data_3GTL
# 
_entry.id   3GTL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GTL         
NDB   PH0056       
RCSB  RCSB052290   
WWPDB D_1000052290 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3GTG 'Backtracked RNA polymerase II complex with 12mer RNA'    unspecified 
PDB 3GTJ 'Backtracked RNA polymerase II complex with 13mer RNA'    unspecified 
PDB 3GTK 'Backtracked RNA polymerase II complex with 18mer RNA'    unspecified 
PDB 3GTM 'Co-complex of Backtracked RNA polymerase II with TFIIS'  unspecified 
PDB 3GTO 'Backtracked RNA polymerase II complex with 15mer RNA'    unspecified 
PDB 3GTP 'Backtracked RNA polymerase II complex with 24mer RNA'    unspecified 
PDB 3GTQ 'Backtracked RNA polymerase II complex induced by damage' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GTL 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, D.'       1 
'Bushnell, D.A.' 2 
'Huang, X.'      3 
'Westover, K.D.' 4 
'Levitt, M.'     5 
'Kornberg, R.D.' 6 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            324 
_citation.page_first                1203 
_citation.page_last                 1206 
_citation.year                      2009 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19478184 
_citation.pdbx_database_id_DOI      10.1126/science.1168729 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, D.'       1 
primary 'Bushnell, D.A.' 2 
primary 'Huang, X.'      3 
primary 'Westover, K.D.' 4 
primary 'Levitt, M.'     5 
primary 'Kornberg, R.D.' 6 
# 
_cell.entry_id           3GTL 
_cell.length_a           170.531 
_cell.length_b           222.282 
_cell.length_c           194.813 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.19 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GTL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                191821.578 1 2.7.7.6 ? 
'DNA-directed RNA polymerase II largest subunit'                   ?                         
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138937.297 1 2.7.7.6 ? 
'DNA-directed RNA polymerase II 140 kDa polypeptide'               ?                         
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                35330.457  1 ?       ? 
'DNA-directed RNA polymerase II 45 kDa polypeptide'                ?                         
4  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? 
'DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide'   ?                         
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? 
'DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide'   ?                         
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? 
'DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide' ?                         
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                14308.161  1 ?       ? 
'DNA-directed RNA polymerase II subunit 9'                         ?                         
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? 
'DNA-directed RNA polymerases I/II/III subunit 10'                 ?                         
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               13633.493  1 ?       ? 
'DNA-directed RNA polymerase II 13.6 kDa polypeptide'              ?                         
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? 
'DNA-directed RNA polymerases I, II, and III 7.7 kDa polypeptide'  ?                         
11 polymer     syn 
;RNA (5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*AP*UP*UP*C)-3')
;
4181.549   1 ?       ? 'RNA strand'                                                       'RNA strand'              
12 polymer     syn 'DNA (28-MER)'                                               8534.519   1 ?       ? 'DNA template strand' 
'DNA template strand'     
13 polymer     syn 
;DNA (5'-D(*CP*TP*GP*CP*TP*TP*AP*TP*CP*GP*GP*TP*AP*G)-3')
;
4286.789   1 ?       ? 'DNA non-template strand'                                          'DNA non-template strand' 
14 non-polymer syn 'ZINC ION'                                                   65.409     8 ?       ? ? ?                         
15 non-polymer syn 'MAGNESIUM ION'                                              24.305     1 ?       ? ? ?                         
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit B1, RNA polymerase II subunit 1, DNA-directed RNA polymerase III largest subunit, RNA polymerase II subunit B220
;
2  'RNA polymerase II subunit 2, DNA-directed RNA polymerase II 140 kDa polypeptide, B150' 
3  'RNA polymerase II subunit B3, RNA polymerase II subunit 3, DNA-directed RNA polymerase II 45 kDa polypeptide, B44.5' 
4  'RNA polymerases I, II, and III subunit ABC1, DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide, ABC27' 
5  'RNA polymerases I, II, and III subunit ABC2, DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide, ABC23' 
6  
'RNA polymerases I, II, and III subunit ABC3, DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide, ABC14.5, ABC14.4' 
7  
'RNA polymerase II subunit B9, DNA-directed RNA polymerase II subunit 9, DNA-directed RNA polymerase II 14.2 kDa polypeptide, B12.6' 
8  
'RNA polymerases I, II, and III subunit ABC5, DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide, ABC10-beta, ABC8' 
9  'RNA polymerase II subunit B11, DNA-directed RNA polymerase II 13.6 kDa polypeptide, B13.6' 
10 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
5  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
6  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
7  'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
8  'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
9  'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
10 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
11 polyribonucleotide      no no AUCGAGAGGAUUC AUCGAGAGGAUUC R ? 
12 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DC)(DC)(DG)(DA)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DA)(DC)(DG)(DA)(DT)(DC)
(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
CTACCGATAAGCAGACGATCCTCTCGAT T ? 
13 polydeoxyribonucleotide no no '(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DT)(DC)(DG)(DG)(DT)(DA)(DG)' CTGCTTATCGGTAG N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASP n 
4  3    GLN n 
4  4    GLU n 
4  5    ASN n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ILE n 
4  10   SER n 
4  11   ARG n 
4  12   LEU n 
4  13   TRP n 
4  14   ARG n 
4  15   ALA n 
4  16   PHE n 
4  17   ARG n 
4  18   THR n 
4  19   VAL n 
4  20   LYS n 
4  21   GLU n 
4  22   MET n 
4  23   VAL n 
4  24   LYS n 
4  25   ASP n 
4  26   ARG n 
4  27   GLY n 
4  28   TYR n 
4  29   PHE n 
4  30   ILE n 
4  31   THR n 
4  32   GLN n 
4  33   GLU n 
4  34   GLU n 
4  35   VAL n 
4  36   GLU n 
4  37   LEU n 
4  38   PRO n 
4  39   LEU n 
4  40   GLU n 
4  41   ASP n 
4  42   PHE n 
4  43   LYS n 
4  44   ALA n 
4  45   LYS n 
4  46   TYR n 
4  47   CYS n 
4  48   ASP n 
4  49   SER n 
4  50   MET n 
4  51   GLY n 
4  52   ARG n 
4  53   PRO n 
4  54   GLN n 
4  55   ARG n 
4  56   LYS n 
4  57   MET n 
4  58   MET n 
4  59   SER n 
4  60   PHE n 
4  61   GLN n 
4  62   ALA n 
4  63   ASN n 
4  64   PRO n 
4  65   THR n 
4  66   GLU n 
4  67   GLU n 
4  68   SER n 
4  69   ILE n 
4  70   SER n 
4  71   LYS n 
4  72   PHE n 
4  73   PRO n 
4  74   ASP n 
4  75   MET n 
4  76   GLY n 
4  77   SER n 
4  78   LEU n 
4  79   TRP n 
4  80   VAL n 
4  81   GLU n 
4  82   PHE n 
4  83   CYS n 
4  84   ASP n 
4  85   GLU n 
4  86   PRO n 
4  87   SER n 
4  88   VAL n 
4  89   GLY n 
4  90   VAL n 
4  91   LYS n 
4  92   THR n 
4  93   MET n 
4  94   LYS n 
4  95   THR n 
4  96   PHE n 
4  97   VAL n 
4  98   ILE n 
4  99   HIS n 
4  100  ILE n 
4  101  GLN n 
4  102  GLU n 
4  103  LYS n 
4  104  ASN n 
4  105  PHE n 
4  106  GLN n 
4  107  THR n 
4  108  GLY n 
4  109  ILE n 
4  110  PHE n 
4  111  VAL n 
4  112  TYR n 
4  113  GLN n 
4  114  ASN n 
4  115  ASN n 
4  116  ILE n 
4  117  THR n 
4  118  PRO n 
4  119  SER n 
4  120  ALA n 
4  121  MET n 
4  122  LYS n 
4  123  LEU n 
4  124  VAL n 
4  125  PRO n 
4  126  SER n 
4  127  ILE n 
4  128  PRO n 
4  129  PRO n 
4  130  ALA n 
4  131  THR n 
4  132  ILE n 
4  133  GLU n 
4  134  THR n 
4  135  PHE n 
4  136  ASN n 
4  137  GLU n 
4  138  ALA n 
4  139  ALA n 
4  140  LEU n 
4  141  VAL n 
4  142  VAL n 
4  143  ASN n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  HIS n 
4  148  GLU n 
4  149  LEU n 
4  150  VAL n 
4  151  PRO n 
4  152  LYS n 
4  153  HIS n 
4  154  ILE n 
4  155  ARG n 
4  156  LEU n 
4  157  SER n 
4  158  SER n 
4  159  ASP n 
4  160  GLU n 
4  161  LYS n 
4  162  ARG n 
4  163  GLU n 
4  164  LEU n 
4  165  LEU n 
4  166  LYS n 
4  167  ARG n 
4  168  TYR n 
4  169  ARG n 
4  170  LEU n 
4  171  LYS n 
4  172  GLU n 
4  173  SER n 
4  174  GLN n 
4  175  LEU n 
4  176  PRO n 
4  177  ARG n 
4  178  ILE n 
4  179  GLN n 
4  180  ARG n 
4  181  ALA n 
4  182  ASP n 
4  183  PRO n 
4  184  VAL n 
4  185  ALA n 
4  186  LEU n 
4  187  TYR n 
4  188  LEU n 
4  189  GLY n 
4  190  LEU n 
4  191  LYS n 
4  192  ARG n 
4  193  GLY n 
4  194  GLU n 
4  195  VAL n 
4  196  VAL n 
4  197  LYS n 
4  198  ILE n 
4  199  ILE n 
4  200  ARG n 
4  201  LYS n 
4  202  SER n 
4  203  GLU n 
4  204  THR n 
4  205  SER n 
4  206  GLY n 
4  207  ARG n 
4  208  TYR n 
4  209  ALA n 
4  210  SER n 
4  211  TYR n 
4  212  ARG n 
4  213  ILE n 
4  214  CYS n 
4  215  MET n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    TYR n 
5  5    GLU n 
5  6    GLU n 
5  7    ALA n 
5  8    PHE n 
5  9    ASN n 
5  10   ASP n 
5  11   GLY n 
5  12   ASN n 
5  13   GLU n 
5  14   ASN n 
5  15   PHE n 
5  16   GLU n 
5  17   ASP n 
5  18   PHE n 
5  19   ASP n 
5  20   VAL n 
5  21   GLU n 
5  22   HIS n 
5  23   PHE n 
5  24   SER n 
5  25   ASP n 
5  26   GLU n 
5  27   GLU n 
5  28   THR n 
5  29   TYR n 
5  30   GLU n 
5  31   GLU n 
5  32   LYS n 
5  33   PRO n 
5  34   GLN n 
5  35   PHE n 
5  36   LYS n 
5  37   ASP n 
5  38   GLY n 
5  39   GLU n 
5  40   THR n 
5  41   THR n 
5  42   ASP n 
5  43   ALA n 
5  44   ASN n 
5  45   GLY n 
5  46   LYS n 
5  47   THR n 
5  48   ILE n 
5  49   VAL n 
5  50   THR n 
5  51   GLY n 
5  52   GLY n 
5  53   ASN n 
5  54   GLY n 
5  55   PRO n 
5  56   GLU n 
5  57   ASP n 
5  58   PHE n 
5  59   GLN n 
5  60   GLN n 
5  61   HIS n 
5  62   GLU n 
5  63   GLN n 
5  64   ILE n 
5  65   ARG n 
5  66   ARG n 
5  67   LYS n 
5  68   THR n 
5  69   LEU n 
5  70   LYS n 
5  71   GLU n 
5  72   LYS n 
5  73   ALA n 
5  74   ILE n 
5  75   PRO n 
5  76   LYS n 
5  77   ASP n 
5  78   GLN n 
5  79   ARG n 
5  80   ALA n 
5  81   THR n 
5  82   THR n 
5  83   PRO n 
5  84   TYR n 
5  85   MET n 
5  86   THR n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ARG n 
5  91   ALA n 
5  92   ARG n 
5  93   ILE n 
5  94   LEU n 
5  95   GLY n 
5  96   THR n 
5  97   ARG n 
5  98   ALA n 
5  99   LEU n 
5  100  GLN n 
5  101  ILE n 
5  102  SER n 
5  103  MET n 
5  104  ASN n 
5  105  ALA n 
5  106  PRO n 
5  107  VAL n 
5  108  PHE n 
5  109  VAL n 
5  110  ASP n 
5  111  LEU n 
5  112  GLU n 
5  113  GLY n 
5  114  GLU n 
5  115  THR n 
5  116  ASP n 
5  117  PRO n 
5  118  LEU n 
5  119  ARG n 
5  120  ILE n 
5  121  ALA n 
5  122  MET n 
5  123  LYS n 
5  124  GLU n 
5  125  LEU n 
5  126  ALA n 
5  127  GLU n 
5  128  LYS n 
5  129  LYS n 
5  130  ILE n 
5  131  PRO n 
5  132  LEU n 
5  133  VAL n 
5  134  ILE n 
5  135  ARG n 
5  136  ARG n 
5  137  TYR n 
5  138  LEU n 
5  139  PRO n 
5  140  ASP n 
5  141  GLY n 
5  142  SER n 
5  143  PHE n 
5  144  GLU n 
5  145  ASP n 
5  146  TRP n 
5  147  SER n 
5  148  VAL n 
5  149  GLU n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  VAL n 
5  154  ASP n 
5  155  LEU n 
6  1    MET n 
6  2    SER n 
6  3    ASN n 
6  4    THR n 
6  5    LEU n 
6  6    PHE n 
6  7    ASP n 
6  8    ASP n 
6  9    ILE n 
6  10   PHE n 
6  11   GLN n 
6  12   VAL n 
6  13   SER n 
6  14   GLU n 
6  15   VAL n 
6  16   ASP n 
6  17   PRO n 
6  18   GLY n 
6  19   ARG n 
6  20   TYR n 
6  21   ASN n 
6  22   LYS n 
6  23   VAL n 
6  24   CYS n 
6  25   ARG n 
6  26   ILE n 
6  27   GLU n 
6  28   ALA n 
6  29   ALA n 
6  30   SER n 
6  31   THR n 
6  32   THR n 
6  33   GLN n 
6  34   ASP n 
6  35   GLN n 
6  36   CYS n 
6  37   LYS n 
6  38   LEU n 
6  39   THR n 
6  40   LEU n 
6  41   ASP n 
6  42   ILE n 
6  43   ASN n 
6  44   VAL n 
6  45   GLU n 
6  46   LEU n 
6  47   PHE n 
6  48   PRO n 
6  49   VAL n 
6  50   ALA n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   SER n 
6  55   LEU n 
6  56   THR n 
6  57   VAL n 
6  58   THR n 
6  59   ILE n 
6  60   ALA n 
6  61   SER n 
6  62   SER n 
6  63   LEU n 
6  64   ASN n 
6  65   LEU n 
6  66   GLU n 
6  67   ASP n 
6  68   THR n 
6  69   PRO n 
6  70   ALA n 
6  71   ASN n 
6  72   ASP n 
6  73   SER n 
6  74   SER n 
6  75   ALA n 
6  76   THR n 
6  77   ARG n 
6  78   SER n 
6  79   TRP n 
6  80   ARG n 
6  81   PRO n 
6  82   PRO n 
6  83   GLN n 
6  84   ALA n 
6  85   GLY n 
6  86   ASP n 
6  87   ARG n 
6  88   SER n 
6  89   LEU n 
6  90   ALA n 
6  91   ASP n 
6  92   ASP n 
6  93   TYR n 
6  94   ASP n 
6  95   TYR n 
6  96   VAL n 
6  97   MET n 
6  98   TYR n 
6  99   GLY n 
6  100  THR n 
6  101  ALA n 
6  102  TYR n 
6  103  LYS n 
6  104  PHE n 
6  105  GLU n 
6  106  GLU n 
6  107  VAL n 
6  108  SER n 
6  109  LYS n 
6  110  ASP n 
6  111  LEU n 
6  112  ILE n 
6  113  ALA n 
6  114  VAL n 
6  115  TYR n 
6  116  TYR n 
6  117  SER n 
6  118  PHE n 
6  119  GLY n 
6  120  GLY n 
6  121  LEU n 
6  122  LEU n 
6  123  MET n 
6  124  ARG n 
6  125  LEU n 
6  126  GLU n 
6  127  GLY n 
6  128  ASN n 
6  129  TYR n 
6  130  ARG n 
6  131  ASN n 
6  132  LEU n 
6  133  ASN n 
6  134  ASN n 
6  135  LEU n 
6  136  LYS n 
6  137  GLN n 
6  138  GLU n 
6  139  ASN n 
6  140  ALA n 
6  141  TYR n 
6  142  LEU n 
6  143  LEU n 
6  144  ILE n 
6  145  ARG n 
6  146  ARG n 
7  1    MET n 
7  2    THR n 
7  3    THR n 
7  4    PHE n 
7  5    ARG n 
7  6    PHE n 
7  7    CYS n 
7  8    ARG n 
7  9    ASP n 
7  10   CYS n 
7  11   ASN n 
7  12   ASN n 
7  13   MET n 
7  14   LEU n 
7  15   TYR n 
7  16   PRO n 
7  17   ARG n 
7  18   GLU n 
7  19   ASP n 
7  20   LYS n 
7  21   GLU n 
7  22   ASN n 
7  23   ASN n 
7  24   ARG n 
7  25   LEU n 
7  26   LEU n 
7  27   PHE n 
7  28   GLU n 
7  29   CYS n 
7  30   ARG n 
7  31   THR n 
7  32   CYS n 
7  33   SER n 
7  34   TYR n 
7  35   VAL n 
7  36   GLU n 
7  37   GLU n 
7  38   ALA n 
7  39   GLY n 
7  40   SER n 
7  41   PRO n 
7  42   LEU n 
7  43   VAL n 
7  44   TYR n 
7  45   ARG n 
7  46   HIS n 
7  47   GLU n 
7  48   LEU n 
7  49   ILE n 
7  50   THR n 
7  51   ASN n 
7  52   ILE n 
7  53   GLY n 
7  54   GLU n 
7  55   THR n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   VAL n 
7  60   GLN n 
7  61   ASP n 
7  62   ILE n 
7  63   GLY n 
7  64   SER n 
7  65   ASP n 
7  66   PRO n 
7  67   THR n 
7  68   LEU n 
7  69   PRO n 
7  70   ARG n 
7  71   SER n 
7  72   ASP n 
7  73   ARG n 
7  74   GLU n 
7  75   CYS n 
7  76   PRO n 
7  77   LYS n 
7  78   CYS n 
7  79   HIS n 
7  80   SER n 
7  81   ARG n 
7  82   GLU n 
7  83   ASN n 
7  84   VAL n 
7  85   PHE n 
7  86   PHE n 
7  87   GLN n 
7  88   SER n 
7  89   GLN n 
7  90   GLN n 
7  91   ARG n 
7  92   ARG n 
7  93   LYS n 
7  94   ASP n 
7  95   THR n 
7  96   SER n 
7  97   MET n 
7  98   VAL n 
7  99   LEU n 
7  100  PHE n 
7  101  PHE n 
7  102  VAL n 
7  103  CYS n 
7  104  LEU n 
7  105  SER n 
7  106  CYS n 
7  107  SER n 
7  108  HIS n 
7  109  ILE n 
7  110  PHE n 
7  111  THR n 
7  112  SER n 
7  113  ASP n 
7  114  GLN n 
7  115  LYS n 
7  116  ASN n 
7  117  LYS n 
7  118  ARG n 
7  119  THR n 
7  120  GLN n 
7  121  PHE n 
7  122  SER n 
8  1    MET n 
8  2    ILE n 
8  3    VAL n 
8  4    PRO n 
8  5    VAL n 
8  6    ARG n 
8  7    CYS n 
8  8    PHE n 
8  9    SER n 
8  10   CYS n 
8  11   GLY n 
8  12   LYS n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   ASP n 
8  17   LYS n 
8  18   TRP n 
8  19   GLU n 
8  20   SER n 
8  21   TYR n 
8  22   LEU n 
8  23   ASN n 
8  24   LEU n 
8  25   LEU n 
8  26   GLN n 
8  27   GLU n 
8  28   ASP n 
8  29   GLU n 
8  30   LEU n 
8  31   ASP n 
8  32   GLU n 
8  33   GLY n 
8  34   THR n 
8  35   ALA n 
8  36   LEU n 
8  37   SER n 
8  38   ARG n 
8  39   LEU n 
8  40   GLY n 
8  41   LEU n 
8  42   LYS n 
8  43   ARG n 
8  44   TYR n 
8  45   CYS n 
8  46   CYS n 
8  47   ARG n 
8  48   ARG n 
8  49   MET n 
8  50   ILE n 
8  51   LEU n 
8  52   THR n 
8  53   HIS n 
8  54   VAL n 
8  55   ASP n 
8  56   LEU n 
8  57   ILE n 
8  58   GLU n 
8  59   LYS n 
8  60   PHE n 
8  61   LEU n 
8  62   ARG n 
8  63   TYR n 
8  64   ASN n 
8  65   PRO n 
8  66   LEU n 
8  67   GLU n 
8  68   LYS n 
8  69   ARG n 
8  70   ASP n 
9  1    MET n 
9  2    ASN n 
9  3    ALA n 
9  4    PRO n 
9  5    ASP n 
9  6    ARG n 
9  7    PHE n 
9  8    GLU n 
9  9    LEU n 
9  10   PHE n 
9  11   LEU n 
9  12   LEU n 
9  13   GLY n 
9  14   GLU n 
9  15   GLY n 
9  16   GLU n 
9  17   SER n 
9  18   LYS n 
9  19   LEU n 
9  20   LYS n 
9  21   ILE n 
9  22   ASP n 
9  23   PRO n 
9  24   ASP n 
9  25   THR n 
9  26   LYS n 
9  27   ALA n 
9  28   PRO n 
9  29   ASN n 
9  30   ALA n 
9  31   VAL n 
9  32   VAL n 
9  33   ILE n 
9  34   THR n 
9  35   PHE n 
9  36   GLU n 
9  37   LYS n 
9  38   GLU n 
9  39   ASP n 
9  40   HIS n 
9  41   THR n 
9  42   LEU n 
9  43   GLY n 
9  44   ASN n 
9  45   LEU n 
9  46   ILE n 
9  47   ARG n 
9  48   ALA n 
9  49   GLU n 
9  50   LEU n 
9  51   LEU n 
9  52   ASN n 
9  53   ASP n 
9  54   ARG n 
9  55   LYS n 
9  56   VAL n 
9  57   LEU n 
9  58   PHE n 
9  59   ALA n 
9  60   ALA n 
9  61   TYR n 
9  62   LYS n 
9  63   VAL n 
9  64   GLU n 
9  65   HIS n 
9  66   PRO n 
9  67   PHE n 
9  68   PHE n 
9  69   ALA n 
9  70   ARG n 
9  71   PHE n 
9  72   LYS n 
9  73   LEU n 
9  74   ARG n 
9  75   ILE n 
9  76   GLN n 
9  77   THR n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TYR n 
9  82   ASP n 
9  83   PRO n 
9  84   LYS n 
9  85   ASP n 
9  86   ALA n 
9  87   LEU n 
9  88   LYS n 
9  89   ASN n 
9  90   ALA n 
9  91   CYS n 
9  92   ASN n 
9  93   SER n 
9  94   ILE n 
9  95   ILE n 
9  96   ASN n 
9  97   LYS n 
9  98   LEU n 
9  99   GLY n 
9  100  ALA n 
9  101  LEU n 
9  102  LYS n 
9  103  THR n 
9  104  ASN n 
9  105  PHE n 
9  106  GLU n 
9  107  THR n 
9  108  GLU n 
9  109  TRP n 
9  110  ASN n 
9  111  LEU n 
9  112  GLN n 
9  113  THR n 
9  114  LEU n 
9  115  ALA n 
9  116  ALA n 
9  117  ASP n 
9  118  ASP n 
9  119  ALA n 
9  120  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ARG n 
10 4    GLU n 
10 5    GLY n 
10 6    PHE n 
10 7    GLN n 
10 8    ILE n 
10 9    PRO n 
10 10   THR n 
10 11   ASN n 
10 12   LEU n 
10 13   ASP n 
10 14   ALA n 
10 15   ALA n 
10 16   ALA n 
10 17   ALA n 
10 18   GLY n 
10 19   THR n 
10 20   SER n 
10 21   GLN n 
10 22   ALA n 
10 23   ARG n 
10 24   THR n 
10 25   ALA n 
10 26   THR n 
10 27   LEU n 
10 28   LYS n 
10 29   TYR n 
10 30   ILE n 
10 31   CYS n 
10 32   ALA n 
10 33   GLU n 
10 34   CYS n 
10 35   SER n 
10 36   SER n 
10 37   LYS n 
10 38   LEU n 
10 39   SER n 
10 40   LEU n 
10 41   SER n 
10 42   ARG n 
10 43   THR n 
10 44   ASP n 
10 45   ALA n 
10 46   VAL n 
10 47   ARG n 
10 48   CYS n 
10 49   LYS n 
10 50   ASP n 
10 51   CYS n 
10 52   GLY n 
10 53   HIS n 
10 54   ARG n 
10 55   ILE n 
10 56   LEU n 
10 57   LEU n 
10 58   LYS n 
10 59   ALA n 
10 60   ARG n 
10 61   THR n 
10 62   LYS n 
10 63   ARG n 
10 64   LEU n 
10 65   VAL n 
10 66   GLN n 
10 67   PHE n 
10 68   GLU n 
10 69   ALA n 
10 70   ARG n 
11 1    A   n 
11 2    U   n 
11 3    C   n 
11 4    G   n 
11 5    A   n 
11 6    G   n 
11 7    A   n 
11 8    G   n 
11 9    G   n 
11 10   A   n 
11 11   U   n 
11 12   U   n 
11 13   C   n 
12 1    DC  n 
12 2    DT  n 
12 3    DA  n 
12 4    DC  n 
12 5    DC  n 
12 6    DG  n 
12 7    DA  n 
12 8    DT  n 
12 9    DA  n 
12 10   DA  n 
12 11   DG  n 
12 12   DC  n 
12 13   DA  n 
12 14   DG  n 
12 15   DA  n 
12 16   DC  n 
12 17   DG  n 
12 18   DA  n 
12 19   DT  n 
12 20   DC  n 
12 21   DC  n 
12 22   DT  n 
12 23   DC  n 
12 24   DT  n 
12 25   DC  n 
12 26   DG  n 
12 27   DA  n 
12 28   DT  n 
13 1    DC  n 
13 2    DT  n 
13 3    DG  n 
13 4    DC  n 
13 5    DT  n 
13 6    DT  n 
13 7    DA  n 
13 8    DT  n 
13 9    DC  n 
13 10   DG  n 
13 11   DG  n 
13 12   DT  n 
13 13   DA  n 
13 14   DG  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? yeast 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
11 1 sample ? ? ? ? ? 'Synthetic RNA'              
12 1 sample ? ? ? ? ? 'Synthetic template DNA'     
13 1 sample ? ? ? ? ? 'Synthetic non-template DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 ? 
