data_3GK1
# 
_entry.id   3GK1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GK1         
RCSB  RCSB051957   
WWPDB D_1000051957 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MHO 'THE 2.0 A STRUCTURE OF HOLO S100B FROM BOVINE BRAIN'                                                           
unspecified 
PDB 3CR2 'X-ray structure of bovine Zn(2+),Ca(2+)-S100B'                                                                 
unspecified 
PDB 3CR4 'X-ray structure of bovine Pnt,Ca(2+)-S100B'                                                                    
unspecified 
PDB 3CR5 'X-ray structure of bovine Pnt-Zn(2+),Ca(2+)-S100B'                                                             
unspecified 
PDB 1DT7 'SOLUTION STRUCTURE OF THE C-TERMINAL NEGATIVE REGULATORY DOMAIN OF P53 IN A COMPLEX WITH CA2+-BOUND S100B(BB)' 
unspecified 
PDB 3GK2 .                                                                                                               
unspecified 
PDB 3GK4 .                                                                                                               
unspecified 
# 
_pdbx_database_status.entry_id                        3GK1 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-09 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Charpentier, T.H.' 1 ? 
'Weber, D.J.'       2 ? 
'Toth, E.A.'        3 ? 
# 
_citation.id                        primary 
_citation.title                     
;Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            48 
_citation.page_first                6202 
_citation.page_last                 6212 
_citation.year                      2009 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19469484 
_citation.pdbx_database_id_DOI      10.1021/bi9005754 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charpentier, T.H.' 1  
primary 'Wilder, P.T.'      2  
primary 'Liriano, M.A.'     3  
primary 'Varney, K.M.'      4  
primary 'Zhong, S.'         5  
primary 'Coop, A.'          6  
primary 'Pozharski, E.'     7  
primary 'MacKerell, A.D.'   8  
primary 'Toth, E.A.'        9  
primary 'Weber, D.J.'       10 
# 
_cell.length_a           34.666 
_cell.length_b           90.778 
_cell.length_c           58.994 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3GK1 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         3GK1 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B'                                                          10681.974 1  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                                                             40.078    2  ? ? ? ? 
3 non-polymer syn '2-[(5-hex-1-yn-1-ylfuran-2-yl)carbonyl]-N-methylhydrazinecarbothioamide' 279.358   1  ? ? ? ? 
4 non-polymer syn 'CACODYLATE ION'                                                          136.989   1  ? ? ? ? 
5 water       nat water                                                                     18.015    37 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  VAL n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 SER n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 ILE n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'bovine,cow,domestic cattle,domestic cow' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_BOVIN 
_struct_ref.pdbx_db_accession          P02638 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM
ITTACHEFFEHE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3GK1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02638 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  92 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
32A non-polymer         . '2-[(5-hex-1-yn-1-ylfuran-2-yl)carbonyl]-N-methylhydrazinecarbothioamide' ?                
'C13 H17 N3 O2 S' 279.358 
ALA 'L-peptide linking' y ALANINE                                                                   ?                'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                  ?                
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                ?                'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                           ?                'C4 H7 N O4' 
133.103 
CA  non-polymer         . 'CALCIUM ION'                                                             ?                'Ca 2' 40.078 
CAC non-polymer         . 'CACODYLATE ION'                                                          dimethylarsinate 
'C2 H6 As O2 -1'  136.989 
CYS 'L-peptide linking' y CYSTEINE                                                                  ?                
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                 ?                
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                           ?                'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                   ?                'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                 ?                
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                     ?                'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                ?                'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                   ?                'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                    ?                
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                ?                
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                             ?                'C9 H11 N O2' 
165.189 
SER 'L-peptide linking' y SERINE                                                                    ?                'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                 ?                'C4 H9 N O3' 
119.119 
TYR 'L-peptide linking' y TYROSINE                                                                  ?                'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                    ?                'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3GK1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   43.38 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.pdbx_details    
'28% PEG3350, 7.5mM CaCl2, 100mM Cacodylate buffer, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2007-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
# 
_reflns.entry_id                     3GK1 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             45.410 
_reflns.number_obs                   5585 
_reflns.pdbx_Rmerge_I_obs            0.042 
_reflns.pdbx_netI_over_sigmaI        37.481 
_reflns.pdbx_chi_squared             1.093 
_reflns.pdbx_redundancy              6.400 
_reflns.percent_possible_obs         97.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.10 2.18  ? ? ? 0.277 ? ? 0.984 3.80 ? 525 93.80  1  1 
2.18 2.26  ? ? ? 0.199 ? ? 0.908 5.30 ? 538 98.70  2  1 
2.26 2.37  ? ? ? 0.163 ? ? 0.999 6.30 ? 558 100.00 3  1 
2.37 2.49  ? ? ? 0.106 ? ? 1.026 6.80 ? 561 100.00 4  1 
2.49 2.65  ? ? ? 0.080 ? ? 1.010 7.10 ? 564 100.00 5  1 
2.65 2.85  ? ? ? 0.059 ? ? 1.235 7.10 ? 569 100.00 6  1 
2.85 3.14  ? ? ? 0.051 ? ? 1.263 7.10 ? 564 100.00 7  1 
3.14 3.59  ? ? ? 0.048 ? ? 1.094 7.00 ? 567 99.80  8  1 
3.59 4.52  ? ? ? 0.037 ? ? 1.222 6.70 ? 587 99.70  9  1 
4.52 45.00 ? ? ? 0.028 ? ? 1.044 6.20 ? 552 88.50  10 1 
# 
_refine.entry_id                                 3GK1 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             45.410 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.690 
_refine.ls_number_reflns_obs                     5572 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_wR_factor_R_work                      0.249 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_wR_factor_R_free                      0.290 
_refine.ls_percent_reflns_R_free                 4.500 
_refine.ls_number_reflns_R_free                  251 
_refine.ls_number_reflns_R_work                  5321 
_refine.B_iso_mean                               46.161 
_refine.aniso_B[1][1]                            0.250 
_refine.aniso_B[2][2]                            -0.420 
_refine.aniso_B[3][3]                            0.170 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.overall_SU_R_Cruickshank_DPI             0.295 
_refine.overall_SU_R_free                        0.231 
_refine.pdbx_overall_ESU_R                       0.261 
_refine.pdbx_overall_ESU_R_Free                  0.211 
_refine.overall_SU_ML                            0.170 
_refine.overall_SU_B                             14.437 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.overall_FOM_work_R_set                   0.797 
_refine.B_iso_max                                77.86 
_refine.B_iso_min                                35.78 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.30 
_refine.pdbx_starting_model                      'PDB ENTRY 1MHO' 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        710 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               773 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        45.410 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         744 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      994 1.828  1.982  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   87  5.209  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   39  37.588 26.410 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   140 15.668 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   1   19.951 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           107 0.122  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     553 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            292 0.216  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          510 0.299  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    32  0.181  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      7   0.186  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   45  0.309  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 8   0.172  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              451 0.762  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             698 1.090  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              322 2.377  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             296 3.729  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.102 
_refine_ls_shell.d_res_low                        2.157 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               88.810 
_refine_ls_shell.number_reflns_R_work             358 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             15 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                373 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3GK1 
_struct.title                     'X-ray structure of bovine SBi132,Ca(2+)-S100B' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GK1 
_struct_keywords.text            'EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER A 1  GLY A 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 
