019 0.2917 0.2893 -0.0006 0.0001  -0.0017 43  ALA L CB  
324  N  N   . PRO A 44  ? 0.2857 0.2880 0.2742 -0.0004 0.0014  -0.0036 44  PRO L N   
325  C  CA  . PRO A 44  ? 0.2824 0.2825 0.2675 -0.0022 0.0053  -0.0036 44  PRO L CA  
326  C  C   . PRO A 44  ? 0.2757 0.2837 0.2636 0.0011  0.0079  -0.0043 44  PRO L C   
327  O  O   . PRO A 44  ? 0.2871 0.2817 0.2527 -0.0005 0.0169  -0.0050 44  PRO L O   
328  C  CB  . PRO A 44  ? 0.2804 0.2812 0.2639 -0.0023 0.0031  -0.0073 44  PRO L CB  
329  C  CG  . PRO A 44  ? 0.2743 0.2834 0.2575 -0.0051 0.0017  -0.0024 44  PRO L CG  
330  C  CD  . PRO A 44  ? 0.2820 0.2822 0.2663 -0.0054 0.0002  -0.0073 44  PRO L CD  
331  N  N   . ARG A 45  ? 0.2747 0.2779 0.2716 0.0016  0.0088  -0.0086 45  ARG L N   
332  C  CA  . ARG A 45  ? 0.2835 0.2910 0.2822 0.0010  0.0051  -0.0076 45  ARG L CA  
333  C  C   . ARG A 45  ? 0.2693 0.2774 0.2702 -0.0020 0.0052  -0.0057 45  ARG L C   
334  O  O   . ARG A 45  ? 0.2671 0.2585 0.2568 -0.0004 0.0077  -0.0041 45  ARG L O   
335  C  CB  . ARG A 45  ? 0.2906 0.2963 0.2835 -0.0006 0.0062  -0.0085 45  ARG L CB  
336  C  CG  . ARG A 45  ? 0.2950 0.3061 0.3106 -0.0066 0.0051  -0.0048 45  ARG L CG  
337  C  CD  . ARG A 45  ? 0.3149 0.3355 0.3103 -0.0008 0.0053  -0.0001 45  ARG L CD  
338  N  NE  . ARG A 45  ? 0.4001 0.4018 0.3898 0.0094  -0.0105 0.0145  45  ARG L NE  
339  C  CZ  . ARG A 45  ? 0.3566 0.3885 0.3622 -0.0079 -0.0108 0.0143  45  ARG L CZ  
340  N  NH1 . ARG A 45  ? 0.4002 0.4209 0.4032 0.0073  -0.0085 -0.0094 45  ARG L NH1 
341  N  NH2 . ARG A 45  ? 0.4187 0.4192 0.4032 -0.0033 0.0077  0.0024  45  ARG L NH2 
342  N  N   . LEU A 46  ? 0.2589 0.2694 0.2652 -0.0026 0.0036  -0.0067 46  LEU L N   
343  C  CA  . LEU A 46  ? 0.2601 0.2655 0.2618 0.0018  0.0011  -0.0033 46  LEU L CA  
344  C  C   . LEU A 46  ? 0.2618 0.2638 0.2620 0.0037  0.0015  -0.0020 46  LEU L C   
345  O  O   . LEU A 46  ? 0.2640 0.2623 0.2659 0.0037  -0.0024 0.0012  46  LEU L O   
346  C  CB  . LEU A 46  ? 0.2598 0.2676 0.2630 0.0022  0.0010  -0.0033 46  LEU L CB  
347  C  CG  . LEU A 46  ? 0.2651 0.2663 0.2552 0.0047  0.0006  -0.0029 46  LEU L CG  
348  C  CD1 . LEU A 46  ? 0.2582 0.2680 0.2485 0.0005  0.0036  -0.0044 46  LEU L CD1 
349  C  CD2 . LEU A 46  ? 0.2656 0.2648 0.2617 0.0041  -0.0030 -0.0047 46  LEU L CD2 
350  N  N   . LEU A 47  ? 0.2620 0.2669 0.2583 0.0010  -0.0027 0.0009  47  LEU L N   
351  C  CA  . LEU A 47  ? 0.2610 0.2593 0.2571 0.0027  -0.0013 -0.0014 47  LEU L CA  
352  C  C   . LEU A 47  ? 0.2668 0.2648 0.2583 0.0031  -0.0042 -0.0011 47  LEU L C   
353  O  O   . LEU A 47  ? 0.2632 0.2590 0.2627 0.0039  -0.0099 -0.0018 47  LEU L O   
354  C  CB  . LEU A 47  ? 0.2518 0.2540 0.2483 0.0016  0.0006  -0.0006 47  LEU L CB  
355  C  CG  . LEU A 47  ? 0.2461 0.2426 0.2485 -0.0063 -0.0045 -0.0040 47  LEU L CG  
356  C  CD1 . LEU A 47  ? 0.2634 0.2395 0.2497 -0.0108 0.0030  0.0130  47  LEU L CD1 
357  C  CD2 . LEU A 47  ? 0.2377 0.2077 0.2013 -0.0061 -0.0037 -0.0176 47  LEU L CD2 
358  N  N   . ILE A 48  ? 0.2663 0.2690 0.2556 0.0042  -0.0029 0.0003  48  ILE L N   
359  C  CA  . ILE A 48  ? 0.2761 0.2682 0.2618 0.0071  -0.0012 -0.0039 48  ILE L CA  
360  C  C   . ILE A 48  ? 0.2827 0.2762 0.2704 0.0043  0.0008  -0.0027 48  ILE L C   
361  O  O   . ILE A 48  ? 0.2793 0.2697 0.2610 0.0037  0.0011  -0.0092 48  ILE L O   
362  C  CB  . ILE A 48  ? 0.2823 0.2714 0.2583 0.0072  -0.0007 -0.0051 48  ILE L CB  
363  C  CG1 . ILE A 48  ? 0.2646 0.2484 0.2576 0.0035  0.0043  -0.0061 48  ILE L CG1 
364  C  CG2 . ILE A 48  ? 0.2803 0.2646 0.2670 0.0134  0.0013  -0.0075 48  ILE L CG2 
365  C  CD1 . ILE A 48  ? 0.2417 0.2483 0.2404 0.0038  -0.0044 -0.0017 48  ILE L CD1 
366  N  N   . TYR A 49  ? 0.2966 0.2892 0.2797 0.0012  -0.0004 -0.0042 49  TYR L N   
367  C  CA  . TYR A 49  ? 0.3001 0.3017 0.2941 0.0008  0.0019  -0.0035 49  TYR L CA  
368  C  C   . TYR A 49  ? 0.3018 0.3067 0.2991 0.0037  -0.0003 -0.0030 49  TYR L C   
369  O  O   . TYR A 49  ? 0.2881 0.2974 0.2852 0.0088  0.0004  -0.0026 49  TYR L O   
370  C  CB  . TYR A 49  ? 0.3037 0.3072 0.2985 -0.0010 0.0002  -0.0011 49  TYR L CB  
371  C  CG  . TYR A 49  ? 0.3117 0.3153 0.3114 -0.0064 0.0022  -0.0032 49  TYR L CG  
372  C  CD1 . TYR A 49  ? 0.3001 0.3053 0.3081 0.0009  0.0049  -0.0075 49  TYR L CD1 
373  C  CD2 . TYR A 49  ? 0.3116 0.3256 0.3130 -0.0012 0.0032  -0.0127 49  TYR L CD2 
374  C  CE1 . TYR A 49  ? 0.3138 0.3248 0.3200 0.0045  0.0024  -0.0138 49  TYR L CE1 
375  C  CE2 . TYR A 49  ? 0.3053 0.3364 0.3144 -0.0035 0.0105  -0.0065 49  TYR L CE2 
376  C  CZ  . TYR A 49  ? 0.3098 0.3291 0.3229 -0.0079 0.0001  -0.0071 49  TYR L CZ  
377  O  OH  . TYR A 49  ? 0.3158 0.3273 0.3386 -0.0112 0.0027  -0.0014 49  TYR L OH  
378  N  N   . ASP A 50  ? 0.3138 0.3206 0.3148 0.0046  0.0000  -0.0040 50  ASP L N   
379  C  CA  . ASP A 50  ? 0.3271 0.3348 0.3290 0.0027  0.0034  -0.0052 50  ASP L CA  
380  C  C   . ASP A 50  ? 0.3303 0.3342 0.3388 0.0026  0.0055  -0.0057 50  ASP L C   
381  O  O   . ASP A 50  ? 0.3229 0.3284 0.3447 -0.0064 0.0105  -0.0088 50  ASP L O   
382  C  CB  . ASP A 50  ? 0.3336 0.3429 0.3378 0.0005  0.0025  -0.0065 50  ASP L CB  
383  C  CG  . ASP A 50  ? 0.3570 0.3574 0.3570 0.0016  0.0038  -0.0086 50  ASP L CG  
384  O  OD1 . ASP A 50  ? 0.3539 0.3575 0.3493 -0.0077 -0.0077 -0.0089 50  ASP L OD1 
385  O  OD2 . ASP A 50  ? 0.4015 0.3865 0.4024 -0.0109 -0.0050 0.0051  50  ASP L OD2 
386  N  N   . ALA A 51  ? 0.3296 0.3369 0.3328 0.0023  0.0033  -0.0060 51  ALA L N   
387  C  CA  . ALA A 51  ? 0.3419 0.3391 0.3347 0.0043  0.0053  -0.0045 51  ALA L CA  
388  C  C   . ALA A 51  ? 0.3406 0.3378 0.3372 0.0035  0.0035  -0.0054 51  ALA L C   
389  O  O   . ALA A 51  ? 0.3434 0.3398 0.3313 0.0078  0.0071  -0.0027 51  ALA L O   
390  C  CB  . ALA A 51  ? 0.3405 0.3450 0.3348 0.0068  0.0043  -0.0066 51  ALA L CB  
391  N  N   . SER A 52  ? 0.3439 0.3387 0.3388 0.0032  0.0026  -0.0055 52  SER L N   
392  C  CA  . SER A 52  ? 0.3451 0.3395 0.3408 0.0022  0.0042  -0.0080 52  SER L CA  
393  C  C   . SER A 52  ? 0.3454 0.3408 0.3376 0.0013  -0.0012 -0.0096 52  SER L C   
394  O  O   . SER A 52  ? 0.3434 0.3365 0.3429 -0.0061 -0.0046 -0.0144 52  SER L O   
395  C  CB  . SER A 52  ? 0.3424 0.3341 0.3392 0.0011  0.0036  -0.0073 52  SER L CB  
396  O  OG  . SER A 52  ? 0.3491 0.3260 0.3455 0.0121  0.0010  -0.0020 52  SER L OG  
397  N  N   . ASN A 53  ? 0.3489 0.3433 0.3408 0.0023  -0.0006 -0.0094 53  ASN L N   
398  C  CA  . ASN A 53  ? 0.3542 0.3528 0.3495 0.0051  -0.0017 -0.0059 53  ASN L CA  
399  C  C   . ASN A 53  ? 0.3461 0.3486 0.3454 0.0059  -0.0019 -0.0033 53  ASN L C   
400  O  O   . ASN A 53  ? 0.3438 0.3490 0.3457 0.0123  -0.0052 -0.0055 53  ASN L O   
401  C  CB  . ASN A 53  ? 0.3576 0.3550 0.3528 0.0028  -0.0019 -0.0030 53  ASN L CB  
402  C  CG  . ASN A 53  ? 0.3881 0.3781 0.3792 0.0010  0.0001  -0.0066 53  ASN L CG  
403  O  OD1 . ASN A 53  ? 0.4170 0.4139 0.4292 -0.0110 0.0031  -0.0058 53  ASN L OD1 
404  N  ND2 . ASN A 53  ? 0.4214 0.4009 0.4021 -0.0028 0.0075  -0.0020 53  ASN L ND2 
405  N  N   . ARG A 54  ? 0.3500 0.3522 0.3493 0.0070  -0.0009 -0.0040 54  ARG L N   
406  C  CA  . ARG A 54  ? 0.3518 0.3556 0.3481 0.0020  0.0012  -0.0045 54  ARG L CA  
407  C  C   . ARG A 54  ? 0.3411 0.3493 0.3406 0.0022  0.0031  -0.0037 54  ARG L C   
408  O  O   . ARG A 54  ? 0.3316 0.3515 0.3300 -0.0009 0.0064  -0.0061 54  ARG L O   
409  C  CB  . ARG A 54  ? 0.3519 0.3559 0.3492 -0.0022 0.0031  -0.0036 54  ARG L CB  
410  C  CG  . ARG A 54  ? 0.3729 0.3761 0.3681 0.0038  0.0021  -0.0042 54  ARG L CG  
411  C  CD  . ARG A 54  ? 0.3963 0.3880 0.3785 -0.0012 0.0130  0.0028  54  ARG L CD  
412  N  NE  . ARG A 54  ? 0.4178 0.4171 0.3912 -0.0071 0.0073  -0.0024 54  ARG L NE  
413  C  CZ  . ARG A 54  ? 0.4421 0.4481 0.4255 -0.0036 0.0026  0.0001  54  ARG L CZ  
414  N  NH1 . ARG A 54  ? 0.4562 0.4529 0.4423 0.0125  0.0056  0.0091  54  ARG L NH1 
415  N  NH2 . ARG A 54  ? 0.4678 0.4429 0.4415 -0.0039 0.0025  -0.0038 54  ARG L NH2 
416  N  N   . ALA A 55  ? 0.3405 0.3442 0.3390 0.0024  0.0039  -0.0032 55  ALA L N   
417  C  CA  . ALA A 55  ? 0.3441 0.3463 0.3410 0.0027  0.0022  -0.0017 55  ALA L CA  
418  C  C   . ALA A 55  ? 0.3446 0.3448 0.3455 -0.0005 -0.0002 -0.0013 55  ALA L C   
419  O  O   . ALA A 55  ? 0.3447 0.3355 0.3382 0.0035  -0.0046 -0.0066 55  ALA L O   
420  C  CB  . ALA A 55  ? 0.3369 0.3402 0.3391 -0.0001 0.0018  -0.0021 55  ALA L CB  
421  N  N   . THR A 56  ? 0.3513 0.3484 0.3487 0.0008  0.0004  -0.0004 56  THR L N   
422  C  CA  . THR A 56  ? 0.3564 0.3554 0.3554 0.0045  -0.0005 -0.0004 56  THR L CA  
423  C  C   . THR A 56  ? 0.3542 0.3558 0.3548 0.0056  0.0005  -0.0017 56  THR L C   
424  O  O   . THR A 56  ? 0.3598 0.3615 0.3606 0.0130  0.0001  -0.0051 56  THR L O   
425  C  CB  . THR A 56  ? 0.3587 0.3615 0.3562 0.0022  -0.0007 -0.0005 56  THR L CB  
426  O  OG1 . THR A 56  ? 0.3812 0.3804 0.3720 0.0008  0.0021  0.0042  56  THR L OG1 
427  C  CG2 . THR A 56  ? 0.3599 0.3625 0.3592 0.0049  -0.0018 0.0034  56  THR L CG2 
428  N  N   . GLY A 57  ? 0.3547 0.3537 0.3520 0.0082  0.0011  -0.0015 57  GLY L N   
429  C  CA  . GLY A 57  ? 0.3512 0.3521 0.3485 0.0063  -0.0001 -0.0023 57  GLY L CA  
430  C  C   . GLY A 57  ? 0.3435 0.3504 0.3431 0.0059  0.0008  -0.0033 57  GLY L C   
431  O  O   . GLY A 57  ? 0.3430 0.3519 0.3439 0.0086  0.0034  -0.0032 57  GLY L O   
432  N  N   . ILE A 58  ? 0.3394 0.3478 0.3407 0.0027  0.0002  -0.0044 58  ILE L N   
433  C  CA  . ILE A 58  ? 0.3296 0.3394 0.3343 0.0027  0.0000  -0.0025 58  ILE L CA  
434  C  C   . ILE A 58  ? 0.3297 0.3398 0.3364 0.0012  0.0015  -0.0049 58  ILE L C   
435  O  O   . ILE A 58  ? 0.3358 0.3507 0.3449 0.0024  0.0001  -0.0065 58  ILE L O   
436  C  CB  . ILE A 58  ? 0.3250 0.3346 0.3252 0.0022  0.0022  -0.0033 58  ILE L CB  
437  C  CG1 . ILE A 58  ? 0.3154 0.3244 0.3196 0.0060  -0.0039 -0.0063 58  ILE L CG1 
438  C  CG2 . ILE A 58  ? 0.3106 0.3261 0.3217 0.0045  0.0064  0.0008  58  ILE L CG2 
439  C  CD1 . ILE A 58  ? 0.3058 0.3050 0.2966 0.0063  -0.0092 0.0019  58  ILE L CD1 
440  N  N   . PRO A 59  ? 0.3268 0.3379 0.3356 0.0013  0.0003  -0.0042 59  PRO L N   
441  C  CA  . PRO A 59  ? 0.3225 0.3314 0.3313 -0.0001 0.0021  -0.0036 59  PRO L CA  
442  C  C   . PRO A 59  ? 0.3222 0.3314 0.3295 -0.0020 0.0031  -0.0049 59  PRO L C   
443  O  O   . PRO A 59  ? 0.3305 0.3380 0.3405 0.0062  0.0033  -0.0097 59  PRO L O   
444  C  CB  . PRO A 59  ? 0.3215 0.3314 0.3327 -0.0014 0.0023  -0.0028 59  PRO L CB  
445  C  CG  . PRO A 59  ? 0.3270 0.3301 0.3328 -0.0016 0.0016  -0.0044 59  PRO L CG  
446  C  CD  . PRO A 59  ? 0.3250 0.3362 0.3331 -0.0025 -0.0013 -0.0058 59  PRO L CD  
447  N  N   . ALA A 60  ? 0.3193 0.3284 0.3219 -0.0005 0.0045  -0.0038 60  ALA L N   
448  C  CA  . ALA A 60  ? 0.3169 0.3218 0.3242 -0.0030 -0.0007 0.0013  60  ALA L CA  
449  C  C   . ALA A 60  ? 0.3144 0.3172 0.3208 -0.0042 0.0000  -0.0009 60  ALA L C   
450  O  O   . ALA A 60  ? 0.3213 0.3131 0.3291 -0.0035 -0.0019 -0.0010 60  ALA L O   
451  C  CB  . ALA A 60  ? 0.3150 0.3233 0.3298 -0.0082 -0.0034 0.0016  60  ALA L CB  
452  N  N   . ARG A 61  ? 0.3099 0.3096 0.3152 -0.0029 -0.0002 -0.0002 61  ARG L N   
453  C  CA  . ARG A 61  ? 0.3079 0.2975 0.3028 -0.0015 0.0017  0.0002  61  ARG L CA  
454  C  C   . ARG A 61  ? 0.3055 0.2976 0.3002 0.0010  0.0029  -0.0024 61  ARG L C   
455  O  O   . ARG A 61  ? 0.3079 0.2916 0.2869 0.0019  -0.0010 -0.0007 61  ARG L O   
456  C  CB  . ARG A 61  ? 0.2994 0.2966 0.2977 -0.0037 0.0021  0.0015  61  ARG L CB  
457  C  CG  . ARG A 61  ? 0.2896 0.2942 0.2890 0.0011  0.0034  0.0028  61  ARG L CG  
458  C  CD  . ARG A 61  ? 0.3059 0.2925 0.2981 0.0013  0.0028  0.0034  61  ARG L CD  
459  N  NE  . ARG A 61  ? 0.3028 0.3018 0.2901 0.0062  0.0047  0.0050  61  ARG L NE  
460  C  CZ  . ARG A 61  ? 0.2937 0.3033 0.2767 0.0016  0.0023  0.0028  61  ARG L CZ  
461  N  NH1 . ARG A 61  ? 0.2897 0.3089 0.2660 0.0053  -0.0083 0.0004  61  ARG L NH1 
462  N  NH2 . ARG A 61  ? 0.2924 0.2898 0.2477 0.0149  -0.0071 -0.0016 61  ARG L NH2 
463  N  N   . PHE A 62  ? 0.3111 0.2985 0.3034 0.0022  0.0028  -0.0007 62  PHE L N   
464  C  CA  . PHE A 62  ? 0.3171 0.3058 0.3112 -0.0003 0.0022  0.0006  62  PHE L CA  
465  C  C   . PHE A 62  ? 0.3270 0.3203 0.3181 -0.0010 0.0022  0.0028  62  PHE L C   
466  O  O   . PHE A 62  ? 0.3281 0.3251 0.3272 -0.0034 0.0002  -0.0002 62  PHE L O   
467  C  CB  . PHE A 62  ? 0.3141 0.3040 0.3038 -0.0027 0.0050  -0.0019 62  PHE L CB  
468  C  CG  . PHE A 62  ? 0.3060 0.2928 0.3080 -0.0025 0.0021  -0.0015 62  PHE L CG  
469  C  CD1 . PHE A 62  ? 0.2989 0.2879 0.2972 0.0016  -0.0036 -0.0006 62  PHE L CD1 
470  C  CD2 . PHE A 62  ? 0.3022 0.2840 0.3010 -0.0017 0.0003  -0.0012 62  PHE L CD2 
471  C  CE1 . PHE A 62  ? 0.2921 0.2805 0.3024 0.0038  -0.0056 0.0030  62  PHE L CE1 
472  C  CE2 . PHE A 62  ? 0.2985 0.2707 0.2943 0.0028  0.0059  0.0000  62  PHE L CE2 
473  C  CZ  . PHE A 62  ? 0.2920 0.2792 0.2926 0.0022  0.0045  0.0051  62  PHE L CZ  
474  N  N   . SER A 63  ? 0.3398 0.3322 0.3304 0.0002  0.0004  0.0049  63  SER L N   
475  C  CA  . SER A 63  ? 0.3498 0.3416 0.3383 0.0001  -0.0020 0.0036  63  SER L CA  
476  C  C   . SER A 63  ? 0.3492 0.3479 0.3395 0.0000  -0.0030 0.0036  63  SER L C   
477  O  O   . SER A 63  ? 0.3587 0.3585 0.3448 0.0000  -0.0045 0.0052  63  SER L O   
478  C  CB  . SER A 63  ? 0.3526 0.3408 0.3422 0.0002  -0.0060 0.0044  63  SER L CB  
479  O  OG  . SER A 63  ? 0.3766 0.3479 0.3521 0.0000  -0.0093 0.0044  63  SER L OG  
480  N  N   . GLY A 64  ? 0.3487 0.3510 0.3440 -0.0001 0.0006  0.0022  64  GLY L N   
481  C  CA  . GLY A 64  ? 0.3396 0.3429 0.3411 0.0018  0.0001  0.0017  64  GLY L CA  
482  C  C   . GLY A 64  ? 0.3385 0.3356 0.3394 0.0008  0.0005  0.0031  64  GLY L C   
483  O  O   . GLY A 64  ? 0.3291 0.3266 0.3298 0.0011  0.0012  0.0050  64  GLY L O   
484  N  N   . SER A 65  ? 0.3395 0.3362 0.3437 0.0007  0.0034  0.0019  65  SER L N   
485  C  CA  . SER A 65  ? 0.3434 0.3449 0.3467 0.0000  0.0051  -0.0003 65  SER L CA  
486  C  C   . SER A 65  ? 0.3448 0.3425 0.3467 -0.0017 0.0066  -0.0007 65  SER L C   
487  O  O   . SER A 65  ? 0.3405 0.3370 0.3398 -0.0011 0.0144  0.0017  65  SER L O   
488  C  CB  . SER A 65  ? 0.3415 0.3468 0.3462 0.0028  0.0031  0.0005  65  SER L CB  
489  O  OG  . SER A 65  ? 0.3530 0.3729 0.3631 0.0030  0.0060  0.0026  65  SER L OG  
490  N  N   . GLY A 66  ? 0.3498 0.3409 0.3492 -0.0028 0.0055  -0.0012 66  GLY L N   
491  C  CA  . GLY A 66  ? 0.3549 0.3432 0.3543 -0.0019 0.0028  -0.0031 66  GLY L CA  
492  C  C   . GLY A 66  ? 0.3620 0.3504 0.3618 -0.0027 0.0021  -0.0045 66  GLY L C   
493  O  O   . GLY A 66  ? 0.3678 0.3540 0.3632 -0.0013 0.0022  -0.0041 66  GLY L O   
494  N  N   . SER A 67  ? 0.3618 0.3539 0.3653 -0.0011 0.0015  -0.0054 67  SER L N   
495  C  CA  . SER A 67  ? 0.3682 0.3668 0.3686 -0.0075 0.0003  -0.0052 67  SER L CA  
496  C  C   . SER A 67  ? 0.3648 0.3639 0.3658 -0.0079 0.0002  -0.0026 67  SER L C   
497  O  O   . SER A 67  ? 0.3602 0.3609 0.3671 -0.0086 -0.0009 0.0020  67  SER L O   
498  C  CB  . SER A 67  ? 0.3757 0.3723 0.3703 -0.0092 -0.0001 -0.0073 67  SER L CB  
499  O  OG  . SER A 67  ? 0.3866 0.4007 0.3914 -0.0176 -0.0024 -0.0149 67  SER L OG  
500  N  N   . GLY A 68  ? 0.3617 0.3652 0.3588 -0.0087 0.0014  -0.0044 68  GLY L N   
501  C  CA  . GLY A 68  ? 0.3519 0.3595 0.3574 -0.0042 0.0029  0.0000  68  GLY L CA  
502  C  C   . GLY A 68  ? 0.3479 0.3572 0.3582 -0.0022 0.0038  -0.0009 68  GLY L C   
503  O  O   . GLY A 68  ? 0.3418 0.3624 0.3653 -0.0027 0.0075  0.0000  68  GLY L O   
504  N  N   . THR A 69  ? 0.3504 0.3509 0.3538 0.0000  0.0028  0.0005  69  THR L N   
505  C  CA  . THR A 69  ? 0.3515 0.3532 0.3564 0.0012  0.0007  0.0000  69  THR L CA  
506  C  C   . THR A 69  ? 0.3587 0.3587 0.3639 0.0052  -0.0025 -0.0021 69  THR L C   
507  O  O   . THR A 69  ? 0.3609 0.3564 0.3658 0.0079  -0.0041 -0.0076 69  THR L O   
508  C  CB  . THR A 69  ? 0.3531 0.3483 0.3508 0.0054  -0.0005 0.0005  69  THR L CB  
509  O  OG1 . THR A 69  ? 0.3461 0.3412 0.3491 -0.0035 0.0022  -0.0083 69  THR L OG1 
510  C  CG2 . THR A 69  ? 0.3346 0.3332 0.3439 0.0098  -0.0035 0.0048  69  THR L CG2 
511  N  N   . ASP A 70  ? 0.3563 0.3646 0.3687 0.0021  -0.0016 -0.0004 70  ASP L N   
512  C  CA  . ASP A 70  ? 0.3691 0.3746 0.3756 0.0030  -0.0011 -0.0014 70  ASP L CA  
513  C  C   . ASP A 70  ? 0.3640 0.3638 0.3667 0.0041  -0.0021 -0.0026 70  ASP L C   
514  O  O   . ASP A 70  ? 0.3613 0.3620 0.3775 -0.0033 -0.0024 -0.0014 70  ASP L O   
515  C  CB  . ASP A 70  ? 0.3858 0.3854 0.3903 0.0056  -0.0026 -0.0023 70  ASP L CB  
516  C  CG  . ASP A 70  ? 0.4275 0.4276 0.4199 -0.0018 0.0005  0.0035  70  ASP L CG  
517  O  OD1 . ASP A 70  ? 0.4820 0.4735 0.4717 -0.0049 -0.0081 -0.0067 70  ASP L OD1 
518  O  OD2 . ASP A 70  ? 0.4664 0.4430 0.4633 -0.0192 -0.0094 0.0019  70  ASP L OD2 
519  N  N   . PHE A 71  ? 0.3461 0.3517 0.3515 0.0062  -0.0009 0.0000  71  PHE L N   
520  C  CA  . PHE A 71  ? 0.3288 0.3327 0.3326 0.0052  -0.0014 -0.0001 71  PHE L CA  
521  C  C   . PHE A 71  ? 0.3203 0.3211 0.3312 0.0060  -0.0016 -0.0016 71  PHE L C   
522  O  O   . PHE A 71  ? 0.3224 0.3239 0.3311 0.0137  -0.0057 -0.0018 71  PHE L O   
523  C  CB  . PHE A 71  ? 0.3211 0.3260 0.3265 0.0049  0.0000  -0.0035 71  PHE L CB  
524  C  CG  . PHE A 71  ? 0.3079 0.3238 0.3132 0.0040  -0.0028 0.0041  71  PHE L CG  
525  C  CD1 . PHE A 71  ? 0.3028 0.3116 0.3047 0.0042  -0.0108 0.0024  71  PHE L CD1 
526  C  CD2 . PHE A 71  ? 0.2931 0.2968 0.3080 0.0042  -0.0007 -0.0028 71  PHE L CD2 
527  C  CE1 . PHE A 71  ? 0.2700 0.3006 0.3019 0.0181  0.0046  -0.0037 71  PHE L CE1 
528  C  CE2 . PHE A 71  ? 0.2987 0.2892 0.3138 0.0029  0.0010  -0.0055 71  PHE L CE2 
529  C  CZ  . PHE A 71  ? 0.2929 0.2920 0.3162 0.0075  0.0045  -0.0088 71  PHE L CZ  
530  N  N   . THR A 72  ? 0.3206 0.3069 0.3233 0.0025  0.0030  0.0002  72  THR L N   
531  C  CA  . THR A 72  ? 0.3078 0.2980 0.3073 0.0023  0.0011  -0.0017 72  THR L CA  
532  C  C   . THR A 72  ? 0.2997 0.2964 0.3015 -0.0010 0.0043  0.0010  72  THR L C   
533  O  O   . THR A 72  ? 0.2952 0.3019 0.2941 -0.0010 0.0050  0.0028  72  THR L O   
534  C  CB  . THR A 72  ? 0.3070 0.2953 0.3060 0.0029  0.0014  -0.0017 72  THR L CB  
535  O  OG1 . THR A 72  ? 0.3021 0.2899 0.3141 0.0120  -0.0037 -0.0066 72  THR L OG1 
536  C  CG2 . THR A 72  ? 0.2984 0.2850 0.3052 0.0005  0.0003  -0.0040 72  THR L CG2 
537  N  N   . LEU A 73  ? 0.2950 0.2886 0.3014 -0.0035 0.0039  0.0023  73  LEU L N   
538  C  CA  . LEU A 73  ? 0.2873 0.2859 0.3007 0.0001  0.0034  0.0013  73  LEU L CA  
539  C  C   . LEU A 73  ? 0.2917 0.2970 0.3059 0.0019  0.0040  -0.0021 73  LEU L C   
540  O  O   . LEU A 73  ? 0.2873 0.2936 0.3031 0.0024  0.0086  -0.0043 73  LEU L O   
541  C  CB  . LEU A 73  ? 0.2790 0.2847 0.2982 -0.0020 0.0015  0.0004  73  LEU L CB  
542  C  CG  . LEU A 73  ? 0.2910 0.2896 0.3034 -0.0011 0.0026  -0.0023 73  LEU L CG  
543  C  CD1 . LEU A 73  ? 0.2563 0.2775 0.2875 -0.0029 -0.0009 0.0048  73  LEU L CD1 
544  C  CD2 . LEU A 73  ? 0.2821 0.2724 0.2981 -0.0033 0.0027  0.0042  73  LEU L CD2 
545  N  N   . THR A 74  ? 0.2969 0.2960 0.3124 -0.0008 0.0018  -0.0016 74  THR L N   
546  C  CA  . THR A 74  ? 0.3132 0.3071 0.3175 -0.0006 0.0006  -0.0018 74  THR L CA  
547  C  C   . THR A 74  ? 0.3156 0.3092 0.3179 -0.0003 0.0024  -0.0013 74  THR L C   
548  O  O   . THR A 74  ? 0.3118 0.3080 0.3137 -0.0060 0.0070  -0.0025 74  THR L O   
549  C  CB  . THR A 74  ? 0.3164 0.3065 0.3233 0.0005  0.0020  -0.0024 74  THR L CB  
550  O  OG1 . THR A 74  ? 0.3324 0.3216 0.3410 0.0008  -0.0010 -0.0098 74  THR L OG1 
551  C  CG2 . THR A 74  ? 0.3193 0.3077 0.3104 0.0066  0.0000  -0.0050 74  THR L CG2 
552  N  N   . ILE A 75  ? 0.3271 0.3178 0.3315 -0.0014 -0.0009 -0.0023 75  ILE L N   
553  C  CA  . ILE A 75  ? 0.3334 0.3271 0.3377 0.0029  0.0006  -0.0051 75  ILE L CA  
554  C  C   . ILE A 75  ? 0.3366 0.3273 0.3394 0.0035  0.0007  -0.0052 75  ILE L C   
555  O  O   . ILE A 75  ? 0.3375 0.3221 0.3464 0.0018  -0.0007 -0.0086 75  ILE L O   
556  C  CB  . ILE A 75  ? 0.3367 0.3313 0.3409 -0.0004 0.0009  -0.0037 75  ILE L CB  
557  C  CG1 . ILE A 75  ? 0.3484 0.3380 0.3453 0.0017  0.0070  -0.0043 75  ILE L CG1 
558  C  CG2 . ILE A 75  ? 0.3306 0.3249 0.3407 0.0109  -0.0010 -0.0030 75  ILE L CG2 
559  C  CD1 . ILE A 75  ? 0.3390 0.3342 0.3421 -0.0016 -0.0064 -0.0074 75  ILE L CD1 
560  N  N   . SER A 76  ? 0.3392 0.3383 0.3432 0.0045  0.0018  -0.0043 76  SER L N   
561  C  CA  . SER A 76  ? 0.3456 0.3522 0.3496 0.0004  0.0019  -0.0023 76  SER L CA  
562  C  C   . SER A 76  ? 0.3451 0.3505 0.3498 0.0002  0.0013  -0.0044 76  SER L C   
563  O  O   . SER A 76  ? 0.3381 0.3501 0.3514 0.0036  -0.0016 -0.0065 76  SER L O   
564  C  CB  . SER A 76  ? 0.3510 0.3528 0.3465 0.0003  0.0009  -0.0042 76  SER L CB  
565  O  OG  . SER A 76  ? 0.3678 0.3928 0.3757 0.0072  0.0017  0.0008  76  SER L OG  
566  N  N   . SER A 77  ? 0.3411 0.3486 0.3501 0.0011  0.0013  -0.0042 77  SER L N   
567  C  CA  . SER A 77  ? 0.3437 0.3475 0.3448 0.0007  0.0042  -0.0020 77  SER L CA  
568  C  C   . SER A 77  ? 0.3390 0.3431 0.3381 0.0000  0.0033  -0.0024 77  SER L C   
569  O  O   . SER A 77  ? 0.3469 0.3390 0.3356 -0.0008 0.0038  -0.0038 77  SER L O   
570  C  CB  . SER A 77  ? 0.3505 0.3524 0.3471 0.0015  0.0055  -0.0001 77  SER L CB  
571  O  OG  . SER A 77  ? 0.3786 0.3858 0.3845 -0.0028 0.0140  0.0007  77  SER L OG  
572  N  N   . LEU A 78  ? 0.3352 0.3340 0.3293 0.0017  0.0037  -0.0034 78  LEU L N   
573  C  CA  . LEU A 78  ? 0.3315 0.3285 0.3250 0.0008  0.0052  -0.0005 78  LEU L CA  
574  C  C   . LEU A 78  ? 0.3282 0.3225 0.3252 -0.0007 0.0035  -0.0001 78  LEU L C   
575  O  O   . LEU A 78  ? 0.3163 0.3086 0.3183 -0.0019 0.0042  0.0000  78  LEU L O   
576  C  CB  . LEU A 78  ? 0.3324 0.3260 0.3300 -0.0034 0.0056  0.0032  78  LEU L CB  
577  C  CG  . LEU A 78  ? 0.3415 0.3429 0.3445 0.0031  0.0057  0.0007  78  LEU L CG  
578  C  CD1 . LEU A 78  ? 0.3295 0.3472 0.3269 0.0034  -0.0008 -0.0019 78  LEU L CD1 
579  C  CD2 . LEU A 78  ? 0.3770 0.3439 0.3638 0.0085  0.0022  0.0138  78  LEU L CD2 
580  N  N   . GLU A 79  ? 0.3219 0.3202 0.3130 -0.0028 0.0050  0.0002  79  GLU L N   
581  C  CA  . GLU A 79  ? 0.3240 0.3250 0.3160 -0.0017 0.0059  -0.0008 79  GLU L CA  
582  C  C   . GLU A 79  ? 0.3212 0.3118 0.3156 -0.0011 0.0095  0.0005  79  GLU L C   
583  O  O   . GLU A 79  ? 0.3322 0.3140 0.3193 0.0026  0.0140  -0.0014 79  GLU L O   
584  C  CB  . GLU A 79  ? 0.3227 0.3378 0.3183 -0.0012 0.0115  0.0001  79  GLU L CB  
585  C  CG  . GLU A 79  ? 0.3447 0.3563 0.3418 -0.0037 0.0016  -0.0052 79  GLU L CG  
586  C  CD  . GLU A 79  ? 0.3775 0.4345 0.3812 -0.0122 0.0054  -0.0062 79  GLU L CD  
587  O  OE1 . GLU A 79  ? 0.4445 0.4915 0.4314 -0.0197 -0.0056 0.0049  79  GLU L OE1 
588  O  OE2 . GLU A 79  ? 0.3092 0.4343 0.3438 -0.0325 0.0038  -0.0061 79  GLU L OE2 
589  N  N   . PRO A 80  ? 0.3167 0.3041 0.3177 -0.0010 0.0078  -0.0009 80  PRO L N   
590  C  CA  . PRO A 80  ? 0.3067 0.2999 0.3061 -0.0029 0.0029  -0.0032 80  PRO L CA  
591  C  C   . PRO A 80  ? 0.2995 0.2952 0.2999 -0.0036 0.0025  -0.0028 80  PRO L C   
592  O  O   . PRO A 80  ? 0.3028 0.3012 0.2999 -0.0035 0.0042  -0.0042 80  PRO L O   
593  C  CB  . PRO A 80  ? 0.3098 0.2938 0.3020 -0.0058 0.0016  -0.0086 80  PRO L CB  
594  C  CG  . PRO A 80  ? 0.3179 0.3004 0.3093 -0.0028 0.0051  0.0009  80  PRO L CG  
595  C  CD  . PRO A 80  ? 0.3176 0.3012 0.3133 -0.0042 0.0089  0.0008  80  PRO L CD  
596  N  N   . GLU A 81  ? 0.2952 0.2918 0.2922 -0.0019 0.0063  -0.0014 81  GLU L N   
597  C  CA  . GLU A 81  ? 0.2849 0.2857 0.2854 -0.0016 0.0047  0.0028  81  GLU L CA  
598  C  C   . GLU A 81  ? 0.2723 0.2809 0.2834 -0.0007 0.0038  0.0013  81  GLU L C   
599  O  O   . GLU A 81  ? 0.2565 0.2772 0.2683 0.0001  0.0068  0.0023  81  GLU L O   
600  C  CB  . GLU A 81  ? 0.2770 0.2891 0.2850 0.0008  0.0073  0.0056  81  GLU L CB  
601  C  CG  . GLU A 81  ? 0.2955 0.2829 0.2994 -0.0030 0.0018  0.0083  81  GLU L CG  
602  C  CD  . GLU A 81  ? 0.2682 0.2541 0.2724 0.0110  -0.0039 0.0043  81  GLU L CD  
603  O  OE1 . GLU A 81  ? 0.2616 0.2344 0.2801 0.0139  0.0053  0.0072  81  GLU L OE1 
604  O  OE2 . GLU A 81  ? 0.2748 0.2320 0.2796 0.0037  -0.0073 0.0252  81  GLU L OE2 
605  N  N   . ASP A 82  ? 0.2755 0.2884 0.2865 -0.0010 0.0036  0.0004  82  ASP L N   
606  C  CA  . ASP A 82  ? 0.2822 0.2878 0.2854 0.0016  0.0049  -0.0019 82  ASP L CA  
607  C  C   . ASP A 82  ? 0.2866 0.2936 0.2923 0.0002  0.0044  -0.0025 82  ASP L C   
608  O  O   . ASP A 82  ? 0.2926 0.2939 0.3021 0.0042  0.0065  -0.0061 82  ASP L O   
609  C  CB  . ASP A 82  ? 0.2746 0.2780 0.2788 0.0037  0.0047  0.0000  82  ASP L CB  
610  C  CG  . ASP A 82  ? 0.2760 0.2645 0.2634 0.0048  0.0052  -0.0004 82  ASP L CG  
611  O  OD1 . ASP A 82  ? 0.2902 0.2394 0.2615 0.0118  0.0172  0.0023  82  ASP L OD1 
612  O  OD2 . ASP A 82  ? 0.2672 0.2581 0.2516 0.0204  0.0046  0.0000  82  ASP L OD2 
613  N  N   . PHE A 83  ? 0.2911 0.2982 0.2886 -0.0016 0.0031  -0.0040 83  PHE L N   
614  C  CA  . PHE A 83  ? 0.2951 0.2963 0.2924 -0.0008 0.0016  -0.0010 83  PHE L CA  
615  C  C   . PHE A 83  ? 0.2960 0.2927 0.2910 0.0007  0.0016  -0.0026 83  PHE L C   
616  O  O   . PHE A 83  ? 0.3024 0.2941 0.2959 0.0050  0.0022  -0.0070 83  PHE L O   
617  C  CB  . PHE A 83  ? 0.2911 0.2964 0.2853 -0.0021 0.0010  -0.0020 83  PHE L CB  
618  C  CG  . PHE A 83  ? 0.2976 0.2942 0.2936 0.0003  -0.0003 -0.0021 83  PHE L CG  
619  C  CD1 . PHE A 83  ? 0.3093 0.2984 0.2901 0.0023  0.0033  0.0034  83  PHE L CD1 
620  C  CD2 . PHE A 83  ? 0.2998 0.2903 0.2846 -0.0046 -0.0060 -0.0029 83  PHE L CD2 
621  C  CE1 . PHE A 83  ? 0.3060 0.3065 0.2988 -0.0011 0.0128  0.0049  83  PHE L CE1 
622  C  CE2 . PHE A 83  ? 0.3014 0.2944 0.2840 -0.0011 -0.0069 -0.0053 83  PHE L CE2 
623  C  CZ  . PHE A 83  ? 0.2947 0.3016 0.2857 -0.0003 0.0070  0.0020  83  PHE L CZ  
624  N  N   . ALA A 84  ? 0.2937 0.2839 0.2854 0.0025  0.0003  -0.0028 84  ALA L N   
625  C  CA  . ALA A 84  ? 0.2845 0.2773 0.2758 0.0010  -0.0004 -0.0025 84  ALA L CA  
626  C  C   . ALA A 84  ? 0.2796 0.2708 0.2715 0.0013  -0.0035 -0.0022 84  ALA L C   
627  O  O   . ALA A 84  ? 0.2733 0.2633 0.2628 -0.0026 -0.0088 -0.0006 84  ALA L O   
628  C  CB  . ALA A 84  ? 0.2822 0.2754 0.2697 0.0029  -0.0005 -0.0036 84  ALA L CB  
629  N  N   . VAL A 85  ? 0.2768 0.2627 0.2669 0.0009  -0.0031 -0.0009 85  VAL L N   
630  C  CA  . VAL A 85  ? 0.2758 0.2619 0.2652 0.0029  -0.0040 0.0004  85  VAL L CA  
631  C  C   . VAL A 85  ? 0.2752 0.2607 0.2603 0.0035  -0.0030 0.0008  85  VAL L C   
632  O  O   . VAL A 85  ? 0.2845 0.2663 0.2613 0.0044  -0.0029 -0.0011 85  VAL L O   
633  C  CB  . VAL A 85  ? 0.2760 0.2626 0.2660 0.0021  -0.0029 0.0003  85  VAL L CB  
634  C  CG1 . VAL A 85  ? 0.2557 0.2581 0.2785 0.0107  -0.0115 0.0022  85  VAL L CG1 
635  C  CG2 . VAL A 85  ? 0.2670 0.2664 0.2675 0.0048  -0.0115 0.0074  85  VAL L CG2 
636  N  N   . TYR A 86  ? 0.2703 0.2537 0.2527 0.0020  0.0034  0.0000  86  TYR L N   
637  C  CA  . TYR A 86  ? 0.2632 0.2466 0.2503 -0.0018 0.0016  0.0036  86  TYR L CA  
638  C  C   . TYR A 86  ? 0.2600 0.2450 0.2476 -0.0013 0.0049  0.0023  86  TYR L C   
639  O  O   . TYR A 86  ? 0.2572 0.2470 0.2367 -0.0061 0.0051  0.0018  86  TYR L O   
640  C  CB  . TYR A 86  ? 0.2612 0.2446 0.2495 -0.0040 0.0069  0.0049  86  TYR L CB  
641  C  CG  . TYR A 86  ? 0.2436 0.2308 0.2440 0.0039  0.0044  0.0062  86  TYR L CG  
642  C  CD1 . TYR A 86  ? 0.2434 0.2074 0.2449 0.0040  0.0014  0.0040  86  TYR L CD1 
643  C  CD2 . TYR A 86  ? 0.2461 0.2135 0.2331 0.0045  0.0064  0.0021  86  TYR L CD2 
644  C  CE1 . TYR A 86  ? 0.2400 0.2087 0.2204 0.0044  0.0047  0.0108  86  TYR L CE1 
645  C  CE2 . TYR A 86  ? 0.2441 0.2175 0.2435 0.0119  0.0034  0.0101  86  TYR L CE2 
646  C  CZ  . TYR A 86  ? 0.2469 0.2291 0.2403 0.0003  0.0046  0.0094  86  TYR L CZ  
647  O  OH  . TYR A 86  ? 0.2585 0.2419 0.2361 -0.0102 0.0102  0.0186  86  TYR L OH  
648  N  N   . TYR A 87  ? 0.2627 0.2498 0.2563 -0.0009 0.0034  0.0044  87  TYR L N   
649  C  CA  . TYR A 87  ? 0.2620 0.2509 0.2599 0.0013  0.0029  0.0005  87  TYR L CA  
650  C  C   . TYR A 87  ? 0.2617 0.2583 0.2622 0.0026  0.0003  0.0013  87  TYR L C   
651  O  O   . TYR A 87  ? 0.2522 0.2477 0.2664 -0.0009 -0.0008 0.0033  87  TYR L O   
652  C  CB  . TYR A 87  ? 0.2594 0.2528 0.2583 -0.0004 0.0059  -0.0001 87  TYR L CB  
653  C  CG  . TYR A 87  ? 0.2605 0.2413 0.2709 -0.0009 0.0026  -0.0006 87  TYR L CG  
654  C  CD1 . TYR A 87  ? 0.2638 0.2540 0.2671 -0.0067 0.0090  -0.0029 87  TYR L CD1 
655  C  CD2 . TYR A 87  ? 0.2501 0.2472 0.2698 0.0056  0.0069  -0.0051 87  TYR L CD2 
656  C  CE1 . TYR A 87  ? 0.2629 0.2612 0.2483 -0.0032 0.0094  -0.0052 87  TYR L CE1 
657  C  CE2 . TYR A 87  ? 0.2648 0.2692 0.2675 0.0027  0.0006  -0.0110 87  TYR L CE2 
658  C  CZ  . TYR A 87  ? 0.2649 0.2668 0.2580 0.0016  0.0006  -0.0095 87  TYR L CZ  
659  O  OH  . TYR A 87  ? 0.2726 0.2409 0.2779 -0.0010 0.0075  -0.0025 87  TYR L OH  
660  N  N   . CYS A 88  ? 0.2710 0.2735 0.2651 0.0009  0.0000  -0.0001 88  CYS L N   
661  C  CA  . CYS A 88  ? 0.2728 0.2742 0.2604 0.0015  0.0015  0.0006  88  CYS L CA  
662  C  C   . CYS A 88  ? 0.2641 0.2715 0.2625 0.0011  0.0028  -0.0009 88  CYS L C   
663  O  O   . CYS A 88  ? 0.2603 0.2646 0.2559 0.0008  -0.0024 -0.0036 88  CYS L O   
664  C  CB  . CYS A 88  ? 0.2754 0.2758 0.2592 0.0024  0.0045  0.0018  88  CYS L CB  
665  S  SG  . CYS A 88  ? 0.3056 0.2990 0.2497 -0.0071 0.0020  0.0050  88  CYS L SG  
666  N  N   . GLN A 89  ? 0.2675 0.2696 0.2582 0.0040  0.0027  -0.0060 89  GLN L N   
667  C  CA  . GLN A 89  ? 0.2711 0.2772 0.2681 0.0024  0.0032  -0.0035 89  GLN L CA  
668  C  C   . GLN A 89  ? 0.2815 0.2882 0.2722 0.0049  0.0040  -0.0033 89  GLN L C   
669  O  O   . GLN A 89  ? 0.2756 0.2826 0.2565 0.0012  0.0059  -0.0058 89  GLN L O   
670  C  CB  . GLN A 89  ? 0.2747 0.2733 0.2663 0.0061  0.0063  -0.0064 89  GLN L CB  
671  C  CG  . GLN A 89  ? 0.2718 0.2667 0.2720 0.0100  0.0069  -0.0046 89  GLN L CG  
672  C  CD  . GLN A 89  ? 0.2781 0.2784 0.2796 0.0002  0.0046  -0.0037 89  GLN L CD  
673  O  OE1 . GLN A 89  ? 0.2945 0.3050 0.3121 0.0034  0.0096  0.0182  89  GLN L OE1 
674  N  NE2 . GLN A 89  ? 0.2646 0.2578 0.2437 0.0010  0.0072  -0.0128 89  GLN L NE2 
675  N  N   . GLN A 90  ? 0.2970 0.3067 0.2862 0.0083  0.0032  0.0000  90  GLN L N   
676  C  CA  . GLN A 90  ? 0.3085 0.3199 0.3001 0.0068  0.0031  -0.0039 90  GLN L CA  
677  C  C   . GLN A 90  ? 0.3205 0.3389 0.3158 0.0078  0.0038  -0.0019 90  GLN L C   
678  O  O   . GLN A 90  ? 0.3092 0.3299 0.3025 0.0077  0.0060  0.0002  90  GLN L O   
679  C  CB  . GLN A 90  ? 0.3038 0.3140 0.2949 0.0074  -0.0001 -0.0031 90  GLN L CB  
680  C  CG  . GLN A 90  ? 0.3028 0.3044 0.2861 0.0103  -0.0005 -0.0009 90  GLN L CG  
681  C  CD  . GLN A 90  ? 0.2847 0.2952 0.2893 0.0051  0.0083  -0.0058 90  GLN L CD  
682  O  OE1 . GLN A 90  ? 0.2850 0.3167 0.2832 0.0071  0.0041  -0.0069 90  GLN L OE1 
683  N  NE2 . GLN A 90  ? 0.2804 0.2633 0.2677 0.0120  0.0052  -0.0123 90  GLN L NE2 
684  N  N   . ARG A 91  ? 0.3437 0.3654 0.3466 0.0056  0.0005  -0.0067 91  ARG L N   
685  C  CA  . ARG A 91  ? 0.3733 0.3903 0.3730 0.0053  -0.0013 -0.0020 91  ARG L CA  
686  C  C   . ARG A 91  ? 0.3944 0.4090 0.3936 0.0042  0.0002  -0.0040 91  ARG L C   
687  O  O   . ARG A 91  ? 0.3893 0.4139 0.3915 0.0079  -0.0042 -0.0053 91  ARG L O   
688  C  CB  . ARG A 91  ? 0.3726 0.3872 0.3736 0.0046  -0.0043 -0.0039 91  ARG L CB  
689  C  CG  . ARG A 91  ? 0.3766 0.3912 0.3774 0.0033  -0.0060 -0.0041 91  ARG L CG  
690  C  CD  . ARG A 91  ? 0.3776 0.3849 0.3884 0.0081  -0.0022 -0.0004 91  ARG L CD  
691  N  NE  . ARG A 91  ? 0.3757 0.3799 0.3948 0.0059  -0.0065 0.0046  91  ARG L NE  
692  C  CZ  . ARG A 91  ? 0.3765 0.3849 0.4183 -0.0035 -0.0063 -0.0007 91  ARG L CZ  
693  N  NH1 . ARG A 91  ? 0.3732 0.3853 0.3948 -0.0011 -0.0056 0.0015  91  ARG L NH1 
694  N  NH2 . ARG A 91  ? 0.3534 0.3813 0.3910 -0.0020 -0.0114 -0.0036 91  ARG L NH2 
695  N  N   . SER A 92  ? 0.4134 0.4298 0.4214 0.0036  -0.0009 -0.0004 92  SER L N   
696  C  CA  . SER A 92  ? 0.4417 0.4532 0.4458 0.0034  -0.0010 -0.0027 92  SER L CA  
697  C  C   . SER A 92  ? 0.4575 0.4728 0.4648 0.0033  0.0014  0.0000  92  SER L C   
698  O  O   . SER A 92  ? 0.4579 0.4790 0.4662 0.0026  -0.0028 0.0003  92  SER L O   
699  C  CB  . SER A 92  ? 0.4426 0.4507 0.4411 0.0056  -0.0008 -0.0014 92  SER L CB  
700  O  OG  . SER A 92  ? 0.4371 0.4508 0.4366 0.0036  -0.0015 0.0034  92  SER L OG  
701  N  N   . ASN A 93  ? 0.4821 0.4915 0.4905 0.0035  0.0013  -0.0001 93  ASN L N   
702  C  CA  . ASN A 93  ? 0.5065 0.5092 0.5112 0.0003  0.0023  0.0022  93  ASN L CA  
703  C  C   . ASN A 93  ? 0.5123 0.5129 0.5122 0.0014  0.0033  0.0009  93  ASN L C   
704  O  O   . ASN A 93  ? 0.5170 0.5155 0.5163 0.0034  0.0046  0.0021  93  ASN L O   
705  C  CB  . ASN A 93  ? 0.5127 0.5163 0.5196 0.0013  0.0019  0.0011  93  ASN L CB  
706  C  CG  . ASN A 93  ? 0.5307 0.5333 0.5347 -0.0005 0.0026  0.0006  93  ASN L CG  
707  O  OD1 . ASN A 93  ? 0.5602 0.5471 0.5585 0.0024  0.0041  -0.0081 93  ASN L OD1 
708  N  ND2 . ASN A 93  ? 0.5438 0.5309 0.5338 0.0084  -0.0011 0.0044  93  ASN L ND2 
709  N  N   . TRP A 94  ? 0.5165 0.5132 0.5078 0.0027  0.0039  0.0026  94  TRP L N   
710  C  CA  . TRP A 94  ? 0.5113 0.5084 0.5019 0.0004  0.0026  0.0020  94  TRP L CA  
711  C  C   . TRP A 94  ? 0.4927 0.4845 0.4781 0.0015  0.0060  0.0040  94  TRP L C   
712  O  O   . TRP A 94  ? 0.4968 0.4901 0.4857 0.0009  0.0076  0.0061  94  TRP L O   
713  C  CB  . TRP A 94  ? 0.5415 0.5370 0.5191 0.0060  0.0052  0.0038  94  TRP L CB  
714  C  CG  . TRP A 94  ? 0.5576 0.5485 0.5400 0.0014  0.0011  0.0019  94  TRP L CG  
715  C  CD1 . TRP A 94  ? 0.5830 0.5701 0.5564 0.0019  0.0069  0.0006  94  TRP L CD1 
716  C  CD2 . TRP A 94  ? 0.5605 0.5659 0.5558 -0.0042 0.0002  0.0050  94  TRP L CD2 
717  N  NE1 . TRP A 94  ? 0.5603 0.5628 0.5567 -0.0028 0.0072  0.0027  94  TRP L NE1 
718  C  CE2 . TRP A 94  ? 0.5662 0.5674 0.5508 -0.0018 0.0031  0.0059  94  TRP L CE2 
719  C  CE3 . TRP A 94  ? 0.5719 0.5684 0.5655 -0.0009 0.0051  0.0023  94  TRP L CE3 
720  C  CZ2 . TRP A 94  ? 0.5656 0.5541 0.5432 -0.0036 0.0000  -0.0014 94  TRP L CZ2 
721  C  CZ3 . TRP A 94  ? 0.5596 0.5613 0.5608 -0.0056 0.0044  0.0012  94  TRP L CZ3 
722  C  CH2 . TRP A 94  ? 0.5555 0.5584 0.5558 -0.0084 0.0015  -0.0026 94  TRP L CH2 
723  N  N   . PRO A 95  ? 0.4610 0.4581 0.4483 -0.0001 0.0045  0.0061  95  PRO L N   
724  C  CA  . PRO A 95  ? 0.4315 0.4309 0.4183 -0.0024 0.0038  0.0043  95  PRO L CA  
725  C  C   . PRO A 95  ? 0.4010 0.4042 0.3898 0.0021  0.0014  -0.0004 95  PRO L C   
726  O  O   . PRO A 95  ? 0.3903 0.4067 0.3702 -0.0024 0.0022  0.0025  95  PRO L O   
727  C  CB  . PRO A 95  ? 0.4345 0.4359 0.4223 -0.0005 0.0045  0.0040  95  PRO L CB  
728  C  CG  . PRO A 95  ? 0.4459 0.4433 0.4341 -0.0048 0.0027  0.0035  95  PRO L CG  
729  C  CD  . PRO A 95  ? 0.4611 0.4569 0.4490 0.0015  0.0042  0.0061  95  PRO L CD  
730  N  N   . ILE A 96  ? 0.3690 0.3679 0.3542 -0.0002 0.0020  0.0005  96  ILE L N   
731  C  CA  . ILE A 96  ? 0.3360 0.3316 0.3289 0.0021  -0.0015 0.0007  96  ILE L CA  
732  C  C   . ILE A 96  ? 0.3205 0.3205 0.3158 0.0025  0.0024  0.0047  96  ILE L C   
733  O  O   . ILE A 96  ? 0.3139 0.3087 0.3003 0.0067  -0.0019 0.0068  96  ILE L O   
734  C  CB  . ILE A 96  ? 0.3345 0.3351 0.3294 0.0006  0.0000  0.0016  96  ILE L CB  
735  C  CG1 . ILE A 96  ? 0.3331 0.3208 0.3244 0.0052  0.0039  -0.0053 96  ILE L CG1 
736  C  CG2 . ILE A 96  ? 0.3228 0.3220 0.3243 0.0023  -0.0021 0.0037  96  ILE L CG2 
737  C  CD1 . ILE A 96  ? 0.3293 0.3231 0.3128 -0.0015 -0.0039 -0.0018 96  ILE L CD1 
738  N  N   . THR A 97  ? 0.3059 0.3163 0.3047 0.0008  0.0048  0.0023  97  THR L N   
739  C  CA  . THR A 97  ? 0.2861 0.3002 0.2929 0.0000  0.0054  0.0044  97  THR L CA  
740  C  C   . THR A 97  ? 0.2838 0.2960 0.2894 0.0035  0.0041  0.0000  97  THR L C   
741  O  O   . THR A 97  ? 0.2672 0.2895 0.2887 -0.0036 0.0119  0.0024  97  THR L O   
742  C  CB  . THR A 97  ? 0.2922 0.2969 0.2935 0.0009  0.0072  0.0030  97  THR L CB  
743  O  OG1 . THR A 97  ? 0.2933 0.2877 0.2822 -0.0004 0.0184  0.0055  97  THR L OG1 
744  C  CG2 . THR A 97  ? 0.2636 0.2916 0.2761 0.0020  -0.0021 -0.0011 97  THR L CG2 
745  N  N   . PHE A 98  ? 0.2809 0.2930 0.2898 0.0059  0.0035  0.0020  98  PHE L N   
746  C  CA  . PHE A 98  ? 0.2771 0.2885 0.2809 0.0081  0.0032  -0.0008 98  PHE L CA  
747  C  C   . PHE A 98  ? 0.2751 0.2881 0.2765 0.0037  0.0018  -0.0043 98  PHE L C   
748  O  O   . PHE A 98  ? 0.2867 0.2913 0.2775 0.0015  0.0001  -0.0055 98  PHE L O   
749  C  CB  . PHE A 98  ? 0.2778 0.2797 0.2755 0.0065  -0.0028 -0.0018 98  PHE L CB  
750  C  CG  . PHE A 98  ? 0.2615 0.2559 0.2645 0.0108  0.0017  -0.0061 98  PHE L CG  
751  C  CD1 . PHE A 98  ? 0.2510 0.2412 0.2390 0.0024  0.0029  -0.0128 98  PHE L CD1 
752  C  CD2 . PHE A 98  ? 0.2575 0.2474 0.2508 0.0022  -0.0014 -0.0194 98  PHE L CD2 
753  C  CE1 . PHE A 98  ? 0.2591 0.2283 0.2383 -0.0018 -0.0012 -0.0016 98  PHE L CE1 
754  C  CE2 . PHE A 98  ? 0.2586 0.2576 0.2394 0.0012  0.0060  -0.0131 98  PHE L CE2 