2  UNP RPB2_YEAST  P08518 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 ? 
3  UNP RPB3_YEAST  P16370 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 ? 
4  UNP RPAB1_YEAST P20434 4  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 ? 
5  UNP RPAB2_YEAST P20435 5  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 ? 
6  UNP RPAB3_YEAST P20436 6  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 ? 
7  UNP RPB9_YEAST  P27999 7  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 ? 
8  UNP RPAB5_YEAST P22139 8  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 ? 
9  UNP RPB11_YEAST P38902 9  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 ? 
10 UNP RPAB4_YEAST P40422 10 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 ? 
11 PDB 3GTL        3GTL   11 AUCGAGAGGAUUC 1 ? 
12 PDB 3GTL        3GTL   12 CTACCGATAAGCAGACGATCCTCTCGAT 1 ? 
13 PDB 3GTL        3GTL   13 CTGCTTATCGGTAG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3GTL A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  3GTL B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  3GTL C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  3GTL E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  3GTL F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  3GTL H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  3GTL I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  3GTL J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  3GTL K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 3GTL L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 3GTL R 1 ? 13   ? 3GTL   1 ? 13   ? 1 13   
12 12 3GTL T 1 ? 28   ? 3GTL   1 ? 28   ? 1 28   
13 13 3GTL N 1 ? 14   ? 3GTL   1 ? 14   ? 1 14   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          3GTL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.71 
_exptl_crystal.density_percent_sol   66.83 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'390mM (NH4)2HPO4/NaH2PO4, pH 6.0, 50mM Dioxane, 10mM DTT, 9-11% PEG 6000, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 '(NH4)2HPO4/NaH2PO4' ? ? ? 
1 2 1 Dioxane              ? ? ? 
1 3 1 DTT                  ? ? ? 
1 4 1 'PEG 6000'           ? ? ? 
1 5 2 '(NH4)2HPO4/NaH2PO4' ? ? ? 
1 6 2 Dioxane              ? ? ? 
1 7 2 DTT                  ? ? ? 
1 8 2 'PEG 6000'           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-06-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     3GTL 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.38 
_reflns.number_obs                   90557 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.38 
_reflns_shell.d_res_low              3.50 
_reflns_shell.percent_possible_all   89.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GTL 
_refine.ls_number_reflns_obs                     85851 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            3.38 
_refine.ls_percent_reflns_obs                    91.06 
_refine.ls_R_factor_obs                          0.27285 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.27028 
_refine.ls_R_factor_R_free                       0.32168 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4515 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.908 
_refine.correlation_coeff_Fo_to_Fc_free          0.876 
_refine.B_iso_mean                               96.182 
_refine.aniso_B[1][1]                            1.57 
_refine.aniso_B[2][2]                            -4.39 
_refine.aniso_B[3][3]                            -2.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -11.68 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 3GTG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.666 
_refine.overall_SU_ML                            0.641 
_refine.overall_SU_B                             89.441 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28140 
_refine_hist.pdbx_number_atoms_nucleic_acid   1107 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29256 
_refine_hist.d_res_high                       3.38 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 29906 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.613  2.016  ? 40616 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.947  5.000  ? 3518  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.538 24.029 ? 1333  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       24.019 15.000 ? 5251  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.674 15.000 ? 222   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.110  0.200  ? 4569  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 22004 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.273  0.200  ? 14930 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.319  0.200  ? 19501 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.211  0.200  ? 1054  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.295  0.200  ? 53    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.284  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.656  1.500  ? 18105 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.168  2.000  ? 28569 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.071  3.000  ? 13527 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.882  4.500  ? 12047 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.38 
_refine_ls_shell.d_res_low                        3.47 
_refine_ls_shell.number_reflns_R_work             5108 
_refine_ls_shell.R_factor_R_work                  0.430 
_refine_ls_shell.percent_reflns_obs               74.03 
_refine_ls_shell.R_factor_R_free                  0.450 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             293 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GTL 
_struct.title                     'Backtracked RNA polymerase II complex with 13mer with G<>U mismatch' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase II subunit RPB1 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB2 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GTL 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA-RNA HYBRID' 
_struct_keywords.text            
;TRANSCRIPTION, TRANSFERASE, DNA-RNA HYBRID, Backtrack, DNA-directed RNA polymerase, DNA binding, Isopeptide bond, Magnesium, Metal binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Zinc-finger, DNA damage, DNA repair, TRANSFERASE-DNA-RNA HYBRID COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 15 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 14 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'ASYMMETRIC UNIT IS THE BIOLOGICAL UNIT' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? CYS A 103  ? PHE A 95   CYS A 103  1 ? 9  
HELX_P HELX_P3   3   LEU A 121  ? ALA A 125  ? LEU A 121  ALA A 125  5 ? 5  
HELX_P HELX_P4   4   ASP A 130  ? THR A 140  ? ASP A 130  THR A 140  1 ? 11 
HELX_P HELX_P5   5   SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P8   8   ASP A 261  ? ALA A 272  ? ASP A 261  ALA A 272  1 ? 12 
HELX_P HELX_P9   9   PRO A 285  ? HIS A 287  ? PRO A 285  HIS A 287  5 ? 3  
HELX_P HELX_P10  10  ALA A 288  ? LEU A 295  ? ALA A 288  LEU A 295  1 ? 8  
HELX_P HELX_P11  11  LEU A 296  ? MET A 304  ? LEU A 296  MET A 304  1 ? 9  
HELX_P HELX_P12  12  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P13  13  ASN A 384  ? ASN A 394  ? ASN A 384  ASN A 394  1 ? 11 
HELX_P HELX_P14  14  HIS A 451  ? MET A 455  ? HIS A 451  MET A 455  5 ? 5  
HELX_P HELX_P15  15  ASN A 471  ? THR A 475  ? ASN A 471  THR A 475  5 ? 5  
HELX_P HELX_P16  16  SER A 494  ? GLN A 503  ? SER A 494  GLN A 503  1 ? 10 
HELX_P HELX_P17  17  VAL A 507  ? ILE A 511  ? VAL A 507  ILE A 511  5 ? 5  
HELX_P HELX_P18  18  SER A 513  ? ASN A 517  ? SER A 513  ASN A 517  5 ? 5  
HELX_P HELX_P19  19  VAL A 524  ? ARG A 532  ? VAL A 524  ARG A 532  1 ? 9  
HELX_P HELX_P20  20  LYS A 533  ? LEU A 536  ? LYS A 533  LEU A 536  5 ? 4  
HELX_P HELX_P21  21  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P22  22  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P23  23  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P24  24  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P25  25  GLY A 638  ? HIS A 659  ? GLY A 638  HIS A 659  1 ? 22 
HELX_P HELX_P26  26  GLY A 665  ? ILE A 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P27  27  ASP A 672  ? GLN A 698  ? ASP A 672  GLN A 698  1 ? 27 
HELX_P HELX_P28  28  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P29  29  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P30  30  PHE A 755  ? ALA A 763  ? PHE A 755  ALA A 763  1 ? 9  
HELX_P HELX_P31  31  SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P32  32  THR A 809  ? LYS A 830  ? THR A 809  LYS A 830  1 ? 22 
HELX_P HELX_P33  33  THR A 831  ? GLU A 846  ? THR A 831  GLU A 846  1 ? 16 
HELX_P HELX_P34  34  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P35  35  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P36  36  VAL A 927  ? PHE A 947  ? VAL A 927  PHE A 947  1 ? 21 
HELX_P HELX_P37  37  ASN A 959  ? ASN A 966  ? ASN A 959  ASN A 966  1 ? 8  
HELX_P HELX_P38  38  THR A 982  ? GLN A 994  ? THR A 982  GLN A 994  1 ? 13 
HELX_P HELX_P39  39  GLU A 995  ? LEU A 997  ? GLU A 995  LEU A 997  5 ? 3  
HELX_P HELX_P40  40  ILE A 1006 ? ALA A 1010 ? ILE A 1006 ALA A 1010 5 ? 5  
HELX_P HELX_P41  41  ARG A 1012 ? ALA A 1014 ? ARG A 1012 ALA A 1014 5 ? 3  
HELX_P HELX_P42  42  VAL A 1015 ? LEU A 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P43  43  ALA A 1027 ? TYR A 1035 ? ALA A 1027 TYR A 1035 1 ? 9  
HELX_P HELX_P44  44  THR A 1038 ? ARG A 1055 ? THR A 1038 ARG A 1055 1 ? 18 
HELX_P HELX_P45  45  MET A 1063 ? THR A 1077 ? MET A 1063 THR A 1077 1 ? 15 
HELX_P HELX_P46  46  GLY A 1097 ? ASN A 1106 ? GLY A 1097 ASN A 1106 1 ? 10 
HELX_P HELX_P47  47  ASP A 1127 ? ALA A 1137 ? ASP A 1127 ALA A 1137 1 ? 11 
HELX_P HELX_P48  48  LEU A 1143 ? SER A 1145 ? LEU A 1143 SER A 1145 5 ? 3  
HELX_P HELX_P49  49  ASP A 1166 ? LEU A 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P50  50  ALA A 1200 ? LYS A 1205 ? ALA A 1200 LYS A 1205 1 ? 6  
HELX_P HELX_P51  51  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P52  52  ILE A 1263 ? GLU A 1269 ? ILE A 1263 GLU A 1269 1 ? 7  
HELX_P HELX_P53  53  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P54  54  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P55  55  GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P56  56  ASN A 1364 ? GLN A 1378 ? ASN A 1364 GLN A 1378 1 ? 15 
HELX_P HELX_P57  57  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P58  58  GLY A 1395 ? PHE A 1402 ? GLY A 1395 PHE A 1402 1 ? 8  
HELX_P HELX_P59  59  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P60  60  VAL A 1424 ? ILE A 1429 ? VAL A 1424 ILE A 1429 1 ? 6  
HELX_P HELX_P61  61  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P62  62  THR B 26   ? GLU B 28   ? THR B 26   GLU B 28   5 ? 3  
HELX_P HELX_P63  63  ASP B 29   ? GLU B 40   ? ASP B 29   GLU B 40   1 ? 12 
HELX_P HELX_P64  64  VAL B 44   ? ASP B 56   ? VAL B 44   ASP B 56   1 ? 13 
HELX_P HELX_P65  65  TYR B 57   ? CYS B 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P66  66  TYR B 113  ? ARG B 118  ? TYR B 113  ARG B 118  1 ? 6  
HELX_P HELX_P67  67  CYS B 179  ? ALA B 184  ? CYS B 179  ALA B 184  5 ? 6  
HELX_P HELX_P68  68  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P69  69  PRO B 281  ? LEU B 289  ? PRO B 281  LEU B 289  1 ? 9  
HELX_P HELX_P70  70  GLY B 295  ? CYS B 302  ? GLY B 295  CYS B 302  1 ? 8  
HELX_P HELX_P71  71  ASP B 307  ? PHE B 322  ? ASP B 307  PHE B 322  1 ? 16 
HELX_P HELX_P72  72  ASP B 326  ? LEU B 331  ? ASP B 326  LEU B 331  1 ? 6  
HELX_P HELX_P73  73  GLU B 346  ? ASP B 354  ? GLU B 346  ASP B 354  1 ? 9  
HELX_P HELX_P74  74  ILE B 355  ? GLN B 357  ? ILE B 355  GLN B 357  5 ? 3  
HELX_P HELX_P75  75  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P76  76  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P77  77  LEU B 408  ? ARG B 434  ? LEU B 408  ARG B 434  1 ? 27 
HELX_P HELX_P78  78  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P79  79  MET B 473  ? GLY B 478  ? MET B 473  GLY B 478  5 ? 6  
HELX_P HELX_P80  80  THR B 487  ? ARG B 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P81  81  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P82  82  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P83  83  PRO B 565  ? TYR B 569  ? PRO B 565  TYR B 569  5 ? 5  
HELX_P HELX_P84  84  ASN B 592  ? ARG B 605  ? ASN B 592  ARG B 605  1 ? 14 
HELX_P HELX_P85  85  ILE B 619  ? LYS B 622  ? ILE B 619  LYS B 622  5 ? 4  
HELX_P HELX_P86  86  ARG B 654  ? MET B 662  ? ARG B 654  MET B 662  1 ? 9  
HELX_P HELX_P87  87  MET B 662  ? GLN B 667  ? MET B 662  GLN B 667  1 ? 6  
HELX_P HELX_P88  88  THR B 680  ? GLY B 688  ? THR B 680  GLY B 688  1 ? 9  
HELX_P HELX_P89  89  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P90  90  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P91  91  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P92  92  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P93  93  LYS B 775  ? ALA B 777  ? LYS B 775  ALA B 777  5 ? 3  
HELX_P HELX_P94  94  LEU B 782  ? VAL B 787  ? LEU B 782  VAL B 787  5 ? 6  
HELX_P HELX_P95  95  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P96  96  ASN B 1013 ? ILE B 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P97  97  THR B 1022 ? ILE B 1027 ? THR B 1022 ILE B 1027 1 ? 6  
HELX_P HELX_P98  98  GLU B 1028 ? GLY B 1039 ? GLU B 1028 GLY B 1039 1 ? 12 
HELX_P HELX_P99  99  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P100 100 MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P101 101 GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P102 102 ALA B 1144 ? ARG B 1150 ? ALA B 1144 ARG B 1150 1 ? 7  
HELX_P HELX_P103 103 PRO B 1197 ? MET B 1210 ? PRO B 1197 MET B 1210 1 ? 14 
HELX_P HELX_P104 104 ASP C 26   ? ALA C 39   ? ASP C 26   ALA C 39   1 ? 14 
HELX_P HELX_P105 105 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P106 106 MET C 75   ? LEU C 80   ? MET C 75   LEU C 80   5 ? 6  
HELX_P HELX_P107 107 SER C 204  ? GLU C 208  ? SER C 204  GLU C 208  5 ? 5  
HELX_P HELX_P108 108 PRO C 239  ? GLN C 264  ? PRO C 239  GLN C 264  1 ? 26 
HELX_P HELX_P109 109 GLU D 6    ? GLY D 27   ? GLU E 6    GLY E 27   1 ? 22 
HELX_P HELX_P110 110 PRO D 38   ? TYR D 46   ? PRO E 38   TYR E 46   1 ? 9  
HELX_P HELX_P111 111 GLN D 54   ? MET D 58   ? GLN E 54   MET E 58   5 ? 5  
HELX_P HELX_P112 112 GLU D 67   ? PHE D 72   ? GLU E 67   PHE E 72   1 ? 6  
HELX_P HELX_P113 113 GLY D 89   ? ASN D 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P114 114 ALA D 120  ? VAL D 124  ? ALA E 120  VAL E 124  5 ? 5  
HELX_P HELX_P115 115 ALA D 138  ? VAL D 141  ? ALA E 138  VAL E 141  5 ? 4  
HELX_P HELX_P116 116 ASN D 143  ? HIS D 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P117 117 SER D 157  ? TYR D 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P118 118 LYS D 171  ? LEU D 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P119 119 ASP D 182  ? GLY D 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P120 120 THR E 86   ? MET E 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P121 121 ASP E 116  ? GLU E 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P122 122 ASN F 128  ? ASN F 133  ? ASN H 128  ASN H 133  5 ? 6  
HELX_P HELX_P123 123 VAL G 59   ? SER G 64   ? VAL I 59   SER I 64   5 ? 6  
HELX_P HELX_P124 124 ASP H 16   ? GLU H 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P125 125 GLY H 33   ? ARG H 38   ? GLY J 33   ARG J 38   1 ? 6  
HELX_P HELX_P126 126 ARG H 43   ? THR H 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P127 127 LEU H 56   ? LEU H 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P128 128 ASP I 5    ? PHE I 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P129 129 LEU I 42   ? LEU I 50   ? LEU K 42   LEU K 50   1 ? 9  
HELX_P HELX_P130 130 ASP I 82   ? GLN I 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 67   SG    ? ? ? 1_555 A CYS 77   SG ? ? A CYS 67   A CYS 77   1_555 ? ? ? ? ? ? ?               2.086 ? 
disulf2  disulf ? ? B CYS 1166 SG    ? ? ? 1_555 B CYS 1185 SG ? ? B CYS 1166 B CYS 1185 1_555 ? ? ? ? ? ? ?               2.213 ? 
disulf3  disulf ? ? G CYS 7    SG    ? ? ? 1_555 G CYS 10   SG ? ? I CYS 7    I CYS 10   1_555 ? ? ? ? ? ? ?               3.005 ? 
disulf4  disulf ? ? G CYS 10   SG    ? ? ? 1_555 G CYS 29   SG ? ? I CYS 10   I CYS 29   1_555 ? ? ? ? ? ? ?               3.878 ? 
disulf5  disulf ? ? G CYS 10   SG    ? ? ? 1_555 G CYS 32   SG ? ? I CYS 10   I CYS 32   1_555 ? ? ? ? ? ? ?               2.873 ? 
disulf6  disulf ? ? G CYS 78   SG    ? ? ? 1_555 G CYS 106  SG ? ? I CYS 78   I CYS 106  1_555 ? ? ? ? ? ? ?               2.035 ? 
disulf7  disulf ? ? H CYS 10   SG    ? ? ? 1_555 H CYS 46   SG ? ? J CYS 10   J CYS 46   1_555 ? ? ? ? ? ? ?               2.083 ? 
disulf8  disulf ? ? J CYS 48   SG    ? ? ? 1_555 J CYS 51   SG ? ? L CYS 48   L CYS 51   1_555 ? ? ? ? ? ? ?               2.033 ? 
metalc1  metalc ? ? A CYS 67   SG    ? ? ? 1_555 O ZN  .    ZN ? ? A CYS 67   A ZN  1735 1_555 ? ? ? ? ? ? ?               2.529 ? 
metalc2  metalc ? ? A CYS 70   SG    ? ? ? 1_555 O ZN  .    ZN ? ? A CYS 70   A ZN  1735 1_555 ? ? ? ? ? ? ?               2.435 ? 
metalc3  metalc ? ? A CYS 148  SG    ? ? ? 1_555 N ZN  .    ZN ? ? A CYS 148  A ZN  1734 1_555 ? ? ? ? ? ? ?               2.978 ? 
metalc4  metalc ? ? A ASP 483  OD2   ? ? ? 1_555 P MG  .    MG ? ? A ASP 483  A MG  1736 1_555 ? ? ? ? ? ? ?               2.261 ? 
metalc5  metalc ? ? A ASP 485  OD1   ? ? ? 1_555 P MG  .    MG ? ? A ASP 485  A MG  1736 1_555 ? ? ? ? ? ? ?               2.177 ? 
metalc6  metalc ? ? A ASP 485  OD2   ? ? ? 1_555 P MG  .    MG ? ? A ASP 485  A MG  1736 1_555 ? ? ? ? ? ? ?               2.169 ? 
metalc7  metalc ? ? B CYS 1163 SG    ? ? ? 1_555 Q ZN  .    ZN ? ? B CYS 1163 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.682 ? 
metalc8  metalc ? ? B CYS 1182 SG    ? ? ? 1_555 Q ZN  .    ZN ? ? B CYS 1182 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.623 ? 
metalc9  metalc ? ? B CYS 1185 SG    ? ? ? 1_555 Q ZN  .    ZN ? ? B CYS 1185 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.400 ? 
metalc10 metalc ? ? C CYS 86   SG    ? ? ? 1_555 R ZN  .    ZN ? ? C CYS 86   C ZN  319  1_555 ? ? ? ? ? ? ?               2.074 ? 
metalc11 metalc ? ? C CYS 88   SG    ? ? ? 1_555 R ZN  .    ZN ? ? C CYS 88   C ZN  319  1_555 ? ? ? ? ? ? ?               2.384 ? 
metalc12 metalc ? ? C CYS 92   SG    ? ? ? 1_555 R ZN  .    ZN ? ? C CYS 92   C ZN  319  1_555 ? ? ? ? ? ? ?               2.058 ? 
metalc13 metalc ? ? C CYS 95   SG    ? ? ? 1_555 R ZN  .    ZN ? ? C CYS 95   C ZN  319  1_555 ? ? ? ? ? ? ?               2.715 ? 
metalc14 metalc ? ? G CYS 7    SG    ? ? ? 1_555 S ZN  .    ZN ? ? I CYS 7    I ZN  203  1_555 ? ? ? ? ? ? ?               2.882 ? 
metalc15 metalc ? ? G CYS 32   SG    ? ? ? 1_555 S ZN  .    ZN ? ? I CYS 32   I ZN  203  1_555 ? ? ? ? ? ? ?               2.801 ? 
metalc16 metalc ? ? G CYS 75   SG    ? ? ? 1_555 T ZN  .    ZN ? ? I CYS 75   I ZN  204  1_555 ? ? ? ? ? ? ?               2.200 ? 
metalc17 metalc ? ? G CYS 78   SG    ? ? ? 1_555 T ZN  .    ZN ? ? I CYS 78   I ZN  204  1_555 ? ? ? ? ? ? ?               1.983 ? 
metalc18 metalc ? ? G CYS 103  SG    ? ? ? 1_555 T ZN  .    ZN ? ? I CYS 103  I ZN  204  1_555 ? ? ? ? ? ? ?               2.655 ? 
metalc19 metalc ? ? H CYS 10   SG    ? ? ? 1_555 U ZN  .    ZN ? ? J CYS 10   J ZN  101  1_555 ? ? ? ? ? ? ?               2.441 ? 
metalc20 metalc ? ? H CYS 45   SG    ? ? ? 1_555 U ZN  .    ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?               2.128 ? 
metalc21 metalc ? ? H CYS 46   N     ? ? ? 1_555 U ZN  .    ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?               2.277 ? 
metalc22 metalc ? ? J CYS 31   SG    ? ? ? 1_555 V ZN  .    ZN ? ? L CYS 31   L ZN  105  1_555 ? ? ? ? ? ? ?               2.970 ? 
metalc23 metalc ? ? J CYS 34   SG    ? ? ? 1_555 V ZN  .    ZN ? ? L CYS 34   L ZN  105  1_555 ? ? ? ? ? ? ?               2.717 ? 
metalc24 metalc ? ? K A   10   "O3'" ? ? ? 1_555 P MG  .    MG ? ? R A   10   A MG  1736 1_555 ? ? ? ? ? ? ?               2.377 ? 
metalc25 metalc ? ? B CYS 1166 SG    ? ? ? 1_555 Q ZN  .    ZN ? ? B CYS 1166 B ZN  1307 1_555 ? ? ? ? ? ? ?               2.465 ? 
metalc26 metalc ? ? G CYS 29   SG    ? ? ? 1_555 S ZN  .    ZN ? ? I CYS 29   I ZN  203  1_555 ? ? ? ? ? ? ?               2.305 ? 
metalc27 metalc ? ? G CYS 10   SG    ? ? ? 1_555 S ZN  .    ZN ? ? I CYS 10   I ZN  203  1_555 ? ? ? ? ? ? ?               1.644 ? 
hydrog1  hydrog ? ? K A   1    N1    ? ? ? 1_555 L DA  27   N6 ? ? R A   1    T DA  27   1_555 ? ? ? ? ? ? 'A-DA MISPAIR'  ?     ? 
hydrog2  hydrog ? ? K C   3    N4    ? ? ? 1_555 L DG  26   O6 ? ? R C   3    T DG  26   1_555 ? ? ? ? ? ? 'C-DG PAIR'     ?     ? 
hydrog3  hydrog ? ? K G   4    N2    ? ? ? 1_555 L DC  25   O2 ? ? R G   4    T DC  25   1_555 ? ? ? ? ? ? 'G-DC PAIR'     ?     ? 
hydrog4  hydrog ? ? K A   5    N1    ? ? ? 1_555 L DT  24   N3 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? K A   5    N6    ? ? ? 1_555 L DT  24   O4 ? ? R A   5    T DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? K G   6    N1    ? ? ? 1_555 L DC  23   N3 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? K G   6    N2    ? ? ? 1_555 L DC  23   O2 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? K G   6    O6    ? ? ? 1_555 L DC  23   N4 ? ? R G   6    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? K A   7    N1    ? ? ? 1_555 L DT  22   N3 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? K A   7    N6    ? ? ? 1_555 L DT  22   O4 ? ? R A   7    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? K G   8    N1    ? ? ? 1_555 L DC  21   N3 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? K G   8    N2    ? ? ? 1_555 L DC  21   O2 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? K G   8    O6    ? ? ? 1_555 L DC  21   N4 ? ? R G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? K G   9    N1    ? ? ? 1_555 L DC  20   N3 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? K G   9    N2    ? ? ? 1_555 L DC  20   O2 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? K G   9    O6    ? ? ? 1_555 L DC  20   N4 ? ? R G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? K G   9    N1    ? ? ? 1_555 L DC  21   N3 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? K G   9    N2    ? ? ? 1_555 L DC  21   O2 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? K G   9    O6    ? ? ? 1_555 L DC  21   N4 ? ? R G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? K A   10   N1    ? ? ? 1_555 L DT  19   N3 ? ? R A   10   T DT  19   1_555 ? ? ? ? ? ? 'A-DT PAIR'     ?     ? 
hydrog21 hydrog ? ? K U   11   N3    ? ? ? 1_555 L DA  18   N1 ? ? R U   11   T DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? K U   11   O4    ? ? ? 1_555 L DA  18   N6 ? ? R U   11   T DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? L DT  2    N3    ? ? ? 1_555 M DA  13   N1 ? ? T DT  2    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? L DT  2    O4    ? ? ? 1_555 M DA  13   N6 ? ? T DT  2    N DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? L DT  2    O2    ? ? ? 1_555 M DG  14   N1 ? ? T DT  2    N DG  14   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog26 hydrog ? ? L DC  4    N3    ? ? ? 1_555 M DG  11   N1 ? ? T DC  4    N DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? L DC  4    N4    ? ? ? 1_555 M DG  11   O6 ? ? T DC  4    N DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? L DC  4    O2    ? ? ? 1_555 M DG  11   N2 ? ? T DC  4    N DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? L DG  6    N1    ? ? ? 1_555 M DC  9    N3 ? ? T DG  6    N DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? L DG  6    N2    ? ? ? 1_555 M DC  9    O2 ? ? T DG  6    N DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? L DG  6    O6    ? ? ? 1_555 M DC  9    N4 ? ? T DG  6    N DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? L DA  10   N6    ? ? ? 1_555 M DT  5    O4 ? ? T DA  10   N DT  5    1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog33 hydrog ? ? L DG  11   N2    ? ? ? 1_555 M DT  5    O2 ? ? T DG  11   N DT  5    1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 254 A . ? GLU 254 A SER 255 A ? SER 255 A 1 6.75   
2 GLN 256 A . ? GLN 256 A ARG 257 A ? ARG 257 A 1 -6.27  
3 LEU 315 A . ? LEU 315 A GLN 316 A ? GLN 316 A 1 -5.43  
4 ARG 320 A . ? ARG 320 A PRO 321 A ? PRO 321 A 1 -23.07 
5 GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 0.02   
6 PRO 636 B . ? PRO 636 B LEU 637 B ? LEU 637 B 1 -0.29  
7 PRO 128 D . ? PRO 128 E PRO 129 D ? PRO 129 E 1 7.27   
8 LYS 109 F . ? LYS 109 H ASP 110 F ? ASP 110 H 1 1.31   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 8 ? 
F  ? 4 ? 