HELX_P HELX_P4 4 ASP A 70 ? PHE A 89 ? ASP A 69 PHE A 88 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 19 O   ? ? ? 1_555 B CA  . CA ? ? A SER 18 A CA  92  1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc2  metalc ? ? A GLU 22 O   ? ? ? 1_555 B CA  . CA ? ? A GLU 21 A CA  92  1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc3  metalc ? ? A ASP 24 O   ? ? ? 1_555 B CA  . CA ? ? A ASP 23 A CA  92  1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc4  metalc ? ? A LYS 27 O   ? ? ? 1_555 B CA  . CA ? ? A LYS 26 A CA  92  1_555 ? ? ? ? ? ? ? 2.517 ? 
metalc5  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc6  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc7  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 61 A CA  93  1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc8  metalc ? ? A ASP 64 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 63 A CA  93  1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc9  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 65 A CA  93  1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc10 metalc ? ? A GLU 68 O   ? ? ? 1_555 C CA  . CA ? ? A GLU 67 A CA  93  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc13 metalc ? ? B CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? A CA  92 A HOH 125 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc14 metalc ? ? C CA  .  CA  ? ? ? 1_555 F HOH . O  ? ? A CA  93 A HOH 117 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 92'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 93'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE 32A A 94' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CAC A 95' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 19 ? SER A 18  . ? 1_555 ? 
2  AC1 6 GLU A 22 ? GLU A 21  . ? 1_555 ? 
3  AC1 6 ASP A 24 ? ASP A 23  . ? 1_555 ? 
4  AC1 6 LYS A 27 ? LYS A 26  . ? 1_555 ? 
5  AC1 6 GLU A 32 ? GLU A 31  . ? 1_555 ? 
6  AC1 6 HOH F .  ? HOH A 125 . ? 1_555 ? 
7  AC2 6 ASP A 62 ? ASP A 61  . ? 1_555 ? 
8  AC2 6 ASP A 64 ? ASP A 63  . ? 1_555 ? 
9  AC2 6 ASP A 66 ? ASP A 65  . ? 1_555 ? 
10 AC2 6 GLU A 68 ? GLU A 67  . ? 1_555 ? 
11 AC2 6 GLU A 73 ? GLU A 72  . ? 1_555 ? 
12 AC2 6 HOH F .  ? HOH A 117 . ? 1_555 ? 
13 AC3 3 ILE A 81 ? ILE A 80  . ? 1_555 ? 
14 AC3 3 ALA A 84 ? ALA A 83  . ? 1_555 ? 
15 AC3 3 PHE A 88 ? PHE A 87  . ? 1_555 ? 
16 AC4 5 ARG A 21 ? ARG A 20  . ? 3_554 ? 
17 AC4 5 LYS A 25 ? LYS A 24  . ? 3_554 ? 
18 AC4 5 GLU A 52 ? GLU A 51  . ? 8_455 ? 
19 AC4 5 GLU A 52 ? GLU A 51  . ? 6_554 ? 
20 AC4 5 HOH F .  ? HOH A 127 . ? 6_554 ? 
# 
_atom_sites.entry_id                    3GK1 
_atom_sites.fract_transf_matrix[1][1]   0.028847 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011016 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016951 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . SER A 1 2  ? -5.419 -8.386 -4.428  1.00 43.23 ? 1   SER A N   1 
ATOM   2   C  CA  . SER A 1 2  ? -5.203 -8.520 -2.959  1.00 42.40 ? 1   SER A CA  1 
ATOM   3   C  C   . SER A 1 2  ? -4.890 -7.165 -2.390  1.00 42.54 ? 1   SER A C   1 
ATOM   4   O  O   . SER A 1 2  ? -4.631 -6.228 -3.124  1.00 42.57 ? 1   SER A O   1 
ATOM   5   C  CB  . SER A 1 2  ? -4.031 -9.452 -2.671  1.00 42.27 ? 1   SER A CB  1 
ATOM   6   O  OG  . SER A 1 2  ? -2.780 -8.813 -2.953  1.00 41.67 ? 1   SER A OG  1 
ATOM   7   N  N   . GLU A 1 3  ? -4.895 -7.070 -1.070  1.00 42.97 ? 2   GLU A N   1 
ATOM   8   C  CA  . GLU A 1 3  ? -4.488 -5.848 -0.392  1.00 43.38 ? 2   GLU A CA  1 
ATOM   9   C  C   . GLU A 1 3  ? -3.035 -5.450 -0.637  1.00 42.89 ? 2   GLU A C   1 
ATOM   10  O  O   . GLU A 1 3  ? -2.733 -4.265 -0.650  1.00 43.21 ? 2   GLU A O   1 
ATOM   11  C  CB  . GLU A 1 3  ? -4.733 -6.006 1.099   1.00 44.25 ? 2   GLU A CB  1 
ATOM   12  C  CG  . GLU A 1 3  ? -6.216 -6.041 1.454   1.00 48.45 ? 2   GLU A CG  1 
ATOM   13  C  CD  . GLU A 1 3  ? -6.756 -4.653 1.669   1.00 54.04 ? 2   GLU A CD  1 
ATOM   14  O  OE1 . GLU A 1 3  ? -6.193 -3.937 2.528   1.00 57.23 ? 2   GLU A OE1 1 
ATOM   15  O  OE2 . GLU A 1 3  ? -7.727 -4.265 0.986   1.00 58.12 ? 2   GLU A OE2 1 
ATOM   16  N  N   . LEU A 1 4  ? -2.128 -6.417 -0.809  1.00 41.12 ? 3   LEU A N   1 
ATOM   17  C  CA  . LEU A 1 4  ? -0.744 -6.096 -1.118  1.00 40.22 ? 3   LEU A CA  1 
ATOM   18  C  C   . LEU A 1 4  ? -0.609 -5.452 -2.521  1.00 40.27 ? 3   LEU A C   1 
ATOM   19  O  O   . LEU A 1 4  ? 0.075  -4.422 -2.695  1.00 40.32 ? 3   LEU A O   1 
ATOM   20  C  CB  . LEU A 1 4  ? 0.144  -7.349 -1.031  1.00 39.50 ? 3   LEU A CB  1 
ATOM   21  C  CG  . LEU A 1 4  ? 1.625  -7.345 -0.575  1.00 39.89 ? 3   LEU A CG  1 
ATOM   22  C  CD1 . LEU A 1 4  ? 2.375  -8.576 -1.032  1.00 35.78 ? 3   LEU A CD1 1 
ATOM   23  C  CD2 . LEU A 1 4  ? 2.465  -6.101 -0.837  1.00 40.22 ? 3   LEU A CD2 1 
ATOM   24  N  N   . GLU A 1 5  ? -1.232 -6.060 -3.527  1.00 40.13 ? 4   GLU A N   1 
ATOM   25  C  CA  . GLU A 1 5  ? -1.242 -5.488 -4.885  1.00 40.46 ? 4   GLU A CA  1 
ATOM   26  C  C   . GLU A 1 5  ? -1.853 -4.097 -4.876  1.00 41.10 ? 4   GLU A C   1 
ATOM   27  O  O   . GLU A 1 5  ? -1.367 -3.199 -5.560  1.00 40.45 ? 4   GLU A O   1 
ATOM   28  C  CB  . GLU A 1 5  ? -1.938 -6.430 -5.896  1.00 39.90 ? 4   GLU A CB  1 
ATOM   29  C  CG  . GLU A 1 5  ? -1.072 -7.686 -6.171  1.00 39.21 ? 4   GLU A CG  1 
ATOM   30  C  CD  . GLU A 1 5  ? -1.790 -8.919 -6.770  1.00 39.90 ? 4   GLU A CD  1 
ATOM   31  O  OE1 . GLU A 1 5  ? -2.997 -9.157 -6.567  1.00 40.12 ? 4   GLU A OE1 1 
ATOM   32  O  OE2 . GLU A 1 5  ? -1.100 -9.690 -7.447  1.00 38.43 ? 4   GLU A OE2 1 
ATOM   33  N  N   . LYS A 1 6  ? -2.893 -3.912 -4.069  1.00 41.77 ? 5   LYS A N   1 
ATOM   34  C  CA  . LYS A 1 6  ? -3.481 -2.584 -3.876  1.00 43.50 ? 5   LYS A CA  1 
ATOM   35  C  C   . LYS A 1 6  ? -2.500 -1.535 -3.369  1.00 43.57 ? 5   LYS A C   1 
ATOM   36  O  O   . LYS A 1 6  ? -2.468 -0.410 -3.880  1.00 44.51 ? 5   LYS A O   1 
ATOM   37  C  CB  . LYS A 1 6  ? -4.720 -2.661 -2.980  1.00 43.48 ? 5   LYS A CB  1 
ATOM   38  C  CG  . LYS A 1 6  ? -5.961 -2.921 -3.826  1.00 46.59 ? 5   LYS A CG  1 
ATOM   39  C  CD  . LYS A 1 6  ? -6.970 -3.811 -3.138  1.00 50.70 ? 5   LYS A CD  1 
ATOM   40  C  CE  . LYS A 1 6  ? -7.869 -3.049 -2.165  1.00 52.03 ? 5   LYS A CE  1 
ATOM   41  N  NZ  . LYS A 1 6  ? -8.810 -3.997 -1.469  1.00 53.13 ? 5   LYS A NZ  1 
ATOM   42  N  N   . ALA A 1 7  ? -1.707 -1.915 -2.371  1.00 44.04 ? 6   ALA A N   1 
ATOM   43  C  CA  . ALA A 1 7  ? -0.650 -1.075 -1.797  1.00 43.19 ? 6   ALA A CA  1 
ATOM   44  C  C   . ALA A 1 7  ? 0.431  -0.751 -2.821  1.00 43.29 ? 6   ALA A C   1 
ATOM   45  O  O   . ALA A 1 7  ? 0.858  0.386  -2.913  1.00 43.27 ? 6   ALA A O   1 
ATOM   46  C  CB  . ALA A 1 7  ? -0.018 -1.768 -0.585  1.00 43.11 ? 6   ALA A CB  1 
ATOM   47  N  N   . VAL A 1 8  ? 0.894  -1.753 -3.571  1.00 43.28 ? 7   VAL A N   1 
ATOM   48  C  CA  . VAL A 1 8  ? 1.854  -1.487 -4.668  1.00 43.29 ? 7   VAL A CA  1 
ATOM   49  C  C   . VAL A 1 8  ? 1.340  -0.416 -5.646  1.00 43.42 ? 7   VAL A C   1 
ATOM   50  O  O   . VAL A 1 8  ? 2.088  0.491  -5.991  1.00 43.64 ? 7   VAL A O   1 
ATOM   51  C  CB  . VAL A 1 8  ? 2.245  -2.728 -5.457  1.00 42.35 ? 7   VAL A CB  1 
ATOM   52  C  CG1 . VAL A 1 8  ? 3.073  -2.327 -6.676  1.00 42.58 ? 7   VAL A CG1 1 
ATOM   53  C  CG2 . VAL A 1 8  ? 3.014  -3.691 -4.584  1.00 42.66 ? 7   VAL A CG2 1 
ATOM   54  N  N   . VAL A 1 9  ? 0.082  -0.508 -6.095  1.00 43.60 ? 8   VAL A N   1 
ATOM   55  C  CA  . VAL A 1 9  ? -0.385 0.470  -7.090  1.00 43.64 ? 8   VAL A CA  1 
ATOM   56  C  C   . VAL A 1 9  ? -0.686 1.816  -6.467  1.00 43.94 ? 8   VAL A C   1 
ATOM   57  O  O   . VAL A 1 9  ? -0.550 2.836  -7.144  1.00 44.10 ? 8   VAL A O   1 
ATOM   58  C  CB  . VAL A 1 9  ? -1.548 0.016  -8.053  1.00 44.23 ? 8   VAL A CB  1 
ATOM   59  C  CG1 . VAL A 1 9  ? -1.470 -1.478 -8.408  1.00 44.39 ? 8   VAL A CG1 1 
ATOM   60  C  CG2 . VAL A 1 9  ? -2.923 0.457  -7.550  1.00 44.16 ? 8   VAL A CG2 1 
ATOM   61  N  N   . ALA A 1 10 ? -1.053 1.831  -5.179  1.00 43.90 ? 9   ALA A N   1 
ATOM   62  C  CA  . ALA A 1 10 ? -1.159 3.095  -4.443  1.00 43.85 ? 9   ALA A CA  1 
ATOM   63  C  C   . ALA A 1 10 ? 0.191  3.851  -4.326  1.00 44.12 ? 9   ALA A C   1 
ATOM   64  O  O   . ALA A 1 10 ? 0.225  5.096  -4.468  1.00 44.17 ? 9   ALA A O   1 
ATOM   65  C  CB  . ALA A 1 10 ? -1.827 2.893  -3.066  1.00 43.52 ? 9   ALA A CB  1 
ATOM   66  N  N   . LEU A 1 11 ? 1.284  3.132  -4.074  1.00 42.98 ? 10  LEU A N   1 
ATOM   67  C  CA  . LEU A 1 11 ? 2.598  3.760  -4.011  1.00 43.59 ? 10  LEU A CA  1 
ATOM   68  C  C   . LEU A 1 11 ? 2.968  4.437  -5.339  1.00 44.03 ? 10  LEU A C   1 
ATOM   69  O  O   . LEU A 1 11 ? 3.400  5.605  -5.368  1.00 44.57 ? 10  LEU A O   1 
ATOM   70  C  CB  . LEU A 1 11 ? 3.678  2.723  -3.625  1.00 44.59 ? 10  LEU A CB  1 
ATOM   71  C  CG  . LEU A 1 11 ? 3.530  2.007  -2.269  1.00 44.73 ? 10  LEU A CG  1 
ATOM   72  C  CD1 . LEU A 1 11 ? 4.642  0.997  -2.124  1.00 45.19 ? 10  LEU A CD1 1 
ATOM   73  C  CD2 . LEU A 1 11 ? 3.503  2.991  -1.115  1.00 45.96 ? 10  LEU A CD2 1 
ATOM   74  N  N   . ILE A 1 12 ? 2.804  3.699  -6.439  1.00 43.89 ? 11  ILE A N   1 
ATOM   75  C  CA  . ILE A 1 12 ? 3.001  4.238  -7.786  1.00 43.76 ? 11  ILE A CA  1 
ATOM   76  C  C   . ILE A 1 12 ? 2.087  5.439  -8.006  1.00 44.29 ? 11  ILE A C   1 
ATOM   77  O  O   . ILE A 1 12 ? 2.550  6.518  -8.381  1.00 44.70 ? 11  ILE A O   1 
ATOM   78  C  CB  . ILE A 1 12 ? 2.811  3.138  -8.876  1.00 43.82 ? 11  ILE A CB  1 
ATOM   79  C  CG1 . ILE A 1 12 ? 3.746  1.950  -8.583  1.00 43.22 ? 11  ILE A CG1 1 
ATOM   80  C  CG2 . ILE A 1 12 ? 3.048  3.699  -10.292 1.00 44.01 ? 11  ILE A CG2 1 
ATOM   81  C  CD1 . ILE A 1 12 ? 3.685  0.784  -9.563  1.00 43.24 ? 11  ILE A CD1 1 
ATOM   82  N  N   . ASP A 1 13 ? 0.804  5.291  -7.706  1.00 44.89 ? 12  ASP A N   1 
ATOM   83  C  CA  . ASP A 1 13 ? -0.115 6.355  -8.058  1.00 46.48 ? 12  ASP A CA  1 
ATOM   84  C  C   . ASP A 1 13 ? 0.165  7.661  -7.309  1.00 46.04 ? 12  ASP A C   1 
ATOM   85  O  O   . ASP A 1 13 ? 0.162  8.728  -7.929  1.00 46.09 ? 12  ASP A O   1 
ATOM   86  C  CB  . ASP A 1 13 ? -1.574 5.930  -7.928  1.00 47.08 ? 12  ASP A CB  1 
ATOM   87  C  CG  . ASP A 1 13 ? -2.535 7.001  -8.442  1.00 52.17 ? 12  ASP A CG  1 
ATOM   88  O  OD1 . ASP A 1 13 ? -2.619 7.231  -9.676  1.00 55.87 ? 12  ASP A OD1 1 
ATOM   89  O  OD2 . ASP A 1 13 ? -3.207 7.639  -7.599  1.00 57.88 ? 12  ASP A OD2 1 
ATOM   90  N  N   . VAL A 1 14 ? 0.434  7.585  -6.005  1.00 45.87 ? 13  VAL A N   1 
ATOM   91  C  CA  . VAL A 1 14 ? 0.637  8.808  -5.215  1.00 45.48 ? 13  VAL A CA  1 
ATOM   92  C  C   . VAL A 1 14 ? 1.902  9.566  -5.643  1.00 45.51 ? 13  VAL A C   1 
ATOM   93  O  O   . VAL A 1 14 ? 1.873  10.788 -5.747  1.00 45.49 ? 13  VAL A O   1 
ATOM   94  C  CB  . VAL A 1 14 ? 0.545  8.593  -3.675  1.00 44.99 ? 13  VAL A CB  1 
ATOM   95  C  CG1 . VAL A 1 14 ? 1.754  7.795  -3.127  1.00 45.83 ? 13  VAL A CG1 1 
ATOM   96  C  CG2 . VAL A 1 14 ? 0.450  9.925  -2.959  1.00 44.37 ? 13  VAL A CG2 1 
ATOM   97  N  N   . PHE A 1 15 ? 2.996  8.843  -5.883  1.00 45.19 ? 14  PHE A N   1 
ATOM   98  C  CA  . PHE A 1 15 ? 4.234  9.468  -6.376  1.00 45.08 ? 14  PHE A CA  1 
ATOM   99  C  C   . PHE A 1 15 ? 3.937  10.240 -7.650  1.00 45.64 ? 14  PHE A C   1 
ATOM   100 O  O   . PHE A 1 15 ? 4.468  11.341 -7.883  1.00 46.06 ? 14  PHE A O   1 
