data_3GJ9
# 
_entry.id   3GJ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GJ9         
RCSB  RCSB051929   
WWPDB D_1000051929 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3diw 'TIP-1 in complex with c-terminal b-catenin' unspecified 
PDB 3dj1 'TIP-1 wild type'                            unspecified 
PDB 3dj3 'c-terminal truncation of TIP-1'             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GJ9 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Shen, Y.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Molecular mechanism of inward rectifier potassium channel 2.3 regulation by tax-interacting protein-1' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            392 
_citation.page_first                967 
_citation.page_last                 976 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19635485 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2009.07.060 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yan, X.'   1 
primary 'Zhou, H.'  2 
primary 'Zhang, J.' 3 
primary 'Shi, C.'   4 
primary 'Xie, X.'   5 
primary 'Wu, Y.'    6 
primary 'Tian, C.'  7 
primary 'Shen, Y.'  8 
primary 'Long, J.'  9 
# 
_cell.entry_id           3GJ9 
_cell.length_a           86.457 
_cell.length_b           86.457 
_cell.length_c           101.517 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GJ9 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tax1-binding protein 3'                                       13751.685 2   ? ? ? ? 
2 polymer     syn 'C-terminal peptide from Inward rectifier potassium channel 4' 1210.342  2   ? ? ? ? 
3 non-polymer syn 'ZINC ION'                                                     65.409    4   ? ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                 35.453    4   ? ? ? ? 
5 water       nat water                                                          18.015    106 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Tax interaction protein 1, TIP-1, Glutaminase-interacting protein 3' 
2 'C-terminal peptide of Inward rectifier K(+) channel Kir2.3'          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV
NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
;
;MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV
NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
;
A,B ? 
2 'polypeptide(L)' no no NISYRRESAI NISYRRESAI C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   TYR n 
1 4   ILE n 
1 5   PRO n 
1 6   GLY n 
1 7   GLN n 
1 8   PRO n 
1 9   VAL n 
1 10  THR n 
1 11  ALA n 
1 12  VAL n 
1 13  VAL n 
1 14  GLN n 
1 15  ARG n 
1 16  VAL n 
1 17  GLU n 
1 18  ILE n 
1 19  HIS n 
1 20  LYS n 
1 21  LEU n 
1 22  ARG n 
1 23  GLN n 
1 24  GLY n 
1 25  GLU n 
1 26  ASN n 
1 27  LEU n 
1 28  ILE n 
1 29  LEU n 
1 30  GLY n 
1 31  PHE n 
1 32  SER n 
1 33  ILE n 
1 34  GLY n 
1 35  GLY n 
1 36  GLY n 
1 37  ILE n 
1 38  ASP n 
1 39  GLN n 
1 40  ASP n 
1 41  PRO n 
1 42  SER n 
1 43  GLN n 
1 44  ASN n 
1 45  PRO n 
1 46  PHE n 
1 47  SER n 
1 48  GLU n 
1 49  ASP n 
1 50  LYS n 
1 51  THR n 
1 52  ASP n 
1 53  LYS n 
1 54  GLY n 
1 55  ILE n 
1 56  TYR n 
1 57  VAL n 
1 58  THR n 
1 59  ARG n 
1 60  VAL n 
1 61  SER n 
1 62  GLU n 
1 63  GLY n 
1 64  GLY n 
1 65  PRO n 
1 66  ALA n 
1 67  GLU n 
1 68  ILE n 
1 69  ALA n 
1 70  GLY n 
1 71  LEU n 
1 72  GLN n 
1 73  ILE n 
1 74  GLY n 
1 75  ASP n 
1 76  LYS n 
1 77  ILE n 
1 78  MET n 
1 79  GLN n 
1 80  VAL n 
1 81  ASN n 
1 82  GLY n 
1 83  TRP n 
1 84  ASP n 
1 85  MET n 
1 86  THR n 
1 87  MET n 
1 88  VAL n 
1 89  THR n 
1 90  HIS n 
1 91  ASP n 
1 92  GLN n 
1 93  ALA n 
1 94  ARG n 
1 95  LYS n 
1 96  ARG n 
1 97  LEU n 
1 98  THR n 
1 99  LYS n 
1 100 ARG n 
1 101 SER n 
1 102 GLU n 
1 103 GLU n 
1 104 VAL n 
1 105 VAL n 
1 106 ARG n 
1 107 LEU n 
1 108 LEU n 
1 109 VAL n 
1 110 THR n 
1 111 ARG n 
1 112 GLN n 
1 113 SER n 
1 114 LEU n 
1 115 GLN n 
1 116 LYS n 
1 117 ALA n 
1 118 VAL n 
1 119 GLN n 
1 120 GLN n 
1 121 SER n 
1 122 MET n 
1 123 LEU n 
1 124 SER n 
2 1   ASN n 
2 2   ILE n 
2 3   SER n 
2 4   TYR n 
2 5   ARG n 
2 6   ARG n 
2 7   GLU n 
2 8   SER n 
2 9   ALA n 
2 10  ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'this sequence occurs naturally in humans' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TX1B3_HUMAN O14907 1 
;MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV
NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
;
1   ? 
2 UNP IRK4_HUMAN  P48050 2 NISYRRESAI 436 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GJ9 A 1 ? 124 ? O14907 1   ? 124 ? 1   124 
2 1 3GJ9 B 1 ? 124 ? O14907 1   ? 124 ? 1   124 
3 2 3GJ9 C 1 ? 10  ? P48050 436 ? 445 ? 436 445 
4 2 3GJ9 D 1 ? 10  ? P48050 436 ? 445 ? 436 445 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3GJ9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.density_percent_sol   61.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG8000, cacodylate buffer, zinc acetate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2008-10-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3GJ9 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   10830 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.067 
_reflns.pdbx_netI_over_sigmaI        29.6 
_reflns.B_iso_Wilson_estimate        57.4 
_reflns.pdbx_redundancy              8.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   81.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.371 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        6.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      873 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3GJ9 
_refine.ls_number_reflns_obs                     9632 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               83181.19 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.27 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_obs                          0.247 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.247 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_R_factor_R_free_error                 0.012 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  515 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               66.0 
_refine.aniso_B[1][1]                            6.48 
_refine.aniso_B[2][2]                            6.48 
_refine.aniso_B[3][3]                            -12.97 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 58.7946 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      3DIW 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3GJ9 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.38 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1749 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             106 
_refine_hist.number_atoms_total               1863 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        29.27 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.70  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.68  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.03  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.02  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.38  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             1347 
_refine_ls_shell.R_factor_R_work                  0.339 
_refine_ls_shell.percent_reflns_obs               88.0 
_refine_ls_shell.R_factor_R_free                  0.358 
_refine_ls_shell.R_factor_R_free_error            0.042 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             73 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top   'X-RAY DIFFRACTION' 
2 ion.param         ion.top       'X-RAY DIFFRACTION' 
3 so4.param         so4.top       'X-RAY DIFFRACTION' 
4 gol.param         gol.top       'X-RAY DIFFRACTION' 
5 water_rep.param   water_rep.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GJ9 
_struct.title                     'crystal structure of TIP-1 in complex with c-terminal of Kir2.3' 
_struct.pdbx_descriptor           'Tax1-binding protein 3, C-terminal peptide from Inward rectifier potassium channel 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GJ9 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'TIP-1, Kir2.3, PDZ domain, Cytoplasm, Nucleus, Phosphoprotein, Wnt signaling pathway, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 40 ? ASN A 44 ? ASP A 40 ASN A 44 5 ? 5  
HELX_P HELX_P2 2 GLY A 64 ? GLY A 70 ? GLY A 64 GLY A 70 1 ? 7  
HELX_P HELX_P3 3 THR A 89 ? THR A 98 ? THR A 89 THR A 98 1 ? 10 
HELX_P HELX_P4 4 GLY B 64 ? GLY B 70 ? GLY B 64 GLY B 70 1 ? 7  
HELX_P HELX_P5 5 THR B 89 ? THR B 98 ? THR B 89 THR B 98 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 62  OE2 ? ? ? 1_555 J ZN  . ZN ? ? A GLU 62  B ZN  127 1_555 ? ? ? ? ? ? ? 1.819 ? 
metalc2  metalc ? ? A GLU 67  OE2 ? ? ? 1_555 J ZN  . ZN ? ? A GLU 67  B ZN  127 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc3  metalc ? ? A GLU 103 OE2 ? ? ? 1_555 E ZN  . ZN ? ? A GLU 103 A ZN  125 1_555 ? ? ? ? ? ? ? 2.020 ? 
metalc4  metalc ? ? B GLU 17  OE1 ? ? ? 1_555 J ZN  . ZN ? ? B GLU 17  B ZN  127 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc5  metalc ? ? B GLU 62  OE2 ? ? ? 1_555 I ZN  . ZN ? ? B GLU 62  B ZN  126 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc6  metalc ? ? B GLU 67  OE2 ? ? ? 1_555 I ZN  . ZN ? ? B GLU 67  B ZN  126 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc7  metalc ? ? B GLU 103 OE2 ? ? ? 1_555 H ZN  . ZN ? ? B GLU 103 B ZN  125 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc8  metalc ? ? J ZN  .   ZN  ? ? ? 1_555 M HOH . O  ? ? B ZN  127 A HOH 128 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc9  metalc ? ? B GLU 17  OE2 ? ? ? 1_555 J ZN  . ZN ? ? B GLU 17  B ZN  127 1_555 ? ? ? ? ? ? ? 1.749 ? 
metalc10 metalc ? ? I ZN  .   ZN  ? ? ? 1_555 N HOH . O  ? ? B ZN  126 B HOH 164 1_555 ? ? ? ? ? ? ? 2.567 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 2 ? 
D ? 4 ? 
E ? 6 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 11  ? HIS A 19  ? ALA A 11  HIS A 19  
A 2 VAL A 104 ? GLN A 112 ? VAL A 104 GLN A 112 
A 3 LYS A 76  ? VAL A 80  ? LYS A 76  VAL A 80  
A 4 TRP A 83  ? ASP A 84  ? TRP A 83  ASP A 84  
B 1 ALA A 11  ? HIS A 19  ? ALA A 11  HIS A 19  
B 2 VAL A 104 ? GLN A 112 ? VAL A 104 GLN A 112 
B 3 LYS A 76  ? VAL A 80  ? LYS A 76  VAL A 80  
B 4 ILE A 55  ? VAL A 60  ? ILE A 55  VAL A 60  
B 5 PHE A 31  ? GLY A 35  ? PHE A 31  GLY A 35  
B 6 SER C 8   ? ALA C 9   ? SER C 443 ALA C 444 
C 1 LEU A 21  ? GLN A 23  ? LEU A 21  GLN A 23  
C 2 ASN A 26  ? ILE A 28  ? ASN A 26  ILE A 28  
D 1 VAL B 12  ? HIS B 19  ? VAL B 12  HIS B 19  
D 2 VAL B 104 ? ARG B 111 ? VAL B 104 ARG B 111 
D 3 LYS B 76  ? VAL B 80  ? LYS B 76  VAL B 80  
D 4 TRP B 83  ? ASP B 84  ? TRP B 83  ASP B 84  
E 1 VAL B 12  ? HIS B 19  ? VAL B 12  HIS B 19  
E 2 VAL B 104 ? ARG B 111 ? VAL B 104 ARG B 111 
E 3 LYS B 76  ? VAL B 80  ? LYS B 76  VAL B 80  
E 4 ILE B 55  ? VAL B 60  ? ILE B 55  VAL B 60  
E 5 PHE B 31  ? GLY B 35  ? PHE B 31  GLY B 35  
E 6 SER D 8   ? ALA D 9   ? SER D 443 ALA D 444 
F 1 LEU B 21  ? GLN B 23  ? LEU B 21  GLN B 23  
F 2 ASN B 26  ? ILE B 28  ? ASN B 26  ILE B 28  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 16  ? N VAL A 16  O LEU A 107 ? O LEU A 107 
A 2 3 O LEU A 108 ? O LEU A 108 N MET A 78  ? N MET A 78  
A 3 4 N VAL A 80  ? N VAL A 80  O TRP A 83  ? O TRP A 83  
B 1 2 N VAL A 16  ? N VAL A 16  O LEU A 107 ? O LEU A 107 
B 2 3 O LEU A 108 ? O LEU A 108 N MET A 78  ? N MET A 78  
B 3 4 O ILE A 77  ? O ILE A 77  N ILE A 55  ? N ILE A 55  
B 4 5 O TYR A 56  ? O TYR A 56  N GLY A 34  ? N GLY A 34  
B 5 6 N ILE A 33  ? N ILE A 33  O SER C 8   ? O SER C 443 
C 1 2 N LEU A 21  ? N LEU A 21  O ILE A 28  ? O ILE A 28  
D 1 2 N GLN B 14  ? N GLN B 14  O VAL B 109 ? O VAL B 109 
D 2 3 O LEU B 108 ? O LEU B 108 N MET B 78  ? N MET B 78  
D 3 4 N VAL B 80  ? N VAL B 80  O TRP B 83  ? O TRP B 83  
E 1 2 N GLN B 14  ? N GLN B 14  O VAL B 109 ? O VAL B 109 
E 2 3 O LEU B 108 ? O LEU B 108 N MET B 78  ? N MET B 78  
E 3 4 O ILE B 77  ? O ILE B 77  N ILE B 55  ? N ILE B 55  
E 4 5 O TYR B 56  ? O TYR B 56  N GLY B 34  ? N GLY B 34  
E 5 6 N ILE B 33  ? N ILE B 33  O SER D 8   ? O SER D 443 
F 1 2 N LEU B 21  ? N LEU B 21  O ILE B 28  ? O ILE B 28  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 125' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 125' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 126' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 127' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 126' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 127' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 128' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL B 129' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 19  ? HIS A 19  . ? 1_555 ? 
2  AC1 4 GLU A 103 ? GLU A 103 . ? 1_555 ? 
3  AC1 4 GLU B 103 ? GLU B 103 . ? 6_565 ? 
4  AC1 4 ZN  H .   ? ZN  B 125 . ? 6_565 ? 
5  AC2 4 GLU A 103 ? GLU A 103 . ? 6_565 ? 
6  AC2 4 ZN  E .   ? ZN  A 125 . ? 6_565 ? 
7  AC2 4 HIS B 19  ? HIS B 19  . ? 1_555 ? 
8  AC2 4 GLU B 103 ? GLU B 103 . ? 1_555 ? 
9  AC3 5 GLU A 17  ? GLU A 17  . ? 4_455 ? 
10 AC3 5 GLU B 62  ? GLU B 62  . ? 1_555 ? 
11 AC3 5 GLU B 67  ? GLU B 67  . ? 1_555 ? 
12 AC3 5 HOH N .   ? HOH B 135 . ? 1_555 ? 
13 AC3 5 HOH N .   ? HOH B 164 . ? 1_555 ? 
14 AC4 5 GLU A 62  ? GLU A 62  . ? 1_555 ? 
15 AC4 5 GLU A 67  ? GLU A 67  . ? 1_555 ? 
16 AC4 5 HOH M .   ? HOH A 128 . ? 1_555 ? 
17 AC4 5 GLU B 17  ? GLU B 17  . ? 1_555 ? 
18 AC4 5 HOH N .   ? HOH B 134 . ? 1_555 ? 
19 AC5 4 ARG A 15  ? ARG A 15  . ? 1_555 ? 
20 AC5 4 GLN A 79  ? GLN A 79  . ? 1_555 ? 
21 AC5 4 GLY A 82  ? GLY A 82  . ? 1_555 ? 
22 AC5 4 ARG A 106 ? ARG A 106 . ? 1_555 ? 
23 AC6 3 GLN A 72  ? GLN A 72  . ? 1_555 ? 
24 AC6 3 ILE A 73  ? ILE A 73  . ? 1_555 ? 
25 AC6 3 ARG B 106 ? ARG B 106 . ? 1_555 ? 
26 AC7 4 ARG B 15  ? ARG B 15  . ? 1_555 ? 
27 AC7 4 GLN B 79  ? GLN B 79  . ? 1_555 ? 
28 AC7 4 GLY B 82  ? GLY B 82  . ? 1_555 ? 
29 AC7 4 ARG B 106 ? ARG B 106 . ? 1_555 ? 
30 AC8 2 ARG A 106 ? ARG A 106 . ? 4_455 ? 
31 AC8 2 ILE B 73  ? ILE B 73  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GJ9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GJ9 
_atom_sites.fract_transf_matrix[1][1]   0.011566 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011566 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009851 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 10  ? -28.592 27.234 0.605  1.00 91.05  ? 10  THR A N   1 
ATOM   2    C  CA  . THR A 1 10  ? -27.103 27.310 0.512  1.00 91.24  ? 10  THR A CA  1 
ATOM   3    C  C   . THR A 1 10  ? -26.530 28.269 1.562  1.00 90.98  ? 10  THR A C   1 
ATOM   4    O  O   . THR A 1 10  ? -26.963 28.267 2.717  1.00 90.96  ? 10  THR A O   1 
ATOM   5    C  CB  . THR A 1 10  ? -26.693 27.757 -0.888 1.00 90.09  ? 10  THR A CB  1 
ATOM   6    N  N   . ALA A 1 11  ? -25.560 29.085 1.156  1.00 89.88  ? 11  ALA A N   1 
ATOM   7    C  CA  . ALA A 1 11  ? -24.930 30.038 2.065  1.00 88.79  ? 11  ALA A CA  1 
ATOM   8    C  C   . ALA A 1 11  ? -25.518 31.441 1.930  1.00 87.42  ? 11  ALA A C   1 
ATOM   9    O  O   . ALA A 1 11  ? -25.780 31.908 0.824  1.00 87.51  ? 11  ALA A O   1 
ATOM   10   C  CB  . ALA A 1 11  ? -23.425 30.077 1.812  1.00 89.04  ? 11  ALA A CB  1 
ATOM   11   N  N   . VAL A 1 12  ? -25.725 32.107 3.063  1.00 85.98  ? 12  VAL A N   1 
ATOM   12   C  CA  . VAL A 1 12  ? -26.274 33.459 3.070  1.00 84.52  ? 12  VAL A CA  1 
ATOM   13   C  C   . VAL A 1 12  ? -25.193 34.503 3.353  1.00 82.64  ? 12  VAL A C   1 
ATOM   14   O  O   . VAL A 1 12  ? -24.206 34.225 4.039  1.00 83.48  ? 12  VAL A O   1 
ATOM   15   C  CB  . VAL A 1 12  ? -27.389 33.605 4.127  1.00 85.66  ? 12  VAL A CB  1 
ATOM   16   C  CG1 . VAL A 1 12  ? -26.820 33.399 5.526  1.00 85.73  ? 12  VAL A CG1 1 
ATOM   17   C  CG2 . VAL A 1 12  ? -28.033 34.975 4.011  1.00 86.91  ? 12  VAL A CG2 1 
ATOM   18   N  N   . VAL A 1 13  ? -25.392 35.705 2.829  1.00 79.62  ? 13  VAL A N   1 
ATOM   19   C  CA  . VAL A 1 13  ? -24.439 36.792 3.008  1.00 77.67  ? 13  VAL A CA  1 
ATOM   20   C  C   . VAL A 1 13  ? -24.967 37.856 3.961  1.00 75.96  ? 13  VAL A C   1 
ATOM   21   O  O   . VAL A 1 13  ? -26.074 38.350 3.795  1.00 76.60  ? 13  VAL A O   1 
ATOM   22   C  CB  . VAL A 1 13  ? -24.113 37.446 1.655  1.00 77.79  ? 13  VAL A CB  1 
ATOM   23   C  CG1 . VAL A 1 13  ? -25.399 37.777 0.929  1.00 79.14  ? 13  VAL A CG1 1 
ATOM   24   C  CG2 . VAL A 1 13  ? -23.281 38.699 1.861  1.00 77.13  ? 13  VAL A CG2 1 
ATOM   25   N  N   . GLN A 1 14  ? -24.165 38.211 4.958  1.00 74.44  ? 14  GLN A N   1 
ATOM   26   C  CA  . GLN A 1 14  ? -24.566 39.214 5.937  1.00 73.14  ? 14  GLN A CA  1 
ATOM   27   C  C   . GLN A 1 14  ? -23.411 40.119 6.348  1.00 70.66  ? 14  GLN A C   1 
ATOM   28   O  O   . GLN A 1 14  ? -22.241 39.750 6.222  1.00 69.84  ? 14  GLN A O   1 
ATOM   29   C  CB  . GLN A 1 14  ? -25.127 38.540 7.186  1.00 75.25  ? 14  GLN A CB  1 
ATOM   30   C  CG  . GLN A 1 14  ? -26.264 37.579 6.922  1.00 78.97  ? 14  GLN A CG  1 
ATOM   31   C  CD  . GLN A 1 14  ? -27.225 37.520 8.091  1.00 81.91  ? 14  GLN A CD  1 
ATOM   32   O  OE1 . GLN A 1 14  ? -26.813 37.320 9.238  1.00 83.47  ? 14  GLN A OE1 1 
ATOM   33   N  NE2 . GLN A 1 14  ? -28.516 37.699 7.811  1.00 82.42  ? 14  GLN A NE2 1 
ATOM   34   N  N   . ARG A 1 15  ? -23.739 41.306 6.844  1.00 67.88  ? 15  ARG A N   1 
ATOM   35   C  CA  . ARG A 1 15  ? -22.700 42.218 7.275  1.00 66.46  ? 15  ARG A CA  1 
ATOM   36   C  C   . ARG A 1 15  ? -22.718 42.458 8.776  1.00 63.63  ? 15  ARG A C   1 
ATOM   37   O  O   . ARG A 1 15  ? -23.772 42.650 9.384  1.00 62.37  ? 15  ARG A O   1 
ATOM   38   C  CB  . ARG A 1 15  ? -22.781 43.542 6.512  1.00 69.48  ? 15  ARG A CB  1 
ATOM   39   C  CG  . ARG A 1 15  ? -24.091 44.289 6.578  1.00 73.34  ? 15  ARG A CG  1 
ATOM   40   C  CD  . ARG A 1 15  ? -24.165 45.234 5.373  1.00 77.83  ? 15  ARG A CD  1 
ATOM   41   N  NE  . ARG A 1 15  ? -22.909 45.965 5.185  1.00 81.14  ? 15  ARG A NE  1 
ATOM   42   C  CZ  . ARG A 1 15  ? -22.480 46.456 4.022  1.00 81.79  ? 15  ARG A CZ  1 
ATOM   43   N  NH1 . ARG A 1 15  ? -21.320 47.105 3.963  1.00 80.87  ? 15  ARG A NH1 1 
ATOM   44   N  NH2 . ARG A 1 15  ? -23.205 46.292 2.917  1.00 82.28  ? 15  ARG A NH2 1 
ATOM   45   N  N   . VAL A 1 16  ? -21.525 42.418 9.361  1.00 59.59  ? 16  VAL A N   1 
ATOM   46   C  CA  . VAL A 1 16  ? -21.345 42.605 10.784 1.00 55.73  ? 16  VAL A CA  1 
ATOM   47   C  C   . VAL A 1 16  ? -20.487 43.829 11.012 1.00 53.99  ? 16  VAL A C   1 
ATOM   48   O  O   . VAL A 1 16  ? -19.454 43.989 10.379 1.00 53.82  ? 16  VAL A O   1 
ATOM   49   C  CB  . VAL A 1 16  ? -20.641 41.392 11.406 1.00 54.48  ? 16  VAL A CB  1 
ATOM   50   C  CG1 . VAL A 1 16  ? -20.547 41.554 12.911 1.00 53.95  ? 16  VAL A CG1 1 
ATOM   51   C  CG2 . VAL A 1 16  ? -21.384 40.131 11.040 1.00 52.86  ? 16  VAL A CG2 1 
ATOM   52   N  N   . GLU A 1 17  ? -20.923 44.690 11.918 1.00 53.40  ? 17  GLU A N   1 
ATOM   53   C  CA  . GLU A 1 17  ? -20.186 45.899 12.239 1.00 53.81  ? 17  GLU A CA  1 
ATOM   54   C  C   . GLU A 1 17  ? -19.722 45.774 13.688 1.00 51.93  ? 17  GLU A C   1 
ATOM   55   O  O   . GLU A 1 17  ? -20.531 45.707 14.609 1.00 51.79  ? 17  GLU A O   1 
ATOM   56   C  CB  . GLU A 1 17  ? -21.093 47.116 12.051 1.00 54.35  ? 17  GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 17  ? -20.383 48.444 12.059 1.00 58.39  ? 17  GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 17  ? -21.330 49.598 11.743 1.00 63.04  ? 17  GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 17  ? -21.790 49.711 10.580 1.00 64.28  ? 17  GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 17  ? -21.622 50.386 12.669 1.00 65.35  ? 17  GLU A OE2 1 
ATOM   61   N  N   . ILE A 1 18  ? -18.412 45.736 13.883 1.00 50.38  ? 18  ILE A N   1 
ATOM   62   C  CA  . ILE A 1 18  ? -17.853 45.582 15.215 1.00 49.38  ? 18  ILE A CA  1 
ATOM   63   C  C   . ILE A 1 18  ? -17.088 46.806 15.691 1.00 49.46  ? 18  ILE A C   1 
ATOM   64   O  O   . ILE A 1 18  ? -16.129 47.234 15.056 1.00 49.35  ? 18  ILE A O   1 
ATOM   65   C  CB  . ILE A 1 18  ? -16.879 44.389 15.256 1.00 49.15  ? 18  ILE A CB  1 
ATOM   66   C  CG1 . ILE A 1 18  ? -17.550 43.147 14.670 1.00 48.03  ? 18  ILE A CG1 1 
ATOM   67   C  CG2 . ILE A 1 18  ? -16.431 44.136 16.683 1.00 49.27  ? 18  ILE A CG2 1 
ATOM   68   C  CD1 . ILE A 1 18  ? -16.610 41.986 14.451 1.00 45.23  ? 18  ILE A CD1 1 
ATOM   69   N  N   . HIS A 1 19  ? -17.504 47.372 16.813 1.00 50.00  ? 19  HIS A N   1 
ATOM   70   C  CA  . HIS A 1 19  ? -16.786 48.510 17.350 1.00 52.29  ? 19  HIS A CA  1 
ATOM   71   C  C   . HIS A 1 19  ? -15.682 47.919 18.228 1.00 50.85  ? 19  HIS A C   1 
ATOM   72   O  O   . HIS A 1 19  ? -15.954 47.185 19.168 1.00 52.16  ? 19  HIS A O   1 
ATOM   73   C  CB  . HIS A 1 19  ? -17.717 49.412 18.182 1.00 56.50  ? 19  HIS A CB  1 
ATOM   74   C  CG  . HIS A 1 19  ? -18.855 50.015 17.401 1.00 64.19  ? 19  HIS A CG  1 
ATOM   75   N  ND1 . HIS A 1 19  ? -19.521 51.157 17.809 1.00 66.93  ? 19  HIS A ND1 1 
ATOM   76   C  CD2 . HIS A 1 19  ? -19.477 49.611 16.264 1.00 65.81  ? 19  HIS A CD2 1 
ATOM   77   C  CE1 . HIS A 1 19  ? -20.500 51.426 16.960 1.00 65.67  ? 19  HIS A CE1 1 
ATOM   78   N  NE2 . HIS A 1 19  ? -20.496 50.503 16.013 1.00 65.04  ? 19  HIS A NE2 1 
ATOM   79   N  N   . LYS A 1 20  ? -14.435 48.221 17.912 1.00 49.57  ? 20  LYS A N   1 
ATOM   80   C  CA  . LYS A 1 20  ? -13.314 47.705 18.685 1.00 49.96  ? 20  LYS A CA  1 
ATOM   81   C  C   . LYS A 1 20  ? -13.367 48.138 20.136 1.00 50.44  ? 20  LYS A C   1 
ATOM   82   O  O   . LYS A 1 20  ? -13.949 49.164 20.463 1.00 51.63  ? 20  LYS A O   1 
ATOM   83   C  CB  . LYS A 1 20  ? -11.991 48.165 18.066 1.00 50.44  ? 20  LYS A CB  1 
ATOM   84   C  CG  . LYS A 1 20  ? -11.745 47.606 16.675 1.00 47.98  ? 20  LYS A CG  1 
ATOM   85   C  CD  . LYS A 1 20  ? -10.521 48.219 16.046 1.00 48.58  ? 20  LYS A CD  1 
ATOM   86   C  CE  . LYS A 1 20  ? -10.366 47.765 14.612 1.00 48.61  ? 20  LYS A CE  1 
ATOM   87   N  NZ  . LYS A 1 20  ? -9.164  48.363 13.974 1.00 52.25  ? 20  LYS A NZ  1 
ATOM   88   N  N   . LEU A 1 21  ? -12.745 47.349 21.004 1.00 52.98  ? 21  LEU A N   1 
ATOM   89   C  CA  . LEU A 1 21  ? -12.705 47.632 22.440 1.00 54.58  ? 21  LEU A CA  1 
ATOM   90   C  C   . LEU A 1 21  ? -11.346 48.245 22.781 1.00 56.80  ? 21  LEU A C   1 
ATOM   91   O  O   . LEU A 1 21  ? -10.300 47.626 22.572 1.00 53.77  ? 21  LEU A O   1 
ATOM   92   C  CB  . LEU A 1 21  ? -12.935 46.335 23.237 1.00 53.49  ? 21  LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 21  ? -13.228 46.354 24.747 1.00 51.52  ? 21  LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 21  ? -12.046 46.872 25.501 1.00 53.91  ? 21  LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 21  ? -14.428 47.228 25.034 1.00 53.07  ? 21  LEU A CD2 1 
ATOM   96   N  N   . ARG A 1 22  ? -11.371 49.471 23.299 1.00 61.75  ? 22  ARG A N   1 
ATOM   97   C  CA  . ARG A 1 22  ? -10.143 50.181 23.647 1.00 67.38  ? 22  ARG A CA  1 
ATOM   98   C  C   . ARG A 1 22  ? -9.646  49.777 25.021 1.00 68.52  ? 22  ARG A C   1 
ATOM   99   O  O   . ARG A 1 22  ? -10.079 50.325 26.036 1.00 69.41  ? 22  ARG A O   1 
ATOM   100  C  CB  . ARG A 1 22  ? -10.364 51.708 23.612 1.00 70.77  ? 22  ARG A CB  1 
ATOM   101  C  CG  . ARG A 1 22  ? -10.713 52.282 22.233 1.00 73.99  ? 22  ARG A CG  1 
ATOM   102  C  CD  . ARG A 1 22  ? -11.036 53.784 22.275 1.00 76.17  ? 22  ARG A CD  1 
ATOM   103  N  NE  . ARG A 1 22  ? -11.505 54.281 20.979 1.00 79.35  ? 22  ARG A NE  1 
ATOM   104  C  CZ  . ARG A 1 22  ? -10.717 54.673 19.974 1.00 80.89  ? 22  ARG A CZ  1 
ATOM   105  N  NH1 . ARG A 1 22  ? -9.395  54.645 20.097 1.00 80.29  ? 22  ARG A NH1 1 
ATOM   106  N  NH2 . ARG A 1 22  ? -11.257 55.078 18.829 1.00 81.59  ? 22  ARG A NH2 1 
ATOM   107  N  N   . GLN A 1 23  ? -8.734  48.814 25.048 1.00 69.84  ? 23  GLN A N   1 
ATOM   108  C  CA  . GLN A 1 23  ? -8.173  48.348 26.306 1.00 72.62  ? 23  GLN A CA  1 