G  ? 2 ? 
H  ? 3 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 4 ? 
L  ? 5 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 3 ? 
P  ? 2 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 2 ? 
Y  ? 5 ? 
Z  ? 4 ? 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 4 ? 
AJ ? 2 ? 
AK ? 3 ? 
AL ? 9 ? 
AM ? 3 ? 
AN ? 2 ? 
AO ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
E  5 6 ? parallel      
E  6 7 ? anti-parallel 
E  7 8 ? parallel      
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? parallel      
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? parallel      
AI 3 4 ? parallel      
AJ 1 2 ? parallel      
AK 1 2 ? parallel      
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AL 6 7 ? anti-parallel 
AL 7 8 ? anti-parallel 
AL 8 9 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
A  2 GLU A 16   ? PHE A 19   ? GLU A 16   PHE A 19   
A  3 PRO B 1214 ? TYR B 1217 ? PRO B 1214 TYR B 1217 
B  1 GLY A 82   ? VAL A 90   ? GLY A 82   VAL A 90   
B  2 LEU A 236  ? VAL A 241  ? LEU A 236  VAL A 241  
C  1 ARG A 175  ? ASP A 177  ? ARG A 175  ASP A 177  
C  2 LYS A 180  ? VAL A 182  ? LYS A 180  VAL A 182  
D  1 ARG A 344  ? VAL A 345  ? ARG A 344  VAL A 345  
D  2 LEU B 1128 ? ARG B 1129 ? LEU B 1128 ARG B 1129 
E  1 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
E  2 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
E  3 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
E  4 VAL A 442  ? ASN A 445  ? VAL A 442  ASN A 445  
E  5 MET A 456  ? ILE A 463  ? MET A 456  ILE A 463  
E  6 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
E  7 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
E  8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
F  1 TYR A 376  ? VAL A 379  ? TYR A 376  VAL A 379  
F  2 LYS A 431  ? ARG A 434  ? LYS A 431  ARG A 434  
F  3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
F  4 ARG A 412  ? ILE A 413  ? ARG A 412  ILE A 413  
G  1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
G  2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
H  1 HIS A 587  ? GLN A 589  ? HIS A 587  GLN A 589  
H  2 MET A 605  ? ILE A 608  ? MET A 605  ILE A 608  
H  3 GLN A 611  ? GLY A 615  ? GLN A 611  GLY A 615  
I  1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
I  2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
J  1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
J  2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
K  1 VAL A 1283 ? TYR A 1287 ? VAL A 1283 TYR A 1287 
K  2 GLU A 1303 ? GLU A 1307 ? GLU A 1303 GLU A 1307 
K  3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
K  4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
L  1 PHE A 1225 ? TRP A 1228 ? PHE A 1225 TRP A 1228 
L  2 ILE A 1237 ? ARG A 1241 ? ILE A 1237 ARG A 1241 
L  3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
L  4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
L  5 LEU G 42   ? ARG G 45   ? LEU I 42   ARG I 45   
M  1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
M  2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
N  1 ASP A 1442 ? MET A 1444 ? ASP A 1442 MET A 1444 
N  2 VAL E 133  ? TYR E 137  ? VAL F 133  TYR F 137  
N  3 PHE E 143  ? SER E 147  ? PHE F 143  SER F 147  
O  1 ILE B 95   ? VAL B 97   ? ILE B 95   VAL B 97   
O  2 SER B 125  ? VAL B 130  ? SER B 125  VAL B 130  
O  3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
P  1 MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
P  2 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
Q  1 PHE B 203  ? ILE B 204  ? PHE B 203  ILE B 204  
Q  2 GLU B 209  ? LYS B 210  ? GLU B 209  LYS B 210  
R  1 GLN B 215  ? SER B 218  ? GLN B 215  SER B 218  
R  2 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
S  1 GLN B 224  ? VAL B 225  ? GLN B 224  VAL B 225  
S  2 ALA B 238  ? SER B 242  ? ALA B 238  SER B 242  
S  3 SER B 252  ? GLN B 255  ? SER B 252  GLN B 255  
T  1 ARG B 497  ? THR B 498  ? ARG B 497  THR B 498  
T  2 LYS B 537  ? ASN B 538  ? LYS B 537  ASN B 538  
U  1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
U  2 VAL B 633  ? ARG B 635  ? VAL B 633  ARG B 635  
U  3 ILE B 693  ? ASP B 694  ? ILE B 693  ASP B 694  
V  1 MET B 563  ? GLU B 564  ? MET B 563  GLU B 564  
V  2 VAL B 589  ? HIS B 590  ? VAL B 589  HIS B 590  
W  1 VAL B 585  ? TRP B 586  ? VAL B 585  TRP B 586  
W  2 PHE B 581  ? VAL B 582  ? PHE B 581  VAL B 582  
W  3 LEU B 624  ? PHE B 627  ? LEU B 624  PHE B 627  
W  4 SER B 614  ? ARG B 617  ? SER B 614  ARG B 617  
X  1 PHE B 638  ? ILE B 639  ? PHE B 638  ILE B 639  
X  2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
Y  1 ASN B 794  ? LEU B 796  ? ASN B 794  LEU B 796  
Y  2 SER B 853  ? ASP B 861  ? SER B 853  ASP B 861  
Y  3 LEU B 961  ? LYS B 972  ? LEU B 961  LYS B 972  
Y  4 ASN B 946  ? GLN B 951  ? ASN B 946  GLN B 951  
Y  5 ARG B 904  ? SER B 906  ? ARG B 904  SER B 906  
Z  1 ASN B 794  ? LEU B 796  ? ASN B 794  LEU B 796  
Z  2 SER B 853  ? ASP B 861  ? SER B 853  ASP B 861  
Z  3 LEU B 961  ? LYS B 972  ? LEU B 961  LYS B 972  
Z  4 VAL B 954  ? ASN B 957  ? VAL B 954  ASN B 957  
AA 1 THR B 989  ? TYR B 994  ? THR B 989  TYR B 994  
AA 2 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
AA 3 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
AA 4 ILE B 824  ? ILE B 827  ? ILE B 824  ILE B 827  
AA 5 PHE B 1087 ? PRO B 1089 ? PHE B 1087 PRO B 1089 
AB 1 THR B 915  ? PRO B 917  ? THR B 915  PRO B 917  
AB 2 LYS B 934  ? ASP B 936  ? LYS B 934  ASP B 936  
AC 1 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
AC 2 MET B 1072 ? TYR B 1073 ? MET B 1072 TYR B 1073 
AD 1 ARG B 1159 ? CYS B 1163 ? ARG B 1159 CYS B 1163 
AD 2 ILE B 1191 ? HIS B 1195 ? ILE B 1191 HIS B 1195 
AE 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
AE 2 VAL C 18   ? SER C 23   ? VAL C 18   SER C 23   
AF 1 THR C 43   ? VAL C 51   ? THR C 43   VAL C 51   
AF 2 LEU C 155  ? GLY C 162  ? LEU C 155  GLY C 162  
AF 3 VAL C 97   ? LEU C 101  ? VAL C 97   LEU C 101  
AF 4 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AG 1 THR C 111  ? VAL C 113  ? THR C 111  VAL C 113  
AG 2 CYS C 145  ? LEU C 147  ? CYS C 145  LEU C 147  
AH 1 ILE C 176  ? GLU C 179  ? ILE C 176  GLU C 179  
AH 2 TYR C 229  ? VAL C 232  ? TYR C 229  VAL C 232  
AI 1 GLN D 61   ? ALA D 62   ? GLN E 61   ALA E 62   
AI 2 LEU D 78   ? PHE D 82   ? LEU E 78   PHE E 82   
AI 3 THR D 107  ? TYR D 112  ? THR E 107  TYR E 112  
AI 4 THR D 131  ? ASN D 136  ? THR E 131  ASN E 136  
AJ 1 SER D 87   ? VAL D 88   ? SER E 87   VAL E 88   
AJ 2 ASN D 115  ? ILE D 116  ? ASN E 115  ILE E 116  
AK 1 ARG D 177  ? ILE D 178  ? ARG E 177  ILE E 178  
AK 2 ARG D 207  ? CYS D 214  ? ARG E 207  CYS E 214  
AK 3 VAL D 196  ? LYS D 201  ? VAL E 196  LYS E 201  
AL 1 TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
AL 2 TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
AL 3 SER F 54   ? THR F 58   ? SER H 54   THR H 58   
AL 4 ASP F 7    ? ASP F 16   ? ASP H 7    ASP H 16   
AL 5 CYS F 24   ? SER F 30   ? CYS H 24   SER H 30   
AL 6 LYS F 37   ? ILE F 42   ? LYS H 37   ILE H 42   
AL 7 LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
AL 8 ILE F 112  ? PHE F 118  ? ILE H 112  PHE H 118  
AL 9 THR F 100  ? GLU F 105  ? THR H 100  GLU H 105  
AM 1 TYR G 15   ? ASP G 19   ? TYR I 15   ASP I 19   
AM 2 ARG G 24   ? GLU G 28   ? ARG I 24   GLU I 28   
AM 3 VAL G 35   ? GLU G 37   ? VAL I 35   GLU I 37   
AN 1 PHE G 100  ? VAL G 102  ? PHE I 100  VAL I 102  
AN 2 ILE G 109  ? THR G 111  ? ILE I 109  THR I 111  
AO 1 LEU I 19   ? PRO I 23   ? LEU K 19   PRO K 23   
AO 2 ALA I 30   ? PHE I 35   ? ALA K 30   PHE K 35   
AO 3 LYS I 72   ? THR I 77   ? LYS K 72   THR K 77   
AO 4 VAL I 56   ? LYS I 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A 1419 ? O ASP A 1419 N VAL A 17   ? N VAL A 17   
A  2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
B  1 2 N GLY A 82   ? N GLY A 82   O VAL A 241  ? O VAL A 241  
C  1 2 N ASP A 177  ? N ASP A 177  O LYS A 180  ? O LYS A 180  
D  1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
E  1 2 O ARG B 1106 ? O ARG B 1106 N SER A 348  ? N SER A 348  
E  2 3 N ALA A 349  ? N ALA A 349  O LEU A 489  ? O LEU A 489  
E  3 4 O ASN A 488  ? O ASN A 488  N ASN A 445  ? N ASN A 445  
E  4 5 N PHE A 444  ? N PHE A 444  O MET A 456  ? O MET A 456  
E  5 6 O LYS A 461  ? O LYS A 461  N VAL A 366  ? N VAL A 366  
E  6 7 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
E  7 8 O PHE A 468  ? O PHE A 468  N VAL A 352  ? N VAL A 352  
F  1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
F  2 3 O LYS A 431  ? O LYS A 431  N ILE A 406  ? N ILE A 406  
F  3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
G  1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
H  1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
H  2 3 N LEU A 606  ? N LEU A 606  O ILE A 613  ? O ILE A 613  
I  1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
J  1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
K  1 2 N MET A 1285 ? N MET A 1285 O VAL A 1305 ? O VAL A 1305 
K  2 3 O LEU A 1306 ? O LEU A 1306 N VAL A 1118 ? N VAL A 1118 
K  3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
L  1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
L  2 3 O ILE A 1238 ? O ILE A 1238 N LEU A 1195 ? N LEU A 1195 
L  3 4 O ARG A 1194 ? O ARG A 1194 N GLU A 1151 ? N GLU A 1151 
L  4 5 N ILE A 1152 ? N ILE A 1152 O VAL G 43   ? O VAL I 43   
M  1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
N  1 2 N MET A 1444 ? N MET A 1444 O VAL E 133  ? O VAL F 133  
N  2 3 N ARG E 136  ? N ARG F 136  O GLU E 144  ? O GLU F 144  
O  1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
O  2 3 N SER B 126  ? N SER B 126  O LEU B 170  ? O LEU B 170  
P  1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
Q  1 2 N PHE B 203  ? N PHE B 203  O LYS B 210  ? O LYS B 210  
R  1 2 N ARG B 217  ? N ARG B 217  O ARG B 405  ? O ARG B 405  
S  1 2 N GLN B 224  ? N GLN B 224  O GLU B 239  ? O GLU B 239  
S  2 3 N SER B 242  ? N SER B 242  O SER B 252  ? O SER B 252  
T  1 2 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
U  1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
U  2 3 N ARG B 635  ? N ARG B 635  O ILE B 693  ? O ILE B 693  
V  1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
W  1 2 O VAL B 585  ? O VAL B 585  N VAL B 582  ? N VAL B 582  
W  2 3 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
W  3 4 O PHE B 627  ? O PHE B 627  N SER B 614  ? N SER B 614  
X  1 2 N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
Y  1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
Y  2 3 N PHE B 855  ? N PHE B 855  O THR B 970  ? O THR B 970  
Y  3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
Y  4 5 O GLY B 947  ? O GLY B 947  N VAL B 905  ? N VAL B 905  
Z  1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
Z  2 3 N PHE B 855  ? N PHE B 855  O THR B 970  ? O THR B 970  
Z  3 4 O PHE B 963  ? O PHE B 963  N THR B 955  ? N THR B 955  
AA 1 2 O ILE B 992  ? O ILE B 992  N MET B 841  ? N MET B 841  
AA 2 3 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
AA 3 4 O ILE B 1012 ? O ILE B 1012 N ALA B 826  ? N ALA B 826  
AA 4 5 N VAL B 825  ? N VAL B 825  O GLY B 1088 ? O GLY B 1088 
AB 1 2 N THR B 916  ? N THR B 916  O ARG B 935  ? O ARG B 935  
AC 1 2 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
AD 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
AE 1 2 N LYS C 9    ? N LYS C 9    O ILE C 21   ? O ILE C 21   
AF 1 2 N THR C 43   ? N THR C 43   O GLY C 162  ? O GLY C 162  
AF 2 3 O LEU C 155  ? O LEU C 155  N LEU C 101  ? N LEU C 101  
AF 3 4 N THR C 100  ? N THR C 100  O VAL C 119  ? O VAL C 119  
AG 1 2 N THR C 111  ? N THR C 111  O LEU C 147  ? O LEU C 147  
AH 1 2 N GLU C 177  ? N GLU C 177  O ASN C 231  ? O ASN C 231  
AI 1 2 N ALA D 62   ? N ALA E 62   O LEU D 78   ? O LEU E 78   
AI 2 3 N TRP D 79   ? N TRP E 79   O ILE D 109  ? O ILE E 109  
AI 3 4 N GLY D 108  ? N GLY E 108  O GLU D 133  ? O GLU E 133  
AJ 1 2 O VAL D 88   ? O VAL E 88   N ASN D 115  ? N ASN E 115  
AK 1 2 N ILE D 178  ? N ILE E 178  O ILE D 213  ? O ILE E 213  
AK 2 3 O ARG D 212  ? O ARG E 212  N VAL D 196  ? N VAL E 196  
AL 1 2 N TYR F 95   ? N TYR H 95   O ILE F 144  ? O ILE H 144  
AL 2 3 O LEU F 143  ? O LEU H 143  N THR F 58   ? N THR H 58   
AL 3 4 O LEU F 55   ? O LEU H 55   N PHE F 10   ? N PHE H 10   
AL 4 5 N GLN F 11   ? N GLN H 11   O ALA F 29   ? O ALA H 29   
AL 5 6 N ILE F 26   ? N ILE H 26   O LEU F 40   ? O LEU H 40   
AL 6 7 N THR F 39   ? N THR H 39   O ARG F 124  ? O ARG H 124  
AL 7 8 O LEU F 121  ? O LEU H 121  N PHE F 118  ? N PHE H 118  
AL 8 9 O ALA F 113  ? O ALA H 113  N GLU F 105  ? N GLU H 105  
AM 1 2 N TYR G 15   ? N TYR I 15   O GLU G 28   ? O GLU I 28   
AM 2 3 N PHE G 27   ? N PHE I 27   O GLU G 36   ? O GLU I 36   
AN 1 2 N PHE G 101  ? N PHE I 101  O PHE G 110  ? O PHE I 110  
AO 1 2 N ASP I 22   ? N ASP K 22   O VAL I 32   ? O VAL K 32   
AO 2 3 N ILE I 33   ? N ILE K 33   O LEU I 73   ? O LEU K 73   
AO 3 4 O ARG I 74   ? O ARG K 74   N ALA I 60   ? N ALA K 60   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1734' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1735' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1307' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 319'  
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN I 203'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 204'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 101'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 105'  
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 1736' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 MET A 108  ? MET A 108  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