755  C  CZ  . PHE A 98  ? 0.2538 0.2395 0.2479 0.0001  0.0004  -0.0053 98  PHE L CZ  
756  N  N   . GLY A 99  ? 0.2730 0.2893 0.2751 0.0020  0.0023  -0.0026 99  GLY L N   
757  C  CA  . GLY A 99  ? 0.2763 0.2910 0.2789 0.0004  0.0005  -0.0011 99  GLY L CA  
758  C  C   . GLY A 99  ? 0.2798 0.2914 0.2808 -0.0007 0.0028  -0.0012 99  GLY L C   
759  O  O   . GLY A 99  ? 0.2818 0.2915 0.2722 -0.0048 0.0058  -0.0030 99  GLY L O   
760  N  N   . GLN A 100 ? 0.2869 0.2981 0.2869 -0.0053 0.0035  -0.0042 100 GLN L N   
761  C  CA  . GLN A 100 ? 0.2930 0.3010 0.2952 -0.0018 0.0037  -0.0009 100 GLN L CA  
762  C  C   . GLN A 100 ? 0.2833 0.2930 0.2887 -0.0002 0.0015  -0.0016 100 GLN L C   
763  O  O   . GLN A 100 ? 0.2742 0.2878 0.2882 0.0039  0.0042  0.0005  100 GLN L O   
764  C  CB  . GLN A 100 ? 0.2963 0.3076 0.2993 -0.0014 0.0012  -0.0043 100 GLN L CB  
765  C  CG  . GLN A 100 ? 0.3422 0.3525 0.3439 -0.0064 0.0019  0.0043  100 GLN L CG  
766  C  CD  . GLN A 100 ? 0.3939 0.3850 0.3815 0.0038  -0.0028 0.0090  100 GLN L CD  
767  O  OE1 . GLN A 100 ? 0.4029 0.4283 0.4019 -0.0027 -0.0021 0.0035  100 GLN L OE1 
768  N  NE2 . GLN A 100 ? 0.4014 0.3802 0.3886 0.0028  -0.0014 0.0017  100 GLN L NE2 
769  N  N   . GLY A 101 ? 0.2825 0.2863 0.2804 0.0013  0.0018  0.0028  101 GLY L N   
770  C  CA  . GLY A 101 ? 0.2800 0.2764 0.2734 0.0013  -0.0010 0.0026  101 GLY L CA  
771  C  C   . GLY A 101 ? 0.2783 0.2807 0.2687 -0.0007 0.0009  0.0000  101 GLY L C   
772  O  O   . GLY A 101 ? 0.2784 0.2764 0.2576 0.0015  -0.0044 0.0074  101 GLY L O   
773  N  N   . THR A 102 ? 0.2769 0.2810 0.2691 -0.0005 0.0006  0.0011  102 THR L N   
774  C  CA  . THR A 102 ? 0.2775 0.2757 0.2675 0.0015  -0.0011 -0.0005 102 THR L CA  
775  C  C   . THR A 102 ? 0.2767 0.2799 0.2704 0.0034  0.0019  0.0009  102 THR L C   
776  O  O   . THR A 102 ? 0.2753 0.2782 0.2601 0.0064  0.0060  -0.0032 102 THR L O   
777  C  CB  . THR A 102 ? 0.2721 0.2690 0.2683 0.0006  -0.0006 0.0009  102 THR L CB  
778  O  OG1 . THR A 102 ? 0.2594 0.2651 0.2668 -0.0007 -0.0017 0.0076  102 THR L OG1 
779  C  CG2 . THR A 102 ? 0.2646 0.2599 0.2542 0.0035  -0.0019 -0.0089 102 THR L CG2 
780  N  N   . ARG A 103 ? 0.2855 0.2798 0.2802 0.0037  0.0021  0.0003  103 ARG L N   
781  C  CA  . ARG A 103 ? 0.2973 0.2966 0.2935 0.0038  0.0017  0.0000  103 ARG L CA  
782  C  C   . ARG A 103 ? 0.3023 0.3013 0.2949 0.0051  -0.0001 -0.0002 103 ARG L C   
783  O  O   . ARG A 103 ? 0.2971 0.3041 0.2906 0.0065  -0.0020 0.0035  103 ARG L O   
784  C  CB  . ARG A 103 ? 0.2999 0.2979 0.2986 0.0019  0.0013  -0.0010 103 ARG L CB  
785  C  CG  . ARG A 103 ? 0.3289 0.3218 0.3209 0.0047  0.0056  -0.0004 103 ARG L CG  
786  C  CD  . ARG A 103 ? 0.3661 0.3516 0.3485 -0.0066 -0.0052 -0.0073 103 ARG L CD  
787  N  NE  . ARG A 103 ? 0.3890 0.3912 0.3866 -0.0018 0.0025  -0.0087 103 ARG L NE  
788  C  CZ  . ARG A 103 ? 0.3967 0.3970 0.3906 0.0047  0.0049  0.0014  103 ARG L CZ  
789  N  NH1 . ARG A 103 ? 0.3988 0.3936 0.3942 -0.0104 0.0096  -0.0052 103 ARG L NH1 
790  N  NH2 . ARG A 103 ? 0.4191 0.4155 0.4016 0.0014  -0.0051 0.0074  103 ARG L NH2 
791  N  N   . LEU A 104 ? 0.3076 0.3097 0.3038 0.0051  -0.0012 -0.0001 104 LEU L N   
792  C  CA  . LEU A 104 ? 0.3188 0.3135 0.3108 0.0024  -0.0037 0.0014  104 LEU L CA  
793  C  C   . LEU A 104 ? 0.3246 0.3192 0.3143 0.0014  -0.0016 0.0020  104 LEU L C   
794  O  O   . LEU A 104 ? 0.3275 0.3215 0.3114 -0.0005 -0.0040 0.0032  104 LEU L O   
795  C  CB  . LEU A 104 ? 0.3238 0.3159 0.3188 0.0042  -0.0048 0.0000  104 LEU L CB  
796  C  CG  . LEU A 104 ? 0.3290 0.3206 0.3232 0.0021  -0.0056 0.0001  104 LEU L CG  
797  C  CD1 . LEU A 104 ? 0.3098 0.3355 0.3381 -0.0018 0.0025  -0.0014 104 LEU L CD1 
798  C  CD2 . LEU A 104 ? 0.3354 0.3355 0.3243 0.0034  0.0097  -0.0088 104 LEU L CD2 
799  N  N   . GLU A 105 ? 0.3320 0.3255 0.3196 -0.0018 -0.0010 0.0001  105 GLU L N   
800  C  CA  . GLU A 105 ? 0.3334 0.3328 0.3221 -0.0055 0.0010  -0.0023 105 GLU L CA  
801  C  C   . GLU A 105 ? 0.3261 0.3317 0.3187 -0.0050 0.0024  -0.0037 105 GLU L C   
802  O  O   . GLU A 105 ? 0.3231 0.3366 0.3131 -0.0116 0.0055  -0.0027 105 GLU L O   
803  C  CB  . GLU A 105 ? 0.3385 0.3383 0.3315 -0.0084 0.0069  -0.0027 105 GLU L CB  
804  C  CG  . GLU A 105 ? 0.3596 0.3535 0.3604 -0.0138 0.0038  -0.0070 105 GLU L CG  
805  C  CD  . GLU A 105 ? 0.3694 0.3622 0.3754 -0.0077 -0.0067 0.0017  105 GLU L CD  
806  O  OE1 . GLU A 105 ? 0.3521 0.3478 0.3802 -0.0060 -0.0071 -0.0166 105 GLU L OE1 
807  O  OE2 . GLU A 105 ? 0.4315 0.4120 0.4169 -0.0032 0.0049  -0.0076 105 GLU L OE2 
808  N  N   . ILE A 106 ? 0.3343 0.3336 0.3218 -0.0031 0.0011  -0.0019 106 ILE L N   
809  C  CA  . ILE A 106 ? 0.3324 0.3332 0.3277 -0.0022 0.0050  -0.0022 106 ILE L CA  
810  C  C   . ILE A 106 ? 0.3377 0.3389 0.3257 -0.0033 0.0061  -0.0023 106 ILE L C   
811  O  O   . ILE A 106 ? 0.3388 0.3447 0.3208 -0.0062 0.0074  -0.0019 106 ILE L O   
812  C  CB  . ILE A 106 ? 0.3348 0.3297 0.3313 -0.0005 0.0050  -0.0009 106 ILE L CB  
813  C  CG1 . ILE A 106 ? 0.3317 0.3272 0.3204 -0.0027 0.0027  -0.0018 106 ILE L CG1 
814  C  CG2 . ILE A 106 ? 0.3305 0.3244 0.3314 0.0021  0.0143  -0.0016 106 ILE L CG2 
815  C  CD1 . ILE A 106 ? 0.3328 0.3320 0.3274 0.0023  0.0040  -0.0087 106 ILE L CD1 
816  N  N   . LYS A 107 ? 0.3398 0.3406 0.3306 -0.0003 0.0063  0.0004  107 LYS L N   
817  C  CA  . LYS A 107 ? 0.3570 0.3545 0.3424 0.0000  0.0024  -0.0031 107 LYS L CA  
818  C  C   . LYS A 107 ? 0.3537 0.3477 0.3394 -0.0015 0.0018  0.0000  107 LYS L C   
819  O  O   . LYS A 107 ? 0.3575 0.3442 0.3400 -0.0046 0.0070  0.0002  107 LYS L O   
820  C  CB  . LYS A 107 ? 0.3567 0.3539 0.3439 0.0027  -0.0014 0.0001  107 LYS L CB  
821  C  CG  . LYS A 107 ? 0.3757 0.3727 0.3593 0.0060  0.0010  0.0000  107 LYS L CG  
822  C  CD  . LYS A 107 ? 0.3829 0.3728 0.3708 0.0073  -0.0007 -0.0006 107 LYS L CD  
823  C  CE  . LYS A 107 ? 0.4238 0.4455 0.4333 0.0026  0.0031  -0.0052 107 LYS L CE  
824  N  NZ  . LYS A 107 ? 0.4662 0.4390 0.4852 0.0256  -0.0048 -0.0029 107 LYS L NZ  
825  N  N   . ARG A 108 ? 0.3539 0.3419 0.3339 -0.0014 0.0012  0.0000  108 ARG L N   
826  C  CA  . ARG A 108 ? 0.3514 0.3391 0.3362 -0.0014 -0.0018 -0.0008 108 ARG L CA  
827  C  C   . ARG A 108 ? 0.3526 0.3340 0.3342 -0.0031 -0.0010 -0.0025 108 ARG L C   
828  O  O   . ARG A 108 ? 0.3555 0.3321 0.3341 -0.0032 -0.0043 -0.0024 108 ARG L O   
829  C  CB  . ARG A 108 ? 0.3457 0.3463 0.3345 0.0042  -0.0012 0.0012  108 ARG L CB  
830  C  CG  . ARG A 108 ? 0.3608 0.3553 0.3367 0.0082  0.0000  -0.0023 108 ARG L CG  
831  C  CD  . ARG A 108 ? 0.3401 0.3345 0.3340 -0.0093 -0.0097 0.0005  108 ARG L CD  
832  N  NE  . ARG A 108 ? 0.3370 0.3271 0.3380 -0.0081 -0.0030 -0.0102 108 ARG L NE  
833  C  CZ  . ARG A 108 ? 0.3171 0.3332 0.3297 -0.0099 0.0004  0.0011  108 ARG L CZ  
834  N  NH1 . ARG A 108 ? 0.3000 0.3193 0.3201 -0.0217 -0.0017 -0.0013 108 ARG L NH1 
835  N  NH2 . ARG A 108 ? 0.3173 0.3462 0.3427 -0.0079 -0.0018 0.0015  108 ARG L NH2 
836  N  N   . THR A 109 ? 0.3490 0.3292 0.3342 -0.0062 -0.0009 -0.0019 109 THR L N   
837  C  CA  . THR A 109 ? 0.3511 0.3360 0.3373 -0.0069 0.0005  0.0007  109 THR L CA  
838  C  C   . THR A 109 ? 0.3475 0.3310 0.3331 -0.0065 -0.0017 0.0000  109 THR L C   
839  O  O   . THR A 109 ? 0.3496 0.3296 0.3260 -0.0115 -0.0042 -0.0015 109 THR L O   
840  C  CB  . THR A 109 ? 0.3466 0.3367 0.3392 -0.0062 0.0038  0.0005  109 THR L CB  
841  O  OG1 . THR A 109 ? 0.3633 0.3488 0.3548 -0.0055 0.0078  0.0022  109 THR L OG1 
842  C  CG2 . THR A 109 ? 0.3412 0.3285 0.3248 -0.0083 0.0016  0.0064  109 THR L CG2 
843  N  N   . VAL A 110 ? 0.3429 0.3324 0.3349 -0.0057 -0.0014 0.0009  110 VAL L N   
844  C  CA  . VAL A 110 ? 0.3433 0.3339 0.3352 -0.0037 -0.0017 0.0008  110 VAL L CA  
845  C  C   . VAL A 110 ? 0.3413 0.3343 0.3290 -0.0055 -0.0015 0.0012  110 VAL L C   
846  O  O   . VAL A 110 ? 0.3375 0.3349 0.3230 -0.0087 -0.0020 0.0009  110 VAL L O   
847  C  CB  . VAL A 110 ? 0.3476 0.3368 0.3423 -0.0032 -0.0019 0.0012  110 VAL L CB  
848  C  CG1 . VAL A 110 ? 0.3521 0.3356 0.3470 -0.0058 -0.0020 -0.0014 110 VAL L CG1 
849  C  CG2 . VAL A 110 ? 0.3416 0.3356 0.3431 0.0009  0.0058  -0.0002 110 VAL L CG2 
850  N  N   . ALA A 111 ? 0.3427 0.3344 0.3256 -0.0064 -0.0003 -0.0007 111 ALA L N   
851  C  CA  . ALA A 111 ? 0.3412 0.3332 0.3199 -0.0069 -0.0007 -0.0015 111 ALA L CA  
852  C  C   . ALA A 111 ? 0.3444 0.3359 0.3227 -0.0072 0.0003  -0.0015 111 ALA L C   
853  O  O   . ALA A 111 ? 0.3438 0.3336 0.3085 -0.0103 -0.0018 -0.0057 111 ALA L O   
854  C  CB  . ALA A 111 ? 0.3395 0.3275 0.3238 -0.0075 0.0013  0.0005  111 ALA L CB  
855  N  N   . ALA A 112 ? 0.3441 0.3362 0.3195 -0.0059 0.0001  -0.0019 112 ALA L N   
856  C  CA  . ALA A 112 ? 0.3446 0.3373 0.3225 -0.0033 0.0014  -0.0026 112 ALA L CA  
857  C  C   . ALA A 112 ? 0.3418 0.3378 0.3268 -0.0021 0.0009  -0.0027 112 ALA L C   
858  O  O   . ALA A 112 ? 0.3550 0.3480 0.3295 -0.0057 -0.0012 -0.0026 112 ALA L O   
859  C  CB  . ALA A 112 ? 0.3463 0.3387 0.3295 -0.0019 -0.0014 -0.0014 112 ALA L CB  
860  N  N   . PRO A 113 ? 0.3379 0.3347 0.3291 -0.0006 0.0021  -0.0022 113 PRO L N   
861  C  CA  . PRO A 113 ? 0.3374 0.3331 0.3276 -0.0008 0.0013  -0.0008 113 PRO L CA  
862  C  C   . PRO A 113 ? 0.3379 0.3306 0.3292 0.0005  0.0023  -0.0007 113 PRO L C   
863  O  O   . PRO A 113 ? 0.3327 0.3239 0.3219 -0.0024 -0.0005 -0.0004 113 PRO L O   
864  C  CB  . PRO A 113 ? 0.3321 0.3301 0.3251 -0.0003 0.0021  -0.0018 113 PRO L CB  
865  C  CG  . PRO A 113 ? 0.3232 0.3277 0.3238 -0.0005 0.0023  0.0009  113 PRO L CG  
866  C  CD  . PRO A 113 ? 0.3321 0.3367 0.3296 -0.0004 -0.0008 -0.0006 113 PRO L CD  
867  N  N   . SER A 114 ? 0.3440 0.3361 0.3324 0.0005  0.0004  -0.0007 114 SER L N   
868  C  CA  . SER A 114 ? 0.3444 0.3339 0.3301 -0.0014 -0.0027 -0.0030 114 SER L CA  
869  C  C   . SER A 114 ? 0.3384 0.3229 0.3204 -0.0029 -0.0049 -0.0006 114 SER L C   
870  O  O   . SER A 114 ? 0.3426 0.3202 0.3250 -0.0084 -0.0064 -0.0031 114 SER L O   
871  C  CB  . SER A 114 ? 0.3476 0.3393 0.3333 0.0042  -0.0053 -0.0046 114 SER L CB  
872  O  OG  . SER A 114 ? 0.3816 0.3597 0.3446 0.0081  -0.0023 0.0027  114 SER L OG  
873  N  N   . VAL A 115 ? 0.3273 0.3145 0.3142 -0.0037 -0.0013 0.0031  115 VAL L N   
874  C  CA  . VAL A 115 ? 0.3145 0.3050 0.3038 -0.0021 -0.0013 -0.0020 115 VAL L CA  
875  C  C   . VAL A 115 ? 0.3045 0.3007 0.2997 -0.0047 -0.0016 -0.0036 115 VAL L C   
876  O  O   . VAL A 115 ? 0.2908 0.2905 0.2987 -0.0063 0.0002  -0.0080 115 VAL L O   
877  C  CB  . VAL A 115 ? 0.3153 0.3062 0.3070 -0.0022 0.0006  0.0009  115 VAL L CB  
878  C  CG1 . VAL A 115 ? 0.3138 0.3102 0.3040 -0.0035 0.0062  -0.0029 115 VAL L CG1 
879  C  CG2 . VAL A 115 ? 0.3066 0.2938 0.2823 0.0009  0.0002  -0.0107 115 VAL L CG2 
880  N  N   . PHE A 116 ? 0.2963 0.2913 0.2939 -0.0062 0.0000  -0.0014 116 PHE L N   
881  C  CA  . PHE A 116 ? 0.2907 0.2894 0.2876 -0.0065 0.0029  -0.0062 116 PHE L CA  
882  C  C   . PHE A 116 ? 0.2943 0.2917 0.2911 -0.0079 0.0039  -0.0089 116 PHE L C   
883  O  O   . PHE A 116 ? 0.2925 0.2815 0.2940 -0.0113 0.0082  -0.0181 116 PHE L O   
884  C  CB  . PHE A 116 ? 0.2824 0.2852 0.2806 -0.0059 0.0023  -0.0015 116 PHE L CB  
885  C  CG  . PHE A 116 ? 0.2863 0.2842 0.2748 -0.0024 -0.0025 0.0005  116 PHE L CG  
886  C  CD1 . PHE A 116 ? 0.2777 0.2877 0.2676 0.0000  0.0019  0.0027  116 PHE L CD1 
887  C  CD2 . PHE A 116 ? 0.2768 0.2864 0.2845 -0.0026 -0.0033 0.0046  116 PHE L CD2 
888  C  CE1 . PHE A 116 ? 0.2811 0.2966 0.2782 -0.0050 -0.0037 -0.0007 116 PHE L CE1 
889  C  CE2 . PHE A 116 ? 0.2717 0.2905 0.2900 -0.0010 -0.0060 -0.0016 116 PHE L CE2 
890  C  CZ  . PHE A 116 ? 0.2755 0.2926 0.2902 -0.0037 0.0024  -0.0015 116 PHE L CZ  
891  N  N   . ILE A 117 ? 0.2972 0.3053 0.2902 -0.0079 0.0031  -0.0080 117 ILE L N   
892  C  CA  . ILE A 117 ? 0.2916 0.3015 0.2877 -0.0078 0.0000  -0.0061 117 ILE L CA  
893  C  C   . ILE A 117 ? 0.2941 0.3075 0.2890 -0.0062 -0.0016 -0.0063 117 ILE L C   
894  O  O   . ILE A 117 ? 0.2925 0.3117 0.2910 -0.0071 -0.0026 -0.0064 117 ILE L O   
895  C  CB  . ILE A 117 ? 0.2940 0.3067 0.2909 -0.0043 0.0008  -0.0030 117 ILE L CB  
896  C  CG1 . ILE A 117 ? 0.2934 0.3040 0.2844 -0.0062 -0.0019 0.0041  117 ILE L CG1 
897  C  CG2 . ILE A 117 ? 0.3016 0.3150 0.2895 -0.0039 -0.0065 -0.0047 117 ILE L CG2 
898  C  CD1 . ILE A 117 ? 0.2816 0.2915 0.2897 -0.0079 0.0017  -0.0003 117 ILE L CD1 
899  N  N   . PHE A 118 ? 0.2992 0.3074 0.2922 -0.0074 -0.0031 -0.0077 118 PHE L N   
900  C  CA  . PHE A 118 ? 0.3033 0.3099 0.2978 -0.0029 -0.0010 -0.0086 118 PHE L CA  
901  C  C   . PHE A 118 ? 0.3099 0.3164 0.3090 -0.0050 0.0020  -0.0075 118 PHE L C   
902  O  O   . PHE A 118 ? 0.3173 0.3162 0.3065 -0.0063 0.0023  -0.0128 118 PHE L O   
903  C  CB  . PHE A 118 ? 0.2961 0.3087 0.2955 -0.0038 0.0018  -0.0058 118 PHE L CB  
904  C  CG  . PHE A 118 ? 0.2914 0.2945 0.2841 0.0005  -0.0026 -0.0018 118 PHE L CG  
905  C  CD1 . PHE A 118 ? 0.2693 0.2749 0.2684 0.0065  -0.0003 0.0036  118 PHE L CD1 
906  C  CD2 . PHE A 118 ? 0.2801 0.2808 0.2701 -0.0011 -0.0004 0.0001  118 PHE L CD2 
907  C  CE1 . PHE A 118 ? 0.2783 0.2764 0.2893 0.0064  -0.0036 -0.0021 118 PHE L CE1 
908  C  CE2 . PHE A 118 ? 0.2861 0.2924 0.2859 -0.0041 0.0040  -0.0044 118 PHE L CE2 
909  C  CZ  . PHE A 118 ? 0.2899 0.3002 0.2978 0.0007  0.0041  -0.0096 118 PHE L CZ  
910  N  N   . PRO A 119 ? 0.3214 0.3215 0.3154 -0.0036 0.0008  -0.0095 119 PRO L N   
911  C  CA  . PRO A 119 ? 0.3287 0.3250 0.3220 -0.0047 0.0004  -0.0083 119 PRO L CA  
912  C  C   . PRO A 119 ? 0.3417 0.3343 0.3318 -0.0032 0.0001  -0.0091 119 PRO L C   
913  O  O   . PRO A 119 ? 0.3485 0.3306 0.3250 -0.0074 -0.0032 -0.0112 119 PRO L O   
914  C  CB  . PRO A 119 ? 0.3253 0.3249 0.3221 -0.0022 0.0008  -0.0038 119 PRO L CB  
915  C  CG  . PRO A 119 ? 0.3277 0.3292 0.3294 -0.0039 0.0043  -0.0066 119 PRO L CG  
916  C  CD  . PRO A 119 ? 0.3185 0.3234 0.3145 -0.0066 0.0010  -0.0093 119 PRO L CD  
917  N  N   . PRO A 120 ? 0.3514 0.3483 0.3455 -0.0024 0.0029  -0.0065 120 PRO L N   
918  C  CA  . PRO A 120 ? 0.3658 0.3615 0.3580 -0.0024 0.0012  -0.0030 120 PRO L CA  
919  C  C   . PRO A 120 ? 0.3794 0.3718 0.3766 -0.0018 0.0011  -0.0045 120 PRO L C   
920  O  O   . PRO A 120 ? 0.3832 0.3682 0.3710 -0.0030 -0.0004 -0.0036 120 PRO L O   
921  C  CB  . PRO A 120 ? 0.3641 0.3609 0.3550 -0.0043 -0.0010 -0.0034 120 PRO L CB  
922  C  CG  . PRO A 120 ? 0.3534 0.3495 0.3534 -0.0038 0.0000  -0.0040 120 PRO L CG  
923  C  CD  . PRO A 120 ? 0.3552 0.3499 0.3477 -0.0017 0.0016  -0.0066 120 PRO L CD  
924  N  N   . SER A 121 ? 0.3962 0.3857 0.3929 -0.0025 -0.0019 -0.0021 121 SER L N   
925  C  CA  . SER A 121 ? 0.4107 0.4073 0.4181 0.0009  0.0004  -0.0053 121 SER L CA  
926  C  C   . SER A 121 ? 0.4321 0.4218 0.4376 0.0003  0.0000  -0.0047 121 SER L C   
927  O  O   . SER A 121 ? 0.4350 0.4229 0.4425 0.0017  -0.0017 -0.0053 121 SER L O   
928  C  CB  . SER A 121 ? 0.4034 0.4005 0.4125 0.0008  0.0000  -0.0032 121 SER L CB  
929  O  OG  . SER A 121 ? 0.3943 0.4021 0.4169 0.0014  -0.0072 -0.0115 121 SER L OG  
930  N  N   . ASP A 122 ? 0.4552 0.4481 0.4608 0.0027  0.0005  -0.0071 122 ASP L N   
931  C  CA  . ASP A 122 ? 0.4778 0.4663 0.4813 0.0018  0.0015  -0.0067 122 ASP L CA  
932  C  C   . ASP A 122 ? 0.4904 0.4757 0.4874 0.0036  0.0011  -0.0063 122 ASP L C   
933  O  O   . ASP A 122 ? 0.4929 0.4751 0.4947 0.0030  0.0017  -0.0115 122 ASP L O   
934  C  CB  . ASP A 122 ? 0.4789 0.4722 0.4809 0.0034  0.0020  -0.0052 122 ASP L CB  
935  C  CG  . ASP A 122 ? 0.4879 0.4879 0.4852 0.0016  0.0002  -0.0027 122 ASP L CG  
936  O  OD1 . ASP A 122 ? 0.4944 0.5130 0.4976 0.0013  0.0073  -0.0018 122 ASP L OD1 
937  O  OD2 . ASP A 122 ? 0.4861 0.5013 0.4968 0.0002  0.0015  0.0007  122 ASP L OD2 
938  N  N   . GLU A 123 ? 0.5016 0.4915 0.5049 0.0022  -0.0013 -0.0060 123 GLU L N   
939  C  CA  . GLU A 123 ? 0.5200 0.5116 0.5118 0.0011  -0.0017 -0.0016 123 GLU L CA  
940  C  C   . GLU A 123 ? 0.5154 0.5075 0.5081 -0.0010 -0.0023 -0.0013 123 GLU L C   
941  O  O   . GLU A 123 ? 0.5240 0.5115 0.5158 -0.0014 -0.0013 -0.0030 123 GLU L O   
942  C  CB  . GLU A 123 ? 0.5218 0.5153 0.5142 0.0007  -0.0018 -0.0031 123 GLU L CB  
943  C  CG  . GLU A 123 ? 0.5423 0.5319 0.5290 0.0033  -0.0094 0.0015  123 GLU L CG  
944  C  CD  . GLU A 123 ? 0.5443 0.5398 0.5367 0.0001  -0.0062 0.0003  123 GLU L CD  
945  O  OE1 . GLU A 123 ? 0.5822 0.5632 0.5470 0.0052  -0.0070 0.0056  123 GLU L OE1 
946  O  OE2 . GLU A 123 ? 0.5705 0.5751 0.5754 -0.0053 0.0044  0.0110  123 GLU L OE2 
947  N  N   . GLN A 124 ? 0.5117 0.5051 0.5022 -0.0006 -0.0019 -0.0007 124 GLN L N   
948  C  CA  . GLN A 124 ? 0.5027 0.4982 0.4947 -0.0023 -0.0013 0.0011  124 GLN L CA  
949  C  C   . GLN A 124 ? 0.5186 0.5162 0.5122 -0.0038 -0.0013 -0.0001 124 GLN L C   
950  O  O   . GLN A 124 ? 0.5209 0.5195 0.5175 -0.0073 -0.0017 0.0004  124 GLN L O   
951  C  CB  . GLN A 124 ? 0.4988 0.4974 0.4890 -0.0014 -0.0004 0.0000  124 GLN L CB  
952  C  CG  . GLN A 124 ? 0.4803 0.4741 0.4722 -0.0065 -0.0064 0.0020  124 GLN L CG  
953  C  CD  . GLN A 124 ? 0.4663 0.4685 0.4591 -0.0061 -0.0031 0.0020  124 GLN L CD  
954  O  OE1 . GLN A 124 ? 0.4380 0.4171 0.4322 -0.0045 -0.0132 -0.0164 124 GLN L OE1 
955  N  NE2 . GLN A 124 ? 0.3999 0.3905 0.4203 -0.0152 -0.0125 0.0110  124 GLN L NE2 
956  N  N   . LEU A 125 ? 0.5325 0.5303 0.5229 -0.0027 -0.0013 0.0008  125 LEU L N   
957  C  CA  . LEU A 125 ? 0.5402 0.5437 0.5385 -0.0038 -0.0024 0.0013  125 LEU L CA  
958  C  C   . LEU A 125 ? 0.5509 0.5482 0.5499 -0.0028 -0.0028 0.0003  125 LEU L C   
959  O  O   . LEU A 125 ? 0.5575 0.5533 0.5590 -0.0031 -0.0022 -0.0012 125 LEU L O   
960  C  CB  . LEU A 125 ? 0.5386 0.5431 0.5379 -0.0039 -0.0023 0.0012  125 LEU L CB  
961  C  CG  . LEU A 125 ? 0.5374 0.5370 0.5345 0.0009  -0.0017 0.0023  125 LEU L CG  
962  C  CD1 . LEU A 125 ? 0.5389 0.5274 0.5333 0.0016  -0.0047 0.0036  125 LEU L CD1 
963  C  CD2 . LEU A 125 ? 0.5353 0.5367 0.5344 -0.0033 -0.0022 0.0079  125 LEU L CD2 
964  N  N   . LYS A 126 ? 0.5598 0.5577 0.5612 -0.0008 -0.0026 -0.0011 126 LYS L N   
965  C  CA  . LYS A 126 ? 0.5682 0.5654 0.5677 -0.0015 -0.0010 -0.0001 126 LYS L CA  
966  C  C   . LYS A 126 ? 0.5632 0.5600 0.5638 -0.0016 -0.0020 0.0001  126 LYS L C   
967  O  O   . LYS A 126 ? 0.5647 0.5636 0.5676 -0.0009 -0.0027 0.0004  126 LYS L O   
968  C  CB  . LYS A 126 ? 0.5695 0.5656 0.5720 0.0006  -0.0012 0.0001  126 LYS L CB  
969  C  CG  . LYS A 126 ? 0.5761 0.5745 0.5763 0.0009  0.0010  -0.0006 126 LYS L CG  
970  C  CD  . LYS A 126 ? 0.5865 0.5835 0.5898 0.0003  0.0019  -0.0019 126 LYS L CD  
971  C  CE  . LYS A 126 ? 0.6137 0.5595 0.6140 -0.0073 -0.0098 -0.0005 126 LYS L CE  
972  N  NZ  . LYS A 126 ? 0.6364 0.6324 0.6397 -0.0078 -0.0026 0.0009  126 LYS L NZ  
973  N  N   . SER A 127 ? 0.5540 0.5505 0.5526 -0.0007 -0.0018 0.0000  127 SER L N   
974  C  CA  . SER A 127 ? 0.5416 0.5418 0.5440 -0.0010 -0.0016 0.0017  127 SER L CA  
975  C  C   . SER A 127 ? 0.5312 0.5315 0.5305 -0.0040 -0.0015 0.0021  127 SER L C   
976  O  O   . SER A 127 ? 0.5315 0.5323 0.5349 -0.0047 -0.0001 0.0022  127 SER L O   
977  C  CB  . SER A 127 ? 0.5435 0.5485 0.5464 -0.0017 -0.0017 0.0014  127 SER L CB  
978  O  OG  . SER A 127 ? 0.5573 0.5558 0.5527 0.0056  -0.0115 0.0039  127 SER L OG  
979  N  N   . GLY A 128 ? 0.5124 0.5173 0.5162 -0.0044 -0.0009 0.0000  128 GLY L N   
980  C  CA  . GLY A 128 ? 0.4996 0.4953 0.4940 -0.0041 -0.0010 0.0011  128 GLY L CA  
981  C  C   . GLY A 128 ? 0.4804 0.4841 0.4791 -0.0037 -0.0018 0.0040  128 GLY L C   
982  O  O   . GLY A 128 ? 0.4828 0.4845 0.4785 -0.0028 -0.0018 0.0065  128 GLY L O   
983  N  N   . THR A 129 ? 0.4708 0.4674 0.4640 -0.0012 -0.0040 0.0034  129 THR L N   
984  C  CA  . THR A 129 ? 0.4483 0.4497 0.4446 -0.0016 -0.0034 0.0035  129 THR L CA  
985  C  C   . THR A 129 ? 0.4290 0.4303 0.4308 -0.0017 -0.0058 0.0003  129 THR L C   
986  O  O   . THR A 129 ? 0.4174 0.4213 0.4165 -0.0023 -0.0085 -0.0014 129 THR L O   
987  C  CB  . THR A 129 ? 0.4537 0.4512 0.4482 -0.0032 -0.0027 0.0011  129 THR L CB  
988  O  OG1 . THR A 129 ? 0.4561 0.4587 0.4542 -0.0080 -0.0002 0.0001  129 THR L OG1 
989  C  CG2 . THR A 129 ? 0.4546 0.4538 0.4500 0.0007  -0.0015 0.0081  129 THR L CG2 
990  N  N   . ALA A 130 ? 0.4087 0.4117 0.4139 -0.0035 -0.0018 0.0001  130 ALA L N   
991  C  CA  . ALA A 130 ? 0.3877 0.3901 0.3938 -0.0020 0.0000  -0.0033 130 ALA L CA  
992  C  C   . ALA A 130 ? 0.3775 0.3842 0.3817 -0.0001 0.0007  -0.0022 130 ALA L C   
993  O  O   . ALA A 130 ? 0.3804 0.3778 0.3814 0.0046  0.0020  -0.0020 130 ALA L O   
994  C  CB  . ALA A 130 ? 0.3827 0.3875 0.3873 -0.0030 0.0011  -0.0054 130 ALA L CB  
995  N  N   . SER A 131 ? 0.3633 0.3639 0.3590 -0.0030 -0.0023 -0.0041 131 SER L N   
996  C  CA  . SER A 131 ? 0.3445 0.3486 0.3425 -0.0018 -0.0029 -0.0033 131 SER L CA  
997  C  C   . SER A 131 ? 0.3338 0.3335 0.3289 -0.0025 -0.0055 -0.0034 131 SER L C   
998  O  O   . SER A 131 ? 0.3380 0.3307 0.3295 -0.0066 -0.0020 -0.0015 131 SER L O   
999  C  CB  . SER A 131 ? 0.3427 0.3507 0.3432 -0.0016 -0.0055 -0.0020 131 SER L CB  
1000 O  OG  . SER A 131 ? 0.3214 0.3432 0.3429 -0.0005 -0.0103 -0.0052 131 SER L OG  
1001 N  N   . VAL A 132 ? 0.3257 0.3247 0.3151 -0.0055 -0.0043 -0.0042 132 VAL L N   
1002 C  CA  . VAL A 132 ? 0.3160 0.3177 0.3067 -0.0040 -0.0027 -0.0027 132 VAL L CA  
1003 C  C   . VAL A 132 ? 0.3032 0.3114 0.2964 -0.0027 -0.0053 -0.0020 132 VAL L C   
1004 O  O   . VAL A 132 ? 0.3010 0.3076 0.2979 -0.0043 -0.0048 -0.0055 132 VAL L O   
1005 C  CB  . VAL A 132 ? 0.3145 0.3158 0.3013 -0.0074 -0.0032 -0.0014 132 VAL L CB  
1006 C  CG1 . VAL A 132 ? 0.3296 0.3174 0.3061 -0.0041 -0.0060 -0.0062 132 VAL L CG1 
1007 C  CG2 . VAL A 132 ? 0.3178 0.3292 0.3028 -0.0049 -0.0037 -0.0034 132 VAL L CG2 
1008 N  N   . VAL A 133 ? 0.2941 0.3058 0.2886 0.0034  -0.0050 -0.0034 133 VAL L N   
1009 C  CA  . VAL A 133 ? 0.2850 0.2973 0.2907 0.0028  -0.0044 0.0015  133 VAL L CA  
1010 C  C   . VAL A 133 ? 0.2841 0.3001 0.2888 0.0056  -0.0026 0.0002  133 VAL L C   
1011 O  O   . VAL A 133 ? 0.2731 0.2982 0.2945 0.0116  -0.0027 -0.0014 133 VAL L O   
1012 C  CB  . VAL A 133 ? 0.2837 0.2948 0.2924 0.0049  -0.0052 0.0031  133 VAL L CB  
1013 C  CG1 . VAL A 133 ? 0.2567 0.2847 0.2618 0.0067  -0.0139 0.0044  133 VAL L CG1 
1014 C  CG2 . VAL A 133 ? 0.2836 0.3038 0.2914 0.0070  -0.0033 0.0041  133 VAL L CG2 
1015 N  N   . CYS A 134 ? 0.2873 0.3017 0.2920 -0.0015 0.0017  -0.0008 134 CYS L N   
1016 C  CA  . CYS A 134 ? 0.2841 0.2960 0.2898 -0.0013 0.0020  -0.0018 134 CYS L CA  
1017 C  C   . CYS A 134 ? 0.2782 0.2879 0.2815 -0.0009 0.0011  -0.0027 134 CYS L C   
1018 O  O   . CYS A 134 ? 0.2731 0.2901 0.2771 -0.0025 0.0000  0.0001  134 CYS L O   
1019 C  CB  . CYS A 134 ? 0.2836 0.2987 0.2904 -0.0035 -0.0022 -0.0012 134 CYS L CB  
1020 S  SG  . CYS A 134 ? 0.3078 0.3195 0.3048 -0.0027 0.0074  0.0003  134 CYS L SG  
1021 N  N   . LEU A 135 ? 0.2760 0.2820 0.2758 -0.0040 0.0000  -0.0019 135 LEU L N   
1022 C  CA  . LEU A 135 ? 0.2667 0.2760 0.2681 -0.0015 -0.0013 -0.0017 135 LEU L CA  
1023 C  C   . LEU A 135 ? 0.2675 0.2765 0.2728 -0.0020 -0.0017 -0.0020 135 LEU L C   
1024 O  O   . LEU A 135 ? 0.2668 0.2787 0.2728 -0.0051 -0.0008 -0.0019 135 LEU L O   
1025 C  CB  . LEU A 135 ? 0.2659 0.2713 0.2670 0.0000  0.0000  -0.0008 135 LEU L CB  
1026 C  CG  . LEU A 135 ? 0.2618 0.2698 0.2620 0.0031  -0.0010 -0.0010 135 LEU L CG  
1027 C  CD1 . LEU A 135 ? 0.2193 0.2411 0.2473 0.0115  -0.0046 0.0011  135 LEU L CD1 
1028 C  CD2 . LEU A 135 ? 0.2604 0.2715 0.2602 0.0034  0.0008  -0.0024 135 LEU L CD2 
1029 N  N   . LEU A 136 ? 0.2626 0.2723 0.2719 -0.0015 -0.0016 -0.0039 136 LEU L N   
1030 C  CA  . LEU A 136 ? 0.2614 0.2712 0.2754 -0.0013 -0.0009 -0.0007 136 LEU L CA  
1031 C  C   . LEU A 136 ? 0.2616 0.2737 0.2746 -0.0036 -0.0015 -0.0026 136 LEU L C   
1032 O  O   . LEU A 136 ? 0.2499 0.2754 0.2748 -0.0060 -0.0061 -0.0034 136 LEU L O   
1033 C  CB  . LEU A 136 ? 0.2641 0.2717 0.2770 -0.0040 0.0025  0.0006  136 LEU L CB  
1034 C  CG  . LEU A 136 ? 0.2640 0.2728 0.2726 0.0040  -0.0052 0.0020  136 LEU L CG  
1035 C  CD1 . LEU A 136 ? 0.2827 0.2663 0.2559 -0.0040 -0.0113 0.0105  136 LEU L CD1 
1036 C  CD2 . LEU A 136 ? 0.2421 0.2697 0.2474 0.0122  -0.0063 -0.0054 136 LEU L CD2 
1037 N  N   . ASN A 137 ? 0.2625 0.2722 0.2803 -0.0031 -0.0021 -0.0046 137 ASN L N   
1038 C  CA  . ASN A 137 ? 0.2660 0.2812 0.2798 -0.0005 0.0003  -0.0025 137 ASN L CA  
1039 C  C   . ASN A 137 ? 0.2705 0.2919 0.2837 -0.0040 -0.0009 -0.0010 137 ASN L C   
1040 O  O   . ASN A 137 ? 0.2741 0.2969 0.2860 -0.0023 -0.0006 0.0045  137 ASN L O   
1041 C  CB  . ASN A 137 ? 0.2695 0.2886 0.2853 -0.0039 -0.0021 -0.0007 137 ASN L CB  
1042 C  CG  . ASN A 137 ? 0.2632 0.2795 0.2730 0.0010  -0.0022 -0.0015 137 ASN L CG  
1043 O  OD1 . ASN A 137 ? 0.2683 0.2640 0.2742 -0.0042 -0.0020 -0.0013 137 ASN L OD1 
1044 N  ND2 . ASN A 137 ? 0.2495 0.2565 0.2616 0.0084  -0.0037 0.0130  137 ASN L ND2 
1045 N  N   . ASN A 138 ? 0.2787 0.2969 0.2775 -0.0015 0.0012  -0.0038 138 ASN L N   
1046 C  CA  . ASN A 138 ? 0.2847 0.2958 0.2769 -0.0012 0.0000  -0.0062 138 ASN L CA  
1047 C  C   . ASN A 138 ? 0.2822 0.2931 0.2715 -0.0034 0.0009  -0.0066 138 ASN L C   
1048 O  O   . ASN A 138 ? 0.2809 0.2900 0.2656 -0.0068 0.0019  -0.0062 138 ASN L O   
1049 C  CB  . ASN A 138 ? 0.2886 0.3080 0.2841 -0.0013 -0.0003 -0.0079 138 ASN L CB  
1050 C  CG  . ASN A 138 ? 0.3111 0.3168 0.3158 0.0006  0.0025  -0.0016 138 ASN L CG  
1051 O  OD1 . ASN A 138 ? 0.3584 0.3579 0.3591 -0.0078 0.0107  0.0101  138 ASN L OD1 
1052 N  ND2 . ASN A 138 ? 0.3219 0.3406 0.3413 -0.0083 0.0040  -0.0092 138 ASN L ND2 
1053 N  N   . PHE A 139 ? 0.2821 0.2882 0.2685 -0.0026 -0.0007 -0.0076 139 PHE L N   
1054 C  CA  . PHE A 139 ? 0.2794 0.2785 0.2668 -0.0013 0.0025  -0.0036 139 PHE L CA  
1055 C  C   . PHE A 139 ? 0.2907 0.2890 0.2766 -0.0021 0.0010  -0.0039 139 PHE L C   
1056 O  O   . PHE A 139 ? 0.2906 0.2918 0.2794 0.0003  -0.0041 -0.0090 139 PHE L O   
1057 C  CB  . PHE A 139 ? 0.2693 0.2637 0.2541 -0.0019 0.0023  -0.0021 139 PHE L CB  
1058 C  CG  . PHE A 139 ? 0.2587 0.2531 0.2556 0.0001  -0.0010 -0.0038 139 PHE L CG  
1059 C  CD1 . PHE A 139 ? 0.2524 0.2373 0.2632 0.0068  0.0003  0.0031  139 PHE L CD1 
1060 C  CD2 . PHE A 139 ? 0.2267 0.2344 0.2305 -0.0020 -0.0118 -0.0064 139 PHE L CD2 
1061 C  CE1 . PHE A 139 ? 0.2399 0.2350 0.2379 0.0061  0.0019  -0.0015 139 PHE L CE1 
1062 C  CE2 . PHE A 139 ? 0.2097 0.2034 0.2135 -0.0056 -0.0165 -0.0098 139 PHE L CE2 
1063 C  CZ  . PHE A 139 ? 0.2288 0.2336 0.2374 -0.0030 -0.0060 -0.0078 139 PHE L CZ  
1064 N  N   . TYR A 140 ? 0.2976 0.2943 0.2869 -0.0020 0.0025  -0.0022 140 TYR L N   
1065 C  CA  . TYR A 140 ? 0.3030 0.3078 0.2986 -0.0005 0.0035  -0.0031 140 TYR L CA  
1066 C  C   . TYR A 140 ? 0.3184 0.3214 0.3149 0.0002  0.0037  0.0008  140 TYR L C   
1067 O  O   . TYR A 140 ? 0.3247 0.3331 0.3239 0.0028  0.0067  0.0013  140 TYR L O   
1068 C  CB  . TYR A 140 ? 0.2981 0.2958 0.2928 -0.0014 0.0048  -0.0048 140 TYR L CB  
1069 C  CG  . TYR A 140 ? 0.2836 0.2862 0.2902 -0.0059 0.0016  -0.0017 140 TYR L CG  
1070 C  CD1 . TYR A 140 ? 0.2605 0.2721 0.2726 -0.0164 -0.0008 -0.0062 140 TYR L CD1 
1071 C  CD2 . TYR A 140 ? 0.2684 0.2718 0.2804 -0.0042 0.0006  0.0023  140 TYR L CD2 
1072 C  CE1 . TYR A 140 ? 0.2751 0.2822 0.2870 -0.0095 -0.0009 0.0009  140 TYR L CE1 
1073 C  CE2 . TYR A 140 ? 0.2527 0.2502 0.2652 -0.0114 -0.0069 0.0043  140 TYR L CE2 
1074 C  CZ  . TYR A 140 ? 0.2676 0.2714 0.2823 -0.0130 -0.0050 -0.0014 140 TYR L CZ  
1075 O  OH  . TYR A 140 ? 0.2750 0.2751 0.2920 -0.0097 0.0020  -0.0040 140 TYR L OH  
1076 N  N   . PRO A 141 ? 0.3291 0.3297 0.3296 0.0029  0.0035  -0.0008 141 PRO L N   
1077 C  CA  . PRO A 141 ? 0.3379 0.3448 0.3403 0.0038  0.0030  0.0002  141 PRO L CA  
1078 C  C   . PRO A 141 ? 0.3492 0.3597 0.3594 0.0012  0.0026  0.0012  141 PRO L C   
1079 O  O   . PRO A 141 ? 0.3365 0.3566 0.3484 0.0013  -0.0006 0.0017  141 PRO L O   
1080 C  CB  . PRO A 141 ? 0.3363 0.3406 0.3350 0.0015  0.0052  -0.0001 141 PRO L CB  
1081 C  CG  . PRO A 141 ? 0.3330 0.3306 0.3347 0.0017  0.0015  -0.0029 141 PRO L CG  
1082 C  CD  . PRO A 141 ? 0.3259 0.3331 0.3257 -0.0012 0.0015  -0.0005 141 PRO L CD  
1083 N  N   . ARG A 142 ? 0.3753 0.3880 0.3789 0.0019  0.0020  -0.0013 142 ARG L N   
1084 C  CA  . ARG A 142 ? 0.4050 0.4106 0.4062 -0.0010 0.0017  0.0015  142 ARG L CA  
1085 C  C   . ARG A 142 ? 0.4079 0.4168 0.4070 -0.0019 0.0007  -0.0003 142 ARG L C   
1086 O  O   . ARG A 142 ? 0.4123 0.4236 0.4114 -0.0007 0.0007  0.0005  142 ARG L O   
1087 C  CB  . ARG A 142 ? 0.3990 0.4120 0.4030 -0.0005 0.0004  0.0011  142 ARG L CB  
1088 C  CG  . ARG A 142 ? 0.4210 0.4315 0.4190 -0.0043 -0.0015 0.0060  142 ARG L CG  
1089 C  CD  . ARG A 142 ? 0.4402 0.4411 0.4298 -0.0006 0.0072  0.0007  142 ARG L CD  
1090 N  NE  . ARG A 142 ? 0.4736 0.4814 0.4731 0.0034  -0.0057 0.0123  142 ARG L NE  
1091 C  CZ  . ARG A 142 ? 0.5769 0.5370 0.5226 -0.0067 0.0031  0.0032  142 ARG L CZ  
1092 N  NH1 . ARG A 142 ? 0.5360 0.5594 0.5531 -0.0074 0.0127  -0.0039 142 ARG L NH1 
1093 N  NH2 . ARG A 142 ? 0.5062 0.5100 0.5147 -0.0039 -0.0034 0.0022  142 ARG L NH2 
1094 N  N   . GLU A 143 ? 0.4183 0.4234 0.4148 0.0000  0.0019  -0.0018 143 GLU L N   
1095 C  CA  . GLU A 143 ? 0.4328 0.4387 0.4290 0.0009  -0.0019 -0.0015 143 GLU L CA  
1096 C  C   . GLU A 143 ? 0.4214 0.4308 0.4251 0.0000  -0.0025 -0.0021 143 GLU L C   
1097 O  O   . GLU A 143 ? 0.4171 0.4356 0.4240 0.0010  -0.0016 -0.0026 143 GLU L O   
1098 C  CB  . GLU A 143 ? 0.4350 0.4383 0.4314 0.0014  0.0000  -0.0039 143 GLU L CB  
1099 C  CG  . GLU A 143 ? 0.4601 0.4601 0.4510 0.0047  -0.0044 -0.0015 143 GLU L CG  
1100 C  CD  . GLU A 143 ? 0.4709 0.4672 0.4617 0.0062  -0.0056 0.0020  143 GLU L CD  
1101 O  OE1 . GLU A 143 ? 0.4967 0.5065 0.4865 0.0033  -0.0220 -0.0040 143 GLU L OE1 
1102 O  OE2 . GLU A 143 ? 0.5316 0.4969 0.5170 -0.0101 -0.0067 0.0044  143 GLU L OE2 
1103 N  N   . ALA A 144 ? 0.4180 0.4277 0.4202 -0.0009 -0.0022 -0.0010 144 ALA L N   
1104 C  CA  . ALA A 144 ? 0.4154 0.4228 0.4119 -0.0021 -0.0014 -0.0027 144 ALA L CA  
1105 C  C   . ALA A 144 ? 0.4159 0.4186 0.4095 -0.0039 -0.0027 -0.0030 144 ALA L C   
1106 O  O   . ALA A 144 ? 0.4109 0.4160 0.4045 -0.0082 -0.0015 -0.0036 144 ALA L O   
1107 C  CB  . ALA A 144 ? 0.4142 0.4214 0.4077 -0.0031 -0.0050 -0.0043 144 ALA L CB  
1108 N  N   . LYS A 145 ? 0.4141 0.4174 0.4082 -0.0023 -0.0016 -0.0021 145 LYS L N   
1109 C  CA  . LYS A 145 ? 0.4139 0.4175 0.4101 0.0003  -0.0008 -0.0028 145 LYS L CA  
1110 C  C   . LYS A 145 ? 0.4034 0.4097 0.4009 -0.0010 -0.0024 -0.0009 145 LYS L C   
1111 O  O   . LYS A 145 ? 0.3945 0.4027 0.3979 0.0033  -0.0026 -0.0058 145 LYS L O   
1112 C  CB  . LYS A 145 ? 0.4113 0.4181 0.4108 0.0000  -0.0010 -0.0040 145 LYS L CB  
1113 C  CG  . LYS A 145 ? 0.4268 0.4332 0.4302 0.0046  -0.0042 -0.0052 145 LYS L CG  
1114 C  CD  . LYS A 145 ? 0.4314 0.4412 0.4305 0.0039  -0.0035 -0.0019 145 LYS L CD  
1115 C  CE  . LYS A 145 ? 0.4580 0.4630 0.4425 0.0047  -0.0063 0.0010  145 LYS L CE  
1116 N  NZ  . LYS A 145 ? 0.4639 0.4747 0.4466 0.0125  -0.0043 -0.0012 145 LYS L NZ  
1117 N  N   . VAL A 146 ? 0.3975 0.4017 0.3969 -0.0030 -0.0003 -0.0040 146 VAL L N   
1118 C  CA  . VAL A 146 ? 0.3949 0.4006 0.3888 -0.0033 0.0030  -0.0010 146 VAL L CA  
1119 C  C   . VAL A 146 ? 0.3889 0.3934 0.3824 -0.0044 0.0008  -0.0026 146 VAL L C   
1120 O  O   . VAL A 146 ? 0.3841 0.3920 0.3814 -0.0059 -0.0002 -0.0064 146 VAL L O   
1121 C  CB  . VAL A 146 ? 0.3970 0.3997 0.3836 -0.0027 0.0003  0.0011  146 VAL L CB  
1122 C  CG1 . VAL A 146 ? 0.4030 0.4060 0.3878 0.0021  0.0021  0.0042  146 VAL L CG1 
1123 C  CG2 . VAL A 146 ? 0.4086 0.4093 0.3879 -0.0026 0.0023  0.0090  146 VAL L CG2 
1124 N  N   . GLN A 147 ? 0.3790 0.3868 0.3802 -0.0040 0.0009  0.0019  147 GLN L N   
1125 C  CA  . GLN A 147 ? 0.3704 0.3777 0.3745 -0.0020 0.0006  -0.0004 147 GLN L CA  
1126 C  C   . GLN A 147 ? 0.3638 0.3763 0.3700 -0.0008 0.0016  0.0000  147 GLN L C   
1127 O  O   . GLN A 147 ? 0.3520 0.3761 0.3740 -0.0011 -0.0008 0.0017  147 GLN L O   
1128 C  CB  . GLN A 147 ? 0.3710 0.3759 0.3748 -0.0017 0.0002  0.0014  147 GLN L CB  
1129 C  CG  . GLN A 147 ? 0.3779 0.3782 0.3810 -0.0023 -0.0006 -0.0060 147 GLN L CG  
1130 C  CD  . GLN A 147 ? 0.3971 0.3839 0.3973 0.0032  -0.0005 -0.0039 147 GLN L CD  
1131 O  OE1 . GLN A 147 ? 0.4089 0.3731 0.4071 0.0097  0.0002  0.0066  147 GLN L OE1 
1132 N  NE2 . GLN A 147 ? 0.4098 0.4108 0.4331 0.0052  -0.0048 -0.0088 147 GLN L NE2 
1133 N  N   . TRP A 148 ? 0.3534 0.3684 0.3628 -0.0002 0.0032  -0.0010 148 TRP L N   
1134 C  CA  . TRP A 148 ? 0.3506 0.3658 0.3559 -0.0006 0.0042  -0.0013 148 TRP L CA  
1135 C  C   . TRP A 148 ? 0.3507 0.3665 0.3550 0.0002  0.0043  -0.0029 148 TRP L C   
1136 O  O   . TRP A 148 ? 0.3547 0.3673 0.3574 0.0023  0.0055  -0.0061 148 TRP L O   
1137 C  CB  . TRP A 148 ? 0.3449 0.3627 0.3526 0.0020  0.0017  -0.0011 148 TRP L CB  
1138 C  CG  . TRP A 148 ? 0.3468 0.3559 0.3563 -0.0003 0.0019  0.0015  148 TRP L CG  
1139 C  CD1 . TRP A 148 ? 0.3405 0.3511 0.3524 0.0031  0.0051  -0.0061 148 TRP L CD1 
1140 C  CD2 . TRP A 148 ? 0.3486 0.3480 0.3520 -0.0070 0.0037  0.0015  148 TRP L CD2 
1141 N  NE1 . TRP A 148 ? 0.3459 0.3611 0.3456 0.0016  0.0038  -0.0080 148 TRP L NE1 
1142 C  CE2 . TRP A 148 ? 0.3505 0.3529 0.3611 -0.0056 -0.0019 -0.0027 148 TRP L CE2 
1143 C  CE3 . TRP A 148 ? 0.3360 0.3448 0.3442 -0.0019 0.0051  0.0052  148 TRP L CE3 
1144 C  CZ2 . TRP A 148 ? 0.3382 0.3454 0.3523 -0.0035 -0.0014 -0.0039 148 TRP L CZ2 
1145 C  CZ3 . TRP A 148 ? 0.3523 0.3607 0.3542 -0.0057 0.0017  0.0014  148 TRP L CZ3 
1146 C  CH2 . TRP A 148 ? 0.3455 0.3534 0.3490 -0.0055 -0.0005 0.0020  148 TRP L CH2 
1147 N  N   . LYS A 149 ? 0.3492 0.3595 0.3504 -0.0014 0.0025  -0.0056 149 LYS L N   
1148 C  CA  . LYS A 149 ? 0.3425 0.3530 0.3439 -0.0020 0.0010  -0.0047 149 LYS L CA  
1149 C  C   . LYS A 149 ? 0.3428 0.3494 0.3395 -0.0031 0.0000  -0.0046 149 LYS L C   
1150 O  O   . LYS A 149 ? 0.3484 0.3517 0.3410 -0.0076 0.0019  -0.0090 149 LYS L O   
1151 C  CB  . LYS A 149 ? 0.3431 0.3544 0.3442 -0.0022 -0.0025 -0.0061 149 LYS L CB  
1152 C  CG  . LYS A 149 ? 0.3561 0.3685 0.3510 0.0045  0.0004  -0.0042 149 LYS L CG  
1153 C  CD  . LYS A 149 ? 0.3669 0.3690 0.3880 -0.0113 -0.0055 0.0017  149 LYS L CD  
1154 C  CE  . LYS A 149 ? 0.3788 0.3877 0.4018 -0.0065 -0.0003 -0.0006 149 LYS L CE  
1155 N  NZ  . LYS A 149 ? 0.4148 0.4064 0.4135 -0.0006 -0.0005 0.0100  149 LYS L NZ  
1156 N  N   . VAL A 150 ? 0.3399 0.3407 0.3339 -0.0032 0.0022  0.0007  150 VAL L N   
1157 C  CA  . VAL A 150 ? 0.3360 0.3391 0.3280 -0.0024 0.0034  0.0017  150 VAL L CA  
1158 C  C   . VAL A 150 ? 0.3379 0.3367 0.3301 -0.0023 0.0018  0.0022  150 VAL L C   
1159 O  O   . VAL A 150 ? 0.3344 0.3340 0.3227 0.0013  0.0027  0.0048  150 VAL L O   
1160 C  CB  . VAL A 150 ? 0.3313 0.3360 0.3289 -0.0012 0.0023  0.0029  150 VAL L CB  
1161 C  CG1 . VAL A 150 ? 0.3062 0.3187 0.3179 0.0017  0.0066  0.0011  150 VAL L CG1 
1162 C  CG2 . VAL A 150 ? 0.3259 0.3405 0.3179 0.0002  0.0092  0.0040  150 VAL L CG2 
1163 N  N   . ASP A 151 ? 0.3447 0.3415 0.3341 -0.0035 0.0003  0.0025  151 ASP L N   
1164 C  CA  . ASP A 151 ? 0.3542 0.3511 0.3395 -0.0037 0.0008  0.0017  151 ASP L CA  
1165 C  C   . ASP A 151 ? 0.3619 0.3568 0.3470 -0.0009 0.0022  0.0020  151 ASP L C   
1166 O  O   . ASP A 151 ? 0.3668 0.3589 0.3402 -0.0030 -0.0008 0.0040  151 ASP L O   
1167 C  CB  . ASP A 151 ? 0.3501 0.3450 0.3349 -0.0041 -0.0025 0.0006  151 ASP L CB  
1168 C  CG  . ASP A 151 ? 0.3386 0.3468 0.3272 -0.0068 -0.0002 -0.0093 151 ASP L CG  
1169 O  OD1 . ASP A 151 ? 0.3114 0.3244 0.3015 -0.0090 -0.0007 -0.0173 151 ASP L OD1 
1170 O  OD2 . ASP A 151 ? 0.3721 0.3694 0.3515 -0.0137 -0.0096 -0.0070 151 ASP L OD2 
1171 N  N   . ASN A 152 ? 0.3735 0.3674 0.3590 -0.0016 0.0023  0.0000  152 ASN L N   
1172 C  CA  . ASN A 152 ? 0.3855 0.3807 0.3755 0.0000  0.0028  0.0031  152 ASN L CA  
1173 C  C   . ASN A 152 ? 0.3763 0.3758 0.3717 -0.0012 0.0012  0.0012  152 ASN L C   
1174 O  O   . ASN A 152 ? 0.3766 0.3798 0.3774 0.0024  -0.0016 0.0017  152 ASN L O   
1175 C  CB  . ASN A 152 ? 0.3967 0.3939 0.3795 -0.0012 0.0003  0.0013  152 ASN L CB  
1176 C  CG  . ASN A 152 ? 0.4344 0.4227 0.4213 -0.0072 0.0067  0.0063  152 ASN L CG  
1177 O  OD1 . ASN A 152 ? 0.4791 0.4754 0.4714 0.0067  0.0100  -0.0035 152 ASN L OD1 
1178 N  ND2 . ASN A 152 ? 0.4700 0.4314 0.4269 0.0040  0.0094  -0.0045 152 ASN L ND2 
1179 N  N   . ALA A 153 ? 0.3654 0.3710 0.3589 -0.0015 0.0001  0.0015  153 ALA L N   
1180 C  CA  . ALA A 153 ? 0.3564 0.3610 0.3513 -0.0020 0.0002  0.0002  153 ALA L CA  
1181 C  C   . ALA A 153 ? 0.3571 0.3566 0.3501 -0.0017 0.0034  0.0016  153 ALA L C   
1182 O  O   . ALA A 153 ? 0.3531 0.3584 0.3454 -0.0045 0.0033  0.0019  153 ALA L O   
1183 C  CB  . ALA A 153 ? 0.3532 0.3623 0.3521 -0.0006 0.0023  0.0031  153 ALA L CB  
1184 N  N   . LEU A 154 ? 0.3486 0.3526 0.3413 0.0000  0.0046  0.0015  154 LEU L N   
1185 C  CA  . LEU A 154 ? 0.3478 0.3413 0.3420 -0.0011 0.0025  -0.0013 154 LEU L CA  