ATOM   109  C  C   . GLN A 1 23  ? -6.814  49.012 26.483 1.00 73.52  ? 23  GLN A C   1 
ATOM   110  O  O   . GLN A 1 23  ? -5.794  48.515 25.998 1.00 74.36  ? 23  GLN A O   1 
ATOM   111  C  CB  . GLN A 1 23  ? -8.026  46.820 26.290 1.00 73.20  ? 23  GLN A CB  1 
ATOM   112  C  CG  . GLN A 1 23  ? -8.022  46.173 27.670 1.00 73.42  ? 23  GLN A CG  1 
ATOM   113  C  CD  . GLN A 1 23  ? -6.840  46.584 28.517 1.00 73.94  ? 23  GLN A CD  1 
ATOM   114  O  OE1 . GLN A 1 23  ? -5.695  46.260 28.200 1.00 74.09  ? 23  GLN A OE1 1 
ATOM   115  N  NE2 . GLN A 1 23  ? -7.110  47.305 29.601 1.00 73.67  ? 23  GLN A NE2 1 
ATOM   116  N  N   . GLY A 1 24  ? -6.807  50.148 27.167 1.00 74.20  ? 24  GLY A N   1 
ATOM   117  C  CA  . GLY A 1 24  ? -5.564  50.860 27.371 1.00 76.30  ? 24  GLY A CA  1 
ATOM   118  C  C   . GLY A 1 24  ? -5.067  51.409 26.047 1.00 77.94  ? 24  GLY A C   1 
ATOM   119  O  O   . GLY A 1 24  ? -5.565  52.428 25.566 1.00 78.52  ? 24  GLY A O   1 
ATOM   120  N  N   . GLU A 1 25  ? -4.099  50.729 25.442 1.00 78.16  ? 25  GLU A N   1 
ATOM   121  C  CA  . GLU A 1 25  ? -3.545  51.176 24.170 1.00 79.15  ? 25  GLU A CA  1 
ATOM   122  C  C   . GLU A 1 25  ? -3.784  50.132 23.095 1.00 77.80  ? 25  GLU A C   1 
ATOM   123  O  O   . GLU A 1 25  ? -3.309  50.271 21.966 1.00 77.80  ? 25  GLU A O   1 
ATOM   124  C  CB  . GLU A 1 25  ? -2.045  51.440 24.306 1.00 81.92  ? 25  GLU A CB  1 
ATOM   125  C  CG  . GLU A 1 25  ? -1.269  50.219 24.762 1.00 86.21  ? 25  GLU A CG  1 
ATOM   126  C  CD  . GLU A 1 25  ? -1.865  49.609 26.023 1.00 88.69  ? 25  GLU A CD  1 
ATOM   127  O  OE1 . GLU A 1 25  ? -1.818  50.263 27.091 1.00 88.53  ? 25  GLU A OE1 1 
ATOM   128  O  OE2 . GLU A 1 25  ? -2.397  48.480 25.938 1.00 91.06  ? 25  GLU A OE2 1 
ATOM   129  N  N   . ASN A 1 26  ? -4.520  49.083 23.452 1.00 75.88  ? 26  ASN A N   1 
ATOM   130  C  CA  . ASN A 1 26  ? -4.831  48.021 22.507 1.00 73.04  ? 26  ASN A CA  1 
ATOM   131  C  C   . ASN A 1 26  ? -6.282  48.100 22.065 1.00 69.49  ? 26  ASN A C   1 
ATOM   132  O  O   . ASN A 1 26  ? -7.148  48.543 22.820 1.00 69.38  ? 26  ASN A O   1 
ATOM   133  C  CB  . ASN A 1 26  ? -4.576  46.654 23.143 1.00 75.74  ? 26  ASN A CB  1 
ATOM   134  C  CG  . ASN A 1 26  ? -3.178  46.528 23.710 1.00 77.86  ? 26  ASN A CG  1 
ATOM   135  O  OD1 . ASN A 1 26  ? -2.185  46.760 23.010 1.00 78.98  ? 26  ASN A OD1 1 
ATOM   136  N  ND2 . ASN A 1 26  ? -3.090  46.156 24.987 1.00 76.94  ? 26  ASN A ND2 1 
ATOM   137  N  N   . LEU A 1 27  ? -6.539  47.675 20.834 1.00 64.72  ? 27  LEU A N   1 
ATOM   138  C  CA  . LEU A 1 27  ? -7.891  47.659 20.298 1.00 61.31  ? 27  LEU A CA  1 
ATOM   139  C  C   . LEU A 1 27  ? -8.259  46.207 20.038 1.00 58.31  ? 27  LEU A C   1 
ATOM   140  O  O   . LEU A 1 27  ? -7.667  45.535 19.197 1.00 58.50  ? 27  LEU A O   1 
ATOM   141  C  CB  . LEU A 1 27  ? -7.969  48.491 19.021 1.00 61.60  ? 27  LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 27  ? -7.775  49.988 19.279 1.00 60.74  ? 27  LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 27  ? -7.746  50.732 17.961 1.00 62.11  ? 27  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 27  ? -8.904  50.511 20.163 1.00 59.42  ? 27  LEU A CD2 1 
ATOM   145  N  N   . ILE A 1 28  ? -9.246  45.732 20.780 1.00 54.89  ? 28  ILE A N   1 
ATOM   146  C  CA  . ILE A 1 28  ? -9.685  44.352 20.700 1.00 51.22  ? 28  ILE A CA  1 
ATOM   147  C  C   . ILE A 1 28  ? -10.986 44.161 19.937 1.00 48.87  ? 28  ILE A C   1 
ATOM   148  O  O   . ILE A 1 28  ? -11.927 44.937 20.078 1.00 47.28  ? 28  ILE A O   1 
ATOM   149  C  CB  . ILE A 1 28  ? -9.850  43.803 22.135 1.00 52.54  ? 28  ILE A CB  1 
ATOM   150  C  CG1 . ILE A 1 28  ? -8.518  43.971 22.878 1.00 53.26  ? 28  ILE A CG1 1 
ATOM   151  C  CG2 . ILE A 1 28  ? -10.353 42.363 22.116 1.00 49.27  ? 28  ILE A CG2 1 
ATOM   152  C  CD1 . ILE A 1 28  ? -8.639  43.938 24.388 1.00 53.03  ? 28  ILE A CD1 1 
ATOM   153  N  N   . LEU A 1 29  ? -11.030 43.109 19.128 1.00 46.87  ? 29  LEU A N   1 
ATOM   154  C  CA  . LEU A 1 29  ? -12.224 42.776 18.364 1.00 44.01  ? 29  LEU A CA  1 
ATOM   155  C  C   . LEU A 1 29  ? -12.970 41.594 19.002 1.00 42.13  ? 29  LEU A C   1 
ATOM   156  O  O   . LEU A 1 29  ? -14.195 41.487 18.906 1.00 40.13  ? 29  LEU A O   1 
ATOM   157  C  CB  . LEU A 1 29  ? -11.837 42.445 16.928 1.00 45.33  ? 29  LEU A CB  1 
ATOM   158  C  CG  . LEU A 1 29  ? -11.562 43.678 16.074 1.00 47.86  ? 29  LEU A CG  1 
ATOM   159  C  CD1 . LEU A 1 29  ? -11.069 43.268 14.689 1.00 46.99  ? 29  LEU A CD1 1 
ATOM   160  C  CD2 . LEU A 1 29  ? -12.854 44.500 15.977 1.00 48.36  ? 29  LEU A CD2 1 
ATOM   161  N  N   . GLY A 1 30  ? -12.216 40.704 19.640 1.00 39.91  ? 30  GLY A N   1 
ATOM   162  C  CA  . GLY A 1 30  ? -12.817 39.563 20.293 1.00 41.15  ? 30  GLY A CA  1 
ATOM   163  C  C   . GLY A 1 30  ? -13.095 38.340 19.436 1.00 40.97  ? 30  GLY A C   1 
ATOM   164  O  O   . GLY A 1 30  ? -14.123 37.682 19.624 1.00 39.74  ? 30  GLY A O   1 
ATOM   165  N  N   . PHE A 1 31  ? -12.202 38.030 18.499 1.00 39.62  ? 31  PHE A N   1 
ATOM   166  C  CA  . PHE A 1 31  ? -12.387 36.851 17.672 1.00 41.06  ? 31  PHE A CA  1 
ATOM   167  C  C   . PHE A 1 31  ? -11.076 36.425 17.009 1.00 41.60  ? 31  PHE A C   1 
ATOM   168  O  O   . PHE A 1 31  ? -10.103 37.173 17.026 1.00 41.83  ? 31  PHE A O   1 
ATOM   169  C  CB  . PHE A 1 31  ? -13.522 37.084 16.651 1.00 43.79  ? 31  PHE A CB  1 
ATOM   170  C  CG  . PHE A 1 31  ? -13.134 37.907 15.442 1.00 47.41  ? 31  PHE A CG  1 
ATOM   171  C  CD1 . PHE A 1 31  ? -12.721 37.283 14.262 1.00 47.50  ? 31  PHE A CD1 1 
ATOM   172  C  CD2 . PHE A 1 31  ? -13.240 39.297 15.460 1.00 48.79  ? 31  PHE A CD2 1 
ATOM   173  C  CE1 . PHE A 1 31  ? -12.423 38.026 13.122 1.00 48.36  ? 31  PHE A CE1 1 
ATOM   174  C  CE2 . PHE A 1 31  ? -12.941 40.057 14.316 1.00 50.25  ? 31  PHE A CE2 1 
ATOM   175  C  CZ  . PHE A 1 31  ? -12.536 39.417 13.144 1.00 48.40  ? 31  PHE A CZ  1 
ATOM   176  N  N   . SER A 1 32  ? -11.032 35.210 16.465 1.00 40.98  ? 32  SER A N   1 
ATOM   177  C  CA  . SER A 1 32  ? -9.811  34.725 15.821 1.00 40.26  ? 32  SER A CA  1 
ATOM   178  C  C   . SER A 1 32  ? -10.038 34.292 14.393 1.00 38.94  ? 32  SER A C   1 
ATOM   179  O  O   . SER A 1 32  ? -11.133 33.904 14.012 1.00 37.38  ? 32  SER A O   1 
ATOM   180  C  CB  . SER A 1 32  ? -9.207  33.566 16.605 1.00 38.66  ? 32  SER A CB  1 
ATOM   181  O  OG  . SER A 1 32  ? -8.829  33.997 17.893 1.00 41.99  ? 32  SER A OG  1 
ATOM   182  N  N   . ILE A 1 33  ? -8.983  34.350 13.599 1.00 39.79  ? 33  ILE A N   1 
ATOM   183  C  CA  . ILE A 1 33  ? -9.105  33.973 12.207 1.00 41.94  ? 33  ILE A CA  1 
ATOM   184  C  C   . ILE A 1 33  ? -8.118  32.902 11.773 1.00 42.45  ? 33  ILE A C   1 
ATOM   185  O  O   . ILE A 1 33  ? -7.073  32.694 12.391 1.00 38.93  ? 33  ILE A O   1 
ATOM   186  C  CB  . ILE A 1 33  ? -8.926  35.200 11.269 1.00 41.66  ? 33  ILE A CB  1 
ATOM   187  C  CG1 . ILE A 1 33  ? -7.542  35.814 11.474 1.00 41.40  ? 33  ILE A CG1 1 
ATOM   188  C  CG2 . ILE A 1 33  ? -10.010 36.223 11.528 1.00 39.88  ? 33  ILE A CG2 1 
ATOM   189  C  CD1 . ILE A 1 33  ? -7.160  36.827 10.421 1.00 42.19  ? 33  ILE A CD1 1 
ATOM   190  N  N   . GLY A 1 34  ? -8.492  32.235 10.687 1.00 44.40  ? 34  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 34  ? -7.684  31.193 10.088 1.00 46.54  ? 34  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 34  ? -7.928  31.286 8.595  1.00 48.96  ? 34  GLY A C   1 
ATOM   193  O  O   . GLY A 1 34  ? -8.972  31.781 8.160  1.00 50.27  ? 34  GLY A O   1 
ATOM   194  N  N   . GLY A 1 35  ? -6.977  30.833 7.792  1.00 50.36  ? 35  GLY A N   1 
ATOM   195  C  CA  . GLY A 1 35  ? -7.171  30.911 6.357  1.00 51.73  ? 35  GLY A CA  1 
ATOM   196  C  C   . GLY A 1 35  ? -6.161  31.811 5.677  1.00 53.46  ? 35  GLY A C   1 
ATOM   197  O  O   . GLY A 1 35  ? -5.214  32.303 6.303  1.00 52.74  ? 35  GLY A O   1 
ATOM   198  N  N   . GLY A 1 36  ? -6.375  32.034 4.388  1.00 54.79  ? 36  GLY A N   1 
ATOM   199  C  CA  . GLY A 1 36  ? -5.464  32.851 3.616  1.00 57.94  ? 36  GLY A CA  1 
ATOM   200  C  C   . GLY A 1 36  ? -4.794  32.003 2.555  1.00 59.95  ? 36  GLY A C   1 
ATOM   201  O  O   . GLY A 1 36  ? -4.547  30.814 2.758  1.00 59.57  ? 36  GLY A O   1 
ATOM   202  N  N   . ILE A 1 37  ? -4.498  32.623 1.419  1.00 62.87  ? 37  ILE A N   1 
ATOM   203  C  CA  . ILE A 1 37  ? -3.858  31.944 0.299  1.00 64.30  ? 37  ILE A CA  1 
ATOM   204  C  C   . ILE A 1 37  ? -2.517  31.304 0.662  1.00 65.33  ? 37  ILE A C   1 
ATOM   205  O  O   . ILE A 1 37  ? -2.133  30.293 0.081  1.00 65.52  ? 37  ILE A O   1 
ATOM   206  C  CB  . ILE A 1 37  ? -3.657  32.924 -0.870 1.00 64.61  ? 37  ILE A CB  1 
ATOM   207  C  CG1 . ILE A 1 37  ? -2.849  34.136 -0.397 1.00 63.56  ? 37  ILE A CG1 1 
ATOM   208  C  CG2 . ILE A 1 37  ? -5.017  33.354 -1.421 1.00 63.04  ? 37  ILE A CG2 1 
ATOM   209  C  CD1 . ILE A 1 37  ? -2.566  35.160 -1.493 1.00 63.97  ? 37  ILE A CD1 1 
ATOM   210  N  N   . ASP A 1 38  ? -1.814  31.891 1.626  1.00 66.86  ? 38  ASP A N   1 
ATOM   211  C  CA  . ASP A 1 38  ? -0.523  31.372 2.063  1.00 68.91  ? 38  ASP A CA  1 
ATOM   212  C  C   . ASP A 1 38  ? -0.692  30.243 3.076  1.00 71.67  ? 38  ASP A C   1 
ATOM   213  O  O   . ASP A 1 38  ? 0.257   29.870 3.770  1.00 71.42  ? 38  ASP A O   1 
ATOM   214  C  CB  . ASP A 1 38  ? 0.318   32.502 2.676  1.00 67.65  ? 38  ASP A CB  1 
ATOM   215  C  CG  . ASP A 1 38  ? -0.297  33.078 3.943  1.00 67.06  ? 38  ASP A CG  1 
ATOM   216  O  OD1 . ASP A 1 38  ? -1.524  33.309 3.956  1.00 66.27  ? 38  ASP A OD1 1 
ATOM   217  O  OD2 . ASP A 1 38  ? 0.449   33.310 4.920  1.00 65.33  ? 38  ASP A OD2 1 
ATOM   218  N  N   . GLN A 1 39  ? -1.900  29.694 3.152  1.00 74.78  ? 39  GLN A N   1 
ATOM   219  C  CA  . GLN A 1 39  ? -2.188  28.617 4.095  1.00 77.89  ? 39  GLN A CA  1 
ATOM   220  C  C   . GLN A 1 39  ? -2.843  27.401 3.427  1.00 80.10  ? 39  GLN A C   1 
ATOM   221  O  O   . GLN A 1 39  ? -3.456  27.516 2.359  1.00 79.34  ? 39  GLN A O   1 
ATOM   222  C  CB  . GLN A 1 39  ? -3.098  29.144 5.210  1.00 77.61  ? 39  GLN A CB  1 
ATOM   223  C  CG  . GLN A 1 39  ? -2.575  30.392 5.923  1.00 77.06  ? 39  GLN A CG  1 
ATOM   224  C  CD  . GLN A 1 39  ? -1.340  30.126 6.765  1.00 76.79  ? 39  GLN A CD  1 
ATOM   225  O  OE1 . GLN A 1 39  ? -1.382  29.342 7.708  1.00 76.77  ? 39  GLN A OE1 1 
ATOM   226  N  NE2 . GLN A 1 39  ? -0.234  30.782 6.428  1.00 77.57  ? 39  GLN A NE2 1 
ATOM   227  N  N   . ASP A 1 40  ? -2.712  26.242 4.070  1.00 82.19  ? 40  ASP A N   1 
ATOM   228  C  CA  . ASP A 1 40  ? -3.284  24.996 3.566  1.00 84.85  ? 40  ASP A CA  1 
ATOM   229  C  C   . ASP A 1 40  ? -4.793  24.971 3.815  1.00 85.94  ? 40  ASP A C   1 
ATOM   230  O  O   . ASP A 1 40  ? -5.237  24.688 4.925  1.00 86.39  ? 40  ASP A O   1 
ATOM   231  C  CB  . ASP A 1 40  ? -2.615  23.811 4.263  1.00 86.81  ? 40  ASP A CB  1 
ATOM   232  C  CG  . ASP A 1 40  ? -3.024  22.476 3.670  1.00 89.12  ? 40  ASP A CG  1 
ATOM   233  O  OD1 . ASP A 1 40  ? -2.935  22.322 2.434  1.00 90.08  ? 40  ASP A OD1 1 
ATOM   234  O  OD2 . ASP A 1 40  ? -3.428  21.579 4.440  1.00 90.53  ? 40  ASP A OD2 1 
ATOM   235  N  N   . PRO A 1 41  ? -5.600  25.245 2.773  1.00 86.95  ? 41  PRO A N   1 
ATOM   236  C  CA  . PRO A 1 41  ? -7.068  25.276 2.836  1.00 87.98  ? 41  PRO A CA  1 
ATOM   237  C  C   . PRO A 1 41  ? -7.762  23.985 3.247  1.00 89.03  ? 41  PRO A C   1 
ATOM   238  O  O   . PRO A 1 41  ? -8.916  24.010 3.679  1.00 89.07  ? 41  PRO A O   1 
ATOM   239  C  CB  . PRO A 1 41  ? -7.458  25.700 1.426  1.00 87.68  ? 41  PRO A CB  1 
ATOM   240  C  CG  . PRO A 1 41  ? -6.409  25.046 0.600  1.00 87.50  ? 41  PRO A CG  1 
ATOM   241  C  CD  . PRO A 1 41  ? -5.150  25.382 1.377  1.00 87.43  ? 41  PRO A CD  1 
ATOM   242  N  N   . SER A 1 42  ? -7.061  22.864 3.105  1.00 90.21  ? 42  SER A N   1 
ATOM   243  C  CA  . SER A 1 42  ? -7.617  21.557 3.449  1.00 90.58  ? 42  SER A CA  1 
ATOM   244  C  C   . SER A 1 42  ? -7.834  21.390 4.947  1.00 90.67  ? 42  SER A C   1 
ATOM   245  O  O   . SER A 1 42  ? -8.629  20.551 5.380  1.00 90.50  ? 42  SER A O   1 
ATOM   246  C  CB  . SER A 1 42  ? -6.693  20.444 2.953  1.00 90.32  ? 42  SER A CB  1 
ATOM   247  O  OG  . SER A 1 42  ? -5.460  20.460 3.652  1.00 89.01  ? 42  SER A OG  1 
ATOM   248  N  N   . GLN A 1 43  ? -7.104  22.171 5.736  1.00 89.98  ? 43  GLN A N   1 
ATOM   249  C  CA  . GLN A 1 43  ? -7.228  22.103 7.183  1.00 89.90  ? 43  GLN A CA  1 
ATOM   250  C  C   . GLN A 1 43  ? -8.299  23.081 7.663  1.00 88.54  ? 43  GLN A C   1 
ATOM   251  O  O   . GLN A 1 43  ? -8.144  23.734 8.689  1.00 88.67  ? 43  GLN A O   1 
ATOM   252  C  CB  . GLN A 1 43  ? -5.882  22.421 7.851  1.00 90.94  ? 43  GLN A CB  1 
ATOM   253  C  CG  . GLN A 1 43  ? -4.724  21.538 7.391  1.00 92.28  ? 43  GLN A CG  1 
ATOM   254  C  CD  . GLN A 1 43  ? -3.504  21.628 8.306  1.00 93.77  ? 43  GLN A CD  1 
ATOM   255  O  OE1 . GLN A 1 43  ? -3.512  21.114 9.426  1.00 94.23  ? 43  GLN A OE1 1 
ATOM   256  N  NE2 . GLN A 1 43  ? -2.451  22.288 7.830  1.00 94.36  ? 43  GLN A NE2 1 
ATOM   257  N  N   . ASN A 1 44  ? -9.389  23.176 6.914  1.00 86.95  ? 44  ASN A N   1 
ATOM   258  C  CA  . ASN A 1 44  ? -10.467 24.079 7.276  1.00 85.88  ? 44  ASN A CA  1 
ATOM   259  C  C   . ASN A 1 44  ? -11.791 23.342 7.366  1.00 85.10  ? 44  ASN A C   1 
ATOM   260  O  O   . ASN A 1 44  ? -12.395 22.991 6.352  1.00 85.20  ? 44  ASN A O   1 
ATOM   261  C  CB  . ASN A 1 44  ? -10.569 25.210 6.258  1.00 86.01  ? 44  ASN A CB  1 
ATOM   262  C  CG  . ASN A 1 44  ? -11.550 26.284 6.676  1.00 86.00  ? 44  ASN A CG  1 
ATOM   263  O  OD1 . ASN A 1 44  ? -11.331 27.463 6.411  1.00 87.60  ? 44  ASN A OD1 1 
ATOM   264  N  ND2 . ASN A 1 44  ? -12.642 25.884 7.321  1.00 85.72  ? 44  ASN A ND2 1 
ATOM   265  N  N   . PRO A 1 45  ? -12.267 23.113 8.599  1.00 83.64  ? 45  PRO A N   1 
ATOM   266  C  CA  . PRO A 1 45  ? -13.523 22.418 8.888  1.00 82.35  ? 45  PRO A CA  1 
ATOM   267  C  C   . PRO A 1 45  ? -14.812 23.183 8.583  1.00 82.05  ? 45  PRO A C   1 
ATOM   268  O  O   . PRO A 1 45  ? -15.885 22.583 8.508  1.00 82.46  ? 45  PRO A O   1 
ATOM   269  C  CB  . PRO A 1 45  ? -13.392 22.102 10.371 1.00 82.19  ? 45  PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 45  ? -12.609 23.280 10.883 1.00 81.57  ? 45  PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 45  ? -11.541 23.429 9.843  1.00 81.56  ? 45  PRO A CD  1 
ATOM   272  N  N   . PHE A 1 46  ? -14.716 24.495 8.391  1.00 81.58  ? 46  PHE A N   1 
ATOM   273  C  CA  . PHE A 1 46  ? -15.913 25.301 8.146  1.00 81.04  ? 46  PHE A CA  1 
ATOM   274  C  C   . PHE A 1 46  ? -16.278 25.523 6.690  1.00 82.61  ? 46  PHE A C   1 
ATOM   275  O  O   . PHE A 1 46  ? -17.383 25.974 6.388  1.00 82.22  ? 46  PHE A O   1 
ATOM   276  C  CB  . PHE A 1 46  ? -15.767 26.649 8.853  1.00 77.52  ? 46  PHE A CB  1 
ATOM   277  C  CG  . PHE A 1 46  ? -15.355 26.524 10.288 1.00 73.76  ? 46  PHE A CG  1 
ATOM   278  C  CD1 . PHE A 1 46  ? -16.220 25.977 11.226 1.00 72.37  ? 46  PHE A CD1 1 
ATOM   279  C  CD2 . PHE A 1 46  ? -14.075 26.880 10.685 1.00 72.92  ? 46  PHE A CD2 1 
ATOM   280  C  CE1 . PHE A 1 46  ? -15.817 25.777 12.536 1.00 71.77  ? 46  PHE A CE1 1 
ATOM   281  C  CE2 . PHE A 1 46  ? -13.657 26.686 11.995 1.00 72.39  ? 46  PHE A CE2 1 
ATOM   282  C  CZ  . PHE A 1 46  ? -14.531 26.131 12.925 1.00 73.20  ? 46  PHE A CZ  1 
ATOM   283  N  N   . SER A 1 47  ? -15.359 25.199 5.789  1.00 85.10  ? 47  SER A N   1 
ATOM   284  C  CA  . SER A 1 47  ? -15.599 25.385 4.361  1.00 87.49  ? 47  SER A CA  1 
ATOM   285  C  C   . SER A 1 47  ? -16.030 24.094 3.676  1.00 89.12  ? 47  SER A C   1 
ATOM   286  O  O   . SER A 1 47  ? -15.414 23.043 3.889  1.00 88.64  ? 47  SER A O   1 
ATOM   287  C  CB  . SER A 1 47  ? -14.330 25.929 3.688  1.00 87.27  ? 47  SER A CB  1 
ATOM   288  O  OG  . SER A 1 47  ? -13.217 25.072 3.898  1.00 87.37  ? 47  SER A OG  1 
ATOM   289  N  N   . GLU A 1 48  ? -17.094 24.170 2.868  1.00 91.49  ? 48  GLU A N   1 
ATOM   290  C  CA  . GLU A 1 48  ? -17.575 22.994 2.139  1.00 93.03  ? 48  GLU A CA  1 
ATOM   291  C  C   . GLU A 1 48  ? -16.460 22.560 1.184  1.00 93.54  ? 48  GLU A C   1 
ATOM   292  O  O   . GLU A 1 48  ? -16.065 21.390 1.154  1.00 94.29  ? 48  GLU A O   1 
ATOM   293  C  CB  . GLU A 1 48  ? -18.845 23.327 1.354  1.00 92.88  ? 48  GLU A CB  1 
ATOM   294  N  N   . ASP A 1 49  ? -15.953 23.522 0.420  1.00 92.98  ? 49  ASP A N   1 
ATOM   295  C  CA  . ASP A 1 49  ? -14.872 23.284 -0.527 1.00 92.35  ? 49  ASP A CA  1 
ATOM   296  C  C   . ASP A 1 49  ? -13.553 23.319 0.252  1.00 91.04  ? 49  ASP A C   1 
ATOM   297  O  O   . ASP A 1 49  ? -13.227 24.327 0.872  1.00 91.68  ? 49  ASP A O   1 
ATOM   298  C  CB  . ASP A 1 49  ? -14.883 24.383 -1.592 1.00 93.39  ? 49  ASP A CB  1 
ATOM   299  C  CG  . ASP A 1 49  ? -13.909 24.115 -2.717 1.00 94.97  ? 49  ASP A CG  1 
ATOM   300  O  OD1 . ASP A 1 49  ? -12.758 23.727 -2.425 1.00 95.32  ? 49  ASP A OD1 1 
ATOM   301  O  OD2 . ASP A 1 49  ? -14.293 24.303 -3.893 1.00 95.75  ? 49  ASP A OD2 1 
ATOM   302  N  N   . LYS A 1 50  ? -12.795 22.227 0.226  1.00 89.42  ? 50  LYS A N   1 
ATOM   303  C  CA  . LYS A 1 50  ? -11.532 22.176 0.959  1.00 87.96  ? 50  LYS A CA  1 
ATOM   304  C  C   . LYS A 1 50  ? -10.368 22.831 0.235  1.00 86.26  ? 50  LYS A C   1 
ATOM   305  O  O   . LYS A 1 50  ? -9.216  22.681 0.642  1.00 84.95  ? 50  LYS A O   1 
ATOM   306  C  CB  . LYS A 1 50  ? -11.172 20.730 1.304  1.00 89.29  ? 50  LYS A CB  1 
ATOM   307  C  CG  . LYS A 1 50  ? -12.168 20.053 2.234  1.00 90.70  ? 50  LYS A CG  1 
ATOM   308  C  CD  . LYS A 1 50  ? -12.285 20.781 3.567  1.00 91.11  ? 50  LYS A CD  1 
ATOM   309  C  CE  . LYS A 1 50  ? -13.390 20.176 4.421  1.00 91.16  ? 50  LYS A CE  1 
ATOM   310  N  NZ  . LYS A 1 50  ? -13.565 20.880 5.717  1.00 91.77  ? 50  LYS A NZ  1 
ATOM   311  N  N   . THR A 1 51  ? -10.667 23.553 -0.841 1.00 85.15  ? 51  THR A N   1 
ATOM   312  C  CA  . THR A 1 51  ? -9.635  24.254 -1.603 1.00 83.66  ? 51  THR A CA  1 
ATOM   313  C  C   . THR A 1 51  ? -9.739  25.736 -1.257 1.00 82.73  ? 51  THR A C   1 
ATOM   314  O  O   . THR A 1 51  ? -8.790  26.496 -1.443 1.00 83.23  ? 51  THR A O   1 
ATOM   315  C  CB  . THR A 1 51  ? -9.831  24.107 -3.125 1.00 83.17  ? 51  THR A CB  1 
ATOM   316  O  OG1 . THR A 1 51  ? -10.893 24.966 -3.558 1.00 82.94  ? 51  THR A OG1 1 
ATOM   317  C  CG2 . THR A 1 51  ? -10.170 22.673 -3.482 1.00 83.14  ? 51  THR A CG2 1 
ATOM   318  N  N   . ASP A 1 52  ? -10.908 26.127 -0.754 1.00 80.55  ? 52  ASP A N   1 
ATOM   319  C  CA  . ASP A 1 52  ? -11.185 27.505 -0.366 1.00 78.18  ? 52  ASP A CA  1 
ATOM   320  C  C   . ASP A 1 52  ? -10.157 27.978 0.649  1.00 75.77  ? 52  ASP A C   1 
ATOM   321  O  O   . ASP A 1 52  ? -10.097 27.460 1.759  1.00 76.00  ? 52  ASP A O   1 
ATOM   322  C  CB  . ASP A 1 52  ? -12.594 27.595 0.221  1.00 78.42  ? 52  ASP A CB  1 
ATOM   323  C  CG  . ASP A 1 52  ? -13.014 29.019 0.517  1.00 79.16  ? 52  ASP A CG  1 
ATOM   324  O  OD1 . ASP A 1 52  ? -14.231 29.259 0.639  1.00 78.83  ? 52  ASP A OD1 1 
ATOM   325  O  OD2 . ASP A 1 52  ? -12.134 29.896 0.636  1.00 79.66  ? 52  ASP A OD2 1 
ATOM   326  N  N   . LYS A 1 53  ? -9.354  28.964 0.258  1.00 73.19  ? 53  LYS A N   1 
ATOM   327  C  CA  . LYS A 1 53  ? -8.305  29.499 1.122  1.00 70.95  ? 53  LYS A CA  1 
ATOM   328  C  C   . LYS A 1 53  ? -8.701  30.857 1.683  1.00 67.60  ? 53  LYS A C   1 
ATOM   329  O  O   . LYS A 1 53  ? -7.845  31.620 2.126  1.00 66.10  ? 53  LYS A O   1 
ATOM   330  C  CB  . LYS A 1 53  ? -7.001  29.641 0.334  1.00 73.23  ? 53  LYS A CB  1 
ATOM   331  C  CG  . LYS A 1 53  ? -6.771  28.512 -0.656 1.00 75.45  ? 53  LYS A CG  1 
ATOM   332  C  CD  . LYS A 1 53  ? -5.579  28.763 -1.573 1.00 77.51  ? 53  LYS A CD  1 
ATOM   333  C  CE  . LYS A 1 53  ? -4.253  28.463 -0.890 1.00 78.49  ? 53  LYS A CE  1 
ATOM   334  N  NZ  . LYS A 1 53  ? -3.120  28.498 -1.863 1.00 77.84  ? 53  LYS A NZ  1 
ATOM   335  N  N   . GLY A 1 54  ? -9.997  31.153 1.649  1.00 64.29  ? 54  GLY A N   1 
ATOM   336  C  CA  . GLY A 1 54  ? -10.484 32.415 2.167  1.00 59.68  ? 54  GLY A CA  1 
ATOM   337  C  C   . GLY A 1 54  ? -10.237 32.540 3.661  1.00 57.22  ? 54  GLY A C   1 
ATOM   338  O  O   . GLY A 1 54  ? -9.618  31.674 4.277  1.00 56.54  ? 54  GLY A O   1 
ATOM   339  N  N   . ILE A 1 55  ? -10.710 33.634 4.245  1.00 54.73  ? 55  ILE A N   1 
ATOM   340  C  CA  . ILE A 1 55  ? -10.550 33.877 5.675  1.00 50.80  ? 55  ILE A CA  1 
ATOM   341  C  C   . ILE A 1 55  ? -11.804 33.443 6.441  1.00 49.04  ? 55  ILE A C   1 
ATOM   342  O  O   . ILE A 1 55  ? -12.939 33.733 6.039  1.00 47.07  ? 55  ILE A O   1 
ATOM   343  C  CB  . ILE A 1 55  ? -10.282 35.362 5.949  1.00 49.92  ? 55  ILE A CB  1 
ATOM   344  C  CG1 . ILE A 1 55  ? -9.012  35.802 5.212  1.00 48.98  ? 55  ILE A CG1 1 
ATOM   345  C  CG2 . ILE A 1 55  ? -10.171 35.598 7.450  1.00 48.54  ? 55  ILE A CG2 1 
ATOM   346  C  CD1 . ILE A 1 55  ? -7.715  35.176 5.734  1.00 48.66  ? 55  ILE A CD1 1 
ATOM   347  N  N   . TYR A 1 56  ? -11.587 32.750 7.552  1.00 46.42  ? 56  TYR A N   1 
ATOM   348  C  CA  . TYR A 1 56  ? -12.685 32.248 8.367  1.00 44.55  ? 56  TYR A CA  1 
ATOM   349  C  C   . TYR A 1 56  ? -12.530 32.590 9.830  1.00 43.10  ? 56  TYR A C   1 
ATOM   350  O  O   . TYR A 1 56  ? -11.407 32.699 10.339 1.00 40.78  ? 56  TYR A O   1 
ATOM   351  C  CB  . TYR A 1 56  ? -12.766 30.730 8.249  1.00 46.74  ? 56  TYR A CB  1 
ATOM   352  C  CG  . TYR A 1 56  ? -13.366 30.234 6.963  1.00 48.33  ? 56  TYR A CG  1 
ATOM   353  C  CD1 . TYR A 1 56  ? -14.734 29.943 6.881  1.00 47.23  ? 56  TYR A CD1 1 
ATOM   354  C  CD2 . TYR A 1 56  ? -12.574 30.055 5.824  1.00 48.02  ? 56  TYR A CD2 1 
ATOM   355  C  CE1 . TYR A 1 56  ? -15.299 29.485 5.699  1.00 48.21  ? 56  TYR A CE1 1 
ATOM   356  C  CE2 . TYR A 1 56  ? -13.132 29.594 4.629  1.00 49.62  ? 56  TYR A CE2 1 
ATOM   357  C  CZ  . TYR A 1 56  ? -14.496 29.309 4.575  1.00 48.80  ? 56  TYR A CZ  1 
ATOM   358  O  OH  . TYR A 1 56  ? -15.056 28.842 3.414  1.00 46.90  ? 56  TYR A OH  1 
ATOM   359  N  N   . VAL A 1 57  ? -13.667 32.744 10.503 1.00 41.72  ? 57  VAL A N   1 
ATOM   360  C  CA  . VAL A 1 57  ? -13.677 33.040 11.930 1.00 41.31  ? 57  VAL A CA  1 
ATOM   361  C  C   . VAL A 1 57  ? -13.573 31.702 12.661 1.00 42.49  ? 57  VAL A C   1 
ATOM   362  O  O   . VAL A 1 57  ? -14.479 30.868 12.587 1.00 43.21  ? 57  VAL A O   1 
ATOM   363  C  CB  . VAL A 1 57  ? -14.974 33.766 12.334 1.00 40.91  ? 57  VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 57  ? -14.982 34.042 13.828 1.00 36.53  ? 57  VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 57  ? -15.102 35.064 11.542 1.00 39.93  ? 57  VAL A CG2 1 
ATOM   366  N  N   . THR A 1 58  ? -12.460 31.488 13.352 1.00 42.83  ? 58  THR A N   1 
ATOM   367  C  CA  . THR A 1 58  ? -12.256 30.237 14.064 1.00 45.84  ? 58  THR A CA  1 
ATOM   368  C  C   . THR A 1 58  ? -12.612 30.318 15.544 1.00 47.27  ? 58  THR A C   1 
ATOM   369  O  O   . THR A 1 58  ? -12.759 29.299 16.213 1.00 48.70  ? 58  THR A O   1 
ATOM   370  C  CB  . THR A 1 58  ? -10.805 29.779 13.969 1.00 45.23  ? 58  THR A CB  1 
ATOM   371  O  OG1 . THR A 1 58  ? -9.971  30.723 14.641 1.00 49.34  ? 58  THR A OG1 1 
ATOM   372  C  CG2 . THR A 1 58  ? -10.372 29.679 12.539 1.00 46.68  ? 58  THR A CG2 1 
ATOM   373  N  N   . ARG A 1 59  ? -12.754 31.532 16.054 1.00 48.73  ? 59  ARG A N   1 
ATOM   374  C  CA  . ARG A 1 59  ? -13.077 31.730 17.458 1.00 48.76  ? 59  ARG A CA  1 
ATOM   375  C  C   . ARG A 1 59  ? -13.805 33.038 17.687 1.00 47.17  ? 59  ARG A C   1 
ATOM   376  O  O   . ARG A 1 59  ? -13.553 34.027 17.002 1.00 48.05  ? 59  ARG A O   1 
ATOM   377  C  CB  . ARG A 1 59  ? -11.795 31.726 18.290 1.00 51.48  ? 59  ARG A CB  1 
ATOM   378  C  CG  . ARG A 1 59  ? -11.222 30.362 18.570 1.00 55.22  ? 59  ARG A CG  1 