10 AC3 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
11 AC3 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
12 AC3 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
13 AC4 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
14 AC4 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
15 AC4 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
16 AC4 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
17 AC5 5 CYS G 7    ? CYS I 7    . ? 1_555 ? 
18 AC5 5 CYS G 10   ? CYS I 10   . ? 1_555 ? 
19 AC5 5 CYS G 29   ? CYS I 29   . ? 1_555 ? 
20 AC5 5 THR G 31   ? THR I 31   . ? 1_555 ? 
21 AC5 5 CYS G 32   ? CYS I 32   . ? 1_555 ? 
22 AC6 4 CYS G 75   ? CYS I 75   . ? 1_555 ? 
23 AC6 4 CYS G 78   ? CYS I 78   . ? 1_555 ? 
24 AC6 4 CYS G 103  ? CYS I 103  . ? 1_555 ? 
25 AC6 4 CYS G 106  ? CYS I 106  . ? 1_555 ? 
26 AC7 4 CYS H 7    ? CYS J 7    . ? 1_555 ? 
27 AC7 4 CYS H 10   ? CYS J 10   . ? 1_555 ? 
28 AC7 4 CYS H 45   ? CYS J 45   . ? 1_555 ? 
29 AC7 4 CYS H 46   ? CYS J 46   . ? 1_555 ? 
30 AC8 4 CYS J 31   ? CYS L 31   . ? 1_555 ? 
31 AC8 4 CYS J 34   ? CYS L 34   . ? 1_555 ? 
32 AC8 4 CYS J 48   ? CYS L 48   . ? 1_555 ? 
33 AC8 4 CYS J 51   ? CYS L 51   . ? 1_555 ? 
34 AC9 5 ASP A 481  ? ASP A 481  . ? 1_555 ? 
35 AC9 5 ASP A 483  ? ASP A 483  . ? 1_555 ? 
36 AC9 5 ASP A 485  ? ASP A 485  . ? 1_555 ? 
37 AC9 5 A   K 10   ? A   R 10   . ? 1_555 ? 
38 AC9 5 U   K 11   ? U   R 11   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GTL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GTL 
_atom_sites.fract_transf_matrix[1][1]   0.005864 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001267 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004499 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005251 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 30.731  -8.855  16.988  1.00 117.55 ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 31.003  -7.636  17.816  1.00 117.47 ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 32.180  -6.833  17.299  1.00 117.31 ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 32.034  -5.658  16.951  1.00 117.10 ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 33.345  -7.481  17.257  1.00 117.27 ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 34.574  -6.892  16.708  1.00 117.22 ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 35.196  -7.811  15.632  1.00 116.99 ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 34.469  -8.292  14.758  1.00 116.95 ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 35.546  -6.512  17.840  1.00 117.35 ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 35.044  -5.329  18.697  1.00 117.43 ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 35.564  -5.326  20.134  1.00 117.34 ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 36.683  -4.892  20.407  1.00 117.07 ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 34.731  -5.782  21.063  1.00 117.58 ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 36.510  -8.047  15.675  1.00 116.70 ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 37.184  -8.822  14.617  1.00 116.52 ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 38.012  -10.002 15.124  1.00 116.32 ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 38.063  -10.271 16.321  1.00 116.23 ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 38.072  -7.916  13.755  1.00 116.56 ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 37.330  -6.981  12.809  1.00 116.45 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 38.125  -5.714  12.512  1.00 116.59 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 39.355  -5.705  12.580  1.00 116.62 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 37.421  -4.635  12.187  1.00 116.76 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 38.656  -10.694 14.186  1.00 116.20 ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 39.528  -11.826 14.470  1.00 116.11 ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 40.875  -11.306 14.941  1.00 115.84 ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 41.506  -10.503 14.252  1.00 115.70 ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 39.731  -12.641 13.191  1.00 116.36 ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 40.188  -14.080 13.367  1.00 116.81 ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 39.526  -15.118 12.698  1.00 117.50 ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 41.289  -14.410 14.171  1.00 116.89 ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 39.937  -16.447 12.831  1.00 117.53 ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 41.706  -15.738 14.318  1.00 116.99 ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 41.025  -16.750 13.643  1.00 117.19 ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 41.423  -18.064 13.771  1.00 116.75 ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 41.315  -11.771 16.108  1.00 115.57 ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 42.613  -11.382 16.648  1.00 115.30 ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 43.567  -12.558 16.760  1.00 115.22 ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 43.220  -13.600 17.319  1.00 115.18 ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 42.459  -10.714 18.007  1.00 115.21 ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 43.719  -10.558 18.632  1.00 115.02 ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 44.778  -12.361 16.239  1.00 115.14 ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 45.822  -13.393 16.218  1.00 115.01 ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 46.403  -13.697 17.604  1.00 114.77 ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 47.286  -14.556 17.734  1.00 114.87 ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 46.936  -13.028 15.221  1.00 115.07 ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 47.185  -11.629 15.196  1.00 115.42 ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 45.897  -12.988 18.620  1.00 114.29 ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 46.197  -13.258 20.035  1.00 113.76 ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 45.086  -14.114 20.661  1.00 113.32 ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 43.919  -13.949 20.299  1.00 113.42 ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 46.355  -11.952 20.801  1.00 113.73 ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 45.440  -15.042 21.585  1.00 112.76 ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 44.428  -15.894 22.225  1.00 112.22 ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 43.690  -15.225 23.383  1.00 111.60 ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 44.274  -14.421 24.114  1.00 111.56 ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 45.238  -17.095 22.744  1.00 112.19 ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 46.668  -16.845 22.343  1.00 112.60 ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 46.789  -15.383 22.057  1.00 112.77 ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 42.408  -15.565 23.526  1.00 110.83 ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 41.568  -15.104 24.631  1.00 109.90 ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 41.891  -15.875 25.903  1.00 109.37 ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 41.968  -17.103 25.899  1.00 109.28 ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 40.072  -15.241 24.279  1.00 109.88 ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 39.008  -15.559 25.352  1.00 109.70 ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 38.774  -14.406 26.306  1.00 109.84 ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 37.686  -15.971 24.730  1.00 109.76 ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 42.088  -15.141 26.987  1.00 108.68 ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 42.185  -15.745 28.304  1.00 108.14 ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 41.425  -14.915 29.313  1.00 107.41 ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 41.189  -13.731 29.103  1.00 107.29 ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 43.643  -15.928 28.725  1.00 108.40 ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 44.214  -17.267 28.299  1.00 109.24 ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 45.727  -17.256 28.221  1.00 110.74 ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 46.175  -17.839 26.956  1.00 112.07 ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 47.410  -18.265 26.704  1.00 112.56 ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 48.353  -18.192 27.641  1.00 112.42 ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 47.697  -18.772 25.509  1.00 112.94 ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 41.038  -15.551 30.407  1.00 106.63 ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 40.292  -14.895 31.467  1.00 106.07 ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 41.218  -13.956 32.269  1.00 105.62 ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 42.338  -13.678 31.846  1.00 105.69 ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 39.632  -15.971 32.359  1.00 106.16 ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 39.109  -17.021 31.531  1.00 105.72 ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 38.505  -15.387 33.183  1.00 106.32 ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 40.753  -13.444 33.402  1.00 104.93 ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 41.623  -12.695 34.291  1.00 104.47 ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 41.716  -13.409 35.631  1.00 104.43 ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 40.707  -13.890 36.146  1.00 104.62 ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 41.138  -11.259 34.442  1.00 104.38 ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 41.522  -10.681 35.787  1.00 104.35 ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 41.717  -10.427 33.329  1.00 104.38 ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 42.925  -13.488 36.187  1.00 104.16 ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 43.157  -14.267 37.406  1.00 103.81 ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 43.711  -13.476 38.598  1.00 103.58 ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 43.188  -13.590 39.705  1.00 103.39 ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 44.052  -15.466 37.095  1.00 103.89 ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 43.539  -16.401 35.987  1.00 104.18 ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 42.220  -17.104 36.336  1.00 104.66 ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 42.312  -18.634 36.149  1.00 105.30 ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 42.969  -19.111 34.886  1.00 105.21 ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 44.767  -12.693 38.366  1.00 103.43 ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 45.334  -11.776 39.368  1.00 103.37 ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 44.978  -10.334 39.038  1.00 103.20 ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 44.889  -9.964  37.872  1.00 102.97 ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 46.863  -11.842 39.365  1.00 103.36 ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 47.532  -12.989 40.106  1.00 103.58 ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 49.058  -12.972 39.928  1.00 103.66 ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 49.539  -12.550 38.854  1.00 103.55 ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 49.785  -13.381 40.860  1.00 104.37 ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 44.811  -9.509  40.060  1.00 103.33 ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 44.805  -8.069  39.837  1.00 103.84 ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 45.848  -7.408  40.746  1.00 104.28 ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 45.739  -7.484  41.973  1.00 104.42 ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 43.388  -7.452  39.991  1.00 103.81 ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 43.446  -5.938  40.113  1.00 103.63 ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 42.528  -7.815  38.801  1.00 103.97 ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 46.857  -6.773  40.132  1.00 104.55 ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 48.001  -6.207  40.859  1.00 104.79 ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 47.962  -4.688  40.895  1.00 104.96 ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 48.280  -4.043  39.906  1.00 104.79 ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 49.315  -6.650  40.209  1.00 104.75 ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 50.362  -7.236  41.162  1.00 105.44 ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 50.569  -6.432  42.441  1.00 106.67 ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 50.677  -5.204  42.419  1.00 106.95 ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 50.637  -7.135  43.567  1.00 107.05 ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 47.585  -4.122  42.037  1.00 105.54 ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 47.515  -2.668  42.180  1.00 106.29 ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 48.877  -2.087  42.463  1.00 107.02 ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 49.647  -2.661  43.230  1.00 107.26 ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 46.546  -2.270  43.286  1.00 106.16 ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 45.127  -2.545  42.953  1.00 105.81 ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 44.510  -3.694  43.415  1.00 105.85 ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 44.413  -1.670  42.145  1.00 105.50 ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 43.198  -3.963  43.089  1.00 106.16 ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 43.101  -1.925  41.810  1.00 105.53 ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 42.487  -3.072  42.285  1.00 106.24 ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 49.164  -0.944  41.851  1.00 107.78 ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 50.490  -0.355  41.925  1.00 108.92 ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 50.439  1.139   41.791  1.00 109.75 ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 49.446  1.759   42.155  1.00 109.72 ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 51.519  1.712   41.273  1.00 110.82 ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 51.629  3.151   41.110  1.00 112.05 ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 52.408  3.509   39.858  1.00 112.96 ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 53.148  2.685   39.313  1.00 112.98 ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 52.284  3.784   42.339  1.00 112.02 ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 51.399  4.043   43.565  1.00 112.51 ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 52.234  4.483   44.754  1.00 113.21 ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 50.340  5.094   43.263  1.00 113.13 ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 52.242  4.750   39.415  1.00 114.24 ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 52.839  5.205   38.169  1.00 115.62 ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 54.197  5.866   38.316  1.00 116.63 ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 54.299  7.023   38.733  1.00 116.69 ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 51.879  6.131   37.424  1.00 115.58 ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 50.968  5.411   36.489  1.00 115.58 ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 49.650  5.165   36.842  1.00 115.67 ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 51.437  4.957   35.259  1.00 115.41 ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 48.807  4.486   35.978  1.00 115.89 ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 50.604  4.277   34.387  1.00 115.36 ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 49.285  4.041   34.744  1.00 115.75 ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 55.243  5.136   37.956  1.00 117.94 ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 56.541  5.758   37.850  1.00 119.44 ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 56.475  6.693   36.653  1.00 120.52 ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 56.025  6.288   35.577  1.00 120.52 ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 57.658  4.718   37.686  1.00 119.49 ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 58.080  4.564   36.343  1.00 119.76 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 56.873  7.961   36.850  1.00 121.71 ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 57.146  8.882   35.747  1.00 122.71 ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 57.982  8.223   34.648  1.00 123.67 ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 57.809  8.532   33.466  1.00 123.64 ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 57.958  10.002  36.419  1.00 122.73 ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 58.196  9.539   37.851  1.00 122.36 ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 57.075  8.616   38.150  1.00 121.72 ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 58.868  7.314   35.055  1.00 124.91 ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 59.735  6.572   34.145  1.00 126.20 ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 58.914  5.734   33.157  1.00 127.05 ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 59.247  5.661   31.975  1.00 127.25 ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 60.719  5.705   34.941  1.00 126.23 ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 62.155  5.714   34.402  1.00 126.29 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 63.178  5.246   35.428  1.00 126.17 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 63.950  4.315   35.110  1.00 126.22 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 63.208  5.806   36.548  1.00 125.76 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 57.840  5.114   33.641  1.00 128.19 ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 56.851  4.496   32.756  1.00 129.31 ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 56.055  5.558   32.004  1.00 130.02 ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 56.057  5.571   30.774  1.00 130.18 ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 55.893  3.574   33.522  1.00 129.34 ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 55.941  2.104   33.079  1.00 129.59 ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 54.719  1.292   33.526  1.00 129.34 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 54.176  1.565   34.619  1.00 129.17 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 54.306  0.370   32.784  1.00 128.96 ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 55.398  6.451   32.748  1.00 130.83 ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 54.515  7.477   32.175  1.00 131.66 ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 55.103  8.177   30.937  1.00 132.22 ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 54.415  8.338   29.930  1.00 132.17 ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 54.063  8.515   33.242  1.00 131.67 ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 53.092  9.524   32.647  1.00 131.86 ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 53.404  7.818   34.420  1.00 131.68 ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 56.372  8.573   31.009  1.00 133.09 ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 57.037  9.230   29.877  1.00 133.99 ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 57.202  8.323   28.657  1.00 134.57 ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 57.148  8.791   27.518  1.00 134.58 ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 58.392  9.812   30.294  1.00 133.98 ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 58.297  11.200  30.912  1.00 134.16 ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 59.666  11.804  31.167  1.00 134.29 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 59.577  13.072  31.893  1.00 134.61 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 59.564  13.191  33.222  1.00 134.77 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 59.632  12.120  34.006  1.00 134.61 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 59.483  14.393  33.776  1.00 134.98 ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 57.397  7.031   28.905  1.00 135.39 ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 57.600  6.054   27.838  1.00 136.22 ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 56.301  5.360   27.419  1.00 136.84 ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 56.237  4.756   26.346  1.00 136.93 ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 58.646  5.025   28.259  1.00 136.16 ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 55.272  5.465   28.260  1.00 137.62 ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 54.015  4.728   28.079  1.00 138.34 ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 53.178  5.228   26.904  1.00 138.90 ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 52.564  4.438   26.189  1.00 138.80 ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 53.145  4.737   29.385  1.00 138.33 ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 52.156  3.568   29.398  1.00 138.32 ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 52.411  6.071   29.578  1.00 138.30 ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 51.276  3.498   30.643  1.00 138.28 ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 53.177  6.541   26.708  1.00 139.78 ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 52.178  7.187   25.872  1.00 140.75 ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 52.679  7.565   24.480  1.00 141.39 ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 53.793  7.209   24.085  1.00 141.58 ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 51.617  8.412   26.599  1.00 140.73 ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 52.599  9.412   26.784  1.00 141.00 ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 51.835  8.290   23.751  1.00 142.13 ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 52.122  8.723   22.389  1.00 142.88 ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 52.062  10.245  22.287  1.00 143.46 ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 52.292  10.827  21.223  1.00 143.45 ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 51.121  8.097   21.399  1.00 142.83 ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 51.547  6.682   21.031  1.00 142.93 ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 49.708  8.108   21.981  1.00 142.65 ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 51.775  10.877  23.421  1.00 144.30 ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 51.470  12.300  23.472  1.00 145.14 ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 52.645  13.194  23.857  1.00 145.72 ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 53.768  12.728  24.064  1.00 145.78 ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 50.303  12.540  24.403  1.00 145.13 ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 52.353  14.489  23.941  1.00 146.47 ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 53.341  15.529  24.184  1.00 147.26 ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 52.672  16.604  25.029  1.00 147.82 ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 