1186 C  C   . LEU A 154 ? 0.3357 0.3303 0.3308 -0.0003 0.0029  -0.0044 154 LEU L C   
1187 O  O   . LEU A 154 ? 0.3331 0.3202 0.3192 -0.0018 0.0085  -0.0085 154 LEU L O   
1188 C  CB  . LEU A 154 ? 0.3510 0.3497 0.3451 -0.0005 0.0016  0.0035  154 LEU L CB  
1189 C  CG  . LEU A 154 ? 0.3614 0.3497 0.3666 0.0002  -0.0020 -0.0018 154 LEU L CG  
1190 C  CD1 . LEU A 154 ? 0.3759 0.3817 0.4008 -0.0083 -0.0005 0.0034  154 LEU L CD1 
1191 C  CD2 . LEU A 154 ? 0.3628 0.3482 0.3553 0.0001  -0.0049 -0.0002 154 LEU L CD2 
1192 N  N   . GLN A 155 ? 0.3306 0.3264 0.3280 -0.0038 0.0033  -0.0039 155 GLN L N   
1193 C  CA  . GLN A 155 ? 0.3254 0.3278 0.3283 -0.0047 0.0031  -0.0033 155 GLN L CA  
1194 C  C   . GLN A 155 ? 0.3288 0.3339 0.3324 -0.0024 0.0014  -0.0027 155 GLN L C   
1195 O  O   . GLN A 155 ? 0.3246 0.3307 0.3257 0.0024  0.0000  -0.0026 155 GLN L O   
1196 C  CB  . GLN A 155 ? 0.3194 0.3234 0.3249 -0.0064 0.0024  -0.0004 155 GLN L CB  
1197 C  CG  . GLN A 155 ? 0.3076 0.3035 0.3107 -0.0096 0.0017  -0.0036 155 GLN L CG  
1198 C  CD  . GLN A 155 ? 0.3061 0.3098 0.3068 -0.0071 -0.0014 0.0016  155 GLN L CD  
1199 O  OE1 . GLN A 155 ? 0.3180 0.3224 0.3150 -0.0259 -0.0029 0.0006  155 GLN L OE1 
1200 N  NE2 . GLN A 155 ? 0.2720 0.2726 0.2765 -0.0158 0.0006  -0.0075 155 GLN L NE2 
1201 N  N   . SER A 156 ? 0.3307 0.3422 0.3383 -0.0015 0.0025  -0.0010 156 SER L N   
1202 C  CA  . SER A 156 ? 0.3395 0.3491 0.3466 -0.0026 0.0037  -0.0026 156 SER L CA  
1203 C  C   . SER A 156 ? 0.3432 0.3548 0.3522 -0.0020 0.0069  -0.0017 156 SER L C   
1204 O  O   . SER A 156 ? 0.3407 0.3681 0.3571 -0.0044 0.0096  0.0027  156 SER L O   
1205 C  CB  . SER A 156 ? 0.3409 0.3488 0.3492 -0.0011 0.0070  -0.0033 156 SER L CB  
1206 O  OG  . SER A 156 ? 0.3539 0.3661 0.3613 -0.0039 0.0060  -0.0044 156 SER L OG  
1207 N  N   . GLY A 157 ? 0.3413 0.3558 0.3524 -0.0017 0.0042  -0.0010 157 GLY L N   
1208 C  CA  . GLY A 157 ? 0.3465 0.3631 0.3568 -0.0015 0.0043  0.0008  157 GLY L CA  
1209 C  C   . GLY A 157 ? 0.3512 0.3683 0.3590 -0.0017 0.0026  0.0008  157 GLY L C   
1210 O  O   . GLY A 157 ? 0.3472 0.3780 0.3546 -0.0018 0.0055  0.0044  157 GLY L O   
1211 N  N   . ASN A 158 ? 0.3505 0.3679 0.3579 -0.0038 0.0022  0.0012  158 ASN L N   
1212 C  CA  . ASN A 158 ? 0.3504 0.3663 0.3570 0.0013  0.0014  0.0021  158 ASN L CA  
1213 C  C   . ASN A 158 ? 0.3554 0.3672 0.3556 0.0031  0.0000  0.0028  158 ASN L C   
1214 O  O   . ASN A 158 ? 0.3545 0.3612 0.3568 0.0104  -0.0033 0.0087  158 ASN L O   
1215 C  CB  . ASN A 158 ? 0.3457 0.3628 0.3513 -0.0008 0.0005  0.0003  158 ASN L CB  
1216 C  CG  . ASN A 158 ? 0.3361 0.3574 0.3562 0.0004  0.0040  0.0006  158 ASN L CG  
1217 O  OD1 . ASN A 158 ? 0.3356 0.3722 0.3425 -0.0017 0.0113  0.0056  158 ASN L OD1 
1218 N  ND2 . ASN A 158 ? 0.3046 0.3439 0.3344 0.0112  -0.0048 -0.0070 158 ASN L ND2 
1219 N  N   . SER A 159 ? 0.3550 0.3629 0.3550 0.0042  -0.0006 -0.0017 159 SER L N   
1220 C  CA  . SER A 159 ? 0.3563 0.3661 0.3588 0.0029  0.0000  -0.0006 159 SER L CA  
1221 C  C   . SER A 159 ? 0.3609 0.3679 0.3628 0.0023  -0.0006 -0.0015 159 SER L C   
1222 O  O   . SER A 159 ? 0.3656 0.3692 0.3679 -0.0005 -0.0015 -0.0004 159 SER L O   
1223 C  CB  . SER A 159 ? 0.3543 0.3616 0.3588 0.0031  -0.0030 0.0002  159 SER L CB  
1224 O  OG  . SER A 159 ? 0.3474 0.3585 0.3502 0.0008  0.0060  -0.0021 159 SER L OG  
1225 N  N   . GLN A 160 ? 0.3661 0.3731 0.3609 0.0011  -0.0003 0.0000  160 GLN L N   
1226 C  CA  . GLN A 160 ? 0.3604 0.3646 0.3598 0.0001  -0.0013 -0.0029 160 GLN L CA  
1227 C  C   . GLN A 160 ? 0.3690 0.3658 0.3580 0.0025  -0.0011 -0.0030 160 GLN L C   
1228 O  O   . GLN A 160 ? 0.3691 0.3597 0.3486 0.0068  -0.0006 -0.0029 160 GLN L O   
1229 C  CB  . GLN A 160 ? 0.3603 0.3680 0.3617 -0.0006 -0.0037 -0.0037 160 GLN L CB  
1230 C  CG  . GLN A 160 ? 0.3644 0.3680 0.3623 0.0040  0.0014  0.0010  160 GLN L CG  
1231 C  CD  . GLN A 160 ? 0.3609 0.3746 0.3640 0.0024  -0.0038 -0.0040 160 GLN L CD  
1232 O  OE1 . GLN A 160 ? 0.3297 0.3523 0.3506 0.0011  -0.0146 -0.0144 160 GLN L OE1 
1233 N  NE2 . GLN A 160 ? 0.3565 0.3941 0.3732 0.0108  -0.0006 -0.0124 160 GLN L NE2 
1234 N  N   . GLU A 161 ? 0.3663 0.3621 0.3571 0.0002  0.0009  -0.0025 161 GLU L N   
1235 C  CA  . GLU A 161 ? 0.3552 0.3620 0.3540 -0.0017 0.0015  -0.0030 161 GLU L CA  
1236 C  C   . GLU A 161 ? 0.3513 0.3604 0.3557 -0.0021 0.0044  -0.0037 161 GLU L C   
1237 O  O   . GLU A 161 ? 0.3402 0.3597 0.3454 -0.0046 0.0032  -0.0039 161 GLU L O   
1238 C  CB  . GLU A 161 ? 0.3648 0.3646 0.3656 -0.0040 0.0054  -0.0046 161 GLU L CB  
1239 C  CG  . GLU A 161 ? 0.3565 0.3658 0.3619 0.0026  0.0054  0.0024  161 GLU L CG  
1240 C  CD  . GLU A 161 ? 0.3546 0.3657 0.3557 -0.0059 0.0067  -0.0036 161 GLU L CD  
1241 O  OE1 . GLU A 161 ? 0.3423 0.3465 0.3650 -0.0034 0.0105  -0.0064 161 GLU L OE1 
1242 O  OE2 . GLU A 161 ? 0.3323 0.3852 0.3333 -0.0139 0.0291  -0.0234 161 GLU L OE2 
1243 N  N   . SER A 162 ? 0.3409 0.3530 0.3501 -0.0022 0.0021  -0.0051 162 SER L N   
1244 C  CA  . SER A 162 ? 0.3341 0.3388 0.3337 -0.0017 0.0018  -0.0033 162 SER L CA  
1245 C  C   . SER A 162 ? 0.3278 0.3316 0.3291 -0.0019 0.0014  -0.0045 162 SER L C   
1246 O  O   . SER A 162 ? 0.3171 0.3276 0.3236 -0.0030 0.0036  -0.0045 162 SER L O   
1247 C  CB  . SER A 162 ? 0.3381 0.3358 0.3350 -0.0018 0.0007  -0.0047 162 SER L CB  
1248 O  OG  . SER A 162 ? 0.3323 0.3426 0.3312 0.0059  0.0027  0.0035  162 SER L OG  
1249 N  N   . VAL A 163 ? 0.3177 0.3210 0.3239 -0.0030 -0.0016 -0.0024 163 VAL L N   
1250 C  CA  . VAL A 163 ? 0.3168 0.3127 0.3152 -0.0016 -0.0012 -0.0039 163 VAL L CA  
1251 C  C   . VAL A 163 ? 0.3158 0.3116 0.3143 -0.0035 -0.0025 -0.0053 163 VAL L C   
1252 O  O   . VAL A 163 ? 0.3231 0.3031 0.3158 -0.0069 -0.0043 -0.0075 163 VAL L O   
1253 C  CB  . VAL A 163 ? 0.3129 0.3085 0.3168 -0.0001 -0.0011 -0.0029 163 VAL L CB  
1254 C  CG1 . VAL A 163 ? 0.3081 0.3009 0.3025 0.0032  0.0008  -0.0030 163 VAL L CG1 
1255 C  CG2 . VAL A 163 ? 0.3148 0.2965 0.3128 0.0015  0.0010  -0.0058 163 VAL L CG2 
1256 N  N   . THR A 164 ? 0.3132 0.3122 0.3137 -0.0038 -0.0038 -0.0107 164 THR L N   
1257 C  CA  . THR A 164 ? 0.3142 0.3110 0.3104 -0.0007 -0.0039 -0.0062 164 THR L CA  
1258 C  C   . THR A 164 ? 0.3180 0.3128 0.3148 -0.0028 -0.0038 -0.0057 164 THR L C   
1259 O  O   . THR A 164 ? 0.3146 0.3005 0.3094 0.0014  -0.0041 -0.0072 164 THR L O   
1260 C  CB  . THR A 164 ? 0.3087 0.3062 0.3131 -0.0012 -0.0056 -0.0047 164 THR L CB  
1261 O  OG1 . THR A 164 ? 0.2906 0.3123 0.2711 -0.0046 -0.0086 -0.0033 164 THR L OG1 
1262 C  CG2 . THR A 164 ? 0.3105 0.3141 0.3222 0.0029  -0.0084 -0.0093 164 THR L CG2 
1263 N  N   . GLU A 165 ? 0.3270 0.3179 0.3175 -0.0028 -0.0022 -0.0021 165 GLU L N   
1264 C  CA  . GLU A 165 ? 0.3301 0.3194 0.3249 -0.0060 -0.0030 -0.0008 165 GLU L CA  
1265 C  C   . GLU A 165 ? 0.3312 0.3245 0.3292 -0.0037 -0.0049 -0.0002 165 GLU L C   
1266 O  O   . GLU A 165 ? 0.3238 0.3144 0.3335 -0.0039 -0.0065 0.0034  165 GLU L O   
1267 C  CB  . GLU A 165 ? 0.3353 0.3221 0.3299 -0.0049 -0.0033 0.0000  165 GLU L CB  
1268 C  CG  . GLU A 165 ? 0.3499 0.3291 0.3347 -0.0077 0.0002  -0.0016 165 GLU L CG  
1269 C  CD  . GLU A 165 ? 0.3757 0.3683 0.3629 -0.0038 0.0000  -0.0012 165 GLU L CD  
1270 O  OE1 . GLU A 165 ? 0.4079 0.3728 0.3531 0.0068  -0.0104 0.0063  165 GLU L OE1 
1271 O  OE2 . GLU A 165 ? 0.3716 0.3813 0.3802 -0.0147 -0.0005 -0.0075 165 GLU L OE2 
1272 N  N   . GLN A 166 ? 0.3312 0.3243 0.3330 -0.0036 -0.0058 0.0000  166 GLN L N   
1273 C  CA  . GLN A 166 ? 0.3343 0.3312 0.3370 -0.0049 -0.0049 -0.0010 166 GLN L CA  
1274 C  C   . GLN A 166 ? 0.3460 0.3387 0.3486 -0.0072 -0.0053 -0.0011 166 GLN L C   
1275 O  O   . GLN A 166 ? 0.3486 0.3365 0.3460 -0.0036 0.0010  0.0038  166 GLN L O   
1276 C  CB  . GLN A 166 ? 0.3252 0.3300 0.3307 -0.0057 -0.0070 -0.0007 166 GLN L CB  
1277 C  CG  . GLN A 166 ? 0.3233 0.3322 0.3358 -0.0072 -0.0067 0.0006  166 GLN L CG  
1278 C  CD  . GLN A 166 ? 0.3186 0.3336 0.3266 -0.0075 -0.0029 0.0010  166 GLN L CD  
1279 O  OE1 . GLN A 166 ? 0.3113 0.3399 0.3338 -0.0210 -0.0034 0.0189  166 GLN L OE1 
1280 N  NE2 . GLN A 166 ? 0.3211 0.3213 0.3025 -0.0190 0.0011  0.0053  166 GLN L NE2 
1281 N  N   . ASP A 167 ? 0.3578 0.3533 0.3604 -0.0083 -0.0046 -0.0009 167 ASP L N   
1282 C  CA  . ASP A 167 ? 0.3756 0.3802 0.3823 -0.0043 -0.0011 -0.0003 167 ASP L CA  
1283 C  C   . ASP A 167 ? 0.3831 0.3901 0.3922 -0.0056 0.0003  -0.0014 167 ASP L C   
1284 O  O   . ASP A 167 ? 0.3765 0.3976 0.3937 -0.0026 -0.0010 -0.0028 167 ASP L O   
1285 C  CB  . ASP A 167 ? 0.3794 0.3796 0.3858 -0.0075 -0.0027 0.0004  167 ASP L CB  
1286 C  CG  . ASP A 167 ? 0.3955 0.3941 0.4072 0.0000  -0.0012 -0.0014 167 ASP L CG  
1287 O  OD1 . ASP A 167 ? 0.4295 0.4192 0.4526 -0.0011 -0.0040 -0.0005 167 ASP L OD1 
1288 O  OD2 . ASP A 167 ? 0.4073 0.4094 0.4265 0.0092  -0.0023 -0.0048 167 ASP L OD2 
1289 N  N   . SER A 168 ? 0.4008 0.4119 0.4085 -0.0036 -0.0015 -0.0001 168 SER L N   
1290 C  CA  . SER A 168 ? 0.4206 0.4312 0.4315 -0.0006 -0.0033 0.0008  168 SER L CA  
1291 C  C   . SER A 168 ? 0.4235 0.4348 0.4363 -0.0024 -0.0032 0.0006  168 SER L C   
1292 O  O   . SER A 168 ? 0.4259 0.4347 0.4437 -0.0018 -0.0057 0.0025  168 SER L O   
1293 C  CB  . SER A 168 ? 0.4277 0.4423 0.4343 -0.0002 -0.0040 0.0003  168 SER L CB  
1294 O  OG  . SER A 168 ? 0.4452 0.4562 0.4590 0.0063  -0.0002 -0.0029 168 SER L OG  
1295 N  N   . LYS A 169 ? 0.4274 0.4399 0.4419 0.0003  0.0011  -0.0023 169 LYS L N   
1296 C  CA  . LYS A 169 ? 0.4352 0.4405 0.4452 -0.0005 0.0002  -0.0001 169 LYS L CA  
1297 C  C   . LYS A 169 ? 0.4215 0.4275 0.4354 -0.0025 -0.0011 -0.0024 169 LYS L C   
1298 O  O   . LYS A 169 ? 0.4239 0.4289 0.4401 -0.0044 -0.0009 0.0007  169 LYS L O   
1299 C  CB  . LYS A 169 ? 0.4377 0.4478 0.4450 -0.0008 0.0014  -0.0016 169 LYS L CB  
1300 C  CG  . LYS A 169 ? 0.4528 0.4638 0.4644 0.0001  0.0044  -0.0048 169 LYS L CG  
1301 C  CD  . LYS A 169 ? 0.4593 0.4618 0.4709 0.0036  0.0042  -0.0060 169 LYS L CD  
1302 C  CE  . LYS A 169 ? 0.4729 0.4408 0.4986 0.0031  0.0092  -0.0062 169 LYS L CE  
1303 N  NZ  . LYS A 169 ? 0.4809 0.5045 0.5062 -0.0018 0.0105  -0.0055 169 LYS L NZ  
1304 N  N   . ASP A 170 ? 0.4070 0.4076 0.4141 -0.0011 -0.0003 -0.0022 170 ASP L N   
1305 C  CA  . ASP A 170 ? 0.3846 0.3832 0.3954 -0.0015 0.0005  -0.0024 170 ASP L CA  
1306 C  C   . ASP A 170 ? 0.3679 0.3655 0.3718 -0.0035 0.0034  -0.0020 170 ASP L C   
1307 O  O   . ASP A 170 ? 0.3597 0.3583 0.3707 -0.0072 0.0035  -0.0023 170 ASP L O   
1308 C  CB  . ASP A 170 ? 0.3845 0.3801 0.3889 0.0008  0.0017  -0.0032 170 ASP L CB  
1309 C  CG  . ASP A 170 ? 0.3980 0.4014 0.4033 -0.0040 0.0022  -0.0041 170 ASP L CG  
1310 O  OD1 . ASP A 170 ? 0.4033 0.4066 0.4003 -0.0070 0.0016  -0.0001 170 ASP L OD1 
1311 O  OD2 . ASP A 170 ? 0.4165 0.3903 0.4263 -0.0138 0.0046  -0.0089 170 ASP L OD2 
1312 N  N   . SER A 171 ? 0.3497 0.3457 0.3565 -0.0024 -0.0004 -0.0003 171 SER L N   
1313 C  CA  . SER A 171 ? 0.3300 0.3183 0.3249 -0.0026 0.0020  -0.0026 171 SER L CA  
1314 C  C   . SER A 171 ? 0.3172 0.3058 0.3120 -0.0019 0.0034  -0.0003 171 SER L C   
1315 O  O   . SER A 171 ? 0.3118 0.2963 0.3011 -0.0060 0.0025  0.0029  171 SER L O   
1316 C  CB  . SER A 171 ? 0.3271 0.3193 0.3243 -0.0055 0.0011  -0.0019 171 SER L CB  
1317 O  OG  . SER A 171 ? 0.3296 0.2925 0.3174 -0.0083 0.0008  -0.0093 171 SER L OG  
1318 N  N   . THR A 172 ? 0.3006 0.2986 0.2941 0.0003  0.0003  -0.0017 172 THR L N   
1319 C  CA  . THR A 172 ? 0.2852 0.2850 0.2796 0.0041  0.0023  -0.0034 172 THR L CA  
1320 C  C   . THR A 172 ? 0.2818 0.2817 0.2739 0.0078  0.0007  -0.0048 172 THR L C   
1321 O  O   . THR A 172 ? 0.2813 0.2757 0.2641 0.0134  -0.0041 -0.0057 172 THR L O   
1322 C  CB  . THR A 172 ? 0.2808 0.2854 0.2785 0.0049  0.0002  -0.0028 172 THR L CB  
1323 O  OG1 . THR A 172 ? 0.2977 0.2896 0.2722 0.0025  0.0100  -0.0101 172 THR L OG1 
1324 C  CG2 . THR A 172 ? 0.2540 0.2694 0.2743 0.0035  0.0055  -0.0102 172 THR L CG2 
1325 N  N   . TYR A 173 ? 0.2746 0.2713 0.2668 0.0047  0.0057  -0.0058 173 TYR L N   
1326 C  CA  . TYR A 173 ? 0.2688 0.2633 0.2623 0.0033  0.0045  -0.0024 173 TYR L CA  
1327 C  C   . TYR A 173 ? 0.2667 0.2629 0.2624 0.0010  0.0032  -0.0001 173 TYR L C   
1328 O  O   . TYR A 173 ? 0.2608 0.2601 0.2615 0.0006  -0.0002 0.0022  173 TYR L O   
1329 C  CB  . TYR A 173 ? 0.2693 0.2575 0.2625 -0.0002 0.0044  -0.0012 173 TYR L CB  
1330 C  CG  . TYR A 173 ? 0.2619 0.2599 0.2566 0.0015  0.0089  -0.0001 173 TYR L CG  
1331 C  CD1 . TYR A 173 ? 0.2551 0.2536 0.2641 0.0031  0.0129  -0.0110 173 TYR L CD1 
1332 C  CD2 . TYR A 173 ? 0.2588 0.2580 0.2584 0.0001  0.0006  -0.0044 173 TYR L CD2 
1333 C  CE1 . TYR A 173 ? 0.2424 0.2452 0.2530 -0.0028 0.0043  -0.0103 173 TYR L CE1 
1334 C  CE2 . TYR A 173 ? 0.2474 0.2459 0.2525 -0.0003 -0.0053 -0.0065 173 TYR L CE2 
1335 C  CZ  . TYR A 173 ? 0.2483 0.2475 0.2558 0.0002  -0.0041 0.0002  173 TYR L CZ  
1336 O  OH  . TYR A 173 ? 0.2642 0.2555 0.2527 0.0084  -0.0005 0.0022  173 TYR L OH  
1337 N  N   . SER A 174 ? 0.2592 0.2621 0.2570 0.0022  0.0008  0.0038  174 SER L N   
1338 C  CA  . SER A 174 ? 0.2530 0.2638 0.2546 0.0017  0.0007  -0.0013 174 SER L CA  
1339 C  C   . SER A 174 ? 0.2588 0.2705 0.2639 -0.0012 0.0000  0.0005  174 SER L C   
1340 O  O   . SER A 174 ? 0.2578 0.2795 0.2675 -0.0054 0.0017  0.0037  174 SER L O   
1341 C  CB  . SER A 174 ? 0.2455 0.2598 0.2482 -0.0035 -0.0031 -0.0002 174 SER L CB  
1342 O  OG  . SER A 174 ? 0.2080 0.2560 0.2198 0.0223  0.0014  -0.0138 174 SER L OG  
1343 N  N   . LEU A 175 ? 0.2699 0.2710 0.2728 -0.0020 0.0002  -0.0012 175 LEU L N   
1344 C  CA  . LEU A 175 ? 0.2711 0.2774 0.2792 -0.0040 0.0016  -0.0012 175 LEU L CA  
1345 C  C   . LEU A 175 ? 0.2794 0.2901 0.2838 -0.0054 -0.0016 -0.0039 175 LEU L C   
1346 O  O   . LEU A 175 ? 0.2717 0.2911 0.2790 -0.0043 -0.0058 -0.0047 175 LEU L O   
1347 C  CB  . LEU A 175 ? 0.2727 0.2737 0.2755 -0.0074 0.0002  0.0028  175 LEU L CB  
1348 C  CG  . LEU A 175 ? 0.2708 0.2691 0.2794 0.0004  0.0057  0.0016  175 LEU L CG  
1349 C  CD1 . LEU A 175 ? 0.2936 0.2752 0.3058 -0.0058 0.0090  0.0096  175 LEU L CD1 
1350 C  CD2 . LEU A 175 ? 0.2572 0.2745 0.2737 0.0094  -0.0014 0.0184  175 LEU L CD2 
1351 N  N   . SER A 176 ? 0.2977 0.3031 0.2950 -0.0064 -0.0008 -0.0035 176 SER L N   
1352 C  CA  . SER A 176 ? 0.3144 0.3175 0.3082 -0.0079 -0.0008 -0.0054 176 SER L CA  
1353 C  C   . SER A 176 ? 0.3158 0.3235 0.3098 -0.0110 0.0026  -0.0056 176 SER L C   
1354 O  O   . SER A 176 ? 0.3182 0.3213 0.3055 -0.0184 0.0012  -0.0055 176 SER L O   
1355 C  CB  . SER A 176 ? 0.3190 0.3202 0.3087 -0.0086 -0.0006 -0.0008 176 SER L CB  
1356 O  OG  . SER A 176 ? 0.3386 0.3366 0.3264 -0.0107 0.0038  -0.0116 176 SER L OG  
1357 N  N   . SER A 177 ? 0.3206 0.3277 0.3121 -0.0108 0.0047  -0.0103 177 SER L N   
1358 C  CA  . SER A 177 ? 0.3209 0.3299 0.3085 -0.0054 0.0066  -0.0076 177 SER L CA  
1359 C  C   . SER A 177 ? 0.3234 0.3291 0.3098 -0.0074 0.0103  -0.0083 177 SER L C   
1360 O  O   . SER A 177 ? 0.3220 0.3294 0.3171 -0.0069 0.0098  -0.0080 177 SER L O   
1361 C  CB  . SER A 177 ? 0.3236 0.3338 0.3064 -0.0053 0.0077  -0.0086 177 SER L CB  
1362 O  OG  . SER A 177 ? 0.3266 0.3604 0.3018 -0.0023 0.0063  -0.0053 177 SER L OG  
1363 N  N   . THR A 178 ? 0.3227 0.3243 0.3083 -0.0034 0.0122  -0.0101 178 THR L N   
1364 C  CA  . THR A 178 ? 0.3133 0.3151 0.2981 -0.0005 0.0103  -0.0067 178 THR L CA  
1365 C  C   . THR A 178 ? 0.3096 0.3088 0.2996 -0.0019 0.0054  -0.0061 178 THR L C   
1366 O  O   . THR A 178 ? 0.3090 0.3031 0.3077 -0.0006 0.0008  -0.0102 178 THR L O   
1367 C  CB  . THR A 178 ? 0.3140 0.3201 0.2906 -0.0029 0.0108  -0.0070 178 THR L CB  
1368 O  OG1 . THR A 178 ? 0.3285 0.3440 0.2794 -0.0059 0.0117  -0.0068 178 THR L OG1 
1369 C  CG2 . THR A 178 ? 0.2995 0.3004 0.2833 0.0019  0.0178  -0.0035 178 THR L CG2 
1370 N  N   . LEU A 179 ? 0.3081 0.3058 0.3079 -0.0014 0.0035  0.0009  179 LEU L N   
1371 C  CA  . LEU A 179 ? 0.3041 0.3022 0.3037 -0.0010 -0.0013 0.0008  179 LEU L CA  
1372 C  C   . LEU A 179 ? 0.3076 0.3067 0.3104 -0.0007 -0.0009 0.0009  179 LEU L C   
1373 O  O   . LEU A 179 ? 0.3049 0.2954 0.3080 0.0008  -0.0023 0.0040  179 LEU L O   
1374 C  CB  . LEU A 179 ? 0.2954 0.2931 0.2963 -0.0009 0.0034  -0.0005 179 LEU L CB  
1375 C  CG  . LEU A 179 ? 0.3043 0.3008 0.2944 0.0017  0.0011  -0.0034 179 LEU L CG  
1376 C  CD1 . LEU A 179 ? 0.2744 0.2739 0.2799 0.0026  -0.0098 0.0080  179 LEU L CD1 
1377 C  CD2 . LEU A 179 ? 0.3061 0.3093 0.2948 -0.0083 -0.0021 0.0044  179 LEU L CD2 
1378 N  N   . THR A 180 ? 0.3119 0.3140 0.3130 0.0011  -0.0006 0.0011  180 THR L N   
1379 C  CA  . THR A 180 ? 0.3220 0.3303 0.3252 -0.0005 0.0019  0.0019  180 THR L CA  
1380 C  C   . THR A 180 ? 0.3285 0.3379 0.3299 -0.0020 0.0005  0.0011  180 THR L C   
1381 O  O   . THR A 180 ? 0.3398 0.3477 0.3425 -0.0012 -0.0010 0.0037  180 THR L O   
1382 C  CB  . THR A 180 ? 0.3207 0.3294 0.3238 -0.0036 0.0009  0.0013  180 THR L CB  
1383 O  OG1 . THR A 180 ? 0.3168 0.3253 0.3092 -0.0006 0.0050  0.0032  180 THR L OG1 
1384 C  CG2 . THR A 180 ? 0.3322 0.3266 0.3343 0.0091  -0.0005 -0.0014 180 THR L CG2 
1385 N  N   . LEU A 181 ? 0.3330 0.3386 0.3341 -0.0021 0.0014  -0.0006 181 LEU L N   
1386 C  CA  . LEU A 181 ? 0.3386 0.3483 0.3405 -0.0030 0.0013  -0.0012 181 LEU L CA  
1387 C  C   . LEU A 181 ? 0.3449 0.3494 0.3456 -0.0033 0.0001  -0.0024 181 LEU L C   
1388 O  O   . LEU A 181 ? 0.3413 0.3525 0.3408 -0.0029 -0.0021 -0.0020 181 LEU L O   
1389 C  CB  . LEU A 181 ? 0.3355 0.3425 0.3394 -0.0036 -0.0009 -0.0007 181 LEU L CB  
1390 C  CG  . LEU A 181 ? 0.3275 0.3370 0.3355 -0.0040 0.0002  -0.0012 181 LEU L CG  
1391 C  CD1 . LEU A 181 ? 0.3241 0.3361 0.3381 0.0048  -0.0060 -0.0038 181 LEU L CD1 
1392 C  CD2 . LEU A 181 ? 0.3150 0.3246 0.3340 -0.0181 0.0021  -0.0023 181 LEU L CD2 
1393 N  N   . SER A 182 ? 0.3535 0.3579 0.3530 -0.0055 -0.0003 -0.0039 182 SER L N   
1394 C  CA  . SER A 182 ? 0.3609 0.3644 0.3688 -0.0077 -0.0006 -0.0026 182 SER L CA  
1395 C  C   . SER A 182 ? 0.3651 0.3713 0.3771 -0.0077 -0.0020 -0.0038 182 SER L C   
1396 O  O   . SER A 182 ? 0.3605 0.3699 0.3709 -0.0092 -0.0030 -0.0068 182 SER L O   
1397 C  CB  . SER A 182 ? 0.3600 0.3671 0.3699 -0.0067 -0.0001 -0.0017 182 SER L CB  
1398 O  OG  . SER A 182 ? 0.3492 0.3515 0.3633 -0.0086 -0.0041 -0.0039 182 SER L OG  
1399 N  N   . LYS A 183 ? 0.3745 0.3772 0.3889 -0.0088 -0.0037 -0.0028 183 LYS L N   
1400 C  CA  . LYS A 183 ? 0.3879 0.3904 0.3985 -0.0037 0.0000  -0.0011 183 LYS L CA  
1401 C  C   . LYS A 183 ? 0.3909 0.3947 0.3997 -0.0023 -0.0006 -0.0003 183 LYS L C   
1402 O  O   . LYS A 183 ? 0.3907 0.3865 0.3952 -0.0014 -0.0027 0.0023  183 LYS L O   
1403 C  CB  . LYS A 183 ? 0.3903 0.3953 0.4008 -0.0019 -0.0006 0.0028  183 LYS L CB  
1404 C  CG  . LYS A 183 ? 0.4071 0.3961 0.4057 0.0020  -0.0013 0.0000  183 LYS L CG  
1405 C  CD  . LYS A 183 ? 0.4072 0.4021 0.4189 0.0029  -0.0010 -0.0020 183 LYS L CD  
1406 C  CE  . LYS A 183 ? 0.4552 0.4378 0.4428 0.0029  0.0016  -0.0062 183 LYS L CE  
1407 N  NZ  . LYS A 183 ? 0.4358 0.4386 0.4720 0.0096  -0.0034 0.0071  183 LYS L NZ  
1408 N  N   . ALA A 184 ? 0.3958 0.4007 0.4056 -0.0037 -0.0007 -0.0009 184 ALA L N   
1409 C  CA  . ALA A 184 ? 0.3957 0.4050 0.4059 -0.0031 -0.0021 0.0003  184 ALA L CA  
1410 C  C   . ALA A 184 ? 0.3952 0.4054 0.4060 -0.0010 -0.0017 0.0002  184 ALA L C   
1411 O  O   . ALA A 184 ? 0.4023 0.4113 0.4106 0.0023  0.0004  -0.0008 184 ALA L O   
1412 C  CB  . ALA A 184 ? 0.3949 0.4060 0.4032 -0.0031 0.0004  -0.0005 184 ALA L CB  
1413 N  N   . ASP A 185 ? 0.3916 0.4053 0.4044 -0.0026 -0.0010 -0.0008 185 ASP L N   
1414 C  CA  . ASP A 185 ? 0.3939 0.4045 0.4072 -0.0031 0.0018  -0.0010 185 ASP L CA  
1415 C  C   . ASP A 185 ? 0.4008 0.4081 0.4080 -0.0021 0.0021  -0.0003 185 ASP L C   
1416 O  O   . ASP A 185 ? 0.4011 0.3992 0.4001 -0.0030 0.0048  -0.0047 185 ASP L O   
1417 C  CB  . ASP A 185 ? 0.3899 0.4009 0.4026 -0.0029 0.0037  -0.0023 185 ASP L CB  
1418 C  CG  . ASP A 185 ? 0.3744 0.4021 0.3936 0.0010  0.0020  -0.0022 185 ASP L CG  
1419 O  OD1 . ASP A 185 ? 0.3734 0.3991 0.3907 0.0067  0.0113  -0.0037 185 ASP L OD1 
1420 O  OD2 . ASP A 185 ? 0.3643 0.4010 0.4013 -0.0062 -0.0032 0.0042  185 ASP L OD2 
1421 N  N   . TYR A 186 ? 0.4016 0.4139 0.4163 -0.0029 0.0038  0.0023  186 TYR L N   
1422 C  CA  . TYR A 186 ? 0.4106 0.4203 0.4154 -0.0034 0.0010  0.0009  186 TYR L CA  
1423 C  C   . TYR A 186 ? 0.4109 0.4198 0.4125 -0.0045 -0.0017 0.0000  186 TYR L C   
1424 O  O   . TYR A 186 ? 0.4029 0.4235 0.4111 -0.0057 -0.0014 -0.0004 186 TYR L O   
1425 C  CB  . TYR A 186 ? 0.4071 0.4167 0.4116 -0.0041 -0.0021 -0.0008 186 TYR L CB  
1426 C  CG  . TYR A 186 ? 0.4115 0.4197 0.4088 -0.0037 -0.0015 -0.0016 186 TYR L CG  
1427 C  CD1 . TYR A 186 ? 0.4044 0.4155 0.4024 0.0020  -0.0061 0.0000  186 TYR L CD1 
1428 C  CD2 . TYR A 186 ? 0.4123 0.4186 0.4178 -0.0021 -0.0016 -0.0035 186 TYR L CD2 
1429 C  CE1 . TYR A 186 ? 0.4074 0.4124 0.4120 -0.0046 -0.0083 0.0031  186 TYR L CE1 
1430 C  CE2 . TYR A 186 ? 0.4204 0.4193 0.4243 -0.0026 -0.0011 -0.0020 186 TYR L CE2 
1431 C  CZ  . TYR A 186 ? 0.4075 0.4163 0.4128 -0.0052 -0.0012 -0.0039 186 TYR L CZ  
1432 O  OH  . TYR A 186 ? 0.4115 0.4093 0.4059 -0.0082 -0.0033 -0.0074 186 TYR L OH  
1433 N  N   . GLU A 187 ? 0.4177 0.4223 0.4135 -0.0027 -0.0017 0.0021  187 GLU L N   
1434 C  CA  . GLU A 187 ? 0.4175 0.4222 0.4113 -0.0006 -0.0002 -0.0004 187 GLU L CA  
1435 C  C   . GLU A 187 ? 0.4137 0.4180 0.4069 -0.0019 0.0000  -0.0029 187 GLU L C   
1436 O  O   . GLU A 187 ? 0.4146 0.4185 0.4057 -0.0029 -0.0001 -0.0006 187 GLU L O   
1437 C  CB  . GLU A 187 ? 0.4235 0.4229 0.4162 0.0009  0.0006  0.0000  187 GLU L CB  
1438 C  CG  . GLU A 187 ? 0.4362 0.4491 0.4377 -0.0035 -0.0040 -0.0009 187 GLU L CG  
1439 C  CD  . GLU A 187 ? 0.4246 0.4632 0.4700 0.0017  -0.0017 0.0000  187 GLU L CD  
1440 O  OE1 . GLU A 187 ? 0.4640 0.4935 0.4773 0.0053  -0.0018 -0.0036 187 GLU L OE1 
1441 O  OE2 . GLU A 187 ? 0.4781 0.4829 0.4714 -0.0054 0.0109  0.0090  187 GLU L OE2 
1442 N  N   . LYS A 188 ? 0.4053 0.4096 0.3951 -0.0025 -0.0025 -0.0034 188 LYS L N   
1443 C  CA  . LYS A 188 ? 0.3970 0.4019 0.3857 -0.0043 -0.0028 -0.0034 188 LYS L CA  
1444 C  C   . LYS A 188 ? 0.3863 0.3926 0.3776 -0.0044 -0.0035 -0.0038 188 LYS L C   
1445 O  O   . LYS A 188 ? 0.3894 0.3943 0.3848 -0.0039 -0.0044 0.0002  188 LYS L O   
1446 C  CB  . LYS A 188 ? 0.3983 0.4060 0.3837 -0.0070 -0.0031 -0.0058 188 LYS L CB  
1447 C  CG  . LYS A 188 ? 0.4115 0.4128 0.3997 -0.0040 -0.0015 -0.0013 188 LYS L CG  
1448 C  CD  . LYS A 188 ? 0.4149 0.4254 0.4060 -0.0043 0.0023  -0.0081 188 LYS L CD  
1449 C  CE  . LYS A 188 ? 0.4171 0.4359 0.4098 -0.0017 0.0018  0.0035  188 LYS L CE  
1450 N  NZ  . LYS A 188 ? 0.4535 0.4655 0.4280 -0.0005 0.0029  0.0025  188 LYS L NZ  
1451 N  N   . HIS A 189 ? 0.3713 0.3789 0.3583 -0.0023 -0.0023 -0.0039 189 HIS L N   
1452 C  CA  . HIS A 189 ? 0.3580 0.3658 0.3455 -0.0027 -0.0023 -0.0061 189 HIS L CA  
1453 C  C   . HIS A 189 ? 0.3548 0.3577 0.3348 -0.0049 -0.0066 -0.0051 189 HIS L C   
1454 O  O   . HIS A 189 ? 0.3529 0.3577 0.3268 -0.0056 -0.0028 -0.0100 189 HIS L O   
1455 C  CB  . HIS A 189 ? 0.3556 0.3678 0.3428 -0.0014 -0.0012 -0.0047 189 HIS L CB  
1456 C  CG  . HIS A 189 ? 0.3547 0.3564 0.3473 0.0000  -0.0010 -0.0039 189 HIS L CG  
1457 N  ND1 . HIS A 189 ? 0.3476 0.3563 0.3575 -0.0068 -0.0004 -0.0043 189 HIS L ND1 
1458 C  CD2 . HIS A 189 ? 0.3442 0.3374 0.3368 -0.0040 0.0018  -0.0059 189 HIS L CD2 
1459 C  CE1 . HIS A 189 ? 0.3455 0.3487 0.3433 -0.0089 -0.0053 -0.0019 189 HIS L CE1 
1460 N  NE2 . HIS A 189 ? 0.3317 0.3303 0.3179 -0.0197 -0.0009 -0.0075 189 HIS L NE2 
1461 N  N   . LYS A 190 ? 0.3492 0.3549 0.3299 -0.0090 -0.0047 -0.0063 190 LYS L N   
1462 C  CA  . LYS A 190 ? 0.3445 0.3521 0.3339 -0.0064 -0.0049 -0.0013 190 LYS L CA  
1463 C  C   . LYS A 190 ? 0.3375 0.3467 0.3292 -0.0077 -0.0079 -0.0019 190 LYS L C   
1464 O  O   . LYS A 190 ? 0.3446 0.3532 0.3297 -0.0123 -0.0083 0.0019  190 LYS L O   
1465 C  CB  . LYS A 190 ? 0.3406 0.3491 0.3255 -0.0062 -0.0066 -0.0054 190 LYS L CB  
1466 C  CG  . LYS A 190 ? 0.3317 0.3348 0.3240 -0.0007 0.0016  0.0043  190 LYS L CG  
1467 C  CD  . LYS A 190 ? 0.3178 0.3127 0.2976 -0.0062 0.0079  0.0062  190 LYS L CD  
1468 C  CE  . LYS A 190 ? 0.2947 0.3109 0.2877 -0.0021 0.0075  0.0082  190 LYS L CE  
1469 N  NZ  . LYS A 190 ? 0.2945 0.2950 0.2792 -0.0045 0.0083  0.0104  190 LYS L NZ  
1470 N  N   . VAL A 191 ? 0.3355 0.3462 0.3327 -0.0088 -0.0082 -0.0025 191 VAL L N   
1471 C  CA  . VAL A 191 ? 0.3405 0.3479 0.3385 -0.0048 -0.0078 -0.0012 191 VAL L CA  
1472 C  C   . VAL A 191 ? 0.3369 0.3422 0.3368 -0.0032 -0.0061 -0.0039 191 VAL L C   
1473 O  O   . VAL A 191 ? 0.3386 0.3537 0.3394 -0.0042 -0.0116 -0.0029 191 VAL L O   
1474 C  CB  . VAL A 191 ? 0.3435 0.3423 0.3395 -0.0042 -0.0074 0.0013  191 VAL L CB  
1475 C  CG1 . VAL A 191 ? 0.3407 0.3426 0.3618 -0.0033 -0.0043 0.0030  191 VAL L CG1 
1476 C  CG2 . VAL A 191 ? 0.3394 0.3430 0.3259 -0.0015 -0.0122 0.0012  191 VAL L CG2 
1477 N  N   . TYR A 192 ? 0.3332 0.3383 0.3323 -0.0014 -0.0065 -0.0039 192 TYR L N   
1478 C  CA  . TYR A 192 ? 0.3288 0.3334 0.3279 -0.0022 -0.0022 -0.0046 192 TYR L CA  
1479 C  C   . TYR A 192 ? 0.3339 0.3361 0.3324 -0.0013 -0.0012 -0.0051 192 TYR L C   
1480 O  O   . TYR A 192 ? 0.3268 0.3293 0.3258 -0.0038 0.0011  -0.0082 192 TYR L O   
1481 C  CB  . TYR A 192 ? 0.3226 0.3296 0.3193 -0.0049 -0.0022 -0.0026 192 TYR L CB  
1482 C  CG  . TYR A 192 ? 0.3220 0.3341 0.3267 0.0026  -0.0022 -0.0037 192 TYR L CG  
1483 C  CD1 . TYR A 192 ? 0.3237 0.3340 0.3308 -0.0066 -0.0022 0.0016  192 TYR L CD1 
1484 C  CD2 . TYR A 192 ? 0.3121 0.3174 0.2967 -0.0004 -0.0072 0.0085  192 TYR L CD2 
1485 C  CE1 . TYR A 192 ? 0.3240 0.3300 0.3189 -0.0057 -0.0041 0.0013  192 TYR L CE1 
1486 C  CE2 . TYR A 192 ? 0.3192 0.3089 0.3056 0.0038  0.0017  0.0074  192 TYR L CE2 
1487 C  CZ  . TYR A 192 ? 0.3197 0.3366 0.3083 -0.0016 -0.0110 0.0026  192 TYR L CZ  
1488 O  OH  . TYR A 192 ? 0.3102 0.3401 0.3162 -0.0062 -0.0127 0.0052  192 TYR L OH  
1489 N  N   . ALA A 193 ? 0.3356 0.3373 0.3368 0.0018  -0.0005 -0.0030 193 ALA L N   
1490 C  CA  . ALA A 193 ? 0.3340 0.3362 0.3332 -0.0045 0.0001  -0.0013 193 ALA L CA  
1491 C  C   . ALA A 193 ? 0.3406 0.3414 0.3363 -0.0028 0.0022  0.0003  193 ALA L C   
1492 O  O   . ALA A 193 ? 0.3453 0.3437 0.3332 -0.0100 0.0067  0.0019  193 ALA L O   
1493 C  CB  . ALA A 193 ? 0.3308 0.3371 0.3324 -0.0005 -0.0017 -0.0034 193 ALA L CB  
1494 N  N   . CYS A 194 ? 0.3476 0.3446 0.3371 -0.0048 -0.0020 0.0003  194 CYS L N   
1495 C  CA  . CYS A 194 ? 0.3473 0.3392 0.3327 -0.0047 -0.0032 0.0004  194 CYS L CA  
1496 C  C   . CYS A 194 ? 0.3428 0.3350 0.3313 -0.0027 -0.0012 -0.0020 194 CYS L C   
1497 O  O   . CYS A 194 ? 0.3346 0.3136 0.3170 -0.0036 -0.0004 -0.0040 194 CYS L O   
1498 C  CB  . CYS A 194 ? 0.3526 0.3365 0.3313 -0.0054 -0.0010 0.0015  194 CYS L CB  
1499 S  SG  . CYS A 194 ? 0.3820 0.3745 0.3427 -0.0102 -0.0143 0.0053  194 CYS L SG  
1500 N  N   . GLU A 195 ? 0.3472 0.3434 0.3360 -0.0023 -0.0028 0.0000  195 GLU L N   
1501 C  CA  . GLU A 195 ? 0.3490 0.3525 0.3421 -0.0025 -0.0031 -0.0005 195 GLU L CA  
1502 C  C   . GLU A 195 ? 0.3426 0.3554 0.3371 -0.0024 -0.0030 0.0003  195 GLU L C   
1503 O  O   . GLU A 195 ? 0.3364 0.3582 0.3334 -0.0037 -0.0016 0.0000  195 GLU L O   
1504 C  CB  . GLU A 195 ? 0.3474 0.3610 0.3408 -0.0009 -0.0056 -0.0039 195 GLU L CB  
1505 C  CG  . GLU A 195 ? 0.3804 0.3796 0.3688 -0.0073 -0.0044 0.0000  195 GLU L CG  
1506 C  CD  . GLU A 195 ? 0.4185 0.4388 0.4247 0.0085  -0.0041 0.0048  195 GLU L CD  
1507 O  OE1 . GLU A 195 ? 0.4523 0.4756 0.4652 0.0064  0.0039  0.0042  195 GLU L OE1 
1508 O  OE2 . GLU A 195 ? 0.4541 0.4815 0.4466 0.0014  -0.0083 -0.0001 195 GLU L OE2 
1509 N  N   . VAL A 196 ? 0.3430 0.3565 0.3418 -0.0031 -0.0019 0.0004  196 VAL L N   
1510 C  CA  . VAL A 196 ? 0.3381 0.3538 0.3423 -0.0034 -0.0002 0.0007  196 VAL L CA  
1511 C  C   . VAL A 196 ? 0.3395 0.3548 0.3515 -0.0034 -0.0010 -0.0010 196 VAL L C   
1512 O  O   . VAL A 196 ? 0.3310 0.3538 0.3411 -0.0029 -0.0036 -0.0026 196 VAL L O   
1513 C  CB  . VAL A 196 ? 0.3374 0.3485 0.3397 -0.0043 -0.0003 0.0015  196 VAL L CB  
1514 C  CG1 . VAL A 196 ? 0.3319 0.3505 0.3264 -0.0056 0.0055  0.0100  196 VAL L CG1 
1515 C  CG2 . VAL A 196 ? 0.3309 0.3526 0.3497 -0.0033 -0.0013 0.0025  196 VAL L CG2 
1516 N  N   . THR A 197 ? 0.3460 0.3626 0.3600 -0.0033 -0.0014 -0.0023 197 THR L N   
1517 C  CA  . THR A 197 ? 0.3557 0.3619 0.3731 -0.0010 -0.0016 0.0017  197 THR L CA  
1518 C  C   . THR A 197 ? 0.3641 0.3678 0.3749 0.0008  -0.0014 0.0022  197 THR L C   
1519 O  O   . THR A 197 ? 0.3659 0.3638 0.3753 -0.0002 0.0040  0.0055  197 THR L O   
1520 C  CB  . THR A 197 ? 0.3609 0.3645 0.3779 -0.0004 -0.0033 0.0007  197 THR L CB  
1521 O  OG1 . THR A 197 ? 0.3525 0.3655 0.3764 0.0009  -0.0069 -0.0043 197 THR L OG1 
1522 C  CG2 . THR A 197 ? 0.3625 0.3545 0.3801 0.0000  -0.0101 0.0007  197 THR L CG2 
1523 N  N   . HIS A 198 ? 0.3685 0.3772 0.3836 0.0006  -0.0003 0.0032  198 HIS L N   
1524 C  CA  . HIS A 198 ? 0.3766 0.3817 0.3861 -0.0011 -0.0020 0.0018  198 HIS L CA  
1525 C  C   . HIS A 198 ? 0.3911 0.3951 0.3958 0.0017  -0.0026 0.0016  198 HIS L C   
1526 O  O   . HIS A 198 ? 0.3919 0.3961 0.3970 0.0024  -0.0018 0.0048  198 HIS L O   
1527 C  CB  . HIS A 198 ? 0.3708 0.3780 0.3806 -0.0022 -0.0012 0.0007  198 HIS L CB  
1528 C  CG  . HIS A 198 ? 0.3613 0.3700 0.3700 0.0020  0.0007  0.0047  198 HIS L CG  
1529 N  ND1 . HIS A 198 ? 0.3364 0.3494 0.3623 0.0093  0.0000  0.0013  198 HIS L ND1 
1530 C  CD2 . HIS A 198 ? 0.3487 0.3553 0.3622 0.0015  -0.0087 0.0022  198 HIS L CD2 
1531 C  CE1 . HIS A 198 ? 0.3243 0.3375 0.3537 0.0123  0.0023  -0.0008 198 HIS L CE1 
1532 N  NE2 . HIS A 198 ? 0.3600 0.3473 0.3590 0.0137  -0.0008 0.0078  198 HIS L NE2 
1533 N  N   . GLN A 199 ? 0.4039 0.4044 0.4099 0.0012  -0.0029 -0.0018 199 GLN L N   
1534 C  CA  . GLN A 199 ? 0.4250 0.4177 0.4207 0.0010  -0.0013 0.0034  199 GLN L CA  
1535 C  C   . GLN A 199 ? 0.4279 0.4215 0.4235 0.0025  -0.0009 0.0024  199 GLN L C   
1536 O  O   . GLN A 199 ? 0.4372 0.4253 0.4316 0.0021  -0.0036 0.0063  199 GLN L O   
1537 C  CB  . GLN A 199 ? 0.4256 0.4178 0.4209 0.0013  -0.0014 0.0013  199 GLN L CB  
1538 C  CG  . GLN A 199 ? 0.4356 0.4231 0.4255 -0.0067 -0.0002 0.0035  199 GLN L CG  
1539 C  CD  . GLN A 199 ? 0.4467 0.4321 0.4364 -0.0025 0.0017  -0.0004 199 GLN L CD  
1540 O  OE1 . GLN A 199 ? 0.4824 0.4652 0.4506 0.0002  -0.0021 0.0026  199 GLN L OE1 
1541 N  NE2 . GLN A 199 ? 0.4714 0.4494 0.4664 -0.0066 0.0040  0.0019  199 GLN L NE2 
1542 N  N   . GLY A 200 ? 0.4335 0.4233 0.4273 0.0034  -0.0009 0.0049  200 GLY L N   
1543 C  CA  . GLY A 200 ? 0.4368 0.4280 0.4338 0.0055  0.0005  0.0046  200 GLY L CA  
1544 C  C   . GLY A 200 ? 0.4405 0.4358 0.4360 0.0050  0.0008  0.0061  200 GLY L C   
1545 O  O   . GLY A 200 ? 0.4429 0.4376 0.4389 0.0042  0.0000  0.0116  200 GLY L O   
1546 N  N   . LEU A 201 ? 0.4445 0.4438 0.4422 0.0035  0.0017  0.0019  201 LEU L N   
1547 C  CA  . LEU A 201 ? 0.4498 0.4526 0.4442 0.0020  0.0007  0.0005  201 LEU L CA  
1548 C  C   . LEU A 201 ? 0.4543 0.4587 0.4525 0.0020  0.0003  0.0010  201 LEU L C   
1549 O  O   . LEU A 201 ? 0.4562 0.4667 0.4563 0.0020  0.0018  -0.0017 201 LEU L O   
1550 C  CB  . LEU A 201 ? 0.4442 0.4481 0.4407 -0.0007 0.0003  -0.0020 201 LEU L CB  
1551 C  CG  . LEU A 201 ? 0.4463 0.4461 0.4395 -0.0014 0.0037  -0.0051 201 LEU L CG  
1552 C  CD1 . LEU A 201 ? 0.4451 0.4495 0.4345 -0.0005 0.0089  -0.0099 201 LEU L CD1 
1553 C  CD2 . LEU A 201 ? 0.4420 0.4502 0.4398 -0.0035 0.0040  -0.0048 201 LEU L CD2 
1554 N  N   . SER A 202 ? 0.4589 0.4573 0.4532 -0.0005 -0.0012 0.0029  202 SER L N   
1555 C  CA  . SER A 202 ? 0.4607 0.4636 0.4585 -0.0010 -0.0023 0.0022  202 SER L CA  
1556 C  C   . SER A 202 ? 0.4577 0.4585 0.4601 0.0003  -0.0026 0.0033  202 SER L C   
1557 O  O   . SER A 202 ? 0.4599 0.4582 0.4627 0.0035  -0.0029 0.0052  202 SER L O   
1558 C  CB  . SER A 202 ? 0.4653 0.4628 0.4581 0.0002  -0.0026 0.0016  202 SER L CB  
1559 O  OG  . SER A 202 ? 0.4731 0.4768 0.4544 0.0041  0.0005  -0.0006 202 SER L OG  
1560 N  N   . SER A 203 ? 0.4525 0.4556 0.4555 -0.0001 -0.0033 0.0016  203 SER L N   
1561 C  CA  . SER A 203 ? 0.4474 0.4457 0.4482 -0.0016 -0.0037 0.0039  203 SER L CA  
1562 C  C   . SER A 203 ? 0.4395 0.4433 0.4418 -0.0013 -0.0025 0.0031  203 SER L C   
1563 O  O   . SER A 203 ? 0.4350 0.4387 0.4373 -0.0019 -0.0055 0.0015  203 SER L O   
1564 C  CB  . SER A 203 ? 0.4498 0.4512 0.4449 -0.0013 -0.0014 0.0019  203 SER L CB  
1565 O  OG  . SER A 203 ? 0.4439 0.4535 0.4535 0.0028  -0.0086 0.0072  203 SER L OG  
1566 N  N   . PRO A 204 ? 0.4340 0.4321 0.4352 -0.0012 -0.0019 0.0049  204 PRO L N   
1567 C  CA  . PRO A 204 ? 0.4256 0.4240 0.4266 -0.0003 -0.0017 0.0024  204 PRO L CA  
1568 C  C   . PRO A 204 ? 0.4203 0.4149 0.4158 -0.0021 -0.0015 0.0024  204 PRO L C   
1569 O  O   . PRO A 204 ? 0.4210 0.4156 0.4165 -0.0018 -0.0021 0.0021  204 PRO L O   
1570 C  CB  . PRO A 204 ? 0.4273 0.4259 0.4282 -0.0010 -0.0015 0.0032  204 PRO L CB  
1571 C  CG  . PRO A 204 ? 0.4286 0.4252 0.4302 0.0019  -0.0010 0.0041  204 PRO L CG  
1572 C  CD  . PRO A 204 ? 0.4304 0.4318 0.4374 -0.0023 -0.0022 0.0039  204 PRO L CD  
1573 N  N   . VAL A 205 ? 0.4107 0.4029 0.4067 -0.0025 0.0017  -0.0004 205 VAL L N   
1574 C  CA  . VAL A 205 ? 0.4004 0.3973 0.3977 -0.0036 0.0011  0.0013  205 VAL L CA  
1575 C  C   . VAL A 205 ? 0.3903 0.3880 0.3848 -0.0055 0.0023  -0.0025 205 VAL L C   
1576 O  O   . VAL A 205 ? 0.3931 0.3890 0.3865 -0.0060 0.0044  -0.0007 205 VAL L O   
1577 C  CB  . VAL A 205 ? 0.4026 0.3988 0.4012 -0.0063 0.0004  -0.0017 205 VAL L CB  
1578 C  CG1 . VAL A 205 ? 0.4084 0.4011 0.4115 -0.0025 -0.0022 -0.0009 205 VAL L CG1 
1579 C  CG2 . VAL A 205 ? 0.4069 0.3979 0.3973 -0.0062 -0.0050 -0.0002 205 VAL L CG2 
1580 N  N   . THR A 206 ? 0.3729 0.3773 0.3697 -0.0066 0.0010  -0.0019 206 THR L N   
1581 C  CA  . THR A 206 ? 0.3568 0.3609 0.3527 -0.0044 -0.0021 -0.0031 206 THR L CA  
1582 C  C   . THR A 206 ? 0.3484 0.3609 0.3428 -0.0078 -0.0012 -0.0047 206 THR L C   
1583 O  O   . THR A 206 ? 0.3498 0.3592 0.3364 -0.0119 -0.0034 -0.0095 206 THR L O   
1584 C  CB  . THR A 206 ? 0.3572 0.3614 0.3583 -0.0038 -0.0017 -0.0035 206 THR L CB  
1585 O  OG1 . THR A 206 ? 0.3475 0.3360 0.3547 -0.0007 -0.0123 -0.0001 206 THR L OG1 
1586 C  CG2 . THR A 206 ? 0.3434 0.3457 0.3489 -0.0010 -0.0027 -0.0017 206 THR L CG2 
1587 N  N   . LYS A 207 ? 0.3428 0.3569 0.3358 -0.0059 -0.0003 -0.0066 207 LYS L N   
1588 C  CA  . LYS A 207 ? 0.3415 0.3543 0.3367 -0.0064 0.0015  -0.0055 207 LYS L CA  
1589 C  C   . LYS A 207 ? 0.3408 0.3607 0.3376 -0.0052 0.0032  -0.0018 207 LYS L C   
1590 O  O   . LYS A 207 ? 0.3344 0.3664 0.3346 -0.0053 0.0003  -0.0041 207 LYS L O   
1591 C  CB  . LYS A 207 ? 0.3399 0.3528 0.3296 -0.0052 0.0041  -0.0007 207 LYS L CB  
1592 C  CG  . LYS A 207 ? 0.3475 0.3603 0.3380 -0.0078 -0.0039 -0.0060 207 LYS L CG  
1593 C  CD  . LYS A 207 ? 0.3593 0.3797 0.3576 -0.0048 0.0060  -0.0057 207 LYS L CD  
1594 C  CE  . LYS A 207 ? 0.3666 0.3842 0.3707 -0.0064 0.0089  -0.0065 207 LYS L CE  
1595 N  NZ  . LYS A 207 ? 0.3919 0.4173 0.3826 -0.0187 0.0025  -0.0071 207 LYS L NZ  
1596 N  N   . SER A 208 ? 0.3427 0.3565 0.3433 -0.0057 0.0031  -0.0012 208 SER L N   
1597 C  CA  . SER A 208 ? 0.3506 0.3631 0.3466 -0.0033 0.0016  -0.0020 208 SER L CA  
1598 C  C   . SER A 208 ? 0.3533 0.3657 0.3507 -0.0047 0.0008  -0.0025 208 SER L C   
1599 O  O   . SER A 208 ? 0.3469 0.3736 0.3539 -0.0101 0.0010  0.0014  208 SER L O   
1600 C  CB  . SER A 208 ? 0.3562 0.3585 0.3417 -0.0032 0.0022  -0.0011 208 SER L CB  
1601 O  OG  . SER A 208 ? 0.3756 0.3626 0.3535 0.0034  -0.0010 0.0014  208 SER L OG  
1602 N  N   . PHE A 209 ? 0.3558 0.3657 0.3512 -0.0062 0.0046  0.0019  209 PHE L N   
1603 C  CA  . PHE A 209 ? 0.3603 0.3678 0.3558 -0.0020 0.0030  -0.0004 209 PHE L CA  
1604 C  C   . PHE A 209 ? 0.3674 0.3804 0.3641 -0.0021 -0.0004 -0.0036 209 PHE L C   
1605 O  O   . PHE A 209 ? 0.3630 0.3799 0.3672 0.0028  -0.0047 -0.0096 209 PHE L O   
1606 C  CB  . PHE A 209 ? 0.3494 0.3632 0.3426 -0.0048 0.0012  0.0016  209 PHE L CB  
1607 C  CG  . PHE A 209 ? 0.3397 0.3382 0.3352 0.0007  -0.0035 0.0019  209 PHE L CG  
1608 C  CD1 . PHE A 209 ? 0.3233 0.3291 0.3147 -0.0023 -0.0091 -0.0022 209 PHE L CD1 
1609 C  CD2 . PHE A 209 ? 0.3218 0.3118 0.3181 0.0000  -0.0098 0.0052  209 PHE L CD2 
1610 C  CE1 . PHE A 209 ? 0.3017 0.3136 0.3173 -0.0082 -0.0032 -0.0013 209 PHE L CE1 
1611 C  CE2 . PHE A 209 ? 0.3189 0.3131 0.3189 -0.0035 -0.0142 0.0053  209 PHE L CE2 
1612 C  CZ  . PHE A 209 ? 0.3250 0.3396 0.3304 -0.0052 -0.0064 0.0020  209 PHE L CZ  
1613 N  N   . ASN A 210 ? 0.3829 0.3901 0.3759 -0.0012 0.0014  -0.0071 210 ASN L N   
1614 C  CA  . ASN A 210 ? 0.3922 0.3990 0.3892 -0.0003 0.0018  -0.0046 210 ASN L CA  
1615 C  C   . ASN A 210 ? 0.3972 0.4066 0.3889 -0.0001 0.0010  -0.0030 210 ASN L C   
1616 O  O   . ASN A 210 ? 0.3926 0.4160 0.3917 0.0020  0.0011  -0.0035 210 ASN L O   
1617 C  CB  . ASN A 210 ? 0.3954 0.4037 0.3908 -0.0008 0.0001  -0.0018 210 ASN L CB  