ATOM   379  C  CD  . ARG A 1 59  ? -9.806  30.472 19.070 1.00 60.21  ? 59  ARG A CD  1 
ATOM   380  N  NE  . ARG A 1 59  ? -9.339  29.221 19.660 1.00 67.52  ? 59  ARG A NE  1 
ATOM   381  C  CZ  . ARG A 1 59  ? -8.056  28.880 19.771 1.00 70.57  ? 59  ARG A CZ  1 
ATOM   382  N  NH1 . ARG A 1 59  ? -7.102  29.692 19.324 1.00 71.58  ? 59  ARG A NH1 1 
ATOM   383  N  NH2 . ARG A 1 59  ? -7.726  27.729 20.342 1.00 71.64  ? 59  ARG A NH2 1 
ATOM   384  N  N   . VAL A 1 60  ? -14.703 33.038 18.660 1.00 45.01  ? 60  VAL A N   1 
ATOM   385  C  CA  . VAL A 1 60  ? -15.456 34.233 19.011 1.00 42.75  ? 60  VAL A CA  1 
ATOM   386  C  C   . VAL A 1 60  ? -15.575 34.291 20.532 1.00 44.14  ? 60  VAL A C   1 
ATOM   387  O  O   . VAL A 1 60  ? -16.315 33.530 21.131 1.00 46.11  ? 60  VAL A O   1 
ATOM   388  C  CB  . VAL A 1 60  ? -16.856 34.220 18.392 1.00 39.60  ? 60  VAL A CB  1 
ATOM   389  C  CG1 . VAL A 1 60  ? -17.612 35.461 18.799 1.00 39.39  ? 60  VAL A CG1 1 
ATOM   390  C  CG2 . VAL A 1 60  ? -16.756 34.143 16.897 1.00 35.86  ? 60  VAL A CG2 1 
ATOM   391  N  N   . SER A 1 61  ? -14.832 35.194 21.158 1.00 44.50  ? 61  SER A N   1 
ATOM   392  C  CA  . SER A 1 61  ? -14.850 35.325 22.603 1.00 41.86  ? 61  SER A CA  1 
ATOM   393  C  C   . SER A 1 61  ? -16.208 35.690 23.187 1.00 42.22  ? 61  SER A C   1 
ATOM   394  O  O   . SER A 1 61  ? -16.929 36.523 22.627 1.00 39.97  ? 61  SER A O   1 
ATOM   395  C  CB  . SER A 1 61  ? -13.819 36.347 23.009 1.00 43.54  ? 61  SER A CB  1 
ATOM   396  O  OG  . SER A 1 61  ? -12.563 35.987 22.461 1.00 46.40  ? 61  SER A OG  1 
ATOM   397  N  N   . GLU A 1 62  ? -16.546 35.046 24.315 1.00 42.32  ? 62  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 62  ? -17.815 35.278 25.014 1.00 40.25  ? 62  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 62  ? -17.851 36.677 25.590 1.00 39.78  ? 62  GLU A C   1 
ATOM   400  O  O   . GLU A 1 62  ? -16.901 37.106 26.253 1.00 38.64  ? 62  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 62  ? -18.017 34.287 26.176 1.00 38.12  ? 62  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 62  ? -19.191 33.343 26.012 1.00 35.71  ? 62  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 62  ? -20.512 34.040 25.721 1.00 33.64  ? 62  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 62  ? -20.994 34.782 26.583 1.00 35.78  ? 62  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 62  ? -21.085 33.836 24.639 1.00 30.08  ? 62  GLU A OE2 1 
ATOM   406  N  N   . GLY A 1 63  ? -18.956 37.375 25.350 1.00 38.90  ? 63  GLY A N   1 
ATOM   407  C  CA  . GLY A 1 63  ? -19.098 38.721 25.860 1.00 39.67  ? 63  GLY A CA  1 
ATOM   408  C  C   . GLY A 1 63  ? -18.131 39.694 25.220 1.00 40.08  ? 63  GLY A C   1 
ATOM   409  O  O   . GLY A 1 63  ? -17.859 40.749 25.780 1.00 43.48  ? 63  GLY A O   1 
ATOM   410  N  N   . GLY A 1 64  ? -17.600 39.339 24.058 1.00 39.06  ? 64  GLY A N   1 
ATOM   411  C  CA  . GLY A 1 64  ? -16.678 40.217 23.377 1.00 38.09  ? 64  GLY A CA  1 
ATOM   412  C  C   . GLY A 1 64  ? -17.422 41.078 22.372 1.00 38.55  ? 64  GLY A C   1 
ATOM   413  O  O   . GLY A 1 64  ? -18.625 40.895 22.167 1.00 37.03  ? 64  GLY A O   1 
ATOM   414  N  N   . PRO A 1 65  ? -16.734 42.045 21.744 1.00 38.18  ? 65  PRO A N   1 
ATOM   415  C  CA  . PRO A 1 65  ? -17.348 42.930 20.755 1.00 37.87  ? 65  PRO A CA  1 
ATOM   416  C  C   . PRO A 1 65  ? -17.940 42.148 19.575 1.00 38.53  ? 65  PRO A C   1 
ATOM   417  O  O   . PRO A 1 65  ? -19.101 42.349 19.194 1.00 37.92  ? 65  PRO A O   1 
ATOM   418  C  CB  . PRO A 1 65  ? -16.187 43.823 20.342 1.00 36.94  ? 65  PRO A CB  1 
ATOM   419  C  CG  . PRO A 1 65  ? -15.401 43.938 21.629 1.00 36.37  ? 65  PRO A CG  1 
ATOM   420  C  CD  . PRO A 1 65  ? -15.376 42.506 22.091 1.00 36.85  ? 65  PRO A CD  1 
ATOM   421  N  N   . ALA A 1 66  ? -17.136 41.256 19.009 1.00 38.58  ? 66  ALA A N   1 
ATOM   422  C  CA  . ALA A 1 66  ? -17.561 40.444 17.878 1.00 39.16  ? 66  ALA A CA  1 
ATOM   423  C  C   . ALA A 1 66  ? -18.793 39.595 18.200 1.00 40.58  ? 66  ALA A C   1 
ATOM   424  O  O   . ALA A 1 66  ? -19.754 39.543 17.418 1.00 38.61  ? 66  ALA A O   1 
ATOM   425  C  CB  . ALA A 1 66  ? -16.418 39.550 17.434 1.00 38.59  ? 66  ALA A CB  1 
ATOM   426  N  N   . GLU A 1 67  ? -18.788 38.933 19.354 1.00 42.13  ? 67  GLU A N   1 
ATOM   427  C  CA  . GLU A 1 67  ? -19.940 38.105 19.694 1.00 43.61  ? 67  GLU A CA  1 
ATOM   428  C  C   . GLU A 1 67  ? -21.207 38.941 19.798 1.00 43.28  ? 67  GLU A C   1 
ATOM   429  O  O   . GLU A 1 67  ? -22.263 38.548 19.319 1.00 44.67  ? 67  GLU A O   1 
ATOM   430  C  CB  . GLU A 1 67  ? -19.735 37.374 21.012 1.00 43.95  ? 67  GLU A CB  1 
ATOM   431  C  CG  . GLU A 1 67  ? -20.662 36.188 21.147 1.00 44.08  ? 67  GLU A CG  1 
ATOM   432  C  CD  . GLU A 1 67  ? -21.089 35.934 22.573 1.00 48.01  ? 67  GLU A CD  1 
ATOM   433  O  OE1 . GLU A 1 67  ? -20.265 36.161 23.501 1.00 46.76  ? 67  GLU A OE1 1 
ATOM   434  O  OE2 . GLU A 1 67  ? -22.251 35.490 22.756 1.00 50.05  ? 67  GLU A OE2 1 
ATOM   435  N  N   . ILE A 1 68  ? -21.097 40.093 20.441 1.00 43.00  ? 68  ILE A N   1 
ATOM   436  C  CA  . ILE A 1 68  ? -22.237 40.983 20.607 1.00 42.49  ? 68  ILE A CA  1 
ATOM   437  C  C   . ILE A 1 68  ? -22.686 41.561 19.261 1.00 42.89  ? 68  ILE A C   1 
ATOM   438  O  O   . ILE A 1 68  ? -23.863 41.860 19.069 1.00 41.37  ? 68  ILE A O   1 
ATOM   439  C  CB  . ILE A 1 68  ? -21.867 42.131 21.581 1.00 41.63  ? 68  ILE A CB  1 
ATOM   440  C  CG1 . ILE A 1 68  ? -21.491 41.535 22.938 1.00 41.99  ? 68  ILE A CG1 1 
ATOM   441  C  CG2 . ILE A 1 68  ? -23.028 43.067 21.769 1.00 38.12  ? 68  ILE A CG2 1 
ATOM   442  C  CD1 . ILE A 1 68  ? -20.840 42.508 23.893 1.00 43.88  ? 68  ILE A CD1 1 
ATOM   443  N  N   . ALA A 1 69  ? -21.736 41.689 18.334 1.00 43.08  ? 69  ALA A N   1 
ATOM   444  C  CA  . ALA A 1 69  ? -21.988 42.242 17.016 1.00 43.12  ? 69  ALA A CA  1 
ATOM   445  C  C   . ALA A 1 69  ? -22.642 41.251 16.048 1.00 45.72  ? 69  ALA A C   1 
ATOM   446  O  O   . ALA A 1 69  ? -23.200 41.663 15.021 1.00 47.95  ? 69  ALA A O   1 
ATOM   447  C  CB  . ALA A 1 69  ? -20.690 42.766 16.430 1.00 40.99  ? 69  ALA A CB  1 
ATOM   448  N  N   . GLY A 1 70  ? -22.572 39.956 16.359 1.00 44.75  ? 70  GLY A N   1 
ATOM   449  C  CA  . GLY A 1 70  ? -23.187 38.967 15.488 1.00 44.35  ? 70  GLY A CA  1 
ATOM   450  C  C   . GLY A 1 70  ? -22.237 37.973 14.834 1.00 45.16  ? 70  GLY A C   1 
ATOM   451  O  O   . GLY A 1 70  ? -22.668 36.979 14.250 1.00 44.94  ? 70  GLY A O   1 
ATOM   452  N  N   . LEU A 1 71  ? -20.939 38.236 14.914 1.00 44.44  ? 71  LEU A N   1 
ATOM   453  C  CA  . LEU A 1 71  ? -19.964 37.333 14.331 1.00 43.44  ? 71  LEU A CA  1 
ATOM   454  C  C   . LEU A 1 71  ? -20.185 35.936 14.905 1.00 44.29  ? 71  LEU A C   1 
ATOM   455  O  O   . LEU A 1 71  ? -20.417 35.781 16.099 1.00 44.76  ? 71  LEU A O   1 
ATOM   456  C  CB  . LEU A 1 71  ? -18.551 37.794 14.669 1.00 42.04  ? 71  LEU A CB  1 
ATOM   457  C  CG  . LEU A 1 71  ? -17.542 37.996 13.545 1.00 40.85  ? 71  LEU A CG  1 
ATOM   458  C  CD1 . LEU A 1 71  ? -16.214 37.426 14.000 1.00 37.80  ? 71  LEU A CD1 1 
ATOM   459  C  CD2 . LEU A 1 71  ? -18.012 37.345 12.255 1.00 42.36  ? 71  LEU A CD2 1 
ATOM   460  N  N   . GLN A 1 72  ? -20.109 34.927 14.046 1.00 45.57  ? 72  GLN A N   1 
ATOM   461  C  CA  . GLN A 1 72  ? -20.291 33.540 14.448 1.00 46.74  ? 72  GLN A CA  1 
ATOM   462  C  C   . GLN A 1 72  ? -19.121 32.703 13.965 1.00 46.06  ? 72  GLN A C   1 
ATOM   463  O  O   . GLN A 1 72  ? -18.579 32.966 12.891 1.00 47.73  ? 72  GLN A O   1 
ATOM   464  C  CB  . GLN A 1 72  ? -21.588 32.983 13.865 1.00 48.90  ? 72  GLN A CB  1 
ATOM   465  C  CG  . GLN A 1 72  ? -22.846 33.467 14.554 1.00 53.96  ? 72  GLN A CG  1 
ATOM   466  C  CD  . GLN A 1 72  ? -24.089 32.820 13.977 1.00 58.97  ? 72  GLN A CD  1 
ATOM   467  O  OE1 . GLN A 1 72  ? -24.200 31.588 13.934 1.00 62.47  ? 72  GLN A OE1 1 
ATOM   468  N  NE2 . GLN A 1 72  ? -25.035 33.643 13.525 1.00 60.87  ? 72  GLN A NE2 1 
ATOM   469  N  N   . ILE A 1 73  ? -18.728 31.708 14.753 1.00 44.57  ? 73  ILE A N   1 
ATOM   470  C  CA  . ILE A 1 73  ? -17.624 30.840 14.377 1.00 46.23  ? 73  ILE A CA  1 
ATOM   471  C  C   . ILE A 1 73  ? -17.956 30.179 13.048 1.00 47.30  ? 73  ILE A C   1 
ATOM   472  O  O   . ILE A 1 73  ? -19.105 29.830 12.799 1.00 47.37  ? 73  ILE A O   1 
ATOM   473  C  CB  . ILE A 1 73  ? -17.390 29.736 15.414 1.00 47.77  ? 73  ILE A CB  1 
ATOM   474  C  CG1 . ILE A 1 73  ? -17.179 30.350 16.797 1.00 46.08  ? 73  ILE A CG1 1 
ATOM   475  C  CG2 . ILE A 1 73  ? -16.180 28.891 15.009 1.00 49.06  ? 73  ILE A CG2 1 
ATOM   476  C  CD1 . ILE A 1 73  ? -16.956 29.329 17.880 1.00 46.76  ? 73  ILE A CD1 1 
ATOM   477  N  N   . GLY A 1 74  ? -16.952 30.024 12.188 1.00 47.73  ? 74  GLY A N   1 
ATOM   478  C  CA  . GLY A 1 74  ? -17.188 29.422 10.888 1.00 48.52  ? 74  GLY A CA  1 
ATOM   479  C  C   . GLY A 1 74  ? -17.571 30.418 9.804  1.00 48.76  ? 74  GLY A C   1 
ATOM   480  O  O   . GLY A 1 74  ? -17.675 30.051 8.635  1.00 47.60  ? 74  GLY A O   1 
ATOM   481  N  N   . ASP A 1 75  ? -17.799 31.673 10.186 1.00 49.91  ? 75  ASP A N   1 
ATOM   482  C  CA  . ASP A 1 75  ? -18.144 32.717 9.219  1.00 51.12  ? 75  ASP A CA  1 
ATOM   483  C  C   . ASP A 1 75  ? -16.952 33.009 8.296  1.00 51.18  ? 75  ASP A C   1 
ATOM   484  O  O   . ASP A 1 75  ? -15.794 33.010 8.730  1.00 52.54  ? 75  ASP A O   1 
ATOM   485  C  CB  . ASP A 1 75  ? -18.523 34.016 9.940  1.00 52.98  ? 75  ASP A CB  1 
ATOM   486  C  CG  . ASP A 1 75  ? -19.911 33.975 10.567 1.00 53.13  ? 75  ASP A CG  1 
ATOM   487  O  OD1 . ASP A 1 75  ? -20.659 32.999 10.351 1.00 53.23  ? 75  ASP A OD1 1 
ATOM   488  O  OD2 . ASP A 1 75  ? -20.254 34.947 11.270 1.00 50.90  ? 75  ASP A OD2 1 
ATOM   489  N  N   . LYS A 1 76  ? -17.229 33.256 7.026  1.00 50.84  ? 76  LYS A N   1 
ATOM   490  C  CA  . LYS A 1 76  ? -16.165 33.556 6.081  1.00 51.78  ? 76  LYS A CA  1 
ATOM   491  C  C   . LYS A 1 76  ? -16.150 35.054 5.817  1.00 51.16  ? 76  LYS A C   1 
ATOM   492  O  O   . LYS A 1 76  ? -17.145 35.625 5.370  1.00 50.70  ? 76  LYS A O   1 
ATOM   493  C  CB  . LYS A 1 76  ? -16.377 32.798 4.765  1.00 54.10  ? 76  LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 76  ? -15.256 33.015 3.756  1.00 56.76  ? 76  LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 76  ? -15.521 32.327 2.437  1.00 58.66  ? 76  LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 76  ? -14.342 32.522 1.487  1.00 61.85  ? 76  LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 76  ? -14.539 31.846 0.168  1.00 63.75  ? 76  LYS A NZ  1 
ATOM   498  N  N   . ILE A 1 77  ? -15.018 35.691 6.090  1.00 50.90  ? 77  ILE A N   1 
ATOM   499  C  CA  . ILE A 1 77  ? -14.895 37.132 5.889  1.00 52.41  ? 77  ILE A CA  1 
ATOM   500  C  C   . ILE A 1 77  ? -14.629 37.494 4.432  1.00 52.86  ? 77  ILE A C   1 
ATOM   501  O  O   . ILE A 1 77  ? -13.530 37.302 3.935  1.00 53.11  ? 77  ILE A O   1 
ATOM   502  C  CB  . ILE A 1 77  ? -13.761 37.708 6.760  1.00 51.45  ? 77  ILE A CB  1 
ATOM   503  C  CG1 . ILE A 1 77  ? -14.012 37.349 8.229  1.00 50.73  ? 77  ILE A CG1 1 
ATOM   504  C  CG2 . ILE A 1 77  ? -13.685 39.219 6.580  1.00 50.13  ? 77  ILE A CG2 1 
ATOM   505  C  CD1 . ILE A 1 77  ? -12.917 37.767 9.177  1.00 50.43  ? 77  ILE A CD1 1 
ATOM   506  N  N   . MET A 1 78  ? -15.642 38.021 3.754  1.00 54.43  ? 78  MET A N   1 
ATOM   507  C  CA  . MET A 1 78  ? -15.507 38.407 2.351  1.00 55.35  ? 78  MET A CA  1 
ATOM   508  C  C   . MET A 1 78  ? -14.711 39.695 2.231  1.00 54.98  ? 78  MET A C   1 
ATOM   509  O  O   . MET A 1 78  ? -13.747 39.756 1.476  1.00 55.32  ? 78  MET A O   1 
ATOM   510  C  CB  . MET A 1 78  ? -16.883 38.609 1.700  1.00 58.51  ? 78  MET A CB  1 
ATOM   511  C  CG  . MET A 1 78  ? -17.866 37.454 1.877  1.00 61.35  ? 78  MET A CG  1 
ATOM   512  S  SD  . MET A 1 78  ? -17.107 35.838 1.600  1.00 70.04  ? 78  MET A SD  1 
ATOM   513  C  CE  . MET A 1 78  ? -16.984 35.796 -0.205 1.00 68.53  ? 78  MET A CE  1 
ATOM   514  N  N   . GLN A 1 79  ? -15.117 40.727 2.968  1.00 54.52  ? 79  GLN A N   1 
ATOM   515  C  CA  . GLN A 1 79  ? -14.411 42.003 2.926  1.00 54.35  ? 79  GLN A CA  1 
ATOM   516  C  C   . GLN A 1 79  ? -14.498 42.794 4.223  1.00 52.53  ? 79  GLN A C   1 
ATOM   517  O  O   . GLN A 1 79  ? -15.440 42.654 5.001  1.00 52.34  ? 79  GLN A O   1 
ATOM   518  C  CB  . GLN A 1 79  ? -14.926 42.866 1.774  1.00 55.61  ? 79  GLN A CB  1 
ATOM   519  C  CG  . GLN A 1 79  ? -16.327 43.367 1.962  1.00 59.92  ? 79  GLN A CG  1 
ATOM   520  C  CD  . GLN A 1 79  ? -16.751 44.317 0.860  1.00 62.54  ? 79  GLN A CD  1 
ATOM   521  O  OE1 . GLN A 1 79  ? -16.796 43.945 -0.316 1.00 62.31  ? 79  GLN A OE1 1 
ATOM   522  N  NE2 . GLN A 1 79  ? -17.067 45.554 1.237  1.00 63.68  ? 79  GLN A NE2 1 
ATOM   523  N  N   . VAL A 1 80  ? -13.501 43.641 4.437  1.00 51.13  ? 80  VAL A N   1 
ATOM   524  C  CA  . VAL A 1 80  ? -13.419 44.460 5.634  1.00 50.72  ? 80  VAL A CA  1 
ATOM   525  C  C   . VAL A 1 80  ? -13.241 45.927 5.256  1.00 50.96  ? 80  VAL A C   1 
ATOM   526  O  O   . VAL A 1 80  ? -12.254 46.294 4.623  1.00 50.21  ? 80  VAL A O   1 
ATOM   527  C  CB  . VAL A 1 80  ? -12.217 44.016 6.513  1.00 48.97  ? 80  VAL A CB  1 
ATOM   528  C  CG1 . VAL A 1 80  ? -12.100 44.883 7.742  1.00 47.37  ? 80  VAL A CG1 1 
ATOM   529  C  CG2 . VAL A 1 80  ? -12.385 42.573 6.902  1.00 50.61  ? 80  VAL A CG2 1 
ATOM   530  N  N   . ASN A 1 81  ? -14.198 46.761 5.655  1.00 51.93  ? 81  ASN A N   1 
ATOM   531  C  CA  . ASN A 1 81  ? -14.141 48.190 5.374  1.00 52.75  ? 81  ASN A CA  1 
ATOM   532  C  C   . ASN A 1 81  ? -13.763 48.484 3.928  1.00 54.70  ? 81  ASN A C   1 
ATOM   533  O  O   . ASN A 1 81  ? -12.845 49.268 3.658  1.00 54.02  ? 81  ASN A O   1 
ATOM   534  C  CB  . ASN A 1 81  ? -13.138 48.868 6.307  1.00 51.26  ? 81  ASN A CB  1 
ATOM   535  C  CG  . ASN A 1 81  ? -13.626 48.935 7.729  1.00 50.62  ? 81  ASN A CG  1 
ATOM   536  O  OD1 . ASN A 1 81  ? -14.804 48.707 7.995  1.00 52.06  ? 81  ASN A OD1 1 
ATOM   537  N  ND2 . ASN A 1 81  ? -12.729 49.263 8.655  1.00 48.76  ? 81  ASN A ND2 1 
ATOM   538  N  N   . GLY A 1 82  ? -14.469 47.848 3.000  1.00 55.94  ? 82  GLY A N   1 
ATOM   539  C  CA  . GLY A 1 82  ? -14.185 48.062 1.595  1.00 57.38  ? 82  GLY A CA  1 
ATOM   540  C  C   . GLY A 1 82  ? -13.132 47.138 1.014  1.00 58.66  ? 82  GLY A C   1 
ATOM   541  O  O   . GLY A 1 82  ? -13.259 46.719 -0.126 1.00 61.06  ? 82  GLY A O   1 
ATOM   542  N  N   . TRP A 1 83  ? -12.098 46.813 1.782  1.00 60.00  ? 83  TRP A N   1 
ATOM   543  C  CA  . TRP A 1 83  ? -11.035 45.938 1.291  1.00 61.31  ? 83  TRP A CA  1 
ATOM   544  C  C   . TRP A 1 83  ? -11.472 44.499 1.115  1.00 61.48  ? 83  TRP A C   1 
ATOM   545  O  O   . TRP A 1 83  ? -12.210 43.964 1.929  1.00 62.94  ? 83  TRP A O   1 
ATOM   546  C  CB  . TRP A 1 83  ? -9.834  45.970 2.230  1.00 62.83  ? 83  TRP A CB  1 
ATOM   547  C  CG  . TRP A 1 83  ? -9.226  47.314 2.370  1.00 65.68  ? 83  TRP A CG  1 
ATOM   548  C  CD1 . TRP A 1 83  ? -9.737  48.375 3.052  1.00 66.97  ? 83  TRP A CD1 1 
ATOM   549  C  CD2 . TRP A 1 83  ? -7.995  47.759 1.797  1.00 67.58  ? 83  TRP A CD2 1 
ATOM   550  N  NE1 . TRP A 1 83  ? -8.901  49.459 2.941  1.00 68.46  ? 83  TRP A NE1 1 
ATOM   551  C  CE2 . TRP A 1 83  ? -7.822  49.110 2.175  1.00 68.56  ? 83  TRP A CE2 1 
ATOM   552  C  CE3 . TRP A 1 83  ? -7.018  47.149 0.997  1.00 68.05  ? 83  TRP A CE3 1 
ATOM   553  C  CZ2 . TRP A 1 83  ? -6.708  49.863 1.784  1.00 68.33  ? 83  TRP A CZ2 1 
ATOM   554  C  CZ3 . TRP A 1 83  ? -5.911  47.898 0.607  1.00 67.31  ? 83  TRP A CZ3 1 
ATOM   555  C  CH2 . TRP A 1 83  ? -5.768  49.241 1.002  1.00 68.30  ? 83  TRP A CH2 1 
ATOM   556  N  N   . ASP A 1 84  ? -10.999 43.867 0.051  1.00 62.25  ? 84  ASP A N   1 
ATOM   557  C  CA  . ASP A 1 84  ? -11.343 42.481 -0.202 1.00 64.18  ? 84  ASP A CA  1 
ATOM   558  C  C   . ASP A 1 84  ? -10.565 41.537 0.705  1.00 65.02  ? 84  ASP A C   1 
ATOM   559  O  O   . ASP A 1 84  ? -9.393  41.768 0.993  1.00 66.08  ? 84  ASP A O   1 
ATOM   560  C  CB  . ASP A 1 84  ? -11.066 42.130 -1.656 1.00 65.90  ? 84  ASP A CB  1 
ATOM   561  C  CG  . ASP A 1 84  ? -10.973 40.637 -1.880 1.00 67.88  ? 84  ASP A CG  1 
ATOM   562  O  OD1 . ASP A 1 84  ? -9.858  40.090 -1.715 1.00 67.54  ? 84  ASP A OD1 1 
ATOM   563  O  OD2 . ASP A 1 84  ? -12.015 40.018 -2.206 1.00 68.87  ? 84  ASP A OD2 1 
ATOM   564  N  N   . MET A 1 85  ? -11.219 40.463 1.140  1.00 65.35  ? 85  MET A N   1 
ATOM   565  C  CA  . MET A 1 85  ? -10.591 39.487 2.028  1.00 64.68  ? 85  MET A CA  1 
ATOM   566  C  C   . MET A 1 85  ? -10.600 38.075 1.454  1.00 64.10  ? 85  MET A C   1 
ATOM   567  O  O   . MET A 1 85  ? -10.228 37.122 2.131  1.00 63.91  ? 85  MET A O   1 
ATOM   568  C  CB  . MET A 1 85  ? -11.306 39.484 3.383  1.00 63.89  ? 85  MET A CB  1 
ATOM   569  C  CG  . MET A 1 85  ? -11.219 40.789 4.135  1.00 62.64  ? 85  MET A CG  1 
ATOM   570  S  SD  . MET A 1 85  ? -9.566  41.086 4.767  1.00 65.21  ? 85  MET A SD  1 
ATOM   571  C  CE  . MET A 1 85  ? -9.699  40.445 6.442  1.00 64.41  ? 85  MET A CE  1 
ATOM   572  N  N   . THR A 1 86  ? -11.015 37.937 0.203  1.00 64.87  ? 86  THR A N   1 
ATOM   573  C  CA  . THR A 1 86  ? -11.068 36.617 -0.412 1.00 67.61  ? 86  THR A CA  1 
ATOM   574  C  C   . THR A 1 86  ? -9.734  36.132 -0.989 1.00 69.21  ? 86  THR A C   1 
ATOM   575  O  O   . THR A 1 86  ? -9.448  34.929 -0.966 1.00 70.07  ? 86  THR A O   1 
ATOM   576  C  CB  . THR A 1 86  ? -12.118 36.575 -1.525 1.00 66.79  ? 86  THR A CB  1 
ATOM   577  O  OG1 . THR A 1 86  ? -11.701 37.424 -2.598 1.00 68.04  ? 86  THR A OG1 1 
ATOM   578  C  CG2 . THR A 1 86  ? -13.466 37.061 -1.008 1.00 66.40  ? 86  THR A CG2 1 
ATOM   579  N  N   . MET A 1 87  ? -8.915  37.060 -1.484 1.00 69.91  ? 87  MET A N   1 
ATOM   580  C  CA  . MET A 1 87  ? -7.631  36.706 -2.089 1.00 70.67  ? 87  MET A CA  1 
ATOM   581  C  C   . MET A 1 87  ? -6.420  37.223 -1.331 1.00 68.96  ? 87  MET A C   1 
ATOM   582  O  O   . MET A 1 87  ? -5.407  37.549 -1.943 1.00 69.60  ? 87  MET A O   1 
ATOM   583  C  CB  . MET A 1 87  ? -7.563  37.238 -3.527 1.00 75.10  ? 87  MET A CB  1 
ATOM   584  C  CG  . MET A 1 87  ? -8.673  36.757 -4.460 1.00 79.93  ? 87  MET A CG  1 
ATOM   585  S  SD  . MET A 1 87  ? -8.638  34.968 -4.766 1.00 85.62  ? 87  MET A SD  1 
ATOM   586  C  CE  . MET A 1 87  ? -7.491  34.885 -6.167 1.00 85.15  ? 87  MET A CE  1 
ATOM   587  N  N   . VAL A 1 88  ? -6.504  37.295 -0.010 1.00 66.68  ? 88  VAL A N   1 
ATOM   588  C  CA  . VAL A 1 88  ? -5.381  37.792 0.774  1.00 64.36  ? 88  VAL A CA  1 
ATOM   589  C  C   . VAL A 1 88  ? -4.688  36.722 1.598  1.00 62.80  ? 88  VAL A C   1 
ATOM   590  O  O   . VAL A 1 88  ? -5.210  35.625 1.779  1.00 62.66  ? 88  VAL A O   1 
ATOM   591  C  CB  . VAL A 1 88  ? -5.821  38.920 1.728  1.00 64.94  ? 88  VAL A CB  1 
ATOM   592  C  CG1 . VAL A 1 88  ? -6.368  40.079 0.932  1.00 65.15  ? 88  VAL A CG1 1 
ATOM   593  C  CG2 . VAL A 1 88  ? -6.871  38.404 2.702  1.00 65.70  ? 88  VAL A CG2 1 
ATOM   594  N  N   . THR A 1 89  ? -3.501  37.056 2.091  1.00 61.60  ? 89  THR A N   1 
ATOM   595  C  CA  . THR A 1 89  ? -2.729  36.144 2.917  1.00 61.60  ? 89  THR A CA  1 
ATOM   596  C  C   . THR A 1 89  ? -3.172  36.329 4.361  1.00 61.98  ? 89  THR A C   1 
ATOM   597  O  O   . THR A 1 89  ? -3.887  37.277 4.682  1.00 62.17  ? 89  THR A O   1 
ATOM   598  C  CB  . THR A 1 89  ? -1.228  36.440 2.834  1.00 60.79  ? 89  THR A CB  1 
ATOM   599  O  OG1 . THR A 1 89  ? -0.945  37.677 3.499  1.00 61.02  ? 89  THR A OG1 1 
ATOM   600  C  CG2 . THR A 1 89  ? -0.791  36.536 1.389  1.00 61.12  ? 89  THR A CG2 1 
ATOM   601  N  N   . HIS A 1 90  ? -2.738  35.429 5.233  1.00 61.68  ? 90  HIS A N   1 
ATOM   602  C  CA  . HIS A 1 90  ? -3.111  35.505 6.631  1.00 61.83  ? 90  HIS A CA  1 
ATOM   603  C  C   . HIS A 1 90  ? -2.736  36.851 7.232  1.00 63.63  ? 90  HIS A C   1 
ATOM   604  O  O   . HIS A 1 90  ? -3.580  37.522 7.813  1.00 64.09  ? 90  HIS A O   1 
ATOM   605  C  CB  . HIS A 1 90  ? -2.438  34.390 7.422  1.00 60.68  ? 90  HIS A CB  1 
ATOM   606  C  CG  . HIS A 1 90  ? -3.024  34.179 8.783  1.00 60.73  ? 90  HIS A CG  1 
ATOM   607  N  ND1 . HIS A 1 90  ? -4.217  33.518 8.985  1.00 59.73  ? 90  HIS A ND1 1 
ATOM   608  C  CD2 . HIS A 1 90  ? -2.587  34.549 10.010 1.00 59.23  ? 90  HIS A CD2 1 
ATOM   609  C  CE1 . HIS A 1 90  ? -4.487  33.489 10.276 1.00 58.89  ? 90  HIS A CE1 1 
ATOM   610  N  NE2 . HIS A 1 90  ? -3.514  34.108 10.920 1.00 58.68  ? 90  HIS A NE2 1 
ATOM   611  N  N   . ASP A 1 91  ? -1.471  37.242 7.095  1.00 65.75  ? 91  ASP A N   1 
ATOM   612  C  CA  . ASP A 1 91  ? -1.000  38.516 7.631  1.00 66.08  ? 91  ASP A CA  1 
ATOM   613  C  C   . ASP A 1 91  ? -1.758  39.719 7.091  1.00 65.09  ? 91  ASP A C   1 
ATOM   614  O  O   . ASP A 1 91  ? -1.982  40.690 7.812  1.00 63.13  ? 91  ASP A O   1 
ATOM   615  C  CB  . ASP A 1 91  ? 0.487   38.707 7.345  1.00 70.28  ? 91  ASP A CB  1 
ATOM   616  C  CG  . ASP A 1 91  ? 1.365   38.113 8.419  1.00 75.01  ? 91  ASP A CG  1 
ATOM   617  O  OD1 . ASP A 1 91  ? 2.597   38.333 8.369  1.00 77.95  ? 91  ASP A OD1 1 
ATOM   618  O  OD2 . ASP A 1 91  ? 0.824   37.429 9.314  1.00 76.91  ? 91  ASP A OD2 1 
ATOM   619  N  N   . GLN A 1 92  ? -2.147  39.661 5.823  1.00 63.85  ? 92  GLN A N   1 
ATOM   620  C  CA  . GLN A 1 92  ? -2.871  40.765 5.222  1.00 63.05  ? 92  GLN A CA  1 
ATOM   621  C  C   . GLN A 1 92  ? -4.189  40.974 5.931  1.00 61.87  ? 92  GLN A C   1 
ATOM   622  O  O   . GLN A 1 92  ? -4.516  42.090 6.330  1.00 60.85  ? 92  GLN A O   1 
ATOM   623  C  CB  . GLN A 1 92  ? -3.120  40.501 3.744  1.00 65.18  ? 92  GLN A CB  1 
ATOM   624  C  CG  . GLN A 1 92  ? -1.868  40.518 2.895  1.00 67.42  ? 92  GLN A CG  1 
ATOM   625  C  CD  . GLN A 1 92  ? -2.187  40.422 1.421  1.00 69.00  ? 92  GLN A CD  1 
ATOM   626  O  OE1 . GLN A 1 92  ? -2.790  39.450 0.969  1.00 71.70  ? 92  GLN A OE1 1 
ATOM   627  N  NE2 . GLN A 1 92  ? -1.792  41.436 0.662  1.00 69.98  ? 92  GLN A NE2 1 
ATOM   628  N  N   . ALA A 1 93  ? -4.943  39.891 6.079  1.00 61.07  ? 93  ALA A N   1 
ATOM   629  C  CA  . ALA A 1 93  ? -6.232  39.943 6.755  1.00 59.53  ? 93  ALA A CA  1 
ATOM   630  C  C   . ALA A 1 93  ? -6.052  40.423 8.186  1.00 57.85  ? 93  ALA A C   1 
ATOM   631  O  O   . ALA A 1 93  ? -6.886  41.142 8.719  1.00 55.63  ? 93  ALA A O   1 
ATOM   632  C  CB  . ALA A 1 93  ? -6.878  38.569 6.742  1.00 60.17  ? 93  ALA A CB  1 
ATOM   633  N  N   . ARG A 1 94  ? -4.945  40.023 8.795  1.00 59.07  ? 94  ARG A N   1 
ATOM   634  C  CA  . ARG A 1 94  ? -4.631  40.390 10.168 1.00 61.27  ? 94  ARG A CA  1 
ATOM   635  C  C   . ARG A 1 94  ? -4.408  41.898 10.266 1.00 61.96  ? 94  ARG A C   1 
ATOM   636  O  O   . ARG A 1 94  ? -4.853  42.546 11.208 1.00 61.90  ? 94  ARG A O   1 
ATOM   637  C  CB  . ARG A 1 94  ? -3.381  39.627 10.624 1.00 62.97  ? 94  ARG A CB  1 
ATOM   638  C  CG  . ARG A 1 94  ? -3.223  39.475 12.131 1.00 67.84  ? 94  ARG A CG  1 
ATOM   639  C  CD  . ARG A 1 94  ? -2.388  40.583 12.777 1.00 73.25  ? 94  ARG A CD  1 
ATOM   640  N  NE  . ARG A 1 94  ? -0.941  40.350 12.684 1.00 76.86  ? 94  ARG A NE  1 
ATOM   641  C  CZ  . ARG A 1 94  ? -0.194  40.591 11.606 1.00 78.33  ? 94  ARG A CZ  1 
ATOM   642  N  NH1 . ARG A 1 94  ? -0.742  41.082 10.500 1.00 80.31  ? 94  ARG A NH1 1 
ATOM   643  N  NH2 . ARG A 1 94  ? 1.107   40.339 11.633 1.00 78.06  ? 94  ARG A NH2 1 
ATOM   644  N  N   . LYS A 1 95  ? -3.729  42.453 9.273  1.00 63.16  ? 95  LYS A N   1 
ATOM   645  C  CA  . LYS A 1 95  ? -3.445  43.876 9.249  1.00 62.73  ? 95  LYS A CA  1 
ATOM   646  C  C   . LYS A 1 95  ? -4.668  44.715 8.922  1.00 61.14  ? 95  LYS A C   1 
ATOM   647  O  O   . LYS A 1 95  ? -4.816  45.816 9.441  1.00 61.37  ? 95  LYS A O   1 
ATOM   648  C  CB  . LYS A 1 95  ? -2.323  44.160 8.246  1.00 65.96  ? 95  LYS A CB  1 
ATOM   649  C  CG  . LYS A 1 95  ? -0.941  43.747 8.754  1.00 69.66  ? 95  LYS A CG  1 