53.248  17.096  26.004  1.00 147.90 ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 53.815  16.117  22.849  1.00 147.23 ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 54.405  15.092  21.882  1.00 147.21 ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 54.020  15.381  20.440  1.00 147.23 ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 54.303  14.183  19.542  1.00 147.30 ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 55.764  13.910  19.388  1.00 147.58 ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 51.446  16.947  24.632  1.00 148.54 ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 50.554  17.871  25.349  1.00 149.24 ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 51.184  19.233  25.670  1.00 149.91 ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 51.349  19.597  26.839  1.00 150.00 ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 49.932  17.224  26.623  1.00 149.08 ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 49.650  15.731  26.409  1.00 148.91 ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 48.663  17.953  27.022  1.00 148.93 ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 48.566  15.425  25.384  1.00 148.60 ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 51.524  19.980  24.622  1.00 150.68 ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 52.118  21.304  24.783  1.00 151.43 ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 51.073  22.395  25.016  1.00 151.94 ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 51.332  23.347  25.748  1.00 151.94 ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 53.005  21.663  23.584  1.00 151.37 ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 54.377  20.995  23.579  1.00 151.42 ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 55.262  21.579  22.484  1.00 151.56 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 56.476  20.793  22.249  1.00 151.95 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 56.579  19.794  21.371  1.00 152.09 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 55.538  19.429  20.630  1.00 152.14 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 57.732  19.149  21.237  1.00 152.05 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 49.893  22.240  24.414  1.00 152.70 ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 48.866  23.293  24.418  1.00 153.41 ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 47.578  22.923  25.166  1.00 153.95 ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 47.096  21.796  25.049  1.00 153.90 ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 48.518  23.709  22.983  1.00 153.43 ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 49.678  24.265  22.208  1.00 153.35 ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 50.609  23.415  21.618  1.00 153.24 ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 49.827  25.639  22.051  1.00 153.38 ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 51.679  23.923  20.900  1.00 153.48 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 50.894  26.161  21.330  1.00 153.59 ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 51.823  25.301  20.753  1.00 153.67 ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 47.016  23.881  25.931  1.00 154.57 ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 45.794  23.672  26.694  1.00 155.13 ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 44.522  24.136  25.983  1.00 155.73 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 43.518  24.407  26.643  1.00 155.76 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 46.027  24.534  27.937  1.00 155.10 ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 46.922  25.653  27.466  1.00 154.83 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 47.542  25.240  26.146  1.00 154.64 ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 44.561  24.231  24.658  1.00 156.50 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 43.378  24.624  23.894  1.00 157.36 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 42.445  23.440  23.645  1.00 157.84 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 42.114  22.705  24.575  1.00 157.88 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 43.775  25.314  22.582  1.00 157.43 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 43.321  26.777  22.465  1.00 157.78 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 43.938  27.703  23.510  1.00 158.01 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 45.112  27.498  23.889  1.00 158.13 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 43.243  28.649  23.942  1.00 157.94 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 42.003  23.280  22.399  1.00 158.55 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 41.180  22.139  21.996  1.00 159.19 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 41.452  21.793  20.528  1.00 159.65 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 42.100  20.791  20.237  1.00 159.71 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 39.666  22.377  22.254  1.00 159.16 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 39.483  22.991  23.537  1.00 159.16 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 38.903  21.064  22.231  1.00 159.13 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 40.970  22.624  19.610  1.00 160.24 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 41.242  22.431  18.189  1.00 160.84 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 41.548  23.759  17.515  1.00 161.22 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 42.668  24.262  17.598  1.00 161.21 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 40.060  21.753  17.483  1.00 160.89 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 39.990  20.242  17.634  1.00 161.10 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 39.011  19.695  19.045  1.00 161.46 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 38.990  17.922  18.787  1.00 161.07 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 40.520  24.317  16.875  1.00 161.77 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 40.590  25.529  16.050  1.00 162.25 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 41.805  26.425  16.280  1.00 162.68 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 41.818  27.265  17.184  1.00 162.77 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 39.275  26.327  16.147  1.00 162.14 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 38.083  25.592  15.523  1.00 161.78 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 38.053  24.344  15.551  1.00 161.50 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 37.163  26.265  15.015  1.00 160.96 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 42.830  26.215  15.457  1.00 163.19 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 43.966  27.127  15.367  1.00 163.64 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 43.544  28.287  14.471  1.00 163.94 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 43.685  28.222  13.247  1.00 163.99 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 45.211  26.409  14.822  1.00 163.63 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 44.977  25.580  13.552  1.00 163.58 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 46.153  24.692  13.191  1.00 163.65 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 45.912  23.533  12.794  1.00 163.62 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 47.313  25.141  13.302  1.00 163.78 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 43.019  29.340  15.098  1.00 164.31 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 42.298  30.429  14.408  1.00 164.67 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 41.170  29.920  13.483  1.00 164.76 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 41.174  30.169  12.271  1.00 164.81 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 43.242  31.474  13.692  1.00 164.73 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 44.397  30.824  13.144  1.00 164.92 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 43.695  32.558  14.665  1.00 164.76 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 40.222  29.196  14.086  1.00 164.83 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 38.975  28.725  13.436  1.00 164.83 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 39.039  27.361  12.701  1.00 164.76 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 38.001  26.833  12.290  1.00 164.75 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 38.338  29.820  12.551  1.00 164.87 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 37.721  30.989  13.336  1.00 164.79 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 37.364  32.186  12.463  1.00 164.72 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 37.380  32.104  11.227  1.00 164.52 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 37.039  33.307  13.110  1.00 164.53 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 40.236  26.788  12.564  1.00 164.61 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 40.413  25.517  11.846  1.00 164.43 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 39.946  24.308  12.663  1.00 164.28 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 40.597  23.925  13.639  1.00 164.34 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 41.887  25.291  11.430  1.00 164.44 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 42.417  26.490  10.854  1.00 164.51 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 42.001  24.148  10.421  1.00 164.38 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 38.836  23.696  12.250  1.00 163.96 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 38.338  22.483  12.911  1.00 163.59 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 39.108  21.216  12.541  1.00 163.18 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 38.507  20.171  12.282  1.00 163.15 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 36.840  22.276  12.672  1.00 163.69 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 35.961  22.727  13.821  1.00 164.15 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 35.142  23.949  13.449  1.00 165.26 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 33.804  23.585  12.970  1.00 165.85 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 33.454  23.443  11.691  1.00 166.03 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 34.334  23.629  10.713  1.00 166.28 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 32.205  23.112  11.389  1.00 165.90 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 40.437  21.314  12.516  1.00 162.63 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 41.292  20.136  12.465  1.00 161.98 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 41.339  19.556  13.885  1.00 161.49 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 40.289  19.231  14.450  1.00 161.43 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 42.685  20.496  11.942  1.00 161.96 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 42.531  19.435  14.470  1.00 160.81 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 42.661  18.944  15.850  1.00 159.99 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 43.795  19.612  16.645  1.00 159.38 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 43.619  19.913  17.824  1.00 159.24 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 42.782  17.409  15.897  1.00 160.03 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 41.930  16.650  14.864  1.00 159.95 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 41.265  15.407  15.441  1.00 160.14 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 39.930  15.731  16.106  1.00 160.21 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 39.287  14.538  16.737  1.00 160.16 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 44.931  19.851  15.979  1.00 158.62 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 46.173  20.450  16.546  1.00 157.87 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 46.936  19.561  17.545  1.00 157.28 ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 46.357  18.658  18.143  1.00 157.35 ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 46.003  21.938  17.068  1.00 157.92 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 45.397  22.006  18.481  1.00 157.87 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 45.224  22.781  16.061  1.00 158.01 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 45.462  23.387  19.140  1.00 157.81 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 48.234  19.815  17.705  1.00 156.50 ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 49.088  19.000  18.577  1.00 155.55 ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 49.181  19.444  20.031  1.00 154.89 ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 50.237  19.320  20.658  1.00 154.85 ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 48.071  19.947  20.572  1.00 154.25 ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 48.022  20.460  21.945  1.00 153.34 ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 47.349  19.517  22.923  1.00 152.68 ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 48.023  18.775  23.634  1.00 152.69 ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 46.019  19.563  22.977  1.00 151.97 ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 45.244  18.568  23.718  1.00 151.19 ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 44.881  17.373  22.836  1.00 150.92 ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 45.709  16.906  22.057  1.00 150.87 ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 43.998  19.178  24.368  1.00 151.01 ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 43.955  19.157  25.895  1.00 150.30 ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 42.708  19.843  26.398  1.00 149.99 ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 43.998  17.733  26.401  1.00 149.78 ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 43.644  16.899  22.945  1.00 150.52 ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 43.263  15.591  22.403  1.00 150.18 ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 43.384  15.344  20.892  1.00 150.14 ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 42.441  15.593  20.143  1.00 150.01 ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 41.874  15.165  22.915  1.00 150.03 ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 40.849  16.283  22.862  1.00 149.42 ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 41.073  17.372  23.385  1.00 148.96 ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 39.703  16.004  22.254  1.00 148.71 ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 44.561  14.875  20.466  1.00 150.24 ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 44.725  14.090  19.218  1.00 150.47 ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 46.132  13.681  18.725  1.00 150.50 ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 46.253  12.625  18.106  1.00 150.51 ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 43.929  14.632  18.026  1.00 150.59 ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 43.922  13.654  16.848  1.00 150.99 ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 43.302  12.572  16.962  1.00 151.18 ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 44.559  13.956  15.816  1.00 151.55 ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 47.172  14.520  18.942  1.00 150.53 ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 48.525  14.230  18.432  1.00 150.61 ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 48.985  12.784  18.647  1.00 150.74 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 49.778  12.511  19.556  1.00 150.73 ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 49.419  15.206  19.215  1.00 150.59 ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 48.528  15.842  20.242  1.00 150.56 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 47.160  15.797  19.668  1.00 150.49 ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 48.497  11.895  17.774  1.00 150.88 ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 48.626  10.424  17.864  1.00 151.00 ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 47.463  9.757   18.647  1.00 150.90 ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 47.220  8.559   18.509  1.00 150.92 ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 50.014  9.976   18.376  1.00 151.06 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 51.209  10.343  17.465  1.00 151.20 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 52.537  9.843   18.047  1.00 151.26 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 53.710  10.479  17.438  1.00 151.68 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 54.975  10.196  17.752  1.00 151.74 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 55.255  9.280   18.673  1.00 151.82 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 55.969  10.833  17.142  1.00 151.49 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 46.742  10.549  19.442  1.00 150.80 ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 45.579  10.088  20.214  1.00 150.63 ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 44.339  9.840   19.348  1.00 150.83 ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 44.375  10.046  18.129  1.00 150.80 ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 45.247  11.102  21.312  1.00 150.40 ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 45.555  10.721  22.753  1.00 149.79 ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 45.578  11.951  23.633  1.00 148.98 ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 44.504  9.749   23.227  1.00 149.64 ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 43.246  9.415   19.992  1.00 151.02 ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 41.989  9.043   19.310  1.00 151.25 ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 41.079  10.180  18.861  1.00 151.33 ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 41.079  11.253  19.459  1.00 151.44 ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 40.285  9.936   17.819  1.00 151.37 ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 39.499  11.001  17.183  1.00 151.41 ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 38.027  11.036  17.601  1.00 151.50 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 37.635  10.384  18.571  1.00 151.40 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 39.648  10.951  15.656  1.00 151.36 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 39.691  9.618   15.188  1.00 151.21 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 37.227  11.810  16.866  1.00 151.74 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 35.838  12.107  17.242  1.00 152.00 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 34.837  12.043  16.068  1.00 152.15 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 33.771  11.431  16.192  1.00 152.10 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 35.747  13.483  17.962  1.00 152.03 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 36.506  13.438  19.295  1.00 151.97 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 34.287  13.897  18.184  1.00 152.07 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 37.156  14.748  19.689  1.00 152.00 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 35.182  12.664  14.940  1.00 152.36 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 34.299  12.712  13.764  1.00 152.52 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 34.263  11.372  13.002  1.00 152.68 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 34.218  11.349  11.768  1.00 152.67 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 34.720  13.865  12.834  1.00 152.47 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 33.535  14.525  12.125  1.00 152.32 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 32.374  14.193  12.448  1.00 152.27 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 33.762  15.391  11.247  1.00 151.95 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 34.257  10.268  13.755  1.00 152.86 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 34.350  8.899   13.219  1.00 153.10 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 35.472  8.713   12.186  1.00 153.30 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 35.227  8.257   11.063  1.00 153.28 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 33.004  8.413   12.665  1.00 153.08 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 31.995  8.004   13.727  1.00 153.31 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 31.076  9.158   14.099  1.00 153.81 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 30.224  8.846   15.247  1.00 153.89 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 29.117  9.510   15.573  1.00 153.84 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 28.695  10.531  14.836  1.00 154.07 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 28.422  9.144   16.640  1.00 153.69 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 36.695  9.077   12.588  1.00 153.55 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 37.913  8.944   11.762  1.00 153.59 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 38.941  7.962   12.339  1.00 153.60 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 39.210  7.966   13.540  1.00 153.59 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 38.577  10.307  11.531  1.00 153.55 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 37.948  11.074  10.390  1.00 153.35 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 36.816  11.542  10.489  1.00 153.17 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 38.685  11.212  9.297   1.00 153.31 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 39.532  7.154   11.462  1.00 153.58 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 40.339  5.995   11.862  1.00 153.56 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 41.658  6.324   12.578  1.00 153.56 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 42.215  5.467   13.273  1.00 153.54 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 40.615  5.082   10.649  1.00 153.55 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 39.491  4.627   9.699   1.00 153.47 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 40.069  3.940   8.459   1.00 153.24 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 38.463  3.725   10.386  1.00 153.21 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 42.142  7.557   12.428  1.00 153.55 ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 43.516  7.902   12.829  1.00 153.51 ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 43.787  7.956   14.338  1.00 153.33 ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 44.135  9.007   14.889  1.00 153.28 ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 43.998  9.185   12.131  1.00 153.59 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 44.381  9.008   10.658  1.00 153.75 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 45.783  8.428   10.483  1.00 153.80 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 46.187  8.379   9.010   1.00 153.89 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 46.401  9.737   8.423   1.00 153.70 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 43.632  6.802   14.987  1.00 153.09 ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 44.191  6.563   16.315  1.00 152.86 ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 45.698  6.308   16.153  1.00 153.22 ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 46.247  5.383   16.757  1.00 153.20 ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 43.503  5.362   16.982  1.00 152.45 ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 42.279  5.711   18.303  1.00 150.83 ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 46.346  7.159   15.348  1.00 153.52 ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 47.720  6.969   14.831  1.00 153.81 ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 48.003  5.574   14.251  1.00 153.91 ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 48.286  4.625   14.989  1.00 153.96 ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 48.806  7.421   15.834  1.00 153.87 ? 68   GLN A CB    1 