ATOM   101 C  CB  . PHE A 1 15 ? 5.326  8.420  -6.678  1.00 43.41 ? 14  PHE A CB  1 
ATOM   102 C  CG  . PHE A 1 15 ? 6.613  9.017  -7.212  1.00 42.10 ? 14  PHE A CG  1 
ATOM   103 C  CD1 . PHE A 1 15 ? 7.524  9.636  -6.346  1.00 39.29 ? 14  PHE A CD1 1 
ATOM   104 C  CD2 . PHE A 1 15 ? 6.908  8.959  -8.573  1.00 41.04 ? 14  PHE A CD2 1 
ATOM   105 C  CE1 . PHE A 1 15 ? 8.693  10.208 -6.824  1.00 40.98 ? 14  PHE A CE1 1 
ATOM   106 C  CE2 . PHE A 1 15 ? 8.086  9.528  -9.082  1.00 41.00 ? 14  PHE A CE2 1 
ATOM   107 C  CZ  . PHE A 1 15 ? 8.981  10.157 -8.199  1.00 41.15 ? 14  PHE A CZ  1 
ATOM   108 N  N   . HIS A 1 16 ? 3.102  9.652  -8.493  1.00 45.77 ? 15  HIS A N   1 
ATOM   109 C  CA  . HIS A 1 16 ? 2.857  10.267 -9.762  1.00 46.61 ? 15  HIS A CA  1 
ATOM   110 C  C   . HIS A 1 16 ? 1.926  11.455 -9.751  1.00 46.44 ? 15  HIS A C   1 
ATOM   111 O  O   . HIS A 1 16 ? 2.140  12.420 -10.483 1.00 46.15 ? 15  HIS A O   1 
ATOM   112 C  CB  . HIS A 1 16 ? 2.539  9.245  -10.829 1.00 47.20 ? 15  HIS A CB  1 
ATOM   113 C  CG  . HIS A 1 16 ? 3.774  8.766  -11.499 1.00 50.19 ? 15  HIS A CG  1 
ATOM   114 N  ND1 . HIS A 1 16 ? 4.316  7.520  -11.265 1.00 54.30 ? 15  HIS A ND1 1 
ATOM   115 C  CD2 . HIS A 1 16 ? 4.652  9.423  -12.294 1.00 51.44 ? 15  HIS A CD2 1 
ATOM   116 C  CE1 . HIS A 1 16 ? 5.436  7.406  -11.956 1.00 55.36 ? 15  HIS A CE1 1 
ATOM   117 N  NE2 . HIS A 1 16 ? 5.670  8.550  -12.577 1.00 52.73 ? 15  HIS A NE2 1 
ATOM   118 N  N   . GLN A 1 17 ? 0.946  11.443 -8.867  1.00 46.49 ? 16  GLN A N   1 
ATOM   119 C  CA  . GLN A 1 17 ? 0.122  12.611 -8.793  1.00 46.66 ? 16  GLN A CA  1 
ATOM   120 C  C   . GLN A 1 17 ? 0.932  13.801 -8.300  1.00 46.09 ? 16  GLN A C   1 
ATOM   121 O  O   . GLN A 1 17 ? 0.721  14.920 -8.747  1.00 46.52 ? 16  GLN A O   1 
ATOM   122 C  CB  . GLN A 1 17 ? -1.166 12.371 -8.013  1.00 47.11 ? 16  GLN A CB  1 
ATOM   123 C  CG  . GLN A 1 17 ? -1.041 11.990 -6.590  1.00 50.94 ? 16  GLN A CG  1 
ATOM   124 C  CD  . GLN A 1 17 ? -2.296 11.266 -6.112  1.00 57.06 ? 16  GLN A CD  1 
ATOM   125 O  OE1 . GLN A 1 17 ? -3.025 10.663 -6.921  1.00 61.32 ? 16  GLN A OE1 1 
ATOM   126 N  NE2 . GLN A 1 17 ? -2.556 11.315 -4.805  1.00 56.87 ? 16  GLN A NE2 1 
ATOM   127 N  N   . TYR A 1 18 ? 1.898  13.554 -7.429  1.00 45.01 ? 17  TYR A N   1 
ATOM   128 C  CA  . TYR A 1 18 ? 2.695  14.644 -6.898  1.00 43.51 ? 17  TYR A CA  1 
ATOM   129 C  C   . TYR A 1 18 ? 3.876  15.033 -7.803  1.00 43.31 ? 17  TYR A C   1 
ATOM   130 O  O   . TYR A 1 18 ? 4.106  16.219 -8.008  1.00 43.22 ? 17  TYR A O   1 
ATOM   131 C  CB  . TYR A 1 18 ? 3.096  14.352 -5.437  1.00 43.26 ? 17  TYR A CB  1 
ATOM   132 C  CG  . TYR A 1 18 ? 1.920  14.586 -4.502  1.00 41.43 ? 17  TYR A CG  1 
ATOM   133 C  CD1 . TYR A 1 18 ? 1.027  13.577 -4.206  1.00 41.45 ? 17  TYR A CD1 1 
ATOM   134 C  CD2 . TYR A 1 18 ? 1.674  15.822 -3.991  1.00 40.43 ? 17  TYR A CD2 1 
ATOM   135 C  CE1 . TYR A 1 18 ? -0.085 13.802 -3.404  1.00 42.32 ? 17  TYR A CE1 1 
ATOM   136 C  CE2 . TYR A 1 18 ? 0.572  16.058 -3.188  1.00 42.95 ? 17  TYR A CE2 1 
ATOM   137 C  CZ  . TYR A 1 18 ? -0.293 15.043 -2.894  1.00 41.74 ? 17  TYR A CZ  1 
ATOM   138 O  OH  . TYR A 1 18 ? -1.375 15.314 -2.094  1.00 43.39 ? 17  TYR A OH  1 
ATOM   139 N  N   . SER A 1 19 ? 4.596  14.059 -8.358  1.00 42.81 ? 18  SER A N   1 
ATOM   140 C  CA  . SER A 1 19 ? 5.823  14.338 -9.140  1.00 42.75 ? 18  SER A CA  1 
ATOM   141 C  C   . SER A 1 19 ? 5.552  15.074 -10.440 1.00 42.92 ? 18  SER A C   1 
ATOM   142 O  O   . SER A 1 19 ? 6.346  15.953 -10.865 1.00 43.39 ? 18  SER A O   1 
ATOM   143 C  CB  . SER A 1 19 ? 6.615  13.062 -9.422  1.00 41.81 ? 18  SER A CB  1 
ATOM   144 O  OG  . SER A 1 19 ? 5.929  12.237 -10.326 1.00 44.17 ? 18  SER A OG  1 
ATOM   145 N  N   . GLY A 1 20 ? 4.428  14.739 -11.061 1.00 42.46 ? 19  GLY A N   1 
ATOM   146 C  CA  . GLY A 1 20 ? 4.056  15.341 -12.335 1.00 43.22 ? 19  GLY A CA  1 
ATOM   147 C  C   . GLY A 1 20 ? 3.524  16.768 -12.314 1.00 43.70 ? 19  GLY A C   1 
ATOM   148 O  O   . GLY A 1 20 ? 3.238  17.338 -13.375 1.00 43.73 ? 19  GLY A O   1 
ATOM   149 N  N   . ARG A 1 21 ? 3.388  17.355 -11.124 1.00 43.20 ? 20  ARG A N   1 
ATOM   150 C  CA  . ARG A 1 21 ? 2.858  18.713 -11.018 1.00 43.73 ? 20  ARG A CA  1 
ATOM   151 C  C   . ARG A 1 21 ? 3.703  19.765 -11.750 1.00 43.89 ? 20  ARG A C   1 
ATOM   152 O  O   . ARG A 1 21 ? 3.169  20.575 -12.485 1.00 44.10 ? 20  ARG A O   1 
ATOM   153 C  CB  . ARG A 1 21 ? 2.664  19.115 -9.542  1.00 43.51 ? 20  ARG A CB  1 
ATOM   154 C  CG  . ARG A 1 21 ? 1.531  18.359 -8.814  1.00 42.93 ? 20  ARG A CG  1 
ATOM   155 C  CD  . ARG A 1 21 ? 1.534  18.696 -7.307  1.00 43.65 ? 20  ARG A CD  1 
ATOM   156 N  NE  . ARG A 1 21 ? 0.331  18.186 -6.657  1.00 45.06 ? 20  ARG A NE  1 
ATOM   157 C  CZ  . ARG A 1 21 ? -0.151 18.614 -5.492  1.00 46.16 ? 20  ARG A CZ  1 
ATOM   158 N  NH1 . ARG A 1 21 ? 0.465  19.574 -4.798  1.00 44.48 ? 20  ARG A NH1 1 
ATOM   159 N  NH2 . ARG A 1 21 ? -1.271 18.075 -5.029  1.00 45.76 ? 20  ARG A NH2 1 
ATOM   160 N  N   . GLU A 1 22 ? 5.010  19.775 -11.514 1.00 44.66 ? 21  GLU A N   1 
ATOM   161 C  CA  . GLU A 1 22 ? 5.900  20.818 -12.056 1.00 46.09 ? 21  GLU A CA  1 
ATOM   162 C  C   . GLU A 1 22 ? 7.267  20.242 -12.402 1.00 45.86 ? 21  GLU A C   1 
ATOM   163 O  O   . GLU A 1 22 ? 7.701  19.240 -11.802 1.00 46.74 ? 21  GLU A O   1 
ATOM   164 C  CB  . GLU A 1 22 ? 6.104  21.996 -11.075 1.00 46.17 ? 21  GLU A CB  1 
ATOM   165 C  CG  . GLU A 1 22 ? 4.902  22.381 -10.182 1.00 48.73 ? 21  GLU A CG  1 
ATOM   166 C  CD  . GLU A 1 22 ? 5.130  23.654 -9.374  1.00 48.56 ? 21  GLU A CD  1 
ATOM   167 O  OE1 . GLU A 1 22 ? 6.074  23.701 -8.546  1.00 53.36 ? 21  GLU A OE1 1 
ATOM   168 O  OE2 . GLU A 1 22 ? 4.346  24.608 -9.558  1.00 51.72 ? 21  GLU A OE2 1 
ATOM   169 N  N   . GLY A 1 23 ? 7.949  20.895 -13.345 1.00 45.80 ? 22  GLY A N   1 
ATOM   170 C  CA  . GLY A 1 23 ? 9.262  20.459 -13.806 1.00 45.02 ? 22  GLY A CA  1 
ATOM   171 C  C   . GLY A 1 23 ? 9.273  19.028 -14.318 1.00 44.80 ? 22  GLY A C   1 
ATOM   172 O  O   . GLY A 1 23 ? 8.361  18.612 -15.049 1.00 44.55 ? 22  GLY A O   1 
ATOM   173 N  N   . ASP A 1 24 ? 10.311 18.288 -13.918 1.00 44.39 ? 23  ASP A N   1 
ATOM   174 C  CA  . ASP A 1 24 ? 10.458 16.867 -14.205 1.00 44.16 ? 23  ASP A CA  1 
ATOM   175 C  C   . ASP A 1 24 ? 9.269  16.069 -13.679 1.00 44.49 ? 23  ASP A C   1 
ATOM   176 O  O   . ASP A 1 24 ? 9.032  15.997 -12.460 1.00 44.87 ? 23  ASP A O   1 
ATOM   177 C  CB  . ASP A 1 24 ? 11.764 16.337 -13.605 1.00 43.97 ? 23  ASP A CB  1 
ATOM   178 C  CG  . ASP A 1 24 ? 12.099 14.947 -14.076 1.00 44.53 ? 23  ASP A CG  1 
ATOM   179 O  OD1 . ASP A 1 24 ? 11.180 14.119 -14.259 1.00 45.63 ? 23  ASP A OD1 1 
ATOM   180 O  OD2 . ASP A 1 24 ? 13.295 14.675 -14.278 1.00 47.01 ? 23  ASP A OD2 1 
ATOM   181 N  N   . LYS A 1 25 ? 8.528  15.467 -14.605 1.00 44.49 ? 24  LYS A N   1 
ATOM   182 C  CA  . LYS A 1 25 ? 7.298  14.773 -14.276 1.00 44.72 ? 24  LYS A CA  1 
ATOM   183 C  C   . LYS A 1 25 ? 7.579  13.460 -13.602 1.00 44.97 ? 24  LYS A C   1 
ATOM   184 O  O   . LYS A 1 25 ? 6.658  12.780 -13.135 1.00 46.01 ? 24  LYS A O   1 
ATOM   185 C  CB  . LYS A 1 25 ? 6.439  14.561 -15.514 1.00 45.02 ? 24  LYS A CB  1 
ATOM   186 C  CG  . LYS A 1 25 ? 5.701  15.794 -15.911 1.00 46.19 ? 24  LYS A CG  1 
ATOM   187 C  CD  . LYS A 1 25 ? 4.655  15.507 -16.961 1.00 49.34 ? 24  LYS A CD  1 
ATOM   188 C  CE  . LYS A 1 25 ? 3.541  16.506 -16.802 1.00 51.40 ? 24  LYS A CE  1 
ATOM   189 N  NZ  . LYS A 1 25 ? 4.096  17.815 -16.338 1.00 52.68 ? 24  LYS A NZ  1 
ATOM   190 N  N   . HIS A 1 26 ? 8.856  13.109 -13.531 1.00 44.80 ? 25  HIS A N   1 
ATOM   191 C  CA  . HIS A 1 26 ? 9.255  11.875 -12.886 1.00 44.98 ? 25  HIS A CA  1 
ATOM   192 C  C   . HIS A 1 26 ? 9.965  12.091 -11.539 1.00 44.77 ? 25  HIS A C   1 
ATOM   193 O  O   . HIS A 1 26 ? 10.453 11.145 -10.928 1.00 45.48 ? 25  HIS A O   1 
ATOM   194 C  CB  . HIS A 1 26 ? 10.100 11.041 -13.852 1.00 45.57 ? 25  HIS A CB  1 
ATOM   195 C  CG  . HIS A 1 26 ? 9.406  10.748 -15.145 1.00 47.18 ? 25  HIS A CG  1 
ATOM   196 N  ND1 . HIS A 1 26 ? 8.529  9.693  -15.293 1.00 49.82 ? 25  HIS A ND1 1 
ATOM   197 C  CD2 . HIS A 1 26 ? 9.428  11.393 -16.338 1.00 47.53 ? 25  HIS A CD2 1 
ATOM   198 C  CE1 . HIS A 1 26 ? 8.056  9.692  -16.528 1.00 48.54 ? 25  HIS A CE1 1 
ATOM   199 N  NE2 . HIS A 1 26 ? 8.582  10.715 -17.180 1.00 49.01 ? 25  HIS A NE2 1 
ATOM   200 N  N   . LYS A 1 27 ? 10.022 13.327 -11.063 1.00 44.31 ? 26  LYS A N   1 
ATOM   201 C  CA  . LYS A 1 27 ? 10.726 13.595 -9.811  1.00 44.29 ? 26  LYS A CA  1 
ATOM   202 C  C   . LYS A 1 27 ? 9.947  14.581 -8.980  1.00 44.05 ? 26  LYS A C   1 
ATOM   203 O  O   . LYS A 1 27 ? 9.219  15.412 -9.524  1.00 44.57 ? 26  LYS A O   1 
ATOM   204 C  CB  . LYS A 1 27 ? 12.148 14.124 -10.072 1.00 44.46 ? 26  LYS A CB  1 
ATOM   205 C  CG  . LYS A 1 27 ? 13.078 13.087 -10.729 1.00 44.17 ? 26  LYS A CG  1 
ATOM   206 C  CD  . LYS A 1 27 ? 14.448 13.660 -10.991 1.00 45.15 ? 26  LYS A CD  1 
ATOM   207 C  CE  . LYS A 1 27 ? 15.152 12.920 -12.102 1.00 46.99 ? 26  LYS A CE  1 
ATOM   208 N  NZ  . LYS A 1 27 ? 16.394 13.655 -12.423 1.00 50.60 ? 26  LYS A NZ  1 
ATOM   209 N  N   . LEU A 1 28 ? 10.122 14.477 -7.663  1.00 43.50 ? 27  LEU A N   1 
ATOM   210 C  CA  . LEU A 1 28 ? 9.488  15.332 -6.706  1.00 43.62 ? 27  LEU A CA  1 
ATOM   211 C  C   . LEU A 1 28 ? 10.440 16.487 -6.361  1.00 43.79 ? 27  LEU A C   1 
ATOM   212 O  O   . LEU A 1 28 ? 11.505 16.237 -5.785  1.00 44.61 ? 27  LEU A O   1 
ATOM   213 C  CB  . LEU A 1 28 ? 9.178  14.525 -5.437  1.00 42.91 ? 27  LEU A CB  1 
ATOM   214 C  CG  . LEU A 1 28 ? 8.084  13.452 -5.483  1.00 42.93 ? 27  LEU A CG  1 
ATOM   215 C  CD1 . LEU A 1 28 ? 8.109  12.634 -4.222  1.00 43.97 ? 27  LEU A CD1 1 
ATOM   216 C  CD2 . LEU A 1 28 ? 6.735  14.065 -5.630  1.00 41.65 ? 27  LEU A CD2 1 
ATOM   217 N  N   . LYS A 1 29 ? 10.090 17.735 -6.700  1.00 43.43 ? 28  LYS A N   1 
ATOM   218 C  CA  . LYS A 1 29 ? 10.881 18.879 -6.216  1.00 44.03 ? 28  LYS A CA  1 
ATOM   219 C  C   . LYS A 1 29 ? 10.431 19.185 -4.798  1.00 44.02 ? 28  LYS A C   1 
ATOM   220 O  O   . LYS A 1 29 ? 9.505  18.549 -4.289  1.00 44.15 ? 28  LYS A O   1 
ATOM   221 C  CB  . LYS A 1 29 ? 10.763 20.115 -7.114  1.00 44.07 ? 28  LYS A CB  1 
ATOM   222 C  CG  . LYS A 1 29 ? 9.376  20.714 -7.275  1.00 43.91 ? 28  LYS A CG  1 
ATOM   223 C  CD  . LYS A 1 29 ? 9.460  22.178 -7.784  1.00 46.41 ? 28  LYS A CD  1 
ATOM   224 C  CE  . LYS A 1 29 ? 9.142  22.349 -9.268  1.00 49.08 ? 28  LYS A CE  1 
ATOM   225 N  NZ  . LYS A 1 29 ? 10.222 21.923 -10.229 1.00 53.27 ? 28  LYS A NZ  1 
ATOM   226 N  N   . LYS A 1 30 ? 11.072 20.137 -4.147  1.00 44.34 ? 29  LYS A N   1 
ATOM   227 C  CA  . LYS A 1 30 ? 10.793 20.385 -2.723  1.00 44.30 ? 29  LYS A CA  1 
ATOM   228 C  C   . LYS A 1 30 ? 9.317  20.692 -2.389  1.00 44.74 ? 29  LYS A C   1 
ATOM   229 O  O   . LYS A 1 30 ? 8.793  20.179 -1.386  1.00 45.27 ? 29  LYS A O   1 
ATOM   230 C  CB  . LYS A 1 30 ? 11.654 21.520 -2.212  1.00 44.12 ? 29  LYS A CB  1 
ATOM   231 C  CG  . LYS A 1 30 ? 13.070 21.197 -1.871  1.00 43.86 ? 29  LYS A CG  1 
ATOM   232 C  CD  . LYS A 1 30 ? 13.653 22.528 -1.442  1.00 46.49 ? 29  LYS A CD  1 