1618 C  CG  . ASN A 210 ? 0.4081 0.4061 0.4071 -0.0001 0.0063  0.0020  210 ASN L CG  
1619 O  OD1 . ASN A 210 ? 0.4157 0.4120 0.4099 -0.0034 0.0209  -0.0010 210 ASN L OD1 
1620 N  ND2 . ASN A 210 ? 0.4350 0.4285 0.4202 0.0000  0.0029  -0.0016 210 ASN L ND2 
1621 N  N   . ARG A 211 ? 0.3976 0.4047 0.3916 -0.0010 0.0006  -0.0061 211 ARG L N   
1622 C  CA  . ARG A 211 ? 0.3977 0.4016 0.3910 -0.0013 -0.0006 -0.0030 211 ARG L CA  
1623 C  C   . ARG A 211 ? 0.4025 0.4099 0.3980 0.0000  -0.0019 -0.0022 211 ARG L C   
1624 O  O   . ARG A 211 ? 0.3963 0.4140 0.4004 -0.0012 -0.0059 0.0033  211 ARG L O   
1625 C  CB  . ARG A 211 ? 0.3915 0.3968 0.3887 -0.0005 -0.0017 -0.0052 211 ARG L CB  
1626 C  CG  . ARG A 211 ? 0.3740 0.3907 0.3751 -0.0042 -0.0027 -0.0049 211 ARG L CG  
1627 C  CD  . ARG A 211 ? 0.3623 0.3807 0.3644 0.0042  -0.0010 -0.0035 211 ARG L CD  
1628 N  NE  . ARG A 211 ? 0.3463 0.3684 0.3458 -0.0045 0.0104  -0.0047 211 ARG L NE  
1629 C  CZ  . ARG A 211 ? 0.3299 0.3502 0.3397 -0.0054 0.0080  -0.0009 211 ARG L CZ  
1630 N  NH1 . ARG A 211 ? 0.3186 0.3424 0.3201 -0.0113 0.0154  0.0058  211 ARG L NH1 
1631 N  NH2 . ARG A 211 ? 0.3155 0.3492 0.3418 -0.0005 0.0182  0.0035  211 ARG L NH2 
1632 O  OXT . ARG A 211 ? 0.4064 0.4146 0.3972 0.0024  -0.0018 -0.0003 211 ARG L OXT 
1633 N  N   . GLU B 1   ? 0.4009 0.4333 0.4325 0.0003  -0.0027 0.0029  1   GLU H N   
1634 C  CA  . GLU B 1   ? 0.4055 0.4213 0.4147 -0.0029 0.0015  0.0010  1   GLU H CA  
1635 C  C   . GLU B 1   ? 0.3999 0.4142 0.4067 -0.0025 0.0033  -0.0023 1   GLU H C   
1636 O  O   . GLU B 1   ? 0.4036 0.4244 0.3909 -0.0054 0.0086  -0.0088 1   GLU H O   
1637 C  CB  . GLU B 1   ? 0.4084 0.4209 0.4113 0.0002  0.0038  0.0015  1   GLU H CB  
1638 C  CG  . GLU B 1   ? 0.4158 0.4196 0.4263 -0.0010 0.0029  0.0117  1   GLU H CG  
1639 C  CD  . GLU B 1   ? 0.4023 0.4076 0.4420 -0.0009 0.0075  -0.0035 1   GLU H CD  
1640 O  OE1 . GLU B 1   ? 0.4212 0.4001 0.4423 0.0052  0.0101  0.0048  1   GLU H OE1 
1641 O  OE2 . GLU B 1   ? 0.4584 0.4307 0.5089 0.0047  0.0120  0.0092  1   GLU H OE2 
1642 N  N   . VAL B 2   ? 0.3983 0.4077 0.4037 -0.0059 0.0038  -0.0030 2   VAL H N   
1643 C  CA  . VAL B 2   ? 0.4031 0.4061 0.4027 -0.0035 0.0002  -0.0012 2   VAL H CA  
1644 C  C   . VAL B 2   ? 0.3987 0.4030 0.4019 -0.0066 -0.0001 -0.0001 2   VAL H C   
1645 O  O   . VAL B 2   ? 0.4059 0.4071 0.4034 -0.0099 -0.0021 0.0001  2   VAL H O   
1646 C  CB  . VAL B 2   ? 0.4013 0.4057 0.4011 -0.0005 0.0016  -0.0035 2   VAL H CB  
1647 C  CG1 . VAL B 2   ? 0.3956 0.4007 0.3973 -0.0045 -0.0005 0.0011  2   VAL H CG1 
1648 C  CG2 . VAL B 2   ? 0.3987 0.4036 0.4051 -0.0027 -0.0032 -0.0022 2   VAL H CG2 
1649 N  N   . GLN B 3   ? 0.3964 0.3989 0.3969 -0.0023 0.0028  -0.0023 3   GLN H N   
1650 C  CA  . GLN B 3   ? 0.3886 0.3907 0.3935 -0.0025 0.0030  -0.0020 3   GLN H CA  
1651 C  C   . GLN B 3   ? 0.3778 0.3783 0.3802 0.0000  0.0013  -0.0040 3   GLN H C   
1652 O  O   . GLN B 3   ? 0.3792 0.3761 0.3807 -0.0009 0.0057  -0.0049 3   GLN H O   
1653 C  CB  . GLN B 3   ? 0.3881 0.3885 0.3931 -0.0030 0.0038  -0.0031 3   GLN H CB  
1654 C  CG  . GLN B 3   ? 0.4017 0.3980 0.4054 0.0049  0.0031  -0.0053 3   GLN H CG  
1655 C  CD  . GLN B 3   ? 0.4063 0.4088 0.4050 0.0043  0.0032  -0.0022 3   GLN H CD  
1656 O  OE1 . GLN B 3   ? 0.4102 0.3848 0.4073 0.0140  0.0104  0.0129  3   GLN H OE1 
1657 N  NE2 . GLN B 3   ? 0.4251 0.4417 0.4105 0.0029  -0.0074 -0.0179 3   GLN H NE2 
1658 N  N   . LEU B 4   ? 0.3630 0.3633 0.3687 0.0032  0.0049  -0.0030 4   LEU H N   
1659 C  CA  . LEU B 4   ? 0.3454 0.3428 0.3496 0.0019  0.0030  -0.0021 4   LEU H CA  
1660 C  C   . LEU B 4   ? 0.3392 0.3419 0.3460 0.0023  0.0030  -0.0008 4   LEU H C   
1661 O  O   . LEU B 4   ? 0.3328 0.3347 0.3405 0.0029  0.0022  -0.0007 4   LEU H O   
1662 C  CB  . LEU B 4   ? 0.3407 0.3410 0.3438 -0.0007 0.0009  -0.0006 4   LEU H CB  
1663 C  CG  . LEU B 4   ? 0.3245 0.3310 0.3255 0.0057  0.0051  -0.0003 4   LEU H CG  
1664 C  CD1 . LEU B 4   ? 0.2970 0.3010 0.2910 -0.0044 0.0006  0.0050  4   LEU H CD1 
1665 C  CD2 . LEU B 4   ? 0.2923 0.3229 0.3120 0.0079  0.0007  -0.0055 4   LEU H CD2 
1666 N  N   . VAL B 5   ? 0.3358 0.3347 0.3433 0.0041  0.0028  -0.0035 5   VAL H N   
1667 C  CA  . VAL B 5   ? 0.3349 0.3380 0.3397 0.0016  0.0038  -0.0023 5   VAL H CA  
1668 C  C   . VAL B 5   ? 0.3320 0.3379 0.3340 0.0020  0.0052  -0.0033 5   VAL H C   
1669 O  O   . VAL B 5   ? 0.3249 0.3366 0.3295 0.0043  0.0042  -0.0021 5   VAL H O   
1670 C  CB  . VAL B 5   ? 0.3304 0.3332 0.3426 0.0042  0.0049  -0.0039 5   VAL H CB  
1671 C  CG1 . VAL B 5   ? 0.3210 0.3243 0.3263 0.0031  0.0051  0.0001  5   VAL H CG1 
1672 C  CG2 . VAL B 5   ? 0.3342 0.3332 0.3353 0.0042  0.0046  -0.0059 5   VAL H CG2 
1673 N  N   . GLU B 6   ? 0.3304 0.3372 0.3289 0.0050  0.0047  -0.0007 6   GLU H N   
1674 C  CA  . GLU B 6   ? 0.3324 0.3405 0.3285 0.0013  0.0036  0.0006  6   GLU H CA  
1675 C  C   . GLU B 6   ? 0.3351 0.3459 0.3304 0.0004  0.0022  0.0008  6   GLU H C   
1676 O  O   . GLU B 6   ? 0.3400 0.3432 0.3317 0.0045  0.0005  0.0029  6   GLU H O   
1677 C  CB  . GLU B 6   ? 0.3323 0.3445 0.3295 -0.0006 0.0006  0.0042  6   GLU H CB  
1678 C  CG  . GLU B 6   ? 0.3345 0.3497 0.3186 -0.0074 -0.0030 0.0007  6   GLU H CG  
1679 C  CD  . GLU B 6   ? 0.3050 0.3273 0.3053 -0.0106 -0.0189 -0.0174 6   GLU H CD  
1680 O  OE1 . GLU B 6   ? 0.3061 0.3191 0.2615 -0.0167 -0.0137 -0.0216 6   GLU H OE1 
1681 O  OE2 . GLU B 6   ? 0.3164 0.3427 0.3256 -0.0217 -0.0240 -0.0186 6   GLU H OE2 
1682 N  N   . SER B 7   ? 0.3311 0.3403 0.3308 -0.0013 0.0016  0.0029  7   SER H N   
1683 C  CA  . SER B 7   ? 0.3319 0.3472 0.3342 0.0010  0.0007  0.0020  7   SER H CA  
1684 C  C   . SER B 7   ? 0.3349 0.3466 0.3349 -0.0009 0.0002  0.0037  7   SER H C   
1685 O  O   . SER B 7   ? 0.3161 0.3430 0.3300 0.0006  0.0036  0.0038  7   SER H O   
1686 C  CB  . SER B 7   ? 0.3310 0.3470 0.3302 0.0001  0.0008  0.0035  7   SER H CB  
1687 O  OG  . SER B 7   ? 0.3235 0.3442 0.3516 0.0066  -0.0110 -0.0003 7   SER H OG  
1688 N  N   . GLY B 8   ? 0.3425 0.3508 0.3393 -0.0012 -0.0022 0.0035  8   GLY H N   
1689 C  CA  . GLY B 8   ? 0.3470 0.3610 0.3536 -0.0019 -0.0002 0.0009  8   GLY H CA  
1690 C  C   . GLY B 8   ? 0.3562 0.3647 0.3628 0.0010  -0.0019 0.0023  8   GLY H C   
1691 O  O   . GLY B 8   ? 0.3508 0.3649 0.3668 0.0003  0.0006  0.0022  8   GLY H O   
1692 N  N   . GLY B 9   ? 0.3659 0.3749 0.3722 -0.0011 -0.0005 0.0014  9   GLY H N   
1693 C  CA  . GLY B 9   ? 0.3745 0.3791 0.3753 -0.0018 -0.0033 -0.0004 9   GLY H CA  
1694 C  C   . GLY B 9   ? 0.3755 0.3798 0.3792 -0.0030 -0.0019 -0.0005 9   GLY H C   
1695 O  O   . GLY B 9   ? 0.3792 0.3805 0.3801 -0.0041 -0.0025 0.0018  9   GLY H O   
1696 N  N   . GLY B 10  ? 0.3821 0.3826 0.3817 -0.0013 -0.0004 0.0007  10  GLY H N   
1697 C  CA  . GLY B 10  ? 0.3841 0.3808 0.3829 -0.0027 0.0000  0.0011  10  GLY H CA  
1698 C  C   . GLY B 10  ? 0.3873 0.3820 0.3840 -0.0023 -0.0004 0.0006  10  GLY H C   
1699 O  O   . GLY B 10  ? 0.3935 0.3737 0.3830 -0.0039 -0.0015 0.0036  10  GLY H O   
1700 N  N   . LEU B 11  ? 0.3918 0.3811 0.3863 -0.0010 0.0005  0.0000  11  LEU H N   
1701 C  CA  . LEU B 11  ? 0.3943 0.3853 0.3899 -0.0006 -0.0001 0.0013  11  LEU H CA  
1702 C  C   . LEU B 11  ? 0.3958 0.3910 0.3948 -0.0013 0.0014  0.0004  11  LEU H C   
1703 O  O   . LEU B 11  ? 0.3970 0.3955 0.3917 -0.0027 0.0049  0.0061  11  LEU H O   
1704 C  CB  . LEU B 11  ? 0.3919 0.3816 0.3851 -0.0019 -0.0029 0.0037  11  LEU H CB  
1705 C  CG  . LEU B 11  ? 0.4032 0.3894 0.3838 0.0015  -0.0054 0.0026  11  LEU H CG  
1706 C  CD1 . LEU B 11  ? 0.3791 0.4032 0.3788 -0.0026 -0.0018 -0.0013 11  LEU H CD1 
1707 C  CD2 . LEU B 11  ? 0.4178 0.4148 0.3999 0.0011  0.0010  0.0006  11  LEU H CD2 
1708 N  N   . VAL B 12  ? 0.4001 0.3996 0.4033 -0.0018 -0.0008 -0.0005 12  VAL H N   
1709 C  CA  . VAL B 12  ? 0.4064 0.4061 0.4101 -0.0027 -0.0008 -0.0006 12  VAL H CA  
1710 C  C   . VAL B 12  ? 0.4107 0.4116 0.4178 -0.0052 0.0000  -0.0008 12  VAL H C   
1711 O  O   . VAL B 12  ? 0.4025 0.4026 0.4200 -0.0055 -0.0008 0.0008  12  VAL H O   
1712 C  CB  . VAL B 12  ? 0.4069 0.4086 0.4130 -0.0031 -0.0038 0.0003  12  VAL H CB  
1713 C  CG1 . VAL B 12  ? 0.4115 0.4105 0.4199 0.0002  -0.0044 0.0000  12  VAL H CG1 
1714 C  CG2 . VAL B 12  ? 0.3978 0.4060 0.4014 0.0009  -0.0074 -0.0039 12  VAL H CG2 
1715 N  N   . GLN B 13  ? 0.4217 0.4270 0.4277 -0.0055 0.0018  -0.0006 13  GLN H N   
1716 C  CA  . GLN B 13  ? 0.4305 0.4346 0.4363 -0.0036 0.0038  0.0006  13  GLN H CA  
1717 C  C   . GLN B 13  ? 0.4242 0.4272 0.4266 -0.0051 0.0042  0.0014  13  GLN H C   
1718 O  O   . GLN B 13  ? 0.4161 0.4298 0.4224 -0.0080 0.0063  0.0024  13  GLN H O   
1719 C  CB  . GLN B 13  ? 0.4415 0.4425 0.4465 -0.0075 0.0023  0.0015  13  GLN H CB  
1720 C  CG  . GLN B 13  ? 0.4778 0.4706 0.4775 0.0044  0.0035  -0.0014 13  GLN H CG  
1721 C  CD  . GLN B 13  ? 0.5281 0.5170 0.5415 -0.0066 -0.0055 -0.0028 13  GLN H CD  
1722 O  OE1 . GLN B 13  ? 0.5508 0.5499 0.5659 0.0054  -0.0111 0.0008  13  GLN H OE1 
1723 N  NE2 . GLN B 13  ? 0.5520 0.5291 0.5415 0.0022  -0.0046 0.0081  13  GLN H NE2 
1724 N  N   . PRO B 14  ? 0.4173 0.4197 0.4180 -0.0064 0.0039  0.0020  14  PRO H N   
1725 C  CA  . PRO B 14  ? 0.4185 0.4127 0.4180 -0.0047 0.0018  0.0019  14  PRO H CA  
1726 C  C   . PRO B 14  ? 0.4209 0.4112 0.4217 -0.0061 0.0040  0.0016  14  PRO H C   
1727 O  O   . PRO B 14  ? 0.4201 0.4089 0.4231 -0.0062 0.0056  0.0048  14  PRO H O   
1728 C  CB  . PRO B 14  ? 0.4202 0.4129 0.4171 -0.0038 0.0001  0.0018  14  PRO H CB  
1729 C  CG  . PRO B 14  ? 0.4130 0.4083 0.4156 -0.0057 0.0008  0.0002  14  PRO H CG  
1730 C  CD  . PRO B 14  ? 0.4110 0.4182 0.4162 -0.0063 0.0044  0.0004  14  PRO H CD  
1731 N  N   . GLY B 15  ? 0.4197 0.4056 0.4152 -0.0059 0.0034  0.0000  15  GLY H N   
1732 C  CA  . GLY B 15  ? 0.4243 0.4024 0.4195 -0.0068 0.0034  0.0006  15  GLY H CA  
1733 C  C   . GLY B 15  ? 0.4274 0.4048 0.4220 -0.0076 0.0018  0.0000  15  GLY H C   
1734 O  O   . GLY B 15  ? 0.4255 0.3962 0.4202 -0.0069 0.0015  0.0006  15  GLY H O   
1735 N  N   . ARG B 16  ? 0.4382 0.4181 0.4292 -0.0061 0.0027  0.0010  16  ARG H N   
1736 C  CA  . ARG B 16  ? 0.4467 0.4325 0.4388 -0.0048 0.0008  0.0016  16  ARG H CA  
1737 C  C   . ARG B 16  ? 0.4404 0.4333 0.4377 -0.0054 0.0046  0.0053  16  ARG H C   
1738 O  O   . ARG B 16  ? 0.4347 0.4289 0.4349 -0.0096 0.0076  0.0084  16  ARG H O   
1739 C  CB  . ARG B 16  ? 0.4543 0.4432 0.4446 -0.0056 0.0022  0.0020  16  ARG H CB  
1740 C  CG  . ARG B 16  ? 0.5018 0.4667 0.4850 0.0013  -0.0002 -0.0006 16  ARG H CG  
1741 C  CD  . ARG B 16  ? 0.5403 0.5402 0.5470 -0.0033 -0.0084 -0.0040 16  ARG H CD  
1742 N  NE  . ARG B 16  ? 0.6014 0.5685 0.5974 -0.0035 -0.0040 0.0006  16  ARG H NE  
1743 C  CZ  . ARG B 16  ? 0.6136 0.5877 0.6030 -0.0010 0.0085  -0.0050 16  ARG H CZ  
1744 N  NH1 . ARG B 16  ? 0.6197 0.6113 0.6176 0.0043  0.0042  -0.0033 16  ARG H NH1 
1745 N  NH2 . ARG B 16  ? 0.6151 0.6030 0.6138 0.0020  0.0015  -0.0054 16  ARG H NH2 
1746 N  N   . SER B 17  ? 0.4433 0.4366 0.4382 -0.0063 0.0024  0.0046  17  SER H N   
1747 C  CA  . SER B 17  ? 0.4427 0.4376 0.4329 -0.0046 0.0022  0.0043  17  SER H CA  
1748 C  C   . SER B 17  ? 0.4375 0.4351 0.4295 -0.0027 0.0022  0.0032  17  SER H C   
1749 O  O   . SER B 17  ? 0.4411 0.4318 0.4269 -0.0012 0.0018  -0.0004 17  SER H O   
1750 C  CB  . SER B 17  ? 0.4416 0.4390 0.4342 -0.0038 0.0032  0.0054  17  SER H CB  
1751 O  OG  . SER B 17  ? 0.4555 0.4362 0.4230 -0.0081 0.0078  0.0105  17  SER H OG  
1752 N  N   . LEU B 18  ? 0.4314 0.4295 0.4227 -0.0028 0.0010  0.0043  18  LEU H N   
1753 C  CA  . LEU B 18  ? 0.4242 0.4241 0.4199 -0.0012 0.0010  0.0019  18  LEU H CA  
1754 C  C   . LEU B 18  ? 0.4176 0.4169 0.4135 -0.0022 0.0015  0.0024  18  LEU H C   
1755 O  O   . LEU B 18  ? 0.4163 0.4140 0.4129 -0.0030 0.0050  0.0012  18  LEU H O   
1756 C  CB  . LEU B 18  ? 0.4216 0.4231 0.4191 -0.0013 0.0005  0.0031  18  LEU H CB  
1757 C  CG  . LEU B 18  ? 0.4304 0.4323 0.4255 0.0029  -0.0001 0.0007  18  LEU H CG  
1758 C  CD1 . LEU B 18  ? 0.4327 0.4168 0.4397 -0.0020 0.0009  0.0053  18  LEU H CD1 
1759 C  CD2 . LEU B 18  ? 0.4169 0.4398 0.4261 0.0076  0.0001  0.0037  18  LEU H CD2 
1760 N  N   . ARG B 19  ? 0.4134 0.4068 0.4056 -0.0018 0.0017  0.0012  19  ARG H N   
1761 C  CA  . ARG B 19  ? 0.4086 0.4006 0.4013 -0.0026 0.0014  0.0019  19  ARG H CA  
1762 C  C   . ARG B 19  ? 0.3882 0.3825 0.3817 -0.0014 0.0017  0.0008  19  ARG H C   
1763 O  O   . ARG B 19  ? 0.3832 0.3750 0.3723 -0.0037 0.0016  0.0015  19  ARG H O   
1764 C  CB  . ARG B 19  ? 0.4065 0.3983 0.3998 -0.0028 -0.0004 0.0031  19  ARG H CB  
1765 C  CG  . ARG B 19  ? 0.4306 0.4103 0.4067 -0.0013 -0.0007 -0.0019 19  ARG H CG  
1766 C  CD  . ARG B 19  ? 0.4365 0.4241 0.4218 0.0017  -0.0046 0.0031  19  ARG H CD  
1767 N  NE  . ARG B 19  ? 0.4744 0.4527 0.4620 -0.0074 -0.0148 -0.0011 19  ARG H NE  
1768 C  CZ  . ARG B 19  ? 0.4815 0.4691 0.4804 -0.0083 0.0014  -0.0060 19  ARG H CZ  
1769 N  NH1 . ARG B 19  ? 0.5039 0.4720 0.4868 -0.0041 0.0075  0.0023  19  ARG H NH1 
1770 N  NH2 . ARG B 19  ? 0.4992 0.4840 0.4845 -0.0132 0.0055  0.0019  19  ARG H NH2 
1771 N  N   . LEU B 20  ? 0.3709 0.3708 0.3656 -0.0021 0.0036  0.0018  20  LEU H N   
1772 C  CA  . LEU B 20  ? 0.3552 0.3564 0.3529 0.0003  0.0013  0.0003  20  LEU H CA  
1773 C  C   . LEU B 20  ? 0.3493 0.3512 0.3484 -0.0016 0.0020  0.0001  20  LEU H C   
1774 O  O   . LEU B 20  ? 0.3432 0.3460 0.3416 -0.0052 0.0044  0.0026  20  LEU H O   
1775 C  CB  . LEU B 20  ? 0.3497 0.3523 0.3452 0.0005  0.0006  0.0007  20  LEU H CB  
1776 C  CG  . LEU B 20  ? 0.3384 0.3357 0.3262 0.0056  0.0058  0.0024  20  LEU H CG  
1777 C  CD1 . LEU B 20  ? 0.3088 0.3143 0.3068 0.0025  0.0054  -0.0032 20  LEU H CD1 
1778 C  CD2 . LEU B 20  ? 0.3168 0.2972 0.2935 0.0033  0.0004  0.0114  20  LEU H CD2 
1779 N  N   . SER B 21  ? 0.3439 0.3483 0.3439 -0.0034 0.0015  0.0004  21  SER H N   
1780 C  CA  . SER B 21  ? 0.3352 0.3455 0.3389 -0.0034 0.0021  0.0022  21  SER H CA  
1781 C  C   . SER B 21  ? 0.3296 0.3432 0.3318 -0.0032 0.0020  0.0000  21  SER H C   
1782 O  O   . SER B 21  ? 0.3226 0.3430 0.3289 -0.0067 0.0041  0.0012  21  SER H O   
1783 C  CB  . SER B 21  ? 0.3358 0.3465 0.3367 -0.0025 0.0019  0.0037  21  SER H CB  
1784 O  OG  . SER B 21  ? 0.3534 0.3490 0.3472 -0.0022 -0.0080 0.0047  21  SER H OG  
1785 N  N   . CYS B 22  ? 0.3250 0.3410 0.3247 -0.0065 0.0051  -0.0014 22  CYS H N   
1786 C  CA  . CYS B 22  ? 0.3220 0.3364 0.3221 -0.0023 0.0042  -0.0013 22  CYS H CA  
1787 C  C   . CYS B 22  ? 0.3202 0.3349 0.3236 -0.0017 0.0032  -0.0016 22  CYS H C   
1788 O  O   . CYS B 22  ? 0.3119 0.3327 0.3161 -0.0044 0.0034  -0.0024 22  CYS H O   
1789 C  CB  . CYS B 22  ? 0.3242 0.3415 0.3247 -0.0017 0.0034  -0.0011 22  CYS H CB  
1790 S  SG  . CYS B 22  ? 0.3199 0.3441 0.3097 -0.0164 0.0098  0.0004  22  CYS H SG  
1791 N  N   . ALA B 23  ? 0.3179 0.3305 0.3263 0.0023  0.0008  -0.0002 23  ALA H N   
1792 C  CA  . ALA B 23  ? 0.3199 0.3332 0.3300 0.0043  0.0033  -0.0008 23  ALA H CA  
1793 C  C   . ALA B 23  ? 0.3192 0.3350 0.3293 0.0070  0.0038  0.0005  23  ALA H C   
1794 O  O   . ALA B 23  ? 0.3226 0.3380 0.3279 0.0097  0.0045  -0.0028 23  ALA H O   
1795 C  CB  . ALA B 23  ? 0.3169 0.3302 0.3255 0.0036  0.0044  -0.0011 23  ALA H CB  
1796 N  N   . ALA B 24  ? 0.3225 0.3454 0.3314 0.0054  0.0028  -0.0002 24  ALA H N   
1797 C  CA  . ALA B 24  ? 0.3297 0.3503 0.3417 0.0041  0.0035  0.0000  24  ALA H CA  
1798 C  C   . ALA B 24  ? 0.3366 0.3590 0.3507 0.0058  0.0016  -0.0012 24  ALA H C   
1799 O  O   . ALA B 24  ? 0.3356 0.3606 0.3549 0.0099  0.0044  -0.0021 24  ALA H O   
1800 C  CB  . ALA B 24  ? 0.3238 0.3544 0.3369 0.0018  0.0025  -0.0001 24  ALA H CB  
1801 N  N   . SER B 25  ? 0.3465 0.3688 0.3658 0.0062  0.0016  -0.0038 25  SER H N   
1802 C  CA  . SER B 25  ? 0.3600 0.3807 0.3744 0.0036  0.0037  -0.0086 25  SER H CA  
1803 C  C   . SER B 25  ? 0.3600 0.3786 0.3683 0.0025  0.0043  -0.0070 25  SER H C   
1804 O  O   . SER B 25  ? 0.3558 0.3803 0.3698 0.0071  0.0027  -0.0100 25  SER H O   
1805 C  CB  . SER B 25  ? 0.3638 0.3862 0.3807 0.0041  0.0026  -0.0093 25  SER H CB  
1806 O  OG  . SER B 25  ? 0.3980 0.4108 0.3881 0.0029  0.0034  -0.0123 25  SER H OG  
1807 N  N   . GLY B 26  ? 0.3644 0.3809 0.3691 0.0000  0.0062  -0.0075 26  GLY H N   
1808 C  CA  . GLY B 26  ? 0.3654 0.3820 0.3660 -0.0026 0.0030  -0.0055 26  GLY H CA  
1809 C  C   . GLY B 26  ? 0.3609 0.3837 0.3692 0.0010  0.0035  -0.0023 26  GLY H C   
1810 O  O   . GLY B 26  ? 0.3601 0.3899 0.3665 -0.0040 0.0025  -0.0015 26  GLY H O   
1811 N  N   . PHE B 27  ? 0.3677 0.3845 0.3701 -0.0003 0.0018  -0.0031 27  PHE H N   
1812 C  CA  . PHE B 27  ? 0.3644 0.3764 0.3648 0.0000  0.0037  -0.0035 27  PHE H CA  
1813 C  C   . PHE B 27  ? 0.3608 0.3735 0.3639 -0.0019 0.0057  -0.0035 27  PHE H C   
1814 O  O   . PHE B 27  ? 0.3624 0.3706 0.3696 0.0002  0.0066  -0.0009 27  PHE H O   
1815 C  CB  . PHE B 27  ? 0.3631 0.3724 0.3632 -0.0011 0.0053  -0.0029 27  PHE H CB  
1816 C  CG  . PHE B 27  ? 0.3650 0.3671 0.3665 0.0002  0.0045  -0.0027 27  PHE H CG  
1817 C  CD1 . PHE B 27  ? 0.3545 0.3695 0.3495 -0.0002 0.0011  -0.0025 27  PHE H CD1 
1818 C  CD2 . PHE B 27  ? 0.3538 0.3499 0.3595 0.0031  -0.0008 0.0007  27  PHE H CD2 
1819 C  CE1 . PHE B 27  ? 0.3561 0.3532 0.3490 -0.0026 -0.0034 -0.0098 27  PHE H CE1 
1820 C  CE2 . PHE B 27  ? 0.3543 0.3517 0.3459 0.0033  0.0081  0.0037  27  PHE H CE2 
1821 C  CZ  . PHE B 27  ? 0.3614 0.3576 0.3465 -0.0019 0.0020  -0.0022 27  PHE H CZ  
1822 N  N   . THR B 28  ? 0.3555 0.3733 0.3591 -0.0034 0.0042  -0.0035 28  THR H N   
1823 C  CA  . THR B 28  ? 0.3541 0.3678 0.3513 -0.0059 0.0029  -0.0034 28  THR H CA  
1824 C  C   . THR B 28  ? 0.3495 0.3635 0.3447 -0.0028 0.0035  -0.0024 28  THR H C   
1825 O  O   . THR B 28  ? 0.3494 0.3700 0.3501 -0.0041 0.0052  -0.0033 28  THR H O   
1826 C  CB  . THR B 28  ? 0.3538 0.3662 0.3494 -0.0067 0.0032  -0.0047 28  THR H CB  
1827 O  OG1 . THR B 28  ? 0.3629 0.3695 0.3419 -0.0163 0.0072  -0.0117 28  THR H OG1 
1828 C  CG2 . THR B 28  ? 0.3588 0.3572 0.3540 -0.0108 -0.0009 -0.0031 28  THR H CG2 
1829 N  N   . PHE B 29  ? 0.3417 0.3566 0.3360 -0.0036 0.0035  -0.0014 29  PHE H N   
1830 C  CA  . PHE B 29  ? 0.3361 0.3516 0.3324 0.0020  0.0008  -0.0025 29  PHE H CA  
1831 C  C   . PHE B 29  ? 0.3311 0.3503 0.3338 0.0019  -0.0005 -0.0040 29  PHE H C   
1832 O  O   . PHE B 29  ? 0.3336 0.3586 0.3376 0.0012  0.0034  -0.0106 29  PHE H O   
1833 C  CB  . PHE B 29  ? 0.3307 0.3426 0.3316 0.0033  -0.0020 -0.0031 29  PHE H CB  
1834 C  CG  . PHE B 29  ? 0.3375 0.3392 0.3345 0.0107  0.0033  -0.0039 29  PHE H CG  
1835 C  CD1 . PHE B 29  ? 0.3317 0.3223 0.3333 0.0061  0.0008  -0.0010 29  PHE H CD1 
1836 C  CD2 . PHE B 29  ? 0.3313 0.3414 0.3387 0.0080  0.0025  -0.0062 29  PHE H CD2 
1837 C  CE1 . PHE B 29  ? 0.3369 0.3376 0.3443 0.0084  0.0027  -0.0095 29  PHE H CE1 
1838 C  CE2 . PHE B 29  ? 0.3377 0.3231 0.3418 0.0050  0.0051  -0.0004 29  PHE H CE2 
1839 C  CZ  . PHE B 29  ? 0.3336 0.3347 0.3364 0.0079  0.0016  -0.0009 29  PHE H CZ  
1840 N  N   . ASN B 30  ? 0.3258 0.3429 0.3224 0.0006  0.0004  -0.0026 30  ASN H N   
1841 C  CA  . ASN B 30  ? 0.3212 0.3375 0.3216 0.0019  -0.0022 0.0000  30  ASN H CA  
1842 C  C   . ASN B 30  ? 0.3165 0.3377 0.3160 0.0021  -0.0028 -0.0002 30  ASN H C   
1843 O  O   . ASN B 30  ? 0.3204 0.3449 0.3150 0.0080  -0.0040 -0.0037 30  ASN H O   
1844 C  CB  . ASN B 30  ? 0.3199 0.3338 0.3180 0.0009  -0.0033 0.0017  30  ASN H CB  
1845 C  CG  . ASN B 30  ? 0.3276 0.3320 0.3185 0.0071  -0.0068 0.0029  30  ASN H CG  
1846 O  OD1 . ASN B 30  ? 0.3472 0.3567 0.3294 0.0035  -0.0173 0.0045  30  ASN H OD1 
1847 N  ND2 . ASN B 30  ? 0.3244 0.3203 0.3167 0.0053  -0.0111 -0.0001 30  ASN H ND2 
1848 N  N   . ASP B 31  ? 0.3049 0.3280 0.3121 -0.0030 -0.0028 0.0012  31  ASP H N   
1849 C  CA  . ASP B 31  ? 0.3064 0.3248 0.3073 -0.0018 0.0007  -0.0003 31  ASP H CA  
1850 C  C   . ASP B 31  ? 0.3014 0.3177 0.3000 -0.0031 0.0042  0.0011  31  ASP H C   
1851 O  O   . ASP B 31  ? 0.3069 0.3200 0.3052 -0.0012 0.0000  0.0080  31  ASP H O   
1852 C  CB  . ASP B 31  ? 0.3085 0.3301 0.3140 -0.0024 0.0047  0.0016  31  ASP H CB  
1853 C  CG  . ASP B 31  ? 0.3226 0.3320 0.3121 -0.0048 -0.0020 -0.0021 31  ASP H CG  
1854 O  OD1 . ASP B 31  ? 0.2742 0.3078 0.3238 -0.0233 0.0061  -0.0008 31  ASP H OD1 
1855 O  OD2 . ASP B 31  ? 0.3953 0.3590 0.3370 0.0206  0.0373  0.0174  31  ASP H OD2 
1856 N  N   . TYR B 32  ? 0.2980 0.3139 0.2917 -0.0038 0.0037  0.0046  32  TYR H N   
1857 C  CA  . TYR B 32  ? 0.2938 0.3059 0.2871 -0.0018 0.0033  0.0023  32  TYR H CA  
1858 C  C   . TYR B 32  ? 0.2941 0.2981 0.2831 -0.0008 0.0022  0.0034  32  TYR H C   
1859 O  O   . TYR B 32  ? 0.2974 0.2947 0.2740 0.0027  -0.0002 -0.0005 32  TYR H O   
1860 C  CB  . TYR B 32  ? 0.3000 0.3093 0.2904 -0.0025 0.0036  0.0010  32  TYR H CB  
1861 C  CG  . TYR B 32  ? 0.2962 0.3091 0.2732 -0.0048 0.0042  -0.0005 32  TYR H CG  
1862 C  CD1 . TYR B 32  ? 0.2964 0.3010 0.2663 -0.0056 0.0079  -0.0051 32  TYR H CD1 
1863 C  CD2 . TYR B 32  ? 0.2936 0.3109 0.2684 -0.0058 0.0012  -0.0016 32  TYR H CD2 
1864 C  CE1 . TYR B 32  ? 0.2969 0.3119 0.2948 -0.0050 0.0045  -0.0063 32  TYR H CE1 
1865 C  CE2 . TYR B 32  ? 0.2992 0.3334 0.2864 -0.0086 0.0033  -0.0053 32  TYR H CE2 
1866 C  CZ  . TYR B 32  ? 0.3001 0.3177 0.3017 -0.0064 0.0048  0.0005  32  TYR H CZ  
1867 O  OH  . TYR B 32  ? 0.3134 0.3319 0.3191 -0.0122 0.0052  -0.0041 32  TYR H OH  
1868 N  N   . ALA B 33  ? 0.2860 0.2885 0.2756 -0.0024 0.0008  0.0036  33  ALA H N   
1869 C  CA  . ALA B 33  ? 0.2732 0.2753 0.2634 -0.0037 0.0015  0.0049  33  ALA H CA  
1870 C  C   . ALA B 33  ? 0.2671 0.2686 0.2633 -0.0051 0.0021  0.0050  33  ALA H C   
1871 O  O   . ALA B 33  ? 0.2685 0.2564 0.2567 -0.0098 -0.0022 0.0029  33  ALA H O   
1872 C  CB  . ALA B 33  ? 0.2783 0.2756 0.2634 -0.0046 0.0035  0.0069  33  ALA H CB  
1873 N  N   . MET B 34  ? 0.2600 0.2677 0.2567 -0.0043 0.0033  0.0031  34  MET H N   
1874 C  CA  . MET B 34  ? 0.2519 0.2637 0.2519 -0.0033 -0.0021 0.0029  34  MET H CA  
1875 C  C   . MET B 34  ? 0.2450 0.2589 0.2463 -0.0013 0.0012  0.0051  34  MET H C   
1876 O  O   . MET B 34  ? 0.2300 0.2531 0.2327 0.0025  -0.0053 -0.0003 34  MET H O   
1877 C  CB  . MET B 34  ? 0.2554 0.2681 0.2589 -0.0014 -0.0009 0.0043  34  MET H CB  
1878 C  CG  . MET B 34  ? 0.2649 0.2806 0.2793 0.0021  -0.0166 0.0004  34  MET H CG  
1879 S  SD  . MET B 34  ? 0.2955 0.3354 0.3042 0.0310  -0.0183 0.0042  34  MET H SD  
1880 C  CE  . MET B 34  ? 0.2681 0.2863 0.2748 0.0145  -0.0148 0.0136  34  MET H CE  
1881 N  N   . HIS B 35  ? 0.2406 0.2539 0.2454 -0.0025 -0.0013 0.0014  35  HIS H N   
1882 C  CA  . HIS B 35  ? 0.2401 0.2542 0.2451 0.0000  0.0008  0.0004  35  HIS H CA  
1883 C  C   . HIS B 35  ? 0.2437 0.2547 0.2453 0.0001  -0.0029 0.0013  35  HIS H C   
1884 O  O   . HIS B 35  ? 0.2405 0.2555 0.2505 0.0066  -0.0089 0.0002  35  HIS H O   
1885 C  CB  . HIS B 35  ? 0.2358 0.2477 0.2389 0.0014  0.0033  -0.0004 35  HIS H CB  
1886 C  CG  . HIS B 35  ? 0.2460 0.2631 0.2580 -0.0006 -0.0016 0.0004  35  HIS H CG  
1887 N  ND1 . HIS B 35  ? 0.2800 0.2765 0.2770 -0.0022 -0.0020 -0.0066 35  HIS H ND1 
1888 C  CD2 . HIS B 35  ? 0.2498 0.2587 0.2445 -0.0056 -0.0015 -0.0112 35  HIS H CD2 
1889 C  CE1 . HIS B 35  ? 0.2696 0.2694 0.2698 -0.0015 0.0009  -0.0073 35  HIS H CE1 
1890 N  NE2 . HIS B 35  ? 0.2749 0.2783 0.2798 -0.0070 0.0022  -0.0004 35  HIS H NE2 
1891 N  N   . TRP B 36  ? 0.2466 0.2581 0.2526 -0.0017 -0.0010 0.0041  36  TRP H N   
1892 C  CA  . TRP B 36  ? 0.2511 0.2525 0.2532 -0.0041 -0.0010 0.0009  36  TRP H CA  
1893 C  C   . TRP B 36  ? 0.2486 0.2560 0.2498 -0.0034 -0.0012 -0.0002 36  TRP H C   
1894 O  O   . TRP B 36  ? 0.2452 0.2545 0.2408 -0.0052 -0.0026 -0.0007 36  TRP H O   
1895 C  CB  . TRP B 36  ? 0.2482 0.2527 0.2641 -0.0002 -0.0010 0.0013  36  TRP H CB  
1896 C  CG  . TRP B 36  ? 0.2501 0.2556 0.2576 -0.0030 -0.0011 0.0042  36  TRP H CG  
1897 C  CD1 . TRP B 36  ? 0.2441 0.2586 0.2595 -0.0052 -0.0031 -0.0043 36  TRP H CD1 
1898 C  CD2 . TRP B 36  ? 0.2658 0.2617 0.2643 0.0015  0.0012  0.0017  36  TRP H CD2 
1899 N  NE1 . TRP B 36  ? 0.2661 0.2685 0.2681 0.0088  -0.0032 -0.0098 36  TRP H NE1 
1900 C  CE2 . TRP B 36  ? 0.2684 0.2694 0.2613 0.0033  -0.0031 -0.0009 36  TRP H CE2 
1901 C  CE3 . TRP B 36  ? 0.2802 0.2725 0.2682 0.0070  -0.0011 -0.0061 36  TRP H CE3 
1902 C  CZ2 . TRP B 36  ? 0.2466 0.2532 0.2605 0.0011  -0.0003 -0.0004 36  TRP H CZ2 
1903 C  CZ3 . TRP B 36  ? 0.2523 0.2590 0.2692 -0.0032 -0.0041 0.0026  36  TRP H CZ3 
1904 C  CH2 . TRP B 36  ? 0.2444 0.2488 0.2600 -0.0052 -0.0057 0.0026  36  TRP H CH2 
1905 N  N   . VAL B 37  ? 0.2536 0.2589 0.2574 -0.0037 -0.0011 -0.0001 37  VAL H N   
1906 C  CA  . VAL B 37  ? 0.2598 0.2623 0.2597 -0.0038 -0.0013 -0.0011 37  VAL H CA  
1907 C  C   . VAL B 37  ? 0.2663 0.2731 0.2675 -0.0024 -0.0006 -0.0022 37  VAL H C   
1908 O  O   . VAL B 37  ? 0.2706 0.2830 0.2706 -0.0012 -0.0005 -0.0062 37  VAL H O   
1909 C  CB  . VAL B 37  ? 0.2648 0.2606 0.2604 -0.0037 -0.0021 -0.0009 37  VAL H CB  
1910 C  CG1 . VAL B 37  ? 0.2469 0.2419 0.2538 -0.0066 -0.0035 -0.0015 37  VAL H CG1 
1911 C  CG2 . VAL B 37  ? 0.2677 0.2611 0.2530 -0.0046 0.0050  0.0026  37  VAL H CG2 
1912 N  N   . ARG B 38  ? 0.2734 0.2788 0.2695 -0.0029 -0.0007 -0.0021 38  ARG H N   
1913 C  CA  . ARG B 38  ? 0.2742 0.2781 0.2667 -0.0037 0.0000  -0.0008 38  ARG H CA  
1914 C  C   . ARG B 38  ? 0.2806 0.2812 0.2789 -0.0028 0.0008  0.0032  38  ARG H C   
1915 O  O   . ARG B 38  ? 0.2825 0.2809 0.2848 0.0027  0.0067  0.0050  38  ARG H O   
1916 C  CB  . ARG B 38  ? 0.2754 0.2759 0.2551 0.0000  -0.0031 0.0009  38  ARG H CB  
1917 C  CG  . ARG B 38  ? 0.2665 0.2709 0.2496 0.0010  0.0027  -0.0005 38  ARG H CG  
1918 C  CD  . ARG B 38  ? 0.2754 0.2689 0.2712 -0.0004 -0.0051 0.0039  38  ARG H CD  
1919 N  NE  . ARG B 38  ? 0.2952 0.2835 0.2867 0.0039  0.0014  0.0062  38  ARG H NE  
1920 C  CZ  . ARG B 38  ? 0.2944 0.3082 0.2897 0.0067  0.0091  0.0010  38  ARG H CZ  
1921 N  NH1 . ARG B 38  ? 0.3052 0.3185 0.2725 0.0034  0.0114  0.0085  38  ARG H NH1 
1922 N  NH2 . ARG B 38  ? 0.2795 0.3202 0.2638 0.0141  0.0046  0.0022  38  ARG H NH2 
1923 N  N   . GLN B 39  ? 0.2873 0.2901 0.2783 -0.0040 0.0017  0.0006  39  GLN H N   
1924 C  CA  . GLN B 39  ? 0.2969 0.2963 0.2856 -0.0023 -0.0018 0.0056  39  GLN H CA  
1925 C  C   . GLN B 39  ? 0.3124 0.3081 0.2936 -0.0047 -0.0012 0.0073  39  GLN H C   
1926 O  O   . GLN B 39  ? 0.2973 0.3025 0.2817 -0.0019 -0.0009 0.0121  39  GLN H O   
1927 C  CB  . GLN B 39  ? 0.2967 0.2948 0.2863 -0.0033 -0.0047 0.0034  39  GLN H CB  
1928 C  CG  . GLN B 39  ? 0.2924 0.2949 0.2856 -0.0055 0.0014  0.0064  39  GLN H CG  
1929 C  CD  . GLN B 39  ? 0.2929 0.2907 0.2799 0.0003  -0.0032 0.0027  39  GLN H CD  
1930 O  OE1 . GLN B 39  ? 0.2832 0.2878 0.2638 0.0089  0.0047  0.0005  39  GLN H OE1 
1931 N  NE2 . GLN B 39  ? 0.2879 0.2738 0.2631 -0.0008 -0.0029 -0.0001 39  GLN H NE2 
1932 N  N   . ALA B 40  ? 0.3251 0.3276 0.3132 -0.0048 -0.0029 0.0071  40  ALA H N   
1933 C  CA  . ALA B 40  ? 0.3522 0.3437 0.3366 -0.0038 -0.0037 0.0016  40  ALA H CA  
1934 C  C   . ALA B 40  ? 0.3739 0.3605 0.3518 -0.0036 -0.0046 -0.0010 40  ALA H C   
1935 O  O   . ALA B 40  ? 0.3727 0.3510 0.3396 -0.0075 -0.0051 -0.0007 40  ALA H O   
1936 C  CB  . ALA B 40  ? 0.3473 0.3407 0.3346 -0.0087 -0.0068 0.0028  40  ALA H CB  
1937 N  N   . PRO B 41  ? 0.3978 0.3786 0.3775 -0.0016 -0.0011 -0.0036 41  PRO H N   
1938 C  CA  . PRO B 41  ? 0.4045 0.3874 0.3808 -0.0032 0.0013  -0.0002 41  PRO H CA  
1939 C  C   . PRO B 41  ? 0.4062 0.3967 0.3894 -0.0022 -0.0006 -0.0023 41  PRO H C   
1940 O  O   . PRO B 41  ? 0.4104 0.4064 0.3922 -0.0056 -0.0031 -0.0060 41  PRO H O   
1941 C  CB  . PRO B 41  ? 0.4104 0.3928 0.3896 -0.0068 0.0011  -0.0021 41  PRO H CB  
1942 C  CG  . PRO B 41  ? 0.4125 0.3959 0.3857 -0.0083 0.0018  -0.0055 41  PRO H CG  
1943 C  CD  . PRO B 41  ? 0.4010 0.3814 0.3787 -0.0039 0.0007  0.0016  41  PRO H CD  
1944 N  N   . GLY B 42  ? 0.4070 0.3957 0.3862 -0.0002 -0.0017 -0.0007 42  GLY H N   
1945 C  CA  . GLY B 42  ? 0.4044 0.3954 0.3813 0.0023  0.0000  0.0005  42  GLY H CA  
1946 C  C   . GLY B 42  ? 0.3977 0.3908 0.3755 0.0019  0.0002  -0.0003 42  GLY H C   
1947 O  O   . GLY B 42  ? 0.3964 0.3918 0.3747 0.0016  -0.0014 -0.0028 42  GLY H O   
1948 N  N   . LYS B 43  ? 0.3865 0.3835 0.3735 0.0020  0.0010  -0.0015 43  LYS H N   
1949 C  CA  . LYS B 43  ? 0.3840 0.3719 0.3657 -0.0016 -0.0024 -0.0001 43  LYS H CA  
1950 C  C   . LYS B 43  ? 0.3657 0.3567 0.3450 -0.0009 -0.0038 0.0027  43  LYS H C   
1951 O  O   . LYS B 43  ? 0.3636 0.3487 0.3335 -0.0040 -0.0042 0.0027  43  LYS H O   
1952 C  CB  . LYS B 43  ? 0.3912 0.3805 0.3778 0.0001  0.0044  0.0026  43  LYS H CB  
1953 C  CG  . LYS B 43  ? 0.3910 0.3937 0.3903 -0.0009 -0.0077 -0.0006 43  LYS H CG  
1954 C  CD  . LYS B 43  ? 0.4344 0.4351 0.4264 0.0019  -0.0093 -0.0005 43  LYS H CD  
1955 C  CE  . LYS B 43  ? 0.4105 0.4245 0.4113 -0.0105 -0.0104 -0.0175 43  LYS H CE  
1956 N  NZ  . LYS B 43  ? 0.4301 0.4516 0.4256 -0.0140 -0.0088 0.0049  43  LYS H NZ  
1957 N  N   . GLY B 44  ? 0.3531 0.3382 0.3229 -0.0011 -0.0061 0.0044  44  GLY H N   
1958 C  CA  . GLY B 44  ? 0.3402 0.3282 0.3168 -0.0002 -0.0029 0.0067  44  GLY H CA  
1959 C  C   . GLY B 44  ? 0.3373 0.3238 0.3082 -0.0048 -0.0035 0.0031  44  GLY H C   
1960 O  O   . GLY B 44  ? 0.3471 0.3208 0.2958 -0.0010 -0.0062 0.0092  44  GLY H O   
1961 N  N   . LEU B 45  ? 0.3281 0.3179 0.3026 -0.0043 0.0000  0.0042  45  LEU H N   
1962 C  CA  . LEU B 45  ? 0.3095 0.3038 0.3008 -0.0019 -0.0021 0.0045  45  LEU H CA  
1963 C  C   . LEU B 45  ? 0.3132 0.3045 0.2994 -0.0008 -0.0010 0.0010  45  LEU H C   
1964 O  O   . LEU B 45  ? 0.3088 0.2988 0.2960 0.0000  0.0009  0.0031  45  LEU H O   
1965 C  CB  . LEU B 45  ? 0.3069 0.2985 0.2976 -0.0002 -0.0006 0.0064  45  LEU H CB  
1966 C  CG  . LEU B 45  ? 0.2894 0.2841 0.2937 -0.0019 -0.0001 0.0013  45  LEU H CG  
1967 C  CD1 . LEU B 45  ? 0.2862 0.2702 0.2654 -0.0024 0.0022  0.0037  45  LEU H CD1 
1968 C  CD2 . LEU B 45  ? 0.2736 0.2642 0.2696 -0.0040 0.0009  -0.0013 45  LEU H CD2 
1969 N  N   . GLU B 46  ? 0.3116 0.3034 0.3018 0.0008  -0.0038 0.0011  46  GLU H N   
1970 C  CA  . GLU B 46  ? 0.3192 0.3179 0.3102 0.0009  -0.0022 -0.0008 46  GLU H CA  
1971 C  C   . GLU B 46  ? 0.3115 0.3109 0.3044 0.0017  -0.0019 -0.0003 46  GLU H C   
1972 O  O   . GLU B 46  ? 0.3111 0.3067 0.2940 0.0002  -0.0071 0.0020  46  GLU H O   
1973 C  CB  . GLU B 46  ? 0.3196 0.3122 0.3115 0.0020  -0.0015 -0.0018 46  GLU H CB  
1974 C  CG  . GLU B 46  ? 0.3321 0.3272 0.3380 -0.0038 0.0015  0.0000  46  GLU H CG  
1975 C  CD  . GLU B 46  ? 0.3472 0.3557 0.3564 -0.0045 -0.0010 -0.0028 46  GLU H CD  
1976 O  OE1 . GLU B 46  ? 0.3768 0.4062 0.3981 0.0063  0.0032  -0.0018 46  GLU H OE1 
1977 O  OE2 . GLU B 46  ? 0.4019 0.3945 0.4184 0.0077  -0.0036 -0.0184 46  GLU H OE2 
1978 N  N   . TRP B 47  ? 0.3101 0.3127 0.2986 -0.0018 -0.0019 0.0009  47  TRP H N   
1979 C  CA  . TRP B 47  ? 0.3035 0.3079 0.2972 -0.0016 -0.0008 -0.0002 47  TRP H CA  
1980 C  C   . TRP B 47  ? 0.3010 0.3054 0.2930 -0.0009 -0.0010 0.0004  47  TRP H C   
1981 O  O   . TRP B 47  ? 0.2994 0.3030 0.2917 -0.0032 -0.0015 0.0011  47  TRP H O   
1982 C  CB  . TRP B 47  ? 0.3064 0.3045 0.2971 -0.0038 -0.0013 0.0005  47  TRP H CB  
1983 C  CG  . TRP B 47  ? 0.3058 0.3068 0.2980 -0.0051 0.0022  0.0017  47  TRP H CG  
1984 C  CD1 . TRP B 47  ? 0.2986 0.2880 0.2891 -0.0003 -0.0024 0.0085  47  TRP H CD1 
1985 C  CD2 . TRP B 47  ? 0.2962 0.2845 0.2891 -0.0053 0.0035  0.0033  47  TRP H CD2 
1986 N  NE1 . TRP B 47  ? 0.3104 0.2892 0.2897 -0.0062 0.0005  0.0026  47  TRP H NE1 
1987 C  CE2 . TRP B 47  ? 0.2958 0.2858 0.2827 -0.0011 0.0024  0.0045  47  TRP H CE2 
1988 C  CE3 . TRP B 47  ? 0.3001 0.2884 0.2897 0.0016  0.0083  0.0020  47  TRP H CE3 
1989 C  CZ2 . TRP B 47  ? 0.2977 0.2990 0.3017 0.0023  0.0071  -0.0028 47  TRP H CZ2 
1990 C  CZ3 . TRP B 47  ? 0.3016 0.3040 0.2929 -0.0028 0.0030  0.0053  47  TRP H CZ3 
1991 C  CH2 . TRP B 47  ? 0.2992 0.3046 0.2908 -0.0051 0.0012  0.0058  47  TRP H CH2 
1992 N  N   . VAL B 48  ? 0.2969 0.3052 0.2883 -0.0005 -0.0008 0.0002  48  VAL H N   
1993 C  CA  . VAL B 48  ? 0.2918 0.3039 0.2874 -0.0032 -0.0009 -0.0025 48  VAL H CA  
1994 C  C   . VAL B 48  ? 0.2901 0.3069 0.2844 -0.0034 -0.0006 -0.0005 48  VAL H C   
1995 O  O   . VAL B 48  ? 0.2889 0.3030 0.2728 -0.0059 -0.0020 -0.0007 48  VAL H O   
1996 C  CB  . VAL B 48  ? 0.2916 0.3056 0.2931 -0.0026 -0.0007 -0.0015 48  VAL H CB  
1997 C  CG1 . VAL B 48  ? 0.2862 0.3023 0.2769 0.0029  -0.0034 0.0029  48  VAL H CG1 
1998 C  CG2 . VAL B 48  ? 0.2998 0.3051 0.2920 -0.0026 0.0000  -0.0084 48  VAL H CG2 
1999 N  N   . SER B 49  ? 0.2913 0.3043 0.2810 -0.0023 -0.0004 -0.0001 49  SER H N   
2000 C  CA  . SER B 49  ? 0.2885 0.3042 0.2850 -0.0023 -0.0009 0.0030  49  SER H CA  
2001 C  C   . SER B 49  ? 0.2884 0.2965 0.2824 0.0002  -0.0023 0.0019  49  SER H C   
2002 O  O   . SER B 49  ? 0.2890 0.2940 0.2705 -0.0004 -0.0038 0.0013  49  SER H O   
2003 C  CB  . SER B 49  ? 0.2884 0.3086 0.2853 -0.0048 -0.0023 0.0020  49  SER H CB  
2004 O  OG  . SER B 49  ? 0.2914 0.3289 0.2914 -0.0154 0.0056  0.0087  49  SER H OG  
2005 N  N   . THR B 50  ? 0.2876 0.2931 0.2854 0.0031  0.0025  -0.0001 50  THR H N   
2006 C  CA  . THR B 50  ? 0.2927 0.2989 0.2883 -0.0001 0.0015  0.0002  50  THR H CA  
2007 C  C   . THR B 50  ? 0.2878 0.2994 0.2852 0.0007  -0.0003 0.0039  50  THR H C   
2008 O  O   . THR B 50  ? 0.2929 0.3004 0.2816 -0.0021 0.0035  0.0102  50  THR H O   
2009 C  CB  . THR B 50  ? 0.2943 0.2939 0.2918 -0.0017 0.0006  0.0043  50  THR H CB  
2010 O  OG1 . THR B 50  ? 0.2940 0.2977 0.2991 -0.0068 -0.0057 -0.0003 50  THR H OG1 
2011 C  CG2 . THR B 50  ? 0.3057 0.3000 0.2957 0.0010  0.0030  0.0006  50  THR H CG2 
2012 N  N   . ILE B 51  ? 0.2897 0.2986 0.2810 -0.0002 -0.0006 -0.0019 51  ILE H N   
2013 C  CA  . ILE B 51  ? 0.2772 0.2892 0.2662 0.0000  -0.0033 -0.0018 51  ILE H CA  
2014 C  C   . ILE B 51  ? 0.2822 0.2997 0.2667 0.0022  -0.0026 -0.0051 51  ILE H C   
2015 O  O   . ILE B 51  ? 0.2868 0.3042 0.2377 0.0060  0.0012  -0.0127 51  ILE H O   
2016 C  CB  . ILE B 51  ? 0.2744 0.2914 0.2696 -0.0024 -0.0056 -0.0021 51  ILE H CB  
2017 C  CG1 . ILE B 51  ? 0.2663 0.2837 0.2605 -0.0063 -0.0043 0.0010  51  ILE H CG1 
2018 C  CG2 . ILE B 51  ? 0.2675 0.2815 0.2555 -0.0081 -0.0070 -0.0057 51  ILE H CG2 
2019 C  CD1 . ILE B 51  ? 0.2556 0.2816 0.2594 0.0000  -0.0051 0.0003  51  ILE H CD1 
2020 N  N   . SER B 52  ? 0.2838 0.2999 0.2684 0.0059  0.0049  -0.0093 52  SER H N   
2021 C  CA  . SER B 52  ? 0.2815 0.2961 0.2711 0.0017  0.0044  -0.0085 52  SER H CA  
2022 C  C   . SER B 52  ? 0.2937 0.3014 0.2751 0.0012  0.0037  -0.0062 52  SER H C   
2023 O  O   . SER B 52  ? 0.3010 0.3152 0.2825 -0.0019 0.0039  -0.0026 52  SER H O   
2024 C  CB  . SER B 52  ? 0.2809 0.2937 0.2728 0.0014  0.0028  -0.0041 52  SER H CB  
2025 O  OG  . SER B 52  ? 0.2490 0.2857 0.2611 0.0042  0.0074  -0.0001 52  SER H OG  
2026 N  N   . TRP B 53  ? 0.2962 0.3061 0.2831 -0.0011 0.0020  -0.0062 53  TRP H N   
2027 C  CA  . TRP B 53  ? 0.3034 0.3147 0.2921 -0.0015 0.0000  -0.0076 53  TRP H CA  
2028 C  C   . TRP B 53  ? 0.3120 0.3236 0.3101 -0.0001 -0.0034 -0.0077 53  TRP H C   
2029 O  O   . TRP B 53  ? 0.3055 0.3269 0.3169 0.0053  -0.0048 -0.0158 53  TRP H O   
2030 C  CB  . TRP B 53  ? 0.3022 0.3154 0.2896 0.0003  -0.0008 -0.0055 53  TRP H CB  
2031 C  CG  . TRP B 53  ? 0.3103 0.3076 0.2993 0.0039  -0.0031 -0.0061 53  TRP H CG  
2032 C  CD1 . TRP B 53  ? 0.3127 0.3067 0.2938 0.0042  -0.0079 -0.0001 53  TRP H CD1 
2033 C  CD2 . TRP B 53  ? 0.2991 0.2953 0.2858 0.0000  0.0020  -0.0029 53  TRP H CD2 
2034 N  NE1 . TRP B 53  ? 0.3216 0.2920 0.3008 0.0107  0.0008  -0.0046 53  TRP H NE1 
2035 C  CE2 . TRP B 53  ? 0.3024 0.3066 0.2985 0.0001  -0.0002 -0.0034 53  TRP H CE2 
2036 C  CE3 . TRP B 53  ? 0.2827 0.3002 0.2728 0.0024  0.0070  -0.0062 53  TRP H CE3 
2037 C  CZ2 . TRP B 53  ? 0.3068 0.3048 0.2968 0.0016  -0.0003 -0.0042 53  TRP H CZ2 
2038 C  CZ3 . TRP B 53  ? 0.3007 0.3115 0.2960 -0.0017 0.0020  -0.0026 53  TRP H CZ3 
2039 C  CH2 . TRP B 53  ? 0.3074 0.3056 0.2994 0.0018  -0.0046 -0.0044 53  TRP H CH2 
2040 N  N   . ASN B 54  ? 0.3183 0.3392 0.3179 0.0006  0.0010  -0.0057 54  ASN H N   
2041 C  CA  . ASN B 54  ? 0.3266 0.3448 0.3218 0.0000  -0.0037 0.0018  54  ASN H CA  
2042 C  C   . ASN B 54  ? 0.3260 0.3505 0.3203 0.0013  -0.0023 0.0029  54  ASN H C   
2043 O  O   . ASN B 54  ? 0.3238 0.3640 0.3239 0.0064  0.0000  0.0027  54  ASN H O   
2044 C  CB  . ASN B 54  ? 0.3317 0.3472 0.3200 0.0000  -0.0024 0.0005  54  ASN H CB  
2045 C  CG  . ASN B 54  ? 0.3479 0.3743 0.3501 -0.0003 0.0004  -0.0031 54  ASN H CG  
2046 O  OD1 . ASN B 54  ? 0.3881 0.4181 0.3836 0.0063  -0.0048 -0.0094 54  ASN H OD1 
2047 N  ND2 . ASN B 54  ? 0.3661 0.3980 0.3732 -0.0081 0.0035  -0.0144 54  ASN H ND2 
2048 N  N   . SER B 55  ? 0.3266 0.3475 0.3112 0.0011  -0.0011 0.0015  55  SER H N   