ATOM   514   C  CG    . GLN A 1  68   ? 49.000  6.561   17.099  1.00 154.21 ? 68   GLN A CG    1 
ATOM   515   C  CD    . GLN A 1  68   ? 50.092  5.505   16.962  1.00 154.60 ? 68   GLN A CD    1 
ATOM   516   O  OE1   . GLN A 1  68   ? 51.252  5.822   16.698  1.00 155.04 ? 68   GLN A OE1   1 
ATOM   517   N  NE2   . GLN A 1  68   ? 49.722  4.243   17.159  1.00 154.47 ? 68   GLN A NE2   1 
ATOM   518   N  N     . THR A 1  69   ? 47.908  5.463   12.925  1.00 153.96 ? 69   THR A N     1 
ATOM   519   C  CA    . THR A 1  69   ? 48.168  4.208   12.189  1.00 153.91 ? 69   THR A CA    1 
ATOM   520   C  C     . THR A 1  69   ? 47.330  3.007   12.670  1.00 153.69 ? 69   THR A C     1 
ATOM   521   O  O     . THR A 1  69   ? 47.229  2.001   11.964  1.00 153.73 ? 69   THR A O     1 
ATOM   522   C  CB    . THR A 1  69   ? 49.688  3.809   12.194  1.00 153.97 ? 69   THR A CB    1 
ATOM   523   O  OG1   . THR A 1  69   ? 50.507  4.952   12.474  1.00 154.11 ? 69   THR A OG1   1 
ATOM   524   C  CG2   . THR A 1  69   ? 50.104  3.203   10.852  1.00 153.97 ? 69   THR A CG2   1 
ATOM   525   N  N     . CYS A 1  70   ? 46.733  3.116   13.858  1.00 153.35 ? 70   CYS A N     1 
ATOM   526   C  CA    . CYS A 1  70   ? 46.062  1.981   14.496  1.00 152.90 ? 70   CYS A CA    1 
ATOM   527   C  C     . CYS A 1  70   ? 44.658  1.740   13.951  1.00 152.76 ? 70   CYS A C     1 
ATOM   528   O  O     . CYS A 1  70   ? 44.063  0.693   14.213  1.00 152.73 ? 70   CYS A O     1 
ATOM   529   C  CB    . CYS A 1  70   ? 46.076  2.101   16.027  1.00 152.86 ? 70   CYS A CB    1 
ATOM   530   S  SG    . CYS A 1  70   ? 44.612  2.801   16.790  1.00 151.95 ? 70   CYS A SG    1 
ATOM   531   N  N     . GLN A 1  71   ? 44.142  2.708   13.195  1.00 152.50 ? 71   GLN A N     1 
ATOM   532   C  CA    . GLN A 1  71   ? 42.971  2.495   12.342  1.00 152.40 ? 71   GLN A CA    1 
ATOM   533   C  C     . GLN A 1  71   ? 41.684  2.244   13.140  1.00 152.02 ? 71   GLN A C     1 
ATOM   534   O  O     . GLN A 1  71   ? 41.580  2.623   14.306  1.00 152.01 ? 71   GLN A O     1 
ATOM   535   C  CB    . GLN A 1  71   ? 43.242  1.332   11.361  1.00 152.49 ? 71   GLN A CB    1 
ATOM   536   C  CG    . GLN A 1  71   ? 44.441  1.544   10.411  1.00 152.83 ? 71   GLN A CG    1 
ATOM   537   C  CD    . GLN A 1  71   ? 45.147  0.242   10.006  1.00 152.79 ? 71   GLN A CD    1 
ATOM   538   O  OE1   . GLN A 1  71   ? 45.910  -0.341  10.783  1.00 153.18 ? 71   GLN A OE1   1 
ATOM   539   N  NE2   . GLN A 1  71   ? 44.913  -0.197  8.773   1.00 152.99 ? 71   GLN A NE2   1 
ATOM   540   N  N     . GLU A 1  72   ? 40.701  1.642   12.471  1.00 151.66 ? 72   GLU A N     1 
ATOM   541   C  CA    . GLU A 1  72   ? 39.500  1.037   13.086  1.00 151.27 ? 72   GLU A CA    1 
ATOM   542   C  C     . GLU A 1  72   ? 38.443  1.955   13.726  1.00 150.81 ? 72   GLU A C     1 
ATOM   543   O  O     . GLU A 1  72   ? 37.287  1.554   13.880  1.00 150.77 ? 72   GLU A O     1 
ATOM   544   C  CB    . GLU A 1  72   ? 39.874  -0.127  14.026  1.00 151.38 ? 72   GLU A CB    1 
ATOM   545   C  CG    . GLU A 1  72   ? 40.671  -1.274  13.359  1.00 151.57 ? 72   GLU A CG    1 
ATOM   546   C  CD    . GLU A 1  72   ? 39.958  -1.941  12.172  1.00 151.58 ? 72   GLU A CD    1 
ATOM   547   O  OE1   . GLU A 1  72   ? 40.656  -2.316  11.202  1.00 151.46 ? 72   GLU A OE1   1 
ATOM   548   O  OE2   . GLU A 1  72   ? 38.716  -2.099  12.202  1.00 151.28 ? 72   GLU A OE2   1 
ATOM   549   N  N     . GLY A 1  73   ? 38.823  3.173   14.091  1.00 150.27 ? 73   GLY A N     1 
ATOM   550   C  CA    . GLY A 1  73   ? 37.847  4.167   14.538  1.00 149.67 ? 73   GLY A CA    1 
ATOM   551   C  C     . GLY A 1  73   ? 37.314  3.938   15.937  1.00 149.21 ? 73   GLY A C     1 
ATOM   552   O  O     . GLY A 1  73   ? 37.650  2.942   16.573  1.00 149.15 ? 73   GLY A O     1 
ATOM   553   N  N     . MET A 1  74   ? 36.456  4.852   16.397  1.00 148.77 ? 74   MET A N     1 
ATOM   554   C  CA    . MET A 1  74   ? 36.036  4.915   17.805  1.00 148.25 ? 74   MET A CA    1 
ATOM   555   C  C     . MET A 1  74   ? 35.058  3.827   18.244  1.00 147.84 ? 74   MET A C     1 
ATOM   556   O  O     . MET A 1  74   ? 34.219  4.049   19.118  1.00 147.88 ? 74   MET A O     1 
ATOM   557   C  CB    . MET A 1  74   ? 35.507  6.316   18.166  1.00 148.23 ? 74   MET A CB    1 
ATOM   558   C  CG    . MET A 1  74   ? 34.200  6.723   17.486  1.00 148.17 ? 74   MET A CG    1 
ATOM   559   S  SD    . MET A 1  74   ? 33.434  8.185   18.227  1.00 148.36 ? 74   MET A SD    1 
ATOM   560   C  CE    . MET A 1  74   ? 32.804  7.537   19.778  1.00 148.37 ? 74   MET A CE    1 
ATOM   561   N  N     . ASN A 1  75   ? 35.184  2.648   17.642  1.00 147.33 ? 75   ASN A N     1 
ATOM   562   C  CA    . ASN A 1  75   ? 34.467  1.461   18.096  1.00 146.92 ? 75   ASN A CA    1 
ATOM   563   C  C     . ASN A 1  75   ? 35.421  0.277   18.245  1.00 146.73 ? 75   ASN A C     1 
ATOM   564   O  O     . ASN A 1  75   ? 35.091  -0.858  17.888  1.00 146.68 ? 75   ASN A O     1 
ATOM   565   C  CB    . ASN A 1  75   ? 33.328  1.122   17.138  1.00 146.87 ? 75   ASN A CB    1 
ATOM   566   C  CG    . ASN A 1  75   ? 32.159  0.452   17.833  1.00 146.67 ? 75   ASN A CG    1 
ATOM   567   O  OD1   . ASN A 1  75   ? 32.324  -0.531  18.558  1.00 146.13 ? 75   ASN A OD1   1 
ATOM   568   N  ND2   . ASN A 1  75   ? 30.962  0.983   17.607  1.00 146.69 ? 75   ASN A ND2   1 
ATOM   569   N  N     . GLU A 1  76   ? 36.608  0.568   18.778  1.00 146.45 ? 76   GLU A N     1 
ATOM   570   C  CA    . GLU A 1  76   ? 37.695  -0.398  18.932  1.00 146.14 ? 76   GLU A CA    1 
ATOM   571   C  C     . GLU A 1  76   ? 38.761  0.221   19.836  1.00 145.86 ? 76   GLU A C     1 
ATOM   572   O  O     . GLU A 1  76   ? 38.924  -0.201  20.978  1.00 145.98 ? 76   GLU A O     1 
ATOM   573   C  CB    . GLU A 1  76   ? 38.296  -0.759  17.565  1.00 146.23 ? 76   GLU A CB    1 
ATOM   574   C  CG    . GLU A 1  76   ? 39.372  -1.840  17.588  1.00 146.34 ? 76   GLU A CG    1 
ATOM   575   C  CD    . GLU A 1  76   ? 38.823  -3.247  17.407  1.00 146.67 ? 76   GLU A CD    1 
ATOM   576   O  OE1   . GLU A 1  76   ? 37.582  -3.427  17.374  1.00 146.35 ? 76   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A 1  76   ? 39.648  -4.179  17.291  1.00 146.95 ? 76   GLU A OE2   1 
ATOM   578   N  N     . CYS A 1  77   ? 39.463  1.229   19.311  1.00 145.45 ? 77   CYS A N     1 
ATOM   579   C  CA    . CYS A 1  77   ? 40.499  1.981   20.024  1.00 144.83 ? 77   CYS A CA    1 
ATOM   580   C  C     . CYS A 1  77   ? 40.126  2.218   21.491  1.00 144.10 ? 77   CYS A C     1 
ATOM   581   O  O     . CYS A 1  77   ? 39.130  2.886   21.775  1.00 144.07 ? 77   CYS A O     1 
ATOM   582   C  CB    . CYS A 1  77   ? 40.723  3.325   19.323  1.00 145.14 ? 77   CYS A CB    1 
ATOM   583   S  SG    . CYS A 1  77   ? 42.206  4.254   19.794  1.00 145.99 ? 77   CYS A SG    1 
ATOM   584   N  N     . PRO A 1  78   ? 40.907  1.645   22.428  1.00 143.32 ? 78   PRO A N     1 
ATOM   585   C  CA    . PRO A 1  78   ? 40.737  1.959   23.847  1.00 142.57 ? 78   PRO A CA    1 
ATOM   586   C  C     . PRO A 1  78   ? 41.222  3.375   24.146  1.00 141.83 ? 78   PRO A C     1 
ATOM   587   O  O     . PRO A 1  78   ? 41.027  3.879   25.252  1.00 141.64 ? 78   PRO A O     1 
ATOM   588   C  CB    . PRO A 1  78   ? 41.637  0.932   24.548  1.00 142.59 ? 78   PRO A CB    1 
ATOM   589   C  CG    . PRO A 1  78   ? 41.974  -0.094  23.506  1.00 142.89 ? 78   PRO A CG    1 
ATOM   590   C  CD    . PRO A 1  78   ? 41.975  0.653   22.218  1.00 143.31 ? 78   PRO A CD    1 
ATOM   591   N  N     . GLY A 1  79   ? 41.844  4.000   23.147  1.00 141.10 ? 79   GLY A N     1 
ATOM   592   C  CA    . GLY A 1  79   ? 42.379  5.347   23.263  1.00 140.14 ? 79   GLY A CA    1 
ATOM   593   C  C     . GLY A 1  79   ? 43.653  5.326   24.071  1.00 139.43 ? 79   GLY A C     1 
ATOM   594   O  O     . GLY A 1  79   ? 43.625  5.543   25.277  1.00 139.46 ? 79   GLY A O     1 
ATOM   595   N  N     . HIS A 1  80   ? 44.766  5.042   23.400  1.00 138.66 ? 80   HIS A N     1 
ATOM   596   C  CA    . HIS A 1  80   ? 46.094  4.993   24.025  1.00 137.85 ? 80   HIS A CA    1 
ATOM   597   C  C     . HIS A 1  80   ? 46.407  6.259   24.819  1.00 137.18 ? 80   HIS A C     1 
ATOM   598   O  O     . HIS A 1  80   ? 45.914  7.335   24.494  1.00 137.17 ? 80   HIS A O     1 
ATOM   599   C  CB    . HIS A 1  80   ? 47.164  4.733   22.967  1.00 137.92 ? 80   HIS A CB    1 
ATOM   600   C  CG    . HIS A 1  80   ? 46.721  5.049   21.571  1.00 138.17 ? 80   HIS A CG    1 
ATOM   601   N  ND1   . HIS A 1  80   ? 45.947  4.185   20.826  1.00 138.37 ? 80   HIS A ND1   1 
ATOM   602   C  CD2   . HIS A 1  80   ? 46.940  6.130   20.785  1.00 138.25 ? 80   HIS A CD2   1 
ATOM   603   C  CE1   . HIS A 1  80   ? 45.713  4.719   19.641  1.00 138.30 ? 80   HIS A CE1   1 
ATOM   604   N  NE2   . HIS A 1  80   ? 46.303  5.899   19.590  1.00 138.18 ? 80   HIS A NE2   1 
ATOM   605   N  N     . PHE A 1  81   ? 47.218  6.126   25.864  1.00 136.32 ? 81   PHE A N     1 
ATOM   606   C  CA    . PHE A 1  81   ? 47.379  7.206   26.837  1.00 135.52 ? 81   PHE A CA    1 
ATOM   607   C  C     . PHE A 1  81   ? 48.276  8.359   26.404  1.00 135.12 ? 81   PHE A C     1 
ATOM   608   O  O     . PHE A 1  81   ? 48.973  8.282   25.393  1.00 134.96 ? 81   PHE A O     1 
ATOM   609   C  CB    . PHE A 1  81   ? 47.829  6.653   28.192  1.00 135.42 ? 81   PHE A CB    1 
ATOM   610   C  CG    . PHE A 1  81   ? 46.773  6.740   29.265  1.00 134.77 ? 81   PHE A CG    1 
ATOM   611   C  CD1   . PHE A 1  81   ? 45.903  5.679   29.496  1.00 133.84 ? 81   PHE A CD1   1 
ATOM   612   C  CD2   . PHE A 1  81   ? 46.658  7.882   30.048  1.00 134.19 ? 81   PHE A CD2   1 
ATOM   613   C  CE1   . PHE A 1  81   ? 44.935  5.756   30.485  1.00 133.51 ? 81   PHE A CE1   1 
ATOM   614   C  CE2   . PHE A 1  81   ? 45.694  7.966   31.038  1.00 134.08 ? 81   PHE A CE2   1 
ATOM   615   C  CZ    . PHE A 1  81   ? 44.829  6.900   31.258  1.00 134.12 ? 81   PHE A CZ    1 
ATOM   616   N  N     . GLY A 1  82   ? 48.224  9.434   27.188  1.00 134.73 ? 82   GLY A N     1 
ATOM   617   C  CA    . GLY A 1  82   ? 49.033  10.625  26.971  1.00 134.27 ? 82   GLY A CA    1 
ATOM   618   C  C     . GLY A 1  82   ? 49.747  11.046  28.238  1.00 133.96 ? 82   GLY A C     1 
ATOM   619   O  O     . GLY A 1  82   ? 49.287  10.759  29.339  1.00 133.84 ? 82   GLY A O     1 
ATOM   620   N  N     . HIS A 1  83   ? 50.878  11.725  28.083  1.00 133.79 ? 83   HIS A N     1 
ATOM   621   C  CA    . HIS A 1  83   ? 51.651  12.177  29.232  1.00 133.70 ? 83   HIS A CA    1 
ATOM   622   C  C     . HIS A 1  83   ? 51.848  13.678  29.200  1.00 133.64 ? 83   HIS A C     1 
ATOM   623   O  O     . HIS A 1  83   ? 52.086  14.264  28.145  1.00 133.67 ? 83   HIS A O     1 
ATOM   624   C  CB    . HIS A 1  83   ? 53.001  11.458  29.305  1.00 133.69 ? 83   HIS A CB    1 
ATOM   625   C  CG    . HIS A 1  83   ? 54.056  12.040  28.415  1.00 133.66 ? 83   HIS A CG    1 
ATOM   626   N  ND1   . HIS A 1  83   ? 55.154  12.714  28.906  1.00 133.68 ? 83   HIS A ND1   1 
ATOM   627   C  CD2   . HIS A 1  83   ? 54.182  12.051  27.067  1.00 133.67 ? 83   HIS A CD2   1 
ATOM   628   C  CE1   . HIS A 1  83   ? 55.913  13.110  27.900  1.00 133.63 ? 83   HIS A CE1   1 
ATOM   629   N  NE2   . HIS A 1  83   ? 55.345  12.721  26.772  1.00 133.69 ? 83   HIS A NE2   1 
ATOM   630   N  N     . ILE A 1  84   ? 51.740  14.298  30.365  1.00 133.56 ? 84   ILE A N     1 
ATOM   631   C  CA    . ILE A 1  84   ? 51.948  15.729  30.469  1.00 133.51 ? 84   ILE A CA    1 
ATOM   632   C  C     . ILE A 1  84   ? 53.013  16.024  31.533  1.00 133.59 ? 84   ILE A C     1 
ATOM   633   O  O     . ILE A 1  84   ? 52.895  15.588  32.680  1.00 133.77 ? 84   ILE A O     1 
ATOM   634   C  CB    . ILE A 1  84   ? 50.590  16.484  30.677  1.00 133.45 ? 84   ILE A CB    1 
ATOM   635   C  CG1   . ILE A 1  84   ? 50.699  17.963  30.276  1.00 133.30 ? 84   ILE A CG1   1 
ATOM   636   C  CG2   . ILE A 1  84   ? 49.987  16.233  32.075  1.00 133.18 ? 84   ILE A CG2   1 
ATOM   637   C  CD1   . ILE A 1  84   ? 51.182  18.901  31.360  1.00 133.37 ? 84   ILE A CD1   1 
ATOM   638   N  N     . ASP A 1  85   ? 54.064  16.737  31.128  1.00 133.49 ? 85   ASP A N     1 
ATOM   639   C  CA    . ASP A 1  85   ? 55.216  17.011  31.993  1.00 133.34 ? 85   ASP A CA    1 
ATOM   640   C  C     . ASP A 1  85   ? 54.901  18.097  33.019  1.00 133.21 ? 85   ASP A C     1 
ATOM   641   O  O     . ASP A 1  85   ? 54.416  19.171  32.662  1.00 133.17 ? 85   ASP A O     1 
ATOM   642   C  CB    . ASP A 1  85   ? 56.433  17.450  31.163  1.00 133.38 ? 85   ASP A CB    1 
ATOM   643   C  CG    . ASP A 1  85   ? 56.565  16.694  29.847  1.00 133.54 ? 85   ASP A CG    1 
ATOM   644   O  OD1   . ASP A 1  85   ? 56.856  15.477  29.873  1.00 133.56 ? 85   ASP A OD1   1 
ATOM   645   O  OD2   . ASP A 1  85   ? 56.397  17.332  28.783  1.00 133.81 ? 85   ASP A OD2   1 
ATOM   646   N  N     . LEU A 1  86   ? 55.184  17.819  34.288  1.00 133.11 ? 86   LEU A N     1 
ATOM   647   C  CA    . LEU A 1  86   ? 55.049  18.831  35.337  1.00 133.08 ? 86   LEU A CA    1 
ATOM   648   C  C     . LEU A 1  86   ? 56.302  19.695  35.438  1.00 133.13 ? 86   LEU A C     1 
ATOM   649   O  O     . LEU A 1  86   ? 57.425  19.183  35.409  1.00 133.06 ? 86   LEU A O     1 
ATOM   650   C  CB    . LEU A 1  86   ? 54.754  18.183  36.690  1.00 132.99 ? 86   LEU A CB    1 
ATOM   651   C  CG    . LEU A 1  86   ? 53.385  17.534  36.873  1.00 132.66 ? 86   LEU A CG    1 
ATOM   652   C  CD1   . LEU A 1  86   ? 53.340  16.780  38.186  1.00 131.89 ? 86   LEU A CD1   1 
ATOM   653   C  CD2   . LEU A 1  86   ? 52.279  18.583  36.798  1.00 132.50 ? 86   LEU A CD2   1 
ATOM   654   N  N     . ALA A 1  87   ? 56.100  21.006  35.557  1.00 133.24 ? 87   ALA A N     1 
ATOM   655   C  CA    . ALA A 1  87   ? 57.208  21.958  35.684  1.00 133.28 ? 87   ALA A CA    1 
ATOM   656   C  C     . ALA A 1  87   ? 57.980  21.684  36.965  1.00 133.23 ? 87   ALA A C     1 
ATOM   657   O  O     . ALA A 1  87   ? 59.177  21.373  36.934  1.00 133.30 ? 87   ALA A O     1 
ATOM   658   C  CB    . ALA A 1  87   ? 56.693  23.396  35.663  1.00 133.33 ? 87   ALA A CB    1 
ATOM   659   N  N     . LYS A 1  88   ? 57.279  21.800  38.088  1.00 133.02 ? 88   LYS A N     1 
ATOM   660   C  CA    . LYS A 1  88   ? 57.822  21.397  39.365  1.00 132.78 ? 88   LYS A CA    1 
ATOM   661   C  C     . LYS A 1  88   ? 56.850  20.467  40.071  1.00 132.40 ? 88   LYS A C     1 
ATOM   662   O  O     . LYS A 1  88   ? 55.680  20.812  40.243  1.00 132.38 ? 88   LYS A O     1 
ATOM   663   C  CB    . LYS A 1  88   ? 58.162  22.611  40.232  1.00 132.95 ? 88   LYS A CB    1 
ATOM   664   C  CG    . LYS A 1  88   ? 59.592  23.115  40.050  1.00 133.12 ? 88   LYS A CG    1 
ATOM   665   C  CD    . LYS A 1  88   ? 60.079  23.791  41.321  1.00 133.53 ? 88   LYS A CD    1 
ATOM   666   C  CE    . LYS A 1  88   ? 61.591  23.769  41.429  1.00 133.66 ? 88   LYS A CE    1 
ATOM   667   N  NZ    . LYS A 1  88   ? 62.040  24.006  42.834  1.00 133.83 ? 88   LYS A NZ    1 
ATOM   668   N  N     . PRO A 1  89   ? 57.332  19.266  40.440  1.00 132.05 ? 89   PRO A N     1 
ATOM   669   C  CA    . PRO A 1  89   ? 56.691  18.245  41.261  1.00 131.89 ? 89   PRO A CA    1 
ATOM   670   C  C     . PRO A 1  89   ? 55.625  18.756  42.249  1.00 131.67 ? 89   PRO A C     1 
ATOM   671   O  O     . PRO A 1  89   ? 55.838  19.761  42.933  1.00 131.68 ? 89   PRO A O     1 
ATOM   672   C  CB    . PRO A 1  89   ? 57.880  17.652  42.022  1.00 131.84 ? 89   PRO A CB    1 
ATOM   673   C  CG    . PRO A 1  89   ? 59.069  17.855  41.093  1.00 131.81 ? 89   PRO A CG    1 
ATOM   674   C  CD    . PRO A 1  89   ? 58.658  18.803  39.997  1.00 131.96 ? 89   PRO A CD    1 
ATOM   675   N  N     . VAL A 1  90   ? 54.490  18.059  42.313  1.00 131.28 ? 90   VAL A N     1 
ATOM   676   C  CA    . VAL A 1  90   ? 53.379  18.453  43.183  1.00 130.93 ? 90   VAL A CA    1 
ATOM   677   C  C     . VAL A 1  90   ? 52.729  17.271  43.899  1.00 130.66 ? 90   VAL A C     1 
ATOM   678   O  O     . VAL A 1  90   ? 52.775  16.140  43.419  1.00 130.55 ? 90   VAL A O     1 
ATOM   679   C  CB    . VAL A 1  90   ? 52.297  19.236  42.414  1.00 131.01 ? 90   VAL A CB    1 
ATOM   680   C  CG1   . VAL A 1  90   ? 52.742  20.674  42.182  1.00 131.20 ? 90   VAL A CG1   1 
ATOM   681   C  CG2   . VAL A 1  90   ? 51.965  18.544  41.102  1.00 130.98 ? 90   VAL A CG2   1 
ATOM   682   N  N     . PHE A 1  91   ? 52.110  17.562  45.042  1.00 130.37 ? 91   PHE A N     1 
ATOM   683   C  CA    . PHE A 1  91   ? 51.519  16.554  45.926  1.00 130.18 ? 91   PHE A CA    1 
ATOM   684   C  C     . PHE A 1  91   ? 50.302  15.846  45.317  1.00 129.78 ? 91   PHE A C     1 
ATOM   685   O  O     . PHE A 1  91   ? 49.559  16.442  44.534  1.00 129.83 ? 91   PHE A O     1 
ATOM   686   C  CB    . PHE A 1  91   ? 51.097  17.191  47.253  1.00 130.47 ? 91   PHE A CB    1 
ATOM   687   C  CG    . PHE A 1  91   ? 52.134  18.094  47.869  1.00 131.13 ? 91   PHE A CG    1 
ATOM   688   C  CD1   . PHE A 1  91   ? 53.143  17.571  48.680  1.00 131.50 ? 91   PHE A CD1   1 
ATOM   689   C  CD2   . PHE A 1  91   ? 52.081  19.480  47.666  1.00 131.88 ? 91   PHE A CD2   1 
ATOM   690   C  CE1   . PHE A 1  91   ? 54.099  18.416  49.269  1.00 132.12 ? 91   PHE A CE1   1 
ATOM   691   C  CE2   . PHE A 1  91   ? 53.030  20.337  48.247  1.00 132.13 ? 91   PHE A CE2   1 
ATOM   692   C  CZ    . PHE A 1  91   ? 54.043  19.805  49.050  1.00 131.92 ? 91   PHE A CZ    1 
ATOM   693   N  N     . HIS A 1  92   ? 50.101  14.584  45.709  1.00 129.11 ? 92   HIS A N     1 
ATOM   694   C  CA    . HIS A 1  92   ? 49.012  13.739  45.206  1.00 128.25 ? 92   HIS A CA    1 
ATOM   695   C  C     . HIS A 1  92   ? 47.963  13.505  46.281  1.00 127.63 ? 92   HIS A C     1 
ATOM   696   O  O     . HIS A 1  92   ? 48.234  12.842  47.274  1.00 127.54 ? 92   HIS A O     1 
ATOM   697   C  CB    . HIS A 1  92   ? 49.571  12.396  44.752  1.00 128.31 ? 92   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1  92   ? 48.549  11.494  44.138  1.00 128.53 ? 92   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1  92   ? 48.782  10.795  42.972  1.00 128.57 ? 92   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1  92   ? 47.290  11.179  44.523  1.00 128.95 ? 92   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1  92   ? 47.711  10.085  42.668  1.00 129.10 ? 92   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1  92   ? 46.791  10.300  43.592  1.00 129.53 ? 92   HIS A NE2   1 
ATOM   703   N  N     . VAL A 1  93   ? 46.755  13.998  46.032  1.00 127.00 ? 93   VAL A N     1 
ATOM   704   C  CA    . VAL A 1  93   ? 45.728  14.229  47.067  1.00 126.60 ? 93   VAL A CA    1 
ATOM   705   C  C     . VAL A 1  93   ? 45.308  13.113  48.019  1.00 126.45 ? 93   VAL A C     1 
ATOM   706   O  O     . VAL A 1  93   ? 45.155  13.347  49.223  1.00 126.32 ? 93   VAL A O     1 
ATOM   707   C  CB    . VAL A 1  93   ? 44.447  14.822  46.467  1.00 126.54 ? 93   VAL A CB    1 
ATOM   708   C  CG1   . VAL A 1  93   ? 44.343  16.289  46.805  1.00 126.39 ? 93   VAL A CG1   1 
ATOM   709   C  CG2   . VAL A 1  93   ? 44.407  14.592  44.974  1.00 126.66 ? 93   VAL A CG2   1 
ATOM   710   N  N     . GLY A 1  94   ? 45.081  11.917  47.490  1.00 126.35 ? 94   GLY A N     1 
ATOM   711   C  CA    . GLY A 1  94   ? 44.647  10.798  48.326  1.00 126.26 ? 94   GLY A CA    1 
ATOM   712   C  C     . GLY A 1  94   ? 45.703  10.364  49.329  1.00 126.16 ? 94   GLY A C     1 
ATOM   713   O  O     . GLY A 1  94   ? 45.379  9.912   50.427  1.00 126.13 ? 94   GLY A O     1 
ATOM   714   N  N     . PHE A 1  95   ? 46.968  10.535  48.948  1.00 126.10 ? 95   PHE A N     1 
ATOM   715   C  CA    . PHE A 1  95   ? 48.116  10.053  49.722  1.00 125.92 ? 95   PHE A CA    1 
ATOM   716   C  C     . PHE A 1  95   ? 48.712  11.044  50.731  1.00 126.00 ? 95   PHE A C     1 
ATOM   717   O  O     . PHE A 1  95   ? 49.561  10.665  51.540  1.00 125.91 ? 95   PHE A O     1 
ATOM   718   C  CB    . PHE A 1  95   ? 49.217  9.581   48.773  1.00 125.77 ? 95   PHE A CB    1 
ATOM   719   C  CG    . PHE A 1  95   ? 48.788  8.499   47.832  1.00 125.09 ? 95   PHE A CG    1 
ATOM   720   C  CD1   . PHE A 1  95   ? 49.214  8.513   46.511  1.00 125.04 ? 95   PHE A CD1   1 
ATOM   721   C  CD2   . PHE A 1  95   ? 47.963  7.470   48.261  1.00 124.33 ? 95   PHE A CD2   1 
ATOM   722   C  CE1   . PHE A 1  95   ? 48.835  7.518   45.633  1.00 125.03 ? 95   PHE A CE1   1 
ATOM   723   C  CE2   . PHE A 1  95   ? 47.573  6.475   47.391  1.00 124.72 ? 95   PHE A CE2   1 
ATOM   724   C  CZ    . PHE A 1  95   ? 48.009  6.496   46.071  1.00 125.11 ? 95   PHE A CZ    1 
ATOM   725   N  N     . ILE A 1  96   ? 48.287  12.306  50.669  1.00 126.11 ? 96   ILE A N     1 
ATOM   726   C  CA    . ILE A 1  96   ? 48.651  13.306  51.674  1.00 126.11 ? 96   ILE A CA    1 
ATOM   727   C  C     . ILE A 1  96   ? 48.626  12.658  53.058  1.00 126.35 ? 96   ILE A C     1 
ATOM   728   O  O     . ILE A 1  96   ? 49.642  12.649  53.756  1.00 126.39 ? 96   ILE A O     1 
ATOM   729   C  CB    . ILE A 1  96   ? 47.721  14.563  51.593  1.00 126.00 ? 96   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1  96   ? 48.136  15.472  50.424  1.00 125.76 ? 96   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1  96   ? 47.660  15.340  52.921  1.00 125.69 ? 96   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1  96   ? 49.639  15.676  50.244  1.00 124.50 ? 96   ILE A CD1   1 
ATOM   733   N  N     . ALA A 1  97   ? 47.477  12.079  53.413  1.00 126.58 ? 97   ALA A N     1 
ATOM   734   C  CA    . ALA A 1  97   ? 47.294  11.332  54.658  1.00 126.75 ? 97   ALA A CA    1 
ATOM   735   C  C     . ALA A 1  97   ? 48.505  10.462  54.980  1.00 126.93 ? 97   ALA A C     1 
ATOM   736   O  O     . ALA A 1  97   ? 49.016  10.498  56.101  1.00 126.84 ? 97   ALA A O     1 
ATOM   737   C  CB    . ALA A 1  97   ? 46.024  10.480  54.584  1.00 126.69 ? 97   ALA A CB    1 
ATOM   738   N  N     . LYS A 1  98   ? 48.961  9.697   53.987  1.00 127.29 ? 98   LYS A N     1 
ATOM   739   C  CA    . LYS A 1  98   ? 50.139  8.850   54.146  1.00 127.73 ? 98   LYS A CA    1 
ATOM   740   C  C     . LYS A 1  98   ? 51.452  9.634   54.144  1.00 128.29 ? 98   LYS A C     1 
ATOM   741   O  O     . LYS A 1  98   ? 52.214  9.532   55.100  1.00 128.62 ? 98   LYS A O     1 
ATOM   742   C  CB    . LYS A 1  98   ? 50.180  7.707   53.119  1.00 127.54 ? 98   LYS A CB    1 
ATOM   743   C  CG    . LYS A 1  98   ? 49.752  6.349   53.680  1.00 127.19 ? 98   LYS A CG    1 
ATOM   744   C  CD    . LYS A 1  98   ? 50.572  5.211   53.076  1.00 126.47 ? 98   LYS A CD    1 
ATOM   745   C  CE    . LYS A 1  98   ? 50.213  3.862   53.690  1.00 126.10 ? 98   LYS A CE    1 