ATOM   233 C  CE  . LYS A 1 30 ? 15.142 22.547 -1.412  1.00 49.06 ? 29  LYS A CE  1 
ATOM   234 N  NZ  . LYS A 1 30 ? 15.585 23.982 -1.263  1.00 49.79 ? 29  LYS A NZ  1 
ATOM   235 N  N   . SER A 1 31 ? 8.667  21.536 -3.207  1.00 44.91 ? 30  SER A N   1 
ATOM   236 C  CA  . SER A 1 31 ? 7.267  21.926 -2.974  1.00 45.36 ? 30  SER A CA  1 
ATOM   237 C  C   . SER A 1 31 ? 6.259  20.764 -3.170  1.00 45.12 ? 30  SER A C   1 
ATOM   238 O  O   . SER A 1 31 ? 5.287  20.645 -2.429  1.00 45.61 ? 30  SER A O   1 
ATOM   239 C  CB  . SER A 1 31 ? 6.901  23.127 -3.827  1.00 45.39 ? 30  SER A CB  1 
ATOM   240 O  OG  . SER A 1 31 ? 6.760  22.723 -5.165  1.00 47.79 ? 30  SER A OG  1 
ATOM   241 N  N   . GLU A 1 32 ? 6.529  19.901 -4.142  1.00 44.54 ? 31  GLU A N   1 
ATOM   242 C  CA  . GLU A 1 32 ? 5.775  18.662 -4.359  1.00 43.73 ? 31  GLU A CA  1 
ATOM   243 C  C   . GLU A 1 32 ? 5.962  17.615 -3.241  1.00 44.10 ? 31  GLU A C   1 
ATOM   244 O  O   . GLU A 1 32 ? 4.980  17.024 -2.778  1.00 44.50 ? 31  GLU A O   1 
ATOM   245 C  CB  . GLU A 1 32 ? 6.173  18.043 -5.698  1.00 43.90 ? 31  GLU A CB  1 
ATOM   246 C  CG  . GLU A 1 32 ? 5.885  18.891 -6.909  1.00 41.02 ? 31  GLU A CG  1 
ATOM   247 C  CD  . GLU A 1 32 ? 6.558  18.339 -8.127  1.00 39.05 ? 31  GLU A CD  1 
ATOM   248 O  OE1 . GLU A 1 32 ? 7.593  17.649 -7.990  1.00 40.05 ? 31  GLU A OE1 1 
ATOM   249 O  OE2 . GLU A 1 32 ? 6.066  18.576 -9.236  1.00 39.61 ? 31  GLU A OE2 1 
ATOM   250 N  N   . LEU A 1 33 ? 7.208  17.374 -2.812  1.00 43.48 ? 32  LEU A N   1 
ATOM   251 C  CA  . LEU A 1 33 ? 7.466  16.564 -1.611  1.00 42.54 ? 32  LEU A CA  1 
ATOM   252 C  C   . LEU A 1 33 ? 6.701  17.119 -0.407  1.00 42.19 ? 32  LEU A C   1 
ATOM   253 O  O   . LEU A 1 33 ? 6.119  16.365 0.355   1.00 41.37 ? 32  LEU A O   1 
ATOM   254 C  CB  . LEU A 1 33 ? 8.945  16.582 -1.253  1.00 41.97 ? 32  LEU A CB  1 
ATOM   255 C  CG  . LEU A 1 33 ? 9.738  15.378 -0.727  1.00 44.49 ? 32  LEU A CG  1 
ATOM   256 C  CD1 . LEU A 1 33 ? 10.837 15.831 0.249   1.00 42.76 ? 32  LEU A CD1 1 
ATOM   257 C  CD2 . LEU A 1 33 ? 8.925  14.173 -0.184  1.00 40.18 ? 32  LEU A CD2 1 
ATOM   258 N  N   . LYS A 1 34 ? 6.739  18.429 -0.211  1.00 41.88 ? 33  LYS A N   1 
ATOM   259 C  CA  . LYS A 1 34 ? 6.104  19.026 0.970   1.00 42.68 ? 33  LYS A CA  1 
ATOM   260 C  C   . LYS A 1 34 ? 4.579  18.782 0.978   1.00 42.23 ? 33  LYS A C   1 
ATOM   261 O  O   . LYS A 1 34 ? 3.989  18.423 1.999   1.00 41.40 ? 33  LYS A O   1 
ATOM   262 C  CB  . LYS A 1 34 ? 6.437  20.512 1.042   1.00 42.86 ? 33  LYS A CB  1 
ATOM   263 C  CG  . LYS A 1 34 ? 5.658  21.271 2.106   1.00 45.86 ? 33  LYS A CG  1 
ATOM   264 C  CD  . LYS A 1 34 ? 5.536  22.735 1.717   1.00 50.31 ? 33  LYS A CD  1 
ATOM   265 C  CE  . LYS A 1 34 ? 4.490  23.462 2.552   1.00 54.54 ? 33  LYS A CE  1 
ATOM   266 N  NZ  . LYS A 1 34 ? 4.265  24.850 2.010   1.00 58.50 ? 33  LYS A NZ  1 
ATOM   267 N  N   . GLU A 1 35 ? 3.958  18.952 -0.184  1.00 42.30 ? 34  GLU A N   1 
ATOM   268 C  CA  . GLU A 1 35 ? 2.534  18.753 -0.322  1.00 41.86 ? 34  GLU A CA  1 
ATOM   269 C  C   . GLU A 1 35 ? 2.140  17.299 -0.125  1.00 41.78 ? 34  GLU A C   1 
ATOM   270 O  O   . GLU A 1 35 ? 1.128  17.034 0.513   1.00 41.28 ? 34  GLU A O   1 
ATOM   271 C  CB  . GLU A 1 35 ? 2.048  19.265 -1.677  1.00 42.21 ? 34  GLU A CB  1 
ATOM   272 C  CG  . GLU A 1 35 ? 2.277  20.786 -1.940  1.00 44.29 ? 34  GLU A CG  1 
ATOM   273 C  CD  . GLU A 1 35 ? 1.578  21.734 -0.949  1.00 48.35 ? 34  GLU A CD  1 
ATOM   274 O  OE1 . GLU A 1 35 ? 1.044  21.297 0.090   1.00 49.97 ? 34  GLU A OE1 1 
ATOM   275 O  OE2 . GLU A 1 35 ? 1.552  22.958 -1.211  1.00 50.77 ? 34  GLU A OE2 1 
ATOM   276 N  N   . LEU A 1 36 ? 2.935  16.361 -0.667  1.00 42.14 ? 35  LEU A N   1 
ATOM   277 C  CA  . LEU A 1 36 ? 2.710  14.918 -0.454  1.00 41.89 ? 35  LEU A CA  1 
ATOM   278 C  C   . LEU A 1 36 ? 2.688  14.605 1.037   1.00 43.23 ? 35  LEU A C   1 
ATOM   279 O  O   . LEU A 1 36 ? 1.728  14.012 1.513   1.00 44.42 ? 35  LEU A O   1 
ATOM   280 C  CB  . LEU A 1 36 ? 3.768  14.056 -1.162  1.00 41.09 ? 35  LEU A CB  1 
ATOM   281 C  CG  . LEU A 1 36 ? 3.519  12.551 -1.236  1.00 40.34 ? 35  LEU A CG  1 
ATOM   282 C  CD1 . LEU A 1 36 ? 4.040  11.968 -2.574  1.00 41.47 ? 35  LEU A CD1 1 
ATOM   283 C  CD2 . LEU A 1 36 ? 4.140  11.801 -0.065  1.00 39.88 ? 35  LEU A CD2 1 
ATOM   284 N  N   . ILE A 1 37 ? 3.728  15.005 1.770   1.00 42.95 ? 36  ILE A N   1 
ATOM   285 C  CA  . ILE A 1 37 ? 3.801  14.736 3.204   1.00 43.19 ? 36  ILE A CA  1 
ATOM   286 C  C   . ILE A 1 37 ? 2.643  15.363 3.975   1.00 43.11 ? 36  ILE A C   1 
ATOM   287 O  O   . ILE A 1 37 ? 2.035  14.698 4.813   1.00 44.06 ? 36  ILE A O   1 
ATOM   288 C  CB  . ILE A 1 37 ? 5.154  15.211 3.790   1.00 43.68 ? 36  ILE A CB  1 
ATOM   289 C  CG1 . ILE A 1 37 ? 6.288  14.267 3.346   1.00 44.94 ? 36  ILE A CG1 1 
ATOM   290 C  CG2 . ILE A 1 37 ? 5.111  15.356 5.370   1.00 44.11 ? 36  ILE A CG2 1 
ATOM   291 C  CD1 . ILE A 1 37 ? 7.682  14.872 3.578   1.00 45.25 ? 36  ILE A CD1 1 
ATOM   292 N  N   . ASN A 1 38 ? 2.330  16.627 3.692   1.00 42.55 ? 37  ASN A N   1 
ATOM   293 C  CA  . ASN A 1 38 ? 1.245  17.326 4.357   1.00 42.37 ? 37  ASN A CA  1 
ATOM   294 C  C   . ASN A 1 38 ? -0.152 16.802 4.067   1.00 42.44 ? 37  ASN A C   1 
ATOM   295 O  O   . ASN A 1 38 ? -0.990 16.767 4.981   1.00 43.06 ? 37  ASN A O   1 
ATOM   296 C  CB  . ASN A 1 38 ? 1.307  18.837 4.068   1.00 42.74 ? 37  ASN A CB  1 
ATOM   297 C  CG  . ASN A 1 38 ? 2.408  19.532 4.854   1.00 42.93 ? 37  ASN A CG  1 
ATOM   298 O  OD1 . ASN A 1 38 ? 2.672  20.743 4.695   1.00 45.52 ? 37  ASN A OD1 1 
ATOM   299 N  ND2 . ASN A 1 38 ? 3.070  18.772 5.690   1.00 39.20 ? 37  ASN A ND2 1 
ATOM   300 N  N   . ASN A 1 39 ? -0.415 16.413 2.819   1.00 42.31 ? 38  ASN A N   1 
ATOM   301 C  CA  . ASN A 1 39 ? -1.751 15.962 2.427   1.00 42.03 ? 38  ASN A CA  1 
ATOM   302 C  C   . ASN A 1 39 ? -1.953 14.476 2.619   1.00 41.97 ? 38  ASN A C   1 
ATOM   303 O  O   . ASN A 1 39 ? -3.065 14.048 2.892   1.00 41.36 ? 38  ASN A O   1 
ATOM   304 C  CB  . ASN A 1 39 ? -2.077 16.279 0.960   1.00 42.33 ? 38  ASN A CB  1 
ATOM   305 C  CG  . ASN A 1 39 ? -1.990 17.747 0.626   1.00 42.40 ? 38  ASN A CG  1 
ATOM   306 O  OD1 . ASN A 1 39 ? -2.187 18.627 1.471   1.00 43.34 ? 38  ASN A OD1 1 
ATOM   307 N  ND2 . ASN A 1 39 ? -1.700 18.022 -0.628  1.00 42.36 ? 38  ASN A ND2 1 
ATOM   308 N  N   . GLU A 1 40 ? -0.888 13.696 2.445   1.00 42.01 ? 39  GLU A N   1 
ATOM   309 C  CA  . GLU A 1 40 ? -1.002 12.260 2.363   1.00 42.88 ? 39  GLU A CA  1 
ATOM   310 C  C   . GLU A 1 40 ? -0.379 11.505 3.546   1.00 43.19 ? 39  GLU A C   1 
ATOM   311 O  O   . GLU A 1 40 ? -0.538 10.275 3.653   1.00 43.68 ? 39  GLU A O   1 
ATOM   312 C  CB  . GLU A 1 40 ? -0.367 11.736 1.044   1.00 43.39 ? 39  GLU A CB  1 
ATOM   313 C  CG  . GLU A 1 40 ? -0.804 12.466 -0.248  1.00 43.83 ? 39  GLU A CG  1 
ATOM   314 C  CD  . GLU A 1 40 ? -2.318 12.544 -0.499  1.00 44.70 ? 39  GLU A CD  1 
ATOM   315 O  OE1 . GLU A 1 40 ? -3.088 11.626 -0.130  1.00 45.22 ? 39  GLU A OE1 1 
ATOM   316 O  OE2 . GLU A 1 40 ? -2.746 13.539 -1.128  1.00 45.27 ? 39  GLU A OE2 1 
ATOM   317 N  N   . LEU A 1 41 ? 0.340  12.199 4.419   1.00 42.75 ? 40  LEU A N   1 
ATOM   318 C  CA  . LEU A 1 41 ? 0.960  11.519 5.577   1.00 43.06 ? 40  LEU A CA  1 
ATOM   319 C  C   . LEU A 1 41 ? 0.658  12.215 6.906   1.00 42.68 ? 40  LEU A C   1 
ATOM   320 O  O   . LEU A 1 41 ? 1.460  12.160 7.837   1.00 42.64 ? 40  LEU A O   1 
ATOM   321 C  CB  . LEU A 1 41 ? 2.487  11.318 5.389   1.00 42.04 ? 40  LEU A CB  1 
ATOM   322 C  CG  . LEU A 1 41 ? 2.990  10.349 4.309   1.00 42.21 ? 40  LEU A CG  1 
ATOM   323 C  CD1 . LEU A 1 41 ? 4.438  10.667 3.887   1.00 38.77 ? 40  LEU A CD1 1 
ATOM   324 C  CD2 . LEU A 1 41 ? 2.866  8.891  4.778   1.00 42.84 ? 40  LEU A CD2 1 
ATOM   325 N  N   . SER A 1 42 ? -0.527 12.816 7.008   1.00 43.70 ? 41  SER A N   1 
ATOM   326 C  CA  . SER A 1 42 ? -0.871 13.643 8.175   1.00 44.12 ? 41  SER A CA  1 
ATOM   327 C  C   . SER A 1 42 ? -1.042 12.876 9.473   1.00 44.53 ? 41  SER A C   1 
ATOM   328 O  O   . SER A 1 42 ? -1.161 13.484 10.522  1.00 44.82 ? 41  SER A O   1 
ATOM   329 C  CB  . SER A 1 42 ? -2.136 14.457 7.926   1.00 44.31 ? 41  SER A CB  1 
ATOM   330 O  OG  . SER A 1 42 ? -3.184 13.611 7.513   1.00 45.94 ? 41  SER A OG  1 
ATOM   331 N  N   . HIS A 1 43 ? -1.093 11.546 9.417   1.00 44.94 ? 42  HIS A N   1 
ATOM   332 C  CA  . HIS A 1 43 ? -1.187 10.777 10.666  1.00 45.55 ? 42  HIS A CA  1 
ATOM   333 C  C   . HIS A 1 43 ? 0.156  10.223 11.122  1.00 45.20 ? 42  HIS A C   1 
ATOM   334 O  O   . HIS A 1 43 ? 0.319  9.875  12.295  1.00 45.50 ? 42  HIS A O   1 
ATOM   335 C  CB  . HIS A 1 43 ? -2.202 9.633  10.572  1.00 45.91 ? 42  HIS A CB  1 
ATOM   336 C  CG  . HIS A 1 43 ? -3.580 10.076 10.203  1.00 47.51 ? 42  HIS A CG  1 
ATOM   337 N  ND1 . HIS A 1 43 ? -4.123 9.844  8.959   1.00 48.95 ? 42  HIS A ND1 1 
ATOM   338 C  CD2 . HIS A 1 43 ? -4.517 10.761 10.902  1.00 48.92 ? 42  HIS A CD2 1 
ATOM   339 C  CE1 . HIS A 1 43 ? -5.342 10.350 8.911   1.00 50.73 ? 42  HIS A CE1 1 
ATOM   340 N  NE2 . HIS A 1 43 ? -5.604 10.916 10.077  1.00 50.86 ? 42  HIS A NE2 1 
ATOM   341 N  N   . PHE A 1 44 ? 1.102  10.127 10.205  1.00 45.21 ? 43  PHE A N   1 
ATOM   342 C  CA  . PHE A 1 44 ? 2.418  9.555  10.508  1.00 45.68 ? 43  PHE A CA  1 
ATOM   343 C  C   . PHE A 1 44 ? 3.464  10.631 10.763  1.00 45.47 ? 43  PHE A C   1 
ATOM   344 O  O   . PHE A 1 44 ? 4.384  10.426 11.556  1.00 46.33 ? 43  PHE A O   1 
ATOM   345 C  CB  . PHE A 1 44 ? 2.890  8.619  9.374   1.00 46.38 ? 43  PHE A CB  1 
ATOM   346 C  CG  . PHE A 1 44 ? 2.101  7.304  9.277   1.00 47.26 ? 43  PHE A CG  1 
ATOM   347 C  CD1 . PHE A 1 44 ? 1.376  6.823  10.340  1.00 48.58 ? 43  PHE A CD1 1 
ATOM   348 C  CD2 . PHE A 1 44 ? 2.139  6.542  8.136   1.00 49.82 ? 43  PHE A CD2 1 
ATOM   349 C  CE1 . PHE A 1 44 ? 0.668  5.621  10.243  1.00 50.48 ? 43  PHE A CE1 1 
ATOM   350 C  CE2 . PHE A 1 44 ? 1.426  5.336  8.047   1.00 50.31 ? 43  PHE A CE2 1 
ATOM   351 C  CZ  . PHE A 1 44 ? 0.700  4.893  9.092   1.00 47.86 ? 43  PHE A CZ  1 
ATOM   352 N  N   . LEU A 1 45 ? 3.332  11.773 10.092  1.00 44.81 ? 44  LEU A N   1 
ATOM   353 C  CA  . LEU A 1 45 ? 4.369  12.822 10.163  1.00 44.27 ? 44  LEU A CA  1 
ATOM   354 C  C   . LEU A 1 45 ? 3.783  14.153 10.553  1.00 44.46 ? 44  LEU A C   1 
ATOM   355 O  O   . LEU A 1 45 ? 2.652  14.444 10.201  1.00 43.87 ? 44  LEU A O   1 
ATOM   356 C  CB  . LEU A 1 45 ? 5.094  12.966 8.815   1.00 44.13 ? 44  LEU A CB  1 
ATOM   357 C  CG  . LEU A 1 45 ? 5.896  11.758 8.310   1.00 44.45 ? 44  LEU A CG  1 
ATOM   358 C  CD1 . LEU A 1 45 ? 6.509  12.071 6.971   1.00 46.18 ? 44  LEU A CD1 1 
ATOM   359 C  CD2 . LEU A 1 45 ? 6.966  11.325 9.281   1.00 44.82 ? 44  LEU A CD2 1 
ATOM   360 N  N   . GLU A 1 46 ? 4.568  14.972 11.259  1.00 44.88 ? 45  GLU A N   1 
ATOM   361 C  CA  . GLU A 1 46 ? 4.174  16.337 11.630  1.00 45.52 ? 45  GLU A CA  1 
ATOM   362 C  C   . GLU A 1 46 ? 4.068  17.206 10.371  1.00 45.18 ? 45  GLU A C   1 
ATOM   363 O  O   . GLU A 1 46 ? 4.931  17.151 9.508   1.00 45.53 ? 45  GLU A O   1 
ATOM   364 C  CB  . GLU A 1 46 ? 5.229  16.916 12.574  1.00 45.64 ? 45  GLU A CB  1 