ATOM   650  C  CD  . LYS A 1 95  ? 0.135   43.936 7.694  1.00 73.44  ? 95  LYS A CD  1 
ATOM   651  C  CE  . LYS A 1 95  ? 1.534   43.775 8.288  1.00 76.69  ? 95  LYS A CE  1 
ATOM   652  N  NZ  . LYS A 1 95  ? 1.739   42.460 8.967  1.00 78.38  ? 95  LYS A NZ  1 
ATOM   653  N  N   . ARG A 1 96  ? -5.548  44.197 8.072  1.00 59.55  ? 96  ARG A N   1 
ATOM   654  C  CA  . ARG A 1 96  ? -6.750  44.931 7.691  1.00 58.77  ? 96  ARG A CA  1 
ATOM   655  C  C   . ARG A 1 96  ? -7.820  44.942 8.781  1.00 57.12  ? 96  ARG A C   1 
ATOM   656  O  O   . ARG A 1 96  ? -8.798  45.670 8.689  1.00 57.33  ? 96  ARG A O   1 
ATOM   657  C  CB  . ARG A 1 96  ? -7.320  44.363 6.387  1.00 60.07  ? 96  ARG A CB  1 
ATOM   658  C  CG  . ARG A 1 96  ? -6.301  44.355 5.271  1.00 66.08  ? 96  ARG A CG  1 
ATOM   659  C  CD  . ARG A 1 96  ? -6.868  43.957 3.907  1.00 69.77  ? 96  ARG A CD  1 
ATOM   660  N  NE  . ARG A 1 96  ? -5.802  43.893 2.903  1.00 72.33  ? 96  ARG A NE  1 
ATOM   661  C  CZ  . ARG A 1 96  ? -5.993  43.728 1.595  1.00 74.24  ? 96  ARG A CZ  1 
ATOM   662  N  NH1 . ARG A 1 96  ? -7.222  43.608 1.105  1.00 74.96  ? 96  ARG A NH1 1 
ATOM   663  N  NH2 . ARG A 1 96  ? -4.949  43.681 0.771  1.00 74.32  ? 96  ARG A NH2 1 
ATOM   664  N  N   . LEU A 1 97  ? -7.628  44.139 9.819  1.00 56.28  ? 97  LEU A N   1 
ATOM   665  C  CA  . LEU A 1 97  ? -8.585  44.077 10.913 1.00 53.24  ? 97  LEU A CA  1 
ATOM   666  C  C   . LEU A 1 97  ? -8.014  44.784 12.120 1.00 53.33  ? 97  LEU A C   1 
ATOM   667  O  O   . LEU A 1 97  ? -8.719  45.060 13.077 1.00 53.66  ? 97  LEU A O   1 
ATOM   668  C  CB  . LEU A 1 97  ? -8.888  42.625 11.271 1.00 49.81  ? 97  LEU A CB  1 
ATOM   669  C  CG  . LEU A 1 97  ? -9.617  41.794 10.219 1.00 48.99  ? 97  LEU A CG  1 
ATOM   670  C  CD1 . LEU A 1 97  ? -9.490  40.323 10.555 1.00 48.12  ? 97  LEU A CD1 1 
ATOM   671  C  CD2 . LEU A 1 97  ? -11.063 42.204 10.151 1.00 45.97  ? 97  LEU A CD2 1 
ATOM   672  N  N   . THR A 1 98  ? -6.727  45.085 12.073 1.00 54.23  ? 98  THR A N   1 
ATOM   673  C  CA  . THR A 1 98  ? -6.095  45.747 13.191 1.00 56.13  ? 98  THR A CA  1 
ATOM   674  C  C   . THR A 1 98  ? -5.583  47.157 12.915 1.00 57.92  ? 98  THR A C   1 
ATOM   675  O  O   . THR A 1 98  ? -4.690  47.633 13.613 1.00 58.35  ? 98  THR A O   1 
ATOM   676  C  CB  . THR A 1 98  ? -4.955  44.894 13.728 1.00 56.16  ? 98  THR A CB  1 
ATOM   677  O  OG1 . THR A 1 98  ? -4.043  44.592 12.667 1.00 59.63  ? 98  THR A OG1 1 
ATOM   678  C  CG2 . THR A 1 98  ? -5.503  43.603 14.301 1.00 55.58  ? 98  THR A CG2 1 
ATOM   679  N  N   . LYS A 1 99  ? -6.143  47.825 11.906 1.00 60.47  ? 99  LYS A N   1 
ATOM   680  C  CA  . LYS A 1 99  ? -5.738  49.194 11.586 1.00 62.95  ? 99  LYS A CA  1 
ATOM   681  C  C   . LYS A 1 99  ? -6.201  50.098 12.724 1.00 64.23  ? 99  LYS A C   1 
ATOM   682  O  O   . LYS A 1 99  ? -7.397  50.333 12.901 1.00 63.94  ? 99  LYS A O   1 
ATOM   683  C  CB  . LYS A 1 99  ? -6.357  49.663 10.264 1.00 64.58  ? 99  LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 99  ? -5.603  49.211 9.027  1.00 67.43  ? 99  LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 99  ? -6.344  49.562 7.738  1.00 70.31  ? 99  LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 99  ? -5.584  49.061 6.501  1.00 73.15  ? 99  LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 99  ? -6.361  49.187 5.219  1.00 74.10  ? 99  LYS A NZ  1 
ATOM   688  N  N   . ARG A 1 100 ? -5.238  50.599 13.487 1.00 65.35  ? 100 ARG A N   1 
ATOM   689  C  CA  . ARG A 1 100 ? -5.504  51.450 14.632 1.00 67.82  ? 100 ARG A CA  1 
ATOM   690  C  C   . ARG A 1 100 ? -6.309  52.713 14.364 1.00 67.44  ? 100 ARG A C   1 
ATOM   691  O  O   . ARG A 1 100 ? -6.917  53.261 15.274 1.00 67.32  ? 100 ARG A O   1 
ATOM   692  C  CB  . ARG A 1 100 ? -4.186  51.829 15.291 1.00 70.83  ? 100 ARG A CB  1 
ATOM   693  C  CG  . ARG A 1 100 ? -4.347  52.487 16.638 1.00 77.23  ? 100 ARG A CG  1 
ATOM   694  C  CD  . ARG A 1 100 ? -2.994  52.687 17.282 1.00 82.58  ? 100 ARG A CD  1 
ATOM   695  N  NE  . ARG A 1 100 ? -2.178  51.484 17.156 1.00 87.75  ? 100 ARG A NE  1 
ATOM   696  C  CZ  . ARG A 1 100 ? -0.973  51.336 17.696 1.00 90.95  ? 100 ARG A CZ  1 
ATOM   697  N  NH1 . ARG A 1 100 ? -0.437  52.321 18.410 1.00 92.69  ? 100 ARG A NH1 1 
ATOM   698  N  NH2 . ARG A 1 100 ? -0.301  50.205 17.519 1.00 91.91  ? 100 ARG A NH2 1 
ATOM   699  N  N   . SER A 1 101 ? -6.316  53.181 13.124 1.00 67.90  ? 101 SER A N   1 
ATOM   700  C  CA  . SER A 1 101 ? -7.054  54.394 12.785 1.00 67.44  ? 101 SER A CA  1 
ATOM   701  C  C   . SER A 1 101 ? -8.552  54.153 12.589 1.00 66.86  ? 101 SER A C   1 
ATOM   702  O  O   . SER A 1 101 ? -9.313  55.091 12.371 1.00 68.35  ? 101 SER A O   1 
ATOM   703  C  CB  . SER A 1 101 ? -6.468  55.026 11.520 1.00 67.00  ? 101 SER A CB  1 
ATOM   704  O  OG  . SER A 1 101 ? -6.572  54.150 10.409 1.00 69.09  ? 101 SER A OG  1 
ATOM   705  N  N   . GLU A 1 102 ? -8.974  52.897 12.659 1.00 65.24  ? 102 GLU A N   1 
ATOM   706  C  CA  . GLU A 1 102 ? -10.380 52.578 12.488 1.00 64.47  ? 102 GLU A CA  1 
ATOM   707  C  C   . GLU A 1 102 ? -10.940 51.989 13.778 1.00 63.48  ? 102 GLU A C   1 
ATOM   708  O  O   . GLU A 1 102 ? -10.528 50.918 14.223 1.00 63.34  ? 102 GLU A O   1 
ATOM   709  C  CB  . GLU A 1 102 ? -10.545 51.598 11.332 1.00 65.48  ? 102 GLU A CB  1 
ATOM   710  C  CG  . GLU A 1 102 ? -9.650  51.918 10.160 1.00 66.50  ? 102 GLU A CG  1 
ATOM   711  C  CD  . GLU A 1 102 ? -9.946  51.066 8.946  1.00 68.40  ? 102 GLU A CD  1 
ATOM   712  O  OE1 . GLU A 1 102 ? -10.054 49.829 9.095  1.00 69.18  ? 102 GLU A OE1 1 
ATOM   713  O  OE2 . GLU A 1 102 ? -10.063 51.636 7.838  1.00 68.55  ? 102 GLU A OE2 1 
ATOM   714  N  N   . GLU A 1 103 ? -11.874 52.708 14.384 1.00 62.31  ? 103 GLU A N   1 
ATOM   715  C  CA  . GLU A 1 103 ? -12.486 52.267 15.629 1.00 60.64  ? 103 GLU A CA  1 
ATOM   716  C  C   . GLU A 1 103 ? -13.533 51.202 15.342 1.00 56.07  ? 103 GLU A C   1 
ATOM   717  O  O   . GLU A 1 103 ? -13.989 50.505 16.240 1.00 54.40  ? 103 GLU A O   1 
ATOM   718  C  CB  . GLU A 1 103 ? -13.144 53.455 16.326 1.00 64.67  ? 103 GLU A CB  1 
ATOM   719  C  CG  . GLU A 1 103 ? -13.772 53.130 17.671 1.00 72.29  ? 103 GLU A CG  1 
ATOM   720  C  CD  . GLU A 1 103 ? -15.077 53.880 17.870 1.00 76.71  ? 103 GLU A CD  1 
ATOM   721  O  OE1 . GLU A 1 103 ? -15.100 55.091 17.551 1.00 81.10  ? 103 GLU A OE1 1 
ATOM   722  O  OE2 . GLU A 1 103 ? -16.071 53.274 18.340 1.00 77.53  ? 103 GLU A OE2 1 
ATOM   723  N  N   . VAL A 1 104 ? -13.895 51.077 14.072 1.00 52.25  ? 104 VAL A N   1 
ATOM   724  C  CA  . VAL A 1 104 ? -14.905 50.120 13.663 1.00 49.28  ? 104 VAL A CA  1 
ATOM   725  C  C   . VAL A 1 104 ? -14.494 49.337 12.423 1.00 46.97  ? 104 VAL A C   1 
ATOM   726  O  O   . VAL A 1 104 ? -13.756 49.827 11.588 1.00 48.26  ? 104 VAL A O   1 
ATOM   727  C  CB  . VAL A 1 104 ? -16.246 50.851 13.397 1.00 48.29  ? 104 VAL A CB  1 
ATOM   728  C  CG1 . VAL A 1 104 ? -17.181 49.982 12.594 1.00 50.25  ? 104 VAL A CG1 1 
ATOM   729  C  CG2 . VAL A 1 104 ? -16.897 51.219 14.713 1.00 46.63  ? 104 VAL A CG2 1 
ATOM   730  N  N   . VAL A 1 105 ? -14.946 48.099 12.333 1.00 44.42  ? 105 VAL A N   1 
ATOM   731  C  CA  . VAL A 1 105 ? -14.666 47.273 11.180 1.00 43.58  ? 105 VAL A CA  1 
ATOM   732  C  C   . VAL A 1 105 ? -16.018 46.851 10.656 1.00 43.21  ? 105 VAL A C   1 
ATOM   733  O  O   . VAL A 1 105 ? -16.857 46.357 11.400 1.00 42.71  ? 105 VAL A O   1 
ATOM   734  C  CB  . VAL A 1 105 ? -13.854 46.008 11.536 1.00 45.08  ? 105 VAL A CB  1 
ATOM   735  C  CG1 . VAL A 1 105 ? -12.380 46.344 11.682 1.00 44.46  ? 105 VAL A CG1 1 
ATOM   736  C  CG2 . VAL A 1 105 ? -14.382 45.405 12.829 1.00 47.67  ? 105 VAL A CG2 1 
ATOM   737  N  N   . ARG A 1 106 ? -16.254 47.084 9.378  1.00 44.29  ? 106 ARG A N   1 
ATOM   738  C  CA  . ARG A 1 106 ? -17.519 46.692 8.796  1.00 44.98  ? 106 ARG A CA  1 
ATOM   739  C  C   . ARG A 1 106 ? -17.223 45.468 7.958  1.00 45.83  ? 106 ARG A C   1 
ATOM   740  O  O   . ARG A 1 106 ? -16.595 45.547 6.901  1.00 46.44  ? 106 ARG A O   1 
ATOM   741  C  CB  . ARG A 1 106 ? -18.106 47.840 7.974  1.00 46.22  ? 106 ARG A CB  1 
ATOM   742  C  CG  . ARG A 1 106 ? -18.789 48.878 8.857  1.00 47.34  ? 106 ARG A CG  1 
ATOM   743  C  CD  . ARG A 1 106 ? -19.388 50.018 8.080  1.00 45.83  ? 106 ARG A CD  1 
ATOM   744  N  NE  . ARG A 1 106 ? -18.438 51.109 7.943  1.00 45.44  ? 106 ARG A NE  1 
ATOM   745  C  CZ  . ARG A 1 106 ? -18.412 52.174 8.730  1.00 45.41  ? 106 ARG A CZ  1 
ATOM   746  N  NH1 . ARG A 1 106 ? -19.286 52.298 9.715  1.00 47.46  ? 106 ARG A NH1 1 
ATOM   747  N  NH2 . ARG A 1 106 ? -17.507 53.113 8.534  1.00 45.55  ? 106 ARG A NH2 1 
ATOM   748  N  N   . LEU A 1 107 ? -17.652 44.327 8.479  1.00 45.04  ? 107 LEU A N   1 
ATOM   749  C  CA  . LEU A 1 107 ? -17.422 43.043 7.849  1.00 45.75  ? 107 LEU A CA  1 
ATOM   750  C  C   . LEU A 1 107 ? -18.530 42.579 6.949  1.00 45.89  ? 107 LEU A C   1 
ATOM   751  O  O   . LEU A 1 107 ? -19.707 42.762 7.241  1.00 46.26  ? 107 LEU A O   1 
ATOM   752  C  CB  . LEU A 1 107 ? -17.209 41.968 8.920  1.00 43.83  ? 107 LEU A CB  1 
ATOM   753  C  CG  . LEU A 1 107 ? -15.820 41.761 9.511  1.00 43.53  ? 107 LEU A CG  1 
ATOM   754  C  CD1 . LEU A 1 107 ? -15.021 43.047 9.511  1.00 42.11  ? 107 LEU A CD1 1 
ATOM   755  C  CD2 . LEU A 1 107 ? -15.984 41.212 10.906 1.00 42.88  ? 107 LEU A CD2 1 
ATOM   756  N  N   . LEU A 1 108 ? -18.141 41.958 5.851  1.00 46.11  ? 108 LEU A N   1 
ATOM   757  C  CA  . LEU A 1 108 ? -19.114 41.390 4.947  1.00 47.68  ? 108 LEU A CA  1 
ATOM   758  C  C   . LEU A 1 108 ? -18.772 39.908 5.042  1.00 47.07  ? 108 LEU A C   1 
ATOM   759  O  O   . LEU A 1 108 ? -17.649 39.507 4.747  1.00 45.79  ? 108 LEU A O   1 
ATOM   760  C  CB  . LEU A 1 108 ? -18.904 41.928 3.534  1.00 51.34  ? 108 LEU A CB  1 
ATOM   761  C  CG  . LEU A 1 108 ? -20.172 42.106 2.692  1.00 53.81  ? 108 LEU A CG  1 
ATOM   762  C  CD1 . LEU A 1 108 ? -19.843 42.904 1.426  1.00 54.19  ? 108 LEU A CD1 1 
ATOM   763  C  CD2 . LEU A 1 108 ? -20.756 40.744 2.340  1.00 54.00  ? 108 LEU A CD2 1 
ATOM   764  N  N   . VAL A 1 109 ? -19.720 39.099 5.500  1.00 48.00  ? 109 VAL A N   1 
ATOM   765  C  CA  . VAL A 1 109 ? -19.469 37.671 5.646  1.00 48.81  ? 109 VAL A CA  1 
ATOM   766  C  C   . VAL A 1 109 ? -20.577 36.805 5.075  1.00 50.92  ? 109 VAL A C   1 
ATOM   767  O  O   . VAL A 1 109 ? -21.651 37.290 4.718  1.00 48.14  ? 109 VAL A O   1 
ATOM   768  C  CB  . VAL A 1 109 ? -19.286 37.263 7.138  1.00 48.05  ? 109 VAL A CB  1 
ATOM   769  C  CG1 . VAL A 1 109 ? -18.224 38.114 7.797  1.00 45.24  ? 109 VAL A CG1 1 
ATOM   770  C  CG2 . VAL A 1 109 ? -20.612 37.367 7.875  1.00 46.35  ? 109 VAL A CG2 1 
ATOM   771  N  N   . THR A 1 110 ? -20.281 35.511 5.000  1.00 54.62  ? 110 THR A N   1 
ATOM   772  C  CA  . THR A 1 110 ? -21.207 34.503 4.507  1.00 59.13  ? 110 THR A CA  1 
ATOM   773  C  C   . THR A 1 110 ? -21.124 33.356 5.500  1.00 62.57  ? 110 THR A C   1 
ATOM   774  O  O   . THR A 1 110 ? -20.055 33.078 6.039  1.00 62.16  ? 110 THR A O   1 
ATOM   775  C  CB  . THR A 1 110 ? -20.785 33.961 3.126  1.00 58.88  ? 110 THR A CB  1 
ATOM   776  O  OG1 . THR A 1 110 ? -19.444 33.469 3.202  1.00 60.14  ? 110 THR A OG1 1 
ATOM   777  C  CG2 . THR A 1 110 ? -20.859 35.043 2.066  1.00 57.95  ? 110 THR A CG2 1 
ATOM   778  N  N   . ARG A 1 111 ? -22.250 32.697 5.746  1.00 66.80  ? 111 ARG A N   1 
ATOM   779  C  CA  . ARG A 1 111 ? -22.270 31.572 6.669  1.00 71.22  ? 111 ARG A CA  1 
ATOM   780  C  C   . ARG A 1 111 ? -23.286 30.531 6.225  1.00 74.63  ? 111 ARG A C   1 
ATOM   781  O  O   . ARG A 1 111 ? -24.326 30.875 5.658  1.00 74.54  ? 111 ARG A O   1 
ATOM   782  C  CB  . ARG A 1 111 ? -22.618 32.055 8.084  1.00 70.96  ? 111 ARG A CB  1 
ATOM   783  C  CG  . ARG A 1 111 ? -23.929 32.823 8.165  1.00 69.55  ? 111 ARG A CG  1 
ATOM   784  C  CD  . ARG A 1 111 ? -24.271 33.227 9.597  1.00 71.52  ? 111 ARG A CD  1 
ATOM   785  N  NE  . ARG A 1 111 ? -23.287 34.140 10.181 1.00 72.46  ? 111 ARG A NE  1 
ATOM   786  C  CZ  . ARG A 1 111 ? -23.593 35.179 10.954 1.00 71.17  ? 111 ARG A CZ  1 
ATOM   787  N  NH1 . ARG A 1 111 ? -24.858 35.445 11.243 1.00 70.92  ? 111 ARG A NH1 1 
ATOM   788  N  NH2 . ARG A 1 111 ? -22.633 35.960 11.429 1.00 70.27  ? 111 ARG A NH2 1 
ATOM   789  N  N   . GLN A 1 112 ? -22.983 29.260 6.483  1.00 78.28  ? 112 GLN A N   1 
ATOM   790  C  CA  . GLN A 1 112 ? -23.905 28.190 6.139  1.00 82.41  ? 112 GLN A CA  1 
ATOM   791  C  C   . GLN A 1 112 ? -25.217 28.632 6.776  1.00 86.11  ? 112 GLN A C   1 
ATOM   792  O  O   . GLN A 1 112 ? -25.347 28.651 8.002  1.00 86.92  ? 112 GLN A O   1 
ATOM   793  C  CB  . GLN A 1 112 ? -23.433 26.875 6.736  1.00 81.31  ? 112 GLN A CB  1 
ATOM   794  N  N   . SER A 1 113 ? -26.170 29.011 5.931  1.00 90.73  ? 113 SER A N   1 
ATOM   795  C  CA  . SER A 1 113 ? -27.480 29.502 6.362  1.00 95.51  ? 113 SER A CA  1 
ATOM   796  C  C   . SER A 1 113 ? -28.230 28.634 7.359  1.00 98.45  ? 113 SER A C   1 
ATOM   797  O  O   . SER A 1 113 ? -29.210 29.090 7.959  1.00 97.94  ? 113 SER A O   1 
ATOM   798  C  CB  . SER A 1 113 ? -28.392 29.712 5.145  1.00 96.12  ? 113 SER A CB  1 
ATOM   799  O  OG  . SER A 1 113 ? -28.762 28.471 4.558  1.00 95.74  ? 113 SER A OG  1 
ATOM   800  N  N   . LEU A 1 114 ? -27.782 27.393 7.542  1.00 102.31 ? 114 LEU A N   1 
ATOM   801  C  CA  . LEU A 1 114 ? -28.479 26.486 8.443  1.00 106.34 ? 114 LEU A CA  1 
ATOM   802  C  C   . LEU A 1 114 ? -29.919 26.596 7.948  1.00 109.27 ? 114 LEU A C   1 
ATOM   803  O  O   . LEU A 1 114 ? -30.132 26.905 6.771  1.00 109.85 ? 114 LEU A O   1 
ATOM   804  C  CB  . LEU A 1 114 ? -28.362 26.969 9.887  1.00 105.92 ? 114 LEU A CB  1 
ATOM   805  N  N   . GLN A 1 115 ? -30.901 26.372 8.820  1.00 112.15 ? 115 GLN A N   1 
ATOM   806  C  CA  . GLN A 1 115 ? -32.304 26.473 8.409  1.00 114.72 ? 115 GLN A CA  1 
ATOM   807  C  C   . GLN A 1 115 ? -32.463 25.859 7.015  1.00 116.44 ? 115 GLN A C   1 
ATOM   808  O  O   . GLN A 1 115 ? -33.403 26.179 6.278  1.00 116.58 ? 115 GLN A O   1 
ATOM   809  C  CB  . GLN A 1 115 ? -32.733 27.943 8.369  1.00 114.64 ? 115 GLN A CB  1 
ATOM   810  C  CG  . GLN A 1 115 ? -32.554 28.696 9.680  1.00 114.60 ? 115 GLN A CG  1 
ATOM   811  C  CD  . GLN A 1 115 ? -33.763 28.599 10.593 1.00 114.72 ? 115 GLN A CD  1 
ATOM   812  O  OE1 . GLN A 1 115 ? -33.773 29.168 11.684 1.00 114.81 ? 115 GLN A OE1 1 
ATOM   813  N  NE2 . GLN A 1 115 ? -34.791 27.884 10.148 1.00 114.79 ? 115 GLN A NE2 1 
ATOM   814  N  N   . LYS A 1 116 ? -31.515 24.993 6.665  1.00 118.10 ? 116 LYS A N   1 
ATOM   815  C  CA  . LYS A 1 116 ? -31.491 24.310 5.380  1.00 119.43 ? 116 LYS A CA  1 
ATOM   816  C  C   . LYS A 1 116 ? -31.616 22.818 5.655  1.00 120.42 ? 116 LYS A C   1 
ATOM   817  O  O   . LYS A 1 116 ? -30.668 22.052 5.458  1.00 121.12 ? 116 LYS A O   1 
ATOM   818  C  CB  . LYS A 1 116 ? -30.180 24.609 4.648  1.00 119.03 ? 116 LYS A CB  1 
ATOM   819  N  N   . ALA A 1 117 ? -32.793 22.422 6.133  1.00 120.76 ? 117 ALA A N   1 
ATOM   820  C  CA  . ALA A 1 117 ? -33.081 21.029 6.447  1.00 120.89 ? 117 ALA A CA  1 
ATOM   821  C  C   . ALA A 1 117 ? -33.086 20.193 5.166  1.00 121.09 ? 117 ALA A C   1 
ATOM   822  O  O   . ALA A 1 117 ? -34.171 19.704 4.780  1.00 121.07 ? 117 ALA A O   1 
ATOM   823  C  CB  . ALA A 1 117 ? -34.432 20.925 7.157  1.00 120.12 ? 117 ALA A CB  1 
ATOM   824  N  N   . ALA B 1 11  ? -41.295 20.905 15.008 1.00 90.59  ? 11  ALA B N   1 
ATOM   825  C  CA  . ALA B 1 11  ? -39.822 20.825 14.779 1.00 90.72  ? 11  ALA B CA  1 
ATOM   826  C  C   . ALA B 1 11  ? -39.232 22.229 14.644 1.00 90.49  ? 11  ALA B C   1 
ATOM   827  O  O   . ALA B 1 11  ? -39.251 22.816 13.561 1.00 91.38  ? 11  ALA B O   1 
ATOM   828  C  CB  . ALA B 1 11  ? -39.539 20.013 13.521 1.00 91.26  ? 11  ALA B CB  1 
ATOM   829  N  N   . VAL B 1 12  ? -38.701 22.758 15.746 1.00 88.95  ? 12  VAL B N   1 
ATOM   830  C  CA  . VAL B 1 12  ? -38.125 24.102 15.759 1.00 86.90  ? 12  VAL B CA  1 
ATOM   831  C  C   . VAL B 1 12  ? -36.617 24.092 16.029 1.00 85.04  ? 12  VAL B C   1 
ATOM   832  O  O   . VAL B 1 12  ? -36.092 23.189 16.686 1.00 85.39  ? 12  VAL B O   1 
ATOM   833  C  CB  . VAL B 1 12  ? -38.816 24.981 16.826 1.00 86.97  ? 12  VAL B CB  1 
ATOM   834  C  CG1 . VAL B 1 12  ? -38.538 24.424 18.216 1.00 87.58  ? 12  VAL B CG1 1 
ATOM   835  C  CG2 . VAL B 1 12  ? -38.330 26.409 16.720 1.00 87.57  ? 12  VAL B CG2 1 
ATOM   836  N  N   . VAL B 1 13  ? -35.929 25.108 15.520 1.00 82.12  ? 13  VAL B N   1 
ATOM   837  C  CA  . VAL B 1 13  ? -34.485 25.221 15.691 1.00 79.61  ? 13  VAL B CA  1 
ATOM   838  C  C   . VAL B 1 13  ? -34.118 26.346 16.657 1.00 77.68  ? 13  VAL B C   1 
ATOM   839  O  O   . VAL B 1 13  ? -34.580 27.475 16.511 1.00 77.79  ? 13  VAL B O   1 
ATOM   840  C  CB  . VAL B 1 13  ? -33.800 25.482 14.336 1.00 79.29  ? 13  VAL B CB  1 
ATOM   841  C  CG1 . VAL B 1 13  ? -34.502 26.624 13.623 1.00 80.08  ? 13  VAL B CG1 1 
ATOM   842  C  CG2 . VAL B 1 13  ? -32.326 25.803 14.542 1.00 77.55  ? 13  VAL B CG2 1 
ATOM   843  N  N   . GLN B 1 14  ? -33.282 26.032 17.640 1.00 75.54  ? 14  GLN B N   1 
ATOM   844  C  CA  . GLN B 1 14  ? -32.870 27.019 18.628 1.00 73.61  ? 14  GLN B CA  1 
ATOM   845  C  C   . GLN B 1 14  ? -31.412 26.854 19.027 1.00 71.27  ? 14  GLN B C   1 
ATOM   846  O  O   . GLN B 1 14  ? -30.826 25.779 18.871 1.00 69.75  ? 14  GLN B O   1 
ATOM   847  C  CB  . GLN B 1 14  ? -33.737 26.908 19.880 1.00 75.91  ? 14  GLN B CB  1 
ATOM   848  C  CG  . GLN B 1 14  ? -35.222 27.008 19.626 1.00 79.41  ? 14  GLN B CG  1 
ATOM   849  C  CD  . GLN B 1 14  ? -35.951 27.612 20.807 1.00 83.04  ? 14  GLN B CD  1 
ATOM   850  O  OE1 . GLN B 1 14  ? -35.778 27.170 21.947 1.00 85.00  ? 14  GLN B OE1 1 
ATOM   851  N  NE2 . GLN B 1 14  ? -36.772 28.633 20.545 1.00 84.16  ? 14  GLN B NE2 1 
ATOM   852  N  N   . ARG B 1 15  ? -30.823 27.923 19.551 1.00 68.75  ? 15  ARG B N   1 
ATOM   853  C  CA  . ARG B 1 15  ? -29.435 27.849 19.965 1.00 67.18  ? 15  ARG B CA  1 
ATOM   854  C  C   . ARG B 1 15  ? -29.271 28.019 21.461 1.00 64.20  ? 15  ARG B C   1 
ATOM   855  O  O   . ARG B 1 15  ? -29.886 28.884 22.079 1.00 64.37  ? 15  ARG B O   1 
ATOM   856  C  CB  . ARG B 1 15  ? -28.576 28.865 19.202 1.00 69.45  ? 15  ARG B CB  1 
ATOM   857  C  CG  . ARG B 1 15  ? -28.991 30.314 19.290 1.00 72.93  ? 15  ARG B CG  1 
ATOM   858  C  CD  . ARG B 1 15  ? -28.400 31.057 18.087 1.00 78.26  ? 15  ARG B CD  1 
ATOM   859  N  NE  . ARG B 1 15  ? -26.987 30.714 17.882 1.00 82.06  ? 15  ARG B NE  1 
ATOM   860  C  CZ  . ARG B 1 15  ? -26.349 30.784 16.712 1.00 81.71  ? 15  ARG B CZ  1 
ATOM   861  N  NH1 . ARG B 1 15  ? -25.065 30.449 16.635 1.00 81.72  ? 15  ARG B NH1 1 
ATOM   862  N  NH2 . ARG B 1 15  ? -26.993 31.180 15.620 1.00 80.57  ? 15  ARG B NH2 1 
ATOM   863  N  N   . VAL B 1 16  ? -28.437 27.159 22.030 1.00 60.10  ? 16  VAL B N   1 
ATOM   864  C  CA  . VAL B 1 16  ? -28.170 27.156 23.449 1.00 57.18  ? 16  VAL B CA  1 
ATOM   865  C  C   . VAL B 1 16  ? -26.701 27.437 23.665 1.00 56.56  ? 16  VAL B C   1 
ATOM   866  O  O   . VAL B 1 16  ? -25.850 26.861 22.996 1.00 57.92  ? 16  VAL B O   1 
ATOM   867  C  CB  . VAL B 1 16  ? -28.495 25.785 24.058 1.00 56.33  ? 16  VAL B CB  1 
ATOM   868  C  CG1 . VAL B 1 16  ? -28.292 25.823 25.557 1.00 56.71  ? 16  VAL B CG1 1 
ATOM   869  C  CG2 . VAL B 1 16  ? -29.913 25.386 23.707 1.00 54.97  ? 16  VAL B CG2 1 
ATOM   870  N  N   . GLU B 1 17  ? -26.406 28.328 24.600 1.00 55.21  ? 17  GLU B N   1 
ATOM   871  C  CA  . GLU B 1 17  ? -25.030 28.679 24.907 1.00 54.50  ? 17  GLU B CA  1 
ATOM   872  C  C   . GLU B 1 17  ? -24.778 28.256 26.344 1.00 52.12  ? 17  GLU B C   1 
ATOM   873  O  O   . GLU B 1 17  ? -25.399 28.763 27.271 1.00 51.54  ? 17  GLU B O   1 
ATOM   874  C  CB  . GLU B 1 17  ? -24.838 30.187 24.733 1.00 57.08  ? 17  GLU B CB  1 
ATOM   875  C  CG  . GLU B 1 17  ? -23.406 30.653 24.738 1.00 60.05  ? 17  GLU B CG  1 
ATOM   876  C  CD  . GLU B 1 17  ? -23.297 32.143 24.435 1.00 64.04  ? 17  GLU B CD  1 
ATOM   877  O  OE1 . GLU B 1 17  ? -23.564 32.559 23.276 1.00 64.65  ? 17  GLU B OE1 1 
ATOM   878  O  OE2 . GLU B 1 17  ? -22.952 32.899 25.369 1.00 65.95  ? 17  GLU B OE2 1 
ATOM   879  N  N   . ILE B 1 18  ? -23.862 27.319 26.524 1.00 51.14  ? 18  ILE B N   1 
ATOM   880  C  CA  . ILE B 1 18  ? -23.562 26.800 27.846 1.00 50.20  ? 18  ILE B CA  1 
ATOM   881  C  C   . ILE B 1 18  ? -22.165 27.138 28.314 1.00 49.90  ? 18  ILE B C   1 
ATOM   882  O  O   . ILE B 1 18  ? -21.196 26.789 27.659 1.00 50.07  ? 18  ILE B O   1 
ATOM   883  C  CB  . ILE B 1 18  ? -23.684 25.263 27.860 1.00 50.73  ? 18  ILE B CB  1 
ATOM   884  C  CG1 . ILE B 1 18  ? -25.033 24.839 27.280 1.00 50.68  ? 18  ILE B CG1 1 
ATOM   885  C  CG2 . ILE B 1 18  ? -23.515 24.743 29.278 1.00 51.53  ? 18  ILE B CG2 1 
ATOM   886  C  CD1 . ILE B 1 18  ? -25.145 23.354 27.037 1.00 49.18  ? 18  ILE B CD1 1 
ATOM   887  N  N   . HIS B 1 19  ? -22.054 27.809 29.448 1.00 51.71  ? 19  HIS B N   1 
ATOM   888  C  CA  . HIS B 1 19  ? -20.744 28.128 29.981 1.00 53.57  ? 19  HIS B CA  1 
ATOM   889  C  C   . HIS B 1 19  ? -20.375 26.933 30.847 1.00 52.98  ? 19  HIS B C   1 
ATOM   890  O  O   . HIS B 1 19  ? -21.091 26.591 31.789 1.00 54.18  ? 19  HIS B O   1 
ATOM   891  C  CB  . HIS B 1 19  ? -20.766 29.422 30.830 1.00 57.61  ? 19  HIS B CB  1 
ATOM   892  C  CG  . HIS B 1 19  ? -21.180 30.658 30.073 1.00 64.57  ? 19  HIS B CG  1 
ATOM   893  N  ND1 . HIS B 1 19  ? -20.872 31.935 30.504 1.00 66.45  ? 19  HIS B ND1 1 
ATOM   894  C  CD2 . HIS B 1 19  ? -21.923 30.816 28.947 1.00 66.06  ? 19  HIS B CD2 1 
ATOM   895  C  CE1 . HIS B 1 19  ? -21.407 32.822 29.680 1.00 65.73  ? 19  HIS B CE1 1 
ATOM   896  N  NE2 . HIS B 1 19  ? -22.051 32.169 28.727 1.00 66.00  ? 19  HIS B NE2 1 
ATOM   897  N  N   . LYS B 1 20  ? -19.269 26.283 30.516 1.00 52.30  ? 20  LYS B N   1 
ATOM   898  C  CA  . LYS B 1 20  ? -18.811 25.124 31.271 1.00 51.98  ? 20  LYS B CA  1 
ATOM   899  C  C   . LYS B 1 20  ? -18.541 25.455 32.729 1.00 52.49  ? 20  LYS B C   1 
ATOM   900  O  O   . LYS B 1 20  ? -18.254 26.598 33.073 1.00 51.98  ? 20  LYS B O   1 
ATOM   901  C  CB  . LYS B 1 20  ? -17.539 24.558 30.640 1.00 51.70  ? 20  LYS B CB  1 
ATOM   902  C  CG  . LYS B 1 20  ? -17.758 23.990 29.250 1.00 51.10  ? 20  LYS B CG  1 
ATOM   903  C  CD  . LYS B 1 20  ? -16.453 23.573 28.607 1.00 51.54  ? 20  LYS B CD  1 
ATOM   904  C  CE  . LYS B 1 20  ? -16.684 23.147 27.172 1.00 53.00  ? 20  LYS B CE  1 
ATOM   905  N  NZ  . LYS B 1 20  ? -15.410 22.771 26.497 1.00 57.38  ? 20  LYS B NZ  1 
ATOM   906  N  N   . LEU B 1 21  ? -18.630 24.438 33.583 1.00 55.01  ? 21  LEU B N   1 
ATOM   907  C  CA  . LEU B 1 21  ? -18.397 24.600 35.016 1.00 56.74  ? 21  LEU B CA  1 
ATOM   908  C  C   . LEU B 1 21  ? -16.995 24.099 35.333 1.00 59.57  ? 21  LEU B C   1 
ATOM   909  O  O   . LEU B 1 21  ? -16.667 22.939 35.082 1.00 59.16  ? 21  LEU B O   1 
ATOM   910  C  CB  . LEU B 1 21  ? -19.452 23.814 35.809 1.00 54.57  ? 21  LEU B CB  1 
ATOM   911  C  CG  . LEU B 1 21  ? -19.640 24.037 37.315 1.00 53.64  ? 21  LEU B CG  1 
ATOM   912  C  CD1 . LEU B 1 21  ? -18.429 23.585 38.070 1.00 55.37  ? 21  LEU B CD1 1 
ATOM   913  C  CD2 . LEU B 1 21  ? -19.903 25.491 37.597 1.00 54.27  ? 21  LEU B CD2 1 
ATOM   914  N  N   . ARG B 1 22  ? -16.165 24.986 35.873 1.00 64.27  ? 22  ARG B N   1 
ATOM   915  C  CA  . ARG B 1 22  ? -14.787 24.638 36.209 1.00 68.56  ? 22  ARG B CA  1 
ATOM   916  C  C   . ARG B 1 22  ? -14.705 23.985 37.576 1.00 69.54  ? 22  ARG B C   1 
ATOM   917  O  O   . ARG B 1 22  ? -14.630 24.669 38.594 1.00 70.10  ? 22  ARG B O   1 
ATOM   918  C  CB  . ARG B 1 22  ? -13.882 25.887 36.180 1.00 71.64  ? 22  ARG B CB  1 
ATOM   919  C  CG  . ARG B 1 22  ? -13.739 26.560 34.805 1.00 74.29  ? 22  ARG B CG  1 
ATOM   920  C  CD  . ARG B 1 22  ? -12.919 27.862 34.859 1.00 75.49  ? 22  ARG B CD  1 