2049 C  CA  . SER B 55  ? 0.3207 0.3441 0.2994 0.0024  -0.0071 0.0021  55  SER H CA  
2050 C  C   . SER B 55  ? 0.3202 0.3413 0.3025 0.0021  -0.0092 0.0031  55  SER H C   
2051 O  O   . SER B 55  ? 0.3168 0.3488 0.3041 0.0007  -0.0115 0.0014  55  SER H O   
2052 C  CB  . SER B 55  ? 0.3225 0.3400 0.3026 0.0032  -0.0028 0.0021  55  SER H CB  
2053 O  OG  . SER B 55  ? 0.3280 0.3455 0.2709 0.0092  -0.0036 0.0066  55  SER H OG  
2054 N  N   . GLY B 56  ? 0.3195 0.3351 0.3049 0.0054  -0.0095 0.0052  56  GLY H N   
2055 C  CA  . GLY B 56  ? 0.3282 0.3400 0.3164 0.0041  -0.0042 0.0032  56  GLY H CA  
2056 C  C   . GLY B 56  ? 0.3283 0.3468 0.3245 0.0021  -0.0033 0.0007  56  GLY H C   
2057 O  O   . GLY B 56  ? 0.3299 0.3546 0.3251 0.0018  -0.0009 0.0012  56  GLY H O   
2058 N  N   . SER B 57  ? 0.3316 0.3450 0.3237 0.0030  0.0005  0.0018  57  SER H N   
2059 C  CA  . SER B 57  ? 0.3389 0.3524 0.3379 0.0051  0.0008  0.0018  57  SER H CA  
2060 C  C   . SER B 57  ? 0.3349 0.3525 0.3337 0.0020  0.0006  0.0018  57  SER H C   
2061 O  O   . SER B 57  ? 0.3350 0.3566 0.3263 0.0045  0.0030  0.0005  57  SER H O   
2062 C  CB  . SER B 57  ? 0.3438 0.3560 0.3471 0.0053  0.0012  0.0035  57  SER H CB  
2063 O  OG  . SER B 57  ? 0.3839 0.3866 0.3757 0.0165  0.0020  0.0041  57  SER H OG  
2064 N  N   . ILE B 58  ? 0.3351 0.3442 0.3289 0.0015  -0.0006 0.0027  58  ILE H N   
2065 C  CA  . ILE B 58  ? 0.3284 0.3312 0.3227 -0.0012 0.0013  0.0040  58  ILE H CA  
2066 C  C   . ILE B 58  ? 0.3289 0.3299 0.3220 -0.0019 0.0010  0.0050  58  ILE H C   
2067 O  O   . ILE B 58  ? 0.3225 0.3266 0.3105 -0.0012 0.0026  0.0071  58  ILE H O   
2068 C  CB  . ILE B 58  ? 0.3308 0.3343 0.3240 0.0029  0.0011  0.0024  58  ILE H CB  
2069 C  CG1 . ILE B 58  ? 0.3172 0.3389 0.3251 -0.0027 0.0020  0.0023  58  ILE H CG1 
2070 C  CG2 . ILE B 58  ? 0.3241 0.3238 0.3291 0.0000  0.0005  0.0038  58  ILE H CG2 
2071 C  CD1 . ILE B 58  ? 0.3262 0.3306 0.3190 0.0005  0.0029  0.0056  58  ILE H CD1 
2072 N  N   . GLY B 59  ? 0.3286 0.3283 0.3203 -0.0035 0.0005  0.0036  59  GLY H N   
2073 C  CA  . GLY B 59  ? 0.3280 0.3299 0.3221 -0.0045 0.0004  0.0047  59  GLY H CA  
2074 C  C   . GLY B 59  ? 0.3297 0.3321 0.3247 -0.0044 -0.0008 0.0051  59  GLY H C   
2075 O  O   . GLY B 59  ? 0.3233 0.3300 0.3231 -0.0079 0.0022  0.0066  59  GLY H O   
2076 N  N   . TYR B 60  ? 0.3347 0.3372 0.3323 -0.0033 -0.0028 0.0054  60  TYR H N   
2077 C  CA  . TYR B 60  ? 0.3411 0.3407 0.3371 -0.0030 -0.0027 0.0021  60  TYR H CA  
2078 C  C   . TYR B 60  ? 0.3440 0.3467 0.3444 -0.0025 -0.0047 0.0002  60  TYR H C   
2079 O  O   . TYR B 60  ? 0.3377 0.3477 0.3471 -0.0064 -0.0080 -0.0029 60  TYR H O   
2080 C  CB  . TYR B 60  ? 0.3423 0.3413 0.3343 -0.0029 0.0000  0.0013  60  TYR H CB  
2081 C  CG  . TYR B 60  ? 0.3297 0.3360 0.3272 0.0034  -0.0026 0.0054  60  TYR H CG  
2082 C  CD1 . TYR B 60  ? 0.3433 0.3319 0.3242 -0.0034 0.0018  0.0053  60  TYR H CD1 
2083 C  CD2 . TYR B 60  ? 0.3337 0.3350 0.3334 -0.0055 -0.0024 0.0066  60  TYR H CD2 
2084 C  CE1 . TYR B 60  ? 0.3410 0.3532 0.3398 -0.0021 -0.0023 0.0067  60  TYR H CE1 
2085 C  CE2 . TYR B 60  ? 0.3418 0.3429 0.3335 -0.0020 -0.0023 0.0070  60  TYR H CE2 
2086 C  CZ  . TYR B 60  ? 0.3279 0.3429 0.3249 0.0084  -0.0041 0.0009  60  TYR H CZ  
2087 O  OH  . TYR B 60  ? 0.3336 0.3452 0.3370 -0.0054 0.0000  0.0019  60  TYR H OH  
2088 N  N   . ALA B 61  ? 0.3517 0.3501 0.3482 -0.0023 -0.0030 -0.0012 61  ALA H N   
2089 C  CA  . ALA B 61  ? 0.3571 0.3612 0.3589 0.0023  -0.0050 0.0000  61  ALA H CA  
2090 C  C   . ALA B 61  ? 0.3710 0.3728 0.3702 0.0014  -0.0041 -0.0009 61  ALA H C   
2091 O  O   . ALA B 61  ? 0.3622 0.3738 0.3695 0.0047  -0.0066 0.0018  61  ALA H O   
2092 C  CB  . ALA B 61  ? 0.3496 0.3578 0.3491 0.0002  -0.0073 0.0036  61  ALA H CB  
2093 N  N   . ASP B 62  ? 0.3867 0.3915 0.3923 0.0062  -0.0056 0.0019  62  ASP H N   
2094 C  CA  . ASP B 62  ? 0.4090 0.4164 0.4178 0.0045  -0.0033 0.0025  62  ASP H CA  
2095 C  C   . ASP B 62  ? 0.4174 0.4237 0.4247 0.0036  -0.0043 0.0028  62  ASP H C   
2096 O  O   . ASP B 62  ? 0.4169 0.4282 0.4298 0.0006  -0.0016 0.0010  62  ASP H O   
2097 C  CB  . ASP B 62  ? 0.4179 0.4230 0.4267 0.0054  -0.0070 0.0012  62  ASP H CB  
2098 C  CG  . ASP B 62  ? 0.4379 0.4517 0.4533 0.0062  -0.0020 0.0037  62  ASP H CG  
2099 O  OD1 . ASP B 62  ? 0.4222 0.4321 0.4820 -0.0052 -0.0048 0.0168  62  ASP H OD1 
2100 O  OD2 . ASP B 62  ? 0.5185 0.4843 0.5140 0.0160  -0.0122 0.0009  62  ASP H OD2 
2101 N  N   . SER B 63  ? 0.4307 0.4383 0.4314 0.0030  -0.0033 0.0021  63  SER H N   
2102 C  CA  . SER B 63  ? 0.4447 0.4514 0.4432 0.0015  -0.0018 0.0011  63  SER H CA  
2103 C  C   . SER B 63  ? 0.4455 0.4556 0.4458 0.0024  -0.0006 0.0019  63  SER H C   
2104 O  O   . SER B 63  ? 0.4418 0.4574 0.4425 0.0008  -0.0038 0.0015  63  SER H O   
2105 C  CB  . SER B 63  ? 0.4475 0.4578 0.4427 0.0021  0.0024  0.0020  63  SER H CB  
2106 O  OG  . SER B 63  ? 0.4702 0.4687 0.4499 -0.0038 -0.0011 0.0026  63  SER H OG  
2107 N  N   . VAL B 64  ? 0.4496 0.4614 0.4512 0.0022  0.0011  0.0000  64  VAL H N   
2108 C  CA  . VAL B 64  ? 0.4612 0.4636 0.4603 0.0028  0.0010  0.0025  64  VAL H CA  
2109 C  C   . VAL B 64  ? 0.4722 0.4723 0.4676 0.0032  0.0034  0.0031  64  VAL H C   
2110 O  O   . VAL B 64  ? 0.4810 0.4747 0.4717 0.0027  0.0072  0.0024  64  VAL H O   
2111 C  CB  . VAL B 64  ? 0.4537 0.4641 0.4597 0.0053  0.0014  0.0041  64  VAL H CB  
2112 C  CG1 . VAL B 64  ? 0.4487 0.4539 0.4536 0.0013  0.0030  0.0018  64  VAL H CG1 
2113 C  CG2 . VAL B 64  ? 0.4389 0.4516 0.4621 0.0092  -0.0019 0.0021  64  VAL H CG2 
2114 N  N   . LYS B 65  ? 0.4762 0.4770 0.4715 0.0038  0.0043  0.0032  65  LYS H N   
2115 C  CA  . LYS B 65  ? 0.4819 0.4832 0.4781 0.0027  0.0026  0.0016  65  LYS H CA  
2116 C  C   . LYS B 65  ? 0.4716 0.4762 0.4679 0.0026  0.0040  0.0017  65  LYS H C   
2117 O  O   . LYS B 65  ? 0.4682 0.4754 0.4722 0.0016  0.0051  0.0004  65  LYS H O   
2118 C  CB  . LYS B 65  ? 0.4806 0.4852 0.4736 0.0056  0.0051  -0.0020 65  LYS H CB  
2119 C  CG  . LYS B 65  ? 0.4899 0.4957 0.4850 0.0039  -0.0009 -0.0026 65  LYS H CG  
2120 C  CD  . LYS B 65  ? 0.4962 0.4979 0.4953 0.0075  -0.0013 -0.0011 65  LYS H CD  
2121 C  CE  . LYS B 65  ? 0.5198 0.5354 0.5397 -0.0049 -0.0004 -0.0034 65  LYS H CE  
2122 N  NZ  . LYS B 65  ? 0.5328 0.5322 0.5513 0.0069  -0.0024 -0.0069 65  LYS H NZ  
2123 N  N   . GLY B 66  ? 0.4598 0.4623 0.4573 0.0024  0.0029  0.0043  66  GLY H N   
2124 C  CA  . GLY B 66  ? 0.4456 0.4483 0.4381 0.0007  0.0029  0.0029  66  GLY H CA  
2125 C  C   . GLY B 66  ? 0.4348 0.4350 0.4230 -0.0007 0.0018  0.0057  66  GLY H C   
2126 O  O   . GLY B 66  ? 0.4437 0.4432 0.4260 -0.0012 0.0008  0.0096  66  GLY H O   
2127 N  N   . ARG B 67  ? 0.4185 0.4144 0.4060 -0.0006 -0.0007 0.0049  67  ARG H N   
2128 C  CA  . ARG B 67  ? 0.3981 0.3934 0.3857 -0.0019 -0.0009 0.0042  67  ARG H CA  
2129 C  C   . ARG B 67  ? 0.3890 0.3825 0.3707 -0.0019 -0.0033 0.0033  67  ARG H C   
2130 O  O   . ARG B 67  ? 0.3850 0.3739 0.3672 0.0009  -0.0029 0.0043  67  ARG H O   
2131 C  CB  . ARG B 67  ? 0.3962 0.3894 0.3878 -0.0013 -0.0018 0.0009  67  ARG H CB  
2132 C  CG  . ARG B 67  ? 0.3960 0.3879 0.3832 0.0011  0.0003  0.0052  67  ARG H CG  
2133 C  CD  . ARG B 67  ? 0.3930 0.3882 0.3854 -0.0023 -0.0023 0.0016  67  ARG H CD  
2134 N  NE  . ARG B 67  ? 0.3715 0.3782 0.3719 -0.0039 0.0003  -0.0033 67  ARG H NE  
2135 C  CZ  . ARG B 67  ? 0.3424 0.3590 0.3621 -0.0097 -0.0070 0.0017  67  ARG H CZ  
2136 N  NH1 . ARG B 67  ? 0.3341 0.3743 0.3583 -0.0110 -0.0047 -0.0111 67  ARG H NH1 
2137 N  NH2 . ARG B 67  ? 0.3169 0.3614 0.3242 -0.0052 -0.0228 0.0053  67  ARG H NH2 
2138 N  N   . PHE B 68  ? 0.3774 0.3793 0.3601 -0.0024 -0.0040 -0.0006 68  PHE H N   
2139 C  CA  . PHE B 68  ? 0.3647 0.3686 0.3492 -0.0031 -0.0039 -0.0002 68  PHE H CA  
2140 C  C   . PHE B 68  ? 0.3563 0.3612 0.3442 -0.0035 -0.0047 0.0008  68  PHE H C   
2141 O  O   . PHE B 68  ? 0.3587 0.3546 0.3318 -0.0033 -0.0101 -0.0029 68  PHE H O   
2142 C  CB  . PHE B 68  ? 0.3609 0.3675 0.3491 -0.0033 -0.0039 0.0006  68  PHE H CB  
2143 C  CG  . PHE B 68  ? 0.3592 0.3670 0.3483 -0.0019 0.0027  -0.0007 68  PHE H CG  
2144 C  CD1 . PHE B 68  ? 0.3506 0.3556 0.3551 0.0046  0.0016  -0.0040 68  PHE H CD1 
2145 C  CD2 . PHE B 68  ? 0.3591 0.3619 0.3424 0.0007  0.0056  -0.0007 68  PHE H CD2 
2146 C  CE1 . PHE B 68  ? 0.3327 0.3504 0.3306 0.0060  -0.0103 0.0058  68  PHE H CE1 
2147 C  CE2 . PHE B 68  ? 0.3415 0.3646 0.3417 0.0033  -0.0027 -0.0025 68  PHE H CE2 
2148 C  CZ  . PHE B 68  ? 0.3464 0.3512 0.3421 0.0029  -0.0090 0.0047  68  PHE H CZ  
2149 N  N   . THR B 69  ? 0.3496 0.3495 0.3368 -0.0036 -0.0040 0.0044  69  THR H N   
2150 C  CA  . THR B 69  ? 0.3409 0.3449 0.3395 -0.0058 -0.0018 0.0056  69  THR H CA  
2151 C  C   . THR B 69  ? 0.3322 0.3360 0.3337 -0.0053 -0.0012 0.0039  69  THR H C   
2152 O  O   . THR B 69  ? 0.3252 0.3335 0.3378 -0.0094 0.0037  0.0042  69  THR H O   
2153 C  CB  . THR B 69  ? 0.3424 0.3474 0.3343 -0.0046 -0.0020 0.0060  69  THR H CB  
2154 O  OG1 . THR B 69  ? 0.3464 0.3640 0.3431 -0.0061 -0.0012 0.0176  69  THR H OG1 
2155 C  CG2 . THR B 69  ? 0.3352 0.3336 0.3376 -0.0058 -0.0024 0.0044  69  THR H CG2 
2156 N  N   . ILE B 70  ? 0.3277 0.3345 0.3309 -0.0049 -0.0038 0.0044  70  ILE H N   
2157 C  CA  . ILE B 70  ? 0.3213 0.3267 0.3241 -0.0028 -0.0038 -0.0003 70  ILE H CA  
2158 C  C   . ILE B 70  ? 0.3249 0.3282 0.3226 -0.0043 -0.0042 -0.0002 70  ILE H C   
2159 O  O   . ILE B 70  ? 0.3222 0.3269 0.3112 -0.0068 -0.0065 -0.0040 70  ILE H O   
2160 C  CB  . ILE B 70  ? 0.3217 0.3304 0.3238 -0.0041 -0.0024 0.0018  70  ILE H CB  
2161 C  CG1 . ILE B 70  ? 0.3118 0.3257 0.3160 0.0001  -0.0026 0.0001  70  ILE H CG1 
2162 C  CG2 . ILE B 70  ? 0.3244 0.3250 0.3202 -0.0053 -0.0004 -0.0052 70  ILE H CG2 
2163 C  CD1 . ILE B 70  ? 0.3106 0.3178 0.3165 -0.0051 -0.0055 -0.0048 70  ILE H CD1 
2164 N  N   . SER B 71  ? 0.3261 0.3216 0.3249 0.0005  -0.0061 0.0002  71  SER H N   
2165 C  CA  . SER B 71  ? 0.3244 0.3232 0.3230 -0.0002 -0.0077 0.0011  71  SER H CA  
2166 C  C   . SER B 71  ? 0.3226 0.3231 0.3202 0.0006  -0.0065 0.0006  71  SER H C   
2167 O  O   . SER B 71  ? 0.3260 0.3212 0.3246 0.0024  -0.0126 -0.0039 71  SER H O   
2168 C  CB  . SER B 71  ? 0.3291 0.3249 0.3300 0.0011  -0.0084 -0.0020 71  SER H CB  
2169 O  OG  . SER B 71  ? 0.3270 0.3273 0.3275 0.0081  -0.0063 -0.0029 71  SER H OG  
2170 N  N   . ARG B 72  ? 0.3186 0.3218 0.3192 0.0000  -0.0047 0.0019  72  ARG H N   
2171 C  CA  . ARG B 72  ? 0.3073 0.3147 0.3079 0.0020  -0.0031 0.0014  72  ARG H CA  
2172 C  C   . ARG B 72  ? 0.3187 0.3265 0.3201 0.0055  0.0003  0.0046  72  ARG H C   
2173 O  O   . ARG B 72  ? 0.3150 0.3219 0.3113 0.0057  0.0023  0.0072  72  ARG H O   
2174 C  CB  . ARG B 72  ? 0.3042 0.3149 0.3074 0.0037  -0.0010 0.0031  72  ARG H CB  
2175 C  CG  . ARG B 72  ? 0.2801 0.2937 0.2943 -0.0018 -0.0083 0.0010  72  ARG H CG  
2176 C  CD  . ARG B 72  ? 0.2816 0.2991 0.2848 -0.0018 -0.0061 0.0007  72  ARG H CD  
2177 N  NE  . ARG B 72  ? 0.2666 0.2546 0.2356 0.0073  0.0038  -0.0059 72  ARG H NE  
2178 C  CZ  . ARG B 72  ? 0.2596 0.2668 0.2321 0.0101  0.0078  -0.0070 72  ARG H CZ  
2179 N  NH1 . ARG B 72  ? 0.2492 0.2303 0.2273 -0.0058 -0.0049 -0.0044 72  ARG H NH1 
2180 N  NH2 . ARG B 72  ? 0.2688 0.2937 0.2177 0.0064  -0.0094 0.0114  72  ARG H NH2 
2181 N  N   . ASP B 73  ? 0.3233 0.3320 0.3233 0.0053  0.0043  0.0041  73  ASP H N   
2182 C  CA  . ASP B 73  ? 0.3262 0.3357 0.3268 0.0075  -0.0007 0.0050  73  ASP H CA  
2183 C  C   . ASP B 73  ? 0.3343 0.3434 0.3335 0.0070  -0.0020 0.0056  73  ASP H C   
2184 O  O   . ASP B 73  ? 0.3346 0.3479 0.3444 0.0081  -0.0078 0.0089  73  ASP H O   
2185 C  CB  . ASP B 73  ? 0.3313 0.3372 0.3279 0.0060  -0.0017 0.0064  73  ASP H CB  
2186 C  CG  . ASP B 73  ? 0.3234 0.3336 0.3389 0.0088  -0.0039 0.0020  73  ASP H CG  
2187 O  OD1 . ASP B 73  ? 0.3522 0.3519 0.3605 0.0138  -0.0053 0.0280  73  ASP H OD1 
2188 O  OD2 . ASP B 73  ? 0.2994 0.3258 0.3217 0.0201  -0.0142 -0.0029 73  ASP H OD2 
2189 N  N   . ASN B 74  ? 0.3421 0.3571 0.3357 0.0059  -0.0027 0.0040  74  ASN H N   
2190 C  CA  . ASN B 74  ? 0.3542 0.3656 0.3481 0.0024  0.0003  0.0042  74  ASN H CA  
2191 C  C   . ASN B 74  ? 0.3595 0.3727 0.3579 0.0020  0.0013  0.0035  74  ASN H C   
2192 O  O   . ASN B 74  ? 0.3652 0.3797 0.3617 0.0010  0.0022  0.0027  74  ASN H O   
2193 C  CB  . ASN B 74  ? 0.3561 0.3663 0.3540 0.0035  0.0027  0.0037  74  ASN H CB  
2194 C  CG  . ASN B 74  ? 0.3561 0.3807 0.3571 0.0074  -0.0053 0.0020  74  ASN H CG  
2195 O  OD1 . ASN B 74  ? 0.3690 0.4139 0.3642 0.0054  -0.0020 -0.0056 74  ASN H OD1 
2196 N  ND2 . ASN B 74  ? 0.3448 0.3767 0.3531 0.0088  -0.0064 0.0006  74  ASN H ND2 
2197 N  N   . ALA B 75  ? 0.3645 0.3792 0.3623 0.0022  0.0017  0.0032  75  ALA H N   
2198 C  CA  . ALA B 75  ? 0.3652 0.3796 0.3682 0.0021  -0.0008 0.0037  75  ALA H CA  
2199 C  C   . ALA B 75  ? 0.3666 0.3831 0.3668 0.0006  -0.0006 0.0022  75  ALA H C   
2200 O  O   . ALA B 75  ? 0.3619 0.3795 0.3696 0.0015  -0.0061 0.0054  75  ALA H O   
2201 C  CB  . ALA B 75  ? 0.3695 0.3856 0.3680 0.0040  0.0005  0.0029  75  ALA H CB  
2202 N  N   . LYS B 76  ? 0.3689 0.3863 0.3710 0.0003  -0.0004 0.0013  76  LYS H N   
2203 C  CA  . LYS B 76  ? 0.3717 0.3897 0.3747 0.0007  -0.0001 -0.0002 76  LYS H CA  
2204 C  C   . LYS B 76  ? 0.3665 0.3890 0.3690 -0.0008 -0.0013 -0.0015 76  LYS H C   
2205 O  O   . LYS B 76  ? 0.3702 0.4007 0.3774 0.0007  0.0002  0.0027  76  LYS H O   
2206 C  CB  . LYS B 76  ? 0.3738 0.3868 0.3786 0.0006  0.0024  -0.0028 76  LYS H CB  
2207 C  CG  . LYS B 76  ? 0.4027 0.4068 0.3912 0.0049  0.0006  0.0032  76  LYS H CG  
2208 C  CD  . LYS B 76  ? 0.4465 0.4396 0.4406 -0.0044 0.0050  0.0037  76  LYS H CD  
2209 C  CE  . LYS B 76  ? 0.4919 0.4844 0.4767 0.0066  0.0003  0.0071  76  LYS H CE  
2210 N  NZ  . LYS B 76  ? 0.4911 0.5108 0.4785 0.0124  0.0163  0.0042  76  LYS H NZ  
2211 N  N   . LYS B 77  ? 0.3658 0.3862 0.3644 0.0010  -0.0026 -0.0004 77  LYS H N   
2212 C  CA  . LYS B 77  ? 0.3679 0.3851 0.3673 0.0010  -0.0004 -0.0028 77  LYS H CA  
2213 C  C   . LYS B 77  ? 0.3597 0.3763 0.3629 0.0043  -0.0002 -0.0001 77  LYS H C   
2214 O  O   . LYS B 77  ? 0.3594 0.3780 0.3529 0.0076  -0.0037 -0.0019 77  LYS H O   
2215 C  CB  . LYS B 77  ? 0.3764 0.3876 0.3778 -0.0028 0.0003  -0.0005 77  LYS H CB  
2216 C  CG  . LYS B 77  ? 0.3920 0.3983 0.3871 0.0002  -0.0061 -0.0055 77  LYS H CG  
2217 C  CD  . LYS B 77  ? 0.4101 0.4353 0.4195 -0.0030 0.0013  -0.0031 77  LYS H CD  
2218 C  CE  . LYS B 77  ? 0.4307 0.4507 0.4367 -0.0019 -0.0046 -0.0082 77  LYS H CE  
2219 N  NZ  . LYS B 77  ? 0.4584 0.4696 0.4764 -0.0018 -0.0120 0.0009  77  LYS H NZ  
2220 N  N   . SER B 78  ? 0.3554 0.3646 0.3585 0.0054  -0.0007 -0.0019 78  SER H N   
2221 C  CA  . SER B 78  ? 0.3448 0.3571 0.3467 0.0048  -0.0030 -0.0015 78  SER H CA  
2222 C  C   . SER B 78  ? 0.3410 0.3497 0.3345 0.0052  -0.0019 -0.0010 78  SER H C   
2223 O  O   . SER B 78  ? 0.3344 0.3485 0.3313 0.0076  -0.0056 -0.0031 78  SER H O   
2224 C  CB  . SER B 78  ? 0.3487 0.3559 0.3494 0.0040  -0.0023 -0.0010 78  SER H CB  
2225 O  OG  . SER B 78  ? 0.3596 0.3651 0.3687 -0.0030 0.0005  0.0001  78  SER H OG  
2226 N  N   . LEU B 79  ? 0.3283 0.3363 0.3277 0.0054  -0.0008 0.0028  79  LEU H N   
2227 C  CA  . LEU B 79  ? 0.3213 0.3245 0.3143 0.0043  -0.0006 0.0037  79  LEU H CA  
2228 C  C   . LEU B 79  ? 0.3205 0.3146 0.3096 0.0053  -0.0017 0.0040  79  LEU H C   
2229 O  O   . LEU B 79  ? 0.3245 0.3175 0.2997 0.0023  -0.0054 0.0092  79  LEU H O   
2230 C  CB  . LEU B 79  ? 0.3158 0.3136 0.3089 0.0037  0.0000  0.0033  79  LEU H CB  
2231 C  CG  . LEU B 79  ? 0.3176 0.3171 0.3034 0.0060  -0.0015 0.0053  79  LEU H CG  
2232 C  CD1 . LEU B 79  ? 0.2845 0.2966 0.2736 0.0053  -0.0038 0.0131  79  LEU H CD1 
2233 C  CD2 . LEU B 79  ? 0.3193 0.3259 0.3112 0.0048  0.0014  0.0062  79  LEU H CD2 
2234 N  N   . TYR B 80  ? 0.3127 0.3132 0.3064 0.0045  -0.0010 0.0053  80  TYR H N   
2235 C  CA  . TYR B 80  ? 0.3151 0.3165 0.3078 0.0057  -0.0025 0.0024  80  TYR H CA  
2236 C  C   . TYR B 80  ? 0.3167 0.3167 0.3075 0.0051  -0.0047 0.0047  80  TYR H C   
2237 O  O   . TYR B 80  ? 0.3054 0.3162 0.2969 0.0122  -0.0080 -0.0011 80  TYR H O   
2238 C  CB  . TYR B 80  ? 0.3172 0.3212 0.3095 0.0032  -0.0015 0.0037  80  TYR H CB  
2239 C  CG  . TYR B 80  ? 0.3255 0.3292 0.3179 0.0036  0.0007  0.0035  80  TYR H CG  
2240 C  CD1 . TYR B 80  ? 0.3233 0.3338 0.3052 0.0020  0.0014  0.0016  80  TYR H CD1 
2241 C  CD2 . TYR B 80  ? 0.3327 0.3344 0.3121 0.0063  0.0015  0.0078  80  TYR H CD2 
2242 C  CE1 . TYR B 80  ? 0.3271 0.3369 0.3223 0.0087  0.0038  0.0029  80  TYR H CE1 
2243 C  CE2 . TYR B 80  ? 0.3337 0.3380 0.3201 0.0061  -0.0026 0.0056  80  TYR H CE2 
2244 C  CZ  . TYR B 80  ? 0.3272 0.3325 0.3231 0.0058  -0.0034 0.0003  80  TYR H CZ  
2245 O  OH  . TYR B 80  ? 0.3252 0.3473 0.3272 0.0076  0.0040  -0.0092 80  TYR H OH  
2246 N  N   . LEU B 81  ? 0.3201 0.3180 0.3118 0.0043  -0.0055 0.0061  81  LEU H N   
2247 C  CA  . LEU B 81  ? 0.3209 0.3211 0.3175 0.0003  -0.0011 0.0054  81  LEU H CA  
2248 C  C   . LEU B 81  ? 0.3323 0.3291 0.3254 0.0003  -0.0014 0.0043  81  LEU H C   
2249 O  O   . LEU B 81  ? 0.3309 0.3335 0.3230 0.0020  0.0042  0.0078  81  LEU H O   
2250 C  CB  . LEU B 81  ? 0.3186 0.3186 0.3141 0.0000  -0.0013 0.0034  81  LEU H CB  
2251 C  CG  . LEU B 81  ? 0.3152 0.3046 0.3099 0.0013  -0.0010 0.0035  81  LEU H CG  
2252 C  CD1 . LEU B 81  ? 0.3068 0.3014 0.3058 0.0014  -0.0056 0.0045  81  LEU H CD1 
2253 C  CD2 . LEU B 81  ? 0.3101 0.3031 0.3084 -0.0015 0.0009  0.0039  81  LEU H CD2 
2254 N  N   . GLN B 82  ? 0.3421 0.3417 0.3309 -0.0017 0.0008  0.0045  82  GLN H N   
2255 C  CA  . GLN B 82  ? 0.3567 0.3510 0.3435 -0.0049 0.0003  0.0031  82  GLN H CA  
2256 C  C   . GLN B 82  ? 0.3629 0.3550 0.3486 -0.0032 0.0000  0.0023  82  GLN H C   
2257 O  O   . GLN B 82  ? 0.3580 0.3566 0.3466 -0.0014 0.0026  -0.0003 82  GLN H O   
2258 C  CB  . GLN B 82  ? 0.3643 0.3551 0.3439 -0.0056 -0.0001 0.0020  82  GLN H CB  
2259 C  CG  . GLN B 82  ? 0.3750 0.3671 0.3570 -0.0096 0.0042  0.0057  82  GLN H CG  
2260 C  CD  . GLN B 82  ? 0.3940 0.3793 0.3826 -0.0033 0.0001  0.0074  82  GLN H CD  
2261 O  OE1 . GLN B 82  ? 0.4007 0.3853 0.3879 -0.0008 -0.0072 0.0161  82  GLN H OE1 
2262 N  NE2 . GLN B 82  ? 0.4025 0.3930 0.3982 -0.0165 -0.0031 0.0069  82  GLN H NE2 
2263 N  N   . MET B 83  ? 0.3693 0.3566 0.3503 -0.0053 0.0011  0.0029  83  MET H N   
2264 C  CA  . MET B 83  ? 0.3716 0.3614 0.3566 -0.0077 0.0004  0.0014  83  MET H CA  
2265 C  C   . MET B 83  ? 0.3673 0.3682 0.3551 -0.0050 0.0002  0.0027  83  MET H C   
2266 O  O   . MET B 83  ? 0.3562 0.3629 0.3545 -0.0065 0.0008  0.0046  83  MET H O   
2267 C  CB  . MET B 83  ? 0.3697 0.3622 0.3555 -0.0059 0.0020  0.0027  83  MET H CB  
2268 C  CG  . MET B 83  ? 0.3794 0.3632 0.3582 -0.0059 0.0010  0.0025  83  MET H CG  
2269 S  SD  . MET B 83  ? 0.3958 0.3642 0.3675 -0.0308 0.0095  -0.0013 83  MET H SD  
2270 C  CE  . MET B 83  ? 0.3840 0.3815 0.3852 -0.0001 0.0068  0.0035  83  MET H CE  
2271 N  N   . ASN B 84  ? 0.3779 0.3790 0.3639 -0.0042 -0.0016 -0.0009 84  ASN H N   
2272 C  CA  . ASN B 84  ? 0.3832 0.3874 0.3772 -0.0033 -0.0001 -0.0013 84  ASN H CA  
2273 C  C   . ASN B 84  ? 0.3906 0.3925 0.3808 -0.0026 -0.0029 -0.0012 84  ASN H C   
2274 O  O   . ASN B 84  ? 0.3917 0.3873 0.3803 -0.0039 -0.0050 -0.0007 84  ASN H O   
2275 C  CB  . ASN B 84  ? 0.3781 0.3835 0.3693 -0.0011 -0.0009 -0.0011 84  ASN H CB  
2276 C  CG  . ASN B 84  ? 0.3750 0.3806 0.3744 -0.0039 0.0021  -0.0045 84  ASN H CG  
2277 O  OD1 . ASN B 84  ? 0.3802 0.3731 0.3892 -0.0073 -0.0048 -0.0073 84  ASN H OD1 
2278 N  ND2 . ASN B 84  ? 0.3623 0.3851 0.3692 -0.0046 0.0000  0.0014  84  ASN H ND2 
2279 N  N   . SER B 85  ? 0.4039 0.4021 0.3940 -0.0039 -0.0016 -0.0019 85  SER H N   
2280 C  CA  . SER B 85  ? 0.4111 0.4099 0.4062 -0.0030 -0.0025 -0.0017 85  SER H CA  
2281 C  C   . SER B 85  ? 0.4141 0.4110 0.4105 -0.0045 -0.0016 -0.0020 85  SER H C   
2282 O  O   . SER B 85  ? 0.4167 0.4141 0.4107 -0.0037 -0.0038 -0.0010 85  SER H O   
2283 C  CB  . SER B 85  ? 0.4142 0.4153 0.4080 -0.0020 -0.0009 -0.0024 85  SER H CB  
2284 O  OG  . SER B 85  ? 0.4296 0.4132 0.4245 -0.0049 0.0015  -0.0034 85  SER H OG  
2285 N  N   . LEU B 86  ? 0.4193 0.4103 0.4135 -0.0057 -0.0017 -0.0034 86  LEU H N   
2286 C  CA  . LEU B 86  ? 0.4164 0.4111 0.4175 -0.0058 -0.0018 -0.0020 86  LEU H CA  
2287 C  C   . LEU B 86  ? 0.4224 0.4164 0.4247 -0.0048 -0.0027 -0.0013 86  LEU H C   
2288 O  O   . LEU B 86  ? 0.4209 0.4159 0.4302 -0.0079 -0.0042 -0.0027 86  LEU H O   
2289 C  CB  . LEU B 86  ? 0.4105 0.4036 0.4178 -0.0076 -0.0029 -0.0005 86  LEU H CB  
2290 C  CG  . LEU B 86  ? 0.3978 0.3917 0.3993 0.0011  -0.0063 -0.0018 86  LEU H CG  
2291 C  CD1 . LEU B 86  ? 0.3784 0.3674 0.3715 -0.0036 -0.0085 0.0006  86  LEU H CD1 
2292 C  CD2 . LEU B 86  ? 0.3649 0.3668 0.3684 -0.0063 -0.0059 -0.0021 86  LEU H CD2 
2293 N  N   . ARG B 87  ? 0.4278 0.4217 0.4213 -0.0067 -0.0001 0.0015  87  ARG H N   
2294 C  CA  . ARG B 87  ? 0.4294 0.4287 0.4229 -0.0062 -0.0010 0.0001  87  ARG H CA  
2295 C  C   . ARG B 87  ? 0.4273 0.4274 0.4190 -0.0059 -0.0019 0.0015  87  ARG H C   
2296 O  O   . ARG B 87  ? 0.4360 0.4406 0.4186 -0.0058 0.0025  0.0028  87  ARG H O   
2297 C  CB  . ARG B 87  ? 0.4351 0.4289 0.4276 -0.0053 -0.0032 -0.0003 87  ARG H CB  
2298 C  CG  . ARG B 87  ? 0.4571 0.4566 0.4527 -0.0052 -0.0015 0.0003  87  ARG H CG  
2299 C  CD  . ARG B 87  ? 0.5050 0.4952 0.4863 -0.0008 -0.0020 -0.0070 87  ARG H CD  
2300 N  NE  . ARG B 87  ? 0.5210 0.5016 0.5182 0.0005  -0.0013 0.0004  87  ARG H NE  
2301 C  CZ  . ARG B 87  ? 0.5204 0.5156 0.5205 0.0039  0.0019  -0.0005 87  ARG H CZ  
2302 N  NH1 . ARG B 87  ? 0.5221 0.5329 0.5289 0.0015  -0.0045 0.0055  87  ARG H NH1 
2303 N  NH2 . ARG B 87  ? 0.5202 0.5287 0.5461 0.0033  -0.0071 -0.0019 87  ARG H NH2 
2304 N  N   . ALA B 88  ? 0.4226 0.4234 0.4117 -0.0043 -0.0002 0.0025  88  ALA H N   
2305 C  CA  . ALA B 88  ? 0.4169 0.4163 0.4083 -0.0038 -0.0019 0.0018  88  ALA H CA  
2306 C  C   . ALA B 88  ? 0.4122 0.4057 0.3986 -0.0014 -0.0029 0.0018  88  ALA H C   
2307 O  O   . ALA B 88  ? 0.4089 0.3929 0.3890 -0.0013 -0.0076 0.0034  88  ALA H O   
2308 C  CB  . ALA B 88  ? 0.4166 0.4220 0.4084 -0.0032 -0.0035 0.0014  88  ALA H CB  
2309 N  N   . GLU B 89  ? 0.4070 0.4017 0.3974 -0.0012 -0.0046 0.0040  89  GLU H N   
2310 C  CA  . GLU B 89  ? 0.4059 0.4025 0.3972 0.0003  -0.0032 0.0000  89  GLU H CA  
2311 C  C   . GLU B 89  ? 0.3933 0.3872 0.3845 0.0012  -0.0012 -0.0002 89  GLU H C   
2312 O  O   . GLU B 89  ? 0.3896 0.3842 0.3802 0.0016  -0.0042 0.0011  89  GLU H O   
2313 C  CB  . GLU B 89  ? 0.4099 0.4063 0.4068 0.0009  -0.0018 -0.0012 89  GLU H CB  
2314 C  CG  . GLU B 89  ? 0.4503 0.4486 0.4410 0.0009  -0.0005 0.0018  89  GLU H CG  
2315 C  CD  . GLU B 89  ? 0.4618 0.4494 0.4840 -0.0052 0.0117  -0.0038 89  GLU H CD  
2316 O  OE1 . GLU B 89  ? 0.4819 0.4920 0.5041 -0.0007 0.0011  -0.0006 89  GLU H OE1 
2317 O  OE2 . GLU B 89  ? 0.5071 0.5203 0.5035 0.0026  0.0122  -0.0012 89  GLU H OE2 
2318 N  N   . ASP B 90  ? 0.3804 0.3805 0.3739 0.0007  0.0001  -0.0053 90  ASP H N   
2319 C  CA  . ASP B 90  ? 0.3714 0.3657 0.3646 -0.0004 0.0008  -0.0045 90  ASP H CA  
2320 C  C   . ASP B 90  ? 0.3646 0.3574 0.3526 -0.0062 0.0000  -0.0026 90  ASP H C   
2321 O  O   . ASP B 90  ? 0.3702 0.3560 0.3546 -0.0066 -0.0027 -0.0027 90  ASP H O   
2322 C  CB  . ASP B 90  ? 0.3738 0.3690 0.3661 -0.0018 0.0012  -0.0034 90  ASP H CB  
2323 C  CG  . ASP B 90  ? 0.3768 0.3699 0.3720 -0.0035 0.0042  -0.0015 90  ASP H CG  
2324 O  OD1 . ASP B 90  ? 0.3766 0.3606 0.3763 0.0004  0.0040  0.0139  90  ASP H OD1 
2325 O  OD2 . ASP B 90  ? 0.3948 0.3644 0.3860 -0.0066 0.0031  -0.0052 90  ASP H OD2 
2326 N  N   . THR B 91  ? 0.3464 0.3415 0.3365 -0.0060 0.0009  0.0000  91  THR H N   
2327 C  CA  . THR B 91  ? 0.3423 0.3218 0.3193 -0.0049 0.0003  -0.0021 91  THR H CA  
2328 C  C   . THR B 91  ? 0.3277 0.3122 0.3063 -0.0052 0.0016  -0.0038 91  THR H C   
2329 O  O   . THR B 91  ? 0.3388 0.3079 0.3034 -0.0100 0.0048  0.0000  91  THR H O   
2330 C  CB  . THR B 91  ? 0.3427 0.3267 0.3249 -0.0063 0.0000  -0.0018 91  THR H CB  
2331 O  OG1 . THR B 91  ? 0.3325 0.3299 0.3260 -0.0149 0.0024  -0.0085 91  THR H OG1 
2332 C  CG2 . THR B 91  ? 0.3381 0.3222 0.3126 0.0032  -0.0013 0.0045  91  THR H CG2 
2333 N  N   . ALA B 92  ? 0.3222 0.2939 0.2929 -0.0021 0.0023  -0.0050 92  ALA H N   
2334 C  CA  . ALA B 92  ? 0.3055 0.2856 0.2855 -0.0026 0.0037  -0.0047 92  ALA H CA  
2335 C  C   . ALA B 92  ? 0.3015 0.2780 0.2774 -0.0028 0.0007  -0.0049 92  ALA H C   
2336 O  O   . ALA B 92  ? 0.3050 0.2693 0.2834 -0.0057 0.0009  -0.0068 92  ALA H O   
2337 C  CB  . ALA B 92  ? 0.3025 0.2769 0.2838 -0.0047 0.0009  -0.0007 92  ALA H CB  
2338 N  N   . LEU B 93  ? 0.2922 0.2726 0.2711 -0.0004 0.0033  -0.0044 93  LEU H N   
2339 C  CA  . LEU B 93  ? 0.2860 0.2701 0.2696 0.0000  0.0029  -0.0015 93  LEU H CA  
2340 C  C   . LEU B 93  ? 0.2827 0.2738 0.2713 -0.0006 0.0047  0.0004  93  LEU H C   
2341 O  O   . LEU B 93  ? 0.2845 0.2786 0.2718 0.0000  0.0106  0.0001  93  LEU H O   
2342 C  CB  . LEU B 93  ? 0.2814 0.2646 0.2650 0.0009  0.0045  -0.0045 93  LEU H CB  
2343 C  CG  . LEU B 93  ? 0.2800 0.2722 0.2790 -0.0022 -0.0044 0.0028  93  LEU H CG  
2344 C  CD1 . LEU B 93  ? 0.2639 0.2657 0.2793 -0.0058 -0.0080 -0.0089 93  LEU H CD1 
2345 C  CD2 . LEU B 93  ? 0.2639 0.2751 0.2405 -0.0163 -0.0106 0.0070  93  LEU H CD2 
2346 N  N   . TYR B 94  ? 0.2842 0.2809 0.2733 0.0003  0.0026  -0.0020 94  TYR H N   
2347 C  CA  . TYR B 94  ? 0.2851 0.2845 0.2738 0.0000  0.0007  -0.0001 94  TYR H CA  
2348 C  C   . TYR B 94  ? 0.2829 0.2873 0.2741 -0.0025 -0.0004 0.0006  94  TYR H C   
2349 O  O   . TYR B 94  ? 0.2911 0.2918 0.2866 -0.0029 -0.0017 0.0000  94  TYR H O   
2350 C  CB  . TYR B 94  ? 0.2761 0.2786 0.2676 -0.0034 0.0024  0.0003  94  TYR H CB  
2351 C  CG  . TYR B 94  ? 0.2718 0.2809 0.2629 0.0010  -0.0012 -0.0022 94  TYR H CG  
2352 C  CD1 . TYR B 94  ? 0.2746 0.2750 0.2582 -0.0015 0.0024  0.0003  94  TYR H CD1 
2353 C  CD2 . TYR B 94  ? 0.2680 0.2668 0.2572 0.0060  -0.0049 0.0006  94  TYR H CD2 
2354 C  CE1 . TYR B 94  ? 0.2666 0.2553 0.2492 -0.0092 -0.0013 -0.0025 94  TYR H CE1 
2355 C  CE2 . TYR B 94  ? 0.2551 0.2547 0.2398 0.0000  0.0028  -0.0010 94  TYR H CE2 
2356 C  CZ  . TYR B 94  ? 0.2658 0.2543 0.2586 0.0032  0.0005  -0.0038 94  TYR H CZ  
2357 O  OH  . TYR B 94  ? 0.2749 0.2706 0.2447 -0.0144 0.0073  -0.0137 94  TYR H OH  
2358 N  N   . TYR B 95  ? 0.2832 0.2832 0.2659 -0.0009 -0.0002 0.0029  95  TYR H N   
2359 C  CA  . TYR B 95  ? 0.2952 0.2904 0.2775 -0.0019 0.0017  0.0022  95  TYR H CA  
2360 C  C   . TYR B 95  ? 0.2860 0.2911 0.2758 -0.0018 -0.0007 -0.0006 95  TYR H C   
2361 O  O   . TYR B 95  ? 0.2872 0.2975 0.2726 -0.0016 -0.0012 -0.0037 95  TYR H O   
2362 C  CB  . TYR B 95  ? 0.3030 0.2892 0.2868 0.0027  0.0009  0.0031  95  TYR H CB  
2363 C  CG  . TYR B 95  ? 0.3145 0.2889 0.2952 -0.0008 0.0012  0.0084  95  TYR H CG  
2364 C  CD1 . TYR B 95  ? 0.3140 0.2848 0.2935 -0.0150 -0.0019 0.0012  95  TYR H CD1 
2365 C  CD2 . TYR B 95  ? 0.3157 0.2875 0.2924 -0.0071 0.0026  0.0015  95  TYR H CD2 
2366 C  CE1 . TYR B 95  ? 0.3189 0.2952 0.2974 -0.0105 -0.0023 -0.0033 95  TYR H CE1 
2367 C  CE2 . TYR B 95  ? 0.3273 0.2871 0.2973 -0.0045 -0.0033 0.0006  95  TYR H CE2 
2368 C  CZ  . TYR B 95  ? 0.3227 0.3034 0.2942 -0.0022 0.0005  -0.0009 95  TYR H CZ  
2369 O  OH  . TYR B 95  ? 0.3555 0.3305 0.3014 0.0005  -0.0077 0.0091  95  TYR H OH  
2370 N  N   . CYS B 96  ? 0.2821 0.2882 0.2803 -0.0022 -0.0012 -0.0001 96  CYS H N   
2371 C  CA  . CYS B 96  ? 0.2772 0.2897 0.2866 -0.0013 -0.0013 0.0010  96  CYS H CA  
2372 C  C   . CYS B 96  ? 0.2699 0.2813 0.2804 -0.0008 -0.0067 -0.0003 96  CYS H C   
2373 O  O   . CYS B 96  ? 0.2543 0.2697 0.2702 -0.0085 -0.0126 0.0020  96  CYS H O   
2374 C  CB  . CYS B 96  ? 0.2850 0.2939 0.2878 -0.0028 -0.0005 0.0014  96  CYS H CB  
2375 S  SG  . CYS B 96  ? 0.3027 0.3293 0.3348 0.0006  0.0085  0.0071  96  CYS H SG  
2376 N  N   . ALA B 97  ? 0.2747 0.2821 0.2842 -0.0003 -0.0082 0.0032  97  ALA H N   
2377 C  CA  . ALA B 97  ? 0.2790 0.2856 0.2875 -0.0013 -0.0043 0.0032  97  ALA H CA  
2378 C  C   . ALA B 97  ? 0.2846 0.2924 0.2849 0.0011  -0.0036 0.0039  97  ALA H C   
2379 O  O   . ALA B 97  ? 0.2928 0.2958 0.2891 -0.0029 -0.0066 0.0079  97  ALA H O   
2380 C  CB  . ALA B 97  ? 0.2736 0.2803 0.2764 0.0004  -0.0033 0.0030  97  ALA H CB  
2381 N  N   . LYS B 98  ? 0.2879 0.2980 0.2917 -0.0004 -0.0051 0.0026  98  LYS H N   
2382 C  CA  . LYS B 98  ? 0.2953 0.3124 0.2977 0.0008  -0.0012 -0.0003 98  LYS H CA  
2383 C  C   . LYS B 98  ? 0.3027 0.3219 0.3072 0.0047  -0.0021 -0.0002 98  LYS H C   
2384 O  O   . LYS B 98  ? 0.3010 0.3253 0.3064 0.0074  -0.0041 -0.0004 98  LYS H O   
2385 C  CB  . LYS B 98  ? 0.2979 0.3095 0.3020 0.0040  -0.0034 0.0005  98  LYS H CB  
2386 C  CG  . LYS B 98  ? 0.2804 0.2950 0.2844 -0.0045 0.0021  -0.0032 98  LYS H CG  
2387 C  CD  . LYS B 98  ? 0.2711 0.2753 0.2777 0.0083  -0.0005 -0.0063 98  LYS H CD  
2388 C  CE  . LYS B 98  ? 0.2626 0.2620 0.2602 -0.0067 -0.0055 0.0003  98  LYS H CE  
2389 N  NZ  . LYS B 98  ? 0.2541 0.2590 0.2745 0.0206  -0.0230 -0.0181 98  LYS H NZ  
2390 N  N   . ASP B 99  ? 0.3141 0.3381 0.3215 0.0057  -0.0006 -0.0022 99  ASP H N   
2391 C  CA  . ASP B 99  ? 0.3340 0.3470 0.3354 0.0060  0.0000  -0.0044 99  ASP H CA  
2392 C  C   . ASP B 99  ? 0.3409 0.3596 0.3427 0.0055  0.0031  -0.0043 99  ASP H C   
2393 O  O   . ASP B 99  ? 0.3462 0.3667 0.3413 0.0065  0.0050  -0.0094 99  ASP H O   
2394 C  CB  . ASP B 99  ? 0.3322 0.3470 0.3331 0.0037  -0.0020 -0.0044 99  ASP H CB  
2395 C  CG  . ASP B 99  ? 0.3333 0.3582 0.3542 0.0086  0.0036  -0.0115 99  ASP H CG  
2396 O  OD1 . ASP B 99  ? 0.3440 0.3660 0.3619 0.0207  -0.0018 -0.0104 99  ASP H OD1 
2397 O  OD2 . ASP B 99  ? 0.3286 0.3697 0.3538 -0.0041 0.0134  -0.0041 99  ASP H OD2 
2398 N  N   . ILE B 100 ? 0.3645 0.3770 0.3558 0.0016  0.0069  -0.0033 100 ILE H N   
2399 C  CA  . ILE B 100 ? 0.3749 0.3883 0.3726 -0.0049 0.0018  -0.0023 100 ILE H CA  
2400 C  C   . ILE B 100 ? 0.4004 0.4117 0.3912 -0.0027 0.0002  -0.0016 100 ILE H C   
2401 O  O   . ILE B 100 ? 0.3978 0.4138 0.3905 -0.0042 -0.0008 -0.0009 100 ILE H O   
2402 C  CB  . ILE B 100 ? 0.3718 0.3856 0.3678 -0.0047 -0.0010 -0.0026 100 ILE H CB  
2403 C  CG1 . ILE B 100 ? 0.3700 0.3822 0.3642 -0.0053 0.0005  -0.0039 100 ILE H CG1 
2404 C  CG2 . ILE B 100 ? 0.3641 0.3719 0.3624 -0.0060 0.0024  -0.0004 100 ILE H CG2 
2405 C  CD1 . ILE B 100 ? 0.3732 0.3771 0.3685 -0.0086 0.0038  -0.0014 100 ILE H CD1 
2406 N  N   . GLN B 101 ? 0.4262 0.4377 0.4173 -0.0018 0.0001  0.0009  101 GLN H N   
2407 C  CA  . GLN B 101 ? 0.4530 0.4624 0.4459 0.0013  0.0015  -0.0010 101 GLN H CA  
2408 C  C   . GLN B 101 ? 0.4675 0.4793 0.4594 0.0015  -0.0012 0.0010  101 GLN H C   
2409 O  O   . GLN B 101 ? 0.4689 0.4834 0.4581 0.0052  -0.0023 0.0028  101 GLN H O   
2410 C  CB  . GLN B 101 ? 0.4531 0.4643 0.4516 0.0007  -0.0022 0.0007  101 GLN H CB  
2411 C  CG  . GLN B 101 ? 0.4664 0.4750 0.4638 0.0020  0.0000  -0.0024 101 GLN H CG  
2412 C  CD  . GLN B 101 ? 0.4993 0.5052 0.4978 0.0025  0.0003  0.0033  101 GLN H CD  
2413 O  OE1 . GLN B 101 ? 0.5325 0.5260 0.5023 0.0101  -0.0018 -0.0055 101 GLN H OE1 
2414 N  NE2 . GLN B 101 ? 0.5000 0.4871 0.4938 0.0042  -0.0012 -0.0051 101 GLN H NE2 
2415 N  N   . TYR B 102 ? 0.4867 0.4964 0.4817 -0.0024 -0.0006 -0.0020 102 TYR H N   
2416 C  CA  . TYR B 102 ? 0.5091 0.5184 0.5069 -0.0001 -0.0036 -0.0007 102 TYR H CA  
2417 C  C   . TYR B 102 ? 0.5234 0.5303 0.5193 0.0009  -0.0037 -0.0024 102 TYR H C   
2418 O  O   . TYR B 102 ? 0.5259 0.5307 0.5212 -0.0015 -0.0052 -0.0018 102 TYR H O   
2419 C  CB  . TYR B 102 ? 0.5132 0.5203 0.5141 0.0008  0.0012  -0.0016 102 TYR H CB  
2420 C  CG  . TYR B 102 ? 0.5149 0.5262 0.5155 0.0001  -0.0079 0.0007  102 TYR H CG  
2421 C  CD1 . TYR B 102 ? 0.5246 0.5288 0.5284 0.0011  0.0002  0.0025  102 TYR H CD1 
2422 C  CD2 . TYR B 102 ? 0.5171 0.5150 0.5258 -0.0028 -0.0056 -0.0013 102 TYR H CD2 
2423 C  CE1 . TYR B 102 ? 0.5255 0.5355 0.5209 -0.0028 -0.0022 -0.0016 102 TYR H CE1 
2424 C  CE2 . TYR B 102 ? 0.5323 0.5259 0.5395 0.0009  -0.0030 0.0000  102 TYR H CE2 
2425 C  CZ  . TYR B 102 ? 0.5221 0.5286 0.5175 0.0017  -0.0107 -0.0015 102 TYR H CZ  
2426 O  OH  . TYR B 102 ? 0.5239 0.5366 0.5241 0.0027  -0.0020 -0.0020 102 TYR H OH  
2427 N  N   . GLY B 103 ? 0.5328 0.5459 0.5335 0.0013  -0.0032 -0.0019 103 GLY H N   
2428 C  CA  . GLY B 103 ? 0.5508 0.5567 0.5462 0.0035  -0.0018 -0.0053 103 GLY H CA  
2429 C  C   . GLY B 103 ? 0.5646 0.5668 0.5587 0.0031  -0.0025 -0.0037 103 GLY H C   
2430 O  O   . GLY B 103 ? 0.5662 0.5651 0.5588 0.0035  -0.0030 -0.0056 103 GLY H O   
2431 N  N   . ASN B 104 ? 0.5708 0.5767 0.5662 0.0029  -0.0025 -0.0038 104 ASN H N   
2432 C  CA  . ASN B 104 ? 0.5759 0.5806 0.5718 0.0027  -0.0009 -0.0017 104 ASN H CA  
2433 C  C   . ASN B 104 ? 0.5805 0.5890 0.5749 0.0025  -0.0010 -0.0016 104 ASN H C   
2434 O  O   . ASN B 104 ? 0.5793 0.5936 0.5779 0.0039  -0.0014 0.0001  104 ASN H O   
2435 C  CB  . ASN B 104 ? 0.5750 0.5802 0.5691 0.0016  -0.0017 -0.0028 104 ASN H CB  
2436 C  CG  . ASN B 104 ? 0.5717 0.5736 0.5682 0.0007  -0.0018 -0.0014 104 ASN H CG  
2437 O  OD1 . ASN B 104 ? 0.5768 0.5830 0.5714 0.0020  -0.0053 -0.0056 104 ASN H OD1 
2438 N  ND2 . ASN B 104 ? 0.5645 0.5633 0.5565 -0.0002 0.0019  -0.0092 104 ASN H ND2 
2439 N  N   . TYR B 105 ? 0.5852 0.5926 0.5815 0.0039  0.0007  -0.0016 105 TYR H N   
2440 C  CA  . TYR B 105 ? 0.5895 0.5987 0.5858 0.0026  0.0002  -0.0008 105 TYR H CA  
2441 C  C   . TYR B 105 ? 0.5743 0.5864 0.5749 0.0032  -0.0010 -0.0016 105 TYR H C   
2442 O  O   . TYR B 105 ? 0.5779 0.5887 0.5736 0.0044  -0.0019 -0.0002 105 TYR H O   
2443 C  CB  . TYR B 105 ? 0.6058 0.6129 0.6135 0.0039  -0.0013 -0.0022 105 TYR H CB  
2444 C  CG  . TYR B 105 ? 0.6266 0.6359 0.6202 0.0020  0.0053  0.0005  105 TYR H CG  
2445 C  CD1 . TYR B 105 ? 0.6501 0.6527 0.6448 0.0046  0.0035  0.0003  105 TYR H CD1 
2446 C  CD2 . TYR B 105 ? 0.6446 0.6407 0.6326 0.0004  0.0003  0.0001  105 TYR H CD2 
2447 C  CE1 . TYR B 105 ? 0.6662 0.6686 0.6452 0.0022  0.0017  -0.0007 105 TYR H CE1 
2448 C  CE2 . TYR B 105 ? 0.6572 0.6535 0.6415 0.0008  0.0008  -0.0005 105 TYR H CE2 
2449 C  CZ  . TYR B 105 ? 0.6539 0.6533 0.6277 0.0007  0.0072  -0.0019 105 TYR H CZ  
2450 O  OH  . TYR B 105 ? 0.6487 0.6572 0.6328 0.0030  0.0070  0.0000  105 TYR H OH  
2451 N  N   . TYR B 106 ? 0.5535 0.5660 0.5481 0.0032  -0.0014 -0.0023 106 TYR H N   
2452 C  CA  . TYR B 106 ? 0.5284 0.5368 0.5272 0.0015  -0.0023 -0.0017 106 TYR H CA  
2453 C  C   . TYR B 106 ? 0.5014 0.5159 0.5010 0.0033  -0.0012 -0.0020 106 TYR H C   
2454 O  O   . TYR B 106 ? 0.5014 0.5115 0.4995 0.0017  0.0032  -0.0044 106 TYR H O   
2455 C  CB  . TYR B 106 ? 0.5371 0.5479 0.5312 0.0003  0.0000  -0.0009 106 TYR H CB  
2456 C  CG  . TYR B 106 ? 0.5504 0.5492 0.5420 -0.0009 0.0002  -0.0004 106 TYR H CG  
2457 C  CD1 . TYR B 106 ? 0.5515 0.5587 0.5519 0.0010  -0.0020 0.0000  106 TYR H CD1 
2458 C  CD2 . TYR B 106 ? 0.5598 0.5580 0.5504 -0.0029 -0.0025 -0.0022 106 TYR H CD2 
2459 C  CE1 . TYR B 106 ? 0.5625 0.5618 0.5659 -0.0017 -0.0034 0.0004  106 TYR H CE1 
2460 C  CE2 . TYR B 106 ? 0.5662 0.5653 0.5593 -0.0003 -0.0051 -0.0031 106 TYR H CE2 
2461 C  CZ  . TYR B 106 ? 0.5608 0.5530 0.5618 -0.0016 -0.0048 -0.0006 106 TYR H CZ  
2462 O  OH  . TYR B 106 ? 0.5545 0.5557 0.5580 -0.0053 -0.0027 0.0015  106 TYR H OH  
2463 N  N   . TYR B 107 ? 0.4708 0.4783 0.4753 0.0028  0.0012  -0.0029 107 TYR H N   
2464 C  CA  . TYR B 107 ? 0.4413 0.4522 0.4448 0.0025  -0.0010 0.0006  107 TYR H CA  
2465 C  C   . TYR B 107 ? 0.4120 0.4245 0.4223 0.0003  -0.0003 -0.0002 107 TYR H C   
2466 O  O   . TYR B 107 ? 0.4048 0.4210 0.4084 -0.0007 0.0026  -0.0031 107 TYR H O   
2467 C  CB  . TYR B 107 ? 0.4436 0.4508 0.4511 0.0020  0.0000  0.0021  107 TYR H CB  
2468 C  CG  . TYR B 107 ? 0.4524 0.4584 0.4569 0.0010  -0.0030 0.0018  107 TYR H CG  
2469 C  CD1 . TYR B 107 ? 0.4630 0.4654 0.4600 0.0004  -0.0002 0.0026  107 TYR H CD1 
2470 C  CD2 . TYR B 107 ? 0.4686 0.4719 0.4687 -0.0001 0.0003  0.0023  107 TYR H CD2 
2471 C  CE1 . TYR B 107 ? 0.4738 0.4781 0.4656 0.0024  0.0015  0.0029  107 TYR H CE1 
2472 C  CE2 . TYR B 107 ? 0.4686 0.4705 0.4623 0.0025  0.0014  -0.0025 107 TYR H CE2 
2473 C  CZ  . TYR B 107 ? 0.4705 0.4677 0.4605 0.0054  0.0023  0.0020  107 TYR H CZ  
2474 O  OH  . TYR B 107 ? 0.4619 0.4620 0.4574 0.0101  0.0042  0.0112  107 TYR H OH  
2475 N  N   . GLY B 108 ? 0.3896 0.4057 0.3936 -0.0037 -0.0024 -0.0011 108 GLY H N   
2476 C  CA  . GLY B 108 ? 0.3655 0.3698 0.3680 -0.0020 -0.0039 0.0001  108 GLY H CA  
2477 C  C   . GLY B 108 ? 0.3519 0.3566 0.3502 -0.0062 -0.0025 0.0004  108 GLY H C   
2478 O  O   . GLY B 108 ? 0.3547 0.3456 0.3497 -0.0061 -0.0045 -0.0015 108 GLY H O   
2479 N  N   . MET B 109 ? 0.3343 0.3363 0.3337 -0.0040 0.0003  0.0024  109 MET H N   
2480 C  CA  . MET B 109 ? 0.3183 0.3265 0.3172 -0.0003 -0.0006 0.0025  109 MET H CA  