ATOM   365 C  CG  . GLU A 1 46 ? 4.769  18.031 13.458  1.00 50.00 ? 45  GLU A CG  1 
ATOM   366 C  CD  . GLU A 1 46 ? 5.661  18.186 14.701  1.00 54.58 ? 45  GLU A CD  1 
ATOM   367 O  OE1 . GLU A 1 46 ? 6.909  18.271 14.534  1.00 56.25 ? 45  GLU A OE1 1 
ATOM   368 O  OE2 . GLU A 1 46 ? 5.107  18.224 15.832  1.00 55.85 ? 45  GLU A OE2 1 
ATOM   369 N  N   . GLU A 1 47 ? 3.002  17.995 10.265  1.00 44.86 ? 46  GLU A N   1 
ATOM   370 C  CA  . GLU A 1 47 ? 2.837  18.965 9.182   1.00 43.92 ? 46  GLU A CA  1 
ATOM   371 C  C   . GLU A 1 47 ? 4.070  19.851 9.025   1.00 43.08 ? 46  GLU A C   1 
ATOM   372 O  O   . GLU A 1 47 ? 4.537  20.405 10.001  1.00 43.20 ? 46  GLU A O   1 
ATOM   373 C  CB  . GLU A 1 47 ? 1.658  19.880 9.502   1.00 44.21 ? 46  GLU A CB  1 
ATOM   374 C  CG  . GLU A 1 47 ? 1.064  20.510 8.266   1.00 45.35 ? 46  GLU A CG  1 
ATOM   375 C  CD  . GLU A 1 47 ? 0.070  21.593 8.588   1.00 48.27 ? 46  GLU A CD  1 
ATOM   376 O  OE1 . GLU A 1 47 ? -0.671 21.438 9.590   1.00 50.05 ? 46  GLU A OE1 1 
ATOM   377 O  OE2 . GLU A 1 47 ? 0.038  22.604 7.846   1.00 49.33 ? 46  GLU A OE2 1 
ATOM   378 N  N   . ILE A 1 48 ? 4.580  19.987 7.799   1.00 42.03 ? 47  ILE A N   1 
ATOM   379 C  CA  . ILE A 1 48 ? 5.757  20.806 7.529   1.00 41.44 ? 47  ILE A CA  1 
ATOM   380 C  C   . ILE A 1 48 ? 5.307  22.238 7.254   1.00 41.79 ? 47  ILE A C   1 
ATOM   381 O  O   . ILE A 1 48 ? 4.594  22.480 6.269   1.00 41.36 ? 47  ILE A O   1 
ATOM   382 C  CB  . ILE A 1 48 ? 6.547  20.306 6.297   1.00 41.63 ? 47  ILE A CB  1 
ATOM   383 C  CG1 . ILE A 1 48 ? 7.011  18.846 6.489   1.00 41.22 ? 47  ILE A CG1 1 
ATOM   384 C  CG2 . ILE A 1 48 ? 7.728  21.242 6.039   1.00 40.20 ? 47  ILE A CG2 1 
ATOM   385 C  CD1 . ILE A 1 48 ? 7.701  18.241 5.291   1.00 41.86 ? 47  ILE A CD1 1 
ATOM   386 N  N   . LYS A 1 49 ? 5.724  23.166 8.106   1.00 40.70 ? 48  LYS A N   1 
ATOM   387 C  CA  . LYS A 1 49 ? 5.349  24.573 7.963   1.00 42.66 ? 48  LYS A CA  1 
ATOM   388 C  C   . LYS A 1 49 ? 6.542  25.516 7.752   1.00 42.96 ? 48  LYS A C   1 
ATOM   389 O  O   . LYS A 1 49 ? 6.353  26.718 7.634   1.00 43.74 ? 48  LYS A O   1 
ATOM   390 C  CB  . LYS A 1 49 ? 4.603  25.096 9.211   1.00 41.54 ? 48  LYS A CB  1 
ATOM   391 C  CG  . LYS A 1 49 ? 3.512  24.225 9.764   1.00 43.16 ? 48  LYS A CG  1 
ATOM   392 C  CD  . LYS A 1 49 ? 2.604  25.028 10.724  1.00 43.00 ? 48  LYS A CD  1 
ATOM   393 C  CE  . LYS A 1 49 ? 1.301  24.269 11.009  1.00 45.12 ? 48  LYS A CE  1 
ATOM   394 N  NZ  . LYS A 1 49 ? 0.257  25.060 11.777  1.00 44.28 ? 48  LYS A NZ  1 
ATOM   395 N  N   . GLU A 1 50 ? 7.757  24.993 7.794   1.00 43.65 ? 49  GLU A N   1 
ATOM   396 C  CA  . GLU A 1 50 ? 8.948  25.831 7.772   1.00 44.67 ? 49  GLU A CA  1 
ATOM   397 C  C   . GLU A 1 50 ? 9.820  25.394 6.608   1.00 44.26 ? 49  GLU A C   1 
ATOM   398 O  O   . GLU A 1 50 ? 9.939  24.204 6.340   1.00 44.91 ? 49  GLU A O   1 
ATOM   399 C  CB  . GLU A 1 50 ? 9.765  25.674 9.062   1.00 45.34 ? 49  GLU A CB  1 
ATOM   400 C  CG  . GLU A 1 50 ? 9.105  26.057 10.381  1.00 48.81 ? 49  GLU A CG  1 
ATOM   401 C  CD  . GLU A 1 50 ? 9.044  27.546 10.584  1.00 55.82 ? 49  GLU A CD  1 
ATOM   402 O  OE1 . GLU A 1 50 ? 9.886  28.279 9.996   1.00 59.93 ? 49  GLU A OE1 1 
ATOM   403 O  OE2 . GLU A 1 50 ? 8.145  27.994 11.343  1.00 58.19 ? 49  GLU A OE2 1 
ATOM   404 N  N   . GLN A 1 51 ? 10.447 26.359 5.947   1.00 44.23 ? 50  GLN A N   1 
ATOM   405 C  CA  . GLN A 1 51 ? 11.281 26.098 4.776   1.00 44.05 ? 50  GLN A CA  1 
ATOM   406 C  C   . GLN A 1 51 ? 12.485 25.270 5.171   1.00 43.33 ? 50  GLN A C   1 
ATOM   407 O  O   . GLN A 1 51 ? 12.915 24.406 4.418   1.00 43.52 ? 50  GLN A O   1 
ATOM   408 C  CB  . GLN A 1 51 ? 11.738 27.434 4.162   1.00 44.38 ? 50  GLN A CB  1 
ATOM   409 C  CG  . GLN A 1 51 ? 12.565 27.339 2.894   1.00 44.52 ? 50  GLN A CG  1 
ATOM   410 C  CD  . GLN A 1 51 ? 11.799 26.722 1.741   1.00 46.25 ? 50  GLN A CD  1 
ATOM   411 O  OE1 . GLN A 1 51 ? 10.857 27.315 1.207   1.00 48.45 ? 50  GLN A OE1 1 
ATOM   412 N  NE2 . GLN A 1 51 ? 12.223 25.543 1.326   1.00 45.16 ? 50  GLN A NE2 1 
ATOM   413 N  N   . GLU A 1 52 ? 13.034 25.520 6.360   1.00 43.18 ? 51  GLU A N   1 
ATOM   414 C  CA  . GLU A 1 52 ? 14.197 24.760 6.788   1.00 42.70 ? 51  GLU A CA  1 
ATOM   415 C  C   . GLU A 1 52 ? 13.908 23.276 6.973   1.00 42.02 ? 51  GLU A C   1 
ATOM   416 O  O   . GLU A 1 52 ? 14.811 22.464 6.865   1.00 41.80 ? 51  GLU A O   1 
ATOM   417 C  CB  . GLU A 1 52 ? 14.893 25.394 8.003   1.00 43.19 ? 51  GLU A CB  1 
ATOM   418 C  CG  . GLU A 1 52 ? 14.216 25.289 9.365   1.00 43.69 ? 51  GLU A CG  1 
ATOM   419 C  CD  . GLU A 1 52 ? 15.125 25.803 10.483  1.00 44.43 ? 51  GLU A CD  1 
ATOM   420 O  OE1 . GLU A 1 52 ? 15.040 26.986 10.852  1.00 46.17 ? 51  GLU A OE1 1 
ATOM   421 O  OE2 . GLU A 1 52 ? 15.956 25.026 10.978  1.00 48.94 ? 51  GLU A OE2 1 
ATOM   422 N  N   . VAL A 1 53 ? 12.650 22.926 7.223   1.00 42.19 ? 52  VAL A N   1 
ATOM   423 C  CA  . VAL A 1 53 ? 12.266 21.508 7.396   1.00 42.16 ? 52  VAL A CA  1 
ATOM   424 C  C   . VAL A 1 53 ? 12.083 20.838 6.035   1.00 42.76 ? 52  VAL A C   1 
ATOM   425 O  O   . VAL A 1 53 ? 12.544 19.720 5.829   1.00 43.60 ? 52  VAL A O   1 
ATOM   426 C  CB  . VAL A 1 53 ? 11.001 21.347 8.292   1.00 42.24 ? 52  VAL A CB  1 
ATOM   427 C  CG1 . VAL A 1 53 ? 10.499 19.852 8.354   1.00 40.17 ? 52  VAL A CG1 1 
ATOM   428 C  CG2 . VAL A 1 53 ? 11.281 21.865 9.681   1.00 41.07 ? 52  VAL A CG2 1 
ATOM   429 N  N   . VAL A 1 54 ? 11.430 21.539 5.103   1.00 43.68 ? 53  VAL A N   1 
ATOM   430 C  CA  . VAL A 1 54 ? 11.381 21.155 3.678   1.00 43.99 ? 53  VAL A CA  1 
ATOM   431 C  C   . VAL A 1 54 ? 12.806 20.848 3.160   1.00 44.31 ? 53  VAL A C   1 
ATOM   432 O  O   . VAL A 1 54 ? 13.054 19.767 2.579   1.00 44.40 ? 53  VAL A O   1 
ATOM   433 C  CB  . VAL A 1 54 ? 10.749 22.317 2.801   1.00 44.43 ? 53  VAL A CB  1 
ATOM   434 C  CG1 . VAL A 1 54 ? 10.794 22.008 1.292   1.00 44.96 ? 53  VAL A CG1 1 
ATOM   435 C  CG2 . VAL A 1 54 ? 9.317  22.657 3.229   1.00 45.56 ? 53  VAL A CG2 1 
ATOM   436 N  N   . ASP A 1 55 ? 13.720 21.810 3.368   1.00 43.43 ? 54  ASP A N   1 
ATOM   437 C  CA  . ASP A 1 55 ? 15.119 21.725 2.953   1.00 42.98 ? 54  ASP A CA  1 
ATOM   438 C  C   . ASP A 1 55 ? 15.837 20.528 3.567   1.00 43.19 ? 54  ASP A C   1 
ATOM   439 O  O   . ASP A 1 55 ? 16.548 19.819 2.866   1.00 43.56 ? 54  ASP A O   1 
ATOM   440 C  CB  . ASP A 1 55 ? 15.877 23.006 3.345   1.00 42.22 ? 54  ASP A CB  1 
ATOM   441 C  CG  . ASP A 1 55 ? 15.443 24.211 2.539   1.00 41.43 ? 54  ASP A CG  1 
ATOM   442 O  OD1 . ASP A 1 55 ? 14.618 24.053 1.626   1.00 42.58 ? 54  ASP A OD1 1 
ATOM   443 O  OD2 . ASP A 1 55 ? 15.941 25.314 2.791   1.00 37.56 ? 54  ASP A OD2 1 
ATOM   444 N  N   . LYS A 1 56 ? 15.675 20.326 4.876   1.00 43.28 ? 55  LYS A N   1 
ATOM   445 C  CA  . LYS A 1 56 ? 16.298 19.190 5.569   1.00 43.61 ? 55  LYS A CA  1 
ATOM   446 C  C   . LYS A 1 56 ? 15.732 17.824 5.168   1.00 43.71 ? 55  LYS A C   1 
ATOM   447 O  O   . LYS A 1 56 ? 16.460 16.834 5.136   1.00 43.51 ? 55  LYS A O   1 
ATOM   448 C  CB  . LYS A 1 56 ? 16.144 19.361 7.082   1.00 44.14 ? 55  LYS A CB  1 
ATOM   449 C  CG  . LYS A 1 56 ? 16.778 18.245 7.919   1.00 45.68 ? 55  LYS A CG  1 
ATOM   450 C  CD  . LYS A 1 56 ? 18.244 18.543 8.220   1.00 51.49 ? 55  LYS A CD  1 
ATOM   451 C  CE  . LYS A 1 56 ? 19.204 17.756 7.299   1.00 53.35 ? 55  LYS A CE  1 
ATOM   452 N  NZ  . LYS A 1 56 ? 20.655 18.082 7.556   1.00 55.41 ? 55  LYS A NZ  1 
ATOM   453 N  N   . VAL A 1 57 ? 14.419 17.761 4.925   1.00 43.91 ? 56  VAL A N   1 
ATOM   454 C  CA  . VAL A 1 57 ? 13.752 16.506 4.566   1.00 44.04 ? 56  VAL A CA  1 
ATOM   455 C  C   . VAL A 1 57 ? 14.261 16.055 3.221   1.00 44.49 ? 56  VAL A C   1 
ATOM   456 O  O   . VAL A 1 57 ? 14.636 14.900 3.075   1.00 44.82 ? 56  VAL A O   1 
ATOM   457 C  CB  . VAL A 1 57 ? 12.197 16.649 4.568   1.00 44.03 ? 56  VAL A CB  1 
ATOM   458 C  CG1 . VAL A 1 57 ? 11.517 15.475 3.856   1.00 44.84 ? 56  VAL A CG1 1 
ATOM   459 C  CG2 . VAL A 1 57 ? 11.696 16.745 6.017   1.00 43.06 ? 56  VAL A CG2 1 
ATOM   460 N  N   . MET A 1 58 ? 14.290 16.964 2.242   1.00 44.72 ? 57  MET A N   1 
ATOM   461 C  CA  . MET A 1 58 ? 14.841 16.644 0.915   1.00 44.33 ? 57  MET A CA  1 
ATOM   462 C  C   . MET A 1 58 ? 16.314 16.265 0.991   1.00 44.61 ? 57  MET A C   1 
ATOM   463 O  O   . MET A 1 58 ? 16.753 15.373 0.280   1.00 44.63 ? 57  MET A O   1 
ATOM   464 C  CB  . MET A 1 58 ? 14.699 17.831 -0.037  1.00 44.20 ? 57  MET A CB  1 
ATOM   465 C  CG  . MET A 1 58 ? 15.361 17.582 -1.397  1.00 45.37 ? 57  MET A CG  1 
ATOM   466 S  SD  . MET A 1 58 ? 14.457 16.372 -2.401  1.00 46.90 ? 57  MET A SD  1 
ATOM   467 C  CE  . MET A 1 58 ? 13.107 17.462 -2.921  1.00 43.08 ? 57  MET A CE  1 
ATOM   468 N  N   . GLU A 1 59 ? 17.086 16.965 1.825   1.00 45.02 ? 58  GLU A N   1 
ATOM   469 C  CA  . GLU A 1 59 ? 18.533 16.705 1.978   1.00 45.64 ? 58  GLU A CA  1 
ATOM   470 C  C   . GLU A 1 59 ? 18.742 15.261 2.421   1.00 45.03 ? 58  GLU A C   1 
ATOM   471 O  O   . GLU A 1 59 ? 19.644 14.573 1.958   1.00 44.65 ? 58  GLU A O   1 
ATOM   472 C  CB  . GLU A 1 59 ? 19.142 17.718 2.982   1.00 45.92 ? 58  GLU A CB  1 
ATOM   473 C  CG  . GLU A 1 59 ? 20.648 17.590 3.267   1.00 47.68 ? 58  GLU A CG  1 
ATOM   474 C  CD  . GLU A 1 59 ? 21.179 18.542 4.395   1.00 48.42 ? 58  GLU A CD  1 
ATOM   475 O  OE1 . GLU A 1 59 ? 22.051 18.103 5.179   1.00 51.15 ? 58  GLU A OE1 1 
ATOM   476 O  OE2 . GLU A 1 59 ? 20.748 19.724 4.504   1.00 52.88 ? 58  GLU A OE2 1 
ATOM   477 N  N   . THR A 1 60 ? 17.860 14.804 3.297   1.00 45.34 ? 59  THR A N   1 
ATOM   478 C  CA  . THR A 1 60 ? 17.875 13.443 3.821   1.00 45.82 ? 59  THR A CA  1 
ATOM   479 C  C   . THR A 1 60 ? 17.479 12.387 2.785   1.00 45.66 ? 59  THR A C   1 
ATOM   480 O  O   . THR A 1 60 ? 18.106 11.325 2.714   1.00 45.45 ? 59  THR A O   1 
ATOM   481 C  CB  . THR A 1 60 ? 16.936 13.360 5.035   1.00 46.15 ? 59  THR A CB  1 
ATOM   482 O  OG1 . THR A 1 60 ? 17.391 14.316 6.010   1.00 48.52 ? 59  THR A OG1 1 
ATOM   483 C  CG2 . THR A 1 60 ? 16.940 11.961 5.648   1.00 46.54 ? 59  THR A CG2 1 
ATOM   484 N  N   . LEU A 1 61 ? 16.457 12.680 1.980   1.00 45.00 ? 60  LEU A N   1 
ATOM   485 C  CA  . LEU A 1 61 ? 15.946 11.713 1.018   1.00 45.30 ? 60  LEU A CA  1 
ATOM   486 C  C   . LEU A 1 61 ? 16.777 11.633 -0.280  1.00 45.26 ? 60  LEU A C   1 
ATOM   487 O  O   . LEU A 1 61 ? 16.741 10.619 -1.002  1.00 45.72 ? 60  LEU A O   1 
ATOM   488 C  CB  . LEU A 1 61 ? 14.479 12.029 0.695   1.00 45.43 ? 60  LEU A CB  1 
ATOM   489 C  CG  . LEU A 1 61 ? 13.484 11.948 1.854   1.00 46.77 ? 60  LEU A CG  1 
ATOM   490 C  CD1 . LEU A 1 61 ? 12.053 11.998 1.337   1.00 45.47 ? 60  LEU A CD1 1 
ATOM   491 C  CD2 . LEU A 1 61 ? 13.707 10.689 2.675   1.00 49.25 ? 60  LEU A CD2 1 
ATOM   492 N  N   . ASP A 1 62 ? 17.530 12.701 -0.546  1.00 44.07 ? 61  ASP A N   1 
ATOM   493 C  CA  . ASP A 1 62 ? 18.212 12.931 -1.804  1.00 44.04 ? 61  ASP A CA  1 
ATOM   494 C  C   . ASP A 1 62 ? 19.552 12.227 -1.860  1.00 44.37 ? 61  ASP A C   1 
ATOM   495 O  O   . ASP A 1 62 ? 20.590 12.876 -1.693  1.00 45.14 ? 61  ASP A O   1 
ATOM   496 C  CB  . ASP A 1 62 ? 18.459 14.440 -1.966  1.00 44.11 ? 61  ASP A CB  1 