ATOM   746   N  NZ    . LYS A 1  98   ? 49.064  3.197   53.011  1.00 125.95 ? 98   LYS A NZ    1 
ATOM   747   N  N     . ILE A 1  99   ? 51.722  10.425  53.103  1.00 128.68 ? 99   ILE A N     1 
ATOM   748   C  CA    . ILE A 1  99   ? 53.020  11.120  53.001  1.00 128.96 ? 99   ILE A CA    1 
ATOM   749   C  C     . ILE A 1  99   ? 53.366  11.926  54.269  1.00 129.25 ? 99   ILE A C     1 
ATOM   750   O  O     . ILE A 1  99   ? 54.542  12.096  54.602  1.00 129.12 ? 99   ILE A O     1 
ATOM   751   C  CB    . ILE A 1  99   ? 53.130  11.982  51.731  1.00 128.84 ? 99   ILE A CB    1 
ATOM   752   C  CG1   . ILE A 1  99   ? 52.378  11.318  50.575  1.00 128.94 ? 99   ILE A CG1   1 
ATOM   753   C  CG2   . ILE A 1  99   ? 54.583  12.168  51.356  1.00 128.81 ? 99   ILE A CG2   1 
ATOM   754   C  CD1   . ILE A 1  99   ? 52.457  12.045  49.241  1.00 129.20 ? 99   ILE A CD1   1 
ATOM   755   N  N     . LYS A 1  100  ? 52.331  12.385  54.976  1.00 129.77 ? 100  LYS A N     1 
ATOM   756   C  CA    . LYS A 1  100  ? 52.464  12.971  56.315  1.00 130.25 ? 100  LYS A CA    1 
ATOM   757   C  C     . LYS A 1  100  ? 52.820  11.902  57.356  1.00 130.76 ? 100  LYS A C     1 
ATOM   758   O  O     . LYS A 1  100  ? 53.688  12.130  58.194  1.00 130.83 ? 100  LYS A O     1 
ATOM   759   C  CB    . LYS A 1  100  ? 51.176  13.702  56.718  1.00 130.13 ? 100  LYS A CB    1 
ATOM   760   C  CG    . LYS A 1  100  ? 51.351  14.852  57.709  1.00 129.76 ? 100  LYS A CG    1 
ATOM   761   C  CD    . LYS A 1  100  ? 51.410  14.402  59.171  1.00 130.21 ? 100  LYS A CD    1 
ATOM   762   C  CE    . LYS A 1  100  ? 50.029  14.244  59.810  1.00 130.63 ? 100  LYS A CE    1 
ATOM   763   N  NZ    . LYS A 1  100  ? 49.386  12.939  59.478  1.00 131.19 ? 100  LYS A NZ    1 
ATOM   764   N  N     . LYS A 1  101  ? 52.147  10.749  57.306  1.00 131.40 ? 101  LYS A N     1 
ATOM   765   C  CA    . LYS A 1  101  ? 52.485  9.600   58.160  1.00 132.15 ? 101  LYS A CA    1 
ATOM   766   C  C     . LYS A 1  101  ? 53.943  9.157   57.972  1.00 132.67 ? 101  LYS A C     1 
ATOM   767   O  O     . LYS A 1  101  ? 54.624  8.843   58.952  1.00 132.74 ? 101  LYS A O     1 
ATOM   768   C  CB    . LYS A 1  101  ? 51.568  8.398   57.883  1.00 132.07 ? 101  LYS A CB    1 
ATOM   769   C  CG    . LYS A 1  101  ? 50.191  8.382   58.556  1.00 132.16 ? 101  LYS A CG    1 
ATOM   770   C  CD    . LYS A 1  101  ? 49.553  6.991   58.359  1.00 132.32 ? 101  LYS A CD    1 
ATOM   771   C  CE    . LYS A 1  101  ? 48.022  6.984   58.437  1.00 132.58 ? 101  LYS A CE    1 
ATOM   772   N  NZ    . LYS A 1  101  ? 47.492  6.572   59.771  1.00 132.34 ? 101  LYS A NZ    1 
ATOM   773   N  N     . VAL A 1  102  ? 54.409  9.133   56.719  1.00 133.32 ? 102  VAL A N     1 
ATOM   774   C  CA    . VAL A 1  102  ? 55.755  8.648   56.390  1.00 133.99 ? 102  VAL A CA    1 
ATOM   775   C  C     . VAL A 1  102  ? 56.819  9.655   56.803  1.00 134.65 ? 102  VAL A C     1 
ATOM   776   O  O     . VAL A 1  102  ? 57.896  9.281   57.281  1.00 134.81 ? 102  VAL A O     1 
ATOM   777   C  CB    . VAL A 1  102  ? 55.934  8.330   54.890  1.00 133.82 ? 102  VAL A CB    1 
ATOM   778   C  CG1   . VAL A 1  102  ? 56.921  7.188   54.721  1.00 133.95 ? 102  VAL A CG1   1 
ATOM   779   C  CG2   . VAL A 1  102  ? 54.626  7.945   54.260  1.00 133.78 ? 102  VAL A CG2   1 
ATOM   780   N  N     . CYS A 1  103  ? 56.517  10.935  56.617  1.00 135.38 ? 103  CYS A N     1 
ATOM   781   C  CA    . CYS A 1  103  ? 57.401  11.983  57.102  1.00 136.09 ? 103  CYS A CA    1 
ATOM   782   C  C     . CYS A 1  103  ? 57.150  12.270  58.580  1.00 136.41 ? 103  CYS A C     1 
ATOM   783   O  O     . CYS A 1  103  ? 57.399  13.365  59.072  1.00 136.48 ? 103  CYS A O     1 
ATOM   784   C  CB    . CYS A 1  103  ? 57.301  13.231  56.229  1.00 136.15 ? 103  CYS A CB    1 
ATOM   785   S  SG    . CYS A 1  103  ? 58.187  13.024  54.664  1.00 136.74 ? 103  CYS A SG    1 
ATOM   786   N  N     . GLU A 1  104  ? 56.634  11.258  59.268  1.00 136.95 ? 104  GLU A N     1 
ATOM   787   C  CA    . GLU A 1  104  ? 56.660  11.191  60.719  1.00 137.61 ? 104  GLU A CA    1 
ATOM   788   C  C     . GLU A 1  104  ? 57.434  9.927   61.108  1.00 138.05 ? 104  GLU A C     1 
ATOM   789   O  O     . GLU A 1  104  ? 57.646  9.647   62.293  1.00 138.22 ? 104  GLU A O     1 
ATOM   790   C  CB    . GLU A 1  104  ? 55.239  11.172  61.298  1.00 137.59 ? 104  GLU A CB    1 
ATOM   791   C  CG    . GLU A 1  104  ? 54.477  12.490  61.146  1.00 137.76 ? 104  GLU A CG    1 
ATOM   792   C  CD    . GLU A 1  104  ? 53.370  12.669  62.176  1.00 137.81 ? 104  GLU A CD    1 
ATOM   793   O  OE1   . GLU A 1  104  ? 52.181  12.668  61.788  1.00 137.58 ? 104  GLU A OE1   1 
ATOM   794   O  OE2   . GLU A 1  104  ? 53.689  12.813  63.375  1.00 137.87 ? 104  GLU A OE2   1 
ATOM   795   N  N     . CYS A 1  105  ? 57.869  9.184   60.090  1.00 138.52 ? 105  CYS A N     1 
ATOM   796   C  CA    . CYS A 1  105  ? 58.565  7.911   60.270  1.00 138.87 ? 105  CYS A CA    1 
ATOM   797   C  C     . CYS A 1  105  ? 59.993  7.952   59.721  1.00 139.31 ? 105  CYS A C     1 
ATOM   798   O  O     . CYS A 1  105  ? 60.798  7.070   60.016  1.00 139.24 ? 105  CYS A O     1 
ATOM   799   C  CB    . CYS A 1  105  ? 57.784  6.774   59.590  1.00 138.89 ? 105  CYS A CB    1 
ATOM   800   S  SG    . CYS A 1  105  ? 56.185  6.318   60.339  1.00 137.84 ? 105  CYS A SG    1 
ATOM   801   N  N     . VAL A 1  106  ? 60.296  8.960   58.908  1.00 139.95 ? 106  VAL A N     1 
ATOM   802   C  CA    . VAL A 1  106  ? 61.625  9.104   58.316  1.00 140.78 ? 106  VAL A CA    1 
ATOM   803   C  C     . VAL A 1  106  ? 62.113  10.548  58.465  1.00 141.43 ? 106  VAL A C     1 
ATOM   804   O  O     . VAL A 1  106  ? 61.306  11.479  58.424  1.00 141.53 ? 106  VAL A O     1 
ATOM   805   C  CB    . VAL A 1  106  ? 61.634  8.694   56.821  1.00 140.68 ? 106  VAL A CB    1 
ATOM   806   C  CG1   . VAL A 1  106  ? 63.062  8.508   56.324  1.00 140.86 ? 106  VAL A CG1   1 
ATOM   807   C  CG2   . VAL A 1  106  ? 60.849  7.411   56.603  1.00 140.52 ? 106  VAL A CG2   1 
ATOM   808   N  N     . CYS A 1  107  ? 63.425  10.730  58.635  1.00 142.24 ? 107  CYS A N     1 
ATOM   809   C  CA    . CYS A 1  107  ? 64.008  12.064  58.815  1.00 142.90 ? 107  CYS A CA    1 
ATOM   810   C  C     . CYS A 1  107  ? 64.733  12.612  57.572  1.00 143.55 ? 107  CYS A C     1 
ATOM   811   O  O     . CYS A 1  107  ? 65.008  11.877  56.617  1.00 143.62 ? 107  CYS A O     1 
ATOM   812   C  CB    . CYS A 1  107  ? 64.932  12.087  60.033  1.00 142.86 ? 107  CYS A CB    1 
ATOM   813   S  SG    . CYS A 1  107  ? 65.163  13.725  60.752  1.00 142.51 ? 107  CYS A SG    1 
ATOM   814   N  N     . MET A 1  108  ? 65.046  13.908  57.613  1.00 144.30 ? 108  MET A N     1 
ATOM   815   C  CA    . MET A 1  108  ? 65.534  14.659  56.451  1.00 145.01 ? 108  MET A CA    1 
ATOM   816   C  C     . MET A 1  108  ? 67.063  14.650  56.339  1.00 145.33 ? 108  MET A C     1 
ATOM   817   O  O     . MET A 1  108  ? 67.743  13.936  57.085  1.00 145.31 ? 108  MET A O     1 
ATOM   818   C  CB    . MET A 1  108  ? 65.024  16.114  56.485  1.00 145.07 ? 108  MET A CB    1 
ATOM   819   C  CG    . MET A 1  108  ? 64.036  16.476  57.612  1.00 145.66 ? 108  MET A CG    1 
ATOM   820   S  SD    . MET A 1  108  ? 62.585  15.403  57.846  1.00 146.61 ? 108  MET A SD    1 
ATOM   821   C  CE    . MET A 1  108  ? 61.753  15.535  56.264  1.00 146.57 ? 108  MET A CE    1 
ATOM   822   N  N     . HIS A 1  109  ? 67.578  15.445  55.393  1.00 145.79 ? 109  HIS A N     1 
ATOM   823   C  CA    . HIS A 1  109  ? 69.022  15.634  55.143  1.00 146.16 ? 109  HIS A CA    1 
ATOM   824   C  C     . HIS A 1  109  ? 69.808  14.320  55.021  1.00 146.28 ? 109  HIS A C     1 
ATOM   825   O  O     . HIS A 1  109  ? 71.041  14.324  54.945  1.00 146.35 ? 109  HIS A O     1 
ATOM   826   C  CB    . HIS A 1  109  ? 69.653  16.570  56.198  1.00 146.21 ? 109  HIS A CB    1 
ATOM   827   C  CG    . HIS A 1  109  ? 69.044  17.941  56.240  1.00 146.41 ? 109  HIS A CG    1 
ATOM   828   N  ND1   . HIS A 1  109  ? 69.410  18.947  55.372  1.00 146.59 ? 109  HIS A ND1   1 
ATOM   829   C  CD2   . HIS A 1  109  ? 68.093  18.470  57.047  1.00 146.43 ? 109  HIS A CD2   1 
ATOM   830   C  CE1   . HIS A 1  109  ? 68.709  20.035  55.639  1.00 146.57 ? 109  HIS A CE1   1 
ATOM   831   N  NE2   . HIS A 1  109  ? 67.903  19.772  56.652  1.00 146.52 ? 109  HIS A NE2   1 
ATOM   832   N  N     . CYS A 1  110  ? 69.074  13.208  54.979  1.00 146.35 ? 110  CYS A N     1 
ATOM   833   C  CA    . CYS A 1  110  ? 69.645  11.868  55.038  1.00 146.46 ? 110  CYS A CA    1 
ATOM   834   C  C     . CYS A 1  110  ? 68.650  10.866  54.452  1.00 146.54 ? 110  CYS A C     1 
ATOM   835   O  O     . CYS A 1  110  ? 68.814  10.413  53.318  1.00 146.61 ? 110  CYS A O     1 
ATOM   836   C  CB    . CYS A 1  110  ? 69.996  11.513  56.489  1.00 146.44 ? 110  CYS A CB    1 
ATOM   837   S  SG    . CYS A 1  110  ? 70.853  9.945   56.737  1.00 146.22 ? 110  CYS A SG    1 
ATOM   838   N  N     . GLY A 1  111  ? 67.614  10.536  55.223  1.00 146.59 ? 111  GLY A N     1 
ATOM   839   C  CA    . GLY A 1  111  ? 66.565  9.624   54.771  1.00 146.64 ? 111  GLY A CA    1 
ATOM   840   C  C     . GLY A 1  111  ? 66.788  8.175   55.162  1.00 146.68 ? 111  GLY A C     1 
ATOM   841   O  O     . GLY A 1  111  ? 67.200  7.355   54.340  1.00 146.69 ? 111  GLY A O     1 
ATOM   842   N  N     . LYS A 1  112  ? 66.505  7.860   56.422  1.00 146.71 ? 112  LYS A N     1 
ATOM   843   C  CA    . LYS A 1  112  ? 66.680  6.507   56.947  1.00 146.76 ? 112  LYS A CA    1 
ATOM   844   C  C     . LYS A 1  112  ? 65.662  6.264   58.051  1.00 146.74 ? 112  LYS A C     1 
ATOM   845   O  O     . LYS A 1  112  ? 65.146  7.216   58.646  1.00 146.61 ? 112  LYS A O     1 
ATOM   846   C  CB    . LYS A 1  112  ? 68.106  6.322   57.495  1.00 146.92 ? 112  LYS A CB    1 
ATOM   847   C  CG    . LYS A 1  112  ? 68.533  4.866   57.715  1.00 146.92 ? 112  LYS A CG    1 
ATOM   848   C  CD    . LYS A 1  112  ? 69.782  4.754   58.585  1.00 146.60 ? 112  LYS A CD    1 
ATOM   849   C  CE    . LYS A 1  112  ? 70.236  3.307   58.679  1.00 146.35 ? 112  LYS A CE    1 
ATOM   850   N  NZ    . LYS A 1  112  ? 71.179  3.079   59.803  1.00 146.43 ? 112  LYS A NZ    1 
ATOM   851   N  N     . LEU A 1  113  ? 65.379  4.989   58.318  1.00 146.73 ? 113  LEU A N     1 
ATOM   852   C  CA    . LEU A 1  113  ? 64.508  4.598   59.425  1.00 146.79 ? 113  LEU A CA    1 
ATOM   853   C  C     . LEU A 1  113  ? 65.056  5.116   60.754  1.00 146.99 ? 113  LEU A C     1 
ATOM   854   O  O     . LEU A 1  113  ? 66.265  5.289   60.909  1.00 147.01 ? 113  LEU A O     1 
ATOM   855   C  CB    . LEU A 1  113  ? 64.318  3.073   59.463  1.00 146.67 ? 113  LEU A CB    1 
ATOM   856   C  CG    . LEU A 1  113  ? 63.083  2.469   58.779  1.00 146.00 ? 113  LEU A CG    1 
ATOM   857   C  CD1   . LEU A 1  113  ? 63.267  0.980   58.505  1.00 145.23 ? 113  LEU A CD1   1 
ATOM   858   C  CD2   . LEU A 1  113  ? 61.836  2.707   59.619  1.00 145.21 ? 113  LEU A CD2   1 
ATOM   859   N  N     . LEU A 1  114  ? 64.160  5.366   61.704  1.00 147.26 ? 114  LEU A N     1 
ATOM   860   C  CA    . LEU A 1  114  ? 64.539  5.996   62.966  1.00 147.59 ? 114  LEU A CA    1 
ATOM   861   C  C     . LEU A 1  114  ? 64.674  5.024   64.139  1.00 148.06 ? 114  LEU A C     1 
ATOM   862   O  O     . LEU A 1  114  ? 64.915  5.451   65.269  1.00 148.12 ? 114  LEU A O     1 
ATOM   863   C  CB    . LEU A 1  114  ? 63.564  7.124   63.320  1.00 147.41 ? 114  LEU A CB    1 
ATOM   864   C  CG    . LEU A 1  114  ? 63.094  8.077   62.219  1.00 147.22 ? 114  LEU A CG    1 
ATOM   865   C  CD1   . LEU A 1  114  ? 62.235  9.172   62.830  1.00 147.21 ? 114  LEU A CD1   1 
ATOM   866   C  CD2   . LEU A 1  114  ? 64.250  8.674   61.432  1.00 146.92 ? 114  LEU A CD2   1 
ATOM   867   N  N     . LEU A 1  115  ? 64.509  3.727   63.865  1.00 148.68 ? 115  LEU A N     1 
ATOM   868   C  CA    . LEU A 1  115  ? 64.795  2.643   64.823  1.00 149.31 ? 115  LEU A CA    1 
ATOM   869   C  C     . LEU A 1  115  ? 65.061  1.313   64.105  1.00 149.80 ? 115  LEU A C     1 
ATOM   870   O  O     . LEU A 1  115  ? 64.170  0.770   63.456  1.00 149.82 ? 115  LEU A O     1 
ATOM   871   C  CB    . LEU A 1  115  ? 63.659  2.471   65.848  1.00 149.18 ? 115  LEU A CB    1 
ATOM   872   C  CG    . LEU A 1  115  ? 63.585  3.388   67.078  1.00 149.21 ? 115  LEU A CG    1 
ATOM   873   C  CD1   . LEU A 1  115  ? 62.330  3.115   67.899  1.00 148.97 ? 115  LEU A CD1   1 
ATOM   874   C  CD2   . LEU A 1  115  ? 64.836  3.280   67.952  1.00 149.44 ? 115  LEU A CD2   1 
ATOM   875   N  N     . ASP A 1  116  ? 66.289  0.805   64.211  1.00 150.52 ? 116  ASP A N     1 
ATOM   876   C  CA    . ASP A 1  116  ? 66.643  -0.505  63.647  1.00 151.24 ? 116  ASP A CA    1 
ATOM   877   C  C     . ASP A 1  116  ? 66.377  -1.632  64.649  1.00 151.80 ? 116  ASP A C     1 
ATOM   878   O  O     . ASP A 1  116  ? 65.905  -1.372  65.762  1.00 151.87 ? 116  ASP A O     1 
ATOM   879   C  CB    . ASP A 1  116  ? 68.102  -0.532  63.172  1.00 151.17 ? 116  ASP A CB    1 
ATOM   880   C  CG    . ASP A 1  116  ? 68.234  -0.332  61.672  1.00 151.20 ? 116  ASP A CG    1 
ATOM   881   O  OD1   . ASP A 1  116  ? 68.655  -1.284  60.981  1.00 151.18 ? 116  ASP A OD1   1 
ATOM   882   O  OD2   . ASP A 1  116  ? 67.914  0.769   61.181  1.00 151.34 ? 116  ASP A OD2   1 
ATOM   883   N  N     . GLU A 1  117  ? 66.688  -2.873  64.254  1.00 152.48 ? 117  GLU A N     1 
ATOM   884   C  CA    . GLU A 1  117  ? 66.443  -4.070  65.086  1.00 153.05 ? 117  GLU A CA    1 
ATOM   885   C  C     . GLU A 1  117  ? 67.234  -4.078  66.401  1.00 153.61 ? 117  GLU A C     1 
ATOM   886   O  O     . GLU A 1  117  ? 67.180  -5.052  67.155  1.00 153.62 ? 117  GLU A O     1 
ATOM   887   C  CB    . GLU A 1  117  ? 66.719  -5.376  64.318  1.00 152.92 ? 117  GLU A CB    1 
ATOM   888   C  CG    . GLU A 1  117  ? 66.238  -5.414  62.881  1.00 152.53 ? 117  GLU A CG    1 
ATOM   889   C  CD    . GLU A 1  117  ? 67.312  -4.976  61.908  1.00 152.21 ? 117  GLU A CD    1 
ATOM   890   O  OE1   . GLU A 1  117  ? 68.160  -5.817  61.545  1.00 152.25 ? 117  GLU A OE1   1 
ATOM   891   O  OE2   . GLU A 1  117  ? 67.307  -3.795  61.503  1.00 151.92 ? 117  GLU A OE2   1 
ATOM   892   N  N     . HIS A 1  118  ? 67.974  -2.997  66.658  1.00 154.34 ? 118  HIS A N     1 
ATOM   893   C  CA    . HIS A 1  118  ? 68.659  -2.792  67.936  1.00 154.99 ? 118  HIS A CA    1 
ATOM   894   C  C     . HIS A 1  118  ? 67.636  -2.604  69.055  1.00 155.30 ? 118  HIS A C     1 
ATOM   895   O  O     . HIS A 1  118  ? 67.751  -3.214  70.124  1.00 155.34 ? 118  HIS A O     1 
ATOM   896   C  CB    . HIS A 1  118  ? 69.590  -1.572  67.878  1.00 155.07 ? 118  HIS A CB    1 
ATOM   897   C  CG    . HIS A 1  118  ? 70.747  -1.720  66.935  1.00 155.40 ? 118  HIS A CG    1 
ATOM   898   N  ND1   . HIS A 1  118  ? 71.398  -2.918  66.728  1.00 155.56 ? 118  HIS A ND1   1 
ATOM   899   C  CD2   . HIS A 1  118  ? 71.390  -0.806  66.168  1.00 155.74 ? 118  HIS A CD2   1 
ATOM   900   C  CE1   . HIS A 1  118  ? 72.379  -2.740  65.860  1.00 155.73 ? 118  HIS A CE1   1 
ATOM   901   N  NE2   . HIS A 1  118  ? 72.397  -1.467  65.507  1.00 155.92 ? 118  HIS A NE2   1 
ATOM   902   N  N     . ASN A 1  119  ? 66.641  -1.754  68.790  1.00 155.64 ? 119  ASN A N     1 
ATOM   903   C  CA    . ASN A 1  119  ? 65.536  -1.506  69.714  1.00 155.95 ? 119  ASN A CA    1 
ATOM   904   C  C     . ASN A 1  119  ? 64.667  -2.754  69.880  1.00 156.12 ? 119  ASN A C     1 
ATOM   905   O  O     . ASN A 1  119  ? 64.427  -3.473  68.913  1.00 156.09 ? 119  ASN A O     1 
ATOM   906   C  CB    . ASN A 1  119  ? 64.696  -0.321  69.224  1.00 155.94 ? 119  ASN A CB    1 
ATOM   907   C  CG    . ASN A 1  119  ? 63.822  0.272   70.318  1.00 156.00 ? 119  ASN A CG    1 
ATOM   908   O  OD1   . ASN A 1  119  ? 62.804  -0.307  70.704  1.00 155.86 ? 119  ASN A OD1   1 
ATOM   909   N  ND2   . ASN A 1  119  ? 64.213  1.440   70.814  1.00 156.12 ? 119  ASN A ND2   1 
ATOM   910   N  N     . GLU A 1  120  ? 64.201  -2.997  71.104  1.00 156.37 ? 120  GLU A N     1 
ATOM   911   C  CA    . GLU A 1  120  ? 63.481  -4.230  71.442  1.00 156.62 ? 120  GLU A CA    1 
ATOM   912   C  C     . GLU A 1  120  ? 61.976  -4.214  71.154  1.00 156.79 ? 120  GLU A C     1 
ATOM   913   O  O     . GLU A 1  120  ? 61.351  -5.276  71.087  1.00 156.86 ? 120  GLU A O     1 
ATOM   914   C  CB    . GLU A 1  120  ? 63.729  -4.616  72.902  1.00 156.61 ? 120  GLU A CB    1 
ATOM   915   C  CG    . GLU A 1  120  ? 65.100  -5.217  73.163  1.00 156.64 ? 120  GLU A CG    1 
ATOM   916   C  CD    . GLU A 1  120  ? 65.290  -5.637  74.611  1.00 156.66 ? 120  GLU A CD    1 
ATOM   917   O  OE1   . GLU A 1  120  ? 64.888  -4.878  75.518  1.00 156.58 ? 120  GLU A OE1   1 
ATOM   918   O  OE2   . GLU A 1  120  ? 65.850  -6.727  74.844  1.00 156.69 ? 120  GLU A OE2   1 
ATOM   919   N  N     . LEU A 1  121  ? 61.395  -3.026  71.000  1.00 156.92 ? 121  LEU A N     1 
ATOM   920   C  CA    . LEU A 1  121  ? 59.980  -2.903  70.639  1.00 157.02 ? 121  LEU A CA    1 
ATOM   921   C  C     . LEU A 1  121  ? 59.813  -2.757  69.129  1.00 157.13 ? 121  LEU A C     1 
ATOM   922   O  O     . LEU A 1  121  ? 58.765  -3.084  68.573  1.00 157.09 ? 121  LEU A O     1 
ATOM   923   C  CB    . LEU A 1  121  ? 59.329  -1.739  71.385  1.00 156.98 ? 121  LEU A CB    1 
ATOM   924   C  CG    . LEU A 1  121  ? 59.129  -1.974  72.887  1.00 157.00 ? 121  LEU A CG    1 
ATOM   925   C  CD1   . LEU A 1  121  ? 59.373  -0.695  73.672  1.00 157.15 ? 121  LEU A CD1   1 
ATOM   926   C  CD2   . LEU A 1  121  ? 57.755  -2.570  73.205  1.00 156.57 ? 121  LEU A CD2   1 
ATOM   927   N  N     . MET A 1  122  ? 60.867  -2.270  68.479  1.00 157.36 ? 122  MET A N     1 
ATOM   928   C  CA    . MET A 1  122  ? 60.951  -2.213  67.027  1.00 157.59 ? 122  MET A CA    1 
ATOM   929   C  C     . MET A 1  122  ? 61.201  -3.612  66.468  1.00 157.71 ? 122  MET A C     1 
ATOM   930   O  O     . MET A 1  122  ? 61.012  -3.862  65.279  1.00 157.69 ? 122  MET A O     1 
ATOM   931   C  CB    . MET A 1  122  ? 62.072  -1.260  66.615  1.00 157.65 ? 122  MET A CB    1 
ATOM   932   C  CG    . MET A 1  122  ? 62.095  -0.894  65.141  1.00 157.98 ? 122  MET A CG    1 
ATOM   933   S  SD    . MET A 1  122  ? 60.518  -0.335  64.471  1.00 158.35 ? 122  MET A SD    1 
ATOM   934   C  CE    . MET A 1  122  ? 60.239  1.177   65.395  1.00 158.41 ? 122  MET A CE    1 
ATOM   935   N  N     . ARG A 1  123  ? 61.635  -4.512  67.347  1.00 158.00 ? 123  ARG A N     1 
ATOM   936   C  CA    . ARG A 1  123  ? 61.748  -5.939  67.044  1.00 158.22 ? 123  ARG A CA    1 
ATOM   937   C  C     . ARG A 1  123  ? 60.373  -6.615  67.097  1.00 158.32 ? 123  ARG A C     1 
ATOM   938   O  O     . ARG A 1  123  ? 60.189  -7.704  66.549  1.00 158.34 ? 123  ARG A O     1 
ATOM   939   C  CB    . ARG A 1  123  ? 62.704  -6.630  68.027  1.00 158.31 ? 123  ARG A CB    1 
ATOM   940   C  CG    . ARG A 1  123  ? 64.173  -6.229  67.901  1.00 158.26 ? 123  ARG A CG    1 
ATOM   941   C  CD    . ARG A 1  123  ? 64.984  -6.648  69.128  1.00 158.06 ? 123  ARG A CD    1 
ATOM   942   N  NE    . ARG A 1  123  ? 65.456  -8.025  69.026  1.00 157.72 ? 123  ARG A NE    1 
ATOM   943   C  CZ    . ARG A 1  123  ? 64.805  -9.087  69.492  1.00 157.62 ? 123  ARG A CZ    1 
ATOM   944   N  NH1   . ARG A 1  123  ? 63.638  -8.949  70.113  1.00 157.41 ? 123  ARG A NH1   1 
ATOM   945   N  NH2   . ARG A 1  123  ? 65.325  -10.296 69.339  1.00 157.66 ? 123  ARG A NH2   1 
ATOM   946   N  N     . GLN A 1  124  ? 59.420  -5.969  67.771  1.00 158.40 ? 124  GLN A N     1 
ATOM   947   C  CA    . GLN A 1  124  ? 58.031  -6.427  67.802  1.00 158.50 ? 124  GLN A CA    1 
ATOM   948   C  C     . GLN A 1  124  ? 57.186  -5.706  66.753  1.00 158.57 ? 124  GLN A C     1 
ATOM   949   O  O     . GLN A 1  124  ? 55.962  -5.628  66.872  1.00 158.60 ? 124  GLN A O     1 
ATOM   950   C  CB    . GLN A 1  124  ? 57.424  -6.220  69.188  1.00 158.45 ? 124  GLN A CB    1 
ATOM   951   C  CG    . GLN A 1  124  ? 57.762  -7.304  70.192  1.00 158.52 ? 124  GLN A CG    1 
ATOM   952   C  CD    . GLN A 1  124  ? 57.275  -6.976  71.595  1.00 158.60 ? 124  GLN A CD    1 
ATOM   953   O  OE1   . GLN A 1  124  ? 56.564  -5.991  71.809  1.00 158.86 ? 124  GLN A OE1   1 
ATOM   954   N  NE2   . GLN A 1  124  ? 57.661  -7.804  72.561  1.00 158.48 ? 124  GLN A NE2   1 
ATOM   955   N  N     . ALA A 1  125  ? 57.846  -5.175  65.728  1.00 158.65 ? 125  ALA A N     1 
ATOM   956   C  CA    . ALA A 1  125  ? 57.161  -4.496  64.640  1.00 158.70 ? 125  ALA A CA    1 
ATOM   957   C  C     . ALA A 1  125  ? 57.751  -4.879  63.290  1.00 158.82 ? 125  ALA A C     1 
ATOM   958   O  O     . ALA A 1  125  ? 57.009  -5.183  62.359  1.00 158.84 ? 125  ALA A O     1 
ATOM   959   C  CB    . ALA A 1  125  ? 57.204  -2.993  64.840  1.00 158.67 ? 125  ALA A CB    1 
ATOM   960   N  N     . LEU A 1  126  ? 59.080  -4.881  63.195  1.00 159.04 ? 126  LEU A N     1 
ATOM   961   C  CA    . LEU A 1  126  ? 59.783  -5.156  61.936  1.00 159.31 ? 126  LEU A CA    1 
ATOM   962   C  C     . LEU A 1  126  ? 59.526  -6.551  61.363  1.00 159.55 ? 126  LEU A C     1 
ATOM   963   O  O     . LEU A 1  126  ? 59.674  -6.766  60.157  1.00 159.56 ? 126  LEU A O     1 
ATOM   964   C  CB    . LEU A 1  126  ? 61.291  -4.930  62.096  1.00 159.29 ? 126  LEU A CB    1 
ATOM   965   C  CG    . LEU A 1  126  ? 61.839  -3.503  61.985  1.00 159.17 ? 126  LEU A CG    1 
ATOM   966   C  CD1   . LEU A 1  126  ? 63.159  -3.398  62.719  1.00 159.24 ? 126  LEU A CD1   1 
ATOM   967   C  CD2   . LEU A 1  126  ? 62.002  -3.075  60.533  1.00 158.95 ? 126  LEU A CD2   1 
ATOM   968   N  N     . ALA A 1  127  ? 59.134  -7.485  62.228  1.00 159.87 ? 127  ALA A N     1 
ATOM   969   C  CA    . ALA A 1  127  ? 58.917  -8.879  61.833  1.00 160.22 ? 127  ALA A CA    1 
ATOM   970   C  C     . ALA A 1  127  ? 57.541  -9.138  61.217  1.00 160.45 ? 127  ALA A C     1 
ATOM   971   O  O     . ALA A 1  127  ? 57.441  -9.763  60.156  1.00 160.50 ? 127  ALA A O     1 
ATOM   972   C  CB    . ALA A 1  127  ? 59.152  -9.815  63.023  1.00 160.17 ? 127  ALA A CB    1 
ATOM   973   N  N     . ILE A 1  128  ? 56.497  -8.637  61.882  1.00 160.74 ? 128  ILE A N     1 
ATOM   974   C  CA    . ILE A 1  128  ? 55.089  -8.989  61.605  1.00 160.95 ? 128  ILE A CA    1 
ATOM   975   C  C     . ILE A 1  128  ? 54.687  -9.071  60.116  1.00 161.12 ? 128  ILE A C     1 
ATOM   976   O  O     . ILE A 1  128  ? 55.089  -8.237  59.298  1.00 161.11 ? 128  ILE A O     1 
ATOM   977   C  CB    . ILE A 1  128  ? 54.092  -8.095  62.440  1.00 160.96 ? 128  ILE A CB    1 
ATOM   978   C  CG1   . ILE A 1  128  ? 52.706  -8.751  62.552  1.00 160.84 ? 128  ILE A CG1   1 
ATOM   979   C  CG2   . ILE A 1  128  ? 54.014  -6.668  61.888  1.00 160.97 ? 128  ILE A CG2   1 
ATOM   980   C  CD1   . ILE A 1  128  ? 51.878  -8.272  63.740  1.00 160.79 ? 128  ILE A CD1   1 
ATOM   981   N  N     . LYS A 1  129  ? 53.915  -10.107 59.788  1.00 161.27 ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A 1  129  ? 53.331  -10.276 58.462  1.00 161.49 ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A 1  129  ? 52.125  -9.357  58.303  1.00 161.61 ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A 1  129  ? 51.335  -9.206  59.241  1.00 161.62 ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A 1  129  ? 52.897  -11.729 58.251  1.00 161.48 ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A 1  129  ? 53.943  -12.634 57.613  1.00 161.62 ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A 1  129  ? 53.376  -14.036 57.376  1.00 161.61 ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A 1  129  ? 54.169  -14.811 56.324  1.00 161.71 ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A 1  129  ? 53.892  -14.350 54.929  1.00 161.44 ? 129  LYS A NZ    1 