2481 C  C   . MET B 109 ? 0.3107 0.3168 0.3095 0.0017  -0.0011 -0.0010 109 MET H C   
2482 O  O   . MET B 109 ? 0.3004 0.3128 0.3006 0.0008  0.0014  0.0003  109 MET H O   
2483 C  CB  . MET B 109 ? 0.3221 0.3206 0.3164 0.0001  0.0014  0.0046  109 MET H CB  
2484 C  CG  . MET B 109 ? 0.3156 0.3124 0.3180 0.0029  -0.0024 0.0084  109 MET H CG  
2485 S  SD  . MET B 109 ? 0.3185 0.3313 0.3204 0.0064  -0.0032 0.0091  109 MET H SD  
2486 C  CE  . MET B 109 ? 0.3195 0.3263 0.3152 -0.0007 -0.0012 0.0031  109 MET H CE  
2487 N  N   . ASP B 110 ? 0.3039 0.3081 0.3017 0.0030  0.0013  -0.0040 110 ASP H N   
2488 C  CA  . ASP B 110 ? 0.2962 0.2998 0.2950 0.0027  0.0010  -0.0038 110 ASP H CA  
2489 C  C   . ASP B 110 ? 0.2866 0.2964 0.2861 0.0036  0.0001  -0.0028 110 ASP H C   
2490 O  O   . ASP B 110 ? 0.2765 0.2902 0.2765 0.0039  0.0018  -0.0060 110 ASP H O   
2491 C  CB  . ASP B 110 ? 0.2979 0.3035 0.3025 0.0032  0.0033  -0.0029 110 ASP H CB  
2492 C  CG  . ASP B 110 ? 0.3135 0.3193 0.3181 0.0041  0.0062  -0.0085 110 ASP H CG  
2493 O  OD1 . ASP B 110 ? 0.3577 0.3616 0.3689 0.0019  0.0055  -0.0315 110 ASP H OD1 
2494 O  OD2 . ASP B 110 ? 0.3210 0.3103 0.3179 0.0066  0.0110  -0.0063 110 ASP H OD2 
2495 N  N   . VAL B 111 ? 0.2826 0.2920 0.2818 0.0066  -0.0014 -0.0039 111 VAL H N   
2496 C  CA  . VAL B 111 ? 0.2816 0.2902 0.2805 0.0044  -0.0009 -0.0037 111 VAL H CA  
2497 C  C   . VAL B 111 ? 0.2822 0.2990 0.2838 0.0027  0.0010  -0.0001 111 VAL H C   
2498 O  O   . VAL B 111 ? 0.2841 0.3079 0.2944 0.0008  -0.0032 0.0002  111 VAL H O   
2499 C  CB  . VAL B 111 ? 0.2786 0.2851 0.2761 0.0056  0.0020  -0.0033 111 VAL H CB  
2500 C  CG1 . VAL B 111 ? 0.2858 0.2890 0.2845 0.0022  -0.0080 -0.0001 111 VAL H CG1 
2501 C  CG2 . VAL B 111 ? 0.2623 0.2603 0.2452 0.0093  0.0018  -0.0053 111 VAL H CG2 
2502 N  N   . TRP B 112 ? 0.2882 0.3060 0.2943 0.0027  0.0003  -0.0017 112 TRP H N   
2503 C  CA  . TRP B 112 ? 0.2964 0.3139 0.2941 0.0006  0.0010  0.0007  112 TRP H CA  
2504 C  C   . TRP B 112 ? 0.3123 0.3239 0.3089 0.0008  0.0011  -0.0009 112 TRP H C   
2505 O  O   . TRP B 112 ? 0.3209 0.3362 0.3152 0.0008  0.0020  -0.0020 112 TRP H O   
2506 C  CB  . TRP B 112 ? 0.2952 0.3069 0.2854 0.0008  0.0011  0.0001  112 TRP H CB  
2507 C  CG  . TRP B 112 ? 0.2873 0.3008 0.2652 0.0023  -0.0047 0.0021  112 TRP H CG  
2508 C  CD1 . TRP B 112 ? 0.2744 0.2877 0.2441 0.0000  -0.0125 -0.0012 112 TRP H CD1 
2509 C  CD2 . TRP B 112 ? 0.2861 0.2932 0.2374 -0.0033 0.0021  0.0041  112 TRP H CD2 
2510 N  NE1 . TRP B 112 ? 0.2802 0.2913 0.2418 -0.0030 -0.0074 -0.0050 112 TRP H NE1 
2511 C  CE2 . TRP B 112 ? 0.2874 0.2982 0.2458 0.0000  0.0027  0.0070  112 TRP H CE2 
2512 C  CE3 . TRP B 112 ? 0.2889 0.2807 0.2316 -0.0056 0.0005  0.0056  112 TRP H CE3 
2513 C  CZ2 . TRP B 112 ? 0.2894 0.3085 0.2532 -0.0062 0.0005  0.0086  112 TRP H CZ2 
2514 C  CZ3 . TRP B 112 ? 0.2810 0.2883 0.2417 -0.0021 -0.0022 0.0022  112 TRP H CZ3 
2515 C  CH2 . TRP B 112 ? 0.2839 0.2933 0.2462 -0.0058 -0.0027 0.0036  112 TRP H CH2 
2516 N  N   . GLY B 113 ? 0.3269 0.3347 0.3206 -0.0010 0.0011  -0.0015 113 GLY H N   
2517 C  CA  . GLY B 113 ? 0.3370 0.3394 0.3343 0.0039  0.0000  -0.0018 113 GLY H CA  
2518 C  C   . GLY B 113 ? 0.3460 0.3483 0.3414 0.0029  0.0009  0.0000  113 GLY H C   
2519 O  O   . GLY B 113 ? 0.3541 0.3564 0.3403 -0.0017 -0.0001 -0.0003 113 GLY H O   
2520 N  N   . GLN B 114 ? 0.3524 0.3573 0.3519 0.0052  0.0019  -0.0028 114 GLN H N   
2521 C  CA  . GLN B 114 ? 0.3640 0.3646 0.3632 0.0048  -0.0004 0.0010  114 GLN H CA  
2522 C  C   . GLN B 114 ? 0.3593 0.3576 0.3545 0.0074  0.0000  -0.0008 114 GLN H C   
2523 O  O   . GLN B 114 ? 0.3621 0.3583 0.3592 0.0076  -0.0005 -0.0013 114 GLN H O   
2524 C  CB  . GLN B 114 ? 0.3664 0.3688 0.3629 0.0040  0.0005  -0.0008 114 GLN H CB  
2525 C  CG  . GLN B 114 ? 0.3854 0.3872 0.3875 0.0030  0.0084  0.0000  114 GLN H CG  
2526 C  CD  . GLN B 114 ? 0.3868 0.3878 0.3994 0.0078  0.0058  0.0029  114 GLN H CD  
2527 O  OE1 . GLN B 114 ? 0.4014 0.3795 0.4181 0.0166  0.0092  0.0113  114 GLN H OE1 
2528 N  NE2 . GLN B 114 ? 0.4281 0.4351 0.4358 -0.0030 0.0131  0.0018  114 GLN H NE2 
2529 N  N   . GLY B 115 ? 0.3528 0.3524 0.3474 0.0074  0.0000  -0.0034 115 GLY H N   
2530 C  CA  . GLY B 115 ? 0.3462 0.3437 0.3371 0.0047  -0.0028 -0.0050 115 GLY H CA  
2531 C  C   . GLY B 115 ? 0.3406 0.3472 0.3350 0.0000  -0.0020 -0.0013 115 GLY H C   
2532 O  O   . GLY B 115 ? 0.3432 0.3463 0.3371 -0.0004 -0.0016 -0.0062 115 GLY H O   
2533 N  N   . THR B 116 ? 0.3367 0.3441 0.3318 0.0002  -0.0040 -0.0015 116 THR H N   
2534 C  CA  . THR B 116 ? 0.3284 0.3353 0.3253 0.0014  -0.0036 -0.0019 116 THR H CA  
2535 C  C   . THR B 116 ? 0.3269 0.3341 0.3239 -0.0007 -0.0055 -0.0036 116 THR H C   
2536 O  O   . THR B 116 ? 0.3178 0.3285 0.3162 -0.0005 -0.0091 -0.0069 116 THR H O   
2537 C  CB  . THR B 116 ? 0.3259 0.3292 0.3221 0.0001  -0.0050 -0.0013 116 THR H CB  
2538 O  OG1 . THR B 116 ? 0.3250 0.3242 0.3169 0.0119  -0.0065 0.0029  116 THR H OG1 
2539 C  CG2 . THR B 116 ? 0.3114 0.3212 0.3159 0.0032  -0.0066 0.0029  116 THR H CG2 
2540 N  N   . THR B 117 ? 0.3325 0.3320 0.3348 -0.0004 -0.0023 -0.0022 117 THR H N   
2541 C  CA  . THR B 117 ? 0.3337 0.3305 0.3408 -0.0020 -0.0029 -0.0039 117 THR H CA  
2542 C  C   . THR B 117 ? 0.3305 0.3278 0.3411 -0.0020 -0.0023 -0.0040 117 THR H C   
2543 O  O   . THR B 117 ? 0.3318 0.3358 0.3575 -0.0046 -0.0061 0.0018  117 THR H O   
2544 C  CB  . THR B 117 ? 0.3358 0.3304 0.3432 0.0007  0.0021  -0.0069 117 THR H CB  
2545 O  OG1 . THR B 117 ? 0.3580 0.3465 0.3575 -0.0025 0.0030  -0.0129 117 THR H OG1 
2546 C  CG2 . THR B 117 ? 0.3320 0.3389 0.3391 0.0007  -0.0027 -0.0054 117 THR H CG2 
2547 N  N   . VAL B 118 ? 0.3283 0.3215 0.3319 -0.0042 0.0003  -0.0056 118 VAL H N   
2548 C  CA  . VAL B 118 ? 0.3235 0.3131 0.3194 -0.0038 0.0024  0.0000  118 VAL H CA  
2549 C  C   . VAL B 118 ? 0.3278 0.3240 0.3204 -0.0032 0.0010  0.0002  118 VAL H C   
2550 O  O   . VAL B 118 ? 0.3254 0.3137 0.3127 -0.0039 0.0006  0.0059  118 VAL H O   
2551 C  CB  . VAL B 118 ? 0.3176 0.3028 0.3090 -0.0053 0.0023  -0.0001 118 VAL H CB  
2552 C  CG1 . VAL B 118 ? 0.3073 0.2972 0.3012 0.0029  -0.0041 -0.0033 118 VAL H CG1 
2553 C  CG2 . VAL B 118 ? 0.3012 0.2855 0.2913 0.0003  0.0104  0.0059  118 VAL H CG2 
2554 N  N   . THR B 119 ? 0.3356 0.3300 0.3257 -0.0014 0.0004  -0.0041 119 THR H N   
2555 C  CA  . THR B 119 ? 0.3436 0.3442 0.3314 -0.0030 0.0008  -0.0020 119 THR H CA  
2556 C  C   . THR B 119 ? 0.3508 0.3546 0.3376 -0.0017 0.0006  -0.0023 119 THR H C   
2557 O  O   . THR B 119 ? 0.3535 0.3530 0.3378 0.0016  -0.0014 -0.0033 119 THR H O   
2558 C  CB  . THR B 119 ? 0.3383 0.3421 0.3304 -0.0023 0.0021  0.0007  119 THR H CB  
2559 O  OG1 . THR B 119 ? 0.3531 0.3501 0.3282 -0.0105 0.0096  0.0079  119 THR H OG1 
2560 C  CG2 . THR B 119 ? 0.3365 0.3204 0.3013 -0.0123 0.0078  0.0030  119 THR H CG2 
2561 N  N   . VAL B 120 ? 0.3614 0.3717 0.3530 -0.0010 0.0016  -0.0032 120 VAL H N   
2562 C  CA  . VAL B 120 ? 0.3730 0.3781 0.3621 -0.0044 0.0016  0.0000  120 VAL H CA  
2563 C  C   . VAL B 120 ? 0.3769 0.3843 0.3683 -0.0055 -0.0001 -0.0012 120 VAL H C   
2564 O  O   . VAL B 120 ? 0.3695 0.3868 0.3710 -0.0053 -0.0047 0.0004  120 VAL H O   
2565 C  CB  . VAL B 120 ? 0.3703 0.3772 0.3556 -0.0039 0.0018  0.0008  120 VAL H CB  
2566 C  CG1 . VAL B 120 ? 0.3667 0.3881 0.3564 -0.0019 0.0039  0.0001  120 VAL H CG1 
2567 C  CG2 . VAL B 120 ? 0.3754 0.3649 0.3460 -0.0075 0.0004  -0.0006 120 VAL H CG2 
2568 N  N   . SER B 121 ? 0.3911 0.3956 0.3773 -0.0059 0.0023  -0.0016 121 SER H N   
2569 C  CA  . SER B 121 ? 0.4038 0.4047 0.3874 -0.0051 0.0020  -0.0035 121 SER H CA  
2570 C  C   . SER B 121 ? 0.4123 0.4108 0.3963 -0.0049 0.0025  -0.0040 121 SER H C   
2571 O  O   . SER B 121 ? 0.4050 0.4086 0.3952 -0.0055 -0.0006 -0.0056 121 SER H O   
2572 C  CB  . SER B 121 ? 0.4046 0.4028 0.3845 -0.0043 0.0004  -0.0004 121 SER H CB  
2573 O  OG  . SER B 121 ? 0.4086 0.3885 0.3804 -0.0009 0.0052  0.0036  121 SER H OG  
2574 N  N   . SER B 122 ? 0.4283 0.4269 0.4159 -0.0042 0.0033  -0.0047 122 SER H N   
2575 C  CA  . SER B 122 ? 0.4418 0.4374 0.4345 -0.0043 0.0032  -0.0054 122 SER H CA  
2576 C  C   . SER B 122 ? 0.4466 0.4398 0.4368 -0.0021 0.0025  -0.0051 122 SER H C   
2577 O  O   . SER B 122 ? 0.4567 0.4401 0.4406 -0.0018 0.0024  -0.0049 122 SER H O   
2578 C  CB  . SER B 122 ? 0.4431 0.4459 0.4410 -0.0028 0.0041  -0.0047 122 SER H CB  
2579 O  OG  . SER B 122 ? 0.4616 0.4608 0.4576 -0.0035 0.0052  -0.0125 122 SER H OG  
2580 N  N   . ALA B 123 ? 0.4442 0.4381 0.4361 -0.0041 0.0013  -0.0037 123 ALA H N   
2581 C  CA  . ALA B 123 ? 0.4452 0.4398 0.4389 -0.0017 -0.0010 -0.0043 123 ALA H CA  
2582 C  C   . ALA B 123 ? 0.4449 0.4368 0.4411 -0.0004 -0.0011 -0.0046 123 ALA H C   
2583 O  O   . ALA B 123 ? 0.4426 0.4388 0.4384 0.0051  -0.0007 -0.0093 123 ALA H O   
2584 C  CB  . ALA B 123 ? 0.4440 0.4363 0.4367 -0.0054 -0.0027 -0.0015 123 ALA H CB  
2585 N  N   . SER B 124 ? 0.4487 0.4414 0.4416 -0.0003 -0.0001 -0.0028 124 SER H N   
2586 C  CA  . SER B 124 ? 0.4516 0.4385 0.4442 -0.0014 -0.0003 -0.0038 124 SER H CA  
2587 C  C   . SER B 124 ? 0.4515 0.4352 0.4444 -0.0011 -0.0020 -0.0036 124 SER H C   
2588 O  O   . SER B 124 ? 0.4578 0.4399 0.4502 -0.0048 -0.0001 -0.0011 124 SER H O   
2589 C  CB  . SER B 124 ? 0.4562 0.4417 0.4467 -0.0008 -0.0023 -0.0050 124 SER H CB  
2590 O  OG  . SER B 124 ? 0.4559 0.4469 0.4601 -0.0065 0.0000  -0.0097 124 SER H OG  
2591 N  N   . THR B 125 ? 0.4481 0.4261 0.4412 0.0003  -0.0011 -0.0030 125 THR H N   
2592 C  CA  . THR B 125 ? 0.4457 0.4227 0.4340 0.0004  -0.0011 -0.0018 125 THR H CA  
2593 C  C   . THR B 125 ? 0.4449 0.4197 0.4234 -0.0025 -0.0019 0.0004  125 THR H C   
2594 O  O   . THR B 125 ? 0.4476 0.4171 0.4164 -0.0027 -0.0010 0.0023  125 THR H O   
2595 C  CB  . THR B 125 ? 0.4453 0.4222 0.4362 0.0031  -0.0040 -0.0011 125 THR H CB  
2596 O  OG1 . THR B 125 ? 0.4412 0.4472 0.4579 0.0072  -0.0042 -0.0072 125 THR H OG1 
2597 C  CG2 . THR B 125 ? 0.4430 0.4156 0.4295 0.0069  -0.0037 0.0035  125 THR H CG2 
2598 N  N   . LYS B 126 ? 0.4350 0.4132 0.4197 -0.0045 -0.0017 -0.0019 126 LYS H N   
2599 C  CA  . LYS B 126 ? 0.4180 0.4051 0.4037 -0.0035 0.0000  -0.0002 126 LYS H CA  
2600 C  C   . LYS B 126 ? 0.4060 0.3946 0.3976 -0.0025 -0.0033 -0.0045 126 LYS H C   
2601 O  O   . LYS B 126 ? 0.4071 0.3986 0.3941 -0.0030 -0.0056 -0.0056 126 LYS H O   
2602 C  CB  . LYS B 126 ? 0.4182 0.4034 0.4074 -0.0042 0.0000  0.0006  126 LYS H CB  
2603 C  CG  . LYS B 126 ? 0.4190 0.4113 0.4156 -0.0113 0.0027  0.0056  126 LYS H CG  
2604 C  CD  . LYS B 126 ? 0.4382 0.4373 0.4359 -0.0048 0.0002  0.0041  126 LYS H CD  
2605 C  CE  . LYS B 126 ? 0.4625 0.4472 0.4551 -0.0013 0.0017  0.0007  126 LYS H CE  
2606 N  NZ  . LYS B 126 ? 0.4625 0.4513 0.4546 0.0001  0.0149  0.0065  126 LYS H NZ  
2607 N  N   . GLY B 127 ? 0.3938 0.3854 0.3895 -0.0028 -0.0016 -0.0039 127 GLY H N   
2608 C  CA  . GLY B 127 ? 0.3811 0.3683 0.3761 -0.0010 -0.0042 -0.0052 127 GLY H CA  
2609 C  C   . GLY B 127 ? 0.3692 0.3534 0.3656 0.0010  0.0007  -0.0044 127 GLY H C   
2610 O  O   . GLY B 127 ? 0.3803 0.3625 0.3683 0.0075  -0.0008 -0.0029 127 GLY H O   
2611 N  N   . PRO B 128 ? 0.3566 0.3455 0.3549 0.0032  0.0017  -0.0061 128 PRO H N   
2612 C  CA  . PRO B 128 ? 0.3517 0.3389 0.3481 0.0014  0.0007  -0.0067 128 PRO H CA  
2613 C  C   . PRO B 128 ? 0.3499 0.3405 0.3447 -0.0007 -0.0024 -0.0031 128 PRO H C   
2614 O  O   . PRO B 128 ? 0.3474 0.3300 0.3387 0.0015  -0.0034 -0.0021 128 PRO H O   
2615 C  CB  . PRO B 128 ? 0.3520 0.3388 0.3450 0.0000  0.0038  -0.0060 128 PRO H CB  
2616 C  CG  . PRO B 128 ? 0.3444 0.3240 0.3428 -0.0006 0.0010  -0.0067 128 PRO H CG  
2617 C  CD  . PRO B 128 ? 0.3543 0.3402 0.3511 0.0020  0.0012  -0.0069 128 PRO H CD  
2618 N  N   . SER B 129 ? 0.3479 0.3364 0.3386 -0.0028 -0.0044 -0.0012 129 SER H N   
2619 C  CA  . SER B 129 ? 0.3429 0.3362 0.3368 -0.0037 -0.0009 -0.0004 129 SER H CA  
2620 C  C   . SER B 129 ? 0.3269 0.3303 0.3297 -0.0074 -0.0002 -0.0018 129 SER H C   
2621 O  O   . SER B 129 ? 0.3163 0.3244 0.3156 -0.0114 -0.0019 -0.0038 129 SER H O   
2622 C  CB  . SER B 129 ? 0.3456 0.3361 0.3369 -0.0086 -0.0008 -0.0033 129 SER H CB  
2623 O  OG  . SER B 129 ? 0.3894 0.3455 0.3664 -0.0099 -0.0027 -0.0042 129 SER H OG  
2624 N  N   . VAL B 130 ? 0.3291 0.3265 0.3264 -0.0056 0.0014  -0.0024 130 VAL H N   
2625 C  CA  . VAL B 130 ? 0.3252 0.3266 0.3266 -0.0055 0.0024  0.0000  130 VAL H CA  
2626 C  C   . VAL B 130 ? 0.3281 0.3245 0.3224 -0.0033 0.0042  0.0027  130 VAL H C   
2627 O  O   . VAL B 130 ? 0.3242 0.3146 0.3125 -0.0034 0.0102  0.0103  130 VAL H O   
2628 C  CB  . VAL B 130 ? 0.3287 0.3309 0.3316 -0.0018 0.0025  0.0005  130 VAL H CB  
2629 C  CG1 . VAL B 130 ? 0.3102 0.3221 0.3320 -0.0082 0.0094  0.0000  130 VAL H CG1 
2630 C  CG2 . VAL B 130 ? 0.3102 0.3244 0.3181 0.0017  -0.0040 0.0017  130 VAL H CG2 
2631 N  N   . PHE B 131 ? 0.3326 0.3235 0.3284 -0.0026 0.0039  0.0007  131 PHE H N   
2632 C  CA  . PHE B 131 ? 0.3319 0.3249 0.3276 -0.0011 0.0022  -0.0022 131 PHE H CA  
2633 C  C   . PHE B 131 ? 0.3377 0.3330 0.3320 0.0003  0.0030  -0.0025 131 PHE H C   
2634 O  O   . PHE B 131 ? 0.3311 0.3280 0.3324 -0.0012 0.0026  -0.0011 131 PHE H O   
2635 C  CB  . PHE B 131 ? 0.3296 0.3231 0.3230 -0.0020 0.0018  -0.0043 131 PHE H CB  
2636 C  CG  . PHE B 131 ? 0.3262 0.3226 0.3289 -0.0026 -0.0039 -0.0023 131 PHE H CG  
2637 C  CD1 . PHE B 131 ? 0.3322 0.3342 0.3393 -0.0035 -0.0052 0.0024  131 PHE H CD1 
2638 C  CD2 . PHE B 131 ? 0.3245 0.3301 0.3225 -0.0072 0.0001  0.0000  131 PHE H CD2 
2639 C  CE1 . PHE B 131 ? 0.3249 0.3360 0.3240 -0.0063 -0.0018 -0.0027 131 PHE H CE1 
2640 C  CE2 . PHE B 131 ? 0.3297 0.3252 0.3252 -0.0017 -0.0073 0.0041  131 PHE H CE2 
2641 C  CZ  . PHE B 131 ? 0.3208 0.3281 0.3182 -0.0057 -0.0061 -0.0014 131 PHE H CZ  
2642 N  N   . PRO B 132 ? 0.3432 0.3429 0.3374 0.0002  0.0023  -0.0016 132 PRO H N   
2643 C  CA  . PRO B 132 ? 0.3499 0.3441 0.3415 0.0004  0.0024  0.0003  132 PRO H CA  
2644 C  C   . PRO B 132 ? 0.3533 0.3514 0.3466 0.0017  0.0023  -0.0019 132 PRO H C   
2645 O  O   . PRO B 132 ? 0.3510 0.3445 0.3394 0.0012  0.0022  0.0000  132 PRO H O   
2646 C  CB  . PRO B 132 ? 0.3490 0.3407 0.3391 0.0033  0.0021  -0.0001 132 PRO H CB  
2647 C  CG  . PRO B 132 ? 0.3478 0.3495 0.3432 -0.0037 0.0017  -0.0027 132 PRO H CG  
2648 C  CD  . PRO B 132 ? 0.3431 0.3394 0.3337 -0.0003 0.0031  -0.0049 132 PRO H CD  
2649 N  N   . LEU B 133 ? 0.3639 0.3566 0.3582 -0.0004 0.0016  -0.0008 133 LEU H N   
2650 C  CA  . LEU B 133 ? 0.3730 0.3700 0.3671 -0.0007 -0.0025 -0.0009 133 LEU H CA  
2651 C  C   . LEU B 133 ? 0.3868 0.3814 0.3807 -0.0003 -0.0023 0.0002  133 LEU H C   
2652 O  O   . LEU B 133 ? 0.3813 0.3750 0.3770 0.0005  -0.0078 -0.0011 133 LEU H O   
2653 C  CB  . LEU B 133 ? 0.3672 0.3697 0.3650 -0.0008 -0.0012 0.0009  133 LEU H CB  
2654 C  CG  . LEU B 133 ? 0.3624 0.3693 0.3623 -0.0025 -0.0019 -0.0001 133 LEU H CG  
2655 C  CD1 . LEU B 133 ? 0.3524 0.3574 0.3509 -0.0025 0.0049  -0.0016 133 LEU H CD1 
2656 C  CD2 . LEU B 133 ? 0.3498 0.3607 0.3491 -0.0009 0.0042  -0.0025 133 LEU H CD2 
2657 N  N   . ALA B 134 ? 0.4067 0.3931 0.3981 -0.0002 -0.0027 -0.0040 134 ALA H N   
2658 C  CA  . ALA B 134 ? 0.4241 0.4134 0.4125 0.0005  0.0000  -0.0029 134 ALA H CA  
2659 C  C   . ALA B 134 ? 0.4393 0.4252 0.4263 0.0011  -0.0005 -0.0038 134 ALA H C   
2660 O  O   . ALA B 134 ? 0.4434 0.4231 0.4210 0.0017  -0.0005 -0.0059 134 ALA H O   
2661 C  CB  . ALA B 134 ? 0.4238 0.4070 0.4098 0.0023  -0.0001 -0.0019 134 ALA H CB  
2662 N  N   . PRO B 135 ? 0.4501 0.4435 0.4440 0.0000  0.0000  -0.0036 135 PRO H N   
2663 C  CA  . PRO B 135 ? 0.4642 0.4558 0.4541 0.0004  0.0007  -0.0008 135 PRO H CA  
2664 C  C   . PRO B 135 ? 0.4801 0.4715 0.4676 -0.0007 0.0017  -0.0027 135 PRO H C   
2665 O  O   . PRO B 135 ? 0.4843 0.4767 0.4710 0.0037  0.0062  -0.0026 135 PRO H O   
2666 C  CB  . PRO B 135 ? 0.4611 0.4529 0.4520 0.0023  0.0023  -0.0006 135 PRO H CB  
2667 C  CG  . PRO B 135 ? 0.4524 0.4532 0.4517 0.0000  0.0019  -0.0031 135 PRO H CG  
2668 C  CD  . PRO B 135 ? 0.4524 0.4474 0.4452 0.0012  -0.0002 -0.0014 135 PRO H CD  
2669 N  N   . GLY B 136 ? 0.4955 0.4827 0.4790 0.0000  0.0007  -0.0009 136 GLY H N   
2670 C  CA  . GLY B 136 ? 0.5122 0.5002 0.4907 0.0005  0.0024  -0.0037 136 GLY H CA  
2671 C  C   . GLY B 136 ? 0.5204 0.5054 0.4925 0.0030  0.0056  -0.0035 136 GLY H C   
2672 O  O   . GLY B 136 ? 0.5248 0.5094 0.4975 0.0037  0.0037  -0.0029 136 GLY H O   
2673 N  N   . GLY B 143 ? 0.4373 0.4478 0.4319 0.0031  0.0048  0.0054  143 GLY H N   
2674 C  CA  . GLY B 143 ? 0.4327 0.4431 0.4250 -0.0009 0.0023  0.0072  143 GLY H CA  
2675 C  C   . GLY B 143 ? 0.4228 0.4348 0.4179 -0.0009 0.0025  0.0032  143 GLY H C   
2676 O  O   . GLY B 143 ? 0.4309 0.4338 0.4146 -0.0019 -0.0005 0.0052  143 GLY H O   
2677 N  N   . THR B 144 ? 0.4105 0.4224 0.4085 -0.0031 0.0009  0.0033  144 THR H N   
2678 C  CA  . THR B 144 ? 0.3971 0.4161 0.4019 -0.0018 0.0006  0.0025  144 THR H CA  
2679 C  C   . THR B 144 ? 0.3936 0.4073 0.3937 0.0000  0.0012  0.0038  144 THR H C   
2680 O  O   . THR B 144 ? 0.3922 0.4144 0.3879 -0.0022 -0.0003 0.0046  144 THR H O   
2681 C  CB  . THR B 144 ? 0.3990 0.4116 0.4032 0.0010  0.0034  0.0016  144 THR H CB  
2682 O  OG1 . THR B 144 ? 0.3997 0.4183 0.4230 -0.0012 0.0086  -0.0019 144 THR H OG1 
2683 C  CG2 . THR B 144 ? 0.3801 0.4170 0.3927 0.0036  0.0047  0.0036  144 THR H CG2 
2684 N  N   . ALA B 145 ? 0.3819 0.3923 0.3857 -0.0008 0.0026  0.0019  145 ALA H N   
2685 C  CA  . ALA B 145 ? 0.3666 0.3767 0.3743 -0.0023 0.0030  -0.0005 145 ALA H CA  
2686 C  C   . ALA B 145 ? 0.3545 0.3661 0.3685 -0.0033 0.0040  -0.0025 145 ALA H C   
2687 O  O   . ALA B 145 ? 0.3466 0.3669 0.3652 -0.0056 0.0069  -0.0036 145 ALA H O   
2688 C  CB  . ALA B 145 ? 0.3678 0.3775 0.3725 -0.0023 0.0043  -0.0028 145 ALA H CB  
2689 N  N   . ALA B 146 ? 0.3507 0.3540 0.3594 -0.0030 0.0031  -0.0024 146 ALA H N   
2690 C  CA  . ALA B 146 ? 0.3409 0.3431 0.3512 -0.0028 0.0022  0.0009  146 ALA H CA  
2691 C  C   . ALA B 146 ? 0.3308 0.3422 0.3424 -0.0027 0.0009  0.0008  146 ALA H C   
2692 O  O   . ALA B 146 ? 0.3354 0.3382 0.3440 -0.0046 0.0035  0.0002  146 ALA H O   
2693 C  CB  . ALA B 146 ? 0.3406 0.3394 0.3513 -0.0046 0.0026  0.0007  146 ALA H CB  
2694 N  N   . LEU B 147 ? 0.3231 0.3384 0.3412 -0.0021 0.0031  0.0027  147 LEU H N   
2695 C  CA  . LEU B 147 ? 0.3144 0.3314 0.3340 -0.0013 -0.0013 0.0004  147 LEU H CA  
2696 C  C   . LEU B 147 ? 0.3109 0.3252 0.3293 -0.0007 0.0002  0.0016  147 LEU H C   
2697 O  O   . LEU B 147 ? 0.3036 0.3173 0.3217 0.0031  0.0035  0.0004  147 LEU H O   
2698 C  CB  . LEU B 147 ? 0.3206 0.3323 0.3366 -0.0010 -0.0005 -0.0007 147 LEU H CB  
2699 C  CG  . LEU B 147 ? 0.3189 0.3421 0.3410 -0.0003 0.0005  0.0025  147 LEU H CG  
2700 C  CD1 . LEU B 147 ? 0.3292 0.3649 0.3411 0.0011  -0.0107 0.0075  147 LEU H CD1 
2701 C  CD2 . LEU B 147 ? 0.3149 0.3220 0.3294 0.0003  0.0016  -0.0069 147 LEU H CD2 
2702 N  N   . GLY B 148 ? 0.3117 0.3212 0.3243 -0.0002 -0.0022 0.0008  148 GLY H N   
2703 C  CA  . GLY B 148 ? 0.3154 0.3137 0.3262 0.0003  0.0028  0.0000  148 GLY H CA  
2704 C  C   . GLY B 148 ? 0.3171 0.3076 0.3259 -0.0031 0.0017  -0.0014 148 GLY H C   
2705 O  O   . GLY B 148 ? 0.3199 0.3064 0.3345 -0.0017 0.0018  0.0000  148 GLY H O   
2706 N  N   . CYS B 149 ? 0.3153 0.3020 0.3176 -0.0051 0.0007  -0.0004 149 CYS H N   
2707 C  CA  . CYS B 149 ? 0.3130 0.3010 0.3182 -0.0049 0.0005  -0.0033 149 CYS H CA  
2708 C  C   . CYS B 149 ? 0.3116 0.2961 0.3036 -0.0033 0.0009  -0.0036 149 CYS H C   
2709 O  O   . CYS B 149 ? 0.3193 0.2999 0.3013 -0.0029 0.0006  -0.0057 149 CYS H O   
2710 C  CB  . CYS B 149 ? 0.3182 0.3050 0.3185 -0.0070 0.0009  -0.0022 149 CYS H CB  
2711 S  SG  . CYS B 149 ? 0.3238 0.3071 0.3568 -0.0156 0.0064  -0.0116 149 CYS H SG  
2712 N  N   . LEU B 150 ? 0.3016 0.2844 0.2949 -0.0024 0.0019  -0.0028 150 LEU H N   
2713 C  CA  . LEU B 150 ? 0.2946 0.2769 0.2835 0.0010  -0.0006 -0.0041 150 LEU H CA  
2714 C  C   . LEU B 150 ? 0.2994 0.2832 0.2847 0.0000  -0.0018 -0.0035 150 LEU H C   
2715 O  O   . LEU B 150 ? 0.2974 0.2791 0.2679 0.0020  -0.0035 -0.0071 150 LEU H O   
2716 C  CB  . LEU B 150 ? 0.2904 0.2758 0.2850 0.0016  -0.0007 -0.0023 150 LEU H CB  
2717 C  CG  . LEU B 150 ? 0.2970 0.2768 0.2872 -0.0004 0.0016  -0.0008 150 LEU H CG  
2718 C  CD1 . LEU B 150 ? 0.2808 0.2836 0.2839 -0.0006 -0.0096 -0.0027 150 LEU H CD1 
2719 C  CD2 . LEU B 150 ? 0.2771 0.2597 0.2676 0.0012  0.0012  0.0000  150 LEU H CD2 
2720 N  N   . VAL B 151 ? 0.3056 0.2906 0.2942 0.0001  -0.0061 -0.0036 151 VAL H N   
2721 C  CA  . VAL B 151 ? 0.3090 0.2988 0.2971 -0.0005 -0.0050 -0.0012 151 VAL H CA  
2722 C  C   . VAL B 151 ? 0.3124 0.3063 0.3097 -0.0016 -0.0053 -0.0016 151 VAL H C   
2723 O  O   . VAL B 151 ? 0.3147 0.2963 0.3211 -0.0018 -0.0028 0.0004  151 VAL H O   
2724 C  CB  . VAL B 151 ? 0.3105 0.3015 0.3017 -0.0017 -0.0059 0.0002  151 VAL H CB  
2725 C  CG1 . VAL B 151 ? 0.3024 0.3043 0.2839 0.0037  -0.0045 -0.0021 151 VAL H CG1 
2726 C  CG2 . VAL B 151 ? 0.2942 0.2958 0.2863 -0.0007 -0.0072 0.0055  151 VAL H CG2 
2727 N  N   . LYS B 152 ? 0.3203 0.3172 0.3164 -0.0031 -0.0055 -0.0038 152 LYS H N   
2728 C  CA  . LYS B 152 ? 0.3222 0.3249 0.3265 -0.0028 -0.0034 -0.0045 152 LYS H CA  
2729 C  C   . LYS B 152 ? 0.3214 0.3252 0.3262 -0.0039 -0.0026 -0.0044 152 LYS H C   
2730 O  O   . LYS B 152 ? 0.3164 0.3227 0.3308 -0.0055 -0.0019 -0.0074 152 LYS H O   
2731 C  CB  . LYS B 152 ? 0.3291 0.3323 0.3300 0.0017  -0.0026 -0.0062 152 LYS H CB  
2732 C  CG  . LYS B 152 ? 0.3356 0.3471 0.3411 0.0019  -0.0044 -0.0041 152 LYS H CG  
2733 C  CD  . LYS B 152 ? 0.3673 0.3721 0.3559 0.0034  -0.0055 -0.0046 152 LYS H CD  
2734 C  CE  . LYS B 152 ? 0.3719 0.4009 0.3746 0.0003  -0.0009 -0.0025 152 LYS H CE  
2735 N  NZ  . LYS B 152 ? 0.3786 0.4220 0.3674 -0.0035 -0.0015 -0.0057 152 LYS H NZ  
2736 N  N   . ASP B 153 ? 0.3200 0.3180 0.3223 -0.0075 -0.0029 -0.0042 153 ASP H N   
2737 C  CA  . ASP B 153 ? 0.3223 0.3191 0.3157 -0.0061 -0.0009 -0.0030 153 ASP H CA  
2738 C  C   . ASP B 153 ? 0.3189 0.3128 0.3190 -0.0033 -0.0027 -0.0010 153 ASP H C   
2739 O  O   . ASP B 153 ? 0.3228 0.3121 0.3128 -0.0004 -0.0016 -0.0008 153 ASP H O   
2740 C  CB  . ASP B 153 ? 0.3172 0.3181 0.3171 -0.0079 0.0022  0.0007  153 ASP H CB  
2741 C  CG  . ASP B 153 ? 0.3113 0.3110 0.3038 -0.0123 0.0042  -0.0008 153 ASP H CG  
2742 O  OD1 . ASP B 153 ? 0.2966 0.3148 0.3038 -0.0103 0.0157  -0.0038 153 ASP H OD1 
2743 O  OD2 . ASP B 153 ? 0.3293 0.2860 0.3143 -0.0130 0.0087  -0.0041 153 ASP H OD2 
2744 N  N   . TYR B 154 ? 0.3186 0.3081 0.3174 -0.0030 -0.0030 0.0000  154 TYR H N   
2745 C  CA  . TYR B 154 ? 0.3122 0.3012 0.3114 -0.0055 -0.0005 0.0031  154 TYR H CA  
2746 C  C   . TYR B 154 ? 0.3158 0.3063 0.3122 -0.0066 0.0001  0.0039  154 TYR H C   
2747 O  O   . TYR B 154 ? 0.3231 0.3087 0.3102 -0.0111 0.0016  0.0042  154 TYR H O   
2748 C  CB  . TYR B 154 ? 0.3088 0.2998 0.3102 -0.0012 -0.0015 0.0032  154 TYR H CB  
2749 C  CG  . TYR B 154 ? 0.2919 0.2952 0.2986 -0.0022 0.0007  0.0027  154 TYR H CG  
2750 C  CD1 . TYR B 154 ? 0.2846 0.2844 0.2871 0.0027  0.0023  0.0045  154 TYR H CD1 
2751 C  CD2 . TYR B 154 ? 0.2734 0.2860 0.2798 0.0012  -0.0042 -0.0009 154 TYR H CD2 
2752 C  CE1 . TYR B 154 ? 0.2770 0.2913 0.2896 0.0051  0.0005  0.0004  154 TYR H CE1 
2753 C  CE2 . TYR B 154 ? 0.2712 0.2867 0.2837 0.0013  0.0032  0.0007  154 TYR H CE2 
2754 C  CZ  . TYR B 154 ? 0.2852 0.2941 0.2942 0.0021  0.0033  0.0012  154 TYR H CZ  
2755 O  OH  . TYR B 154 ? 0.2884 0.2968 0.3026 -0.0012 0.0061  -0.0041 154 TYR H OH  
2756 N  N   . PHE B 155 ? 0.3154 0.3028 0.3108 -0.0074 0.0011  0.0036  155 PHE H N   
2757 C  CA  . PHE B 155 ? 0.3120 0.3030 0.3104 -0.0039 0.0013  0.0004  155 PHE H CA  
2758 C  C   . PHE B 155 ? 0.3120 0.3013 0.3100 -0.0036 0.0011  0.0011  155 PHE H C   
2759 O  O   . PHE B 155 ? 0.3148 0.3040 0.3122 -0.0025 0.0022  -0.0007 155 PHE H O   
2760 C  CB  . PHE B 155 ? 0.3093 0.2999 0.3090 -0.0027 0.0019  0.0000  155 PHE H CB  
2761 C  CG  . PHE B 155 ? 0.3003 0.3045 0.3064 0.0009  0.0018  0.0006  155 PHE H CG  
2762 C  CD1 . PHE B 155 ? 0.2942 0.3037 0.2979 0.0011  -0.0021 0.0008  155 PHE H CD1 
2763 C  CD2 . PHE B 155 ? 0.2956 0.2932 0.3096 -0.0045 0.0091  0.0021  155 PHE H CD2 
2764 C  CE1 . PHE B 155 ? 0.2979 0.3043 0.3086 -0.0044 -0.0001 0.0022  155 PHE H CE1 
2765 C  CE2 . PHE B 155 ? 0.2957 0.3072 0.3104 -0.0011 0.0070  0.0007  155 PHE H CE2 
2766 C  CZ  . PHE B 155 ? 0.3004 0.3036 0.3041 -0.0040 0.0059  0.0025  155 PHE H CZ  
2767 N  N   . PRO B 156 ? 0.3135 0.3026 0.3068 -0.0031 0.0013  -0.0004 156 PRO H N   
2768 C  CA  . PRO B 156 ? 0.3154 0.3035 0.3097 -0.0020 0.0005  -0.0023 156 PRO H CA  
2769 C  C   . PRO B 156 ? 0.3216 0.3075 0.3182 -0.0045 -0.0006 -0.0028 156 PRO H C   
2770 O  O   . PRO B 156 ? 0.3254 0.3057 0.3186 -0.0084 -0.0012 -0.0046 156 PRO H O   
2771 C  CB  . PRO B 156 ? 0.3152 0.3019 0.3090 -0.0034 0.0000  -0.0007 156 PRO H CB  
2772 C  CG  . PRO B 156 ? 0.3128 0.3037 0.2979 -0.0013 0.0009  -0.0018 156 PRO H CG  
2773 C  CD  . PRO B 156 ? 0.3126 0.3001 0.3076 -0.0034 0.0012  -0.0001 156 PRO H CD  
2774 N  N   . GLU B 157 ? 0.3320 0.3163 0.3290 -0.0027 0.0013  -0.0032 157 GLU H N   
2775 C  CA  . GLU B 157 ? 0.3389 0.3224 0.3416 -0.0032 0.0026  -0.0033 157 GLU H CA  
2776 C  C   . GLU B 157 ? 0.3435 0.3228 0.3425 -0.0037 0.0025  -0.0049 157 GLU H C   
2777 O  O   . GLU B 157 ? 0.3490 0.3282 0.3466 -0.0063 0.0021  -0.0112 157 GLU H O   
2778 C  CB  . GLU B 157 ? 0.3394 0.3238 0.3449 -0.0033 0.0016  -0.0002 157 GLU H CB  
2779 C  CG  . GLU B 157 ? 0.3600 0.3444 0.3614 -0.0050 -0.0006 -0.0009 157 GLU H CG  
2780 C  CD  . GLU B 157 ? 0.3795 0.3671 0.3878 0.0028  0.0006  0.0049  157 GLU H CD  
2781 O  OE1 . GLU B 157 ? 0.4093 0.3872 0.3958 0.0009  0.0076  0.0094  157 GLU H OE1 
2782 O  OE2 . GLU B 157 ? 0.3593 0.3818 0.3973 0.0057  -0.0132 0.0006  157 GLU H OE2 
2783 N  N   . PRO B 158 ? 0.3473 0.3298 0.3477 -0.0021 0.0014  -0.0051 158 PRO H N   
2784 C  CA  . PRO B 158 ? 0.3498 0.3374 0.3492 -0.0020 0.0027  -0.0033 158 PRO H CA  
2785 C  C   . PRO B 158 ? 0.3559 0.3432 0.3554 -0.0036 0.0009  -0.0027 158 PRO H C   
2786 O  O   . PRO B 158 ? 0.3582 0.3428 0.3585 -0.0031 0.0008  -0.0046 158 PRO H O   
2787 C  CB  . PRO B 158 ? 0.3529 0.3356 0.3501 -0.0024 0.0008  -0.0023 158 PRO H CB  
2788 C  CG  . PRO B 158 ? 0.3445 0.3319 0.3397 -0.0012 0.0050  -0.0043 158 PRO H CG  
2789 C  CD  . PRO B 158 ? 0.3483 0.3294 0.3459 0.0000  -0.0002 -0.0046 158 PRO H CD  
2790 N  N   . VAL B 159 ? 0.3620 0.3542 0.3564 -0.0015 -0.0025 -0.0054 159 VAL H N   
2791 C  CA  . VAL B 159 ? 0.3651 0.3601 0.3656 -0.0007 -0.0016 -0.0031 159 VAL H CA  
2792 C  C   . VAL B 159 ? 0.3685 0.3610 0.3716 -0.0021 -0.0020 -0.0033 159 VAL H C   
2793 O  O   . VAL B 159 ? 0.3765 0.3578 0.3769 -0.0016 -0.0028 -0.0086 159 VAL H O   
2794 C  CB  . VAL B 159 ? 0.3634 0.3580 0.3619 -0.0019 -0.0003 -0.0052 159 VAL H CB  
2795 C  CG1 . VAL B 159 ? 0.3695 0.3734 0.3683 -0.0054 -0.0022 -0.0077 159 VAL H CG1 
2796 C  CG2 . VAL B 159 ? 0.3715 0.3623 0.3570 0.0039  -0.0069 -0.0073 159 VAL H CG2 
2797 N  N   . THR B 160 ? 0.3698 0.3637 0.3741 -0.0032 -0.0006 -0.0033 160 THR H N   
2798 C  CA  . THR B 160 ? 0.3685 0.3680 0.3723 -0.0020 0.0006  -0.0011 160 THR H CA  
2799 C  C   . THR B 160 ? 0.3634 0.3645 0.3729 -0.0014 0.0014  0.0011  160 THR H C   
2800 O  O   . THR B 160 ? 0.3627 0.3684 0.3701 0.0009  0.0024  0.0048  160 THR H O   
2801 C  CB  . THR B 160 ? 0.3691 0.3727 0.3761 0.0005  0.0014  -0.0020 160 THR H CB  
2802 O  OG1 . THR B 160 ? 0.3697 0.3604 0.3711 -0.0050 -0.0002 0.0088  160 THR H OG1 
2803 C  CG2 . THR B 160 ? 0.3875 0.3865 0.3749 -0.0028 0.0011  -0.0029 160 THR H CG2 
2804 N  N   . VAL B 161 ? 0.3612 0.3583 0.3714 0.0000  -0.0003 0.0025  161 VAL H N   
2805 C  CA  . VAL B 161 ? 0.3603 0.3519 0.3665 0.0000  -0.0014 0.0000  161 VAL H CA  
2806 C  C   . VAL B 161 ? 0.3635 0.3635 0.3729 0.0013  -0.0035 -0.0028 161 VAL H C   
2807 O  O   . VAL B 161 ? 0.3636 0.3667 0.3750 -0.0016 -0.0021 -0.0047 161 VAL H O   
2808 C  CB  . VAL B 161 ? 0.3528 0.3493 0.3687 0.0020  -0.0012 -0.0012 161 VAL H CB  
2809 C  CG1 . VAL B 161 ? 0.3473 0.3335 0.3582 0.0012  -0.0091 0.0071  161 VAL H CG1 
2810 C  CG2 . VAL B 161 ? 0.3539 0.3375 0.3629 -0.0031 -0.0013 -0.0015 161 VAL H CG2 
2811 N  N   . SER B 162 ? 0.3636 0.3653 0.3751 0.0036  -0.0057 -0.0016 162 SER H N   
2812 C  CA  . SER B 162 ? 0.3686 0.3714 0.3755 0.0039  -0.0044 0.0012  162 SER H CA  
2813 C  C   . SER B 162 ? 0.3722 0.3751 0.3797 0.0025  -0.0068 0.0013  162 SER H C   
2814 O  O   . SER B 162 ? 0.3765 0.3763 0.3841 0.0025  -0.0087 0.0035  162 SER H O   
2815 C  CB  . SER B 162 ? 0.3691 0.3692 0.3739 0.0028  -0.0065 0.0001  162 SER H CB  
2816 O  OG  . SER B 162 ? 0.3570 0.3800 0.3673 0.0153  -0.0099 0.0048  162 SER H OG  
2817 N  N   . TRP B 163 ? 0.3728 0.3796 0.3798 0.0031  -0.0031 0.0023  163 TRP H N   
2818 C  CA  . TRP B 163 ? 0.3795 0.3858 0.3882 0.0030  -0.0024 0.0019  163 TRP H CA  
2819 C  C   . TRP B 163 ? 0.3850 0.3950 0.3986 0.0021  0.0001  0.0008  163 TRP H C   
2820 O  O   . TRP B 163 ? 0.3804 0.3914 0.3985 0.0017  -0.0002 -0.0009 163 TRP H O   
2821 C  CB  . TRP B 163 ? 0.3537 0.3737 0.3753 -0.0063 -0.0099 -0.0027 163 TRP H CB  
2822 C  CG  . TRP B 163 ? 0.3651 0.3542 0.3560 -0.0020 -0.0067 -0.0024 163 TRP H CG  
2823 C  CD1 . TRP B 163 ? 0.3387 0.3130 0.2987 -0.0052 -0.0055 -0.0316 163 TRP H CD1 
2824 C  CD2 . TRP B 163 ? 0.3597 0.3592 0.3675 0.0017  0.0042  0.0163  163 TRP H CD2 
2825 N  NE1 . TRP B 163 ? 0.3847 0.3154 0.3143 -0.0043 0.0051  -0.0342 163 TRP H NE1 
2826 C  CE2 . TRP B 163 ? 0.3747 0.3547 0.3653 -0.0001 0.0107  0.0027  163 TRP H CE2 
2827 C  CE3 . TRP B 163 ? 0.3271 0.3366 0.3326 -0.0082 -0.0043 -0.0040 163 TRP H CE3 
2828 C  CZ2 . TRP B 163 ? 0.3544 0.3528 0.3526 -0.0032 -0.0006 -0.0088 163 TRP H CZ2 
2829 C  CZ3 . TRP B 163 ? 0.3696 0.4054 0.4069 0.0034  0.0081  0.0024  163 TRP H CZ3 
2830 C  CH2 . TRP B 163 ? 0.3664 0.3789 0.3802 0.0060  0.0082  0.0119  163 TRP H CH2 
2831 N  N   . ASN B 164 ? 0.4017 0.4093 0.4119 -0.0005 0.0012  -0.0035 164 ASN H N   
2832 C  CA  . ASN B 164 ? 0.4174 0.4208 0.4253 0.0037  0.0007  -0.0011 164 ASN H CA  
2833 C  C   . ASN B 164 ? 0.4332 0.4344 0.4416 0.0022  0.0002  0.0000  164 ASN H C   
2834 O  O   . ASN B 164 ? 0.4403 0.4377 0.4500 0.0011  0.0005  -0.0017 164 ASN H O   
2835 C  CB  . ASN B 164 ? 0.4119 0.4165 0.4224 0.0015  -0.0001 -0.0035 164 ASN H CB  
2836 C  CG  . ASN B 164 ? 0.3983 0.4040 0.4128 0.0020  0.0031  0.0006  164 ASN H CG  
2837 O  OD1 . ASN B 164 ? 0.4020 0.3756 0.4061 0.0056  -0.0053 -0.0154 164 ASN H OD1 
2838 N  ND2 . ASN B 164 ? 0.3675 0.3932 0.4048 0.0083  -0.0009 0.0033  164 ASN H ND2 
2839 N  N   . SER B 165 ? 0.4491 0.4528 0.4565 0.0027  0.0011  0.0015  165 SER H N   
2840 C  CA  . SER B 165 ? 0.4562 0.4596 0.4567 0.0007  -0.0013 -0.0002 165 SER H CA  
2841 C  C   . SER B 165 ? 0.4625 0.4650 0.4650 -0.0004 -0.0005 0.0007  165 SER H C   
2842 O  O   . SER B 165 ? 0.4625 0.4687 0.4684 -0.0032 -0.0026 0.0009  165 SER H O   
2843 C  CB  . SER B 165 ? 0.4532 0.4585 0.4589 0.0000  -0.0017 0.0019  165 SER H CB  
2844 O  OG  . SER B 165 ? 0.4602 0.4496 0.4521 0.0079  -0.0016 0.0037  165 SER H OG  
2845 N  N   . GLY B 166 ? 0.4610 0.4696 0.4657 0.0038  -0.0017 0.0005  166 GLY H N   
2846 C  CA  . GLY B 166 ? 0.4664 0.4696 0.4731 0.0005  -0.0010 0.0014  166 GLY H CA  
2847 C  C   . GLY B 166 ? 0.4715 0.4727 0.4746 0.0021  -0.0020 0.0018  166 GLY H C   
2848 O  O   . GLY B 166 ? 0.4771 0.4760 0.4824 0.0010  -0.0033 0.0023  166 GLY H O   
2849 N  N   . ALA B 167 ? 0.4695 0.4658 0.4738 0.0016  -0.0018 0.0021  167 ALA H N   
2850 C  CA  . ALA B 167 ? 0.4639 0.4638 0.4715 0.0008  -0.0007 0.0043  167 ALA H CA  
2851 C  C   . ALA B 167 ? 0.4561 0.4598 0.4745 0.0006  0.0002  0.0047  167 ALA H C   
2852 O  O   . ALA B 167 ? 0.4548 0.4582 0.4774 0.0013  0.0006  0.0117  167 ALA H O   
2853 C  CB  . ALA B 167 ? 0.4638 0.4657 0.4748 0.0038  -0.0022 0.0042  167 ALA H CB  
2854 N  N   . LEU B 168 ? 0.4479 0.4488 0.4622 -0.0011 0.0000  0.0032  168 LEU H N   
2855 C  CA  . LEU B 168 ? 0.4402 0.4432 0.4506 -0.0029 0.0003  0.0003  168 LEU H CA  
2856 C  C   . LEU B 168 ? 0.4330 0.4334 0.4401 -0.0046 -0.0005 0.0010  168 LEU H C   
2857 O  O   . LEU B 168 ? 0.4306 0.4340 0.4486 -0.0072 -0.0004 -0.0036 168 LEU H O   
2858 C  CB  . LEU B 168 ? 0.4455 0.4467 0.4485 -0.0017 0.0012  0.0013  168 LEU H CB  
2859 C  CG  . LEU B 168 ? 0.4391 0.4484 0.4551 -0.0018 0.0002  0.0006  168 LEU H CG  
2860 C  CD1 . LEU B 168 ? 0.4261 0.4240 0.4373 -0.0026 -0.0050 -0.0036 168 LEU H CD1 
2861 C  CD2 . LEU B 168 ? 0.4359 0.4388 0.4565 -0.0002 0.0026  -0.0042 168 LEU H CD2 
2862 N  N   . THR B 169 ? 0.4211 0.4238 0.4207 -0.0035 -0.0022 0.0022  169 THR H N   
2863 C  CA  . THR B 169 ? 0.4070 0.4117 0.4053 -0.0047 -0.0027 0.0048  169 THR H CA  
2864 C  C   . THR B 169 ? 0.3985 0.4071 0.3954 -0.0045 -0.0014 0.0036  169 THR H C   
2865 O  O   . THR B 169 ? 0.3929 0.3973 0.3880 -0.0015 -0.0007 0.0032  169 THR H O   
2866 C  CB  . THR B 169 ? 0.4083 0.4165 0.4074 -0.0042 -0.0038 0.0054  169 THR H CB  
2867 O  OG1 . THR B 169 ? 0.3986 0.4032 0.3889 -0.0120 -0.0080 0.0092  169 THR H OG1 
2868 C  CG2 . THR B 169 ? 0.4125 0.4104 0.4042 -0.0088 -0.0042 0.0088  169 THR H CG2 
2869 N  N   . SER B 170 ? 0.3935 0.4003 0.3905 -0.0023 -0.0021 0.0041  170 SER H N   
2870 C  CA  . SER B 170 ? 0.3823 0.3912 0.3796 -0.0031 0.0009  0.0044  170 SER H CA  
2871 C  C   . SER B 170 ? 0.3675 0.3739 0.3599 -0.0026 0.0042  0.0033  170 SER H C   
2872 O  O   . SER B 170 ? 0.3693 0.3734 0.3573 -0.0038 0.0041  -0.0030 170 SER H O   
2873 C  CB  . SER B 170 ? 0.3845 0.3970 0.3884 -0.0048 0.0010  0.0059  170 SER H CB  
2874 O  OG  . SER B 170 ? 0.4050 0.4226 0.4337 -0.0038 0.0005  0.0021  170 SER H OG  
2875 N  N   . GLY B 171 ? 0.3506 0.3589 0.3382 -0.0048 0.0038  0.0043  171 GLY H N   
2876 C  CA  . GLY B 171 ? 0.3306 0.3362 0.3201 -0.0035 0.0033  0.0048  171 GLY H CA  
2877 C  C   . GLY B 171 ? 0.3191 0.3214 0.3061 -0.0021 0.0018  0.0046  171 GLY H C   
2878 O  O   . GLY B 171 ? 0.3062 0.3073 0.3017 -0.0095 0.0055  0.0059  171 GLY H O   
2879 N  N   . VAL B 172 ? 0.3118 0.3148 0.3055 -0.0037 0.0037  0.0046  172 VAL H N   
2880 C  CA  . VAL B 172 ? 0.2997 0.3000 0.2945 -0.0021 -0.0006 0.0005  172 VAL H CA  
2881 C  C   . VAL B 172 ? 0.2947 0.2922 0.2870 -0.0008 -0.0013 0.0025  172 VAL H C   
2882 O  O   . VAL B 172 ? 0.2973 0.2913 0.2724 0.0080  -0.0036 0.0043  172 VAL H O   
2883 C  CB  . VAL B 172 ? 0.3006 0.2975 0.2943 -0.0018 -0.0021 0.0010  172 VAL H CB  
2884 C  CG1 . VAL B 172 ? 0.2800 0.2977 0.2891 -0.0024 -0.0009 0.0040  172 VAL H CG1 
2885 C  CG2 . VAL B 172 ? 0.2964 0.3059 0.2937 -0.0002 0.0028  -0.0035 172 VAL H CG2 
2886 N  N   . HIS B 173 ? 0.2897 0.2870 0.2788 0.0030  -0.0044 0.0005  173 HIS H N   
2887 C  CA  . HIS B 173 ? 0.2769 0.2752 0.2668 0.0020  0.0000  0.0004  173 HIS H CA  
2888 C  C   . HIS B 173 ? 0.2745 0.2707 0.2671 0.0013  -0.0025 -0.0011 173 HIS H C   
2889 O  O   . HIS B 173 ? 0.2759 0.2668 0.2585 0.0046  -0.0005 -0.0018 173 HIS H O   
2890 C  CB  . HIS B 173 ? 0.2776 0.2740 0.2679 -0.0007 0.0030  0.0001  173 HIS H CB  
2891 C  CG  . HIS B 173 ? 0.2855 0.2771 0.2738 0.0008  0.0004  -0.0013 173 HIS H CG  
2892 N  ND1 . HIS B 173 ? 0.2786 0.2523 0.2698 -0.0015 -0.0009 -0.0038 173 HIS H ND1 
2893 C  CD2 . HIS B 173 ? 0.2698 0.2588 0.2679 0.0059  0.0090  0.0001  173 HIS H CD2 
2894 C  CE1 . HIS B 173 ? 0.2836 0.2669 0.2667 -0.0063 0.0059  -0.0031 173 HIS H CE1 
2895 N  NE2 . HIS B 173 ? 0.2594 0.2711 0.2772 -0.0014 0.0137  -0.0033 173 HIS H NE2 
2896 N  N   . THR B 174 ? 0.2699 0.2708 0.2625 -0.0016 -0.0002 -0.0010 174 THR H N   
2897 C  CA  . THR B 174 ? 0.2660 0.2683 0.2663 -0.0017 -0.0007 -0.0026 174 THR H CA  
2898 C  C   . THR B 174 ? 0.2713 0.2704 0.2627 -0.0048 0.0031  -0.0009 174 THR H C   
2899 O  O   . THR B 174 ? 0.2653 0.2691 0.2607 -0.0084 0.0095  0.0026  174 THR H O   
2900 C  CB  . THR B 174 ? 0.2713 0.2709 0.2644 -0.0022 0.0016  -0.0020 174 THR H CB  
2901 O  OG1 . THR B 174 ? 0.2659 0.2789 0.2920 0.0059  -0.0066 -0.0044 174 THR H OG1 
2902 C  CG2 . THR B 174 ? 0.2660 0.2648 0.2593 -0.0081 -0.0023 -0.0093 174 THR H CG2 
2903 N  N   . PHE B 175 ? 0.2693 0.2688 0.2624 -0.0017 0.0021  0.0011  175 PHE H N   
2904 C  CA  . PHE B 175 ? 0.2744 0.2728 0.2692 -0.0017 0.0000  0.0004  175 PHE H CA  
2905 C  C   . PHE B 175 ? 0.2860 0.2801 0.2785 0.0006  0.0017  0.0022  175 PHE H C   
2906 O  O   . PHE B 175 ? 0.2942 0.2916 0.2834 -0.0014 0.0055  0.0001  175 PHE H O   
2907 C  CB  . PHE B 175 ? 0.2676 0.2631 0.2635 -0.0011 0.0000  0.0013  175 PHE H CB  
2908 C  CG  . PHE B 175 ? 0.2537 0.2555 0.2451 -0.0024 -0.0059 -0.0024 175 PHE H CG  
2909 C  CD1 . PHE B 175 ? 0.2239 0.2521 0.2415 -0.0128 -0.0105 0.0010  175 PHE H CD1 
2910 C  CD2 . PHE B 175 ? 0.2470 0.2533 0.2265 -0.0105 -0.0087 -0.0045 175 PHE H CD2 
2911 C  CE1 . PHE B 175 ? 0.2482 0.2604 0.2342 -0.0082 -0.0128 0.0009  175 PHE H CE1 