ATOM   921  N  NE  . ARG B 1 22  ? -12.920 28.567 33.572 1.00 78.39  ? 22  ARG B NE  1 
ATOM   922  C  CZ  . ARG B 1 22  ? -12.098 28.308 32.554 1.00 79.37  ? 22  ARG B CZ  1 
ATOM   923  N  NH1 . ARG B 1 22  ? -11.177 27.354 32.650 1.00 79.37  ? 22  ARG B NH1 1 
ATOM   924  N  NH2 . ARG B 1 22  ? -12.214 28.993 31.423 1.00 78.17  ? 22  ARG B NH2 1 
ATOM   925  N  N   . GLN B 1 23  ? -14.722 22.659 37.593 1.00 71.44  ? 23  GLN B N   1 
ATOM   926  C  CA  . GLN B 1 23  ? -14.635 21.916 38.843 1.00 74.12  ? 23  GLN B CA  1 
ATOM   927  C  C   . GLN B 1 23  ? -13.193 21.433 39.009 1.00 75.61  ? 23  GLN B C   1 
ATOM   928  O  O   . GLN B 1 23  ? -12.820 20.360 38.523 1.00 75.87  ? 23  GLN B O   1 
ATOM   929  C  CB  . GLN B 1 23  ? -15.595 20.720 38.817 1.00 74.05  ? 23  GLN B CB  1 
ATOM   930  C  CG  . GLN B 1 23  ? -16.029 20.237 40.193 1.00 74.15  ? 23  GLN B CG  1 
ATOM   931  C  CD  . GLN B 1 23  ? -14.883 19.706 41.023 1.00 75.09  ? 23  GLN B CD  1 
ATOM   932  O  OE1 . GLN B 1 23  ? -14.270 18.692 40.678 1.00 76.61  ? 23  GLN B OE1 1 
ATOM   933  N  NE2 . GLN B 1 23  ? -14.580 20.389 42.123 1.00 73.85  ? 23  GLN B NE2 1 
ATOM   934  N  N   . GLY B 1 24  ? -12.386 22.233 39.697 1.00 77.06  ? 24  GLY B N   1 
ATOM   935  C  CA  . GLY B 1 24  ? -10.994 21.879 39.893 1.00 78.24  ? 24  GLY B CA  1 
ATOM   936  C  C   . GLY B 1 24  ? -10.256 21.926 38.567 1.00 79.47  ? 24  GLY B C   1 
ATOM   937  O  O   . GLY B 1 24  ? -9.912  23.005 38.076 1.00 79.35  ? 24  GLY B O   1 
ATOM   938  N  N   . GLU B 1 25  ? -10.025 20.748 37.989 1.00 80.74  ? 25  GLU B N   1 
ATOM   939  C  CA  . GLU B 1 25  ? -9.327  20.612 36.710 1.00 81.67  ? 25  GLU B CA  1 
ATOM   940  C  C   . GLU B 1 25  ? -10.258 20.133 35.599 1.00 80.85  ? 25  GLU B C   1 
ATOM   941  O  O   . GLU B 1 25  ? -9.848  19.992 34.442 1.00 81.01  ? 25  GLU B O   1 
ATOM   942  C  CB  . GLU B 1 25  ? -8.169  19.618 36.848 1.00 83.64  ? 25  GLU B CB  1 
ATOM   943  C  CG  . GLU B 1 25  ? -6.968  20.172 37.586 1.00 86.04  ? 25  GLU B CG  1 
ATOM   944  C  CD  . GLU B 1 25  ? -6.298  21.301 36.822 1.00 87.42  ? 25  GLU B CD  1 
ATOM   945  O  OE1 . GLU B 1 25  ? -5.828  21.051 35.691 1.00 88.94  ? 25  GLU B OE1 1 
ATOM   946  O  OE2 . GLU B 1 25  ? -6.246  22.435 37.350 1.00 87.57  ? 25  GLU B OE2 1 
ATOM   947  N  N   . ASN B 1 26  ? -11.514 19.890 35.955 1.00 78.65  ? 26  ASN B N   1 
ATOM   948  C  CA  . ASN B 1 26  ? -12.490 19.405 34.993 1.00 75.63  ? 26  ASN B CA  1 
ATOM   949  C  C   . ASN B 1 26  ? -13.476 20.482 34.565 1.00 72.81  ? 26  ASN B C   1 
ATOM   950  O  O   . ASN B 1 26  ? -13.784 21.403 35.324 1.00 72.03  ? 26  ASN B O   1 
ATOM   951  C  CB  . ASN B 1 26  ? -13.252 18.228 35.596 1.00 77.48  ? 26  ASN B CB  1 
ATOM   952  C  CG  . ASN B 1 26  ? -12.328 17.178 36.169 1.00 80.45  ? 26  ASN B CG  1 
ATOM   953  O  OD1 . ASN B 1 26  ? -11.451 16.668 35.470 1.00 83.33  ? 26  ASN B OD1 1 
ATOM   954  N  ND2 . ASN B 1 26  ? -12.512 16.849 37.450 1.00 80.80  ? 26  ASN B ND2 1 
ATOM   955  N  N   . LEU B 1 27  ? -13.964 20.363 33.337 1.00 68.68  ? 27  LEU B N   1 
ATOM   956  C  CA  . LEU B 1 27  ? -14.946 21.304 32.817 1.00 65.64  ? 27  LEU B CA  1 
ATOM   957  C  C   . LEU B 1 27  ? -16.222 20.518 32.550 1.00 63.46  ? 27  LEU B C   1 
ATOM   958  O  O   . LEU B 1 27  ? -16.268 19.640 31.686 1.00 63.79  ? 27  LEU B O   1 
ATOM   959  C  CB  . LEU B 1 27  ? -14.432 21.971 31.541 1.00 65.06  ? 27  LEU B CB  1 
ATOM   960  C  CG  . LEU B 1 27  ? -13.249 22.906 31.803 1.00 63.10  ? 27  LEU B CG  1 
ATOM   961  C  CD1 . LEU B 1 27  ? -12.727 23.445 30.491 1.00 63.12  ? 27  LEU B CD1 1 
ATOM   962  C  CD2 . LEU B 1 27  ? -13.679 24.039 32.718 1.00 61.68  ? 27  LEU B CD2 1 
ATOM   963  N  N   . ILE B 1 28  ? -17.258 20.847 33.310 1.00 59.95  ? 28  ILE B N   1 
ATOM   964  C  CA  . ILE B 1 28  ? -18.534 20.155 33.231 1.00 55.40  ? 28  ILE B CA  1 
ATOM   965  C  C   . ILE B 1 28  ? -19.611 20.928 32.491 1.00 52.73  ? 28  ILE B C   1 
ATOM   966  O  O   . ILE B 1 28  ? -19.752 22.143 32.664 1.00 52.90  ? 28  ILE B O   1 
ATOM   967  C  CB  . ILE B 1 28  ? -19.021 19.854 34.660 1.00 56.22  ? 28  ILE B CB  1 
ATOM   968  C  CG1 . ILE B 1 28  ? -17.950 19.035 35.383 1.00 54.98  ? 28  ILE B CG1 1 
ATOM   969  C  CG2 . ILE B 1 28  ? -20.380 19.162 34.629 1.00 55.08  ? 28  ILE B CG2 1 
ATOM   970  C  CD1 . ILE B 1 28  ? -18.056 19.092 36.880 1.00 55.84  ? 28  ILE B CD1 1 
ATOM   971  N  N   . LEU B 1 29  ? -20.377 20.213 31.676 1.00 48.58  ? 29  LEU B N   1 
ATOM   972  C  CA  . LEU B 1 29  ? -21.461 20.821 30.926 1.00 48.23  ? 29  LEU B CA  1 
ATOM   973  C  C   . LEU B 1 29  ? -22.814 20.488 31.556 1.00 48.92  ? 29  LEU B C   1 
ATOM   974  O  O   . LEU B 1 29  ? -23.776 21.269 31.453 1.00 49.21  ? 29  LEU B O   1 
ATOM   975  C  CB  . LEU B 1 29  ? -21.426 20.343 29.481 1.00 49.91  ? 29  LEU B CB  1 
ATOM   976  C  CG  . LEU B 1 29  ? -20.372 21.041 28.622 1.00 51.18  ? 29  LEU B CG  1 
ATOM   977  C  CD1 . LEU B 1 29  ? -20.315 20.407 27.246 1.00 50.72  ? 29  LEU B CD1 1 
ATOM   978  C  CD2 . LEU B 1 29  ? -20.726 22.534 28.526 1.00 51.44  ? 29  LEU B CD2 1 
ATOM   979  N  N   . GLY B 1 30  ? -22.887 19.321 32.196 1.00 46.86  ? 30  GLY B N   1 
ATOM   980  C  CA  . GLY B 1 30  ? -24.113 18.911 32.850 1.00 44.92  ? 30  GLY B CA  1 
ATOM   981  C  C   . GLY B 1 30  ? -25.167 18.243 31.990 1.00 45.15  ? 30  GLY B C   1 
ATOM   982  O  O   . GLY B 1 30  ? -26.363 18.493 32.182 1.00 44.91  ? 30  GLY B O   1 
ATOM   983  N  N   . PHE B 1 31  ? -24.746 17.412 31.038 1.00 44.07  ? 31  PHE B N   1 
ATOM   984  C  CA  . PHE B 1 31  ? -25.701 16.699 30.201 1.00 44.01  ? 31  PHE B CA  1 
ATOM   985  C  C   . PHE B 1 31  ? -25.058 15.488 29.520 1.00 44.43  ? 31  PHE B C   1 
ATOM   986  O  O   . PHE B 1 31  ? -23.842 15.329 29.550 1.00 43.62  ? 31  PHE B O   1 
ATOM   987  C  CB  . PHE B 1 31  ? -26.363 17.664 29.197 1.00 47.21  ? 31  PHE B CB  1 
ATOM   988  C  CG  . PHE B 1 31  ? -25.522 18.002 27.986 1.00 51.37  ? 31  PHE B CG  1 
ATOM   989  C  CD1 . PHE B 1 31  ? -25.681 17.294 26.794 1.00 51.07  ? 31  PHE B CD1 1 
ATOM   990  C  CD2 . PHE B 1 31  ? -24.615 19.064 28.017 1.00 53.49  ? 31  PHE B CD2 1 
ATOM   991  C  CE1 . PHE B 1 31  ? -24.960 17.639 25.649 1.00 52.00  ? 31  PHE B CE1 1 
ATOM   992  C  CE2 . PHE B 1 31  ? -23.885 19.417 26.870 1.00 54.44  ? 31  PHE B CE2 1 
ATOM   993  C  CZ  . PHE B 1 31  ? -24.062 18.701 25.685 1.00 52.29  ? 31  PHE B CZ  1 
ATOM   994  N  N   . SER B 1 32  ? -25.873 14.604 28.949 1.00 45.03  ? 32  SER B N   1 
ATOM   995  C  CA  . SER B 1 32  ? -25.334 13.413 28.296 1.00 44.67  ? 32  SER B CA  1 
ATOM   996  C  C   . SER B 1 32  ? -25.821 13.277 26.879 1.00 44.26  ? 32  SER B C   1 
ATOM   997  O  O   . SER B 1 32  ? -26.894 13.756 26.523 1.00 43.78  ? 32  SER B O   1 
ATOM   998  C  CB  . SER B 1 32  ? -25.700 12.145 29.075 1.00 45.21  ? 32  SER B CB  1 
ATOM   999  O  OG  . SER B 1 32  ? -25.072 12.144 30.348 1.00 47.84  ? 32  SER B OG  1 
ATOM   1000 N  N   . ILE B 1 33  ? -25.026 12.603 26.067 1.00 45.29  ? 33  ILE B N   1 
ATOM   1001 C  CA  . ILE B 1 33  ? -25.390 12.426 24.680 1.00 47.70  ? 33  ILE B CA  1 
ATOM   1002 C  C   . ILE B 1 33  ? -25.414 10.974 24.230 1.00 49.80  ? 33  ILE B C   1 
ATOM   1003 O  O   . ILE B 1 33  ? -24.779 10.089 24.824 1.00 49.92  ? 33  ILE B O   1 
ATOM   1004 C  CB  . ILE B 1 33  ? -24.412 13.179 23.750 1.00 47.77  ? 33  ILE B CB  1 
ATOM   1005 C  CG1 . ILE B 1 33  ? -22.990 12.642 23.955 1.00 45.73  ? 33  ILE B CG1 1 
ATOM   1006 C  CG2 . ILE B 1 33  ? -24.484 14.682 24.020 1.00 45.12  ? 33  ILE B CG2 1 
ATOM   1007 C  CD1 . ILE B 1 33  ? -22.006 13.104 22.900 1.00 45.75  ? 33  ILE B CD1 1 
ATOM   1008 N  N   . GLY B 1 34  ? -26.154 10.765 23.151 1.00 51.35  ? 34  GLY B N   1 
ATOM   1009 C  CA  . GLY B 1 34  ? -26.278 9.463  22.535 1.00 53.97  ? 34  GLY B CA  1 
ATOM   1010 C  C   . GLY B 1 34  ? -26.421 9.724  21.045 1.00 55.25  ? 34  GLY B C   1 
ATOM   1011 O  O   . GLY B 1 34  ? -26.876 10.799 20.631 1.00 54.90  ? 34  GLY B O   1 
ATOM   1012 N  N   . GLY B 1 35  ? -26.025 8.759  20.228 1.00 55.70  ? 35  GLY B N   1 
ATOM   1013 C  CA  . GLY B 1 35  ? -26.145 8.951  18.799 1.00 56.18  ? 35  GLY B CA  1 
ATOM   1014 C  C   . GLY B 1 35  ? -24.800 8.897  18.117 1.00 57.59  ? 35  GLY B C   1 
ATOM   1015 O  O   . GLY B 1 35  ? -23.770 8.604  18.739 1.00 55.13  ? 35  GLY B O   1 
ATOM   1016 N  N   . GLY B 1 36  ? -24.817 9.199  16.826 1.00 59.93  ? 36  GLY B N   1 
ATOM   1017 C  CA  . GLY B 1 36  ? -23.600 9.166  16.042 1.00 63.66  ? 36  GLY B CA  1 
ATOM   1018 C  C   . GLY B 1 36  ? -23.724 8.114  14.955 1.00 65.47  ? 36  GLY B C   1 
ATOM   1019 O  O   . GLY B 1 36  ? -24.392 7.092  15.131 1.00 65.88  ? 36  GLY B O   1 
ATOM   1020 N  N   . ILE B 1 37  ? -23.079 8.368  13.824 1.00 67.53  ? 37  ILE B N   1 
ATOM   1021 C  CA  . ILE B 1 37  ? -23.107 7.447  12.691 1.00 68.82  ? 37  ILE B CA  1 
ATOM   1022 C  C   . ILE B 1 37  ? -22.593 6.046  13.050 1.00 70.18  ? 37  ILE B C   1 
ATOM   1023 O  O   . ILE B 1 37  ? -23.049 5.052  12.483 1.00 70.19  ? 37  ILE B O   1 
ATOM   1024 C  CB  . ILE B 1 37  ? -22.276 8.014  11.520 1.00 67.22  ? 37  ILE B CB  1 
ATOM   1025 C  CG1 . ILE B 1 37  ? -20.850 8.325  12.000 1.00 66.32  ? 37  ILE B CG1 1 
ATOM   1026 C  CG2 . ILE B 1 37  ? -22.958 9.267  10.968 1.00 65.70  ? 37  ILE B CG2 1 
ATOM   1027 C  CD1 . ILE B 1 37  ? -19.935 8.878  10.923 1.00 65.30  ? 37  ILE B CD1 1 
ATOM   1028 N  N   . ASP B 1 38  ? -21.657 5.971  13.996 1.00 71.54  ? 38  ASP B N   1 
ATOM   1029 C  CA  . ASP B 1 38  ? -21.091 4.692  14.421 1.00 72.85  ? 38  ASP B CA  1 
ATOM   1030 C  C   . ASP B 1 38  ? -21.992 3.994  15.439 1.00 75.17  ? 38  ASP B C   1 
ATOM   1031 O  O   . ASP B 1 38  ? -21.561 3.071  16.134 1.00 74.33  ? 38  ASP B O   1 
ATOM   1032 C  CB  . ASP B 1 38  ? -19.700 4.912  15.029 1.00 72.12  ? 38  ASP B CB  1 
ATOM   1033 C  CG  . ASP B 1 38  ? -19.737 5.750  16.303 1.00 72.78  ? 38  ASP B CG  1 
ATOM   1034 O  OD1 . ASP B 1 38  ? -20.474 6.763  16.323 1.00 72.46  ? 38  ASP B OD1 1 
ATOM   1035 O  OD2 . ASP B 1 38  ? -19.020 5.404  17.274 1.00 72.28  ? 38  ASP B OD2 1 
ATOM   1036 N  N   . GLN B 1 39  ? -23.246 4.435  15.519 1.00 77.95  ? 39  GLN B N   1 
ATOM   1037 C  CA  . GLN B 1 39  ? -24.199 3.857  16.465 1.00 80.57  ? 39  GLN B CA  1 
ATOM   1038 C  C   . GLN B 1 39  ? -25.520 3.451  15.799 1.00 82.94  ? 39  GLN B C   1 
ATOM   1039 O  O   . GLN B 1 39  ? -25.884 3.973  14.740 1.00 84.17  ? 39  GLN B O   1 
ATOM   1040 C  CB  . GLN B 1 39  ? -24.479 4.855  17.590 1.00 78.68  ? 39  GLN B CB  1 
ATOM   1041 C  CG  . GLN B 1 39  ? -23.230 5.366  18.297 1.00 78.68  ? 39  GLN B CG  1 
ATOM   1042 C  CD  . GLN B 1 39  ? -22.527 4.303  19.121 1.00 78.44  ? 39  GLN B CD  1 
ATOM   1043 O  OE1 . GLN B 1 39  ? -23.090 3.770  20.078 1.00 78.58  ? 39  GLN B OE1 1 
ATOM   1044 N  NE2 . GLN B 1 39  ? -21.287 3.994  18.757 1.00 78.25  ? 39  GLN B NE2 1 
ATOM   1045 N  N   . ASP B 1 40  ? -26.231 2.518  16.432 1.00 84.83  ? 40  ASP B N   1 
ATOM   1046 C  CA  . ASP B 1 40  ? -27.516 2.025  15.927 1.00 86.77  ? 40  ASP B CA  1 
ATOM   1047 C  C   . ASP B 1 40  ? -28.616 3.060  16.193 1.00 87.57  ? 40  ASP B C   1 
ATOM   1048 O  O   . ASP B 1 40  ? -29.130 3.163  17.306 1.00 87.66  ? 40  ASP B O   1 
ATOM   1049 C  CB  . ASP B 1 40  ? -27.856 0.695  16.611 1.00 88.20  ? 40  ASP B CB  1 
ATOM   1050 C  CG  . ASP B 1 40  ? -29.087 0.028  16.024 1.00 89.33  ? 40  ASP B CG  1 
ATOM   1051 O  OD1 . ASP B 1 40  ? -29.136 -0.141 14.784 1.00 90.01  ? 40  ASP B OD1 1 
ATOM   1052 O  OD2 . ASP B 1 40  ? -29.996 -0.335 16.807 1.00 88.72  ? 40  ASP B OD2 1 
ATOM   1053 N  N   . PRO B 1 41  ? -29.001 3.827  15.162 1.00 88.60  ? 41  PRO B N   1 
ATOM   1054 C  CA  . PRO B 1 41  ? -30.031 4.870  15.246 1.00 90.01  ? 41  PRO B CA  1 
ATOM   1055 C  C   . PRO B 1 41  ? -31.423 4.419  15.667 1.00 91.06  ? 41  PRO B C   1 
ATOM   1056 O  O   . PRO B 1 41  ? -32.232 5.231  16.122 1.00 90.91  ? 41  PRO B O   1 
ATOM   1057 C  CB  . PRO B 1 41  ? -30.026 5.461  13.841 1.00 89.77  ? 41  PRO B CB  1 
ATOM   1058 C  CG  . PRO B 1 41  ? -29.727 4.273  12.997 1.00 89.35  ? 41  PRO B CG  1 
ATOM   1059 C  CD  . PRO B 1 41  ? -28.584 3.634  13.762 1.00 88.96  ? 41  PRO B CD  1 
ATOM   1060 N  N   . SER B 1 42  ? -31.703 3.131  15.510 1.00 93.04  ? 42  SER B N   1 
ATOM   1061 C  CA  . SER B 1 42  ? -33.012 2.589  15.866 1.00 94.57  ? 42  SER B CA  1 
ATOM   1062 C  C   . SER B 1 42  ? -33.290 2.638  17.371 1.00 95.84  ? 42  SER B C   1 
ATOM   1063 O  O   . SER B 1 42  ? -34.439 2.509  17.800 1.00 95.43  ? 42  SER B O   1 
ATOM   1064 C  CB  . SER B 1 42  ? -33.131 1.139  15.369 1.00 93.45  ? 42  SER B CB  1 
ATOM   1065 O  OG  . SER B 1 42  ? -32.218 0.287  16.042 1.00 90.29  ? 42  SER B OG  1 
ATOM   1066 N  N   . GLN B 1 43  ? -32.243 2.874  18.161 1.00 98.03  ? 43  GLN B N   1 
ATOM   1067 C  CA  . GLN B 1 43  ? -32.348 2.896  19.622 1.00 100.24 ? 43  GLN B CA  1 
ATOM   1068 C  C   . GLN B 1 43  ? -33.008 4.085  20.342 1.00 101.09 ? 43  GLN B C   1 
ATOM   1069 O  O   . GLN B 1 43  ? -32.361 5.096  20.630 1.00 100.29 ? 43  GLN B O   1 
ATOM   1070 C  CB  . GLN B 1 43  ? -30.961 2.669  20.234 1.00 101.19 ? 43  GLN B CB  1 
ATOM   1071 C  CG  . GLN B 1 43  ? -30.172 1.543  19.579 1.00 103.27 ? 43  GLN B CG  1 
ATOM   1072 C  CD  . GLN B 1 43  ? -29.020 1.047  20.441 1.00 104.46 ? 43  GLN B CD  1 
ATOM   1073 O  OE1 . GLN B 1 43  ? -29.186 0.131  21.249 1.00 105.40 ? 43  GLN B OE1 1 
ATOM   1074 N  NE2 . GLN B 1 43  ? -27.850 1.658  20.279 1.00 104.16 ? 43  GLN B NE2 1 
ATOM   1075 N  N   . ASN B 1 44  ? -34.303 3.930  20.626 1.00 101.86 ? 44  ASN B N   1 
ATOM   1076 C  CA  . ASN B 1 44  ? -35.132 4.892  21.373 1.00 101.79 ? 44  ASN B CA  1 
ATOM   1077 C  C   . ASN B 1 44  ? -34.987 6.404  21.183 1.00 100.66 ? 44  ASN B C   1 
ATOM   1078 O  O   . ASN B 1 44  ? -35.344 7.169  22.089 1.00 99.37  ? 44  ASN B O   1 
ATOM   1079 C  CB  . ASN B 1 44  ? -34.956 4.635  22.870 1.00 102.76 ? 44  ASN B CB  1 
ATOM   1080 C  CG  . ASN B 1 44  ? -33.654 5.216  23.404 1.00 103.47 ? 44  ASN B CG  1 
ATOM   1081 O  OD1 . ASN B 1 44  ? -32.574 4.646  23.218 1.00 103.82 ? 44  ASN B OD1 1 
ATOM   1082 N  ND2 . ASN B 1 44  ? -33.751 6.372  24.053 1.00 103.57 ? 44  ASN B ND2 1 
ATOM   1083 N  N   . PRO B 1 45  ? -34.509 6.872  20.024 1.00 100.05 ? 45  PRO B N   1 
ATOM   1084 C  CA  . PRO B 1 45  ? -34.422 8.331  20.014 1.00 99.13  ? 45  PRO B CA  1 
ATOM   1085 C  C   . PRO B 1 45  ? -35.752 9.029  20.229 1.00 97.96  ? 45  PRO B C   1 
ATOM   1086 O  O   . PRO B 1 45  ? -36.816 8.405  20.310 1.00 97.34  ? 45  PRO B O   1 
ATOM   1087 C  CB  . PRO B 1 45  ? -33.828 8.644  18.640 1.00 99.40  ? 45  PRO B CB  1 
ATOM   1088 C  CG  . PRO B 1 45  ? -33.133 7.364  18.247 1.00 100.73 ? 45  PRO B CG  1 
ATOM   1089 C  CD  . PRO B 1 45  ? -34.110 6.318  18.722 1.00 100.16 ? 45  PRO B CD  1 
ATOM   1090 N  N   . PHE B 1 46  ? -35.651 10.345 20.341 1.00 96.60  ? 46  PHE B N   1 
ATOM   1091 C  CA  . PHE B 1 46  ? -36.787 11.233 20.518 1.00 94.75  ? 46  PHE B CA  1 
ATOM   1092 C  C   . PHE B 1 46  ? -36.933 11.709 19.081 1.00 95.67  ? 46  PHE B C   1 
ATOM   1093 O  O   . PHE B 1 46  ? -37.685 12.636 18.765 1.00 95.92  ? 46  PHE B O   1 
ATOM   1094 C  CB  . PHE B 1 46  ? -36.374 12.357 21.465 1.00 90.58  ? 46  PHE B CB  1 
ATOM   1095 C  CG  . PHE B 1 46  ? -35.673 11.854 22.699 1.00 86.96  ? 46  PHE B CG  1 
ATOM   1096 C  CD1 . PHE B 1 46  ? -36.371 11.655 23.887 1.00 85.75  ? 46  PHE B CD1 1 
ATOM   1097 C  CD2 . PHE B 1 46  ? -34.333 11.478 22.643 1.00 85.17  ? 46  PHE B CD2 1 
ATOM   1098 C  CE1 . PHE B 1 46  ? -35.743 11.084 24.995 1.00 84.67  ? 46  PHE B CE1 1 
ATOM   1099 C  CE2 . PHE B 1 46  ? -33.699 10.906 23.742 1.00 83.52  ? 46  PHE B CE2 1 
ATOM   1100 C  CZ  . PHE B 1 46  ? -34.404 10.707 24.919 1.00 83.55  ? 46  PHE B CZ  1 
ATOM   1101 N  N   . SER B 1 47  ? -36.175 11.022 18.225 1.00 96.42  ? 47  SER B N   1 
ATOM   1102 C  CA  . SER B 1 47  ? -36.128 11.263 16.792 1.00 96.68  ? 47  SER B CA  1 
ATOM   1103 C  C   . SER B 1 47  ? -37.264 10.512 16.130 1.00 96.88  ? 47  SER B C   1 
ATOM   1104 O  O   . SER B 1 47  ? -37.426 9.302  16.319 1.00 97.52  ? 47  SER B O   1 
ATOM   1105 C  CB  . SER B 1 47  ? -34.798 10.772 16.207 1.00 96.83  ? 47  SER B CB  1 
ATOM   1106 O  OG  . SER B 1 47  ? -34.719 9.356  16.188 1.00 96.47  ? 47  SER B OG  1 
ATOM   1107 N  N   . GLU B 1 48  ? -38.047 11.246 15.352 1.00 96.70  ? 48  GLU B N   1 
ATOM   1108 C  CA  . GLU B 1 48  ? -39.183 10.691 14.630 1.00 96.75  ? 48  GLU B CA  1 
ATOM   1109 C  C   . GLU B 1 48  ? -38.692 9.603  13.671 1.00 96.49  ? 48  GLU B C   1 
ATOM   1110 O  O   . GLU B 1 48  ? -39.233 8.492  13.629 1.00 96.57  ? 48  GLU B O   1 
ATOM   1111 C  CB  . GLU B 1 48  ? -39.887 11.804 13.859 1.00 96.73  ? 48  GLU B CB  1 
ATOM   1112 N  N   . ASP B 1 49  ? -37.656 9.940  12.909 1.00 95.59  ? 49  ASP B N   1 
ATOM   1113 C  CA  . ASP B 1 49  ? -37.048 9.024  11.954 1.00 94.65  ? 49  ASP B CA  1 
ATOM   1114 C  C   . ASP B 1 49  ? -36.085 8.115  12.723 1.00 93.50  ? 49  ASP B C   1 
ATOM   1115 O  O   . ASP B 1 49  ? -35.138 8.598  13.347 1.00 93.90  ? 49  ASP B O   1 
ATOM   1116 C  CB  . ASP B 1 49  ? -36.280 9.828  10.903 1.00 96.02  ? 49  ASP B CB  1 
ATOM   1117 C  CG  . ASP B 1 49  ? -35.765 8.968  9.769  1.00 97.60  ? 49  ASP B CG  1 
ATOM   1118 O  OD1 . ASP B 1 49  ? -35.213 7.884  10.054 1.00 97.80  ? 49  ASP B OD1 1 
ATOM   1119 O  OD2 . ASP B 1 49  ? -35.904 9.381  8.596  1.00 98.67  ? 49  ASP B OD2 1 
ATOM   1120 N  N   . LYS B 1 50  ? -36.316 6.806  12.680 1.00 91.73  ? 50  LYS B N   1 
ATOM   1121 C  CA  . LYS B 1 50  ? -35.453 5.875  13.402 1.00 90.36  ? 50  LYS B CA  1 
ATOM   1122 C  C   . LYS B 1 50  ? -34.159 5.536  12.674 1.00 88.98  ? 50  LYS B C   1 
ATOM   1123 O  O   . LYS B 1 50  ? -33.430 4.626  13.079 1.00 89.10  ? 50  LYS B O   1 
ATOM   1124 C  CB  . LYS B 1 50  ? -36.214 4.589  13.731 1.00 91.56  ? 50  LYS B CB  1 
ATOM   1125 C  CG  . LYS B 1 50  ? -37.397 4.793  14.667 1.00 92.96  ? 50  LYS B CG  1 
ATOM   1126 C  CD  . LYS B 1 50  ? -36.963 5.367  16.010 1.00 93.83  ? 50  LYS B CD  1 
ATOM   1127 C  CE  . LYS B 1 50  ? -38.172 5.713  16.872 1.00 94.44  ? 50  LYS B CE  1 
ATOM   1128 N  NZ  . LYS B 1 50  ? -37.789 6.344  18.168 1.00 94.10  ? 50  LYS B NZ  1 
ATOM   1129 N  N   . THR B 1 51  ? -33.873 6.266  11.601 1.00 87.35  ? 51  THR B N   1 
ATOM   1130 C  CA  . THR B 1 51  ? -32.645 6.051  10.839 1.00 86.23  ? 51  THR B CA  1 
ATOM   1131 C  C   . THR B 1 51  ? -31.670 7.167  11.200 1.00 85.19  ? 51  THR B C   1 
ATOM   1132 O  O   . THR B 1 51  ? -30.460 7.043  11.008 1.00 85.81  ? 51  THR B O   1 
ATOM   1133 C  CB  . THR B 1 51  ? -32.887 6.115  9.321  1.00 86.88  ? 51  THR B CB  1 
ATOM   1134 O  OG1 . THR B 1 51  ? -33.035 7.485  8.920  1.00 85.94  ? 51  THR B OG1 1 
ATOM   1135 C  CG2 . THR B 1 51  ? -34.147 5.337  8.948  1.00 87.06  ? 51  THR B CG2 1 
ATOM   1136 N  N   . ASP B 1 52  ? -32.222 8.261  11.716 1.00 83.43  ? 52  ASP B N   1 
ATOM   1137 C  CA  . ASP B 1 52  ? -31.446 9.426  12.123 1.00 80.78  ? 52  ASP B CA  1 
ATOM   1138 C  C   . ASP B 1 52  ? -30.379 9.017  13.131 1.00 78.76  ? 52  ASP B C   1 
ATOM   1139 O  O   . ASP B 1 52  ? -30.694 8.577  14.238 1.00 80.06  ? 52  ASP B O   1 
ATOM   1140 C  CB  . ASP B 1 52  ? -32.387 10.475 12.730 1.00 80.83  ? 52  ASP B CB  1 
ATOM   1141 C  CG  . ASP B 1 52  ? -31.691 11.782 13.034 1.00 81.16  ? 52  ASP B CG  1 
ATOM   1142 O  OD1 . ASP B 1 52  ? -32.401 12.802 13.167 1.00 81.05  ? 52  ASP B OD1 1 
ATOM   1143 O  OD2 . ASP B 1 52  ? -30.443 11.790 13.148 1.00 81.52  ? 52  ASP B OD2 1 
ATOM   1144 N  N   . LYS B 1 53  ? -29.116 9.164  12.744 1.00 76.16  ? 53  LYS B N   1 
ATOM   1145 C  CA  . LYS B 1 53  ? -27.995 8.794  13.605 1.00 73.91  ? 53  LYS B CA  1 
ATOM   1146 C  C   . LYS B 1 53  ? -27.331 10.041 14.181 1.00 71.22  ? 53  LYS B C   1 
ATOM   1147 O  O   . LYS B 1 53  ? -26.174 10.000 14.612 1.00 70.99  ? 53  LYS B O   1 
ATOM   1148 C  CB  . LYS B 1 53  ? -26.964 7.992  12.803 1.00 75.57  ? 53  LYS B CB  1 
ATOM   1149 C  CG  . LYS B 1 53  ? -27.601 7.042  11.798 1.00 78.12  ? 53  LYS B CG  1 
ATOM   1150 C  CD  . LYS B 1 53  ? -26.588 6.392  10.865 1.00 78.74  ? 53  LYS B CD  1 
ATOM   1151 C  CE  . LYS B 1 53  ? -25.863 5.237  11.535 1.00 79.98  ? 53  LYS B CE  1 
ATOM   1152 N  NZ  . LYS B 1 53  ? -25.031 4.488  10.552 1.00 80.13  ? 53  LYS B NZ  1 
ATOM   1153 N  N   . GLY B 1 54  ? -28.067 11.148 14.174 1.00 67.90  ? 54  GLY B N   1 
ATOM   1154 C  CA  . GLY B 1 54  ? -27.538 12.391 14.701 1.00 64.98  ? 54  GLY B CA  1 
ATOM   1155 C  C   . GLY B 1 54  ? -27.258 12.293 16.188 1.00 62.17  ? 54  GLY B C   1 
ATOM   1156 O  O   . GLY B 1 54  ? -27.435 11.228 16.786 1.00 61.90  ? 54  GLY B O   1 
ATOM   1157 N  N   . ILE B 1 55  ? -26.808 13.397 16.781 1.00 59.07  ? 55  ILE B N   1 
ATOM   1158 C  CA  . ILE B 1 55  ? -26.511 13.431 18.208 1.00 55.28  ? 55  ILE B CA  1 
ATOM   1159 C  C   . ILE B 1 55  ? -27.704 13.994 18.975 1.00 54.27  ? 55  ILE B C   1 
ATOM   1160 O  O   . ILE B 1 55  ? -28.310 14.992 18.570 1.00 53.70  ? 55  ILE B O   1 
ATOM   1161 C  CB  . ILE B 1 55  ? -25.281 14.291 18.495 1.00 54.41  ? 55  ILE B CB  1 
ATOM   1162 C  CG1 . ILE B 1 55  ? -24.066 13.715 17.758 1.00 54.26  ? 55  ILE B CG1 1 
ATOM   1163 C  CG2 . ILE B 1 55  ? -25.036 14.364 19.994 1.00 51.98  ? 55  ILE B CG2 1 
ATOM   1164 C  CD1 . ILE B 1 55  ? -23.593 12.360 18.260 1.00 53.13  ? 55  ILE B CD1 1 
ATOM   1165 N  N   . TYR B 1 56  ? -28.037 13.343 20.085 1.00 52.55  ? 56  TYR B N   1 
ATOM   1166 C  CA  . TYR B 1 56  ? -29.167 13.754 20.906 1.00 50.18  ? 56  TYR B CA  1 
ATOM   1167 C  C   . TYR B 1 56  ? -28.810 13.879 22.377 1.00 49.74  ? 56  TYR B C   1 
ATOM   1168 O  O   . TYR B 1 56  ? -27.926 13.175 22.885 1.00 48.69  ? 56  TYR B O   1 
ATOM   1169 C  CB  . TYR B 1 56  ? -30.297 12.734 20.774 1.00 50.14  ? 56  TYR B CB  1 
ATOM   1170 C  CG  . TYR B 1 56  ? -31.073 12.820 19.494 1.00 49.51  ? 56  TYR B CG  1 
ATOM   1171 C  CD1 . TYR B 1 56  ? -32.240 13.574 19.426 1.00 49.52  ? 56  TYR B CD1 1 
ATOM   1172 C  CD2 . TYR B 1 56  ? -30.640 12.150 18.343 1.00 50.06  ? 56  TYR B CD2 1 
ATOM   1173 C  CE1 . TYR B 1 56  ? -32.968 13.665 18.237 1.00 52.03  ? 56  TYR B CE1 1 
ATOM   1174 C  CE2 . TYR B 1 56  ? -31.357 12.230 17.146 1.00 51.55  ? 56  TYR B CE2 1 
ATOM   1175 C  CZ  . TYR B 1 56  ? -32.524 12.994 17.100 1.00 51.68  ? 56  TYR B CZ  1 
ATOM   1176 O  OH  . TYR B 1 56  ? -33.243 13.103 15.930 1.00 50.42  ? 56  TYR B OH  1 
ATOM   1177 N  N   . VAL B 1 57  ? -29.516 14.775 23.060 1.00 49.50  ? 57  VAL B N   1 
ATOM   1178 C  CA  . VAL B 1 57  ? -29.318 14.970 24.492 1.00 48.17  ? 57  VAL B CA  1 
ATOM   1179 C  C   . VAL B 1 57  ? -30.196 13.931 25.201 1.00 49.59  ? 57  VAL B C   1 
ATOM   1180 O  O   . VAL B 1 57  ? -31.430 13.981 25.116 1.00 49.65  ? 57  VAL B O   1 
ATOM   1181 C  CB  . VAL B 1 57  ? -29.744 16.388 24.916 1.00 46.62  ? 57  VAL B CB  1 
ATOM   1182 C  CG1 . VAL B 1 57  ? -29.558 16.559 26.409 1.00 43.54  ? 57  VAL B CG1 1 
ATOM   1183 C  CG2 . VAL B 1 57  ? -28.922 17.424 24.147 1.00 45.48  ? 57  VAL B CG2 1 
ATOM   1184 N  N   . THR B 1 58  ? -29.560 12.983 25.882 1.00 49.67  ? 58  THR B N   1 
ATOM   1185 C  CA  . THR B 1 58  ? -30.294 11.936 26.579 1.00 51.15  ? 58  THR B CA  1 
ATOM   1186 C  C   . THR B 1 58  ? -30.468 12.230 28.061 1.00 53.71  ? 58  THR B C   1 
ATOM   1187 O  O   . THR B 1 58  ? -31.272 11.588 28.738 1.00 56.29  ? 58  THR B O   1 
ATOM   1188 C  CB  . THR B 1 58  ? -29.579 10.592 26.473 1.00 50.37  ? 58  THR B CB  1 
ATOM   1189 O  OG1 . THR B 1 58  ? -28.322 10.668 27.158 1.00 52.20  ? 58  THR B OG1 1 
ATOM   1190 C  CG2 . THR B 1 58  ? -29.338 10.239 25.030 1.00 50.91  ? 58  THR B CG2 1 
ATOM   1191 N  N   . ARG B 1 59  ? -29.713 13.192 28.573 1.00 54.74  ? 59  ARG B N   1 
ATOM   1192 C  CA  . ARG B 1 59  ? -29.802 13.533 29.986 1.00 54.51  ? 59  ARG B CA  1 