ATOM   497 C  CG  . ASP A 1 62 ? 18.986 14.808 -3.336  1.00 43.40 ? 61  ASP A CG  1 
ATOM   498 O  OD1 . ASP A 1 62 ? 18.903 13.951 -4.250  1.00 44.97 ? 61  ASP A OD1 1 
ATOM   499 O  OD2 . ASP A 1 62 ? 19.451 15.957 -3.500  1.00 42.48 ? 61  ASP A OD2 1 
ATOM   500 N  N   . SER A 1 63 ? 19.527 10.920 -2.122  1.00 44.23 ? 62  SER A N   1 
ATOM   501 C  CA  . SER A 1 63 ? 20.725 10.061 -2.079  1.00 44.43 ? 62  SER A CA  1 
ATOM   502 C  C   . SER A 1 63 ? 21.780 10.337 -3.145  1.00 44.34 ? 62  SER A C   1 
ATOM   503 O  O   . SER A 1 63 ? 22.974 10.240 -2.864  1.00 44.21 ? 62  SER A O   1 
ATOM   504 C  CB  . SER A 1 63 ? 20.324 8.597  -2.200  1.00 43.65 ? 62  SER A CB  1 
ATOM   505 O  OG  . SER A 1 63 ? 19.452 8.265  -1.164  1.00 46.47 ? 62  SER A OG  1 
ATOM   506 N  N   . ASP A 1 64 ? 21.336 10.639 -4.361  1.00 44.70 ? 63  ASP A N   1 
ATOM   507 C  CA  . ASP A 1 64 ? 22.245 10.834 -5.477  1.00 46.10 ? 63  ASP A CA  1 
ATOM   508 C  C   . ASP A 1 64 ? 22.628 12.316 -5.666  1.00 46.16 ? 63  ASP A C   1 
ATOM   509 O  O   . ASP A 1 64 ? 23.432 12.661 -6.534  1.00 47.31 ? 63  ASP A O   1 
ATOM   510 C  CB  . ASP A 1 64 ? 21.670 10.201 -6.759  1.00 46.10 ? 63  ASP A CB  1 
ATOM   511 C  CG  . ASP A 1 64 ? 20.398 10.886 -7.253  1.00 47.61 ? 63  ASP A CG  1 
ATOM   512 O  OD1 . ASP A 1 64 ? 20.066 11.998 -6.800  1.00 50.37 ? 63  ASP A OD1 1 
ATOM   513 O  OD2 . ASP A 1 64 ? 19.713 10.304 -8.112  1.00 50.57 ? 63  ASP A OD2 1 
ATOM   514 N  N   . GLY A 1 65 ? 22.042 13.187 -4.856  1.00 46.66 ? 64  GLY A N   1 
ATOM   515 C  CA  . GLY A 1 65 ? 22.481 14.573 -4.802  1.00 46.42 ? 64  GLY A CA  1 
ATOM   516 C  C   . GLY A 1 65 ? 22.013 15.544 -5.873  1.00 46.53 ? 64  GLY A C   1 
ATOM   517 O  O   . GLY A 1 65 ? 22.608 16.611 -5.993  1.00 47.13 ? 64  GLY A O   1 
ATOM   518 N  N   . ASP A 1 66 ? 20.946 15.229 -6.617  1.00 46.27 ? 65  ASP A N   1 
ATOM   519 C  CA  . ASP A 1 66 ? 20.438 16.142 -7.678  1.00 45.56 ? 65  ASP A CA  1 
ATOM   520 C  C   . ASP A 1 66 ? 19.406 17.184 -7.230  1.00 45.71 ? 65  ASP A C   1 
ATOM   521 O  O   . ASP A 1 66 ? 18.803 17.880 -8.053  1.00 45.94 ? 65  ASP A O   1 
ATOM   522 C  CB  . ASP A 1 66 ? 19.884 15.365 -8.883  1.00 45.66 ? 65  ASP A CB  1 
ATOM   523 C  CG  . ASP A 1 66 ? 18.631 14.540 -8.551  1.00 45.81 ? 65  ASP A CG  1 
ATOM   524 O  OD1 . ASP A 1 66 ? 18.214 14.466 -7.367  1.00 45.24 ? 65  ASP A OD1 1 
ATOM   525 O  OD2 . ASP A 1 66 ? 18.048 13.954 -9.494  1.00 45.36 ? 65  ASP A OD2 1 
ATOM   526 N  N   . GLY A 1 67 ? 19.168 17.282 -5.931  1.00 45.81 ? 66  GLY A N   1 
ATOM   527 C  CA  . GLY A 1 67 ? 18.213 18.262 -5.445  1.00 45.66 ? 66  GLY A CA  1 
ATOM   528 C  C   . GLY A 1 67 ? 16.751 17.839 -5.471  1.00 46.06 ? 66  GLY A C   1 
ATOM   529 O  O   . GLY A 1 67 ? 15.899 18.567 -4.951  1.00 47.38 ? 66  GLY A O   1 
ATOM   530 N  N   . GLU A 1 68 ? 16.425 16.682 -6.054  1.00 45.54 ? 67  GLU A N   1 
ATOM   531 C  CA  . GLU A 1 68 ? 15.021 16.221 -6.080  1.00 45.21 ? 67  GLU A CA  1 
ATOM   532 C  C   . GLU A 1 68 ? 14.910 14.793 -5.634  1.00 44.18 ? 67  GLU A C   1 
ATOM   533 O  O   . GLU A 1 68 ? 15.917 14.115 -5.519  1.00 44.06 ? 67  GLU A O   1 
ATOM   534 C  CB  . GLU A 1 68 ? 14.400 16.385 -7.472  1.00 45.43 ? 67  GLU A CB  1 
ATOM   535 C  CG  . GLU A 1 68 ? 14.413 17.840 -7.955  1.00 47.14 ? 67  GLU A CG  1 
ATOM   536 C  CD  . GLU A 1 68 ? 13.611 18.101 -9.218  1.00 47.26 ? 67  GLU A CD  1 
ATOM   537 O  OE1 . GLU A 1 68 ? 12.636 17.372 -9.517  1.00 49.66 ? 67  GLU A OE1 1 
ATOM   538 O  OE2 . GLU A 1 68 ? 13.959 19.084 -9.901  1.00 50.56 ? 67  GLU A OE2 1 
ATOM   539 N  N   . CYS A 1 69 ? 13.681 14.351 -5.378  1.00 44.09 ? 68  CYS A N   1 
ATOM   540 C  CA  . CYS A 1 69 ? 13.387 12.981 -4.956  1.00 44.04 ? 68  CYS A CA  1 
ATOM   541 C  C   . CYS A 1 69 ? 12.843 12.166 -6.134  1.00 44.07 ? 68  CYS A C   1 
ATOM   542 O  O   . CYS A 1 69 ? 11.706 12.398 -6.556  1.00 44.22 ? 68  CYS A O   1 
ATOM   543 C  CB  . CYS A 1 69 ? 12.369 12.984 -3.770  1.00 43.89 ? 68  CYS A CB  1 
ATOM   544 S  SG  . CYS A 1 69 ? 12.036 11.314 -3.047  1.00 44.48 ? 68  CYS A SG  1 
ATOM   545 N  N   . ASP A 1 70 ? 13.637 11.229 -6.673  1.00 43.88 ? 69  ASP A N   1 
ATOM   546 C  CA  . ASP A 1 70 ? 13.131 10.309 -7.705  1.00 44.00 ? 69  ASP A CA  1 
ATOM   547 C  C   . ASP A 1 70 ? 12.395 9.076  -7.109  1.00 43.93 ? 69  ASP A C   1 
ATOM   548 O  O   . ASP A 1 70 ? 12.230 8.978  -5.886  1.00 43.51 ? 69  ASP A O   1 
ATOM   549 C  CB  . ASP A 1 70 ? 14.229 9.901  -8.709  1.00 44.32 ? 69  ASP A CB  1 
ATOM   550 C  CG  . ASP A 1 70 ? 15.288 9.001  -8.103  1.00 45.64 ? 69  ASP A CG  1 
ATOM   551 O  OD1 . ASP A 1 70 ? 15.064 8.381  -7.038  1.00 47.47 ? 69  ASP A OD1 1 
ATOM   552 O  OD2 . ASP A 1 70 ? 16.367 8.922  -8.701  1.00 47.46 ? 69  ASP A OD2 1 
ATOM   553 N  N   . PHE A 1 71 ? 11.944 8.156  -7.962  1.00 43.65 ? 70  PHE A N   1 
ATOM   554 C  CA  . PHE A 1 71 ? 11.098 7.067  -7.497  1.00 44.11 ? 70  PHE A CA  1 
ATOM   555 C  C   . PHE A 1 71 ? 11.761 6.112  -6.523  1.00 45.02 ? 70  PHE A C   1 
ATOM   556 O  O   . PHE A 1 71 ? 11.123 5.703  -5.556  1.00 46.45 ? 70  PHE A O   1 
ATOM   557 C  CB  . PHE A 1 71 ? 10.461 6.250  -8.626  1.00 44.39 ? 70  PHE A CB  1 
ATOM   558 C  CG  . PHE A 1 71 ? 9.402  5.307  -8.136  1.00 44.28 ? 70  PHE A CG  1 
ATOM   559 C  CD1 . PHE A 1 71 ? 8.216  5.796  -7.599  1.00 45.47 ? 70  PHE A CD1 1 
ATOM   560 C  CD2 . PHE A 1 71 ? 9.596  3.927  -8.167  1.00 46.38 ? 70  PHE A CD2 1 
ATOM   561 C  CE1 . PHE A 1 71 ? 7.229  4.927  -7.092  1.00 46.37 ? 70  PHE A CE1 1 
ATOM   562 C  CE2 . PHE A 1 71 ? 8.600  3.059  -7.662  1.00 42.49 ? 70  PHE A CE2 1 
ATOM   563 C  CZ  . PHE A 1 71 ? 7.426  3.566  -7.146  1.00 43.78 ? 70  PHE A CZ  1 
ATOM   564 N  N   . GLN A 1 72 ? 13.010 5.742  -6.784  1.00 45.21 ? 71  GLN A N   1 
ATOM   565 C  CA  . GLN A 1 72 ? 13.754 4.873  -5.887  1.00 45.72 ? 71  GLN A CA  1 
ATOM   566 C  C   . GLN A 1 72 ? 13.939 5.485  -4.522  1.00 45.01 ? 71  GLN A C   1 
ATOM   567 O  O   . GLN A 1 72 ? 13.898 4.789  -3.537  1.00 45.12 ? 71  GLN A O   1 
ATOM   568 C  CB  . GLN A 1 72 ? 15.112 4.528  -6.475  1.00 46.18 ? 71  GLN A CB  1 
ATOM   569 C  CG  . GLN A 1 72 ? 15.036 3.540  -7.657  1.00 51.44 ? 71  GLN A CG  1 
ATOM   570 C  CD  . GLN A 1 72 ? 14.148 2.306  -7.374  1.00 55.94 ? 71  GLN A CD  1 
ATOM   571 O  OE1 . GLN A 1 72 ? 14.613 1.297  -6.822  1.00 59.41 ? 71  GLN A OE1 1 
ATOM   572 N  NE2 . GLN A 1 72 ? 12.885 2.380  -7.775  1.00 53.91 ? 71  GLN A NE2 1 
ATOM   573 N  N   . GLU A 1 73 ? 14.180 6.792  -4.492  1.00 45.06 ? 72  GLU A N   1 
ATOM   574 C  CA  . GLU A 1 73 ? 14.347 7.570  -3.266  1.00 44.28 ? 72  GLU A CA  1 
ATOM   575 C  C   . GLU A 1 73 ? 13.021 7.682  -2.527  1.00 44.35 ? 72  GLU A C   1 
ATOM   576 O  O   . GLU A 1 73 ? 12.985 7.619  -1.295  1.00 45.15 ? 72  GLU A O   1 
ATOM   577 C  CB  . GLU A 1 73 ? 14.932 8.966  -3.591  1.00 44.06 ? 72  GLU A CB  1 
ATOM   578 C  CG  . GLU A 1 73 ? 16.357 8.887  -4.155  1.00 41.89 ? 72  GLU A CG  1 
ATOM   579 C  CD  . GLU A 1 73 ? 16.830 10.194 -4.759  1.00 43.60 ? 72  GLU A CD  1 
ATOM   580 O  OE1 . GLU A 1 73 ? 15.985 11.055 -5.087  1.00 42.64 ? 72  GLU A OE1 1 
ATOM   581 O  OE2 . GLU A 1 73 ? 18.055 10.378 -4.903  1.00 43.26 ? 72  GLU A OE2 1 
ATOM   582 N  N   . PHE A 1 74 ? 11.931 7.863  -3.267  1.00 44.08 ? 73  PHE A N   1 
ATOM   583 C  CA  . PHE A 1 74 ? 10.603 7.848  -2.652  1.00 43.79 ? 73  PHE A CA  1 
ATOM   584 C  C   . PHE A 1 74 ? 10.353 6.519  -1.982  1.00 44.00 ? 73  PHE A C   1 
ATOM   585 O  O   . PHE A 1 74 ? 9.849  6.479  -0.863  1.00 44.16 ? 73  PHE A O   1 
ATOM   586 C  CB  . PHE A 1 74 ? 9.527  8.170  -3.674  1.00 44.18 ? 73  PHE A CB  1 
ATOM   587 C  CG  . PHE A 1 74 ? 8.132  8.107  -3.122  1.00 45.51 ? 73  PHE A CG  1 
ATOM   588 C  CD1 . PHE A 1 74 ? 7.691  9.042  -2.179  1.00 45.46 ? 73  PHE A CD1 1 
ATOM   589 C  CD2 . PHE A 1 74 ? 7.257  7.093  -3.534  1.00 45.69 ? 73  PHE A CD2 1 
ATOM   590 C  CE1 . PHE A 1 74 ? 6.402  8.972  -1.659  1.00 47.44 ? 73  PHE A CE1 1 
ATOM   591 C  CE2 . PHE A 1 74 ? 5.951  7.022  -3.028  1.00 44.44 ? 73  PHE A CE2 1 
ATOM   592 C  CZ  . PHE A 1 74 ? 5.529  7.965  -2.100  1.00 44.65 ? 73  PHE A CZ  1 
ATOM   593 N  N   . MET A 1 75 ? 10.725 5.434  -2.660  1.00 44.22 ? 74  MET A N   1 
ATOM   594 C  CA  . MET A 1 75 ? 10.602 4.055  -2.128  1.00 44.97 ? 74  MET A CA  1 
ATOM   595 C  C   . MET A 1 75 ? 11.398 3.809  -0.817  1.00 44.53 ? 74  MET A C   1 
ATOM   596 O  O   . MET A 1 75 ? 10.921 3.104  0.094   1.00 44.47 ? 74  MET A O   1 
ATOM   597 C  CB  . MET A 1 75 ? 11.020 3.002  -3.174  1.00 45.74 ? 74  MET A CB  1 
ATOM   598 C  CG  . MET A 1 75 ? 9.976  2.537  -4.204  1.00 47.48 ? 74  MET A CG  1 
ATOM   599 S  SD  . MET A 1 75 ? 8.328  2.222  -3.610  1.00 58.44 ? 74  MET A SD  1 
ATOM   600 C  CE  . MET A 1 75 ? 8.488  0.918  -2.361  1.00 56.63 ? 74  MET A CE  1 
ATOM   601 N  N   . ALA A 1 76 ? 12.601 4.378  -0.723  1.00 43.64 ? 75  ALA A N   1 
ATOM   602 C  CA  . ALA A 1 76 ? 13.388 4.328  0.524   1.00 42.44 ? 75  ALA A CA  1 
ATOM   603 C  C   . ALA A 1 76 ? 12.756 5.114  1.642   1.00 42.58 ? 75  ALA A C   1 
ATOM   604 O  O   . ALA A 1 76 ? 12.855 4.718  2.796   1.00 42.97 ? 75  ALA A O   1 
ATOM   605 C  CB  . ALA A 1 76 ? 14.775 4.851  0.282   1.00 43.01 ? 75  ALA A CB  1 
ATOM   606 N  N   . PHE A 1 77 ? 12.155 6.256  1.302   1.00 41.81 ? 76  PHE A N   1 
ATOM   607 C  CA  . PHE A 1 77 ? 11.379 7.055  2.247   1.00 42.56 ? 76  PHE A CA  1 
ATOM   608 C  C   . PHE A 1 77 ? 10.176 6.261  2.770   1.00 42.59 ? 76  PHE A C   1 
ATOM   609 O  O   . PHE A 1 77 ? 9.940  6.188  3.976   1.00 44.05 ? 76  PHE A O   1 
ATOM   610 C  CB  . PHE A 1 77 ? 10.948 8.342  1.538   1.00 42.73 ? 76  PHE A CB  1 
ATOM   611 C  CG  . PHE A 1 77 ? 10.095 9.257  2.354   1.00 44.06 ? 76  PHE A CG  1 
ATOM   612 C  CD1 . PHE A 1 77 ? 10.407 9.551  3.670   1.00 46.74 ? 76  PHE A CD1 1 
ATOM   613 C  CD2 . PHE A 1 77 ? 9.010  9.887  1.768   1.00 45.51 ? 76  PHE A CD2 1 
ATOM   614 C  CE1 . PHE A 1 77 ? 9.597  10.435 4.439   1.00 48.27 ? 76  PHE A CE1 1 
ATOM   615 C  CE2 . PHE A 1 77 ? 8.194  10.787 2.513   1.00 48.01 ? 76  PHE A CE2 1 
ATOM   616 C  CZ  . PHE A 1 77 ? 8.509  11.060 3.847   1.00 46.89 ? 76  PHE A CZ  1 
ATOM   617 N  N   . VAL A 1 78 ? 9.421  5.644  1.869   1.00 42.71 ? 77  VAL A N   1 
ATOM   618 C  CA  . VAL A 1 78 ? 8.337  4.731  2.273   1.00 43.17 ? 77  VAL A CA  1 
ATOM   619 C  C   . VAL A 1 78 ? 8.852  3.631  3.220   1.00 43.50 ? 77  VAL A C   1 
ATOM   620 O  O   . VAL A 1 78 ? 8.241  3.399  4.287   1.00 44.19 ? 77  VAL A O   1 
ATOM   621 C  CB  . VAL A 1 78 ? 7.569  4.169  1.037   1.00 43.58 ? 77  VAL A CB  1 
ATOM   622 C  CG1 . VAL A 1 78 ? 6.586  3.011  1.404   1.00 44.84 ? 77  VAL A CG1 1 
ATOM   623 C  CG2 . VAL A 1 78 ? 6.845  5.298  0.328   1.00 43.70 ? 77  VAL A CG2 1 
ATOM   624 N  N   . ALA A 1 79 ? 9.957  2.959  2.863   1.00 42.55 ? 78  ALA A N   1 
ATOM   625 C  CA  . ALA A 1 79 ? 10.512 1.918  3.735   1.00 43.00 ? 78  ALA A CA  1 
ATOM   626 C  C   . ALA A 1 79 ? 10.849 2.439  5.135   1.00 43.79 ? 78  ALA A C   1 
ATOM   627 O  O   . ALA A 1 79 ? 10.707 1.701  6.104   1.00 44.52 ? 78  ALA A O   1 
ATOM   628 C  CB  . ALA A 1 79 ? 11.737 1.257  3.119   1.00 42.63 ? 78  ALA A CB  1 