2912 C  CE2 . PHE B 175 ? 0.2396 0.2399 0.2405 -0.0151 -0.0156 -0.0069 175 PHE H CE2 
2913 C  CZ  . PHE B 175 ? 0.2406 0.2545 0.2409 0.0034  -0.0101 -0.0092 175 PHE H CZ  
2914 N  N   . PRO B 176 ? 0.2948 0.2880 0.2894 0.0022  0.0011  0.0012  176 PRO H N   
2915 C  CA  . PRO B 176 ? 0.3006 0.2926 0.2991 0.0037  0.0042  0.0044  176 PRO H CA  
2916 C  C   . PRO B 176 ? 0.3062 0.3008 0.3075 0.0043  0.0044  0.0017  176 PRO H C   
2917 O  O   . PRO B 176 ? 0.3110 0.2959 0.3073 0.0087  0.0069  0.0044  176 PRO H O   
2918 C  CB  . PRO B 176 ? 0.3001 0.2911 0.2934 0.0044  0.0046  0.0035  176 PRO H CB  
2919 C  CG  . PRO B 176 ? 0.3000 0.2887 0.3005 0.0052  0.0031  0.0049  176 PRO H CG  
2920 C  CD  . PRO B 176 ? 0.2919 0.2807 0.2865 0.0027  0.0000  0.0043  176 PRO H CD  
2921 N  N   . ALA B 177 ? 0.3178 0.3086 0.3232 0.0043  0.0064  0.0032  177 ALA H N   
2922 C  CA  . ALA B 177 ? 0.3269 0.3214 0.3309 -0.0012 0.0022  0.0008  177 ALA H CA  
2923 C  C   . ALA B 177 ? 0.3385 0.3307 0.3404 0.0005  0.0010  0.0004  177 ALA H C   
2924 O  O   . ALA B 177 ? 0.3397 0.3256 0.3460 -0.0023 0.0005  0.0016  177 ALA H O   
2925 C  CB  . ALA B 177 ? 0.3240 0.3118 0.3284 0.0025  0.0000  0.0022  177 ALA H CB  
2926 N  N   . VAL B 178 ? 0.3459 0.3445 0.3501 -0.0039 -0.0010 -0.0005 178 VAL H N   
2927 C  CA  . VAL B 178 ? 0.3556 0.3580 0.3636 -0.0031 0.0006  -0.0011 178 VAL H CA  
2928 C  C   . VAL B 178 ? 0.3599 0.3608 0.3639 -0.0040 0.0019  0.0002  178 VAL H C   
2929 O  O   . VAL B 178 ? 0.3489 0.3612 0.3608 -0.0064 0.0005  0.0002  178 VAL H O   
2930 C  CB  . VAL B 178 ? 0.3603 0.3631 0.3652 -0.0046 -0.0005 0.0023  178 VAL H CB  
2931 C  CG1 . VAL B 178 ? 0.3619 0.3752 0.3846 -0.0013 0.0025  0.0006  178 VAL H CG1 
2932 C  CG2 . VAL B 178 ? 0.3694 0.3782 0.3779 -0.0135 -0.0050 -0.0020 178 VAL H CG2 
2933 N  N   . LEU B 179 ? 0.3714 0.3706 0.3799 -0.0046 0.0030  0.0004  179 LEU H N   
2934 C  CA  . LEU B 179 ? 0.3808 0.3823 0.3856 -0.0024 0.0046  0.0012  179 LEU H CA  
2935 C  C   . LEU B 179 ? 0.3834 0.3884 0.3937 -0.0019 0.0026  0.0012  179 LEU H C   
2936 O  O   . LEU B 179 ? 0.3948 0.3920 0.4105 -0.0023 0.0034  0.0025  179 LEU H O   
2937 C  CB  . LEU B 179 ? 0.3802 0.3827 0.3843 -0.0034 0.0035  -0.0001 179 LEU H CB  
2938 C  CG  . LEU B 179 ? 0.3827 0.3789 0.3750 -0.0002 0.0011  0.0031  179 LEU H CG  
2939 C  CD1 . LEU B 179 ? 0.3485 0.3648 0.3531 -0.0057 -0.0022 -0.0004 179 LEU H CD1 
2940 C  CD2 . LEU B 179 ? 0.3805 0.3814 0.3809 0.0019  0.0053  0.0029  179 LEU H CD2 
2941 N  N   . GLN B 180 ? 0.3875 0.3907 0.3935 -0.0011 0.0035  -0.0002 180 GLN H N   
2942 C  CA  . GLN B 180 ? 0.3902 0.3938 0.3949 -0.0007 0.0021  -0.0017 180 GLN H CA  
2943 C  C   . GLN B 180 ? 0.4008 0.4011 0.4040 -0.0019 0.0024  -0.0020 180 GLN H C   
2944 O  O   . GLN B 180 ? 0.4005 0.3954 0.4025 -0.0019 0.0012  -0.0044 180 GLN H O   
2945 C  CB  . GLN B 180 ? 0.3918 0.3953 0.3972 -0.0028 0.0032  -0.0026 180 GLN H CB  
2946 C  CG  . GLN B 180 ? 0.3809 0.3892 0.3802 0.0022  0.0004  -0.0023 180 GLN H CG  
2947 C  CD  . GLN B 180 ? 0.3816 0.3860 0.3811 -0.0025 -0.0009 0.0010  180 GLN H CD  
2948 O  OE1 . GLN B 180 ? 0.3683 0.3756 0.3752 -0.0093 0.0038  0.0039  180 GLN H OE1 
2949 N  NE2 . GLN B 180 ? 0.3484 0.3603 0.3543 0.0015  -0.0080 0.0050  180 GLN H NE2 
2950 N  N   . SER B 181 ? 0.4096 0.4133 0.4127 -0.0031 0.0017  -0.0028 181 SER H N   
2951 C  CA  . SER B 181 ? 0.4177 0.4247 0.4224 -0.0038 0.0015  -0.0023 181 SER H CA  
2952 C  C   . SER B 181 ? 0.4184 0.4240 0.4227 -0.0030 0.0025  -0.0015 181 SER H C   
2953 O  O   . SER B 181 ? 0.4165 0.4311 0.4309 -0.0066 0.0035  -0.0011 181 SER H O   
2954 C  CB  . SER B 181 ? 0.4232 0.4295 0.4254 -0.0019 0.0018  -0.0042 181 SER H CB  
2955 O  OG  . SER B 181 ? 0.4421 0.4441 0.4434 -0.0114 0.0010  -0.0040 181 SER H OG  
2956 N  N   . SER B 182 ? 0.4187 0.4196 0.4174 -0.0030 0.0012  -0.0024 182 SER H N   
2957 C  CA  . SER B 182 ? 0.4158 0.4135 0.4099 -0.0049 0.0002  -0.0018 182 SER H CA  
2958 C  C   . SER B 182 ? 0.4121 0.4078 0.4054 -0.0064 0.0000  -0.0014 182 SER H C   
2959 O  O   . SER B 182 ? 0.4081 0.3992 0.4028 -0.0129 0.0022  0.0016  182 SER H O   
2960 C  CB  . SER B 182 ? 0.4175 0.4154 0.4115 -0.0045 0.0000  -0.0052 182 SER H CB  
2961 O  OG  . SER B 182 ? 0.4142 0.4089 0.4060 -0.0074 0.0021  0.0003  182 SER H OG  
2962 N  N   . GLY B 183 ? 0.4083 0.3989 0.3946 -0.0050 0.0000  -0.0013 183 GLY H N   
2963 C  CA  . GLY B 183 ? 0.3907 0.3852 0.3842 -0.0049 0.0019  -0.0033 183 GLY H CA  
2964 C  C   . GLY B 183 ? 0.3864 0.3815 0.3734 -0.0072 0.0015  -0.0014 183 GLY H C   
2965 O  O   . GLY B 183 ? 0.3857 0.3873 0.3743 -0.0074 -0.0001 0.0023  183 GLY H O   
2966 N  N   . LEU B 184 ? 0.3736 0.3683 0.3653 -0.0080 0.0029  -0.0009 184 LEU H N   
2967 C  CA  . LEU B 184 ? 0.3557 0.3495 0.3505 -0.0038 0.0016  -0.0013 184 LEU H CA  
2968 C  C   . LEU B 184 ? 0.3489 0.3495 0.3424 -0.0009 0.0037  -0.0033 184 LEU H C   
2969 O  O   . LEU B 184 ? 0.3449 0.3337 0.3381 0.0006  0.0109  -0.0055 184 LEU H O   
2970 C  CB  . LEU B 184 ? 0.3554 0.3505 0.3514 -0.0057 0.0010  0.0012  184 LEU H CB  
2971 C  CG  . LEU B 184 ? 0.3545 0.3450 0.3464 -0.0022 0.0011  0.0032  184 LEU H CG  
2972 C  CD1 . LEU B 184 ? 0.3425 0.3294 0.3396 -0.0008 -0.0017 0.0091  184 LEU H CD1 
2973 C  CD2 . LEU B 184 ? 0.3313 0.3205 0.3359 -0.0076 -0.0033 0.0023  184 LEU H CD2 
2974 N  N   . TYR B 185 ? 0.3431 0.3419 0.3397 -0.0037 0.0028  -0.0046 185 TYR H N   
2975 C  CA  . TYR B 185 ? 0.3382 0.3362 0.3340 0.0000  0.0001  -0.0025 185 TYR H CA  
2976 C  C   . TYR B 185 ? 0.3317 0.3336 0.3332 -0.0015 -0.0030 -0.0026 185 TYR H C   
2977 O  O   . TYR B 185 ? 0.3330 0.3349 0.3350 0.0035  -0.0055 -0.0004 185 TYR H O   
2978 C  CB  . TYR B 185 ? 0.3379 0.3359 0.3320 0.0000  0.0022  -0.0019 185 TYR H CB  
2979 C  CG  . TYR B 185 ? 0.3541 0.3371 0.3403 0.0004  0.0000  -0.0037 185 TYR H CG  
2980 C  CD1 . TYR B 185 ? 0.3420 0.3206 0.3273 -0.0018 0.0003  -0.0075 185 TYR H CD1 
2981 C  CD2 . TYR B 185 ? 0.3477 0.3401 0.3409 -0.0002 -0.0010 -0.0013 185 TYR H CD2 
2982 C  CE1 . TYR B 185 ? 0.3341 0.3411 0.3277 -0.0033 -0.0017 -0.0033 185 TYR H CE1 
2983 C  CE2 . TYR B 185 ? 0.3193 0.3311 0.3284 -0.0035 0.0002  -0.0049 185 TYR H CE2 
2984 C  CZ  . TYR B 185 ? 0.3341 0.3318 0.3305 -0.0026 -0.0038 -0.0025 185 TYR H CZ  
2985 O  OH  . TYR B 185 ? 0.3512 0.3361 0.3283 -0.0017 0.0021  -0.0009 185 TYR H OH  
2986 N  N   . SER B 186 ? 0.3243 0.3308 0.3263 -0.0002 -0.0050 -0.0013 186 SER H N   
2987 C  CA  . SER B 186 ? 0.3132 0.3272 0.3210 0.0001  -0.0015 -0.0048 186 SER H CA  
2988 C  C   . SER B 186 ? 0.3084 0.3242 0.3193 -0.0006 -0.0007 -0.0060 186 SER H C   
2989 O  O   . SER B 186 ? 0.2960 0.3217 0.3227 -0.0017 -0.0006 -0.0059 186 SER H O   
2990 C  CB  . SER B 186 ? 0.3172 0.3369 0.3233 -0.0017 0.0024  -0.0075 186 SER H CB  
2991 O  OG  . SER B 186 ? 0.3369 0.3608 0.3304 -0.0010 -0.0049 -0.0098 186 SER H OG  
2992 N  N   . LEU B 187 ? 0.3099 0.3133 0.3110 -0.0040 -0.0015 -0.0074 187 LEU H N   
2993 C  CA  . LEU B 187 ? 0.3050 0.3087 0.3039 -0.0030 0.0003  -0.0050 187 LEU H CA  
2994 C  C   . LEU B 187 ? 0.3091 0.3075 0.3077 -0.0017 -0.0027 -0.0039 187 LEU H C   
2995 O  O   . LEU B 187 ? 0.3090 0.2997 0.3097 -0.0010 -0.0047 0.0005  187 LEU H O   
2996 C  CB  . LEU B 187 ? 0.3014 0.3002 0.2993 -0.0026 -0.0006 -0.0069 187 LEU H CB  
2997 C  CG  . LEU B 187 ? 0.3001 0.3035 0.2988 -0.0069 -0.0006 -0.0108 187 LEU H CG  
2998 C  CD1 . LEU B 187 ? 0.2789 0.2921 0.2888 -0.0157 -0.0108 -0.0085 187 LEU H CD1 
2999 C  CD2 . LEU B 187 ? 0.3024 0.3061 0.2931 -0.0065 0.0010  -0.0046 187 LEU H CD2 
3000 N  N   . SER B 188 ? 0.3126 0.3023 0.3069 0.0004  -0.0029 -0.0001 188 SER H N   
3001 C  CA  . SER B 188 ? 0.3119 0.3096 0.3089 0.0015  -0.0035 -0.0009 188 SER H CA  
3002 C  C   . SER B 188 ? 0.3068 0.3044 0.3010 0.0010  -0.0023 0.0000  188 SER H C   
3003 O  O   . SER B 188 ? 0.3061 0.3139 0.3068 0.0000  -0.0019 -0.0003 188 SER H O   
3004 C  CB  . SER B 188 ? 0.3185 0.3141 0.3149 0.0012  -0.0039 -0.0025 188 SER H CB  
3005 O  OG  . SER B 188 ? 0.3389 0.3461 0.3436 -0.0009 -0.0081 -0.0066 188 SER H OG  
3006 N  N   . SER B 189 ? 0.3019 0.3044 0.2952 -0.0003 -0.0061 -0.0006 189 SER H N   
3007 C  CA  . SER B 189 ? 0.2992 0.2963 0.2905 0.0001  -0.0016 0.0003  189 SER H CA  
3008 C  C   . SER B 189 ? 0.2982 0.2920 0.2935 -0.0009 -0.0025 0.0016  189 SER H C   
3009 O  O   . SER B 189 ? 0.2951 0.2879 0.2950 0.0020  -0.0029 -0.0046 189 SER H O   
3010 C  CB  . SER B 189 ? 0.2879 0.2924 0.2868 0.0046  -0.0018 -0.0004 189 SER H CB  
3011 O  OG  . SER B 189 ? 0.3066 0.2877 0.2754 0.0101  -0.0062 0.0057  189 SER H OG  
3012 N  N   . VAL B 190 ? 0.3023 0.2943 0.2948 0.0009  -0.0013 0.0032  190 VAL H N   
3013 C  CA  . VAL B 190 ? 0.2950 0.2866 0.2895 -0.0005 0.0020  0.0044  190 VAL H CA  
3014 C  C   . VAL B 190 ? 0.2959 0.2843 0.2935 0.0007  0.0013  0.0057  190 VAL H C   
3015 O  O   . VAL B 190 ? 0.2800 0.2605 0.2798 0.0008  -0.0042 0.0082  190 VAL H O   
3016 C  CB  . VAL B 190 ? 0.2922 0.2840 0.2809 -0.0023 -0.0005 0.0061  190 VAL H CB  
3017 C  CG1 . VAL B 190 ? 0.2942 0.2691 0.2812 -0.0039 0.0021  0.0048  190 VAL H CG1 
3018 C  CG2 . VAL B 190 ? 0.2906 0.2898 0.2663 -0.0053 0.0063  0.0017  190 VAL H CG2 
3019 N  N   . VAL B 191 ? 0.3025 0.2939 0.3104 0.0029  0.0042  0.0016  191 VAL H N   
3020 C  CA  . VAL B 191 ? 0.3026 0.3034 0.3177 0.0014  0.0038  0.0002  191 VAL H CA  
3021 C  C   . VAL B 191 ? 0.3144 0.3156 0.3258 0.0001  0.0071  -0.0025 191 VAL H C   
3022 O  O   . VAL B 191 ? 0.3164 0.3191 0.3301 -0.0036 0.0088  -0.0043 191 VAL H O   
3023 C  CB  . VAL B 191 ? 0.3015 0.3041 0.3169 0.0015  0.0052  -0.0014 191 VAL H CB  
3024 C  CG1 . VAL B 191 ? 0.2840 0.3003 0.3166 0.0031  0.0019  -0.0022 191 VAL H CG1 
3025 C  CG2 . VAL B 191 ? 0.2935 0.2901 0.3050 0.0078  -0.0004 -0.0031 191 VAL H CG2 
3026 N  N   . THR B 192 ? 0.3268 0.3247 0.3366 -0.0024 0.0082  -0.0009 192 THR H N   
3027 C  CA  . THR B 192 ? 0.3360 0.3360 0.3404 -0.0015 0.0040  -0.0034 192 THR H CA  
3028 C  C   . THR B 192 ? 0.3402 0.3420 0.3470 -0.0020 0.0062  -0.0021 192 THR H C   
3029 O  O   . THR B 192 ? 0.3435 0.3404 0.3467 -0.0056 0.0088  -0.0028 192 THR H O   
3030 C  CB  . THR B 192 ? 0.3327 0.3338 0.3384 -0.0009 0.0051  -0.0020 192 THR H CB  
3031 O  OG1 . THR B 192 ? 0.3223 0.3219 0.3353 -0.0029 0.0082  -0.0079 192 THR H OG1 
3032 C  CG2 . THR B 192 ? 0.3397 0.3458 0.3489 0.0065  0.0049  -0.0047 192 THR H CG2 
3033 N  N   . VAL B 193 ? 0.3515 0.3567 0.3576 -0.0033 0.0043  -0.0014 193 VAL H N   
3034 C  CA  . VAL B 193 ? 0.3568 0.3697 0.3712 -0.0013 0.0072  -0.0018 193 VAL H CA  
3035 C  C   . VAL B 193 ? 0.3688 0.3821 0.3755 -0.0006 0.0065  -0.0041 193 VAL H C   
3036 O  O   . VAL B 193 ? 0.3603 0.3811 0.3784 -0.0008 0.0172  -0.0020 193 VAL H O   
3037 C  CB  . VAL B 193 ? 0.3541 0.3631 0.3657 -0.0017 0.0067  -0.0016 193 VAL H CB  
3038 C  CG1 . VAL B 193 ? 0.3490 0.3623 0.3798 0.0013  0.0033  0.0016  193 VAL H CG1 
3039 C  CG2 . VAL B 193 ? 0.3617 0.3687 0.3766 0.0002  0.0039  0.0027  193 VAL H CG2 
3040 N  N   . PRO B 194 ? 0.3798 0.3997 0.3913 -0.0028 0.0068  -0.0047 194 PRO H N   
3041 C  CA  . PRO B 194 ? 0.3919 0.4163 0.4042 -0.0025 0.0082  -0.0031 194 PRO H CA  
3042 C  C   . PRO B 194 ? 0.4044 0.4277 0.4161 -0.0011 0.0125  -0.0048 194 PRO H C   
3043 O  O   . PRO B 194 ? 0.3982 0.4219 0.4113 -0.0037 0.0184  -0.0050 194 PRO H O   
3044 C  CB  . PRO B 194 ? 0.3991 0.4184 0.4056 -0.0018 0.0063  -0.0018 194 PRO H CB  
3045 C  CG  . PRO B 194 ? 0.3913 0.4220 0.4022 0.0022  0.0041  -0.0044 194 PRO H CG  
3046 C  CD  . PRO B 194 ? 0.3836 0.4022 0.3932 -0.0011 0.0045  -0.0026 194 PRO H CD  
3047 N  N   . SER B 195 ? 0.4230 0.4481 0.4339 0.0007  0.0074  -0.0047 195 SER H N   
3048 C  CA  . SER B 195 ? 0.4504 0.4693 0.4591 -0.0016 0.0037  -0.0048 195 SER H CA  
3049 C  C   . SER B 195 ? 0.4689 0.4814 0.4732 0.0009  0.0010  -0.0040 195 SER H C   
3050 O  O   . SER B 195 ? 0.4732 0.4816 0.4742 -0.0029 -0.0016 -0.0055 195 SER H O   
3051 C  CB  . SER B 195 ? 0.4488 0.4661 0.4540 0.0021  0.0019  -0.0034 195 SER H CB  
3052 O  OG  . SER B 195 ? 0.4571 0.4858 0.4649 -0.0025 -0.0040 -0.0047 195 SER H OG  
3053 N  N   . SER B 196 ? 0.4860 0.5020 0.4920 -0.0030 0.0008  -0.0034 196 SER H N   
3054 C  CA  . SER B 196 ? 0.5041 0.5149 0.5111 -0.0021 0.0015  -0.0039 196 SER H CA  
3055 C  C   . SER B 196 ? 0.5175 0.5210 0.5205 -0.0020 0.0004  -0.0006 196 SER H C   
3056 O  O   . SER B 196 ? 0.5222 0.5260 0.5240 -0.0052 0.0032  -0.0006 196 SER H O   
3057 C  CB  . SER B 196 ? 0.5057 0.5136 0.5094 -0.0036 0.0042  -0.0017 196 SER H CB  
3058 O  OG  . SER B 196 ? 0.5025 0.5191 0.5171 -0.0050 -0.0008 -0.0037 196 SER H OG  
3059 N  N   . SER B 197 ? 0.5315 0.5310 0.5295 -0.0013 0.0001  -0.0017 197 SER H N   
3060 C  CA  . SER B 197 ? 0.5470 0.5420 0.5436 -0.0016 0.0000  -0.0011 197 SER H CA  
3061 C  C   . SER B 197 ? 0.5492 0.5439 0.5470 -0.0004 0.0022  -0.0011 197 SER H C   
3062 O  O   . SER B 197 ? 0.5494 0.5455 0.5502 0.0011  0.0027  0.0000  197 SER H O   
3063 C  CB  . SER B 197 ? 0.5473 0.5443 0.5414 -0.0023 -0.0007 -0.0008 197 SER H CB  
3064 O  OG  . SER B 197 ? 0.5624 0.5557 0.5629 -0.0032 -0.0031 -0.0061 197 SER H OG  
3065 N  N   . LEU B 198 ? 0.5555 0.5513 0.5534 0.0005  0.0018  -0.0032 198 LEU H N   
3066 C  CA  . LEU B 198 ? 0.5633 0.5584 0.5616 -0.0002 0.0021  -0.0014 198 LEU H CA  
3067 C  C   . LEU B 198 ? 0.5727 0.5665 0.5712 0.0004  0.0017  -0.0013 198 LEU H C   
3068 O  O   . LEU B 198 ? 0.5753 0.5712 0.5704 0.0021  0.0006  0.0005  198 LEU H O   
3069 C  CB  . LEU B 198 ? 0.5603 0.5561 0.5607 0.0004  0.0032  -0.0011 198 LEU H CB  
3070 C  CG  . LEU B 198 ? 0.5546 0.5520 0.5549 -0.0016 0.0007  -0.0014 198 LEU H CG  
3071 C  CD1 . LEU B 198 ? 0.5435 0.5463 0.5511 -0.0001 0.0017  -0.0033 198 LEU H CD1 
3072 C  CD2 . LEU B 198 ? 0.5409 0.5283 0.5455 -0.0004 0.0019  -0.0035 198 LEU H CD2 
3073 N  N   . GLY B 199 ? 0.5792 0.5738 0.5769 -0.0003 0.0028  -0.0016 199 GLY H N   
3074 C  CA  . GLY B 199 ? 0.5839 0.5814 0.5837 0.0015  0.0016  -0.0025 199 GLY H CA  
3075 C  C   . GLY B 199 ? 0.5890 0.5877 0.5885 0.0009  0.0011  -0.0027 199 GLY H C   
3076 O  O   . GLY B 199 ? 0.5899 0.5879 0.5873 0.0005  0.0008  -0.0004 199 GLY H O   
3077 N  N   . THR B 200 ? 0.5932 0.5931 0.5906 0.0014  0.0013  -0.0033 200 THR H N   
3078 C  CA  . THR B 200 ? 0.5902 0.5964 0.5895 0.0029  0.0010  -0.0028 200 THR H CA  
3079 C  C   . THR B 200 ? 0.5855 0.5908 0.5886 0.0047  0.0009  -0.0020 200 THR H C   
3080 O  O   . THR B 200 ? 0.5898 0.5982 0.5914 0.0079  0.0015  -0.0029 200 THR H O   
3081 C  CB  . THR B 200 ? 0.5917 0.6023 0.5932 0.0017  0.0017  -0.0033 200 THR H CB  
3082 O  OG1 . THR B 200 ? 0.6061 0.6158 0.6113 0.0033  0.0019  -0.0051 200 THR H OG1 
3083 C  CG2 . THR B 200 ? 0.5937 0.6117 0.5946 0.0004  0.0021  -0.0041 200 THR H CG2 
3084 N  N   . GLN B 201 ? 0.5754 0.5809 0.5758 0.0036  0.0007  -0.0007 201 GLN H N   
3085 C  CA  . GLN B 201 ? 0.5606 0.5662 0.5663 0.0019  0.0025  -0.0011 201 GLN H CA  
3086 C  C   . GLN B 201 ? 0.5440 0.5474 0.5466 0.0024  0.0024  -0.0015 201 GLN H C   
3087 O  O   . GLN B 201 ? 0.5428 0.5460 0.5430 0.0003  0.0042  -0.0057 201 GLN H O   
3088 C  CB  . GLN B 201 ? 0.5645 0.5684 0.5717 0.0031  0.0008  -0.0014 201 GLN H CB  
3089 C  CG  . GLN B 201 ? 0.5840 0.5904 0.5911 0.0004  0.0017  0.0004  201 GLN H CG  
3090 C  CD  . GLN B 201 ? 0.6012 0.6138 0.6063 0.0055  -0.0057 0.0009  201 GLN H CD  
3091 O  OE1 . GLN B 201 ? 0.6145 0.6255 0.6087 0.0096  -0.0011 0.0011  201 GLN H OE1 
3092 N  NE2 . GLN B 201 ? 0.6046 0.6132 0.6075 0.0022  0.0009  -0.0024 201 GLN H NE2 
3093 N  N   . THR B 202 ? 0.5206 0.5258 0.5301 0.0018  0.0035  -0.0024 202 THR H N   
3094 C  CA  . THR B 202 ? 0.5026 0.5037 0.5080 0.0050  0.0031  -0.0025 202 THR H CA  
3095 C  C   . THR B 202 ? 0.4802 0.4871 0.4898 0.0019  0.0024  -0.0017 202 THR H C   
3096 O  O   . THR B 202 ? 0.4799 0.4873 0.4900 0.0058  0.0021  -0.0039 202 THR H O   
3097 C  CB  . THR B 202 ? 0.5038 0.5057 0.5082 0.0037  0.0022  -0.0005 202 THR H CB  
3098 O  OG1 . THR B 202 ? 0.5153 0.5079 0.5164 0.0072  0.0030  0.0006  202 THR H OG1 
3099 C  CG2 . THR B 202 ? 0.5036 0.5054 0.5116 0.0082  0.0016  0.0011  202 THR H CG2 
3100 N  N   . TYR B 203 ? 0.4549 0.4577 0.4593 0.0020  0.0019  -0.0019 203 TYR H N   
3101 C  CA  . TYR B 203 ? 0.4247 0.4306 0.4331 -0.0003 0.0000  0.0015  203 TYR H CA  
3102 C  C   . TYR B 203 ? 0.4137 0.4221 0.4223 0.0014  0.0001  -0.0010 203 TYR H C   
3103 O  O   . TYR B 203 ? 0.4128 0.4246 0.4213 0.0024  -0.0012 0.0011  203 TYR H O   
3104 C  CB  . TYR B 203 ? 0.4122 0.4184 0.4181 -0.0036 0.0021  0.0021  203 TYR H CB  
3105 C  CG  . TYR B 203 ? 0.3990 0.4134 0.4111 0.0049  -0.0033 -0.0046 203 TYR H CG  
3106 C  CD1 . TYR B 203 ? 0.3818 0.3941 0.3949 -0.0010 -0.0014 -0.0051 203 TYR H CD1 
3107 C  CD2 . TYR B 203 ? 0.3823 0.3919 0.3912 0.0029  -0.0006 0.0004  203 TYR H CD2 
3108 C  CE1 . TYR B 203 ? 0.3742 0.3749 0.3693 0.0055  -0.0015 -0.0038 203 TYR H CE1 
3109 C  CE2 . TYR B 203 ? 0.3853 0.3888 0.3958 0.0033  -0.0023 -0.0047 203 TYR H CE2 
3110 C  CZ  . TYR B 203 ? 0.3892 0.3936 0.3971 0.0129  -0.0083 -0.0036 203 TYR H CZ  
3111 O  OH  . TYR B 203 ? 0.3751 0.3975 0.3844 -0.0029 0.0034  -0.0062 203 TYR H OH  
3112 N  N   . ILE B 204 ? 0.3983 0.4064 0.4091 0.0005  -0.0001 0.0026  204 ILE H N   
3113 C  CA  . ILE B 204 ? 0.3856 0.3927 0.3967 0.0015  -0.0002 0.0022  204 ILE H CA  
3114 C  C   . ILE B 204 ? 0.3776 0.3840 0.3883 -0.0029 -0.0006 0.0041  204 ILE H C   
3115 O  O   . ILE B 204 ? 0.3746 0.3863 0.3910 -0.0054 0.0030  0.0068  204 ILE H O   
3116 C  CB  . ILE B 204 ? 0.3868 0.3974 0.3969 0.0014  -0.0020 0.0033  204 ILE H CB  
3117 C  CG1 . ILE B 204 ? 0.3816 0.3924 0.3915 0.0043  -0.0022 0.0022  204 ILE H CG1 
3118 C  CG2 . ILE B 204 ? 0.3693 0.3900 0.3863 0.0057  -0.0019 0.0039  204 ILE H CG2 
3119 C  CD1 . ILE B 204 ? 0.3899 0.3984 0.3969 0.0040  0.0002  -0.0014 204 ILE H CD1 
3120 N  N   . CYS B 205 ? 0.3671 0.3711 0.3763 -0.0022 -0.0021 0.0028  205 CYS H N   
3121 C  CA  . CYS B 205 ? 0.3568 0.3592 0.3719 -0.0040 -0.0012 0.0024  205 CYS H CA  
3122 C  C   . CYS B 205 ? 0.3560 0.3597 0.3674 -0.0053 0.0000  0.0003  205 CYS H C   
3123 O  O   . CYS B 205 ? 0.3486 0.3480 0.3657 -0.0042 0.0012  -0.0026 205 CYS H O   
3124 C  CB  . CYS B 205 ? 0.3570 0.3546 0.3745 -0.0054 -0.0004 -0.0003 205 CYS H CB  
3125 S  SG  . CYS B 205 ? 0.3567 0.3444 0.3795 -0.0111 0.0034  0.0001  205 CYS H SG  
3126 N  N   . ASN B 206 ? 0.3534 0.3561 0.3600 -0.0050 0.0013  0.0000  206 ASN H N   
3127 C  CA  . ASN B 206 ? 0.3500 0.3501 0.3544 -0.0041 0.0000  0.0026  206 ASN H CA  
3128 C  C   . ASN B 206 ? 0.3503 0.3497 0.3540 -0.0043 0.0006  0.0021  206 ASN H C   
3129 O  O   . ASN B 206 ? 0.3377 0.3484 0.3485 -0.0061 0.0008  0.0052  206 ASN H O   
3130 C  CB  . ASN B 206 ? 0.3501 0.3458 0.3498 -0.0017 0.0003  0.0028  206 ASN H CB  
3131 C  CG  . ASN B 206 ? 0.3495 0.3497 0.3528 -0.0040 -0.0034 0.0033  206 ASN H CG  
3132 O  OD1 . ASN B 206 ? 0.3406 0.3385 0.3283 -0.0074 -0.0019 0.0122  206 ASN H OD1 
3133 N  ND2 . ASN B 206 ? 0.3451 0.3642 0.3684 -0.0018 0.0000  0.0064  206 ASN H ND2 
3134 N  N   . VAL B 207 ? 0.3563 0.3585 0.3613 -0.0017 -0.0013 0.0000  207 VAL H N   
3135 C  CA  . VAL B 207 ? 0.3586 0.3615 0.3653 -0.0010 -0.0027 0.0002  207 VAL H CA  
3136 C  C   . VAL B 207 ? 0.3640 0.3706 0.3706 -0.0019 -0.0029 -0.0013 207 VAL H C   
3137 O  O   . VAL B 207 ? 0.3565 0.3625 0.3627 0.0028  -0.0058 -0.0032 207 VAL H O   
3138 C  CB  . VAL B 207 ? 0.3625 0.3623 0.3657 -0.0015 -0.0023 0.0021  207 VAL H CB  
3139 C  CG1 . VAL B 207 ? 0.3519 0.3515 0.3693 0.0049  -0.0061 0.0045  207 VAL H CG1 
3140 C  CG2 . VAL B 207 ? 0.3600 0.3617 0.3613 -0.0038 -0.0105 -0.0025 207 VAL H CG2 
3141 N  N   . ASN B 208 ? 0.3777 0.3827 0.3788 -0.0029 -0.0033 -0.0036 208 ASN H N   
3142 C  CA  . ASN B 208 ? 0.3920 0.3934 0.3879 -0.0023 -0.0044 -0.0015 208 ASN H CA  
3143 C  C   . ASN B 208 ? 0.3881 0.3860 0.3790 -0.0015 -0.0024 -0.0032 208 ASN H C   
3144 O  O   . ASN B 208 ? 0.3845 0.3832 0.3664 0.0033  -0.0017 -0.0003 208 ASN H O   
3145 C  CB  . ASN B 208 ? 0.4045 0.4088 0.4062 -0.0033 -0.0075 -0.0026 208 ASN H CB  
3146 C  CG  . ASN B 208 ? 0.4358 0.4341 0.4329 -0.0005 -0.0097 0.0038  208 ASN H CG  
3147 O  OD1 . ASN B 208 ? 0.4616 0.4673 0.4970 -0.0088 -0.0054 -0.0048 208 ASN H OD1 
3148 N  ND2 . ASN B 208 ? 0.4605 0.4534 0.4641 -0.0110 -0.0170 -0.0045 208 ASN H ND2 
3149 N  N   . HIS B 209 ? 0.3882 0.3915 0.3796 0.0013  0.0000  -0.0044 209 HIS H N   
3150 C  CA  . HIS B 209 ? 0.3901 0.3879 0.3810 -0.0003 -0.0018 -0.0018 209 HIS H CA  
3151 C  C   . HIS B 209 ? 0.3904 0.3882 0.3813 0.0003  -0.0024 -0.0007 209 HIS H C   
3152 O  O   . HIS B 209 ? 0.3870 0.3873 0.3796 -0.0027 -0.0025 -0.0006 209 HIS H O   
3153 C  CB  . HIS B 209 ? 0.3876 0.3875 0.3788 -0.0011 -0.0008 -0.0007 209 HIS H CB  
3154 C  CG  . HIS B 209 ? 0.3836 0.3795 0.3712 0.0000  -0.0023 -0.0003 209 HIS H CG  
3155 N  ND1 . HIS B 209 ? 0.3950 0.3922 0.3810 0.0046  -0.0013 0.0040  209 HIS H ND1 
3156 C  CD2 . HIS B 209 ? 0.3642 0.3745 0.3476 -0.0025 -0.0041 -0.0015 209 HIS H CD2 
3157 C  CE1 . HIS B 209 ? 0.3665 0.3683 0.3441 -0.0004 -0.0016 0.0044  209 HIS H CE1 
3158 N  NE2 . HIS B 209 ? 0.3475 0.3658 0.3364 -0.0069 -0.0076 -0.0028 209 HIS H NE2 
3159 N  N   . LYS B 210 ? 0.3914 0.3854 0.3829 0.0004  -0.0046 -0.0025 210 LYS H N   
3160 C  CA  . LYS B 210 ? 0.3980 0.3913 0.3848 0.0000  -0.0042 -0.0005 210 LYS H CA  
3161 C  C   . LYS B 210 ? 0.4005 0.3915 0.3822 0.0008  -0.0057 -0.0010 210 LYS H C   
3162 O  O   . LYS B 210 ? 0.4093 0.3958 0.3794 0.0035  -0.0068 0.0022  210 LYS H O   
3163 C  CB  . LYS B 210 ? 0.4029 0.3948 0.3917 0.0005  -0.0048 0.0000  210 LYS H CB  
3164 C  CG  . LYS B 210 ? 0.4107 0.4104 0.4021 0.0007  0.0003  0.0037  210 LYS H CG  
3165 C  CD  . LYS B 210 ? 0.4176 0.4317 0.4290 -0.0048 -0.0051 0.0014  210 LYS H CD  
3166 C  CE  . LYS B 210 ? 0.4446 0.4648 0.4470 0.0008  0.0080  0.0042  210 LYS H CE  
3167 N  NZ  . LYS B 210 ? 0.4511 0.4502 0.4408 0.0068  0.0066  0.0188  210 LYS H NZ  
3168 N  N   . PRO B 211 ? 0.4001 0.3891 0.3808 0.0018  -0.0042 -0.0019 211 PRO H N   
3169 C  CA  . PRO B 211 ? 0.4009 0.3892 0.3832 -0.0017 -0.0028 0.0021  211 PRO H CA  
3170 C  C   . PRO B 211 ? 0.4093 0.3965 0.3898 -0.0015 -0.0001 0.0031  211 PRO H C   
3171 O  O   . PRO B 211 ? 0.4120 0.3946 0.3900 -0.0049 0.0007  0.0099  211 PRO H O   
3172 C  CB  . PRO B 211 ? 0.3945 0.3868 0.3768 -0.0007 -0.0012 0.0018  211 PRO H CB  
3173 C  CG  . PRO B 211 ? 0.3829 0.3812 0.3724 0.0030  -0.0071 0.0020  211 PRO H CG  
3174 C  CD  . PRO B 211 ? 0.3992 0.3858 0.3809 -0.0011 -0.0054 -0.0021 211 PRO H CD  
3175 N  N   . SER B 212 ? 0.4127 0.3998 0.3887 -0.0024 0.0018  0.0044  212 SER H N   
3176 C  CA  . SER B 212 ? 0.4104 0.3967 0.3923 -0.0021 0.0001  0.0037  212 SER H CA  
3177 C  C   . SER B 212 ? 0.4194 0.4072 0.4024 -0.0014 0.0008  0.0054  212 SER H C   
3178 O  O   . SER B 212 ? 0.4232 0.4084 0.4069 0.0027  0.0017  0.0044  212 SER H O   
3179 C  CB  . SER B 212 ? 0.4082 0.3929 0.3919 -0.0026 0.0021  0.0031  212 SER H CB  
3180 O  OG  . SER B 212 ? 0.3738 0.3761 0.3628 -0.0054 -0.0010 -0.0064 212 SER H OG  
3181 N  N   . ASN B 213 ? 0.4236 0.4169 0.4132 -0.0020 -0.0061 0.0056  213 ASN H N   
3182 C  CA  . ASN B 213 ? 0.4327 0.4273 0.4306 0.0004  -0.0030 0.0024  213 ASN H CA  
3183 C  C   . ASN B 213 ? 0.4296 0.4248 0.4310 -0.0011 -0.0063 0.0025  213 ASN H C   
3184 O  O   . ASN B 213 ? 0.4231 0.4166 0.4277 -0.0008 -0.0070 0.0000  213 ASN H O   
3185 C  CB  . ASN B 213 ? 0.4444 0.4334 0.4418 -0.0010 -0.0055 0.0056  213 ASN H CB  
3186 C  CG  . ASN B 213 ? 0.4626 0.4679 0.4748 -0.0017 -0.0023 0.0059  213 ASN H CG  
3187 O  OD1 . ASN B 213 ? 0.4988 0.4984 0.5131 -0.0124 -0.0017 0.0137  213 ASN H OD1 
3188 N  ND2 . ASN B 213 ? 0.4960 0.4852 0.5091 0.0064  -0.0039 0.0053  213 ASN H ND2 
3189 N  N   . THR B 214 ? 0.4282 0.4235 0.4335 -0.0010 -0.0042 0.0011  214 THR H N   
3190 C  CA  . THR B 214 ? 0.4319 0.4247 0.4324 0.0008  -0.0041 0.0025  214 THR H CA  
3191 C  C   . THR B 214 ? 0.4346 0.4268 0.4367 0.0011  -0.0031 0.0016  214 THR H C   
3192 O  O   . THR B 214 ? 0.4345 0.4224 0.4370 -0.0001 -0.0021 0.0004  214 THR H O   
3193 C  CB  . THR B 214 ? 0.4276 0.4277 0.4338 0.0028  -0.0015 0.0009  214 THR H CB  
3194 O  OG1 . THR B 214 ? 0.4292 0.4190 0.4343 0.0011  -0.0071 0.0046  214 THR H OG1 
3195 C  CG2 . THR B 214 ? 0.4212 0.4259 0.4321 0.0064  -0.0052 0.0041  214 THR H CG2 
3196 N  N   . LYS B 215 ? 0.4414 0.4264 0.4398 0.0057  -0.0043 0.0028  215 LYS H N   
3197 C  CA  . LYS B 215 ? 0.4458 0.4348 0.4442 0.0039  -0.0015 0.0023  215 LYS H CA  
3198 C  C   . LYS B 215 ? 0.4469 0.4373 0.4494 0.0051  -0.0023 0.0015  215 LYS H C   
3199 O  O   . LYS B 215 ? 0.4432 0.4369 0.4498 0.0065  -0.0037 0.0037  215 LYS H O   
3200 C  CB  . LYS B 215 ? 0.4526 0.4354 0.4494 0.0047  -0.0021 0.0030  215 LYS H CB  
3201 C  CG  . LYS B 215 ? 0.4773 0.4722 0.4608 0.0022  0.0034  -0.0023 215 LYS H CG  
3202 C  CD  . LYS B 215 ? 0.5001 0.4950 0.4901 0.0080  -0.0008 0.0003  215 LYS H CD  
3203 C  CE  . LYS B 215 ? 0.5238 0.5278 0.5091 -0.0002 -0.0010 0.0014  215 LYS H CE  
3204 N  NZ  . LYS B 215 ? 0.5401 0.5398 0.5177 0.0040  -0.0051 -0.0047 215 LYS H NZ  
3205 N  N   . VAL B 216 ? 0.4463 0.4429 0.4495 0.0042  -0.0029 -0.0004 216 VAL H N   
3206 C  CA  . VAL B 216 ? 0.4474 0.4460 0.4505 0.0041  -0.0015 -0.0013 216 VAL H CA  
3207 C  C   . VAL B 216 ? 0.4456 0.4445 0.4520 0.0034  -0.0014 -0.0012 216 VAL H C   
3208 O  O   . VAL B 216 ? 0.4428 0.4404 0.4520 0.0061  -0.0038 -0.0062 216 VAL H O   
3209 C  CB  . VAL B 216 ? 0.4511 0.4503 0.4514 0.0034  -0.0013 -0.0011 216 VAL H CB  
3210 C  CG1 . VAL B 216 ? 0.4488 0.4523 0.4494 0.0023  -0.0036 -0.0043 216 VAL H CG1 
3211 C  CG2 . VAL B 216 ? 0.4512 0.4532 0.4530 0.0011  0.0001  0.0012  216 VAL H CG2 
3212 N  N   . ASP B 217 ? 0.4457 0.4434 0.4523 0.0037  -0.0007 -0.0010 217 ASP H N   
3213 C  CA  . ASP B 217 ? 0.4469 0.4442 0.4530 0.0023  -0.0008 -0.0007 217 ASP H CA  
3214 C  C   . ASP B 217 ? 0.4506 0.4465 0.4543 0.0024  -0.0005 -0.0017 217 ASP H C   
3215 O  O   . ASP B 217 ? 0.4506 0.4461 0.4556 0.0060  -0.0030 0.0017  217 ASP H O   
3216 C  CB  . ASP B 217 ? 0.4453 0.4384 0.4520 0.0007  0.0001  -0.0004 217 ASP H CB  
3217 C  CG  . ASP B 217 ? 0.4396 0.4351 0.4507 0.0008  -0.0021 0.0001  217 ASP H CG  
3218 O  OD1 . ASP B 217 ? 0.4324 0.4272 0.4433 -0.0075 -0.0073 -0.0015 217 ASP H OD1 
3219 O  OD2 . ASP B 217 ? 0.4448 0.4440 0.4650 0.0029  -0.0126 -0.0033 217 ASP H OD2 
3220 N  N   . LYS B 218 ? 0.4573 0.4516 0.4609 0.0020  0.0010  -0.0029 218 LYS H N   
3221 C  CA  . LYS B 218 ? 0.4666 0.4611 0.4687 0.0015  -0.0009 -0.0024 218 LYS H CA  
3222 C  C   . LYS B 218 ? 0.4662 0.4646 0.4711 0.0005  0.0000  -0.0026 218 LYS H C   
3223 O  O   . LYS B 218 ? 0.4622 0.4609 0.4670 0.0035  -0.0009 -0.0052 218 LYS H O   
3224 C  CB  . LYS B 218 ? 0.4688 0.4629 0.4727 0.0000  0.0019  -0.0041 218 LYS H CB  
3225 C  CG  . LYS B 218 ? 0.4854 0.4878 0.4854 0.0002  -0.0003 0.0000  218 LYS H CG  
3226 C  CD  . LYS B 218 ? 0.5291 0.5104 0.5317 -0.0049 0.0010  -0.0048 218 LYS H CD  
3227 C  CE  . LYS B 218 ? 0.5502 0.5298 0.5382 -0.0075 0.0056  0.0003  218 LYS H CE  
3228 N  NZ  . LYS B 218 ? 0.5752 0.5523 0.5693 -0.0015 0.0012  0.0011  218 LYS H NZ  
3229 N  N   . LYS B 219 ? 0.4714 0.4685 0.4803 0.0023  0.0009  -0.0037 219 LYS H N   
3230 C  CA  . LYS B 219 ? 0.4866 0.4835 0.4890 0.0020  0.0022  -0.0030 219 LYS H CA  
3231 C  C   . LYS B 219 ? 0.4839 0.4819 0.4888 0.0043  0.0039  -0.0033 219 LYS H C   
3232 O  O   . LYS B 219 ? 0.4870 0.4829 0.4875 0.0065  0.0041  -0.0021 219 LYS H O   
3233 C  CB  . LYS B 219 ? 0.4838 0.4823 0.4913 0.0019  0.0011  -0.0019 219 LYS H CB  
3234 C  CG  . LYS B 219 ? 0.4927 0.4920 0.4993 0.0021  0.0034  -0.0004 219 LYS H CG  
3235 C  CD  . LYS B 219 ? 0.5068 0.5013 0.5086 0.0037  0.0048  -0.0021 219 LYS H CD  
3236 C  CE  . LYS B 219 ? 0.5415 0.5515 0.5746 0.0074  -0.0087 -0.0032 219 LYS H CE  
3237 N  NZ  . LYS B 219 ? 0.5635 0.5385 0.5152 -0.0032 0.0066  0.0117  219 LYS H NZ  
3238 N  N   . VAL B 220 ? 0.4904 0.4867 0.4938 0.0026  0.0051  -0.0018 220 VAL H N   
3239 C  CA  . VAL B 220 ? 0.4952 0.4920 0.5005 0.0015  0.0010  -0.0028 220 VAL H CA  
3240 C  C   . VAL B 220 ? 0.5104 0.5062 0.5108 0.0026  0.0017  -0.0021 220 VAL H C   
3241 O  O   . VAL B 220 ? 0.5071 0.5019 0.5066 0.0030  0.0010  -0.0030 220 VAL H O   
3242 C  CB  . VAL B 220 ? 0.4887 0.4903 0.4972 0.0002  0.0017  -0.0024 220 VAL H CB  
3243 C  CG1 . VAL B 220 ? 0.4819 0.4795 0.4997 0.0041  0.0055  -0.0002 220 VAL H CG1 
3244 C  CG2 . VAL B 220 ? 0.4724 0.4621 0.4861 -0.0014 -0.0021 -0.0078 220 VAL H CG2 
3245 N  N   . GLU B 221 ? 0.5308 0.5232 0.5269 0.0026  -0.0007 -0.0020 221 GLU H N   
3246 C  CA  . GLU B 221 ? 0.5502 0.5435 0.5428 0.0016  0.0000  -0.0030 221 GLU H CA  
3247 C  C   . GLU B 221 ? 0.5579 0.5524 0.5504 0.0010  -0.0009 -0.0055 221 GLU H C   
3248 O  O   . GLU B 221 ? 0.5585 0.5564 0.5542 0.0022  -0.0006 -0.0070 221 GLU H O   
3249 C  CB  . GLU B 221 ? 0.5536 0.5458 0.5440 0.0028  0.0008  -0.0043 221 GLU H CB  
3250 C  CG  . GLU B 221 ? 0.5761 0.5775 0.5777 0.0011  -0.0027 -0.0013 221 GLU H CG  
3251 C  CD  . GLU B 221 ? 0.5630 0.5867 0.6208 0.0005  -0.0029 -0.0068 221 GLU H CD  
3252 O  OE1 . GLU B 221 ? 0.6225 0.6053 0.6290 -0.0042 -0.0056 -0.0049 221 GLU H OE1 
3253 O  OE2 . GLU B 221 ? 0.6227 0.6138 0.6395 0.0033  0.0016  -0.0005 221 GLU H OE2 
3254 N  N   . PRO B 222 ? 0.5671 0.5606 0.5574 0.0005  -0.0004 -0.0037 222 PRO H N   
3255 C  CA  . PRO B 222 ? 0.5714 0.5686 0.5607 0.0013  -0.0021 -0.0023 222 PRO H CA  
3256 C  C   . PRO B 222 ? 0.5764 0.5728 0.5629 0.0030  -0.0041 -0.0046 222 PRO H C   
3257 O  O   . PRO B 222 ? 0.5801 0.5694 0.5618 0.0050  -0.0055 -0.0066 222 PRO H O   
3258 C  CB  . PRO B 222 ? 0.5732 0.5742 0.5626 0.0020  -0.0029 -0.0027 222 PRO H CB  
3259 C  CG  . PRO B 222 ? 0.5687 0.5680 0.5634 0.0001  -0.0009 -0.0016 222 PRO H CG  
3260 C  CD  . PRO B 222 ? 0.5661 0.5600 0.5563 0.0007  -0.0002 -0.0057 222 PRO H CD  
3261 O  OXT . PRO B 222 ? 0.5818 0.5813 0.5664 0.0047  -0.0027 -0.0055 222 PRO H OXT 
3262 ZN ZN  . ZN  C .   ? 0.3614 0.3200 0.3949 -0.0034 0.0110  -0.0017 212 ZN  L ZN  
3263 ZN ZN  . ZN  D .   ? 0.3410 0.4418 0.3159 -0.0487 0.0104  0.0017  213 ZN  L ZN  
3264 ZN ZN  . ZN  E .   ? 0.4064 0.4807 0.4260 -0.0157 0.0473  -0.0041 214 ZN  L ZN  
3265 O  O   . HOH F .   ? 0.2104 0.2378 0.2425 0.0181  0.0228  0.0067  215 HOH L O   
3266 O  O   . HOH F .   ? 0.2485 0.2638 0.2792 0.0119  0.0008  0.0129  216 HOH L O   
3267 O  O   . HOH F .   ? 0.2789 0.2816 0.2257 -0.0382 0.0104  0.0044  217 HOH L O   
3268 O  O   . HOH F .   ? 0.2766 0.2988 0.2940 0.0273  0.0097  -0.0013 218 HOH L O   
3269 O  O   . HOH F .   ? 0.2578 0.2051 0.2788 -0.0113 0.0208  0.0455  219 HOH L O   
3270 O  O   . HOH F .   ? 0.2985 0.2336 0.2771 0.0130  -0.0006 -0.0039 220 HOH L O   
3271 O  O   . HOH F .   ? 0.1885 0.2802 0.2463 0.0156  -0.0142 0.0068  221 HOH L O   
3272 O  O   . HOH F .   ? 0.3359 0.2730 0.2868 -0.0076 -0.0194 0.0185  222 HOH L O   
3273 O  O   . HOH F .   ? 0.3262 0.3381 0.3544 -0.0086 0.0030  -0.0030 223 HOH L O   
3274 O  O   . HOH F .   ? 0.1826 0.1960 0.2246 -0.0181 0.0094  0.0047  224 HOH L O   
3275 O  O   . HOH F .   ? 0.3387 0.3336 0.3763 0.0050  -0.0057 0.0133  225 HOH L O   
3276 O  O   . HOH F .   ? 0.3485 0.3342 0.3341 -0.0015 0.0008  -0.0142 226 HOH L O   
3277 O  O   . HOH F .   ? 0.3362 0.3389 0.3000 -0.0132 0.0011  0.0035  227 HOH L O   
3278 O  O   . HOH F .   ? 0.1743 0.2054 0.2329 0.0065  0.0138  -0.0099 228 HOH L O   
3279 O  O   . HOH F .   ? 0.2297 0.2167 0.2330 -0.0411 0.0118  0.0128  229 HOH L O   
3280 O  O   . HOH F .   ? 0.3732 0.2879 0.3412 0.0004  -0.0216 -0.0301 230 HOH L O   
3281 O  O   . HOH F .   ? 0.2980 0.2550 0.2588 -0.0142 0.0143  0.0022  231 HOH L O   
3282 O  O   . HOH F .   ? 0.1980 0.2663 0.2453 0.0132  -0.0187 -0.0067 232 HOH L O   
3283 O  O   . HOH F .   ? 0.3570 0.3380 0.3053 0.0013  -0.0034 -0.0009 233 HOH L O   
3284 O  O   . HOH F .   ? 0.2841 0.2795 0.2665 -0.0016 -0.0052 0.0196  234 HOH L O   
3285 O  O   . HOH F .   ? 0.4015 0.3859 0.4220 0.0146  0.0190  0.0017  235 HOH L O   
3286 O  O   . HOH F .   ? 0.3367 0.3110 0.2412 -0.0075 -0.0156 -0.0030 236 HOH L O   
3287 O  O   . HOH F .   ? 0.4262 0.3819 0.4103 -0.0152 -0.0060 0.0094  237 HOH L O   
3288 O  O   . HOH F .   ? 0.3397 0.2746 0.2879 0.0082  0.0168  -0.0346 238 HOH L O   
3289 O  O   . HOH F .   ? 0.3838 0.3372 0.3340 0.0095  0.0168  0.0024  239 HOH L O   
3290 O  O   . HOH F .   ? 0.3726 0.3682 0.3442 0.0283  -0.0022 -0.0114 240 HOH L O   
3291 O  O   . HOH F .   ? 0.3122 0.3717 0.3675 -0.0241 0.0120  0.0059  241 HOH L O   
3292 O  O   . HOH F .   ? 0.3643 0.3335 0.3393 -0.0021 -0.0114 0.0176  242 HOH L O   
3293 O  O   . HOH F .   ? 0.4617 0.4412 0.4713 0.0051  -0.0117 -0.0024 243 HOH L O   
3294 O  O   . HOH F .   ? 0.3479 0.3988 0.3609 -0.0288 -0.0058 0.0152  244 HOH L O   
3295 O  O   . HOH F .   ? 0.3436 0.3450 0.3181 0.0150  -0.0128 0.0118  245 HOH L O   
3296 O  O   . HOH F .   ? 0.3343 0.3246 0.3012 0.0035  0.0107  -0.0254 246 HOH L O   
3297 O  O   . HOH F .   ? 0.4297 0.4122 0.3768 -0.0049 0.0201  -0.0065 247 HOH L O   
3298 O  O   . HOH F .   ? 0.3748 0.3719 0.3595 0.0177  0.0000  -0.0067 248 HOH L O   
3299 O  O   . HOH F .   ? 0.4339 0.4265 0.4649 0.0197  -0.0046 0.0246  249 HOH L O   
3300 O  O   . HOH F .   ? 0.3592 0.3493 0.2552 0.0589  0.0419  -0.0326 250 HOH L O   
3301 O  O   . HOH F .   ? 0.4713 0.3925 0.4463 -0.0084 -0.0099 0.0000  251 HOH L O   
3302 O  O   . HOH F .   ? 0.3550 0.3411 0.3246 0.0019  0.0016  -0.0146 252 HOH L O   
3303 O  O   . HOH F .   ? 0.3628 0.3819 0.3057 -0.0256 -0.0116 0.0043  253 HOH L O   
3304 O  O   . HOH F .   ? 0.4049 0.3389 0.3830 0.0037  0.0120  -0.0172 254 HOH L O   
3305 O  O   . HOH F .   ? 0.3789 0.4091 0.4031 0.0097  0.0231  -0.0054 255 HOH L O   
3306 O  O   . HOH F .   ? 0.2327 0.2154 0.1979 -0.0232 -0.0212 -0.0129 256 HOH L O   
3307 O  O   . HOH F .   ? 0.2359 0.2369 0.2383 0.0061  0.0122  -0.0027 257 HOH L O   
3308 O  O   . HOH F .   ? 0.4335 0.4261 0.4037 0.0273  -0.0013 -0.0004 258 HOH L O   
3309 O  O   . HOH F .   ? 0.3714 0.4050 0.3465 0.0011  0.0177  -0.0051 259 HOH L O   
3310 O  O   . HOH F .   ? 0.2417 0.2332 0.2795 0.0088  -0.0098 0.0080  260 HOH L O   
3311 O  O   . HOH F .   ? 0.2537 0.2513 0.2741 -0.0335 0.0126  -0.0244 261 HOH L O   
3312 O  O   . HOH F .   ? 0.3000 0.2627 0.2268 0.0118  -0.0322 0.0236  262 HOH L O   
3313 O  O   . HOH F .   ? 0.3825 0.3764 0.3763 -0.0053 0.0061  0.0132  263 HOH L O   
3314 O  O   . HOH F .   ? 0.3660 0.3670 0.4204 0.0076  -0.0081 -0.0004 264 HOH L O   
3315 O  O   . HOH F .   ? 0.4605 0.4871 0.4584 -0.0181 -0.0173 -0.0012 265 HOH L O   
3316 O  O   . HOH F .   ? 0.3140 0.3154 0.3079 0.0175  0.0007  -0.0055 266 HOH L O   
3317 O  O   . HOH F .   ? 0.3015 0.2960 0.3305 0.0089  0.0042  0.0002  267 HOH L O   
3318 O  O   . HOH F .   ? 0.3364 0.3197 0.3631 -0.0026 0.0081  0.0154  268 HOH L O   
3319 O  O   . HOH F .   ? 0.2769 0.3434 0.3125 -0.0181 0.0163  -0.0041 269 HOH L O   
3320 O  O   . HOH F .   ? 0.3863 0.3931 0.3786 -0.0085 -0.0066 -0.0417 270 HOH L O   
3321 O  O   . HOH F .   ? 0.3433 0.2920 0.3066 -0.0210 -0.0120 0.0181  271 HOH L O   
3322 O  O   . HOH F .   ? 0.3552 0.3791 0.3426 0.0045  0.0148  -0.0181 272 HOH L O   
3323 O  O   . HOH F .   ? 0.3778 0.3191 0.3530 0.0123  0.0226  -0.0080 273 HOH L O   
3324 O  O   . HOH F .   ? 0.2755 0.2592 0.2933 -0.0128 -0.0150 -0.0051 274 HOH L O   
3325 O  O   . HOH F .   ? 0.4355 0.4112 0.3814 0.0180  -0.0039 0.0022  275 HOH L O   
3326 O  O   . HOH F .   ? 0.5521 0.5752 0.5671 -0.0167 -0.0004 -0.0191 276 HOH L O   
3327 O  O   . HOH F .   ? 0.2880 0.3541 0.3540 0.0201  -0.0068 0.0035  277 HOH L O   
3328 O  O   . HOH F .   ? 0.5551 0.5447 0.5770 -0.0008 -0.0083 -0.0044 278 HOH L O   
3329 O  O   . HOH F .   ? 0.2655 0.3073 0.1558 -0.0146 0.0225  -0.0156 279 HOH L O   
3330 O  O   . HOH F .   ? 0.2269 0.2123 0.2453 -0.0057 0.0052  0.0150  280 HOH L O   
3331 O  O   . HOH F .   ? 0.3418 0.3567 0.3532 0.0209  -0.0120 -0.0103 281 HOH L O   
3332 O  O   . HOH F .   ? 0.4326 0.3983 0.3991 -0.0024 0.0053  0.0025  282 HOH L O   
3333 O  O   . HOH F .   ? 0.3942 0.4126 0.3689 0.0102  -0.0038 -0.0249 283 HOH L O   
3334 O  O   . HOH F .   ? 0.5278 0.4981 0.5071 -0.0166 -0.0099 -0.0069 284 HOH L O   
3335 O  O   . HOH F .   ? 0.3917 0.3644 0.3480 -0.0031 -0.0233 -0.0184 285 HOH L O   
3336 O  O   . HOH F .   ? 0.3394 0.3412 0.3018 0.0147  0.0039  -0.0070 286 HOH L O   
3337 O  O   . HOH F .   ? 0.4046 0.4897 0.4357 0.0131  0.0003  -0.0076 287 HOH L O   
3338 O  O   . HOH F .   ? 0.5615 0.5337 0.5854 -0.0119 -0.0046 -0.0146 288 HOH L O   
3339 O  O   . HOH F .   ? 0.3789 0.3283 0.3070 -0.0213 0.0160  0.0065  289 HOH L O   
3340 O  O   . HOH F .   ? 0.4114 0.3847 0.3786 -0.0029 -0.0080 0.0289  290 HOH L O   
3341 O  O   . HOH F .   ? 0.4437 0.4688 0.4637 0.0121  0.0017  0.0184  291 HOH L O   
3342 O  O   . HOH F .   ? 0.4239 0.4024 0.3799 -0.0026 0.0111  0.0161  292 HOH L O   
3343 O  O   . HOH F .   ? 0.3412 0.3645 0.3523 0.0009  -0.0010 -0.0280 293 HOH L O   