ATOM   1193 C  C   . ARG B 1 59  ? -29.403 14.976 30.237 1.00 52.32  ? 59  ARG B C   1 
ATOM   1194 O  O   . ARG B 1 59  ? -28.522 15.504 29.562 1.00 52.31  ? 59  ARG B O   1 
ATOM   1195 C  CB  . ARG B 1 59  ? -28.882 12.619 30.796 1.00 56.80  ? 59  ARG B CB  1 
ATOM   1196 C  CG  . ARG B 1 59  ? -29.442 11.250 31.068 1.00 60.54  ? 59  ARG B CG  1 
ATOM   1197 C  CD  . ARG B 1 59  ? -28.357 10.320 31.568 1.00 64.23  ? 59  ARG B CD  1 
ATOM   1198 N  NE  . ARG B 1 59  ? -28.912 9.091  32.136 1.00 70.86  ? 59  ARG B NE  1 
ATOM   1199 C  CZ  . ARG B 1 59  ? -28.249 7.938  32.226 1.00 72.80  ? 59  ARG B CZ  1 
ATOM   1200 N  NH1 . ARG B 1 59  ? -27.001 7.847  31.773 1.00 73.05  ? 59  ARG B NH1 1 
ATOM   1201 N  NH2 . ARG B 1 59  ? -28.825 6.877  32.786 1.00 73.09  ? 59  ARG B NH2 1 
ATOM   1202 N  N   . VAL B 1 60  ? -30.056 15.600 31.210 1.00 49.19  ? 60  VAL B N   1 
ATOM   1203 C  CA  . VAL B 1 60  ? -29.752 16.968 31.587 1.00 46.56  ? 60  VAL B CA  1 
ATOM   1204 C  C   . VAL B 1 60  ? -29.791 17.083 33.114 1.00 47.05  ? 60  VAL B C   1 
ATOM   1205 O  O   . VAL B 1 60  ? -30.858 17.081 33.716 1.00 48.18  ? 60  VAL B O   1 
ATOM   1206 C  CB  . VAL B 1 60  ? -30.754 17.940 30.978 1.00 45.00  ? 60  VAL B CB  1 
ATOM   1207 C  CG1 . VAL B 1 60  ? -30.427 19.357 31.403 1.00 46.13  ? 60  VAL B CG1 1 
ATOM   1208 C  CG2 . VAL B 1 60  ? -30.724 17.826 29.478 1.00 42.73  ? 60  VAL B CG2 1 
ATOM   1209 N  N   . SER B 1 61  ? -28.622 17.173 33.738 1.00 46.59  ? 61  SER B N   1 
ATOM   1210 C  CA  . SER B 1 61  ? -28.534 17.270 35.191 1.00 45.15  ? 61  SER B CA  1 
ATOM   1211 C  C   . SER B 1 61  ? -29.254 18.476 35.789 1.00 46.09  ? 61  SER B C   1 
ATOM   1212 O  O   . SER B 1 61  ? -29.186 19.586 35.235 1.00 46.24  ? 61  SER B O   1 
ATOM   1213 C  CB  . SER B 1 61  ? -27.071 17.289 35.598 1.00 45.05  ? 61  SER B CB  1 
ATOM   1214 O  OG  . SER B 1 61  ? -26.403 16.175 35.034 1.00 45.89  ? 61  SER B OG  1 
ATOM   1215 N  N   . GLU B 1 62  ? -29.940 18.249 36.918 1.00 45.59  ? 62  GLU B N   1 
ATOM   1216 C  CA  . GLU B 1 62  ? -30.685 19.300 37.621 1.00 43.61  ? 62  GLU B CA  1 
ATOM   1217 C  C   . GLU B 1 62  ? -29.727 20.318 38.208 1.00 44.06  ? 62  GLU B C   1 
ATOM   1218 O  O   . GLU B 1 62  ? -28.740 19.958 38.855 1.00 44.51  ? 62  GLU B O   1 
ATOM   1219 C  CB  . GLU B 1 62  ? -31.522 18.727 38.770 1.00 41.10  ? 62  GLU B CB  1 
ATOM   1220 C  CG  . GLU B 1 62  ? -33.021 18.892 38.611 1.00 39.56  ? 62  GLU B CG  1 
ATOM   1221 C  CD  . GLU B 1 62  ? -33.452 20.330 38.344 1.00 37.13  ? 62  GLU B CD  1 
ATOM   1222 O  OE1 . GLU B 1 62  ? -33.229 21.182 39.214 1.00 38.17  ? 62  GLU B OE1 1 
ATOM   1223 O  OE2 . GLU B 1 62  ? -34.024 20.611 37.274 1.00 32.52  ? 62  GLU B OE2 1 
ATOM   1224 N  N   . GLY B 1 63  ? -30.025 21.592 37.990 1.00 44.55  ? 63  GLY B N   1 
ATOM   1225 C  CA  . GLY B 1 63  ? -29.172 22.639 38.516 1.00 45.83  ? 63  GLY B CA  1 
ATOM   1226 C  C   . GLY B 1 63  ? -27.802 22.653 37.866 1.00 46.22  ? 63  GLY B C   1 
ATOM   1227 O  O   . GLY B 1 63  ? -26.863 23.223 38.418 1.00 50.74  ? 63  GLY B O   1 
ATOM   1228 N  N   . GLY B 1 64  ? -27.676 22.019 36.706 1.00 43.56  ? 64  GLY B N   1 
ATOM   1229 C  CA  . GLY B 1 64  ? -26.404 22.010 36.018 1.00 42.51  ? 64  GLY B CA  1 
ATOM   1230 C  C   . GLY B 1 64  ? -26.322 23.154 35.021 1.00 40.99  ? 64  GLY B C   1 
ATOM   1231 O  O   . GLY B 1 64  ? -27.305 23.865 34.819 1.00 41.01  ? 64  GLY B O   1 
ATOM   1232 N  N   . PRO B 1 65  ? -25.157 23.365 34.390 1.00 39.69  ? 65  PRO B N   1 
ATOM   1233 C  CA  . PRO B 1 65  ? -24.959 24.436 33.411 1.00 38.72  ? 65  PRO B CA  1 
ATOM   1234 C  C   . PRO B 1 65  ? -25.929 24.332 32.243 1.00 39.71  ? 65  PRO B C   1 
ATOM   1235 O  O   . PRO B 1 65  ? -26.614 25.302 31.883 1.00 38.88  ? 65  PRO B O   1 
ATOM   1236 C  CB  . PRO B 1 65  ? -23.518 24.233 32.990 1.00 38.14  ? 65  PRO B CB  1 
ATOM   1237 C  CG  . PRO B 1 65  ? -22.876 23.777 34.274 1.00 38.16  ? 65  PRO B CG  1 
ATOM   1238 C  CD  . PRO B 1 65  ? -23.869 22.743 34.746 1.00 38.83  ? 65  PRO B CD  1 
ATOM   1239 N  N   . ALA B 1 66  ? -25.981 23.142 31.661 1.00 39.38  ? 66  ALA B N   1 
ATOM   1240 C  CA  . ALA B 1 66  ? -26.861 22.872 30.538 1.00 40.12  ? 66  ALA B CA  1 
ATOM   1241 C  C   . ALA B 1 66  ? -28.336 23.136 30.870 1.00 41.01  ? 66  ALA B C   1 
ATOM   1242 O  O   . ALA B 1 66  ? -29.053 23.776 30.095 1.00 40.42  ? 66  ALA B O   1 
ATOM   1243 C  CB  . ALA B 1 66  ? -26.676 21.420 30.079 1.00 40.02  ? 66  ALA B CB  1 
ATOM   1244 N  N   . GLU B 1 67  ? -28.800 22.654 32.018 1.00 42.16  ? 67  GLU B N   1 
ATOM   1245 C  CA  . GLU B 1 67  ? -30.198 22.868 32.358 1.00 44.01  ? 67  GLU B CA  1 
ATOM   1246 C  C   . GLU B 1 67  ? -30.509 24.350 32.470 1.00 44.29  ? 67  GLU B C   1 
ATOM   1247 O  O   . GLU B 1 67  ? -31.534 24.821 31.979 1.00 44.82  ? 67  GLU B O   1 
ATOM   1248 C  CB  . GLU B 1 67  ? -30.564 22.198 33.674 1.00 45.22  ? 67  GLU B CB  1 
ATOM   1249 C  CG  . GLU B 1 67  ? -32.065 22.012 33.807 1.00 46.64  ? 67  GLU B CG  1 
ATOM   1250 C  CD  . GLU B 1 67  ? -32.551 22.101 35.234 1.00 49.88  ? 67  GLU B CD  1 
ATOM   1251 O  OE1 . GLU B 1 67  ? -31.816 21.656 36.153 1.00 49.67  ? 67  GLU B OE1 1 
ATOM   1252 O  OE2 . GLU B 1 67  ? -33.682 22.604 35.426 1.00 52.75  ? 67  GLU B OE2 1 
ATOM   1253 N  N   . ILE B 1 68  ? -29.615 25.081 33.119 1.00 43.55  ? 68  ILE B N   1 
ATOM   1254 C  CA  . ILE B 1 68  ? -29.799 26.509 33.307 1.00 43.21  ? 68  ILE B CA  1 
ATOM   1255 C  C   . ILE B 1 68  ? -29.719 27.260 31.978 1.00 43.76  ? 68  ILE B C   1 
ATOM   1256 O  O   . ILE B 1 68  ? -30.341 28.318 31.807 1.00 43.32  ? 68  ILE B O   1 
ATOM   1257 C  CB  . ILE B 1 68  ? -28.731 27.051 34.289 1.00 42.46  ? 68  ILE B CB  1 
ATOM   1258 C  CG1 . ILE B 1 68  ? -28.885 26.348 35.642 1.00 42.38  ? 68  ILE B CG1 1 
ATOM   1259 C  CG2 . ILE B 1 68  ? -28.907 28.544 34.491 1.00 41.95  ? 68  ILE B CG2 1 
ATOM   1260 C  CD1 . ILE B 1 68  ? -27.752 26.574 36.595 1.00 41.69  ? 68  ILE B CD1 1 
ATOM   1261 N  N   . ALA B 1 69  ? -28.961 26.693 31.042 1.00 43.60  ? 69  ALA B N   1 
ATOM   1262 C  CA  . ALA B 1 69  ? -28.752 27.285 29.724 1.00 43.85  ? 69  ALA B CA  1 
ATOM   1263 C  C   . ALA B 1 69  ? -29.916 27.053 28.756 1.00 46.15  ? 69  ALA B C   1 
ATOM   1264 O  O   . ALA B 1 69  ? -30.025 27.743 27.734 1.00 47.11  ? 69  ALA B O   1 
ATOM   1265 C  CB  . ALA B 1 69  ? -27.460 26.746 29.122 1.00 42.22  ? 69  ALA B CB  1 
ATOM   1266 N  N   . GLY B 1 70  ? -30.779 26.084 29.066 1.00 46.07  ? 70  GLY B N   1 
ATOM   1267 C  CA  . GLY B 1 70  ? -31.911 25.817 28.192 1.00 45.49  ? 70  GLY B CA  1 
ATOM   1268 C  C   . GLY B 1 70  ? -31.933 24.448 27.524 1.00 44.82  ? 70  GLY B C   1 
ATOM   1269 O  O   . GLY B 1 70  ? -32.940 24.043 26.934 1.00 43.79  ? 70  GLY B O   1 
ATOM   1270 N  N   . LEU B 1 71  ? -30.825 23.726 27.602 1.00 44.11  ? 71  LEU B N   1 
ATOM   1271 C  CA  . LEU B 1 71  ? -30.773 22.410 26.997 1.00 44.79  ? 71  LEU B CA  1 
ATOM   1272 C  C   . LEU B 1 71  ? -31.915 21.563 27.565 1.00 46.87  ? 71  LEU B C   1 
ATOM   1273 O  O   . LEU B 1 71  ? -32.183 21.595 28.764 1.00 47.06  ? 71  LEU B O   1 
ATOM   1274 C  CB  . LEU B 1 71  ? -29.444 21.743 27.316 1.00 43.79  ? 71  LEU B CB  1 
ATOM   1275 C  CG  . LEU B 1 71  ? -28.593 21.191 26.176 1.00 44.25  ? 71  LEU B CG  1 
ATOM   1276 C  CD1 . LEU B 1 71  ? -28.042 19.821 26.602 1.00 43.13  ? 71  LEU B CD1 1 
ATOM   1277 C  CD2 . LEU B 1 71  ? -29.405 21.077 24.899 1.00 45.06  ? 71  LEU B CD2 1 
ATOM   1278 N  N   . GLN B 1 72  ? -32.585 20.812 26.695 1.00 48.69  ? 72  GLN B N   1 
ATOM   1279 C  CA  . GLN B 1 72  ? -33.687 19.943 27.088 1.00 48.32  ? 72  GLN B CA  1 
ATOM   1280 C  C   . GLN B 1 72  ? -33.438 18.539 26.581 1.00 49.24  ? 72  GLN B C   1 
ATOM   1281 O  O   . GLN B 1 72  ? -32.866 18.368 25.500 1.00 51.90  ? 72  GLN B O   1 
ATOM   1282 C  CB  . GLN B 1 72  ? -35.001 20.456 26.516 1.00 48.71  ? 72  GLN B CB  1 
ATOM   1283 C  CG  . GLN B 1 72  ? -35.536 21.686 27.209 1.00 52.73  ? 72  GLN B CG  1 
ATOM   1284 C  CD  . GLN B 1 72  ? -36.882 22.109 26.660 1.00 57.30  ? 72  GLN B CD  1 
ATOM   1285 O  OE1 . GLN B 1 72  ? -37.818 21.310 26.616 1.00 61.21  ? 72  GLN B OE1 1 
ATOM   1286 N  NE2 . GLN B 1 72  ? -36.990 23.367 26.234 1.00 58.51  ? 72  GLN B NE2 1 
ATOM   1287 N  N   . ILE B 1 73  ? -33.852 17.536 27.355 1.00 49.21  ? 73  ILE B N   1 
ATOM   1288 C  CA  . ILE B 1 73  ? -33.682 16.142 26.956 1.00 49.66  ? 73  ILE B CA  1 
ATOM   1289 C  C   . ILE B 1 73  ? -34.385 15.926 25.625 1.00 50.38  ? 73  ILE B C   1 
ATOM   1290 O  O   . ILE B 1 73  ? -35.455 16.491 25.389 1.00 51.16  ? 73  ILE B O   1 
ATOM   1291 C  CB  . ILE B 1 73  ? -34.293 15.180 27.980 1.00 50.59  ? 73  ILE B CB  1 
ATOM   1292 C  CG1 . ILE B 1 73  ? -33.715 15.462 29.369 1.00 51.36  ? 73  ILE B CG1 1 
ATOM   1293 C  CG2 . ILE B 1 73  ? -34.008 13.735 27.568 1.00 50.03  ? 73  ILE B CG2 1 
ATOM   1294 C  CD1 . ILE B 1 73  ? -34.287 14.573 30.461 1.00 51.73  ? 73  ILE B CD1 1 
ATOM   1295 N  N   . GLY B 1 74  ? -33.780 15.124 24.750 1.00 50.72  ? 74  GLY B N   1 
ATOM   1296 C  CA  . GLY B 1 74  ? -34.383 14.880 23.449 1.00 52.17  ? 74  GLY B CA  1 
ATOM   1297 C  C   . GLY B 1 74  ? -33.944 15.862 22.368 1.00 53.38  ? 74  GLY B C   1 
ATOM   1298 O  O   . GLY B 1 74  ? -34.262 15.679 21.189 1.00 52.29  ? 74  GLY B O   1 
ATOM   1299 N  N   . ASP B 1 75  ? -33.221 16.909 22.765 1.00 54.28  ? 75  ASP B N   1 
ATOM   1300 C  CA  . ASP B 1 75  ? -32.724 17.904 21.815 1.00 54.56  ? 75  ASP B CA  1 
ATOM   1301 C  C   . ASP B 1 75  ? -31.676 17.280 20.889 1.00 54.10  ? 75  ASP B C   1 
ATOM   1302 O  O   . ASP B 1 75  ? -30.843 16.469 21.325 1.00 53.46  ? 75  ASP B O   1 
ATOM   1303 C  CB  . ASP B 1 75  ? -32.076 19.090 22.550 1.00 55.51  ? 75  ASP B CB  1 
ATOM   1304 C  CG  . ASP B 1 75  ? -33.088 20.020 23.201 1.00 56.61  ? 75  ASP B CG  1 
ATOM   1305 O  OD1 . ASP B 1 75  ? -34.311 19.862 22.989 1.00 57.90  ? 75  ASP B OD1 1 
ATOM   1306 O  OD2 . ASP B 1 75  ? -32.642 20.932 23.927 1.00 56.61  ? 75  ASP B OD2 1 
ATOM   1307 N  N   . LYS B 1 76  ? -31.712 17.658 19.616 1.00 53.36  ? 76  LYS B N   1 
ATOM   1308 C  CA  . LYS B 1 76  ? -30.734 17.145 18.667 1.00 54.43  ? 76  LYS B CA  1 
ATOM   1309 C  C   . LYS B 1 76  ? -29.670 18.218 18.413 1.00 54.14  ? 76  LYS B C   1 
ATOM   1310 O  O   . LYS B 1 76  ? -29.986 19.332 17.973 1.00 54.28  ? 76  LYS B O   1 
ATOM   1311 C  CB  . LYS B 1 76  ? -31.411 16.766 17.349 1.00 56.84  ? 76  LYS B CB  1 
ATOM   1312 C  CG  . LYS B 1 76  ? -30.457 16.148 16.337 1.00 58.30  ? 76  LYS B CG  1 
ATOM   1313 C  CD  . LYS B 1 76  ? -31.138 15.855 15.015 1.00 60.99  ? 76  LYS B CD  1 
ATOM   1314 C  CE  . LYS B 1 76  ? -30.153 15.196 14.036 1.00 63.46  ? 76  LYS B CE  1 
ATOM   1315 N  NZ  . LYS B 1 76  ? -30.773 14.904 12.703 1.00 63.10  ? 76  LYS B NZ  1 
ATOM   1316 N  N   . ILE B 1 77  ? -28.417 17.882 18.698 1.00 52.72  ? 77  ILE B N   1 
ATOM   1317 C  CA  . ILE B 1 77  ? -27.310 18.810 18.507 1.00 53.79  ? 77  ILE B CA  1 
ATOM   1318 C  C   . ILE B 1 77  ? -26.858 18.895 17.051 1.00 55.62  ? 77  ILE B C   1 
ATOM   1319 O  O   . ILE B 1 77  ? -26.181 17.989 16.552 1.00 55.80  ? 77  ILE B O   1 
ATOM   1320 C  CB  . ILE B 1 77  ? -26.105 18.396 19.354 1.00 53.55  ? 77  ILE B CB  1 
ATOM   1321 C  CG1 . ILE B 1 77  ? -26.525 18.311 20.823 1.00 53.92  ? 77  ILE B CG1 1 
ATOM   1322 C  CG2 . ILE B 1 77  ? -24.966 19.403 19.172 1.00 52.79  ? 77  ILE B CG2 1 
ATOM   1323 C  CD1 . ILE B 1 77  ? -25.425 17.829 21.759 1.00 53.79  ? 77  ILE B CD1 1 
ATOM   1324 N  N   . MET B 1 78  ? -27.224 19.986 16.378 1.00 57.37  ? 78  MET B N   1 
ATOM   1325 C  CA  . MET B 1 78  ? -26.854 20.190 14.976 1.00 58.61  ? 78  MET B CA  1 
ATOM   1326 C  C   . MET B 1 78  ? -25.377 20.547 14.861 1.00 58.34  ? 78  MET B C   1 
ATOM   1327 O  O   . MET B 1 78  ? -24.642 19.920 14.101 1.00 58.99  ? 78  MET B O   1 
ATOM   1328 C  CB  . MET B 1 78  ? -27.684 21.307 14.336 1.00 60.97  ? 78  MET B CB  1 
ATOM   1329 C  CG  . MET B 1 78  ? -29.191 21.174 14.514 1.00 66.04  ? 78  MET B CG  1 
ATOM   1330 S  SD  . MET B 1 78  ? -29.807 19.506 14.227 1.00 74.25  ? 78  MET B SD  1 
ATOM   1331 C  CE  . MET B 1 78  ? -29.748 19.401 12.416 1.00 72.42  ? 78  MET B CE  1 
ATOM   1332 N  N   . GLN B 1 79  ? -24.941 21.554 15.612 1.00 57.48  ? 79  GLN B N   1 
ATOM   1333 C  CA  . GLN B 1 79  ? -23.541 21.953 15.568 1.00 57.88  ? 79  GLN B CA  1 
ATOM   1334 C  C   . GLN B 1 79  ? -23.045 22.547 16.880 1.00 56.63  ? 79  GLN B C   1 
ATOM   1335 O  O   . GLN B 1 79  ? -23.821 23.076 17.673 1.00 57.97  ? 79  GLN B O   1 
ATOM   1336 C  CB  . GLN B 1 79  ? -23.303 22.951 14.432 1.00 59.69  ? 79  GLN B CB  1 
ATOM   1337 C  CG  . GLN B 1 79  ? -23.969 24.293 14.631 1.00 63.21  ? 79  GLN B CG  1 
ATOM   1338 C  CD  . GLN B 1 79  ? -23.595 25.293 13.553 1.00 65.41  ? 79  GLN B CD  1 
ATOM   1339 O  OE1 . GLN B 1 79  ? -23.895 25.095 12.373 1.00 65.24  ? 79  GLN B OE1 1 
ATOM   1340 N  NE2 . GLN B 1 79  ? -22.929 26.375 13.955 1.00 66.48  ? 79  GLN B NE2 1 
ATOM   1341 N  N   . VAL B 1 80  ? -21.739 22.458 17.091 1.00 54.48  ? 80  VAL B N   1 
ATOM   1342 C  CA  . VAL B 1 80  ? -21.116 22.970 18.293 1.00 53.91  ? 80  VAL B CA  1 
ATOM   1343 C  C   . VAL B 1 80  ? -19.956 23.894 17.930 1.00 54.60  ? 80  VAL B C   1 
ATOM   1344 O  O   . VAL B 1 80  ? -19.003 23.461 17.287 1.00 54.56  ? 80  VAL B O   1 
ATOM   1345 C  CB  . VAL B 1 80  ? -20.577 21.813 19.151 1.00 53.28  ? 80  VAL B CB  1 
ATOM   1346 C  CG1 . VAL B 1 80  ? -19.886 22.347 20.398 1.00 52.21  ? 80  VAL B CG1 1 
ATOM   1347 C  CG2 . VAL B 1 80  ? -21.714 20.893 19.524 1.00 54.89  ? 80  VAL B CG2 1 
ATOM   1348 N  N   . ASN B 1 81  ? -20.043 25.160 18.341 1.00 54.46  ? 81  ASN B N   1 
ATOM   1349 C  CA  . ASN B 1 81  ? -18.995 26.132 18.072 1.00 53.62  ? 81  ASN B CA  1 
ATOM   1350 C  C   . ASN B 1 81  ? -18.517 26.102 16.630 1.00 54.96  ? 81  ASN B C   1 
ATOM   1351 O  O   . ASN B 1 81  ? -17.319 26.036 16.366 1.00 53.38  ? 81  ASN B O   1 
ATOM   1352 C  CB  . ASN B 1 81  ? -17.809 25.885 18.998 1.00 53.65  ? 81  ASN B CB  1 
ATOM   1353 C  CG  . ASN B 1 81  ? -18.106 26.266 20.433 1.00 54.58  ? 81  ASN B CG  1 
ATOM   1354 O  OD1 . ASN B 1 81  ? -19.108 26.927 20.715 1.00 55.61  ? 81  ASN B OD1 1 
ATOM   1355 N  ND2 . ASN B 1 81  ? -17.230 25.866 21.349 1.00 53.33  ? 81  ASN B ND2 1 
ATOM   1356 N  N   . GLY B 1 82  ? -19.464 26.147 15.699 1.00 57.31  ? 82  GLY B N   1 
ATOM   1357 C  CA  . GLY B 1 82  ? -19.118 26.120 14.296 1.00 58.52  ? 82  GLY B CA  1 
ATOM   1358 C  C   . GLY B 1 82  ? -19.034 24.729 13.699 1.00 59.85  ? 82  GLY B C   1 
ATOM   1359 O  O   . GLY B 1 82  ? -19.454 24.533 12.564 1.00 61.37  ? 82  GLY B O   1 
ATOM   1360 N  N   . TRP B 1 83  ? -18.501 23.765 14.445 1.00 60.79  ? 83  TRP B N   1 
ATOM   1361 C  CA  . TRP B 1 83  ? -18.370 22.397 13.940 1.00 62.41  ? 83  TRP B CA  1 
ATOM   1362 C  C   . TRP B 1 83  ? -19.696 21.683 13.752 1.00 63.19  ? 83  TRP B C   1 
ATOM   1363 O  O   . TRP B 1 83  ? -20.607 21.813 14.565 1.00 64.20  ? 83  TRP B O   1 
ATOM   1364 C  CB  . TRP B 1 83  ? -17.502 21.560 14.872 1.00 62.96  ? 83  TRP B CB  1 
ATOM   1365 C  CG  . TRP B 1 83  ? -16.128 22.080 15.021 1.00 66.22  ? 83  TRP B CG  1 
ATOM   1366 C  CD1 . TRP B 1 83  ? -15.743 23.180 15.726 1.00 68.44  ? 83  TRP B CD1 1 
ATOM   1367 C  CD2 . TRP B 1 83  ? -14.937 21.534 14.445 1.00 67.19  ? 83  TRP B CD2 1 
ATOM   1368 N  NE1 . TRP B 1 83  ? -14.381 23.355 15.630 1.00 69.72  ? 83  TRP B NE1 1 
ATOM   1369 C  CE2 . TRP B 1 83  ? -13.861 22.356 14.850 1.00 68.82  ? 83  TRP B CE2 1 
ATOM   1370 C  CE3 . TRP B 1 83  ? -14.673 20.428 13.629 1.00 68.17  ? 83  TRP B CE3 1 
ATOM   1371 C  CZ2 . TRP B 1 83  ? -12.536 22.107 14.462 1.00 69.63  ? 83  TRP B CZ2 1 
ATOM   1372 C  CZ3 . TRP B 1 83  ? -13.355 20.179 13.242 1.00 68.98  ? 83  TRP B CZ3 1 
ATOM   1373 C  CH2 . TRP B 1 83  ? -12.305 21.016 13.662 1.00 69.65  ? 83  TRP B CH2 1 
ATOM   1374 N  N   . ASP B 1 84  ? -19.798 20.916 12.678 1.00 64.02  ? 84  ASP B N   1 
ATOM   1375 C  CA  . ASP B 1 84  ? -21.019 20.175 12.416 1.00 66.99  ? 84  ASP B CA  1 
ATOM   1376 C  C   . ASP B 1 84  ? -21.131 18.938 13.308 1.00 67.83  ? 84  ASP B C   1 
ATOM   1377 O  O   . ASP B 1 84  ? -20.139 18.267 13.584 1.00 67.72  ? 84  ASP B O   1 
ATOM   1378 C  CB  . ASP B 1 84  ? -21.083 19.761 10.952 1.00 69.13  ? 84  ASP B CB  1 
ATOM   1379 C  CG  . ASP B 1 84  ? -22.079 18.650 10.714 1.00 71.72  ? 84  ASP B CG  1 
ATOM   1380 O  OD1 . ASP B 1 84  ? -21.690 17.462 10.873 1.00 73.30  ? 84  ASP B OD1 1 
ATOM   1381 O  OD2 . ASP B 1 84  ? -23.246 18.971 10.386 1.00 72.06  ? 84  ASP B OD2 1 
ATOM   1382 N  N   . MET B 1 85  ? -22.350 18.638 13.749 1.00 69.12  ? 85  MET B N   1 
ATOM   1383 C  CA  . MET B 1 85  ? -22.600 17.491 14.622 1.00 69.13  ? 85  MET B CA  1 
ATOM   1384 C  C   . MET B 1 85  ? -23.604 16.497 14.033 1.00 69.21  ? 85  MET B C   1 
ATOM   1385 O  O   . MET B 1 85  ? -24.013 15.551 14.701 1.00 69.40  ? 85  MET B O   1 
ATOM   1386 C  CB  . MET B 1 85  ? -23.118 17.977 15.978 1.00 68.06  ? 85  MET B CB  1 
ATOM   1387 C  CG  . MET B 1 85  ? -22.134 18.817 16.743 1.00 68.17  ? 85  MET B CG  1 
ATOM   1388 S  SD  . MET B 1 85  ? -20.748 17.832 17.328 1.00 71.76  ? 85  MET B SD  1 
ATOM   1389 C  CE  . MET B 1 85  ? -21.265 17.498 19.022 1.00 69.75  ? 85  MET B CE  1 
ATOM   1390 N  N   . THR B 1 86  ? -24.001 16.707 12.785 1.00 69.36  ? 86  THR B N   1 
ATOM   1391 C  CA  . THR B 1 86  ? -24.964 15.817 12.160 1.00 70.51  ? 86  THR B CA  1 
ATOM   1392 C  C   . THR B 1 86  ? -24.354 14.541 11.567 1.00 72.39  ? 86  THR B C   1 
ATOM   1393 O  O   . THR B 1 86  ? -24.992 13.482 11.580 1.00 72.92  ? 86  THR B O   1 
ATOM   1394 C  CB  . THR B 1 86  ? -25.736 16.546 11.052 1.00 70.20  ? 86  THR B CB  1 
ATOM   1395 O  OG1 . THR B 1 86  ? -24.842 16.863 9.978  1.00 69.56  ? 86  THR B OG1 1 
ATOM   1396 C  CG2 . THR B 1 86  ? -26.353 17.828 11.592 1.00 68.77  ? 86  THR B CG2 1 
ATOM   1397 N  N   . MET B 1 87  ? -23.123 14.632 11.063 1.00 73.38  ? 87  MET B N   1 
ATOM   1398 C  CA  . MET B 1 87  ? -22.460 13.480 10.441 1.00 73.99  ? 87  MET B CA  1 
ATOM   1399 C  C   . MET B 1 87  ? -21.234 12.980 11.198 1.00 72.44  ? 87  MET B C   1 
ATOM   1400 O  O   . MET B 1 87  ? -20.282 12.501 10.584 1.00 72.63  ? 87  MET B O   1 
ATOM   1401 C  CB  . MET B 1 87  ? -22.029 13.833 9.008  1.00 77.09  ? 87  MET B CB  1 
ATOM   1402 C  CG  . MET B 1 87  ? -23.152 14.284 8.083  1.00 82.01  ? 87  MET B CG  1 
ATOM   1403 S  SD  . MET B 1 87  ? -24.378 12.984 7.763  1.00 88.85  ? 87  MET B SD  1 
ATOM   1404 C  CE  . MET B 1 87  ? -23.640 12.148 6.344  1.00 86.58  ? 87  MET B CE  1 
ATOM   1405 N  N   . VAL B 1 88  ? -21.247 13.079 12.519 1.00 70.54  ? 88  VAL B N   1 
ATOM   1406 C  CA  . VAL B 1 88  ? -20.096 12.635 13.297 1.00 68.68  ? 88  VAL B CA  1 
ATOM   1407 C  C   . VAL B 1 88  ? -20.353 11.371 14.103 1.00 67.65  ? 88  VAL B C   1 
ATOM   1408 O  O   . VAL B 1 88  ? -21.494 10.950 14.284 1.00 67.05  ? 88  VAL B O   1 
ATOM   1409 C  CB  . VAL B 1 88  ? -19.616 13.740 14.269 1.00 68.45  ? 88  VAL B CB  1 
ATOM   1410 C  CG1 . VAL B 1 88  ? -19.178 14.960 13.482 1.00 68.33  ? 88  VAL B CG1 1 
ATOM   1411 C  CG2 . VAL B 1 88  ? -20.736 14.106 15.243 1.00 67.19  ? 88  VAL B CG2 1 
ATOM   1412 N  N   . THR B 1 89  ? -19.273 10.771 14.587 1.00 66.58  ? 89  THR B N   1 
ATOM   1413 C  CA  . THR B 1 89  ? -19.369 9.567  15.391 1.00 66.95  ? 89  THR B CA  1 
ATOM   1414 C  C   . THR B 1 89  ? -19.544 9.995  16.837 1.00 67.98  ? 89  THR B C   1 
ATOM   1415 O  O   . THR B 1 89  ? -19.366 11.172 17.169 1.00 68.89  ? 89  THR B O   1 
ATOM   1416 C  CB  . THR B 1 89  ? -18.093 8.719  15.294 1.00 66.67  ? 89  THR B CB  1 
ATOM   1417 O  OG1 . THR B 1 89  ? -17.019 9.388  15.973 1.00 66.67  ? 89  THR B OG1 1 
ATOM   1418 C  CG2 . THR B 1 89  ? -17.716 8.505  13.838 1.00 65.14  ? 89  THR B CG2 1 
ATOM   1419 N  N   . HIS B 1 90  ? -19.872 9.040  17.698 1.00 68.13  ? 90  HIS B N   1 
ATOM   1420 C  CA  . HIS B 1 90  ? -20.079 9.343  19.104 1.00 68.61  ? 90  HIS B CA  1 
ATOM   1421 C  C   . HIS B 1 90  ? -18.858 10.025 19.706 1.00 69.59  ? 90  HIS B C   1 
ATOM   1422 O  O   . HIS B 1 90  ? -18.973 11.098 20.299 1.00 70.91  ? 90  HIS B O   1 
ATOM   1423 C  CB  . HIS B 1 90  ? -20.392 8.069  19.889 1.00 67.06  ? 90  HIS B CB  1 
ATOM   1424 C  CG  . HIS B 1 90  ? -20.963 8.324  21.249 1.00 64.98  ? 90  HIS B CG  1 
ATOM   1425 N  ND1 . HIS B 1 90  ? -22.280 8.682  21.449 1.00 64.56  ? 90  HIS B ND1 1 
ATOM   1426 C  CD2 . HIS B 1 90  ? -20.394 8.277  22.478 1.00 63.82  ? 90  HIS B CD2 1 
ATOM   1427 C  CE1 . HIS B 1 90  ? -22.497 8.841  22.743 1.00 64.58  ? 90  HIS B CE1 1 
ATOM   1428 N  NE2 . HIS B 1 90  ? -21.369 8.600  23.389 1.00 63.76  ? 90  HIS B NE2 1 
ATOM   1429 N  N   . ASP B 1 91  ? -17.690 9.410  19.553 1.00 70.58  ? 91  ASP B N   1 
ATOM   1430 C  CA  . ASP B 1 91  ? -16.463 9.978  20.101 1.00 71.69  ? 91  ASP B CA  1 
ATOM   1431 C  C   . ASP B 1 91  ? -16.149 11.372 19.585 1.00 70.73  ? 91  ASP B C   1 
ATOM   1432 O  O   . ASP B 1 91  ? -15.602 12.203 20.314 1.00 70.83  ? 91  ASP B O   1 
ATOM   1433 C  CB  . ASP B 1 91  ? -15.272 9.069  19.809 1.00 74.84  ? 91  ASP B CB  1 
ATOM   1434 C  CG  . ASP B 1 91  ? -15.061 8.030  20.885 1.00 78.40  ? 91  ASP B CG  1 
ATOM   1435 O  OD1 . ASP B 1 91  ? -14.030 7.324  20.828 1.00 81.08  ? 91  ASP B OD1 1 
ATOM   1436 O  OD2 . ASP B 1 91  ? -15.925 7.926  21.786 1.00 79.08  ? 91  ASP B OD2 1 
ATOM   1437 N  N   . GLN B 1 92  ? -16.479 11.627 18.326 1.00 69.05  ? 92  GLN B N   1 
ATOM   1438 C  CA  . GLN B 1 92  ? -16.211 12.932 17.746 1.00 68.37  ? 92  GLN B CA  1 
ATOM   1439 C  C   . GLN B 1 92  ? -17.003 13.997 18.476 1.00 67.00  ? 92  GLN B C   1 
ATOM   1440 O  O   . GLN B 1 92  ? -16.451 15.008 18.912 1.00 66.80  ? 92  GLN B O   1 
ATOM   1441 C  CB  . GLN B 1 92  ? -16.579 12.944 16.267 1.00 70.09  ? 92  GLN B CB  1 
ATOM   1442 C  CG  . GLN B 1 92  ? -15.677 12.073 15.409 1.00 71.66  ? 92  GLN B CG  1 
ATOM   1443 C  CD  . GLN B 1 92  ? -15.973 12.226 13.937 1.00 72.72  ? 92  GLN B CD  1 
ATOM   1444 O  OE1 . GLN B 1 92  ? -17.090 11.953 13.484 1.00 73.65  ? 92  GLN B OE1 1 
ATOM   1445 N  NE2 . GLN B 1 92  ? -14.976 12.676 13.177 1.00 72.51  ? 92  GLN B NE2 1 
ATOM   1446 N  N   . ALA B 1 93  ? -18.303 13.761 18.607 1.00 65.91  ? 93  ALA B N   1 
ATOM   1447 C  CA  . ALA B 1 93  ? -19.179 14.696 19.293 1.00 64.39  ? 93  ALA B CA  1 
ATOM   1448 C  C   . ALA B 1 93  ? -18.703 14.878 20.728 1.00 63.93  ? 93  ALA B C   1 
ATOM   1449 O  O   . ALA B 1 93  ? -18.782 15.972 21.286 1.00 64.79  ? 93  ALA B O   1 
ATOM   1450 C  CB  . ALA B 1 93  ? -20.603 14.175 19.273 1.00 63.70  ? 93  ALA B CB  1 
ATOM   1451 N  N   . ARG B 1 94  ? -18.192 13.802 21.314 1.00 63.60  ? 94  ARG B N   1 
ATOM   1452 C  CA  . ARG B 1 94  ? -17.711 13.829 22.689 1.00 65.44  ? 94  ARG B CA  1 
ATOM   1453 C  C   . ARG B 1 94  ? -16.493 14.742 22.810 1.00 65.39  ? 94  ARG B C   1 
ATOM   1454 O  O   . ARG B 1 94  ? -16.341 15.487 23.782 1.00 64.69  ? 94  ARG B O   1 
ATOM   1455 C  CB  . ARG B 1 94  ? -17.363 12.401 23.134 1.00 67.21  ? 94  ARG B CB  1 
ATOM   1456 C  CG  . ARG B 1 94  ? -17.360 12.177 24.648 1.00 71.07  ? 94  ARG B CG  1 
ATOM   1457 C  CD  . ARG B 1 94  ? -15.984 12.372 25.289 1.00 74.85  ? 94  ARG B CD  1 
ATOM   1458 N  NE  . ARG B 1 94  ? -15.127 11.188 25.176 1.00 78.12  ? 94  ARG B NE  1 
ATOM   1459 C  CZ  . ARG B 1 94  ? -14.439 10.840 24.087 1.00 81.14  ? 94  ARG B CZ  1 
ATOM   1460 N  NH1 . ARG B 1 94  ? -14.492 11.586 22.988 1.00 82.39  ? 94  ARG B NH1 1 
ATOM   1461 N  NH2 . ARG B 1 94  ? -13.689 9.739  24.093 1.00 81.40  ? 94  ARG B NH2 1 
ATOM   1462 N  N   . LYS B 1 95  ? -15.632 14.688 21.805 1.00 66.65  ? 95  LYS B N   1 
ATOM   1463 C  CA  . LYS B 1 95  ? -14.425 15.499 21.799 1.00 67.23  ? 95  LYS B CA  1 
ATOM   1464 C  C   . LYS B 1 95  ? -14.705 16.966 21.487 1.00 66.35  ? 95  LYS B C   1 