ATOM   629 N  N   . MET A 1 80 ? 11.328 3.678  5.241   1.00 44.35 ? 79  MET A N   1 
ATOM   630 C  CA  . MET A 1 80 ? 11.646 4.270  6.549   1.00 46.12 ? 79  MET A CA  1 
ATOM   631 C  C   . MET A 1 80 ? 10.405 4.467  7.431   1.00 43.82 ? 79  MET A C   1 
ATOM   632 O  O   . MET A 1 80 ? 10.426 4.215  8.610   1.00 43.56 ? 79  MET A O   1 
ATOM   633 C  CB  . MET A 1 80 ? 12.285 5.642  6.368   1.00 46.18 ? 79  MET A CB  1 
ATOM   634 C  CG  . MET A 1 80 ? 13.721 5.693  5.922   1.00 49.62 ? 79  MET A CG  1 
ATOM   635 S  SD  . MET A 1 80 ? 14.040 7.472  5.565   1.00 54.64 ? 79  MET A SD  1 
ATOM   636 C  CE  . MET A 1 80 ? 15.403 7.452  4.340   1.00 53.85 ? 79  MET A CE  1 
ATOM   637 N  N   . ILE A 1 81 ? 9.326  4.962  6.844   1.00 44.22 ? 80  ILE A N   1 
ATOM   638 C  CA  . ILE A 1 81 ? 8.102  5.247  7.593   1.00 44.43 ? 80  ILE A CA  1 
ATOM   639 C  C   . ILE A 1 81 ? 7.454  3.936  8.046   1.00 44.23 ? 80  ILE A C   1 
ATOM   640 O  O   . ILE A 1 81 ? 6.958  3.822  9.176   1.00 44.07 ? 80  ILE A O   1 
ATOM   641 C  CB  . ILE A 1 81 ? 7.114  6.036  6.717   1.00 44.55 ? 80  ILE A CB  1 
ATOM   642 C  CG1 . ILE A 1 81 ? 7.684  7.405  6.390   1.00 45.93 ? 80  ILE A CG1 1 
ATOM   643 C  CG2 . ILE A 1 81 ? 5.722  6.158  7.404   1.00 45.06 ? 80  ILE A CG2 1 
ATOM   644 C  CD1 . ILE A 1 81 ? 7.013  7.993  5.171   1.00 49.94 ? 80  ILE A CD1 1 
ATOM   645 N  N   . THR A 1 82 ? 7.432  2.973  7.131   1.00 43.23 ? 81  THR A N   1 
ATOM   646 C  CA  . THR A 1 82 ? 6.890  1.633  7.427   1.00 44.04 ? 81  THR A CA  1 
ATOM   647 C  C   . THR A 1 82 ? 7.650  0.935  8.553   1.00 43.52 ? 81  THR A C   1 
ATOM   648 O  O   . THR A 1 82 ? 7.048  0.313  9.454   1.00 44.13 ? 81  THR A O   1 
ATOM   649 C  CB  . THR A 1 82 ? 6.870  0.769  6.158   1.00 43.56 ? 81  THR A CB  1 
ATOM   650 O  OG1 . THR A 1 82 ? 6.313  1.550  5.109   1.00 44.73 ? 81  THR A OG1 1 
ATOM   651 C  CG2 . THR A 1 82 ? 5.959  -0.439 6.338   1.00 44.35 ? 81  THR A CG2 1 
ATOM   652 N  N   . THR A 1 83 ? 8.970  1.044  8.521   1.00 43.43 ? 82  THR A N   1 
ATOM   653 C  CA  . THR A 1 83 ? 9.776  0.444  9.574   1.00 43.26 ? 82  THR A CA  1 
ATOM   654 C  C   . THR A 1 83 ? 9.506  1.156  10.892  1.00 43.66 ? 82  THR A C   1 
ATOM   655 O  O   . THR A 1 83 ? 9.375  0.489  11.909  1.00 44.23 ? 82  THR A O   1 
ATOM   656 C  CB  . THR A 1 83 ? 11.295 0.472  9.262   1.00 43.28 ? 82  THR A CB  1 
ATOM   657 O  OG1 . THR A 1 83 ? 11.515 -0.038 7.944   1.00 43.37 ? 82  THR A OG1 1 
ATOM   658 C  CG2 . THR A 1 83 ? 12.091 -0.357 10.288  1.00 42.48 ? 82  THR A CG2 1 
ATOM   659 N  N   . ALA A 1 84 ? 9.426  2.492  10.869  1.00 43.94 ? 83  ALA A N   1 
ATOM   660 C  CA  . ALA A 1 84 ? 9.141  3.290  12.076  1.00 44.91 ? 83  ALA A CA  1 
ATOM   661 C  C   . ALA A 1 84 ? 7.765  2.937  12.651  1.00 45.47 ? 83  ALA A C   1 
ATOM   662 O  O   . ALA A 1 84 ? 7.608  2.739  13.850  1.00 45.04 ? 83  ALA A O   1 
ATOM   663 C  CB  . ALA A 1 84 ? 9.221  4.780  11.757  1.00 44.74 ? 83  ALA A CB  1 
ATOM   664 N  N   . CYS A 1 85 ? 6.769  2.848  11.772  1.00 47.26 ? 84  CYS A N   1 
ATOM   665 C  CA  . CYS A 1 85 ? 5.441  2.412  12.178  1.00 47.24 ? 84  CYS A CA  1 
ATOM   666 C  C   . CYS A 1 85 ? 5.447  0.931  12.631  1.00 47.30 ? 84  CYS A C   1 
ATOM   667 O  O   . CYS A 1 85 ? 4.849  0.578  13.679  1.00 47.66 ? 84  CYS A O   1 
ATOM   668 C  CB  . CYS A 1 85 ? 4.427  2.697  11.061  1.00 47.07 ? 84  CYS A CB  1 
ATOM   669 S  SG  . CYS A 1 85 ? 2.763  2.269  11.537  1.00 51.51 ? 84  CYS A SG  1 
ATOM   670 N  N   . HIS A 1 86 ? 6.163  0.078  11.891  1.00 47.12 ? 85  HIS A N   1 
ATOM   671 C  CA  . HIS A 1 86 ? 6.260  -1.351 12.227  1.00 46.93 ? 85  HIS A CA  1 
ATOM   672 C  C   . HIS A 1 86 ? 6.744  -1.627 13.641  1.00 47.35 ? 85  HIS A C   1 
ATOM   673 O  O   . HIS A 1 86 ? 6.329  -2.613 14.295  1.00 47.94 ? 85  HIS A O   1 
ATOM   674 C  CB  . HIS A 1 86 ? 7.182  -2.072 11.243  1.00 47.12 ? 85  HIS A CB  1 
ATOM   675 C  CG  . HIS A 1 86 ? 7.472  -3.495 11.612  1.00 46.62 ? 85  HIS A CG  1 
ATOM   676 N  ND1 . HIS A 1 86 ? 8.737  -3.938 11.943  1.00 48.06 ? 85  HIS A ND1 1 
ATOM   677 C  CD2 . HIS A 1 86 ? 6.660  -4.575 11.710  1.00 47.92 ? 85  HIS A CD2 1 
ATOM   678 C  CE1 . HIS A 1 86 ? 8.693  -5.229 12.220  1.00 48.49 ? 85  HIS A CE1 1 
ATOM   679 N  NE2 . HIS A 1 86 ? 7.445  -5.640 12.088  1.00 48.30 ? 85  HIS A NE2 1 
ATOM   680 N  N   . GLU A 1 87 ? 7.642  -0.789 14.128  1.00 47.59 ? 86  GLU A N   1 
ATOM   681 C  CA  . GLU A 1 87 ? 8.212  -1.085 15.425  1.00 48.32 ? 86  GLU A CA  1 
ATOM   682 C  C   . GLU A 1 87 ? 7.752  -0.190 16.557  1.00 47.81 ? 86  GLU A C   1 
ATOM   683 O  O   . GLU A 1 87 ? 8.155  -0.398 17.702  1.00 47.87 ? 86  GLU A O   1 
ATOM   684 C  CB  . GLU A 1 87 ? 9.736  -1.178 15.364  1.00 49.16 ? 86  GLU A CB  1 
ATOM   685 C  CG  . GLU A 1 87 ? 10.438 -0.027 14.702  1.00 52.83 ? 86  GLU A CG  1 
ATOM   686 C  CD  . GLU A 1 87 ? 11.895 -0.373 14.410  1.00 58.96 ? 86  GLU A CD  1 
ATOM   687 O  OE1 . GLU A 1 87 ? 12.160 -1.529 13.976  1.00 60.76 ? 86  GLU A OE1 1 
ATOM   688 O  OE2 . GLU A 1 87 ? 12.772 0.504  14.630  1.00 60.78 ? 86  GLU A OE2 1 
ATOM   689 N  N   . PHE A 1 88 ? 6.924  0.802  16.237  1.00 47.89 ? 87  PHE A N   1 
ATOM   690 C  CA  . PHE A 1 88 ? 6.163  1.508  17.258  1.00 47.94 ? 87  PHE A CA  1 
ATOM   691 C  C   . PHE A 1 88 ? 5.288  0.480  17.991  1.00 47.71 ? 87  PHE A C   1 
ATOM   692 O  O   . PHE A 1 88 ? 5.026  0.611  19.192  1.00 48.07 ? 87  PHE A O   1 
ATOM   693 C  CB  . PHE A 1 88 ? 5.293  2.611  16.632  1.00 48.48 ? 87  PHE A CB  1 
ATOM   694 C  CG  . PHE A 1 88 ? 4.567  3.457  17.653  1.00 49.88 ? 87  PHE A CG  1 
ATOM   695 C  CD1 . PHE A 1 88 ? 5.174  4.603  18.186  1.00 50.70 ? 87  PHE A CD1 1 
ATOM   696 C  CD2 . PHE A 1 88 ? 3.294  3.090  18.108  1.00 49.86 ? 87  PHE A CD2 1 
ATOM   697 C  CE1 . PHE A 1 88 ? 4.518  5.384  19.137  1.00 51.71 ? 87  PHE A CE1 1 
ATOM   698 C  CE2 . PHE A 1 88 ? 2.625  3.859  19.057  1.00 51.43 ? 87  PHE A CE2 1 
ATOM   699 C  CZ  . PHE A 1 88 ? 3.237  5.009  19.583  1.00 51.70 ? 87  PHE A CZ  1 
ATOM   700 N  N   . PHE A 1 89 ? 4.892  -0.568 17.267  1.00 48.00 ? 88  PHE A N   1 
ATOM   701 C  CA  . PHE A 1 89 ? 3.915  -1.563 17.740  1.00 48.43 ? 88  PHE A CA  1 
ATOM   702 C  C   . PHE A 1 89 ? 4.518  -2.924 18.064  1.00 48.81 ? 88  PHE A C   1 
ATOM   703 O  O   . PHE A 1 89 ? 5.608  -3.249 17.593  1.00 49.50 ? 88  PHE A O   1 
ATOM   704 C  CB  . PHE A 1 89 ? 2.783  -1.693 16.704  1.00 48.90 ? 88  PHE A CB  1 
ATOM   705 C  CG  . PHE A 1 89 ? 1.982  -0.445 16.577  1.00 49.17 ? 88  PHE A CG  1 
ATOM   706 C  CD1 . PHE A 1 89 ? 0.840  -0.267 17.352  1.00 50.23 ? 88  PHE A CD1 1 
ATOM   707 C  CD2 . PHE A 1 89 ? 2.416  0.588  15.769  1.00 49.73 ? 88  PHE A CD2 1 
ATOM   708 C  CE1 . PHE A 1 89 ? 0.123  0.910  17.287  1.00 50.03 ? 88  PHE A CE1 1 
ATOM   709 C  CE2 . PHE A 1 89 ? 1.702  1.771  15.689  1.00 51.52 ? 88  PHE A CE2 1 
ATOM   710 C  CZ  . PHE A 1 89 ? 0.546  1.932  16.460  1.00 50.66 ? 88  PHE A CZ  1 
HETATM 711 CA CA  . CA  B 2 .  ? 8.052  17.409 -10.516 1.00 50.76 ? 92  CA  A CA  1 
HETATM 712 CA CA  . CA  C 2 .  ? 17.718 12.761 -5.833  1.00 51.68 ? 93  CA  A CA  1 
HETATM 713 C  C1  . 32A D 3 .  ? 5.876  6.757  13.336  1.00 64.50 ? 94  32A A C1  1 
HETATM 714 C  C2  . 32A D 3 .  ? 6.469  7.201  12.047  1.00 65.16 ? 94  32A A C2  1 
HETATM 715 C  C3  . 32A D 3 .  ? 9.481  8.780  11.027  1.00 72.13 ? 94  32A A C3  1 
HETATM 716 C  C4  . 32A D 3 .  ? 4.232  6.199  14.535  0.50 62.42 ? 94  32A A C4  1 
HETATM 717 C  C5  . 32A D 3 .  ? 6.408  6.458  14.596  1.00 64.86 ? 94  32A A C5  1 
HETATM 718 C  C6  . 32A D 3 .  ? 2.972  5.981  14.850  0.50 60.88 ? 94  32A A C6  1 
HETATM 719 C  C7  . 32A D 3 .  ? 1.831  5.898  15.243  0.50 57.94 ? 94  32A A C7  1 
HETATM 720 N  N1  . 32A D 3 .  ? 7.487  8.056  12.058  1.00 67.97 ? 94  32A A N1  1 
HETATM 721 N  N2  . 32A D 3 .  ? 8.301  8.181  10.913  1.00 70.42 ? 94  32A A N2  1 
HETATM 722 N  N3  . 32A D 3 .  ? 10.187 9.126  9.928   1.00 71.95 ? 94  32A A N3  1 
HETATM 723 C  C9  . 32A D 3 .  ? 0.423  6.007  15.579  0.50 55.80 ? 94  32A A C9  1 
HETATM 724 C  C8  . 32A D 3 .  ? 5.326  6.096  15.381  1.00 64.78 ? 94  32A A C8  1 
HETATM 725 O  O2  . 32A D 3 .  ? 6.000  6.763  11.004  1.00 68.81 ? 94  32A A O2  1 
HETATM 726 C  C10 . 32A D 3 .  ? 10.816 8.215  8.979   1.00 70.34 ? 94  32A A C10 1 
HETATM 727 S  S1  . 32A D 3 .  ? 9.977  9.096  12.494  1.00 77.86 ? 94  32A A S1  1 
HETATM 728 O  O1  . 32A D 3 .  ? 4.519  6.615  13.266  0.50 63.17 ? 94  32A A O1  1 
HETATM 729 C  C11 . 32A D 3 .  ? -0.292 6.971  14.657  0.50 53.67 ? 94  32A A C11 1 
HETATM 730 C  C12 . 32A D 3 .  ? -1.191 6.201  13.700  0.50 53.55 ? 94  32A A C12 1 
HETATM 731 C  C13 . 32A D 3 .  ? -2.554 6.850  13.545  0.50 52.32 ? 94  32A A C13 1 
HETATM 732 AS AS  . CAC E 4 .  ? -0.099 19.561 -14.494 0.30 68.71 ? 95  CAC A AS  1 
HETATM 733 O  O1  . CAC E 4 .  ? 0.829  20.512 -13.367 0.30 64.01 ? 95  CAC A O1  1 
HETATM 734 O  O2  . CAC E 4 .  ? 0.419  17.888 -14.556 0.30 63.86 ? 95  CAC A O2  1 
HETATM 735 C  C1  . CAC E 4 .  ? -1.996 19.717 -14.055 0.30 64.39 ? 95  CAC A C1  1 
HETATM 736 C  C2  . CAC E 4 .  ? 0.152  20.444 -16.225 0.30 64.61 ? 95  CAC A C2  1 
HETATM 737 O  O   . HOH F 5 .  ? -2.702 -9.227 0.709   1.00 43.31 ? 96  HOH A O   1 
HETATM 738 O  O   . HOH F 5 .  ? 2.912  21.409 -5.266  1.00 53.92 ? 97  HOH A O   1 
HETATM 739 O  O   . HOH F 5 .  ? 18.667 7.969  -7.989  1.00 48.16 ? 98  HOH A O   1 
HETATM 740 O  O   . HOH F 5 .  ? 15.478 8.436  -0.173  1.00 51.98 ? 99  HOH A O   1 
HETATM 741 O  O   . HOH F 5 .  ? 7.386  22.476 10.034  1.00 43.71 ? 100 HOH A O   1 
HETATM 742 O  O   . HOH F 5 .  ? 17.678 6.473  -0.787  1.00 49.92 ? 101 HOH A O   1 
HETATM 743 O  O   . HOH F 5 .  ? 12.487 27.782 8.104   1.00 53.17 ? 102 HOH A O   1 
HETATM 744 O  O   . HOH F 5 .  ? 14.161 1.797  5.894   1.00 43.88 ? 103 HOH A O   1 
HETATM 745 O  O   . HOH F 5 .  ? -2.963 11.929 5.771   1.00 47.26 ? 104 HOH A O   1 
HETATM 746 O  O   . HOH F 5 .  ? 7.554  16.163 9.505   1.00 48.51 ? 105 HOH A O   1 
HETATM 747 O  O   . HOH F 5 .  ? -0.279 17.127 7.814   1.00 42.41 ? 106 HOH A O   1 
HETATM 748 O  O   . HOH F 5 .  ? 7.161  19.963 10.947  1.00 47.29 ? 107 HOH A O   1 
HETATM 749 O  O   . HOH F 5 .  ? 9.636  29.462 6.366   1.00 46.30 ? 108 HOH A O   1 
HETATM 750 O  O   . HOH F 5 .  ? 14.394 6.188  -9.688  1.00 47.34 ? 109 HOH A O   1 
HETATM 751 O  O   . HOH F 5 .  ? 0.917  22.177 2.451   1.00 53.22 ? 110 HOH A O   1 
HETATM 752 O  O   . HOH F 5 .  ? 10.433 23.664 -4.822  1.00 48.03 ? 111 HOH A O   1 
HETATM 753 O  O   . HOH F 5 .  ? 11.732 19.914 -11.762 1.00 50.49 ? 112 HOH A O   1 
HETATM 754 O  O   . HOH F 5 .  ? 14.776 2.824  8.290   1.00 44.36 ? 113 HOH A O   1 
HETATM 755 O  O   . HOH F 5 .  ? 12.711 4.221  9.945   1.00 51.85 ? 114 HOH A O   1 
HETATM 756 O  O   . HOH F 5 .  ? -5.691 12.266 1.538   1.00 55.80 ? 115 HOH A O   1 
HETATM 757 O  O   . HOH F 5 .  ? 7.494  13.966 12.005  1.00 57.91 ? 116 HOH A O   1 
HETATM 758 O  O   . HOH F 5 .  ? 16.997 12.204 -7.650  1.00 49.67 ? 117 HOH A O   1 
HETATM 759 O  O   . HOH F 5 .  ? 14.790 3.046  3.600   1.00 49.31 ? 118 HOH A O   1 