3344 O  O   . HOH F .   ? 0.2881 0.3069 0.2461 0.0001  0.0137  0.0085  294 HOH L O   
3345 O  O   . HOH F .   ? 0.4875 0.4424 0.4906 0.0081  0.0031  -0.0119 295 HOH L O   
3346 O  O   . HOH F .   ? 0.2876 0.2994 0.3156 0.0285  0.0245  0.0049  296 HOH L O   
3347 O  O   . HOH F .   ? 0.5086 0.4966 0.5004 0.0037  0.0081  0.0203  297 HOH L O   
3348 O  O   . HOH F .   ? 0.3694 0.2659 0.3092 0.0192  -0.0102 0.0256  298 HOH L O   
3349 O  O   . HOH F .   ? 0.3566 0.3843 0.3993 -0.0048 0.0040  -0.0003 299 HOH L O   
3350 O  O   . HOH F .   ? 0.3741 0.4127 0.2869 -0.0144 -0.0083 -0.0111 300 HOH L O   
3351 O  O   . HOH F .   ? 0.6672 0.6634 0.6212 0.0000  -0.0066 0.0034  301 HOH L O   
3352 O  O   . HOH F .   ? 0.3229 0.2912 0.3249 -0.0202 0.0009  -0.0213 302 HOH L O   
3353 O  O   . HOH F .   ? 0.5308 0.5084 0.5499 -0.0169 -0.0108 0.0031  303 HOH L O   
3354 O  O   . HOH F .   ? 0.3645 0.3568 0.3752 0.0062  0.0021  -0.0050 304 HOH L O   
3355 O  O   . HOH F .   ? 0.3936 0.4308 0.3803 -0.0029 -0.0100 -0.0271 305 HOH L O   
3356 O  O   . HOH F .   ? 0.4522 0.4632 0.4423 0.0066  -0.0045 0.0058  306 HOH L O   
3357 O  O   . HOH F .   ? 0.3180 0.2518 0.2808 -0.0121 0.0218  -0.0070 307 HOH L O   
3358 O  O   . HOH F .   ? 0.3601 0.4015 0.3766 -0.0188 -0.0053 -0.0111 308 HOH L O   
3359 O  O   . HOH F .   ? 0.4417 0.4952 0.4351 -0.0124 -0.0062 0.0007  309 HOH L O   
3360 O  O   . HOH F .   ? 0.4893 0.4938 0.5217 0.0005  0.0134  0.0016  310 HOH L O   
3361 O  O   . HOH F .   ? 0.4929 0.4661 0.4493 -0.0063 0.0089  0.0044  311 HOH L O   
3362 O  O   . HOH F .   ? 0.4780 0.4621 0.4875 -0.0168 -0.0083 -0.0115 312 HOH L O   
3363 O  O   . HOH F .   ? 0.4183 0.3901 0.3864 0.0141  -0.0095 -0.0119 313 HOH L O   
3364 O  O   . HOH F .   ? 0.3421 0.2945 0.3386 -0.0125 0.0101  0.0050  314 HOH L O   
3365 O  O   . HOH F .   ? 0.3832 0.3446 0.3757 0.0059  0.0020  -0.0069 315 HOH L O   
3366 O  O   . HOH F .   ? 0.4097 0.4712 0.3865 0.0028  0.0351  0.0046  316 HOH L O   
3367 O  O   . HOH F .   ? 0.3833 0.3769 0.3327 -0.0110 -0.0016 0.0394  317 HOH L O   
3368 O  O   . HOH F .   ? 0.4922 0.4937 0.4674 -0.0142 0.0139  0.0151  318 HOH L O   
3369 O  O   . HOH F .   ? 0.3786 0.3805 0.3555 0.0119  -0.0055 0.0170  319 HOH L O   
3370 O  O   . HOH F .   ? 0.5817 0.5999 0.6184 0.0056  0.0036  0.0049  320 HOH L O   
3371 O  O   . HOH F .   ? 0.4691 0.4829 0.4519 -0.0160 0.0078  -0.0068 321 HOH L O   
3372 O  O   . HOH F .   ? 0.4250 0.3696 0.3469 0.0198  -0.0041 0.0059  322 HOH L O   
3373 O  O   . HOH F .   ? 0.3378 0.3511 0.3635 -0.0070 -0.0061 0.0198  323 HOH L O   
3374 O  O   . HOH F .   ? 0.5565 0.4993 0.5062 0.0007  0.0125  0.0022  324 HOH L O   
3375 O  O   . HOH F .   ? 0.4227 0.4501 0.4393 -0.0141 -0.0191 -0.0076 325 HOH L O   
3376 O  O   . HOH F .   ? 0.3281 0.3188 0.3008 -0.0275 0.0144  0.0033  326 HOH L O   
3377 O  O   . HOH F .   ? 0.4190 0.4170 0.4368 -0.0008 -0.0123 0.0043  327 HOH L O   
3378 O  O   . HOH F .   ? 0.4671 0.4388 0.4593 0.0146  -0.0165 -0.0038 328 HOH L O   
3379 O  O   . HOH F .   ? 0.3360 0.3746 0.2874 -0.0092 -0.0017 -0.0248 329 HOH L O   
3380 O  O   . HOH F .   ? 0.4453 0.4741 0.4300 0.0168  0.0042  -0.0206 330 HOH L O   
3381 O  O   . HOH F .   ? 0.4308 0.4207 0.4722 0.0010  0.0099  0.0015  331 HOH L O   
3382 O  O   . HOH F .   ? 0.3964 0.4489 0.4249 0.0203  0.0000  -0.0131 332 HOH L O   
3383 O  O   . HOH F .   ? 0.4717 0.4486 0.4546 0.0296  0.0087  0.0029  333 HOH L O   
3384 O  O   . HOH F .   ? 0.5149 0.5337 0.4916 0.0058  0.0054  -0.0139 334 HOH L O   
3385 O  O   . HOH F .   ? 0.5026 0.5405 0.5618 0.0002  0.0065  -0.0017 335 HOH L O   
3386 O  O   . HOH F .   ? 0.5025 0.5225 0.5471 -0.0065 0.0132  -0.0100 336 HOH L O   
3387 O  O   . HOH F .   ? 0.4271 0.4673 0.4550 -0.0180 0.0121  -0.0059 337 HOH L O   
3388 O  O   . HOH G .   ? 0.3057 0.3470 0.3436 -0.0011 -0.0116 -0.0039 223 HOH H O   
3389 O  O   . HOH G .   ? 0.3254 0.2867 0.2537 0.0123  0.0006  0.0018  224 HOH H O   
3390 O  O   . HOH G .   ? 0.3412 0.3954 0.3752 -0.0041 -0.0163 -0.0008 225 HOH H O   
3391 O  O   . HOH G .   ? 0.3749 0.3814 0.4043 -0.0136 -0.0001 0.0094  226 HOH H O   
3392 O  O   . HOH G .   ? 0.3616 0.3892 0.3008 0.0048  -0.0246 -0.0015 227 HOH H O   
3393 O  O   . HOH G .   ? 0.2905 0.3576 0.2906 -0.0011 -0.0075 0.0116  228 HOH H O   
3394 O  O   . HOH G .   ? 0.4124 0.3684 0.3989 -0.0145 -0.0153 0.0063  229 HOH H O   
3395 O  O   . HOH G .   ? 0.4031 0.4345 0.3887 0.0086  0.0069  -0.0266 230 HOH H O   
3396 O  O   . HOH G .   ? 0.2928 0.2380 0.2087 0.0223  -0.0076 0.0089  231 HOH H O   
3397 O  O   . HOH G .   ? 0.3203 0.3312 0.3178 0.0100  0.0071  0.0029  232 HOH H O   
3398 O  O   . HOH G .   ? 0.3932 0.2990 0.3625 0.0013  -0.0073 0.0040  233 HOH H O   
3399 O  O   . HOH G .   ? 0.3764 0.3792 0.3588 0.0202  0.0015  -0.0033 234 HOH H O   
3400 O  O   . HOH G .   ? 0.4018 0.4298 0.4408 -0.0203 -0.0014 0.0068  235 HOH H O   
3401 O  O   . HOH G .   ? 0.4165 0.4599 0.4078 -0.0111 -0.0194 0.0062  236 HOH H O   
3402 O  O   . HOH G .   ? 0.4546 0.4067 0.4204 0.0003  -0.0063 0.0155  237 HOH H O   
3403 O  O   . HOH G .   ? 0.3193 0.3064 0.2943 -0.0066 -0.0201 -0.0100 238 HOH H O   
3404 O  O   . HOH G .   ? 0.4161 0.3641 0.3832 0.0170  -0.0120 0.0171  239 HOH H O   
3405 O  O   . HOH G .   ? 0.4700 0.4300 0.4290 -0.0075 -0.0019 -0.0153 240 HOH H O   
3406 O  O   . HOH G .   ? 0.2969 0.2825 0.3293 0.0120  0.0132  0.0190  241 HOH H O   
3407 O  O   . HOH G .   ? 0.4154 0.3703 0.3879 -0.0222 0.0099  0.0254  242 HOH H O   
3408 O  O   . HOH G .   ? 0.3392 0.3793 0.3262 0.0149  -0.0082 -0.0086 243 HOH H O   
3409 O  O   . HOH G .   ? 0.3198 0.3060 0.3318 -0.0070 -0.0160 -0.0317 244 HOH H O   
3410 O  O   . HOH G .   ? 0.3954 0.4112 0.4155 -0.0163 -0.0070 -0.0186 245 HOH H O   
3411 O  O   . HOH G .   ? 0.3302 0.2759 0.3477 -0.0136 0.0053  -0.0137 246 HOH H O   
3412 O  O   . HOH G .   ? 0.2944 0.3228 0.3427 0.0067  0.0138  0.0302  247 HOH H O   
3413 O  O   . HOH G .   ? 0.3866 0.4224 0.3777 0.0102  -0.0217 0.0245  248 HOH H O   
3414 O  O   . HOH G .   ? 0.3852 0.3834 0.4386 -0.0132 -0.0166 -0.0053 249 HOH H O   
3415 O  O   . HOH G .   ? 0.3107 0.3000 0.2781 0.0041  0.0538  0.0042  250 HOH H O   
3416 O  O   . HOH G .   ? 0.3228 0.3208 0.3456 0.0281  0.0012  -0.0128 251 HOH H O   
3417 O  O   . HOH G .   ? 0.4152 0.4197 0.3954 0.0323  -0.0137 -0.0010 252 HOH H O   
3418 O  O   . HOH G .   ? 0.3480 0.4065 0.4031 -0.0257 -0.0072 -0.0009 253 HOH H O   
3419 O  O   . HOH G .   ? 0.3152 0.3702 0.3328 -0.0156 0.0041  -0.0177 254 HOH H O   
3420 O  O   . HOH G .   ? 0.3582 0.3172 0.3713 0.0067  0.0144  -0.0063 255 HOH H O   
3421 O  O   . HOH G .   ? 0.4611 0.4750 0.4834 -0.0120 -0.0017 -0.0002 256 HOH H O   
3422 O  O   . HOH G .   ? 0.3302 0.3751 0.3752 -0.0098 -0.0230 0.0079  257 HOH H O   
3423 O  O   . HOH G .   ? 0.4311 0.4342 0.4357 -0.0065 -0.0103 -0.0149 258 HOH H O   
3424 O  O   . HOH G .   ? 0.4088 0.3403 0.3635 -0.0137 -0.0096 -0.0040 259 HOH H O   
3425 O  O   . HOH G .   ? 0.3141 0.3059 0.3418 0.0140  0.0113  -0.0124 260 HOH H O   
3426 O  O   . HOH G .   ? 0.4108 0.3650 0.3620 0.0060  0.0180  0.0017  261 HOH H O   
3427 O  O   . HOH G .   ? 0.4032 0.3892 0.4095 -0.0035 0.0019  -0.0017 262 HOH H O   
3428 O  O   . HOH G .   ? 0.3978 0.4205 0.4180 -0.0101 -0.0004 -0.0042 263 HOH H O   
3429 O  O   . HOH G .   ? 0.3672 0.3780 0.3420 0.0010  0.0160  0.0051  264 HOH H O   
3430 O  O   . HOH G .   ? 0.3816 0.4210 0.4157 -0.0092 0.0134  0.0138  265 HOH H O   
3431 O  O   . HOH G .   ? 0.4294 0.3879 0.4219 -0.0231 -0.0185 0.0027  266 HOH H O   
3432 O  O   . HOH G .   ? 0.3280 0.3867 0.4142 0.0163  -0.0146 -0.0098 267 HOH H O   
3433 O  O   . HOH G .   ? 0.5086 0.4821 0.5130 0.0064  -0.0243 0.0157  268 HOH H O   
3434 O  O   . HOH G .   ? 0.4357 0.4473 0.4718 -0.0061 0.0099  -0.0098 269 HOH H O   
3435 O  O   . HOH G .   ? 0.4539 0.4305 0.4064 0.0126  -0.0278 -0.0080 270 HOH H O   
3436 O  O   . HOH G .   ? 0.3943 0.3402 0.3411 -0.0223 -0.0118 0.0156  271 HOH H O   
3437 O  O   . HOH G .   ? 0.4092 0.3279 0.3608 -0.0108 -0.0005 0.0451  272 HOH H O   
3438 O  O   . HOH G .   ? 0.3878 0.4006 0.3781 -0.0024 -0.0046 -0.0099 273 HOH H O   
3439 O  O   . HOH G .   ? 0.5496 0.5867 0.5923 0.0011  -0.0025 0.0162  274 HOH H O   
3440 O  O   . HOH G .   ? 0.3761 0.4472 0.3765 0.0167  0.0097  0.0018  275 HOH H O   
3441 O  O   . HOH G .   ? 0.4911 0.4749 0.5021 0.0139  -0.0064 -0.0224 276 HOH H O   
3442 O  O   . HOH G .   ? 0.4017 0.4218 0.4658 -0.0094 0.0082  -0.0051 277 HOH H O   
3443 O  O   . HOH G .   ? 0.3614 0.3446 0.3641 0.0064  0.0025  -0.0018 278 HOH H O   
3444 O  O   . HOH G .   ? 0.3893 0.4304 0.3722 -0.0085 -0.0229 0.0163  279 HOH H O   
3445 O  O   . HOH G .   ? 0.4157 0.4617 0.4289 0.0076  -0.0109 -0.0063 280 HOH H O   
3446 O  O   . HOH G .   ? 0.3978 0.3642 0.3680 -0.0022 -0.0055 0.0037  281 HOH H O   
3447 O  O   . HOH G .   ? 0.4456 0.4744 0.4323 -0.0166 -0.0046 -0.0171 282 HOH H O   
3448 O  O   . HOH G .   ? 0.3557 0.3700 0.4029 -0.0200 -0.0035 0.0000  283 HOH H O   
3449 O  O   . HOH G .   ? 0.5422 0.5701 0.5454 0.0073  -0.0012 0.0026  284 HOH H O   
3450 O  O   . HOH G .   ? 0.4401 0.4534 0.4820 -0.0057 0.0008  -0.0038 285 HOH H O   
3451 O  O   . HOH G .   ? 0.5066 0.5023 0.5387 -0.0030 -0.0019 -0.0026 286 HOH H O   
3452 O  O   . HOH G .   ? 0.4479 0.4581 0.4292 -0.0142 0.0002  0.0135  287 HOH H O   
3453 O  O   . HOH G .   ? 0.3571 0.3722 0.3622 -0.0140 -0.0225 -0.0047 288 HOH H O   
3454 O  O   . HOH G .   ? 0.3131 0.2958 0.2657 -0.0033 -0.0059 -0.0194 289 HOH H O   
3455 O  O   . HOH G .   ? 0.4354 0.4417 0.4872 -0.0076 0.0037  -0.0241 290 HOH H O   
3456 O  O   . HOH G .   ? 0.2833 0.2891 0.3005 -0.0104 -0.0171 -0.0002 291 HOH H O   
3457 O  O   . HOH G .   ? 0.5034 0.5202 0.4956 0.0096  -0.0093 0.0144  292 HOH H O   
3458 O  O   . HOH G .   ? 0.4092 0.3874 0.4248 -0.0180 -0.0046 0.0013  293 HOH H O   
3459 O  O   . HOH G .   ? 0.4532 0.4627 0.4410 0.0082  0.0015  -0.0059 294 HOH H O   
3460 O  O   . HOH G .   ? 0.3638 0.3929 0.3946 0.0026  -0.0138 0.0316  295 HOH H O   
3461 O  O   . HOH G .   ? 0.4310 0.4517 0.4636 0.0094  -0.0049 -0.0039 296 HOH H O   
3462 O  O   . HOH G .   ? 0.5016 0.5333 0.5395 0.0061  -0.0046 0.0157  297 HOH H O   
3463 O  O   . HOH G .   ? 0.3163 0.2758 0.3172 -0.0297 0.0159  0.0047  298 HOH H O   
3464 O  O   . HOH G .   ? 0.4693 0.4572 0.4596 -0.0078 -0.0006 -0.0180 299 HOH H O   
3465 O  O   . HOH G .   ? 0.5634 0.5389 0.5601 -0.0117 -0.0048 -0.0004 300 HOH H O   
3466 O  O   . HOH G .   ? 0.4243 0.4238 0.4559 0.0029  0.0065  -0.0136 301 HOH H O   
3467 O  O   . HOH G .   ? 0.4617 0.3911 0.4642 0.0028  0.0170  -0.0053 302 HOH H O   
3468 O  O   . HOH G .   ? 0.5463 0.4944 0.5049 0.0001  0.0055  -0.0006 303 HOH H O   
3469 O  O   . HOH G .   ? 0.5332 0.4886 0.4936 -0.0104 0.0126  -0.0102 304 HOH H O   
3470 O  O   . HOH G .   ? 0.4730 0.4808 0.4699 0.0018  -0.0106 0.0041  305 HOH H O   
3471 O  O   . HOH G .   ? 0.3888 0.4180 0.4540 0.0056  0.0072  0.0017  306 HOH H O   
3472 O  O   . HOH G .   ? 0.5026 0.4807 0.4811 0.0099  -0.0206 -0.0047 307 HOH H O   
3473 O  O   . HOH G .   ? 0.5316 0.5307 0.5424 0.0031  0.0160  0.0140  308 HOH H O   
3474 O  O   . HOH G .   ? 0.4311 0.4549 0.4402 0.0096  0.0146  -0.0176 309 HOH H O   
3475 O  O   . HOH G .   ? 0.4670 0.4430 0.4189 0.0143  0.0049  -0.0052 310 HOH H O   
3476 O  O   . HOH G .   ? 0.4816 0.5080 0.4855 0.0052  0.0067  -0.0090 311 HOH H O   
3477 O  O   . HOH G .   ? 0.3302 0.3637 0.3789 0.0000  0.0049  -0.0009 312 HOH H O   
3478 O  O   . HOH G .   ? 0.5127 0.5045 0.4549 0.0104  -0.0130 -0.0129 313 HOH H O   
3479 O  O   . HOH G .   ? 0.3855 0.3962 0.4366 -0.0008 -0.0030 0.0039  314 HOH H O   
3480 O  O   . HOH G .   ? 0.3966 0.3881 0.3948 -0.0002 -0.0297 -0.0055 315 HOH H O   
3481 O  O   . HOH G .   ? 0.5797 0.5806 0.5642 0.0118  -0.0058 0.0011  316 HOH H O   
3482 O  O   . HOH G .   ? 0.4928 0.4777 0.5026 -0.0032 0.0059  -0.0065 317 HOH H O   
3483 O  O   . HOH G .   ? 0.4707 0.5005 0.4862 0.0037  0.0061  0.0069  318 HOH H O   
3484 O  O   . HOH G .   ? 0.4247 0.4618 0.4427 -0.0055 0.0126  -0.0001 319 HOH H O   
3485 O  O   . HOH G .   ? 0.3833 0.3559 0.3597 -0.0391 -0.0214 -0.0191 320 HOH H O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   VAL 3   3   3   VAL VAL L . n 
A 1 4   LEU 4   4   4   LEU LEU L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   ALA 9   9   9   ALA ALA L . n 
A 1 10  THR 10  10  10  THR THR L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  SER 12  12  12  SER SER L . n 
A 1 13  LEU 13  13  13  LEU LEU L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  PRO 15  15  15  PRO PRO L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  GLU 17  17  17  GLU GLU L . n 
A 1 18  ARG 18  18  18  ARG ARG L . n 
A 1 19  ALA 19  19  19  ALA ALA L . n 
A 1 20  THR 20  20  20  THR THR L . n 
A 1 21  LEU 21  21  21  LEU LEU L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  ARG 24  24  24  ARG ARG L . n 
A 1 25  ALA 25  25  25  ALA ALA L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  SER 28  28  28  SER SER L . n 
A 1 29  VAL 29  29  29  VAL VAL L . n 
A 1 30  SER 30  30  30  SER SER L . n 
A 1 31  SER 31  31  31  SER SER L . n 
A 1 32  TYR 32  32  32  TYR TYR L . n 
A 1 33  LEU 33  33  33  LEU LEU L . n 
A 1 34  ALA 34  34  34  ALA ALA L . n 
A 1 35  TRP 35  35  35  TRP TRP L . n 
A 1 36  TYR 36  36  36  TYR TYR L . n 
A 1 37  GLN 37  37  37  GLN GLN L . n 
A 1 38  GLN 38  38  38  GLN GLN L . n 
A 1 39  LYS 39  39  39  LYS LYS L . n 
A 1 40  PRO 40  40  40  PRO PRO L . n 
A 1 41  GLY 41  41  41  GLY GLY L . n 
A 1 42  GLN 42  42  42  GLN GLN L . n 
A 1 43  ALA 43  43  43  ALA ALA L . n 
A 1 44  PRO 44  44  44  PRO PRO L . n 
A 1 45  ARG 45  45  45  ARG ARG L . n 
A 1 46  LEU 46  46  46  LEU LEU L . n 
A 1 47  LEU 47  47  47  LEU LEU L . n 
A 1 48  ILE 48  48  48  ILE ILE L . n 
A 1 49  TYR 49  49  49  TYR TYR L . n 
A 1 50  ASP 50  50  50  ASP ASP L . n 
A 1 51  ALA 51  51  51  ALA ALA L . n 
A 1 52  SER 52  52  52  SER SER L . n 
A 1 53  ASN 53  53  53  ASN ASN L . n 
A 1 54  ARG 54  54  54  ARG ARG L . n 
A 1 55  ALA 55  55  55  ALA ALA L . n 
A 1 56  THR 56  56  56  THR THR L . n 
A 1 57  GLY 57  57  57  GLY GLY L . n 
A 1 58  ILE 58  58  58  ILE ILE L . n 
A 1 59  PRO 59  59  59  PRO PRO L . n 
A 1 60  ALA 60  60  60  ALA ALA L . n 
A 1 61  ARG 61  61  61  ARG ARG L . n 
A 1 62  PHE 62  62  62  PHE PHE L . n 
A 1 63  SER 63  63  63  SER SER L . n 
A 1 64  GLY 64  64  64  GLY GLY L . n 
A 1 65  SER 65  65  65  SER SER L . n 
A 1 66  GLY 66  66  66  GLY GLY L . n 
A 1 67  SER 67  67  67  SER SER L . n 
A 1 68  GLY 68  68  68  GLY GLY L . n 
A 1 69  THR 69  69  69  THR THR L . n 
A 1 70  ASP 70  70  70  ASP ASP L . n 
A 1 71  PHE 71  71  71  PHE PHE L . n 
A 1 72  THR 72  72  72  THR THR L . n 
A 1 73  LEU 73  73  73  LEU LEU L . n 
A 1 74  THR 74  74  74  THR THR L . n 
A 1 75  ILE 75  75  75  ILE ILE L . n 
A 1 76  SER 76  76  76  SER SER L . n 
A 1 77  SER 77  77  77  SER SER L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  GLU 79  79  79  GLU GLU L . n 
A 1 80  PRO 80  80  80  PRO PRO L . n 
A 1 81  GLU 81  81  81  GLU GLU L . n 
A 1 82  ASP 82  82  82  ASP ASP L . n 
A 1 83  PHE 83  83  83  PHE PHE L . n 
A 1 84  ALA 84  84  84  ALA ALA L . n 
A 1 85  VAL 85  85  85  VAL VAL L . n 
A 1 86  TYR 86  86  86  TYR TYR L . n 
A 1 87  TYR 87  87  87  TYR TYR L . n 
A 1 88  CYS 88  88  88  CYS CYS L . n 
A 1 89  GLN 89  89  89  GLN GLN L . n 
A 1 90  GLN 90  90  90  GLN GLN L . n 
A 1 91  ARG 91  91  91  ARG ARG L . n 
A 1 92  SER 92  92  92  SER SER L . n 
A 1 93  ASN 93  93  93  ASN ASN L . n 
A 1 94  TRP 94  94  94  TRP TRP L . n 
A 1 95  PRO 95  95  95  PRO PRO L . n 
A 1 96  ILE 96  96  96  ILE ILE L . n 
A 1 97  THR 97  97  97  THR THR L . n 
A 1 98  PHE 98  98  98  PHE PHE L . n 
A 1 99  GLY 99  99  99  GLY GLY L . n 
A 1 100 GLN 100 100 100 GLN GLN L . n 
A 1 101 GLY 101 101 101 GLY GLY L . n 
A 1 102 THR 102 102 102 THR THR L . n 
A 1 103 ARG 103 103 103 ARG ARG L . n 
A 1 104 LEU 104 104 104 LEU LEU L . n 
A 1 105 GLU 105 105 105 GLU GLU L . n 
A 1 106 ILE 106 106 106 ILE ILE L . n 
A 1 107 LYS 107 107 107 LYS LYS L . n 
A 1 108 ARG 108 108 108 ARG ARG L . n 
A 1 109 THR 109 109 109 THR THR L . n 
A 1 110 VAL 110 110 110 VAL VAL L . n 
A 1 111 ALA 111 111 111 ALA ALA L . n 
A 1 112 ALA 112 112 112 ALA ALA L . n 
A 1 113 PRO 113 113 113 PRO PRO L . n 
A 1 114 SER 114 114 114 SER SER L . n 
A 1 115 VAL 115 115 115 VAL VAL L . n 
A 1 116 PHE 116 116 116 PHE PHE L . n 
A 1 117 ILE 117 117 117 ILE ILE L . n 
A 1 118 PHE 118 118 118 PHE PHE L . n 
A 1 119 PRO 119 119 119 PRO PRO L . n 
A 1 120 PRO 120 120 120 PRO PRO L . n 
A 1 121 SER 121 121 121 SER SER L . n 
A 1 122 ASP 122 122 122 ASP ASP L . n 
A 1 123 GLU 123 123 123 GLU GLU L . n 
A 1 124 GLN 124 124 124 GLN GLN L . n 
A 1 125 LEU 125 125 125 LEU LEU L . n 
A 1 126 LYS 126 126 126 LYS LYS L . n 
A 1 127 SER 127 127 127 SER SER L . n 
A 1 128 GLY 128 128 128 GLY GLY L . n 
A 1 129 THR 129 129 129 THR THR L . n 
A 1 130 ALA 130 130 130 ALA ALA L . n 
A 1 131 SER 131 131 131 SER SER L . n 
A 1 132 VAL 132 132 132 VAL VAL L . n 
A 1 133 VAL 133 133 133 VAL VAL L . n 
A 1 134 CYS 134 134 134 CYS CYS L . n 
A 1 135 LEU 135 135 135 LEU LEU L . n 
A 1 136 LEU 136 136 136 LEU LEU L . n 
A 1 137 ASN 137 137 137 ASN ASN L . n 
A 1 138 ASN 138 138 138 ASN ASN L . n 
A 1 139 PHE 139 139 139 PHE PHE L . n 
A 1 140 TYR 140 140 140 TYR TYR L . n 
A 1 141 PRO 141 141 141 PRO PRO L . n 
A 1 142 ARG 142 142 142 ARG ARG L . n 
A 1 143 GLU 143 143 143 GLU GLU L . n 
A 1 144 ALA 144 144 144 ALA ALA L . n 
A 1 145 LYS 145 145 145 LYS LYS L . n 
A 1 146 VAL 146 146 146 VAL VAL L . n 
A 1 147 GLN 147 147 147 GLN GLN L . n 
A 1 148 TRP 148 148 148 TRP TRP L . n 
A 1 149 LYS 149 149 149 LYS LYS L . n 
A 1 150 VAL 150 150 150 VAL VAL L . n 
A 1 151 ASP 151 151 151 ASP ASP L . n 
A 1 152 ASN 152 152 152 ASN ASN L . n 
A 1 153 ALA 153 153 153 ALA ALA L . n 
A 1 154 LEU 154 154 154 LEU LEU L . n 
A 1 155 GLN 155 155 155 GLN GLN L . n 
A 1 156 SER 156 156 156 SER SER L . n 
A 1 157 GLY 157 157 157 GLY GLY L . n 
A 1 158 ASN 158 158 158 ASN ASN L . n 
A 1 159 SER 159 159 159 SER SER L . n 
A 1 160 GLN 160 160 160 GLN GLN L . n 
A 1 161 GLU 161 161 161 GLU GLU L . n 
A 1 162 SER 162 162 162 SER SER L . n 
A 1 163 VAL 163 163 163 VAL VAL L . n 
A 1 164 THR 164 164 164 THR THR L . n 
A 1 165 GLU 165 165 165 GLU GLU L . n 
A 1 166 GLN 166 166 166 GLN GLN L . n 
A 1 167 ASP 167 167 167 ASP ASP L . n 
A 1 168 SER 168 168 168 SER SER L . n 
A 1 169 LYS 169 169 169 LYS LYS L . n 
A 1 170 ASP 170 170 170 ASP ASP L . n 
A 1 171 SER 171 171 171 SER SER L . n 
A 1 172 THR 172 172 172 THR THR L . n 
A 1 173 TYR 173 173 173 TYR TYR L . n 
A 1 174 SER 174 174 174 SER SER L . n 
A 1 175 LEU 175 175 175 LEU LEU L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 SER 177 177 177 SER SER L . n 
A 1 178 THR 178 178 178 THR THR L . n 
A 1 179 LEU 179 179 179 LEU LEU L . n 
A 1 180 THR 180 180 180 THR THR L . n 
A 1 181 LEU 181 181 181 LEU LEU L . n 
A 1 182 SER 182 182 182 SER SER L . n 
A 1 183 LYS 183 183 183 LYS LYS L . n 
A 1 184 ALA 184 184 184 ALA ALA L . n 
A 1 185 ASP 185 185 185 ASP ASP L . n 
A 1 186 TYR 186 186 186 TYR TYR L . n 
A 1 187 GLU 187 187 187 GLU GLU L . n 
A 1 188 LYS 188 188 188 LYS LYS L . n 
A 1 189 HIS 189 189 189 HIS HIS L . n 
A 1 190 LYS 190 190 190 LYS LYS L . n 
A 1 191 VAL 191 191 191 VAL VAL L . n 
A 1 192 TYR 192 192 192 TYR TYR L . n 
A 1 193 ALA 193 193 193 ALA ALA L . n 
A 1 194 CYS 194 194 194 CYS CYS L . n 
A 1 195 GLU 195 195 195 GLU GLU L . n 
A 1 196 VAL 196 196 196 VAL VAL L . n 
A 1 197 THR 197 197 197 THR THR L . n 
A 1 198 HIS 198 198 198 HIS HIS L . n 
A 1 199 GLN 199 199 199 GLN GLN L . n 
A 1 200 GLY 200 200 200 GLY GLY L . n 
A 1 201 LEU 201 201 201 LEU LEU L . n 
A 1 202 SER 202 202 202 SER SER L . n 
A 1 203 SER 203 203 203 SER SER L . n 
A 1 204 PRO 204 204 204 PRO PRO L . n 
A 1 205 VAL 205 205 205 VAL VAL L . n 
A 1 206 THR 206 206 206 THR THR L . n 
A 1 207 LYS 207 207 207 LYS LYS L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PHE 209 209 209 PHE PHE L . n 
A 1 210 ASN 210 210 210 ASN ASN L . n 
A 1 211 ARG 211 211 211 ARG ARG L . n 
B 2 1   GLU 1   1   1   GLU GLU H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   VAL 5   5   5   VAL VAL H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   GLY 9   9   9   GLY GLY H . n 
B 2 10  GLY 10  10  10  GLY GLY H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  GLN 13  13  13  GLN GLN H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  ARG 16  16  16  ARG ARG H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  LEU 18  18  18  LEU LEU H . n 
B 2 19  ARG 19  19  19  ARG ARG H . n 
B 2 20  LEU 20  20  20  LEU LEU H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  ALA 23  23  23  ALA ALA H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  PHE 27  27  27  PHE PHE H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  ASN 30  30  30  ASN ASN H . n 
B 2 31  ASP 31  31  31  ASP ASP H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  ALA 33  33  33  ALA ALA H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  HIS 35  35  35  HIS HIS H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  ARG 38  38  38  ARG ARG H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ALA 40  40  40  ALA ALA H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  VAL 48  48  48  VAL VAL H . n 
B 2 49  SER 49  49  49  SER SER H . n 
B 2 50  THR 50  50  50  THR THR H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  SER 52  52  52  SER SER H . n 
B 2 53  TRP 53  53  53  TRP TRP H . n 
B 2 54  ASN 54  54  54  ASN ASN H . n 
B 2 55  SER 55  55  55  SER SER H . n 
B 2 56  GLY 56  56  56  GLY GLY H . n 
B 2 57  SER 57  57  57  SER SER H . n 
B 2 58  ILE 58  58  58  ILE ILE H . n 
B 2 59  GLY 59  59  59  GLY GLY H . n 
B 2 60  TYR 60  60  60  TYR TYR H . n 
B 2 61  ALA 61  61  61  ALA ALA H . n 
B 2 62  ASP 62  62  62  ASP ASP H . n 
B 2 63  SER 63  63  63  SER SER H . n 
B 2 64  VAL 64  64  64  VAL VAL H . n 
B 2 65  LYS 65  65  65  LYS LYS H . n 
B 2 66  GLY 66  66  66  GLY GLY H . n 
B 2 67  ARG 67  67  67  ARG ARG H . n 
B 2 68  PHE 68  68  68  PHE PHE H . n 
B 2 69  THR 69  69  69  THR THR H . n 
B 2 70  ILE 70  70  70  ILE ILE H . n 
B 2 71  SER 71  71  71  SER SER H . n 
B 2 72  ARG 72  72  72  ARG ARG H . n 
B 2 73  ASP 73  73  73  ASP ASP H . n 
B 2 74  ASN 74  74  74  ASN ASN H . n 
B 2 75  ALA 75  75  75  ALA ALA H . n 
B 2 76  LYS 76  76  76  LYS LYS H . n 
B 2 77  LYS 77  77  77  LYS LYS H . n 
B 2 78  SER 78  78  78  SER SER H . n 
B 2 79  LEU 79  79  79  LEU LEU H . n 
B 2 80  TYR 80  80  80  TYR TYR H . n 
B 2 81  LEU 81  81  81  LEU LEU H . n 
B 2 82  GLN 82  82  82  GLN GLN H . n 
B 2 83  MET 83  83  83  MET MET H . n 
B 2 84  ASN 84  84  84  ASN ASN H . n 
B 2 85  SER 85  85  85  SER SER H . n 
B 2 86  LEU 86  86  86  LEU LEU H . n 
B 2 87  ARG 87  87  87  ARG ARG H . n 
B 2 88  ALA 88  88  88  ALA ALA H . n 
B 2 89  GLU 89  89  89  GLU GLU H . n 
B 2 90  ASP 90  90  90  ASP ASP H . n 
B 2 91  THR 91  91  91  THR THR H . n 
B 2 92  ALA 92  92  92  ALA ALA H . n 
B 2 93  LEU 93  93  93  LEU LEU H . n 
B 2 94  TYR 94  94  94  TYR TYR H . n 
B 2 95  TYR 95  95  95  TYR TYR H . n 
B 2 96  CYS 96  96  96  CYS CYS H . n 
B 2 97  ALA 97  97  97  ALA ALA H . n 
B 2 98  LYS 98  98  98  LYS LYS H . n 
B 2 99  ASP 99  99  99  ASP ASP H . n 
B 2 100 ILE 100 100 100 ILE ILE H . n 
B 2 101 GLN 101 101 101 GLN GLN H . n 
B 2 102 TYR 102 102 102 TYR TYR H . n 
B 2 103 GLY 103 103 103 GLY GLY H . n 
B 2 104 ASN 104 104 104 ASN ASN H . n 
B 2 105 TYR 105 105 105 TYR TYR H . n 
B 2 106 TYR 106 106 106 TYR TYR H . n 
B 2 107 TYR 107 107 107 TYR TYR H . n 
B 2 108 GLY 108 108 108 GLY GLY H . n 
B 2 109 MET 109 109 109 MET MET H . n 
B 2 110 ASP 110 110 110 ASP ASP H . n 
B 2 111 VAL 111 111 111 VAL VAL H . n 
B 2 112 TRP 112 112 112 TRP TRP H . n 
B 2 113 GLY 113 113 113 GLY GLY H . n 
B 2 114 GLN 114 114 114 GLN GLN H . n 
B 2 115 GLY 115 115 115 GLY GLY H . n 
B 2 116 THR 116 116 116 THR THR H . n 
B 2 117 THR 117 117 117 THR THR H . n 
B 2 118 VAL 118 118 118 VAL VAL H . n 
B 2 119 THR 119 119 119 THR THR H . n 
B 2 120 VAL 120 120 120 VAL VAL H . n 
B 2 121 SER 121 121 121 SER SER H . n 
B 2 122 SER 122 122 122 SER SER H . n 
B 2 123 ALA 123 123 123 ALA ALA H . n 
B 2 124 SER 124 124 124 SER SER H . n 
B 2 125 THR 125 125 125 THR THR H . n 
B 2 126 LYS 126 126 126 LYS LYS H . n 
B 2 127 GLY 127 127 127 GLY GLY H . n 
B 2 128 PRO 128 128 128 PRO PRO H . n 
B 2 129 SER 129 129 129 SER SER H . n 
B 2 130 VAL 130 130 130 VAL VAL H . n 
B 2 131 PHE 131 131 131 PHE PHE H . n 
B 2 132 PRO 132 132 132 PRO PRO H . n 
B 2 133 LEU 133 133 133 LEU LEU H . n 
B 2 134 ALA 134 134 134 ALA ALA H . n 
B 2 135 PRO 135 135 135 PRO PRO H . n 
B 2 136 GLY 136 136 136 GLY GLY H . n 
B 2 137 SER 137 137 ?   ?   ?   H . n 
B 2 138 SER 138 138 ?   ?   ?   H . n 
B 2 139 LYS 139 139 ?   ?   ?   H . n 
B 2 140 SER 140 140 ?   ?   ?   H . n 
B 2 141 THR 141 141 ?   ?   ?   H . n 
B 2 142 SER 142 142 ?   ?   ?   H . n 
B 2 143 GLY 143 143 143 GLY GLY H . n 
B 2 144 THR 144 144 144 THR THR H . n 
B 2 145 ALA 145 145 145 ALA ALA H . n 
B 2 146 ALA 146 146 146 ALA ALA H . n 
B 2 147 LEU 147 147 147 LEU LEU H . n 
B 2 148 GLY 148 148 148 GLY GLY H . n 
B 2 149 CYS 149 149 149 CYS CYS H . n 
B 2 150 LEU 150 150 150 LEU LEU H . n 
B 2 151 VAL 151 151 151 VAL VAL H . n 
B 2 152 LYS 152 152 152 LYS LYS H . n 
B 2 153 ASP 153 153 153 ASP ASP H . n 
B 2 154 TYR 154 154 154 TYR TYR H . n 
B 2 155 PHE 155 155 155 PHE PHE H . n 
B 2 156 PRO 156 156 156 PRO PRO H . n 
B 2 157 GLU 157 157 157 GLU GLU H . n 
B 2 158 PRO 158 158 158 PRO PRO H . n 
B 2 159 VAL 159 159 159 VAL VAL H . n 
B 2 160 THR 160 160 160 THR THR H . n 
B 2 161 VAL 161 161 161 VAL VAL H . n 
B 2 162 SER 162 162 162 SER SER H . n 
B 2 163 TRP 163 163 163 TRP TRP H . n 
B 2 164 ASN 164 164 164 ASN ASN H . n 
B 2 165 SER 165 165 165 SER SER H . n 
B 2 166 GLY 166 166 166 GLY GLY H . n 
B 2 167 ALA 167 167 167 ALA ALA H . n 
B 2 168 LEU 168 168 168 LEU LEU H . n 
B 2 169 THR 169 169 169 THR THR H . n 
B 2 170 SER 170 170 170 SER SER H . n 
B 2 171 GLY 171 171 171 GLY GLY H . n 
B 2 172 VAL 172 172 172 VAL VAL H . n 
B 2 173 HIS 173 173 173 HIS HIS H . n 
B 2 174 THR 174 174 174 THR THR H . n 
B 2 175 PHE 175 175 175 PHE PHE H . n 
B 2 176 PRO 176 176 176 PRO PRO H . n 
B 2 177 ALA 177 177 177 ALA ALA H . n 
B 2 178 VAL 178 178 178 VAL VAL H . n 
B 2 179 LEU 179 179 179 LEU LEU H . n 
B 2 180 GLN 180 180 180 GLN GLN H . n 
B 2 181 SER 181 181 181 SER SER H . n 
B 2 182 SER 182 182 182 SER SER H . n 
B 2 183 GLY 183 183 183 GLY GLY H . n 
B 2 184 LEU 184 184 184 LEU LEU H . n 
B 2 185 TYR 185 185 185 TYR TYR H . n 
B 2 186 SER 186 186 186 SER SER H . n 
B 2 187 LEU 187 187 187 LEU LEU H . n 
B 2 188 SER 188 188 188 SER SER H . n 
B 2 189 SER 189 189 189 SER SER H . n 
B 2 190 VAL 190 190 190 VAL VAL H . n 
B 2 191 VAL 191 191 191 VAL VAL H . n 
B 2 192 THR 192 192 192 THR THR H . n 
B 2 193 VAL 193 193 193 VAL VAL H . n 
B 2 194 PRO 194 194 194 PRO PRO H . n 
B 2 195 SER 195 195 195 SER SER H . n 
B 2 196 SER 196 196 196 SER SER H . n 
B 2 197 SER 197 197 197 SER SER H . n 
B 2 198 LEU 198 198 198 LEU LEU H . n 
B 2 199 GLY 199 199 199 GLY GLY H . n 
B 2 200 THR 200 200 200 THR THR H . n 
B 2 201 GLN 201 201 201 GLN GLN H . n 
B 2 202 THR 202 202 202 THR THR H . n 
B 2 203 TYR 203 203 203 TYR TYR H . n 
B 2 204 ILE 204 204 204 ILE ILE H . n 
B 2 205 CYS 205 205 205 CYS CYS H . n 
B 2 206 ASN 206 206 206 ASN ASN H . n 
B 2 207 VAL 207 207 207 VAL VAL H . n 
B 2 208 ASN 208 208 208 ASN ASN H . n 
B 2 209 HIS 209 209 209 HIS HIS H . n 
B 2 210 LYS 210 210 210 LYS LYS H . n 
B 2 211 PRO 211 211 211 PRO PRO H . n 
B 2 212 SER 212 212 212 SER SER H . n 
B 2 213 ASN 213 213 213 ASN ASN H . n 
B 2 214 THR 214 214 214 THR THR H . n 
B 2 215 LYS 215 215 215 LYS LYS H . n 
B 2 216 VAL 216 216 216 VAL VAL H . n 
B 2 217 ASP 217 217 217 ASP ASP H . n 
B 2 218 LYS 218 218 218 LYS LYS H . n 
B 2 219 LYS 219 219 219 LYS LYS H . n 
B 2 220 VAL 220 220 220 VAL VAL H . n 
B 2 221 GLU 221 221 221 GLU GLU H . n 
B 2 222 PRO 222 222 222 PRO PRO H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3470  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  19490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 L ZN  212 ? C ZN  . 
2 1 H HOH 312 ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 N   ? A GLU 1   ? L GLU 1   ? 1_555 ZN ? E ZN . ? L ZN 214 ? 1_555 O   ? A GLU 1   ? L GLU 1   ? 1_555 77.3  ? 
2 ND2 ? A ASN 137 ? L ASN 137 ? 1_555 ZN ? D ZN . ? L ZN 213 ? 1_555 OD1 ? A ASN 138 ? L ASN 138 ? 1_555 89.4  ? 
3 ND2 ? A ASN 137 ? L ASN 137 ? 1_555 ZN ? D ZN . ? L ZN 213 ? 1_555 NE2 ? B HIS 173 ? H HIS 173 ? 1_555 106.8 ? 
4 OD1 ? A ASN 138 ? L ASN 138 ? 1_555 ZN ? D ZN . ? L ZN 213 ? 1_555 NE2 ? B HIS 173 ? H HIS 173 ? 1_555 90.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' .        ? 1 
PHASER       phasing           .        ? 2 
REFMAC       refinement        5.2.0019 ? 3 
CrystalClear 'data reduction'  .        ? 4 
CrystalClear 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER L 30  ? ? 64.23   -121.01 
2 1 ALA L 51  ? ? 63.12   -38.32  
3 1 ALA L 84  ? ? -171.71 -178.17 
4 1 SER H 85  ? ? 38.92   66.40   
5 1 ASP H 153 ? ? 66.64   60.97   
6 1 THR H 169 ? ? -134.90 -35.47  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H SER 137 ? B SER 137 
2 1 Y 1 H SER 138 ? B SER 138 
3 1 Y 1 H LYS 139 ? B LYS 139 
4 1 Y 1 H SER 140 ? B SER 140 
5 1 Y 1 H THR 141 ? B THR 141 
6 1 Y 1 H SER 142 ? B SER 142 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1   212 1   ZN  ZN  L . 
D 3 ZN  1   213 2   ZN  ZN  L . 
E 3 ZN  1   214 3   ZN  ZN  L . 
F 4 HOH 1   215 1   HOH HOH L . 
F 4 HOH 2   216 2   HOH HOH L . 
F 4 HOH 3   217 3   HOH HOH L . 
F 4 HOH 4   218 4   HOH HOH L . 
F 4 HOH 5   219 5   HOH HOH L . 
F 4 HOH 6   220 6   HOH HOH L . 
F 4 HOH 7   221 7   HOH HOH L . 
F 4 HOH 8   222 9   HOH HOH L . 
F 4 HOH 9   223 10  HOH HOH L . 
F 4 HOH 10  224 12  HOH HOH L . 
F 4 HOH 11  225 13  HOH HOH L . 
F 4 HOH 12  226 17  HOH HOH L . 
F 4 HOH 13  227 18  HOH HOH L . 
F 4 HOH 14  228 20  HOH HOH L . 
F 4 HOH 15  229 22  HOH HOH L . 
F 4 HOH 16  230 23  HOH HOH L . 
F 4 HOH 17  231 24  HOH HOH L . 
F 4 HOH 18  232 26  HOH HOH L . 
F 4 HOH 19  233 27  HOH HOH L . 
F 4 HOH 20  234 28  HOH HOH L . 
F 4 HOH 21  235 30  HOH HOH L . 
F 4 HOH 22  236 32  HOH HOH L . 
F 4 HOH 23  237 33  HOH HOH L . 
F 4 HOH 24  238 36  HOH HOH L . 
F 4 HOH 25  239 38  HOH HOH L . 
F 4 HOH 26  240 39  HOH HOH L . 
F 4 HOH 27  241 41  HOH HOH L . 
F 4 HOH 28  242 43  HOH HOH L . 
F 4 HOH 29  243 48  HOH HOH L . 
F 4 HOH 30  244 52  HOH HOH L . 
F 4 HOH 31  245 54  HOH HOH L . 
F 4 HOH 32  246 56  HOH HOH L . 
F 4 HOH 33  247 57  HOH HOH L . 
F 4 HOH 34  248 59  HOH HOH L . 
F 4 HOH 35  249 62  HOH HOH L . 
F 4 HOH 36  250 63  HOH HOH L . 
F 4 HOH 37  251 64  HOH HOH L . 
F 4 HOH 38  252 66  HOH HOH L . 
F 4 HOH 39  253 67  HOH HOH L . 
F 4 HOH 40  254 70  HOH HOH L . 
F 4 HOH 41  255 71  HOH HOH L . 
F 4 HOH 42  256 72  HOH HOH L . 
F 4 HOH 43  257 74  HOH HOH L . 
F 4 HOH 44  258 75  HOH HOH L . 
F 4 HOH 45  259 80  HOH HOH L . 
F 4 HOH 46  260 83  HOH HOH L . 
F 4 HOH 47  261 84  HOH HOH L . 
F 4 HOH 48  262 85  HOH HOH L . 
F 4 HOH 49  263 86  HOH HOH L . 
F 4 HOH 50  264 87  HOH HOH L . 
F 4 HOH 51  265 88  HOH HOH L . 
F 4 HOH 52  266 89  HOH HOH L . 
F 4 HOH 53  267 92  HOH HOH L . 
F 4 HOH 54  268 94  HOH HOH L . 
F 4 HOH 55  269 95  HOH HOH L . 
F 4 HOH 56  270 96  HOH HOH L . 
F 4 HOH 57  271 100 HOH HOH L . 
F 4 HOH 58  272 102 HOH HOH L . 
F 4 HOH 59  273 103 HOH HOH L . 
F 4 HOH 60  274 105 HOH HOH L . 
F 4 HOH 61  275 107 HOH HOH L . 
F 4 HOH 62  276 108 HOH HOH L . 
F 4 HOH 63  277 110 HOH HOH L . 
F 4 HOH 64  278 111 HOH HOH L . 
F 4 HOH 65  279 112 HOH HOH L . 
F 4 HOH 66  280 113 HOH HOH L . 
F 4 HOH 67  281 114 HOH HOH L . 
F 4 HOH 68  282 116 HOH HOH L . 
F 4 HOH 69  283 117 HOH HOH L . 
F 4 HOH 70  284 119 HOH HOH L . 
F 4 HOH 71  285 121 HOH HOH L . 
F 4 HOH 72  286 122 HOH HOH L . 
F 4 HOH 73  287 123 HOH HOH L . 
F 4 HOH 74  288 124 HOH HOH L . 
F 4 HOH 75  289 126 HOH HOH L . 
F 4 HOH 76  290 132 HOH HOH L . 
F 4 HOH 77  291 133 HOH HOH L . 
F 4 HOH 78  292 134 HOH HOH L . 
F 4 HOH 79  293 135 HOH HOH L . 
F 4 HOH 80  294 136 HOH HOH L . 
F 4 HOH 81  295 137 HOH HOH L . 
F 4 HOH 82  296 138 HOH HOH L . 
F 4 HOH 83  297 140 HOH HOH L . 
F 4 HOH 84  298 141 HOH HOH L . 
F 4 HOH 85  299 142 HOH HOH L . 
F 4 HOH 86  300 143 HOH HOH L . 
F 4 HOH 87  301 145 HOH HOH L . 
F 4 HOH 88  302 146 HOH HOH L . 
F 4 HOH 89  303 148 HOH HOH L . 
F 4 HOH 90  304 149 HOH HOH L . 
F 4 HOH 91  305 153 HOH HOH L . 
F 4 HOH 92  306 154 HOH HOH L . 
F 4 HOH 93  307 158 HOH HOH L . 
F 4 HOH 94  308 163 HOH HOH L . 
F 4 HOH 95  309 165 HOH HOH L . 
F 4 HOH 96  310 167 HOH HOH L . 
F 4 HOH 97  311 170 HOH HOH L . 
F 4 HOH 98  312 171 HOH HOH L . 
F 4 HOH 99  313 172 HOH HOH L . 
F 4 HOH 100 314 176 HOH HOH L . 
F 4 HOH 101 315 178 HOH HOH L . 
F 4 HOH 102 316 180 HOH HOH L . 
F 4 HOH 103 317 184 HOH HOH L . 
F 4 HOH 104 318 185 HOH HOH L . 
F 4 HOH 105 319 187 HOH HOH L . 
F 4 HOH 106 320 188 HOH HOH L . 
F 4 HOH 107 321 189 HOH HOH L . 
F 4 HOH 108 322 190 HOH HOH L . 
F 4 HOH 109 323 191 HOH HOH L . 
F 4 HOH 110 324 192 HOH HOH L . 
F 4 HOH 111 325 194 HOH HOH L . 
F 4 HOH 112 326 195 HOH HOH L . 
F 4 HOH 113 327 196 HOH HOH L . 
F 4 HOH 114 328 197 HOH HOH L . 
F 4 HOH 115 329 198 HOH HOH L . 
F 4 HOH 116 330 201 HOH HOH L . 
F 4 HOH 117 331 202 HOH HOH L . 
F 4 HOH 118 332 205 HOH HOH L . 
F 4 HOH 119 333 206 HOH HOH L . 
F 4 HOH 120 334 207 HOH HOH L . 
F 4 HOH 121 335 208 HOH HOH L . 
F 4 HOH 122 336 209 HOH HOH L . 
F 4 HOH 123 337 210 HOH HOH L . 
G 4 HOH 1   223 8   HOH HOH H . 
G 4 HOH 2   224 11  HOH HOH H . 
G 4 HOH 3   225 14  HOH HOH H . 
G 4 HOH 4   226 15  HOH HOH H . 
G 4 HOH 5   227 16  HOH HOH H . 
G 4 HOH 6   228 19  HOH HOH H . 
G 4 HOH 7   229 21  HOH HOH H . 
G 4 HOH 8   230 25  HOH HOH H . 
G 4 HOH 9   231 29  HOH HOH H . 
G 4 HOH 10  232 31  HOH HOH H . 
G 4 HOH 11  233 34  HOH HOH H . 
G 4 HOH 12  234 35  HOH HOH H . 
G 4 HOH 13  235 37  HOH HOH H . 
G 4 HOH 14  236 40  HOH HOH H . 
G 4 HOH 15  237 42  HOH HOH H . 
G 4 HOH 16  238 44  HOH HOH H . 
G 4 HOH 17  239 45  HOH HOH H . 
G 4 HOH 18  240 46  HOH HOH H . 
G 4 HOH 19  241 47  HOH HOH H . 
G 4 HOH 20  242 49  HOH HOH H . 
G 4 HOH 21  243 50  HOH HOH H . 
G 4 HOH 22  244 51  HOH HOH H . 
G 4 HOH 23  245 53  HOH HOH H . 
G 4 HOH 24  246 55  HOH HOH H . 
G 4 HOH 25  247 58  HOH HOH H . 
G 4 HOH 26  248 60  HOH HOH H . 
G 4 HOH 27  249 61  HOH HOH H . 
G 4 HOH 28  250 65  HOH HOH H . 
G 4 HOH 29  251 68  HOH HOH H . 
G 4 HOH 30  252 69  HOH HOH H . 
G 4 HOH 31  253 73  HOH HOH H . 
G 4 HOH 32  254 76  HOH HOH H . 
G 4 HOH 33  255 77  HOH HOH H . 
G 4 HOH 34  256 78  HOH HOH H . 
G 4 HOH 35  257 79  HOH HOH H . 
G 4 HOH 36  258 81  HOH HOH H . 
G 4 HOH 37  259 82  HOH HOH H . 
G 4 HOH 38  260 90  HOH HOH H . 
G 4 HOH 39  261 91  HOH HOH H . 
G 4 HOH 40  262 93  HOH HOH H . 
G 4 HOH 41  263 97  HOH HOH H . 
G 4 HOH 42  264 98  HOH HOH H . 
G 4 HOH 43  265 99  HOH HOH H . 
G 4 HOH 44  266 101 HOH HOH H . 
G 4 HOH 45  267 104 HOH HOH H . 
G 4 HOH 46  268 106 HOH HOH H . 
G 4 HOH 47  269 109 HOH HOH H . 
G 4 HOH 48  270 115 HOH HOH H . 
G 4 HOH 49  271 118 HOH HOH H . 
G 4 HOH 50  272 120 HOH HOH H . 
G 4 HOH 51  273 125 HOH HOH H . 
G 4 HOH 52  274 127 HOH HOH H . 
G 4 HOH 53  275 128 HOH HOH H . 
G 4 HOH 54  276 129 HOH HOH H . 
G 4 HOH 55  277 130 HOH HOH H . 
G 4 HOH 56  278 131 HOH HOH H . 
G 4 HOH 57  279 139 HOH HOH H . 
G 4 HOH 58  280 144 HOH HOH H . 
G 4 HOH 59  281 147 HOH HOH H . 
G 4 HOH 60  282 150 HOH HOH H . 
G 4 HOH 61  283 151 HOH HOH H . 
G 4 HOH 62  284 152 HOH HOH H . 
G 4 HOH 63  285 155 HOH HOH H . 
G 4 HOH 64  286 156 HOH HOH H . 
G 4 HOH 65  287 157 HOH HOH H . 
G 4 HOH 66  288 159 HOH HOH H . 
G 4 HOH 67  289 160 HOH HOH H . 
G 4 HOH 68  290 161 HOH HOH H . 
G 4 HOH 69  291 162 HOH HOH H . 
G 4 HOH 70  292 164 HOH HOH H . 
G 4 HOH 71  293 166 HOH HOH H . 
G 4 HOH 72  294 168 HOH HOH H . 
G 4 HOH 73  295 169 HOH HOH H . 
G 4 HOH 74  296 173 HOH HOH H . 
G 4 HOH 75  297 174 HOH HOH H . 
G 4 HOH 76  298 175 HOH HOH H . 
G 4 HOH 77  299 177 HOH HOH H . 
G 4 HOH 78  300 179 HOH HOH H . 
G 4 HOH 79  301 181 HOH HOH H . 
G 4 HOH 80  302 182 HOH HOH H . 
G 4 HOH 81  303 183 HOH HOH H . 
G 4 HOH 82  304 186 HOH HOH H . 
G 4 HOH 83  305 193 HOH HOH H . 
G 4 HOH 84  306 199 HOH HOH H . 
G 4 HOH 85  307 200 HOH HOH H . 
G 4 HOH 86  308 203 HOH HOH H . 
G 4 HOH 87  309 204 HOH HOH H . 
G 4 HOH 88  310 211 HOH HOH H . 
G 4 HOH 89  311 212 HOH HOH H . 
G 4 HOH 90  312 213 HOH HOH H . 
G 4 HOH 91  313 214 HOH HOH H . 
G 4 HOH 92  314 215 HOH HOH H . 
G 4 HOH 93  315 216 HOH HOH H . 
G 4 HOH 94  316 217 HOH HOH H . 
G 4 HOH 95  317 218 HOH HOH H . 
G 4 HOH 96  318 219 HOH HOH H . 
G 4 HOH 97  319 220 HOH HOH H . 
G 4 HOH 98  320 221 HOH HOH H . 
#