ATOM   1465 O  O   . LYS B 1 95  ? -14.034 17.855 22.016 1.00 66.21  ? 95  LYS B O   1 
ATOM   1466 C  CB  . LYS B 1 95  ? -13.422 14.929 20.795 1.00 69.35  ? 95  LYS B CB  1 
ATOM   1467 C  CG  . LYS B 1 95  ? -12.752 13.647 21.280 1.00 73.69  ? 95  LYS B CG  1 
ATOM   1468 C  CD  . LYS B 1 95  ? -11.843 13.042 20.217 1.00 77.13  ? 95  LYS B CD  1 
ATOM   1469 C  CE  . LYS B 1 95  ? -10.963 11.936 20.805 1.00 79.39  ? 95  LYS B CE  1 
ATOM   1470 N  NZ  . LYS B 1 95  ? -11.755 10.850 21.468 1.00 81.56  ? 95  LYS B NZ  1 
ATOM   1471 N  N   . ARG B 1 96  ? -15.700 17.223 20.643 1.00 64.36  ? 96  ARG B N   1 
ATOM   1472 C  CA  . ARG B 1 96  ? -16.043 18.592 20.280 1.00 63.68  ? 96  ARG B CA  1 
ATOM   1473 C  C   . ARG B 1 96  ? -16.812 19.337 21.371 1.00 63.05  ? 96  ARG B C   1 
ATOM   1474 O  O   . ARG B 1 96  ? -17.046 20.540 21.260 1.00 62.93  ? 96  ARG B O   1 
ATOM   1475 C  CB  . ARG B 1 96  ? -16.845 18.600 18.981 1.00 65.81  ? 96  ARG B CB  1 
ATOM   1476 C  CG  . ARG B 1 96  ? -16.124 17.879 17.859 1.00 70.70  ? 96  ARG B CG  1 
ATOM   1477 C  CD  . ARG B 1 96  ? -16.805 18.025 16.498 1.00 73.77  ? 96  ARG B CD  1 
ATOM   1478 N  NE  . ARG B 1 96  ? -16.092 17.241 15.485 1.00 75.45  ? 96  ARG B NE  1 
ATOM   1479 C  CZ  . ARG B 1 96  ? -16.350 17.275 14.180 1.00 75.96  ? 96  ARG B CZ  1 
ATOM   1480 N  NH1 . ARG B 1 96  ? -17.310 18.061 13.703 1.00 76.08  ? 96  ARG B NH1 1 
ATOM   1481 N  NH2 . ARG B 1 96  ? -15.647 16.514 13.350 1.00 76.51  ? 96  ARG B NH2 1 
ATOM   1482 N  N   . LEU B 1 97  ? -17.208 18.627 22.424 1.00 61.42  ? 97  LEU B N   1 
ATOM   1483 C  CA  . LEU B 1 97  ? -17.941 19.247 23.523 1.00 57.77  ? 97  LEU B CA  1 
ATOM   1484 C  C   . LEU B 1 97  ? -17.028 19.320 24.729 1.00 58.23  ? 97  LEU B C   1 
ATOM   1485 O  O   . LEU B 1 97  ? -17.328 19.994 25.712 1.00 58.70  ? 97  LEU B O   1 
ATOM   1486 C  CB  . LEU B 1 97  ? -19.178 18.424 23.871 1.00 53.98  ? 97  LEU B CB  1 
ATOM   1487 C  CG  . LEU B 1 97  ? -20.264 18.348 22.807 1.00 53.43  ? 97  LEU B CG  1 
ATOM   1488 C  CD1 . LEU B 1 97  ? -21.205 17.206 23.117 1.00 53.78  ? 97  LEU B CD1 1 
ATOM   1489 C  CD2 . LEU B 1 97  ? -21.020 19.658 22.758 1.00 53.39  ? 97  LEU B CD2 1 
ATOM   1490 N  N   . THR B 1 98  ? -15.903 18.628 24.656 1.00 58.54  ? 98  THR B N   1 
ATOM   1491 C  CA  . THR B 1 98  ? -14.987 18.629 25.780 1.00 61.11  ? 98  THR B CA  1 
ATOM   1492 C  C   . THR B 1 98  ? -13.629 19.274 25.513 1.00 62.27  ? 98  THR B C   1 
ATOM   1493 O  O   . THR B 1 98  ? -12.659 18.964 26.200 1.00 62.21  ? 98  THR B O   1 
ATOM   1494 C  CB  . THR B 1 98  ? -14.777 17.198 26.300 1.00 61.70  ? 98  THR B CB  1 
ATOM   1495 O  OG1 . THR B 1 98  ? -14.342 16.349 25.228 1.00 64.15  ? 98  THR B OG1 1 
ATOM   1496 C  CG2 . THR B 1 98  ? -16.076 16.659 26.863 1.00 60.65  ? 98  THR B CG2 1 
ATOM   1497 N  N   . LYS B 1 99  ? -13.561 20.162 24.520 1.00 64.19  ? 99  LYS B N   1 
ATOM   1498 C  CA  . LYS B 1 99  ? -12.315 20.862 24.211 1.00 66.06  ? 99  LYS B CA  1 
ATOM   1499 C  C   . LYS B 1 99  ? -12.011 21.814 25.360 1.00 67.15  ? 99  LYS B C   1 
ATOM   1500 O  O   . LYS B 1 99  ? -12.688 22.826 25.547 1.00 66.85  ? 99  LYS B O   1 
ATOM   1501 C  CB  . LYS B 1 99  ? -12.432 21.652 22.903 1.00 67.47  ? 99  LYS B CB  1 
ATOM   1502 C  CG  . LYS B 1 99  ? -12.208 20.815 21.649 1.00 70.68  ? 99  LYS B CG  1 
ATOM   1503 C  CD  . LYS B 1 99  ? -12.498 21.600 20.365 1.00 72.91  ? 99  LYS B CD  1 
ATOM   1504 C  CE  . LYS B 1 99  ? -12.306 20.724 19.117 1.00 73.66  ? 99  LYS B CE  1 
ATOM   1505 N  NZ  . LYS B 1 99  ? -12.762 21.384 17.858 1.00 73.97  ? 99  LYS B NZ  1 
ATOM   1506 N  N   . ARG B 1 100 ? -10.978 21.478 26.121 1.00 68.46  ? 100 ARG B N   1 
ATOM   1507 C  CA  . ARG B 1 100 ? -10.571 22.257 27.278 1.00 71.03  ? 100 ARG B CA  1 
ATOM   1508 C  C   . ARG B 1 100 ? -10.259 23.731 27.024 1.00 70.95  ? 100 ARG B C   1 
ATOM   1509 O  O   . ARG B 1 100 ? -10.304 24.540 27.948 1.00 71.44  ? 100 ARG B O   1 
ATOM   1510 C  CB  . ARG B 1 100 ? -9.362  21.592 27.929 1.00 73.94  ? 100 ARG B CB  1 
ATOM   1511 C  CG  . ARG B 1 100 ? -9.009  22.161 29.284 1.00 79.50  ? 100 ARG B CG  1 
ATOM   1512 C  CD  . ARG B 1 100 ? -7.916  21.335 29.930 1.00 84.32  ? 100 ARG B CD  1 
ATOM   1513 N  NE  . ARG B 1 100 ? -8.185  19.905 29.788 1.00 88.15  ? 100 ARG B NE  1 
ATOM   1514 C  CZ  . ARG B 1 100 ? -7.428  18.947 30.313 1.00 90.57  ? 100 ARG B CZ  1 
ATOM   1515 N  NH1 . ARG B 1 100 ? -6.352  19.266 31.022 1.00 91.71  ? 100 ARG B NH1 1 
ATOM   1516 N  NH2 . ARG B 1 100 ? -7.739  17.670 30.122 1.00 90.87  ? 100 ARG B NH2 1 
ATOM   1517 N  N   . SER B 1 101 ? -9.947  24.085 25.783 1.00 70.51  ? 101 SER B N   1 
ATOM   1518 C  CA  . SER B 1 101 ? -9.610  25.469 25.466 1.00 69.94  ? 101 SER B CA  1 
ATOM   1519 C  C   . SER B 1 101 ? -10.836 26.353 25.287 1.00 69.31  ? 101 SER B C   1 
ATOM   1520 O  O   . SER B 1 101 ? -10.715 27.562 25.090 1.00 70.31  ? 101 SER B O   1 
ATOM   1521 C  CB  . SER B 1 101 ? -8.754  25.528 24.196 1.00 70.09  ? 101 SER B CB  1 
ATOM   1522 O  OG  . SER B 1 101 ? -9.451  24.992 23.085 1.00 70.33  ? 101 SER B OG  1 
ATOM   1523 N  N   . GLU B 1 102 ? -12.018 25.755 25.349 1.00 68.03  ? 102 GLU B N   1 
ATOM   1524 C  CA  . GLU B 1 102 ? -13.246 26.521 25.184 1.00 66.26  ? 102 GLU B CA  1 
ATOM   1525 C  C   . GLU B 1 102 ? -14.061 26.473 26.472 1.00 65.39  ? 102 GLU B C   1 
ATOM   1526 O  O   . GLU B 1 102 ? -14.528 25.416 26.894 1.00 64.14  ? 102 GLU B O   1 
ATOM   1527 C  CB  . GLU B 1 102 ? -14.053 25.958 24.023 1.00 66.37  ? 102 GLU B CB  1 
ATOM   1528 C  CG  . GLU B 1 102 ? -13.193 25.576 22.842 1.00 68.07  ? 102 GLU B CG  1 
ATOM   1529 C  CD  . GLU B 1 102 ? -14.008 25.186 21.624 1.00 70.64  ? 102 GLU B CD  1 
ATOM   1530 O  OE1 . GLU B 1 102 ? -14.945 24.367 21.768 1.00 70.34  ? 102 GLU B OE1 1 
ATOM   1531 O  OE2 . GLU B 1 102 ? -13.703 25.695 20.519 1.00 71.16  ? 102 GLU B OE2 1 
ATOM   1532 N  N   . GLU B 1 103 ? -14.207 27.629 27.105 1.00 64.71  ? 103 GLU B N   1 
ATOM   1533 C  CA  . GLU B 1 103 ? -14.955 27.733 28.350 1.00 62.92  ? 103 GLU B CA  1 
ATOM   1534 C  C   . GLU B 1 103 ? -16.453 27.735 28.066 1.00 59.10  ? 103 GLU B C   1 
ATOM   1535 O  O   . GLU B 1 103 ? -17.269 27.572 28.963 1.00 57.16  ? 103 GLU B O   1 
ATOM   1536 C  CB  . GLU B 1 103 ? -14.578 29.025 29.064 1.00 67.99  ? 103 GLU B CB  1 
ATOM   1537 C  CG  . GLU B 1 103 ? -15.258 29.221 30.408 1.00 74.54  ? 103 GLU B CG  1 
ATOM   1538 C  CD  . GLU B 1 103 ? -15.651 30.668 30.626 1.00 78.45  ? 103 GLU B CD  1 
ATOM   1539 O  OE1 . GLU B 1 103 ? -14.810 31.547 30.316 1.00 82.17  ? 103 GLU B OE1 1 
ATOM   1540 O  OE2 . GLU B 1 103 ? -16.783 30.925 31.103 1.00 79.33  ? 103 GLU B OE2 1 
ATOM   1541 N  N   . VAL B 1 104 ? -16.806 27.905 26.800 1.00 55.48  ? 104 VAL B N   1 
ATOM   1542 C  CA  . VAL B 1 104 ? -18.196 27.948 26.400 1.00 51.10  ? 104 VAL B CA  1 
ATOM   1543 C  C   . VAL B 1 104 ? -18.443 27.121 25.150 1.00 50.10  ? 104 VAL B C   1 
ATOM   1544 O  O   . VAL B 1 104 ? -17.562 26.964 24.315 1.00 50.90  ? 104 VAL B O   1 
ATOM   1545 C  CB  . VAL B 1 104 ? -18.625 29.412 26.142 1.00 49.78  ? 104 VAL B CB  1 
ATOM   1546 C  CG1 . VAL B 1 104 ? -19.891 29.470 25.333 1.00 50.46  ? 104 VAL B CG1 1 
ATOM   1547 C  CG2 . VAL B 1 104 ? -18.840 30.118 27.463 1.00 48.47  ? 104 VAL B CG2 1 
ATOM   1548 N  N   . VAL B 1 105 ? -19.643 26.567 25.045 1.00 47.93  ? 105 VAL B N   1 
ATOM   1549 C  CA  . VAL B 1 105 ? -20.015 25.795 23.879 1.00 48.25  ? 105 VAL B CA  1 
ATOM   1550 C  C   . VAL B 1 105 ? -21.273 26.449 23.364 1.00 47.83  ? 105 VAL B C   1 
ATOM   1551 O  O   . VAL B 1 105 ? -22.213 26.688 24.118 1.00 48.16  ? 105 VAL B O   1 
ATOM   1552 C  CB  . VAL B 1 105 ? -20.324 24.310 24.215 1.00 49.06  ? 105 VAL B CB  1 
ATOM   1553 C  CG1 . VAL B 1 105 ? -19.034 23.518 24.358 1.00 48.53  ? 105 VAL B CG1 1 
ATOM   1554 C  CG2 . VAL B 1 105 ? -21.123 24.234 25.499 1.00 51.84  ? 105 VAL B CG2 1 
ATOM   1555 N  N   . ARG B 1 106 ? -21.282 26.777 22.084 1.00 47.51  ? 106 ARG B N   1 
ATOM   1556 C  CA  . ARG B 1 106 ? -22.450 27.392 21.510 1.00 47.68  ? 106 ARG B CA  1 
ATOM   1557 C  C   . ARG B 1 106 ? -23.095 26.313 20.663 1.00 48.48  ? 106 ARG B C   1 
ATOM   1558 O  O   . ARG B 1 106 ? -22.596 25.918 19.605 1.00 48.36  ? 106 ARG B O   1 
ATOM   1559 C  CB  . ARG B 1 106 ? -22.060 28.643 20.704 1.00 46.66  ? 106 ARG B CB  1 
ATOM   1560 C  CG  . ARG B 1 106 ? -21.795 29.841 21.603 1.00 46.37  ? 106 ARG B CG  1 
ATOM   1561 C  CD  . ARG B 1 106 ? -21.454 31.102 20.833 1.00 47.43  ? 106 ARG B CD  1 
ATOM   1562 N  NE  . ARG B 1 106 ? -20.015 31.249 20.682 1.00 48.07  ? 106 ARG B NE  1 
ATOM   1563 C  CZ  . ARG B 1 106 ? -19.248 31.966 21.487 1.00 47.40  ? 106 ARG B CZ  1 
ATOM   1564 N  NH1 . ARG B 1 106 ? -19.769 32.626 22.503 1.00 48.76  ? 106 ARG B NH1 1 
ATOM   1565 N  NH2 . ARG B 1 106 ? -17.947 31.991 21.294 1.00 50.59  ? 106 ARG B NH2 1 
ATOM   1566 N  N   . LEU B 1 107 ? -24.207 25.813 21.176 1.00 48.92  ? 107 LEU B N   1 
ATOM   1567 C  CA  . LEU B 1 107 ? -24.950 24.746 20.534 1.00 48.83  ? 107 LEU B CA  1 
ATOM   1568 C  C   . LEU B 1 107 ? -26.067 25.209 19.648 1.00 49.00  ? 107 LEU B C   1 
ATOM   1569 O  O   . LEU B 1 107 ? -26.782 26.155 19.965 1.00 48.77  ? 107 LEU B O   1 
ATOM   1570 C  CB  . LEU B 1 107 ? -25.552 23.826 21.597 1.00 47.83  ? 107 LEU B CB  1 
ATOM   1571 C  CG  . LEU B 1 107 ? -24.711 22.689 22.171 1.00 47.73  ? 107 LEU B CG  1 
ATOM   1572 C  CD1 . LEU B 1 107 ? -23.245 23.038 22.188 1.00 48.45  ? 107 LEU B CD1 1 
ATOM   1573 C  CD2 . LEU B 1 107 ? -25.214 22.390 23.566 1.00 48.84  ? 107 LEU B CD2 1 
ATOM   1574 N  N   . LEU B 1 108 ? -26.220 24.519 18.531 1.00 50.16  ? 108 LEU B N   1 
ATOM   1575 C  CA  . LEU B 1 108 ? -27.311 24.811 17.627 1.00 51.83  ? 108 LEU B CA  1 
ATOM   1576 C  C   . LEU B 1 108 ? -28.122 23.512 17.704 1.00 51.40  ? 108 LEU B C   1 
ATOM   1577 O  O   . LEU B 1 108 ? -27.608 22.439 17.404 1.00 51.58  ? 108 LEU B O   1 
ATOM   1578 C  CB  . LEU B 1 108 ? -26.775 25.074 16.223 1.00 52.93  ? 108 LEU B CB  1 
ATOM   1579 C  CG  . LEU B 1 108 ? -27.557 26.109 15.401 1.00 54.99  ? 108 LEU B CG  1 
ATOM   1580 C  CD1 . LEU B 1 108 ? -26.764 26.471 14.145 1.00 55.77  ? 108 LEU B CD1 1 
ATOM   1581 C  CD2 . LEU B 1 108 ? -28.935 25.559 15.040 1.00 55.69  ? 108 LEU B CD2 1 
ATOM   1582 N  N   . VAL B 1 109 ? -29.368 23.601 18.155 1.00 51.37  ? 109 VAL B N   1 
ATOM   1583 C  CA  . VAL B 1 109 ? -30.189 22.403 18.288 1.00 51.98  ? 109 VAL B CA  1 
ATOM   1584 C  C   . VAL B 1 109 ? -31.590 22.575 17.733 1.00 53.67  ? 109 VAL B C   1 
ATOM   1585 O  O   . VAL B 1 109 ? -32.028 23.683 17.404 1.00 50.48  ? 109 VAL B O   1 
ATOM   1586 C  CB  . VAL B 1 109 ? -30.335 21.956 19.776 1.00 50.93  ? 109 VAL B CB  1 
ATOM   1587 C  CG1 . VAL B 1 109 ? -28.969 21.827 20.426 1.00 49.93  ? 109 VAL B CG1 1 
ATOM   1588 C  CG2 . VAL B 1 109 ? -31.205 22.952 20.543 1.00 50.13  ? 109 VAL B CG2 1 
ATOM   1589 N  N   . THR B 1 110 ? -32.283 21.444 17.646 1.00 57.08  ? 110 THR B N   1 
ATOM   1590 C  CA  . THR B 1 110 ? -33.654 21.384 17.156 1.00 60.90  ? 110 THR B CA  1 
ATOM   1591 C  C   . THR B 1 110 ? -34.396 20.499 18.136 1.00 62.79  ? 110 THR B C   1 
ATOM   1592 O  O   . THR B 1 110 ? -33.827 19.541 18.665 1.00 62.05  ? 110 THR B O   1 
ATOM   1593 C  CB  . THR B 1 110 ? -33.736 20.715 15.763 1.00 62.25  ? 110 THR B CB  1 
ATOM   1594 O  OG1 . THR B 1 110 ? -33.106 19.425 15.819 1.00 62.39  ? 110 THR B OG1 1 
ATOM   1595 C  CG2 . THR B 1 110 ? -33.037 21.569 14.707 1.00 62.83  ? 110 THR B CG2 1 
ATOM   1596 N  N   . ARG B 1 111 ? -35.658 20.819 18.384 1.00 66.24  ? 111 ARG B N   1 
ATOM   1597 C  CA  . ARG B 1 111 ? -36.470 20.020 19.292 1.00 71.75  ? 111 ARG B CA  1 
ATOM   1598 C  C   . ARG B 1 111 ? -37.922 20.003 18.807 1.00 75.21  ? 111 ARG B C   1 
ATOM   1599 O  O   . ARG B 1 111 ? -38.424 21.018 18.314 1.00 74.55  ? 111 ARG B O   1 
ATOM   1600 C  CB  . ARG B 1 111 ? -36.387 20.593 20.718 1.00 71.18  ? 111 ARG B CB  1 
ATOM   1601 C  CG  . ARG B 1 111 ? -36.776 22.061 20.830 1.00 70.70  ? 111 ARG B CG  1 
ATOM   1602 C  CD  . ARG B 1 111 ? -36.733 22.566 22.272 1.00 72.04  ? 111 ARG B CD  1 
ATOM   1603 N  NE  . ARG B 1 111 ? -35.390 22.519 22.847 1.00 72.14  ? 111 ARG B NE  1 
ATOM   1604 C  CZ  . ARG B 1 111 ? -34.879 23.472 23.624 1.00 71.39  ? 111 ARG B CZ  1 
ATOM   1605 N  NH1 . ARG B 1 111 ? -35.602 24.548 23.919 1.00 69.54  ? 111 ARG B NH1 1 
ATOM   1606 N  NH2 . ARG B 1 111 ? -33.644 23.353 24.099 1.00 70.01  ? 111 ARG B NH2 1 
ATOM   1607 N  N   . GLN B 1 112 ? -38.585 18.850 18.894 1.00 79.17  ? 112 GLN B N   1 
ATOM   1608 C  CA  . GLN B 1 112 ? -39.983 18.796 18.487 1.00 84.60  ? 112 GLN B CA  1 
ATOM   1609 C  C   . GLN B 1 112 ? -40.585 19.766 19.478 1.00 86.64  ? 112 GLN B C   1 
ATOM   1610 O  O   . GLN B 1 112 ? -40.233 19.727 20.654 1.00 87.46  ? 112 GLN B O   1 
ATOM   1611 C  CB  . GLN B 1 112 ? -40.571 17.400 18.692 1.00 87.11  ? 112 GLN B CB  1 
ATOM   1612 C  CG  . GLN B 1 112 ? -39.882 16.304 17.894 1.00 91.49  ? 112 GLN B CG  1 
ATOM   1613 C  CD  . GLN B 1 112 ? -40.636 14.978 17.951 1.00 94.64  ? 112 GLN B CD  1 
ATOM   1614 O  OE1 . GLN B 1 112 ? -41.162 14.591 19.005 1.00 95.09  ? 112 GLN B OE1 1 
ATOM   1615 N  NE2 . GLN B 1 112 ? -40.682 14.269 16.818 1.00 95.71  ? 112 GLN B NE2 1 
ATOM   1616 N  N   . SER B 1 113 ? -41.481 20.639 19.038 1.00 89.19  ? 113 SER B N   1 
ATOM   1617 C  CA  . SER B 1 113 ? -42.010 21.613 19.979 1.00 92.33  ? 113 SER B CA  1 
ATOM   1618 C  C   . SER B 1 113 ? -43.511 21.687 20.216 1.00 93.70  ? 113 SER B C   1 
ATOM   1619 O  O   . SER B 1 113 ? -44.260 20.729 20.006 1.00 93.55  ? 113 SER B O   1 
ATOM   1620 C  CB  . SER B 1 113 ? -41.517 23.005 19.591 1.00 93.67  ? 113 SER B CB  1 
ATOM   1621 O  OG  . SER B 1 113 ? -42.120 23.418 18.375 1.00 96.19  ? 113 SER B OG  1 
ATOM   1622 N  N   . LEU B 1 114 ? -43.915 22.870 20.671 1.00 95.41  ? 114 LEU B N   1 
ATOM   1623 C  CA  . LEU B 1 114 ? -45.291 23.202 20.999 1.00 97.30  ? 114 LEU B CA  1 
ATOM   1624 C  C   . LEU B 1 114 ? -46.292 22.852 19.900 1.00 98.61  ? 114 LEU B C   1 
ATOM   1625 O  O   . LEU B 1 114 ? -46.005 22.978 18.706 1.00 98.64  ? 114 LEU B O   1 
ATOM   1626 C  CB  . LEU B 1 114 ? -45.383 24.699 21.329 1.00 97.21  ? 114 LEU B CB  1 
ATOM   1627 C  CG  . LEU B 1 114 ? -44.326 25.259 22.298 1.00 97.66  ? 114 LEU B CG  1 
ATOM   1628 C  CD1 . LEU B 1 114 ? -44.430 26.783 22.369 1.00 96.44  ? 114 LEU B CD1 1 
ATOM   1629 C  CD2 . LEU B 1 114 ? -44.502 24.631 23.682 1.00 97.07  ? 114 LEU B CD2 1 
ATOM   1630 N  N   . GLN B 1 115 ? -47.467 22.405 20.338 1.00 100.10 ? 115 GLN B N   1 
ATOM   1631 C  CA  . GLN B 1 115 ? -48.585 22.027 19.474 1.00 101.54 ? 115 GLN B CA  1 
ATOM   1632 C  C   . GLN B 1 115 ? -49.545 21.169 20.306 1.00 102.96 ? 115 GLN B C   1 
ATOM   1633 O  O   . GLN B 1 115 ? -49.123 20.484 21.244 1.00 102.88 ? 115 GLN B O   1 
ATOM   1634 C  CB  . GLN B 1 115 ? -48.102 21.257 18.226 1.00 100.36 ? 115 GLN B CB  1 
ATOM   1635 C  CG  . GLN B 1 115 ? -48.350 19.746 18.218 1.00 98.89  ? 115 GLN B CG  1 
ATOM   1636 C  CD  . GLN B 1 115 ? -47.131 18.940 18.634 1.00 98.38  ? 115 GLN B CD  1 
ATOM   1637 O  OE1 . GLN B 1 115 ? -46.832 18.796 19.821 1.00 96.72  ? 115 GLN B OE1 1 
ATOM   1638 N  NE2 . GLN B 1 115 ? -46.410 18.417 17.646 1.00 98.37  ? 115 GLN B NE2 1 
ATOM   1639 N  N   . LYS B 1 116 ? -50.833 21.225 19.971 1.00 104.47 ? 116 LYS B N   1 
ATOM   1640 C  CA  . LYS B 1 116 ? -51.861 20.468 20.691 1.00 105.26 ? 116 LYS B CA  1 
ATOM   1641 C  C   . LYS B 1 116 ? -51.548 18.970 20.764 1.00 105.83 ? 116 LYS B C   1 
ATOM   1642 O  O   . LYS B 1 116 ? -51.519 18.429 21.892 1.00 105.72 ? 116 LYS B O   1 
ATOM   1643 C  CB  . LYS B 1 116 ? -53.226 20.673 20.025 1.00 104.93 ? 116 LYS B CB  1 
ATOM   1644 C  CG  . LYS B 1 116 ? -53.664 22.120 19.953 1.00 103.93 ? 116 LYS B CG  1 
ATOM   1645 C  CD  . LYS B 1 116 ? -54.031 22.497 18.531 1.00 103.71 ? 116 LYS B CD  1 
ATOM   1646 C  CE  . LYS B 1 116 ? -54.425 23.962 18.433 1.00 102.51 ? 116 LYS B CE  1 
ATOM   1647 N  NZ  . LYS B 1 116 ? -54.617 24.362 17.014 1.00 101.13 ? 116 LYS B NZ  1 
ATOM   1648 N  N   . ARG C 2 5   ? -2.479  24.720 11.122 1.00 81.46  ? 440 ARG C N   1 
ATOM   1649 C  CA  . ARG C 2 5   ? -3.078  25.967 10.560 1.00 81.01  ? 440 ARG C CA  1 
ATOM   1650 C  C   . ARG C 2 5   ? -2.829  27.148 11.501 1.00 79.48  ? 440 ARG C C   1 
ATOM   1651 O  O   . ARG C 2 5   ? -3.163  27.091 12.691 1.00 79.22  ? 440 ARG C O   1 
ATOM   1652 C  CB  . ARG C 2 5   ? -4.583  25.771 10.353 1.00 83.03  ? 440 ARG C CB  1 
ATOM   1653 C  CG  . ARG C 2 5   ? -5.408  25.774 11.634 1.00 85.16  ? 440 ARG C CG  1 
ATOM   1654 C  CD  . ARG C 2 5   ? -6.752  25.112 11.397 1.00 87.73  ? 440 ARG C CD  1 
ATOM   1655 N  NE  . ARG C 2 5   ? -7.356  25.545 10.139 1.00 88.85  ? 440 ARG C NE  1 
ATOM   1656 C  CZ  . ARG C 2 5   ? -7.913  26.734 9.938  1.00 89.08  ? 440 ARG C CZ  1 
ATOM   1657 N  NH1 . ARG C 2 5   ? -7.950  27.626 10.921 1.00 88.46  ? 440 ARG C NH1 1 
ATOM   1658 N  NH2 . ARG C 2 5   ? -8.432  27.028 8.752  1.00 89.34  ? 440 ARG C NH2 1 
ATOM   1659 N  N   . ARG C 2 6   ? -2.230  28.213 10.970 1.00 76.65  ? 441 ARG C N   1 
ATOM   1660 C  CA  . ARG C 2 6   ? -1.947  29.393 11.776 1.00 72.78  ? 441 ARG C CA  1 
ATOM   1661 C  C   . ARG C 2 6   ? -3.265  29.993 12.235 1.00 70.38  ? 441 ARG C C   1 
ATOM   1662 O  O   . ARG C 2 6   ? -4.320  29.698 11.674 1.00 69.32  ? 441 ARG C O   1 
ATOM   1663 C  CB  . ARG C 2 6   ? -1.162  30.432 10.973 1.00 72.47  ? 441 ARG C CB  1 
ATOM   1664 C  CG  . ARG C 2 6   ? 0.174   30.798 11.609 1.00 73.77  ? 441 ARG C CG  1 
ATOM   1665 C  CD  . ARG C 2 6   ? 0.381   32.304 11.697 1.00 73.04  ? 441 ARG C CD  1 
ATOM   1666 N  NE  . ARG C 2 6   ? 0.477   32.928 10.382 1.00 72.86  ? 441 ARG C NE  1 
ATOM   1667 C  CZ  . ARG C 2 6   ? 0.651   34.233 10.186 1.00 73.73  ? 441 ARG C CZ  1 
ATOM   1668 N  NH1 . ARG C 2 6   ? 0.750   35.057 11.224 1.00 73.39  ? 441 ARG C NH1 1 
ATOM   1669 N  NH2 . ARG C 2 6   ? 0.729   34.717 8.953  1.00 73.43  ? 441 ARG C NH2 1 
ATOM   1670 N  N   . GLU C 2 7   ? -3.206  30.831 13.259 1.00 67.96  ? 442 GLU C N   1 
ATOM   1671 C  CA  . GLU C 2 7   ? -4.414  31.453 13.767 1.00 66.29  ? 442 GLU C CA  1 
ATOM   1672 C  C   . GLU C 2 7   ? -4.096  32.732 14.520 1.00 62.61  ? 442 GLU C C   1 
ATOM   1673 O  O   . GLU C 2 7   ? -3.198  32.769 15.353 1.00 63.18  ? 442 GLU C O   1 
ATOM   1674 C  CB  . GLU C 2 7   ? -5.164  30.482 14.673 1.00 68.37  ? 442 GLU C CB  1 
ATOM   1675 C  CG  . GLU C 2 7   ? -6.646  30.745 14.712 1.00 72.47  ? 442 GLU C CG  1 
ATOM   1676 C  CD  . GLU C 2 7   ? -7.403  29.667 15.447 1.00 75.72  ? 442 GLU C CD  1 
ATOM   1677 O  OE1 . GLU C 2 7   ? -7.284  29.599 16.692 1.00 77.82  ? 442 GLU C OE1 1 
ATOM   1678 O  OE2 . GLU C 2 7   ? -8.113  28.884 14.777 1.00 77.40  ? 442 GLU C OE2 1 
ATOM   1679 N  N   . SER C 2 8   ? -4.842  33.783 14.217 1.00 58.70  ? 443 SER C N   1 
ATOM   1680 C  CA  . SER C 2 8   ? -4.619  35.064 14.851 1.00 55.33  ? 443 SER C CA  1 
ATOM   1681 C  C   . SER C 2 8   ? -5.796  35.502 15.695 1.00 53.26  ? 443 SER C C   1 
ATOM   1682 O  O   . SER C 2 8   ? -6.949  35.457 15.265 1.00 52.76  ? 443 SER C O   1 
ATOM   1683 C  CB  . SER C 2 8   ? -4.332  36.129 13.792 1.00 55.13  ? 443 SER C CB  1 
ATOM   1684 O  OG  . SER C 2 8   ? -3.168  35.804 13.057 1.00 55.60  ? 443 SER C OG  1 
ATOM   1685 N  N   . ALA C 2 9   ? -5.489  35.916 16.915 1.00 51.06  ? 444 ALA C N   1 
ATOM   1686 C  CA  . ALA C 2 9   ? -6.505  36.398 17.826 1.00 49.60  ? 444 ALA C CA  1 
ATOM   1687 C  C   . ALA C 2 9   ? -6.436  37.902 17.679 1.00 49.23  ? 444 ALA C C   1 
ATOM   1688 O  O   . ALA C 2 9   ? -5.355  38.495 17.761 1.00 50.16  ? 444 ALA C O   1 
ATOM   1689 C  CB  . ALA C 2 9   ? -6.180  35.988 19.257 1.00 48.64  ? 444 ALA C CB  1 
ATOM   1690 N  N   . ILE C 2 10  ? -7.583  38.517 17.440 1.00 47.17  ? 445 ILE C N   1 
ATOM   1691 C  CA  . ILE C 2 10  ? -7.635  39.953 17.271 1.00 44.95  ? 445 ILE C CA  1 
ATOM   1692 C  C   . ILE C 2 10  ? -8.706  40.532 18.187 1.00 45.60  ? 445 ILE C C   1 
ATOM   1693 O  O   . ILE C 2 10  ? -8.734  41.772 18.338 1.00 46.09  ? 445 ILE C O   1 
ATOM   1694 C  CB  . ILE C 2 10  ? -7.908  40.306 15.781 1.00 45.19  ? 445 ILE C CB  1 
ATOM   1695 C  CG1 . ILE C 2 10  ? -9.238  39.693 15.329 1.00 43.88  ? 445 ILE C CG1 1 
ATOM   1696 C  CG2 . ILE C 2 10  ? -6.738  39.806 14.911 1.00 44.86  ? 445 ILE C CG2 1 
ATOM   1697 C  CD1 . ILE C 2 10  ? -9.221  39.130 13.935 1.00 43.16  ? 445 ILE C CD1 1 
ATOM   1698 O  OXT . ILE C 2 10  ? -9.499  39.735 18.757 1.00 44.73  ? 445 ILE C OXT 1 
ATOM   1699 N  N   . ARG D 2 5   ? -27.129 1.031  24.397 1.00 94.84  ? 440 ARG D N   1 
ATOM   1700 C  CA  . ARG D 2 5   ? -26.506 2.093  23.556 1.00 94.69  ? 440 ARG D CA  1 
ATOM   1701 C  C   . ARG D 2 5   ? -25.509 2.930  24.346 1.00 93.88  ? 440 ARG D C   1 
ATOM   1702 O  O   . ARG D 2 5   ? -25.621 3.048  25.565 1.00 94.56  ? 440 ARG D O   1 
ATOM   1703 C  CB  . ARG D 2 5   ? -27.589 3.004  22.973 1.00 95.50  ? 440 ARG D CB  1 
ATOM   1704 C  CG  . ARG D 2 5   ? -28.674 3.399  23.959 1.00 96.92  ? 440 ARG D CG  1 
ATOM   1705 C  CD  . ARG D 2 5   ? -29.023 4.865  23.797 1.00 99.24  ? 440 ARG D CD  1 
ATOM   1706 N  NE  . ARG D 2 5   ? -29.295 5.208  22.404 1.00 100.66 ? 440 ARG D NE  1 
ATOM   1707 C  CZ  . ARG D 2 5   ? -29.233 6.443  21.914 1.00 100.63 ? 440 ARG D CZ  1 
ATOM   1708 N  NH1 . ARG D 2 5   ? -28.903 7.451  22.710 1.00 100.26 ? 440 ARG D NH1 1 
ATOM   1709 N  NH2 . ARG D 2 5   ? -29.503 6.673  20.633 1.00 100.58 ? 440 ARG D NH2 1 
ATOM   1710 N  N   . ARG D 2 6   ? -24.534 3.505  23.645 1.00 92.49  ? 441 ARG D N   1 
ATOM   1711 C  CA  . ARG D 2 6   ? -23.521 4.339  24.282 1.00 90.93  ? 441 ARG D CA  1 
ATOM   1712 C  C   . ARG D 2 6   ? -24.077 5.670  24.768 1.00 89.82  ? 441 ARG D C   1 
ATOM   1713 O  O   . ARG D 2 6   ? -25.033 6.210  24.207 1.00 89.26  ? 441 ARG D O   1 
ATOM   1714 C  CB  . ARG D 2 6   ? -22.360 4.612  23.323 1.00 91.53  ? 441 ARG D CB  1 
ATOM   1715 C  CG  . ARG D 2 6   ? -21.218 3.613  23.434 1.00 93.94  ? 441 ARG D CG  1 
ATOM   1716 C  CD  . ARG D 2 6   ? -19.872 4.297  23.706 1.00 94.43  ? 441 ARG D CD  1 
ATOM   1717 N  NE  . ARG D 2 6   ? -19.403 5.093  22.573 1.00 95.08  ? 441 ARG D NE  1 
ATOM   1718 C  CZ  . ARG D 2 6   ? -18.277 5.804  22.569 1.00 95.90  ? 441 ARG D CZ  1 
ATOM   1719 N  NH1 . ARG D 2 6   ? -17.494 5.823  23.640 1.00 95.83  ? 441 ARG D NH1 1 
ATOM   1720 N  NH2 . ARG D 2 6   ? -17.934 6.505  21.495 1.00 96.51  ? 441 ARG D NH2 1 
ATOM   1721 N  N   . GLU D 2 7   ? -23.463 6.187  25.825 1.00 88.46  ? 442 GLU D N   1 
ATOM   1722 C  CA  . GLU D 2 7   ? -23.851 7.463  26.409 1.00 86.85  ? 442 GLU D CA  1 
ATOM   1723 C  C   . GLU D 2 7   ? -22.674 8.089  27.139 1.00 85.00  ? 442 GLU D C   1 
ATOM   1724 O  O   . GLU D 2 7   ? -22.048 7.455  27.987 1.00 84.66  ? 442 GLU D O   1 
ATOM   1725 C  CB  . GLU D 2 7   ? -25.023 7.286  27.376 1.00 87.47  ? 442 GLU D CB  1 
ATOM   1726 C  CG  . GLU D 2 7   ? -26.384 7.329  26.701 1.00 88.76  ? 442 GLU D CG  1 
ATOM   1727 C  CD  . GLU D 2 7   ? -27.511 7.590  27.686 1.00 89.41  ? 442 GLU D CD  1 
ATOM   1728 O  OE1 . GLU D 2 7   ? -27.277 8.337  28.661 1.00 89.89  ? 442 GLU D OE1 1 
ATOM   1729 O  OE2 . GLU D 2 7   ? -28.628 7.065  27.476 1.00 89.49  ? 442 GLU D OE2 1 
ATOM   1730 N  N   . SER D 2 8   ? -22.370 9.335  26.795 1.00 82.85  ? 443 SER D N   1 
ATOM   1731 C  CA  . SER D 2 8   ? -21.264 10.039 27.425 1.00 80.24  ? 443 SER D CA  1 
ATOM   1732 C  C   . SER D 2 8   ? -21.772 11.131 28.357 1.00 78.88  ? 443 SER D C   1 
ATOM   1733 O  O   . SER D 2 8   ? -22.711 11.863 28.035 1.00 78.17  ? 443 SER D O   1 
ATOM   1734 C  CB  . SER D 2 8   ? -20.351 10.647 26.360 1.00 79.76  ? 443 SER D CB  1 
ATOM   1735 O  OG  . SER D 2 8   ? -19.826 9.637  25.517 1.00 79.15  ? 443 SER D OG  1 
ATOM   1736 N  N   . ALA D 2 9   ? -21.151 11.220 29.525 1.00 77.63  ? 444 ALA D N   1 