HETATM 760 O  O   . HOH F 5 .  ? -4.729 1.046  -4.706  1.00 44.48 ? 119 HOH A O   1 
HETATM 761 O  O   . HOH F 5 .  ? 17.487 20.463 0.412   1.00 41.09 ? 120 HOH A O   1 
HETATM 762 O  O   . HOH F 5 .  ? 3.947  11.943 -13.460 1.00 46.83 ? 121 HOH A O   1 
HETATM 763 O  O   . HOH F 5 .  ? -4.221 16.786 5.398   1.00 56.16 ? 122 HOH A O   1 
HETATM 764 O  O   . HOH F 5 .  ? 11.889 8.650  -10.867 1.00 46.19 ? 123 HOH A O   1 
HETATM 765 O  O   . HOH F 5 .  ? -2.691 15.814 -6.037  1.00 48.34 ? 124 HOH A O   1 
HETATM 766 O  O   . HOH F 5 .  ? 10.185 18.299 -10.204 1.00 48.58 ? 125 HOH A O   1 
HETATM 767 O  O   . HOH F 5 .  ? 1.856  15.721 7.601   1.00 49.22 ? 126 HOH A O   1 
HETATM 768 O  O   . HOH F 5 .  ? 17.862 23.618 11.064  1.00 54.87 ? 127 HOH A O   1 
HETATM 769 O  O   . HOH F 5 .  ? -0.510 14.910 -11.872 1.00 57.67 ? 128 HOH A O   1 
HETATM 770 O  O   . HOH F 5 .  ? 6.762  -5.689 15.911  1.00 67.18 ? 129 HOH A O   1 
HETATM 771 O  O   . HOH F 5 .  ? 8.752  15.038 -17.764 1.00 54.63 ? 130 HOH A O   1 
HETATM 772 O  O   . HOH F 5 .  ? 7.208  -4.485 18.320  1.00 40.99 ? 131 HOH A O   1 
HETATM 773 O  O   . HOH F 5 .  ? 10.232 0.007  0.000   0.50 61.69 ? 132 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  ?  ?   ?   A . n 
A 1 2  SER 2  1  1  SER SER A . n 
A 1 3  GLU 3  2  2  GLU GLU A . n 
A 1 4  LEU 4  3  3  LEU LEU A . n 
A 1 5  GLU 5  4  4  GLU GLU A . n 
A 1 6  LYS 6  5  5  LYS LYS A . n 
A 1 7  ALA 7  6  6  ALA ALA A . n 
A 1 8  VAL 8  7  7  VAL VAL A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 ALA 10 9  9  ALA ALA A . n 
A 1 11 LEU 11 10 10 LEU LEU A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 VAL 14 13 13 VAL VAL A . n 
A 1 15 PHE 15 14 14 PHE PHE A . n 
A 1 16 HIS 16 15 15 HIS HIS A . n 
A 1 17 GLN 17 16 16 GLN GLN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 SER 19 18 18 SER SER A . n 
A 1 20 GLY 20 19 19 GLY GLY A . n 
A 1 21 ARG 21 20 20 ARG ARG A . n 
A 1 22 GLU 22 21 21 GLU GLU A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 LYS 25 24 24 LYS LYS A . n 
A 1 26 HIS 26 25 25 HIS HIS A . n 
A 1 27 LYS 27 26 26 LYS LYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LYS 30 29 29 LYS LYS A . n 
A 1 31 SER 31 30 30 SER SER A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 LYS 34 33 33 LYS LYS A . n 
A 1 35 GLU 35 34 34 GLU GLU A . n 
A 1 36 LEU 36 35 35 LEU LEU A . n 
A 1 37 ILE 37 36 36 ILE ILE A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 ASN 39 38 38 ASN ASN A . n 
A 1 40 GLU 40 39 39 GLU GLU A . n 
A 1 41 LEU 41 40 40 LEU LEU A . n 
A 1 42 SER 42 41 41 SER SER A . n 
A 1 43 HIS 43 42 42 HIS HIS A . n 
A 1 44 PHE 44 43 43 PHE PHE A . n 
A 1 45 LEU 45 44 44 LEU LEU A . n 
A 1 46 GLU 46 45 45 GLU GLU A . n 
A 1 47 GLU 47 46 46 GLU GLU A . n 
A 1 48 ILE 48 47 47 ILE ILE A . n 
A 1 49 LYS 49 48 48 LYS LYS A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 GLN 51 50 50 GLN GLN A . n 
A 1 52 GLU 52 51 51 GLU GLU A . n 
A 1 53 VAL 53 52 52 VAL VAL A . n 
A 1 54 VAL 54 53 53 VAL VAL A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 LYS 56 55 55 LYS LYS A . n 
A 1 57 VAL 57 56 56 VAL VAL A . n 
A 1 58 MET 58 57 57 MET MET A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 THR 60 59 59 THR THR A . n 
A 1 61 LEU 61 60 60 LEU LEU A . n 
A 1 62 ASP 62 61 61 ASP ASP A . n 
A 1 63 SER 63 62 62 SER SER A . n 
A 1 64 ASP 64 63 63 ASP ASP A . n 
A 1 65 GLY 65 64 64 GLY GLY A . n 
A 1 66 ASP 66 65 65 ASP ASP A . n 
A 1 67 GLY 67 66 66 GLY GLY A . n 
A 1 68 GLU 68 67 67 GLU GLU A . n 
A 1 69 CYS 69 68 68 CYS CYS A . n 
A 1 70 ASP 70 69 69 ASP ASP A . n 
A 1 71 PHE 71 70 70 PHE PHE A . n 
A 1 72 GLN 72 71 71 GLN GLN A . n 
A 1 73 GLU 73 72 72 GLU GLU A . n 
A 1 74 PHE 74 73 73 PHE PHE A . n 
A 1 75 MET 75 74 74 MET MET A . n 
A 1 76 ALA 76 75 75 ALA ALA A . n 
A 1 77 PHE 77 76 76 PHE PHE A . n 
A 1 78 VAL 78 77 77 VAL VAL A . n 
A 1 79 ALA 79 78 78 ALA ALA A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 ILE 81 80 80 ILE ILE A . n 
A 1 82 THR 82 81 81 THR THR A . n 
A 1 83 THR 83 82 82 THR THR A . n 
A 1 84 ALA 84 83 83 ALA ALA A . n 
A 1 85 CYS 85 84 84 CYS CYS A . n 
A 1 86 HIS 86 85 85 HIS HIS A . n 
A 1 87 GLU 87 86 86 GLU GLU A . n 
A 1 88 PHE 88 87 87 PHE PHE A . n 
A 1 89 PHE 89 88 88 PHE PHE A . n 
A 1 90 GLU 90 89 ?  ?   ?   A . n 
A 1 91 HIS 91 90 ?  ?   ?   A . n 
A 1 92 GLU 92 91 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  92  90 CA  CA  A . 
C 2 CA  1  93  91 CA  CA  A . 
D 3 32A 1  94  1  32A 32A A . 
E 4 CAC 1  95  1  CAC CAC A . 
F 5 HOH 1  96  1  HOH HOH A . 
F 5 HOH 2  97  2  HOH HOH A . 
F 5 HOH 3  98  3  HOH HOH A . 
F 5 HOH 4  99  4  HOH HOH A . 
F 5 HOH 5  100 5  HOH HOH A . 
F 5 HOH 6  101 6  HOH HOH A . 
F 5 HOH 7  102 7  HOH HOH A . 
F 5 HOH 8  103 8  HOH HOH A . 
F 5 HOH 9  104 9  HOH HOH A . 
F 5 HOH 10 105 10 HOH HOH A . 
F 5 HOH 11 106 11 HOH HOH A . 
F 5 HOH 12 107 12 HOH HOH A . 
F 5 HOH 13 108 13 HOH HOH A . 
F 5 HOH 14 109 14 HOH HOH A . 
F 5 HOH 15 110 15 HOH HOH A . 
F 5 HOH 16 111 16 HOH HOH A . 
F 5 HOH 17 112 17 HOH HOH A . 
F 5 HOH 18 113 18 HOH HOH A . 
F 5 HOH 19 114 19 HOH HOH A . 
F 5 HOH 20 115 20 HOH HOH A . 
F 5 HOH 21 116 21 HOH HOH A . 
F 5 HOH 22 117 22 HOH HOH A . 
F 5 HOH 23 118 23 HOH HOH A . 
F 5 HOH 24 119 24 HOH HOH A . 
F 5 HOH 25 120 25 HOH HOH A . 
F 5 HOH 26 121 26 HOH HOH A . 
F 5 HOH 27 122 27 HOH HOH A . 
F 5 HOH 28 123 28 HOH HOH A . 
F 5 HOH 29 124 29 HOH HOH A . 
F 5 HOH 30 125 30 HOH HOH A . 
F 5 HOH 31 126 31 HOH HOH A . 
F 5 HOH 32 127 32 HOH HOH A . 
F 5 HOH 33 128 33 HOH HOH A . 
F 5 HOH 34 129 34 HOH HOH A . 
F 5 HOH 35 130 35 HOH HOH A . 
F 5 HOH 36 131 36 HOH HOH A . 
F 5 HOH 37 132 37 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3010 ? 
1 MORE         -75  ? 
1 'SSA (A^2)'  9900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     132 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 108.3 ? 
2  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 79.6  ? 
3  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 94.2  ? 
4  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 84.3  ? 
5  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 159.6 ? 
6  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 71.8  ? 
7  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 94.4  ? 
8  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 117.0 ? 
9  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 148.4 ? 
10 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 76.7  ? 
11 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 78.0  ? 
12 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 78.5  ? 
13 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 152.8 ? 
14 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 120.6 ? 
15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 49.4  ? 
16 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 162.3 ? 
17 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 84.8  ? 
18 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 87.8  ? 
19 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 80.0  ? 
20 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 89.8  ? 
21 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 92 ? 1_555 O   ? F HOH .  ? A HOH 125 ? 1_555 117.1 ? 
22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 86.8  ? 
23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 88.0  ? 
24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 77.5  ? 
25 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 90.3  ? 
26 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 157.3 ? 
27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 79.9  ? 
28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 119.6 ? 
29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 121.1 ? 
30 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 145.4 ? 
31 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 79.6  ? 
32 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 99.3  ? 
33 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 75.5  ? 
34 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 151.5 ? 
35 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 127.1 ? 
36 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 50.5  ? 
37 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 159.5 ? 
38 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 84.8  ? 
39 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 71.9  ? 
40 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 90.3  ? 
41 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 80.6  ? 
42 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? C CA . ? A CA 93 ? 1_555 O   ? F HOH .  ? A HOH 117 ? 1_555 96.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-09 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         7.3111 
_pdbx_refine_tls.origin_y         11.2699 
_pdbx_refine_tls.origin_z         0.0091 
_pdbx_refine_tls.T[1][1]          -0.0939 
_pdbx_refine_tls.T[2][2]          -0.0707 
_pdbx_refine_tls.T[3][3]          -0.1272 
_pdbx_refine_tls.T[1][2]          0.0578 
_pdbx_refine_tls.T[1][3]          0.0237 
_pdbx_refine_tls.T[2][3]          -0.0156 
_pdbx_refine_tls.L[1][1]          3.4146 
_pdbx_refine_tls.L[2][2]          8.3282 
_pdbx_refine_tls.L[3][3]          1.6014 
_pdbx_refine_tls.L[1][2]          1.5802 
_pdbx_refine_tls.L[1][3]          0.2468 
_pdbx_refine_tls.L[2][3]          0.7299 
_pdbx_refine_tls.S[1][1]          0.0623 
_pdbx_refine_tls.S[2][2]          -0.0978 
_pdbx_refine_tls.S[3][3]          0.0355 
_pdbx_refine_tls.S[1][2]          -0.0274 
_pdbx_refine_tls.S[1][3]          0.0204 
_pdbx_refine_tls.S[2][3]          -0.1568 
_pdbx_refine_tls.S[2][1]          -0.3071 
_pdbx_refine_tls.S[3][1]          -0.2201 
_pdbx_refine_tls.S[3][2]          -0.0408 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1  A 88  ? 'X-RAY DIFFRACTION' . . . . ? 
2 1 A 96 A 132 ? 'X-RAY DIFFRACTION' . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3GK1 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           22.800 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        22.800 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 2 
PHASER      .     ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 3 
REFMAC      .     ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 5 
HKL-2000    .     ?               ?       ?                    ?                           'data reduction'  ? ?          ? 6 
HKL-2000    .     ?               ?       ?                    ?                           'data scaling'    ? ?          ? 7 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   PHE 
_pdbx_validate_close_contact.auth_seq_id_1    88 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    131 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 0  ? A MET 1  
2 1 Y 1 A GLU 89 ? A GLU 90 
3 1 Y 1 A HIS 90 ? A HIS 91 
4 1 Y 1 A GLU 91 ? A GLU 92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                                                             CA  
3 '2-[(5-hex-1-yn-1-ylfuran-2-yl)carbonyl]-N-methylhydrazinecarbothioamide' 32A 
4 'CACODYLATE ION'                                                          CAC 
5 water                                                                     HOH 
#