ATOM   1737 C  CA  . ALA D 2 9   ? -21.520 12.219 30.510 1.00 77.33  ? 444 ALA D CA  1 
ATOM   1738 C  C   . ALA D 2 9   ? -20.505 13.344 30.443 1.00 77.26  ? 444 ALA D C   1 
ATOM   1739 O  O   . ALA D 2 9   ? -19.355 13.182 30.853 1.00 77.37  ? 444 ALA D O   1 
ATOM   1740 C  CB  . ALA D 2 9   ? -21.535 11.611 31.899 1.00 77.31  ? 444 ALA D CB  1 
ATOM   1741 N  N   . ILE D 2 10  ? -20.943 14.481 29.918 1.00 76.69  ? 445 ILE D N   1 
ATOM   1742 C  CA  . ILE D 2 10  ? -20.093 15.652 29.780 1.00 76.26  ? 445 ILE D CA  1 
ATOM   1743 C  C   . ILE D 2 10  ? -20.492 16.723 30.786 1.00 76.51  ? 445 ILE D C   1 
ATOM   1744 O  O   . ILE D 2 10  ? -19.774 17.738 30.882 1.00 77.48  ? 445 ILE D O   1 
ATOM   1745 C  CB  . ILE D 2 10  ? -20.187 16.210 28.346 1.00 75.20  ? 445 ILE D CB  1 
ATOM   1746 C  CG1 . ILE D 2 10  ? -21.645 16.199 27.888 1.00 74.78  ? 445 ILE D CG1 1 
ATOM   1747 C  CG2 . ILE D 2 10  ? -19.331 15.378 27.412 1.00 75.79  ? 445 ILE D CG2 1 
ATOM   1748 C  CD1 . ILE D 2 10  ? -21.837 16.281 26.405 1.00 73.11  ? 445 ILE D CD1 1 
ATOM   1749 O  OXT . ILE D 2 10  ? -21.519 16.526 31.472 1.00 77.49  ? 445 ILE D OXT 1 
HETATM 1750 ZN ZN  . ZN  E 3 .   ? -17.434 52.128 19.293 1.00 108.54 ? 125 ZN  A ZN  1 
HETATM 1751 CL CL  . CL  F 4 .   ? -17.706 46.966 4.179  1.00 95.86  ? 126 CL  A CL  1 
HETATM 1752 CL CL  . CL  G 4 .   ? -20.280 31.610 17.523 1.00 81.15  ? 127 CL  A CL  1 
HETATM 1753 ZN ZN  . ZN  H 3 .   ? -18.524 31.612 32.159 1.00 102.81 ? 125 ZN  B ZN  1 
HETATM 1754 ZN ZN  . ZN  I 3 .   ? -34.695 22.440 37.184 1.00 59.03  ? 126 ZN  B ZN  1 
HETATM 1755 ZN ZN  . ZN  J 3 .   ? -22.806 34.409 24.498 1.00 52.69  ? 127 ZN  B ZN  1 
HETATM 1756 CL CL  . CL  K 4 .   ? -22.573 27.764 16.677 1.00 105.08 ? 128 CL  B CL  1 
HETATM 1757 CL CL  . CL  L 4 .   ? -35.490 18.316 30.081 1.00 80.23  ? 129 CL  B CL  1 
HETATM 1758 O  O   . HOH M 5 .   ? -23.107 36.222 25.949 1.00 43.71  ? 128 HOH A O   1 
HETATM 1759 O  O   . HOH M 5 .   ? -0.389  27.267 -0.940 1.00 56.60  ? 129 HOH A O   1 
HETATM 1760 O  O   . HOH M 5 .   ? -3.478  49.361 3.900  1.00 55.52  ? 130 HOH A O   1 
HETATM 1761 O  O   . HOH M 5 .   ? 3.823   39.424 12.117 1.00 69.81  ? 131 HOH A O   1 
HETATM 1762 O  O   . HOH M 5 .   ? -25.927 46.991 1.273  1.00 69.23  ? 132 HOH A O   1 
HETATM 1763 O  O   . HOH M 5 .   ? -27.836 33.883 12.323 1.00 66.32  ? 133 HOH A O   1 
HETATM 1764 O  O   . HOH M 5 .   ? -9.464  49.309 30.242 1.00 44.17  ? 134 HOH A O   1 
HETATM 1765 O  O   . HOH M 5 .   ? -24.431 45.351 0.083  1.00 72.72  ? 135 HOH A O   1 
HETATM 1766 O  O   . HOH M 5 .   ? -22.443 48.060 8.296  1.00 57.44  ? 136 HOH A O   1 
HETATM 1767 O  O   . HOH M 5 .   ? -31.489 38.477 22.924 1.00 90.82  ? 137 HOH A O   1 
HETATM 1768 O  O   . HOH M 5 .   ? -6.902  53.645 21.486 1.00 67.94  ? 138 HOH A O   1 
HETATM 1769 O  O   . HOH M 5 .   ? -24.205 27.461 10.499 1.00 62.62  ? 139 HOH A O   1 
HETATM 1770 O  O   . HOH M 5 .   ? -34.582 30.141 13.907 1.00 71.21  ? 140 HOH A O   1 
HETATM 1771 O  O   . HOH M 5 .   ? -10.974 28.869 22.190 1.00 71.38  ? 141 HOH A O   1 
HETATM 1772 O  O   . HOH M 5 .   ? -8.277  52.573 28.092 1.00 61.38  ? 142 HOH A O   1 
HETATM 1773 O  O   . HOH M 5 .   ? -11.289 32.926 22.710 1.00 56.33  ? 143 HOH A O   1 
HETATM 1774 O  O   . HOH M 5 .   ? -31.788 40.482 18.757 1.00 64.87  ? 144 HOH A O   1 
HETATM 1775 O  O   . HOH M 5 .   ? -27.972 36.543 1.482  1.00 73.81  ? 145 HOH A O   1 
HETATM 1776 O  O   . HOH M 5 .   ? -6.158  42.681 -1.468 1.00 60.18  ? 146 HOH A O   1 
HETATM 1777 O  O   . HOH M 5 .   ? -3.636  51.798 20.238 1.00 69.51  ? 147 HOH A O   1 
HETATM 1778 O  O   . HOH M 5 .   ? -4.030  53.320 10.959 1.00 52.91  ? 148 HOH A O   1 
HETATM 1779 O  O   . HOH M 5 .   ? -16.162 38.588 20.888 1.00 30.24  ? 149 HOH A O   1 
HETATM 1780 O  O   . HOH M 5 .   ? -14.265 35.587 26.882 1.00 44.45  ? 150 HOH A O   1 
HETATM 1781 O  O   . HOH M 5 .   ? -17.505 47.717 21.536 1.00 57.29  ? 151 HOH A O   1 
HETATM 1782 O  O   . HOH M 5 .   ? -4.704  43.638 32.563 1.00 62.63  ? 152 HOH A O   1 
HETATM 1783 O  O   . HOH M 5 .   ? -5.043  44.328 25.789 1.00 77.46  ? 153 HOH A O   1 
HETATM 1784 O  O   . HOH M 5 .   ? -31.591 20.723 0.806  1.00 62.08  ? 154 HOH A O   1 
HETATM 1785 O  O   . HOH M 5 .   ? -23.438 20.917 3.786  1.00 77.32  ? 155 HOH A O   1 
HETATM 1786 O  O   . HOH M 5 .   ? -20.703 24.844 5.270  1.00 74.57  ? 156 HOH A O   1 
HETATM 1787 O  O   . HOH M 5 .   ? 0.866   40.160 15.412 1.00 61.52  ? 157 HOH A O   1 
HETATM 1788 O  O   . HOH M 5 .   ? -27.920 20.013 2.476  1.00 53.31  ? 158 HOH A O   1 
HETATM 1789 O  O   . HOH M 5 .   ? -21.612 18.246 -0.635 1.00 82.77  ? 159 HOH A O   1 
HETATM 1790 O  O   . HOH M 5 .   ? -23.225 18.233 -3.861 1.00 62.38  ? 160 HOH A O   1 
HETATM 1791 O  O   . HOH M 5 .   ? -14.945 25.327 -7.898 1.00 77.64  ? 161 HOH A O   1 
HETATM 1792 O  O   . HOH M 5 .   ? -33.272 35.005 3.989  1.00 61.16  ? 162 HOH A O   1 
HETATM 1793 O  O   . HOH M 5 .   ? -29.532 39.737 4.785  1.00 72.16  ? 163 HOH A O   1 
HETATM 1794 O  O   . HOH M 5 .   ? -30.180 39.186 9.483  1.00 81.37  ? 164 HOH A O   1 
HETATM 1795 O  O   . HOH M 5 .   ? -31.203 40.643 11.275 1.00 65.68  ? 165 HOH A O   1 
HETATM 1796 O  O   . HOH M 5 .   ? -23.819 44.196 13.437 1.00 53.15  ? 166 HOH A O   1 
HETATM 1797 O  O   . HOH M 5 .   ? -19.495 45.894 18.690 1.00 46.11  ? 167 HOH A O   1 
HETATM 1798 O  O   . HOH M 5 .   ? -27.319 41.619 7.600  1.00 81.96  ? 168 HOH A O   1 
HETATM 1799 O  O   . HOH M 5 .   ? -26.885 41.088 10.226 1.00 73.75  ? 169 HOH A O   1 
HETATM 1800 O  O   . HOH M 5 .   ? -27.722 41.372 17.041 1.00 72.08  ? 170 HOH A O   1 
HETATM 1801 O  O   . HOH M 5 .   ? -1.891  55.227 24.156 1.00 58.10  ? 171 HOH A O   1 
HETATM 1802 O  O   . HOH M 5 .   ? -0.497  44.346 26.322 1.00 59.16  ? 172 HOH A O   1 
HETATM 1803 O  O   . HOH M 5 .   ? -0.402  26.157 5.835  1.00 62.30  ? 173 HOH A O   1 
HETATM 1804 O  O   . HOH M 5 .   ? -12.538 32.623 -1.867 1.00 56.59  ? 174 HOH A O   1 
HETATM 1805 O  O   . HOH M 5 .   ? -25.943 38.279 20.144 1.00 61.10  ? 175 HOH A O   1 
HETATM 1806 O  O   . HOH M 5 .   ? -26.437 40.409 21.740 1.00 62.30  ? 176 HOH A O   1 
HETATM 1807 O  O   . HOH M 5 .   ? -20.707 30.350 10.994 1.00 46.03  ? 177 HOH A O   1 
HETATM 1808 O  O   . HOH M 5 .   ? -21.173 28.761 8.523  1.00 48.23  ? 178 HOH A O   1 
HETATM 1809 O  O   . HOH M 5 .   ? -19.473 21.660 7.107  1.00 74.03  ? 179 HOH A O   1 
HETATM 1810 O  O   . HOH M 5 .   ? -1.335  48.849 19.395 1.00 63.82  ? 182 HOH A O   1 
HETATM 1811 O  O   . HOH N 5 .   ? -12.128 13.164 25.982 1.00 68.24  ? 130 HOH B O   1 
HETATM 1812 O  O   . HOH N 5 .   ? -10.224 11.195 27.004 1.00 66.51  ? 131 HOH B O   1 
HETATM 1813 O  O   . HOH N 5 .   ? -10.437 29.324 28.572 1.00 75.40  ? 132 HOH B O   1 
HETATM 1814 O  O   . HOH N 5 .   ? -38.785 17.359 21.768 1.00 80.34  ? 133 HOH B O   1 
HETATM 1815 O  O   . HOH N 5 .   ? -25.332 34.770 23.524 1.00 62.70  ? 134 HOH B O   1 
HETATM 1816 O  O   . HOH N 5 .   ? -36.265 24.793 37.697 1.00 51.01  ? 135 HOH B O   1 
HETATM 1817 O  O   . HOH N 5 .   ? -32.019 33.403 21.917 1.00 70.40  ? 136 HOH B O   1 
HETATM 1818 O  O   . HOH N 5 .   ? -33.954 25.492 36.995 1.00 32.62  ? 137 HOH B O   1 
HETATM 1819 O  O   . HOH N 5 .   ? -24.830 36.786 24.812 1.00 35.70  ? 138 HOH B O   1 
HETATM 1820 O  O   . HOH N 5 .   ? -20.519 16.411 6.507  1.00 66.68  ? 139 HOH B O   1 
HETATM 1821 O  O   . HOH N 5 .   ? -35.874 33.917 27.739 1.00 70.75  ? 140 HOH B O   1 
HETATM 1822 O  O   . HOH N 5 .   ? -38.659 37.501 28.840 1.00 65.81  ? 141 HOH B O   1 
HETATM 1823 O  O   . HOH N 5 .   ? -34.951 39.582 27.157 1.00 55.70  ? 142 HOH B O   1 
HETATM 1824 O  O   . HOH N 5 .   ? -23.540 1.529  11.698 1.00 81.50  ? 143 HOH B O   1 
HETATM 1825 O  O   . HOH N 5 .   ? -25.659 31.981 20.827 1.00 75.30  ? 144 HOH B O   1 
HETATM 1826 O  O   . HOH N 5 .   ? -33.028 29.910 29.612 1.00 82.52  ? 145 HOH B O   1 
HETATM 1827 O  O   . HOH N 5 .   ? -33.904 29.453 26.879 1.00 63.06  ? 146 HOH B O   1 
HETATM 1828 O  O   . HOH N 5 .   ? -33.191 3.382  26.096 1.00 68.66  ? 147 HOH B O   1 
HETATM 1829 O  O   . HOH N 5 .   ? -37.183 31.271 22.248 1.00 65.71  ? 148 HOH B O   1 
HETATM 1830 O  O   . HOH N 5 .   ? -24.364 27.876 31.299 1.00 41.16  ? 149 HOH B O   1 
HETATM 1831 O  O   . HOH N 5 .   ? -11.586 14.872 39.191 1.00 71.33  ? 150 HOH B O   1 
HETATM 1832 O  O   . HOH N 5 .   ? -12.057 24.410 40.965 1.00 52.15  ? 151 HOH B O   1 
HETATM 1833 O  O   . HOH N 5 .   ? -25.496 30.396 29.085 1.00 66.18  ? 152 HOH B O   1 
HETATM 1834 O  O   . HOH N 5 .   ? -28.514 29.553 26.051 1.00 55.90  ? 153 HOH B O   1 
HETATM 1835 O  O   . HOH N 5 .   ? -10.197 25.522 34.215 1.00 55.83  ? 154 HOH B O   1 
HETATM 1836 O  O   . HOH N 5 .   ? -27.227 20.823 33.411 1.00 35.57  ? 155 HOH B O   1 
HETATM 1837 O  O   . HOH N 5 .   ? -31.079 9.546  33.655 1.00 54.05  ? 156 HOH B O   1 
HETATM 1838 O  O   . HOH N 5 .   ? -11.821 17.628 42.029 1.00 67.70  ? 157 HOH B O   1 
HETATM 1839 O  O   . HOH N 5 .   ? -32.844 17.030 12.698 1.00 67.57  ? 158 HOH B O   1 
HETATM 1840 O  O   . HOH N 5 .   ? -14.604 25.715 17.300 1.00 57.12  ? 159 HOH B O   1 
HETATM 1841 O  O   . HOH N 5 .   ? -39.463 5.511  12.056 1.00 68.57  ? 160 HOH B O   1 
HETATM 1842 O  O   . HOH N 5 .   ? -13.478 15.948 16.522 1.00 74.32  ? 161 HOH B O   1 
HETATM 1843 O  O   . HOH N 5 .   ? -21.651 32.075 33.460 1.00 53.45  ? 162 HOH B O   1 
HETATM 1844 O  O   . HOH N 5 .   ? -33.340 28.608 23.399 1.00 63.28  ? 163 HOH B O   1 
HETATM 1845 O  O   . HOH N 5 .   ? -33.972 24.239 38.867 1.00 51.74  ? 164 HOH B O   1 
HETATM 1846 O  O   . HOH N 5 .   ? -48.807 16.649 22.309 1.00 83.67  ? 165 HOH B O   1 
HETATM 1847 O  O   . HOH N 5 .   ? -22.448 27.484 34.374 1.00 64.45  ? 166 HOH B O   1 
HETATM 1848 O  O   . HOH N 5 .   ? -23.426 11.769 12.683 1.00 107.31 ? 167 HOH B O   1 
HETATM 1849 O  O   . HOH N 5 .   ? -15.192 30.127 24.324 1.00 48.88  ? 168 HOH B O   1 
HETATM 1850 O  O   . HOH N 5 .   ? -15.583 29.781 21.920 1.00 61.63  ? 169 HOH B O   1 
HETATM 1851 O  O   . HOH N 5 .   ? -27.917 32.328 23.808 1.00 55.70  ? 170 HOH B O   1 
HETATM 1852 O  O   . HOH N 5 .   ? -9.189  28.895 34.060 1.00 71.89  ? 171 HOH B O   1 
HETATM 1853 O  O   . HOH N 5 .   ? -7.915  28.137 31.179 1.00 74.09  ? 172 HOH B O   1 
HETATM 1854 O  O   . HOH N 5 .   ? -28.426 13.157 11.070 1.00 53.67  ? 173 HOH B O   1 
HETATM 1855 O  O   . HOH N 5 .   ? -21.020 0.360  19.497 1.00 63.27  ? 174 HOH B O   1 
HETATM 1856 O  O   . HOH N 5 .   ? -41.295 7.568  17.134 1.00 76.87  ? 175 HOH B O   1 
HETATM 1857 O  O   . HOH N 5 .   ? -9.626  7.807  22.575 1.00 62.65  ? 176 HOH B O   1 
HETATM 1858 O  O   . HOH N 5 .   ? -7.324  6.196  25.257 1.00 61.96  ? 177 HOH B O   1 
HETATM 1859 O  O   . HOH N 5 .   ? -10.982 8.807  18.057 1.00 72.96  ? 178 HOH B O   1 
HETATM 1860 O  O   . HOH N 5 .   ? -32.846 13.719 35.987 1.00 43.80  ? 180 HOH B O   1 
HETATM 1861 O  O   . HOH N 5 .   ? -32.267 13.977 33.381 1.00 57.13  ? 181 HOH B O   1 
HETATM 1862 O  O   . HOH O 5 .   ? -2.252  35.794 17.839 1.00 52.77  ? 107 HOH C O   1 
HETATM 1863 O  O   . HOH O 5 .   ? -2.958  38.617 16.227 1.00 64.42  ? 108 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   TYR 3   3   ?   ?   ?   A . n 
A 1 4   ILE 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 VAL 118 118 ?   ?   ?   A . n 
A 1 119 GLN 119 119 ?   ?   ?   A . n 
A 1 120 GLN 120 120 ?   ?   ?   A . n 
A 1 121 SER 121 121 ?   ?   ?   A . n 
A 1 122 MET 122 122 ?   ?   ?   A . n 
A 1 123 LEU 123 123 ?   ?   ?   A . n 
A 1 124 SER 124 124 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   TYR 3   3   ?   ?   ?   B . n 
B 1 4   ILE 4   4   ?   ?   ?   B . n 
B 1 5   PRO 5   5   ?   ?   ?   B . n 
B 1 6   GLY 6   6   ?   ?   ?   B . n 
B 1 7   GLN 7   7   ?   ?   ?   B . n 
B 1 8   PRO 8   8   ?   ?   ?   B . n 
B 1 9   VAL 9   9   ?   ?   ?   B . n 
B 1 10  THR 10  10  ?   ?   ?   B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  VAL 13  13  13  VAL VAL B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  ARG 15  15  15  ARG ARG B . n 
B 1 16  VAL 16  16  16  VAL VAL B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  HIS 19  19  19  HIS HIS B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  LEU 21  21  21  LEU LEU B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  ASN 26  26  26  ASN ASN B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  ILE 28  28  28  ILE ILE B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  PHE 31  31  31  PHE PHE B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  ILE 37  37  37  ILE ILE B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  GLN 39  39  39  GLN GLN B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  PRO 45  45  45  PRO PRO B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  SER 47  47  47  SER SER B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  LYS 50  50  50  LYS LYS B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  ILE 55  55  55  ILE ILE B . n 
B 1 56  TYR 56  56  56  TYR TYR B . n 
B 1 57  VAL 57  57  57  VAL VAL B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  ARG 59  59  59  ARG ARG B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  PRO 65  65  65  PRO PRO B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  GLY 70  70  70  GLY GLY B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  ASP 75  75  75  ASP ASP B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  TRP 83  83  83  TRP TRP B . n 
B 1 84  ASP 84  84  84  ASP ASP B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  THR 86  86  86  THR THR B . n 
B 1 87  MET 87  87  87  MET MET B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  THR 89  89  89  THR THR B . n 
B 1 90  HIS 90  90  90  HIS HIS B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  GLN 92  92  92  GLN GLN B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ARG 100 100 100 ARG ARG B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 VAL 105 105 105 VAL VAL B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 GLN 115 115 115 GLN GLN B . n 
B 1 116 LYS 116 116 116 LYS LYS B . n 
B 1 117 ALA 117 117 ?   ?   ?   B . n 
B 1 118 VAL 118 118 ?   ?   ?   B . n 
B 1 119 GLN 119 119 ?   ?   ?   B . n 
B 1 120 GLN 120 120 ?   ?   ?   B . n 
B 1 121 SER 121 121 ?   ?   ?   B . n 
B 1 122 MET 122 122 ?   ?   ?   B . n 
B 1 123 LEU 123 123 ?   ?   ?   B . n 
B 1 124 SER 124 124 ?   ?   ?   B . n 
C 2 1   ASN 1   436 ?   ?   ?   C . n 
C 2 2   ILE 2   437 ?   ?   ?   C . n 
C 2 3   SER 3   438 ?   ?   ?   C . n 
C 2 4   TYR 4   439 ?   ?   ?   C . n 
C 2 5   ARG 5   440 440 ARG ARG C . n 
C 2 6   ARG 6   441 441 ARG ARG C . n 
C 2 7   GLU 7   442 442 GLU GLU C . n 
C 2 8   SER 8   443 443 SER SER C . n 
C 2 9   ALA 9   444 444 ALA ALA C . n 
C 2 10  ILE 10  445 445 ILE ILE C . n 
D 2 1   ASN 1   436 ?   ?   ?   D . n 
D 2 2   ILE 2   437 ?   ?   ?   D . n 
D 2 3   SER 3   438 ?   ?   ?   D . n 
D 2 4   TYR 4   439 ?   ?   ?   D . n 
D 2 5   ARG 5   440 440 ARG ARG D . n 
D 2 6   ARG 6   441 441 ARG ARG D . n 
D 2 7   GLU 7   442 442 GLU GLU D . n 
D 2 8   SER 8   443 443 SER SER D . n 
D 2 9   ALA 9   444 444 ALA ALA D . n 
D 2 10  ILE 10  445 445 ILE ILE D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,M,O   
2 1 B,D,H,I,J,K,L,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1090 ? 
1 MORE         1    ? 
1 'SSA (A^2)'  6530 ? 
2 'ABSA (A^2)' 1120 ? 
2 MORE         0    ? 
2 'SSA (A^2)'  6600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 62 ? A GLU 62  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE2 ? A GLU 67 ? A GLU 67  ? 1_555 88.7  ? 
2  OE2 ? A GLU 62 ? A GLU 62  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE1 ? B GLU 17 ? B GLU 17  ? 1_555 95.6  ? 
3  OE2 ? A GLU 67 ? A GLU 67  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE1 ? B GLU 17 ? B GLU 17  ? 1_555 93.4  ? 
4  OE2 ? A GLU 62 ? A GLU 62  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 O   ? M HOH .  ? A HOH 128 ? 1_555 108.5 ? 
5  OE2 ? A GLU 67 ? A GLU 67  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 O   ? M HOH .  ? A HOH 128 ? 1_555 98.5  ? 
6  OE1 ? B GLU 17 ? B GLU 17  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 O   ? M HOH .  ? A HOH 128 ? 1_555 153.2 ? 
7  OE2 ? A GLU 62 ? A GLU 62  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE2 ? B GLU 17 ? B GLU 17  ? 1_555 76.6  ? 
8  OE2 ? A GLU 67 ? A GLU 67  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE2 ? B GLU 17 ? B GLU 17  ? 1_555 150.4 ? 
9  OE1 ? B GLU 17 ? B GLU 17  ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE2 ? B GLU 17 ? B GLU 17  ? 1_555 63.3  ? 
10 O   ? M HOH .  ? A HOH 128 ? 1_555 ZN ? J ZN . ? B ZN 127 ? 1_555 OE2 ? B GLU 17 ? B GLU 17  ? 1_555 110.4 ? 
11 OE2 ? B GLU 62 ? B GLU 62  ? 1_555 ZN ? I ZN . ? B ZN 126 ? 1_555 OE2 ? B GLU 67 ? B GLU 67  ? 1_555 86.8  ? 
12 OE2 ? B GLU 62 ? B GLU 62  ? 1_555 ZN ? I ZN . ? B ZN 126 ? 1_555 O   ? N HOH .  ? B HOH 164 ? 1_555 122.0 ? 
13 OE2 ? B GLU 67 ? B GLU 67  ? 1_555 ZN ? I ZN . ? B ZN 126 ? 1_555 O   ? N HOH .  ? B HOH 164 ? 1_555 111.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
PHASES   phasing           .   ? 2 
CNS      refinement        1.2 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    128 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    138 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     129 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     129 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_555 
_pdbx_validate_symm_contact.dist              2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 43  ? ? -90.05  39.67   
2 1 GLN A 112 ? ? -52.24  109.61  
3 1 LEU A 114 ? ? 50.91   -152.48 
4 1 GLN A 115 ? ? 40.40   22.02   
5 1 LYS A 116 ? ? -117.44 68.17   
6 1 ASN B 44  ? ? 38.97   25.52   
7 1 PRO B 45  ? ? -59.66  174.18  
8 1 SER B 113 ? ? -122.70 -156.43 
9 1 GLN B 115 ? ? 162.23  150.40  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A THR 10  ? OG1 ? A THR 10  OG1 
2  1 Y 1 A THR 10  ? CG2 ? A THR 10  CG2 
3  1 Y 1 A GLU 48  ? CG  ? A GLU 48  CG  
4  1 Y 1 A GLU 48  ? CD  ? A GLU 48  CD  
5  1 Y 1 A GLU 48  ? OE1 ? A GLU 48  OE1 
6  1 Y 1 A GLU 48  ? OE2 ? A GLU 48  OE2 
7  1 Y 1 A GLN 112 ? CG  ? A GLN 112 CG  
8  1 Y 1 A GLN 112 ? CD  ? A GLN 112 CD  
9  1 Y 1 A GLN 112 ? OE1 ? A GLN 112 OE1 
10 1 Y 1 A GLN 112 ? NE2 ? A GLN 112 NE2 
11 1 Y 1 A LEU 114 ? CG  ? A LEU 114 CG  
12 1 Y 1 A LEU 114 ? CD1 ? A LEU 114 CD1 
13 1 Y 1 A LEU 114 ? CD2 ? A LEU 114 CD2 
14 1 Y 1 A LYS 116 ? CG  ? A LYS 116 CG  
15 1 Y 1 A LYS 116 ? CD  ? A LYS 116 CD  
16 1 Y 1 A LYS 116 ? CE  ? A LYS 116 CE  
17 1 Y 1 A LYS 116 ? NZ  ? A LYS 116 NZ  
18 1 Y 1 B GLU 48  ? CG  ? B GLU 48  CG  
19 1 Y 1 B GLU 48  ? CD  ? B GLU 48  CD  
20 1 Y 1 B GLU 48  ? OE1 ? B GLU 48  OE1 
21 1 Y 1 B GLU 48  ? OE2 ? B GLU 48  OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A TYR 3   ? A TYR 3   
4  1 Y 1 A ILE 4   ? A ILE 4   
5  1 Y 1 A PRO 5   ? A PRO 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A GLN 7   ? A GLN 7   
8  1 Y 1 A PRO 8   ? A PRO 8   
9  1 Y 1 A VAL 9   ? A VAL 9   
10 1 Y 1 A VAL 118 ? A VAL 118 
11 1 Y 1 A GLN 119 ? A GLN 119 
12 1 Y 1 A GLN 120 ? A GLN 120 
13 1 Y 1 A SER 121 ? A SER 121 
14 1 Y 1 A MET 122 ? A MET 122 
15 1 Y 1 A LEU 123 ? A LEU 123 
16 1 Y 1 A SER 124 ? A SER 124 
17 1 Y 1 B MET 1   ? B MET 1   
18 1 Y 1 B SER 2   ? B SER 2   
19 1 Y 1 B TYR 3   ? B TYR 3   
20 1 Y 1 B ILE 4   ? B ILE 4   
21 1 Y 1 B PRO 5   ? B PRO 5   
22 1 Y 1 B GLY 6   ? B GLY 6   
23 1 Y 1 B GLN 7   ? B GLN 7   
24 1 Y 1 B PRO 8   ? B PRO 8   
25 1 Y 1 B VAL 9   ? B VAL 9   
26 1 Y 1 B THR 10  ? B THR 10  
27 1 Y 1 B ALA 117 ? B ALA 117 
28 1 Y 1 B VAL 118 ? B VAL 118 
29 1 Y 1 B GLN 119 ? B GLN 119 
30 1 Y 1 B GLN 120 ? B GLN 120 
31 1 Y 1 B SER 121 ? B SER 121 
32 1 Y 1 B MET 122 ? B MET 122 
33 1 Y 1 B LEU 123 ? B LEU 123 
34 1 Y 1 B SER 124 ? B SER 124 
35 1 Y 1 C ASN 436 ? C ASN 1   
36 1 Y 1 C ILE 437 ? C ILE 2   
37 1 Y 1 C SER 438 ? C SER 3   
38 1 Y 1 C TYR 439 ? C TYR 4   
39 1 Y 1 D ASN 436 ? D ASN 1   
40 1 Y 1 D ILE 437 ? D ILE 2   
41 1 Y 1 D SER 438 ? D SER 3   
42 1 Y 1 D TYR 439 ? D TYR 4   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'     ZN  
4 'CHLORIDE ION' CL  
5 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ZN  1  125 1   ZN  ZN  A . 
F 4 CL  1  126 5   CL  CL  A . 
G 4 CL  1  127 6   CL  CL  A . 
H 3 ZN  1  125 2   ZN  ZN  B . 
I 3 ZN  1  126 3   ZN  ZN  B . 
J 3 ZN  1  127 4   ZN  ZN  B . 
K 4 CL  1  128 7   CL  CL  B . 
L 4 CL  1  129 8   CL  CL  B . 
M 5 HOH 1  128 3   HOH HOH A . 
M 5 HOH 2  129 6   HOH HOH A . 
M 5 HOH 3  130 8   HOH HOH A . 
M 5 HOH 4  131 10  HOH HOH A . 
M 5 HOH 5  132 11  HOH HOH A . 
M 5 HOH 6  133 12  HOH HOH A . 
M 5 HOH 7  134 17  HOH HOH A . 
M 5 HOH 8  135 135 HOH HOH A . 
M 5 HOH 9  136 18  HOH HOH A . 
M 5 HOH 10 137 137 HOH HOH A . 
M 5 HOH 11 138 138 HOH HOH A . 
M 5 HOH 12 139 21  HOH HOH A . 
M 5 HOH 13 140 23  HOH HOH A . 
M 5 HOH 14 141 24  HOH HOH A . 
M 5 HOH 15 142 27  HOH HOH A . 
M 5 HOH 16 143 28  HOH HOH A . 
M 5 HOH 17 144 144 HOH HOH A . 
M 5 HOH 18 145 29  HOH HOH A . 
M 5 HOH 19 146 38  HOH HOH A . 
M 5 HOH 20 147 39  HOH HOH A . 
M 5 HOH 21 148 40  HOH HOH A . 
M 5 HOH 22 149 41  HOH HOH A . 
M 5 HOH 23 150 42  HOH HOH A . 
M 5 HOH 24 151 46  HOH HOH A . 
M 5 HOH 25 152 48  HOH HOH A . 
M 5 HOH 26 153 51  HOH HOH A . 
M 5 HOH 27 154 52  HOH HOH A . 
M 5 HOH 28 155 53  HOH HOH A . 
M 5 HOH 29 156 54  HOH HOH A . 
M 5 HOH 30 157 56  HOH HOH A . 
M 5 HOH 31 158 92  HOH HOH A . 
M 5 HOH 32 159 93  HOH HOH A . 
M 5 HOH 33 160 94  HOH HOH A . 
M 5 HOH 34 161 95  HOH HOH A . 
M 5 HOH 35 162 96  HOH HOH A . 
M 5 HOH 36 163 97  HOH HOH A . 
M 5 HOH 37 164 98  HOH HOH A . 
M 5 HOH 38 165 99  HOH HOH A . 
M 5 HOH 39 166 100 HOH HOH A . 
M 5 HOH 40 167 101 HOH HOH A . 
M 5 HOH 41 168 102 HOH HOH A . 
M 5 HOH 42 169 103 HOH HOH A . 
M 5 HOH 43 170 104 HOH HOH A . 
M 5 HOH 44 171 105 HOH HOH A . 
M 5 HOH 45 172 106 HOH HOH A . 
M 5 HOH 46 173 109 HOH HOH A . 
M 5 HOH 47 174 110 HOH HOH A . 
M 5 HOH 48 175 113 HOH HOH A . 
M 5 HOH 49 176 114 HOH HOH A . 
M 5 HOH 50 177 115 HOH HOH A . 
M 5 HOH 51 178 116 HOH HOH A . 
M 5 HOH 52 179 117 HOH HOH A . 
M 5 HOH 53 182 120 HOH HOH A . 
N 5 HOH 1  130 130 HOH HOH B . 
N 5 HOH 2  131 131 HOH HOH B . 
N 5 HOH 3  132 132 HOH HOH B . 
N 5 HOH 4  133 133 HOH HOH B . 
N 5 HOH 5  134 134 HOH HOH B . 
N 5 HOH 6  135 1   HOH HOH B . 
N 5 HOH 7  136 136 HOH HOH B . 
N 5 HOH 8  137 2   HOH HOH B . 
N 5 HOH 9  138 4   HOH HOH B . 
N 5 HOH 10 139 139 HOH HOH B . 
N 5 HOH 11 140 140 HOH HOH B . 
N 5 HOH 12 141 141 HOH HOH B . 
N 5 HOH 13 142 142 HOH HOH B . 
N 5 HOH 14 143 143 HOH HOH B . 
N 5 HOH 15 144 5   HOH HOH B . 
N 5 HOH 16 145 145 HOH HOH B . 
N 5 HOH 17 146 146 HOH HOH B . 
N 5 HOH 18 147 9   HOH HOH B . 
N 5 HOH 19 148 13  HOH HOH B . 
N 5 HOH 20 149 15  HOH HOH B . 
N 5 HOH 21 150 16  HOH HOH B . 
N 5 HOH 22 151 19  HOH HOH B . 
N 5 HOH 23 152 20  HOH HOH B . 
N 5 HOH 24 153 22  HOH HOH B . 
N 5 HOH 25 154 26  HOH HOH B . 
N 5 HOH 26 155 34  HOH HOH B . 
N 5 HOH 27 156 35  HOH HOH B . 
N 5 HOH 28 157 37  HOH HOH B . 
N 5 HOH 29 158 43  HOH HOH B . 
N 5 HOH 30 159 44  HOH HOH B . 
N 5 HOH 31 160 45  HOH HOH B . 
N 5 HOH 32 161 49  HOH HOH B . 
N 5 HOH 33 162 55  HOH HOH B . 
N 5 HOH 34 163 57  HOH HOH B . 
N 5 HOH 35 164 59  HOH HOH B . 
N 5 HOH 36 165 60  HOH HOH B . 
N 5 HOH 37 166 61  HOH HOH B . 
N 5 HOH 38 167 70  HOH HOH B . 
N 5 HOH 39 168 111 HOH HOH B . 
N 5 HOH 40 169 112 HOH HOH B . 
N 5 HOH 41 170 121 HOH HOH B . 
N 5 HOH 42 171 122 HOH HOH B . 
N 5 HOH 43 172 123 HOH HOH B . 
N 5 HOH 44 173 124 HOH HOH B . 
N 5 HOH 45 174 125 HOH HOH B . 
N 5 HOH 46 175 126 HOH HOH B . 
N 5 HOH 47 176 127 HOH HOH B . 
N 5 HOH 48 177 128 HOH HOH B . 
N 5 HOH 49 178 129 HOH HOH B . 
N 5 HOH 50 180 118 HOH HOH B . 
N 5 HOH 51 181 119 HOH HOH B . 
O 5 HOH 1  107 107 HOH HOH C . 
O 5 HOH 2  108 108 HOH HOH C . 
#