ATOM   990   N  N     . ASP A 1  130  ? 52.001  -8.762  57.110  1.00 161.74 ? 130  ASP A N     1 
ATOM   991   C  CA    . ASP A 1  130  ? 50.937  -7.802  56.722  1.00 161.84 ? 130  ASP A CA    1 
ATOM   992   C  C     . ASP A 1  130  ? 51.490  -6.394  56.476  1.00 161.81 ? 130  ASP A C     1 
ATOM   993   O  O     . ASP A 1  130  ? 51.654  -5.615  57.420  1.00 161.90 ? 130  ASP A O     1 
ATOM   994   C  CB    . ASP A 1  130  ? 49.772  -7.738  57.734  1.00 161.87 ? 130  ASP A CB    1 
ATOM   995   C  CG    . ASP A 1  130  ? 48.671  -8.757  57.447  1.00 162.07 ? 130  ASP A CG    1 
ATOM   996   O  OD1   . ASP A 1  130  ? 48.167  -8.806  56.302  1.00 162.32 ? 130  ASP A OD1   1 
ATOM   997   O  OD2   . ASP A 1  130  ? 48.288  -9.497  58.382  1.00 162.11 ? 130  ASP A OD2   1 
ATOM   998   N  N     . SER A 1  131  ? 51.761  -6.070  55.210  1.00 161.70 ? 131  SER A N     1 
ATOM   999   C  CA    . SER A 1  131  ? 52.205  -4.728  54.816  1.00 161.61 ? 131  SER A CA    1 
ATOM   1000  C  C     . SER A 1  131  ? 51.362  -3.627  55.462  1.00 161.64 ? 131  SER A C     1 
ATOM   1001  O  O     . SER A 1  131  ? 51.786  -2.473  55.540  1.00 161.63 ? 131  SER A O     1 
ATOM   1002  C  CB    . SER A 1  131  ? 52.167  -4.576  53.293  1.00 161.56 ? 131  SER A CB    1 
ATOM   1003  O  OG    . SER A 1  131  ? 53.406  -4.929  52.705  1.00 161.46 ? 131  SER A OG    1 
ATOM   1004  N  N     . LYS A 1  132  ? 50.181  -4.011  55.942  1.00 161.67 ? 132  LYS A N     1 
ATOM   1005  C  CA    . LYS A 1  132  ? 49.171  -3.084  56.443  1.00 161.72 ? 132  LYS A CA    1 
ATOM   1006  C  C     . LYS A 1  132  ? 49.317  -2.743  57.929  1.00 161.60 ? 132  LYS A C     1 
ATOM   1007  O  O     . LYS A 1  132  ? 49.294  -1.568  58.291  1.00 161.66 ? 132  LYS A O     1 
ATOM   1008  C  CB    . LYS A 1  132  ? 47.775  -3.647  56.171  1.00 161.82 ? 132  LYS A CB    1 
ATOM   1009  C  CG    . LYS A 1  132  ? 46.698  -2.603  55.947  1.00 162.09 ? 132  LYS A CG    1 
ATOM   1010  C  CD    . LYS A 1  132  ? 45.340  -3.272  55.888  1.00 162.81 ? 132  LYS A CD    1 
ATOM   1011  C  CE    . LYS A 1  132  ? 44.386  -2.525  54.978  1.00 163.33 ? 132  LYS A CE    1 
ATOM   1012  N  NZ    . LYS A 1  132  ? 43.136  -3.307  54.735  1.00 163.73 ? 132  LYS A NZ    1 
ATOM   1013  N  N     . LYS A 1  133  ? 49.442  -3.757  58.785  1.00 161.43 ? 133  LYS A N     1 
ATOM   1014  C  CA    . LYS A 1  133  ? 49.588  -3.524  60.229  1.00 161.27 ? 133  LYS A CA    1 
ATOM   1015  C  C     . LYS A 1  133  ? 51.036  -3.285  60.667  1.00 161.18 ? 133  LYS A C     1 
ATOM   1016  O  O     . LYS A 1  133  ? 51.274  -2.728  61.740  1.00 161.14 ? 133  LYS A O     1 
ATOM   1017  C  CB    . LYS A 1  133  ? 48.965  -4.656  61.054  1.00 161.28 ? 133  LYS A CB    1 
ATOM   1018  C  CG    . LYS A 1  133  ? 47.555  -4.380  61.572  1.00 161.06 ? 133  LYS A CG    1 
ATOM   1019  C  CD    . LYS A 1  133  ? 46.490  -5.059  60.718  1.00 160.94 ? 133  LYS A CD    1 
ATOM   1020  C  CE    . LYS A 1  133  ? 45.213  -5.300  61.517  1.00 160.64 ? 133  LYS A CE    1 
ATOM   1021  N  NZ    . LYS A 1  133  ? 44.147  -5.946  60.705  1.00 160.38 ? 133  LYS A NZ    1 
ATOM   1022  N  N     . ARG A 1  134  ? 51.991  -3.710  59.841  1.00 161.12 ? 134  ARG A N     1 
ATOM   1023  C  CA    . ARG A 1  134  ? 53.410  -3.440  60.079  1.00 161.02 ? 134  ARG A CA    1 
ATOM   1024  C  C     . ARG A 1  134  ? 53.612  -1.932  60.191  1.00 161.17 ? 134  ARG A C     1 
ATOM   1025  O  O     . ARG A 1  134  ? 54.162  -1.440  61.175  1.00 161.13 ? 134  ARG A O     1 
ATOM   1026  C  CB    . ARG A 1  134  ? 54.261  -4.012  58.942  1.00 160.98 ? 134  ARG A CB    1 
ATOM   1027  C  CG    . ARG A 1  134  ? 55.666  -4.426  59.346  1.00 160.71 ? 134  ARG A CG    1 
ATOM   1028  C  CD    . ARG A 1  134  ? 56.430  -5.049  58.182  1.00 160.68 ? 134  ARG A CD    1 
ATOM   1029  N  NE    . ARG A 1  134  ? 55.785  -6.255  57.670  1.00 160.12 ? 134  ARG A NE    1 
ATOM   1030  C  CZ    . ARG A 1  134  ? 56.115  -6.867  56.536  1.00 160.05 ? 134  ARG A CZ    1 
ATOM   1031  N  NH1   . ARG A 1  134  ? 57.091  -6.393  55.771  1.00 159.85 ? 134  ARG A NH1   1 
ATOM   1032  N  NH2   . ARG A 1  134  ? 55.458  -7.958  56.163  1.00 159.96 ? 134  ARG A NH2   1 
ATOM   1033  N  N     . PHE A 1  135  ? 53.126  -1.217  59.178  1.00 161.37 ? 135  PHE A N     1 
ATOM   1034  C  CA    . PHE A 1  135  ? 53.103  0.245   59.134  1.00 161.56 ? 135  PHE A CA    1 
ATOM   1035  C  C     . PHE A 1  135  ? 52.313  0.838   60.311  1.00 161.78 ? 135  PHE A C     1 
ATOM   1036  O  O     . PHE A 1  135  ? 52.659  1.900   60.827  1.00 161.79 ? 135  PHE A O     1 
ATOM   1037  C  CB    . PHE A 1  135  ? 52.491  0.685   57.797  1.00 161.44 ? 135  PHE A CB    1 
ATOM   1038  C  CG    . PHE A 1  135  ? 52.739  2.127   57.436  1.00 161.24 ? 135  PHE A CG    1 
ATOM   1039  C  CD1   . PHE A 1  135  ? 53.782  2.469   56.586  1.00 160.94 ? 135  PHE A CD1   1 
ATOM   1040  C  CD2   . PHE A 1  135  ? 51.901  3.137   57.907  1.00 161.24 ? 135  PHE A CD2   1 
ATOM   1041  C  CE1   . PHE A 1  135  ? 54.007  3.796   56.229  1.00 161.00 ? 135  PHE A CE1   1 
ATOM   1042  C  CE2   . PHE A 1  135  ? 52.119  4.468   57.558  1.00 161.08 ? 135  PHE A CE2   1 
ATOM   1043  C  CZ    . PHE A 1  135  ? 53.175  4.797   56.717  1.00 161.07 ? 135  PHE A CZ    1 
ATOM   1044  N  N     . ALA A 1  136  ? 51.258  0.144   60.731  1.00 162.13 ? 136  ALA A N     1 
ATOM   1045  C  CA    . ALA A 1  136  ? 50.405  0.611   61.823  1.00 162.51 ? 136  ALA A CA    1 
ATOM   1046  C  C     . ALA A 1  136  ? 51.113  0.547   63.170  1.00 162.80 ? 136  ALA A C     1 
ATOM   1047  O  O     . ALA A 1  136  ? 50.822  1.341   64.065  1.00 162.85 ? 136  ALA A O     1 
ATOM   1048  C  CB    . ALA A 1  136  ? 49.103  -0.183  61.868  1.00 162.53 ? 136  ALA A CB    1 
ATOM   1049  N  N     . ALA A 1  137  ? 52.038  -0.400  63.310  1.00 163.16 ? 137  ALA A N     1 
ATOM   1050  C  CA    . ALA A 1  137  ? 52.787  -0.566  64.552  1.00 163.55 ? 137  ALA A CA    1 
ATOM   1051  C  C     . ALA A 1  137  ? 53.984  0.373   64.616  1.00 163.82 ? 137  ALA A C     1 
ATOM   1052  O  O     . ALA A 1  137  ? 54.343  0.850   65.692  1.00 163.91 ? 137  ALA A O     1 
ATOM   1053  C  CB    . ALA A 1  137  ? 53.232  -2.012  64.723  1.00 163.55 ? 137  ALA A CB    1 
ATOM   1054  N  N     . ILE A 1  138  ? 54.587  0.634   63.458  1.00 164.13 ? 138  ILE A N     1 
ATOM   1055  C  CA    . ILE A 1  138  ? 55.778  1.476   63.350  1.00 164.44 ? 138  ILE A CA    1 
ATOM   1056  C  C     . ILE A 1  138  ? 55.476  2.943   63.676  1.00 164.86 ? 138  ILE A C     1 
ATOM   1057  O  O     . ILE A 1  138  ? 56.159  3.559   64.498  1.00 164.87 ? 138  ILE A O     1 
ATOM   1058  C  CB    . ILE A 1  138  ? 56.418  1.346   61.942  1.00 164.27 ? 138  ILE A CB    1 
ATOM   1059  C  CG1   . ILE A 1  138  ? 57.012  -0.053  61.757  1.00 163.92 ? 138  ILE A CG1   1 
ATOM   1060  C  CG2   . ILE A 1  138  ? 57.496  2.400   61.728  1.00 164.38 ? 138  ILE A CG2   1 
ATOM   1061  C  CD1   . ILE A 1  138  ? 57.278  -0.430  60.316  1.00 163.40 ? 138  ILE A CD1   1 
ATOM   1062  N  N     . TRP A 1  139  ? 54.440  3.479   63.037  1.00 165.44 ? 139  TRP A N     1 
ATOM   1063  C  CA    . TRP A 1  139  ? 54.070  4.888   63.153  1.00 166.12 ? 139  TRP A CA    1 
ATOM   1064  C  C     . TRP A 1  139  ? 53.753  5.322   64.590  1.00 166.73 ? 139  TRP A C     1 
ATOM   1065  O  O     . TRP A 1  139  ? 54.027  6.462   64.973  1.00 166.84 ? 139  TRP A O     1 
ATOM   1066  C  CB    . TRP A 1  139  ? 52.892  5.187   62.220  1.00 166.01 ? 139  TRP A CB    1 
ATOM   1067  C  CG    . TRP A 1  139  ? 52.485  6.633   62.150  1.00 165.89 ? 139  TRP A CG    1 
ATOM   1068  C  CD1   . TRP A 1  139  ? 53.035  7.604   61.365  1.00 165.73 ? 139  TRP A CD1   1 
ATOM   1069  C  CD2   . TRP A 1  139  ? 51.424  7.262   62.881  1.00 165.78 ? 139  TRP A CD2   1 
ATOM   1070  N  NE1   . TRP A 1  139  ? 52.392  8.801   61.568  1.00 165.60 ? 139  TRP A NE1   1 
ATOM   1071  C  CE2   . TRP A 1  139  ? 51.398  8.620   62.493  1.00 165.66 ? 139  TRP A CE2   1 
ATOM   1072  C  CE3   . TRP A 1  139  ? 50.496  6.811   63.832  1.00 165.88 ? 139  TRP A CE3   1 
ATOM   1073  C  CZ2   . TRP A 1  139  ? 50.478  9.533   63.020  1.00 165.84 ? 139  TRP A CZ2   1 
ATOM   1074  C  CZ3   . TRP A 1  139  ? 49.580  7.718   64.355  1.00 165.82 ? 139  TRP A CZ3   1 
ATOM   1075  C  CH2   . TRP A 1  139  ? 49.580  9.065   63.948  1.00 165.91 ? 139  TRP A CH2   1 
ATOM   1076  N  N     . THR A 1  140  ? 53.191  4.410   65.382  1.00 167.50 ? 140  THR A N     1 
ATOM   1077  C  CA    . THR A 1  140  ? 52.887  4.684   66.788  1.00 168.30 ? 140  THR A CA    1 
ATOM   1078  C  C     . THR A 1  140  ? 54.166  4.917   67.603  1.00 168.93 ? 140  THR A C     1 
ATOM   1079  O  O     . THR A 1  140  ? 54.120  5.475   68.703  1.00 169.04 ? 140  THR A O     1 
ATOM   1080  C  CB    . THR A 1  140  ? 52.076  3.530   67.430  1.00 168.24 ? 140  THR A CB    1 
ATOM   1081  O  OG1   . THR A 1  140  ? 51.149  3.001   66.476  1.00 168.34 ? 140  THR A OG1   1 
ATOM   1082  C  CG2   . THR A 1  140  ? 51.306  4.014   68.652  1.00 168.18 ? 140  THR A CG2   1 
ATOM   1083  N  N     . LEU A 1  141  ? 55.304  4.505   67.045  1.00 169.65 ? 141  LEU A N     1 
ATOM   1084  C  CA    . LEU A 1  141  ? 56.573  4.512   67.769  1.00 170.32 ? 141  LEU A CA    1 
ATOM   1085  C  C     . LEU A 1  141  ? 57.623  5.435   67.148  1.00 170.78 ? 141  LEU A C     1 
ATOM   1086  O  O     . LEU A 1  141  ? 58.774  5.453   67.589  1.00 170.92 ? 141  LEU A O     1 
ATOM   1087  C  CB    . LEU A 1  141  ? 57.127  3.082   67.878  1.00 170.33 ? 141  LEU A CB    1 
ATOM   1088  C  CG    . LEU A 1  141  ? 56.187  1.924   68.249  1.00 170.46 ? 141  LEU A CG    1 
ATOM   1089  C  CD1   . LEU A 1  141  ? 56.884  0.581   68.044  1.00 170.50 ? 141  LEU A CD1   1 
ATOM   1090  C  CD2   . LEU A 1  141  ? 55.633  2.039   69.673  1.00 170.51 ? 141  LEU A CD2   1 
ATOM   1091  N  N     . CYS A 1  142  ? 57.229  6.203   66.136  1.00 171.34 ? 142  CYS A N     1 
ATOM   1092  C  CA    . CYS A 1  142  ? 58.162  7.103   65.461  1.00 171.91 ? 142  CYS A CA    1 
ATOM   1093  C  C     . CYS A 1  142  ? 57.742  8.565   65.527  1.00 172.60 ? 142  CYS A C     1 
ATOM   1094  O  O     . CYS A 1  142  ? 58.485  9.448   65.101  1.00 172.65 ? 142  CYS A O     1 
ATOM   1095  C  CB    . CYS A 1  142  ? 58.372  6.668   64.015  1.00 171.77 ? 142  CYS A CB    1 
ATOM   1096  S  SG    . CYS A 1  142  ? 59.127  5.051   63.879  1.00 170.97 ? 142  CYS A SG    1 
ATOM   1097  N  N     . LYS A 1  143  ? 56.555  8.816   66.065  1.00 173.51 ? 143  LYS A N     1 
ATOM   1098  C  CA    . LYS A 1  143  ? 56.087  10.184  66.259  1.00 174.48 ? 143  LYS A CA    1 
ATOM   1099  C  C     . LYS A 1  143  ? 56.683  10.854  67.509  1.00 175.42 ? 143  LYS A C     1 
ATOM   1100  O  O     . LYS A 1  143  ? 56.813  12.080  67.553  1.00 175.49 ? 143  LYS A O     1 
ATOM   1101  C  CB    . LYS A 1  143  ? 54.552  10.261  66.261  1.00 174.44 ? 143  LYS A CB    1 
ATOM   1102  C  CG    . LYS A 1  143  ? 53.824  9.179   67.053  1.00 174.23 ? 143  LYS A CG    1 
ATOM   1103  C  CD    . LYS A 1  143  ? 52.349  9.532   67.212  1.00 174.02 ? 143  LYS A CD    1 
ATOM   1104  C  CE    . LYS A 1  143  ? 51.468  8.295   67.262  1.00 173.35 ? 143  LYS A CE    1 
ATOM   1105  N  NZ    . LYS A 1  143  ? 51.691  7.467   68.472  1.00 173.21 ? 143  LYS A NZ    1 
ATOM   1106  N  N     . THR A 1  144  ? 57.051  10.051  68.509  1.00 176.53 ? 144  THR A N     1 
ATOM   1107  C  CA    . THR A 1  144  ? 57.629  10.574  69.755  1.00 177.60 ? 144  THR A CA    1 
ATOM   1108  C  C     . THR A 1  144  ? 59.152  10.758  69.658  1.00 178.41 ? 144  THR A C     1 
ATOM   1109  O  O     . THR A 1  144  ? 59.759  11.384  70.533  1.00 178.57 ? 144  THR A O     1 
ATOM   1110  C  CB    . THR A 1  144  ? 57.275  9.689   70.986  1.00 177.54 ? 144  THR A CB    1 
ATOM   1111  O  OG1   . THR A 1  144  ? 55.982  9.097   70.808  1.00 177.52 ? 144  THR A OG1   1 
ATOM   1112  C  CG2   . THR A 1  144  ? 57.280  10.514  72.278  1.00 177.48 ? 144  THR A CG2   1 
ATOM   1113  N  N     . LYS A 1  145  ? 59.759  10.218  68.599  1.00 179.38 ? 145  LYS A N     1 
ATOM   1114  C  CA    . LYS A 1  145  ? 61.196  10.394  68.346  1.00 180.31 ? 145  LYS A CA    1 
ATOM   1115  C  C     . LYS A 1  145  ? 61.457  11.720  67.628  1.00 181.14 ? 145  LYS A C     1 
ATOM   1116  O  O     . LYS A 1  145  ? 61.379  11.801  66.399  1.00 181.14 ? 145  LYS A O     1 
ATOM   1117  C  CB    . LYS A 1  145  ? 61.778  9.218   67.545  1.00 180.13 ? 145  LYS A CB    1 
ATOM   1118  C  CG    . LYS A 1  145  ? 61.646  7.847   68.207  1.00 179.85 ? 145  LYS A CG    1 
ATOM   1119  C  CD    . LYS A 1  145  ? 62.605  7.658   69.372  1.00 179.14 ? 145  LYS A CD    1 
ATOM   1120  C  CE    . LYS A 1  145  ? 62.345  6.334   70.068  1.00 178.75 ? 145  LYS A CE    1 
ATOM   1121  N  NZ    . LYS A 1  145  ? 63.075  6.238   71.355  1.00 178.55 ? 145  LYS A NZ    1 
ATOM   1122  N  N     . MET A 1  146  ? 61.764  12.751  68.413  1.00 182.26 ? 146  MET A N     1 
ATOM   1123  C  CA    . MET A 1  146  ? 61.964  14.114  67.911  1.00 183.35 ? 146  MET A CA    1 
ATOM   1124  C  C     . MET A 1  146  ? 63.335  14.311  67.259  1.00 184.17 ? 146  MET A C     1 
ATOM   1125  O  O     . MET A 1  146  ? 63.448  15.007  66.250  1.00 184.34 ? 146  MET A O     1 
ATOM   1126  C  CB    . MET A 1  146  ? 61.790  15.136  69.040  1.00 183.26 ? 146  MET A CB    1 
ATOM   1127  C  CG    . MET A 1  146  ? 60.488  15.019  69.820  1.00 183.31 ? 146  MET A CG    1 
ATOM   1128  S  SD    . MET A 1  146  ? 60.545  15.904  71.394  1.00 183.38 ? 146  MET A SD    1 
ATOM   1129  C  CE    . MET A 1  146  ? 61.675  14.886  72.346  1.00 183.21 ? 146  MET A CE    1 
ATOM   1130  N  N     . VAL A 1  147  ? 64.371  13.712  67.849  1.00 185.14 ? 147  VAL A N     1 
ATOM   1131  C  CA    . VAL A 1  147  ? 65.749  13.824  67.344  1.00 186.01 ? 147  VAL A CA    1 
ATOM   1132  C  C     . VAL A 1  147  ? 66.139  12.650  66.441  1.00 186.53 ? 147  VAL A C     1 
ATOM   1133  O  O     . VAL A 1  147  ? 65.500  11.595  66.468  1.00 186.57 ? 147  VAL A O     1 
ATOM   1134  C  CB    . VAL A 1  147  ? 66.802  13.955  68.500  1.00 186.03 ? 147  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A 1  147  ? 66.895  15.390  69.006  1.00 186.14 ? 147  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A 1  147  ? 66.511  12.978  69.649  1.00 186.12 ? 147  VAL A CG2   1 
ATOM   1137  N  N     . CYS A 1  148  ? 67.186  12.845  65.640  1.00 187.30 ? 148  CYS A N     1 
ATOM   1138  C  CA    . CYS A 1  148  ? 67.781  11.756  64.861  1.00 187.95 ? 148  CYS A CA    1 
ATOM   1139  C  C     . CYS A 1  148  ? 68.868  11.028  65.674  1.00 188.55 ? 148  CYS A C     1 
ATOM   1140  O  O     . CYS A 1  148  ? 69.337  9.957   65.274  1.00 188.63 ? 148  CYS A O     1 
ATOM   1141  C  CB    . CYS A 1  148  ? 68.330  12.276  63.526  1.00 187.89 ? 148  CYS A CB    1 
ATOM   1142  S  SG    . CYS A 1  148  ? 68.690  10.997  62.291  1.00 187.45 ? 148  CYS A SG    1 
ATOM   1143  N  N     . GLU A 1  149  ? 69.251  11.627  66.811  1.00 189.23 ? 149  GLU A N     1 
ATOM   1144  C  CA    . GLU A 1  149  ? 70.148  11.033  67.835  1.00 189.84 ? 149  GLU A CA    1 
ATOM   1145  C  C     . GLU A 1  149  ? 71.647  11.013  67.477  1.00 190.17 ? 149  GLU A C     1 
ATOM   1146  O  O     . GLU A 1  149  ? 72.032  11.325  66.346  1.00 190.26 ? 149  GLU A O     1 
ATOM   1147  C  CB    . GLU A 1  149  ? 69.665  9.631   68.259  1.00 189.79 ? 149  GLU A CB    1 
ATOM   1148  C  CG    . GLU A 1  149  ? 68.289  9.606   68.937  1.00 189.97 ? 149  GLU A CG    1 
ATOM   1149  C  CD    . GLU A 1  149  ? 67.556  8.273   68.778  1.00 190.04 ? 149  GLU A CD    1 
ATOM   1150  O  OE1   . GLU A 1  149  ? 68.136  7.317   68.215  1.00 190.22 ? 149  GLU A OE1   1 
ATOM   1151  O  OE2   . GLU A 1  149  ? 66.387  8.181   69.217  1.00 190.25 ? 149  GLU A OE2   1 
ATOM   1152  N  N     . THR A 1  150  ? 72.482  10.668  68.460  1.00 190.56 ? 150  THR A N     1 
ATOM   1153  C  CA    . THR A 1  150  ? 73.923  10.496  68.250  1.00 190.92 ? 150  THR A CA    1 
ATOM   1154  C  C     . THR A 1  150  ? 74.220  9.044   67.833  1.00 191.21 ? 150  THR A C     1 
ATOM   1155  O  O     . THR A 1  150  ? 74.686  8.805   66.716  1.00 191.23 ? 150  THR A O     1 
ATOM   1156  C  CB    . THR A 1  150  ? 74.750  10.912  69.503  1.00 190.87 ? 150  THR A CB    1 
ATOM   1157  O  OG1   . THR A 1  150  ? 74.251  12.149  70.027  1.00 190.82 ? 150  THR A OG1   1 
ATOM   1158  C  CG2   . THR A 1  150  ? 76.223  11.084  69.158  1.00 190.80 ? 150  THR A CG2   1 
ATOM   1159  N  N     . ASP A 1  151  ? 73.940  8.096   68.735  1.00 191.59 ? 151  ASP A N     1 
ATOM   1160  C  CA    . ASP A 1  151  ? 74.019  6.644   68.469  1.00 191.91 ? 151  ASP A CA    1 
ATOM   1161  C  C     . ASP A 1  151  ? 73.296  5.812   69.540  1.00 192.17 ? 151  ASP A C     1 
ATOM   1162  O  O     . ASP A 1  151  ? 73.435  6.068   70.738  1.00 192.22 ? 151  ASP A O     1 
ATOM   1163  C  CB    . ASP A 1  151  ? 75.471  6.172   68.313  1.00 191.85 ? 151  ASP A CB    1 
ATOM   1164  C  CG    . ASP A 1  151  ? 75.924  6.139   66.861  1.00 191.74 ? 151  ASP A CG    1 
ATOM   1165  O  OD1   . ASP A 1  151  ? 77.019  6.660   66.565  1.00 191.63 ? 151  ASP A OD1   1 
ATOM   1166  O  OD2   . ASP A 1  151  ? 75.184  5.598   66.012  1.00 191.60 ? 151  ASP A OD2   1 
ATOM   1167  N  N     . VAL A 1  152  ? 72.537  4.813   69.094  1.00 192.51 ? 152  VAL A N     1 
ATOM   1168  C  CA    . VAL A 1  152  ? 71.672  4.001   69.966  1.00 192.83 ? 152  VAL A CA    1 
ATOM   1169  C  C     . VAL A 1  152  ? 72.476  3.043   70.867  1.00 193.06 ? 152  VAL A C     1 
ATOM   1170  O  O     . VAL A 1  152  ? 73.370  2.345   70.380  1.00 193.07 ? 152  VAL A O     1 
ATOM   1171  C  CB    . VAL A 1  152  ? 70.604  3.218   69.128  1.00 192.82 ? 152  VAL A CB    1 
ATOM   1172  C  CG1   . VAL A 1  152  ? 69.785  2.263   69.993  1.00 192.83 ? 152  VAL A CG1   1 
ATOM   1173  C  CG2   . VAL A 1  152  ? 69.677  4.181   68.389  1.00 192.81 ? 152  VAL A CG2   1 
ATOM   1174  N  N     . PRO A 1  153  ? 72.171  3.028   72.187  1.00 193.28 ? 153  PRO A N     1 
ATOM   1175  C  CA    . PRO A 1  153  ? 72.777  2.105   73.165  1.00 193.44 ? 153  PRO A CA    1 
ATOM   1176  C  C     . PRO A 1  153  ? 72.504  0.613   72.904  1.00 193.56 ? 153  PRO A C     1 
ATOM   1177  O  O     . PRO A 1  153  ? 71.370  0.231   72.593  1.00 193.61 ? 153  PRO A O     1 
ATOM   1178  C  CB    . PRO A 1  153  ? 72.135  2.530   74.496  1.00 193.43 ? 153  PRO A CB    1 
ATOM   1179  C  CG    . PRO A 1  153  ? 71.655  3.920   74.270  1.00 193.32 ? 153  PRO A CG    1 
ATOM   1180  C  CD    . PRO A 1  153  ? 71.227  3.955   72.840  1.00 193.28 ? 153  PRO A CD    1 
ATOM   1181  N  N     . SER A 1  154  ? 73.545  -0.209  73.050  1.00 193.63 ? 154  SER A N     1 
ATOM   1182  C  CA    . SER A 1  154  ? 73.457  -1.663  72.869  1.00 193.65 ? 154  SER A CA    1 
ATOM   1183  C  C     . SER A 1  154  ? 72.741  -2.334  74.044  1.00 193.63 ? 154  SER A C     1 
ATOM   1184  O  O     . SER A 1  154  ? 72.372  -3.509  73.978  1.00 193.56 ? 154  SER A O     1 
ATOM   1185  C  CB    . SER A 1  154  ? 74.858  -2.263  72.686  1.00 193.66 ? 154  SER A CB    1 
ATOM   1186  O  OG    . SER A 1  154  ? 74.802  -3.662  72.454  1.00 193.65 ? 154  SER A OG    1 
ATOM   1187  N  N     . LEU A 1  161  ? 76.696  1.511   73.518  1.00 193.17 ? 161  LEU A N     1 
ATOM   1188  C  CA    . LEU A 1  161  ? 77.444  2.635   72.960  1.00 193.13 ? 161  LEU A CA    1 
ATOM   1189  C  C     . LEU A 1  161  ? 77.799  2.385   71.483  1.00 193.13 ? 161  LEU A C     1 
ATOM   1190  O  O     . LEU A 1  161  ? 78.790  2.919   70.978  1.00 193.09 ? 161  LEU A O     1 
ATOM   1191  C  CB    . LEU A 1  161  ? 78.717  2.895   73.788  1.00 193.11 ? 161  LEU A CB    1 
ATOM   1192  C  CG    . LEU A 1  161  ? 78.690  2.774   75.322  1.00 192.95 ? 161  LEU A CG    1 
ATOM   1193  C  CD1   . LEU A 1  161  ? 80.104  2.660   75.882  1.00 192.64 ? 161  LEU A CD1   1 
ATOM   1194  C  CD2   . LEU A 1  161  ? 77.943  3.927   75.981  1.00 192.81 ? 161  LEU A CD2   1 
ATOM   1195  N  N     . VAL A 1  162  ? 76.973  1.585   70.801  1.00 193.13 ? 162  VAL A N     1 
ATOM   1196  C  CA    . VAL A 1  162  ? 77.251  1.116   69.426  1.00 193.08 ? 162  VAL A CA    1 
ATOM   1197  C  C     . VAL A 1  162  ? 76.837  2.097   68.318  1.00 192.99 ? 162  VAL A C     1 
ATOM   1198  O  O     . VAL A 1  162  ? 75.886  2.867   68.479  1.00 192.93 ? 162  VAL A O     1 
ATOM   1199  C  CB    . VAL A 1  162  ? 76.643  -0.295  69.141  1.00 193.12 ? 162  VAL A CB    1 
ATOM   1200  C  CG1   . VAL A 1  162  ? 77.392  -1.379  69.914  1.00 193.13 ? 162  VAL A CG1   1 
ATOM   1201  C  CG2   . VAL A 1  162  ? 75.144  -0.332  69.447  1.00 193.08 ? 162  VAL A CG2   1 
ATOM   1202  N  N     . SER A 1  163  ? 77.549  2.030   67.190  1.00 192.89 ? 163  SER A N     1 
ATOM   1203  C  CA    . SER A 1  163  ? 77.442  3.024   66.112  1.00 192.76 ? 163  SER A CA    1 
ATOM   1204  C  C     . SER A 1  163  ? 76.832  2.510   64.799  1.00 192.60 ? 163  SER A C     1 
ATOM   1205  O  O     . SER A 1  163  ? 76.749  1.299   64.568  1.00 192.59 ? 163  SER A O     1 
ATOM   1206  C  CB    . SER A 1  163  ? 78.813  3.666   65.842  1.00 192.79 ? 163  SER A CB    1 
ATOM   1207  O  OG    . SER A 1  163  ? 79.818  2.688   65.623  1.00 192.80 ? 163  SER A OG    1 
ATOM   1208  N  N     . ARG A 1  164  ? 76.408  3.453   63.953  1.00 192.35 ? 164  ARG A N     1 
ATOM   1209  C  CA    . ARG A 1  164  ? 75.816  3.154   62.642  1.00 192.01 ? 164  ARG A CA    1 
ATOM   1210  C  C     . ARG A 1  164  ? 76.016  4.283   61.614  1.00 191.89 ? 164  ARG A C     1 
ATOM   1211  O  O     . ARG A 1  164  ? 76.021  4.024   60.407  1.00 191.93 ? 164  ARG A O     1 
ATOM   1212  C  CB    . ARG A 1  164  ? 74.326  2.795   62.775  1.00 192.00 ? 164  ARG A CB    1 
ATOM   1213  C  CG    . ARG A 1  164  ? 73.453  3.911   63.320  1.00 191.76 ? 164  ARG A CG    1 
ATOM   1214  C  CD    . ARG A 1  164  ? 72.008  3.488   63.419  1.00 191.70 ? 164  ARG A CD    1 
ATOM   1215  N  NE    . ARG A 1  164  ? 71.129  4.649   63.516  1.00 191.17 ? 164  ARG A NE    1 
ATOM   1216  C  CZ    . ARG A 1  164  ? 69.844  4.600   63.855  1.00 190.96 ? 164  ARG A CZ    1 
ATOM   1217  N  NH1   . ARG A 1  164  ? 69.266  3.441   64.145  1.00 190.80 ? 164  ARG A NH1   1 
ATOM   1218  N  NH2   . ARG A 1  164  ? 69.136  5.719   63.909  1.00 190.75 ? 164  ARG A NH2   1 
ATOM   1219  N  N     . GLY A 1  165  ? 76.165  5.520   62.097  1.00 191.61 ? 165  GLY A N     1 
ATOM   1220  C  CA    . GLY A 1  165  ? 76.443  6.688   61.243  1.00 191.18 ? 165  GLY A CA    1 
ATOM   1221  C  C     . GLY A 1  165  ? 75.254  7.582   60.908  1.00 190.83 ? 165  GLY A C     1 
ATOM   1222  O  O     . GLY A 1  165  ? 74.098  7.160   61.004  1.00 190.79 ? 165  GLY A O     1 
ATOM   1223  N  N     . GLY A 1  166  ? 75.547  8.823   60.514  1.00 190.49 ? 166  GLY A N     1 
ATOM   1224  C  CA    . GLY A 1  166  ? 74.520  9.778   60.080  1.00 190.01 ? 166  GLY A CA    1 
ATOM   1225  C  C     . GLY A 1  166  ? 74.362  10.999  60.973  1.00 189.67 ? 166  GLY A C     1 
ATOM   1226  O  O     . GLY A 1  166  ? 74.638  10.937  62.172  1.00 189.70 ? 166  GLY A O     1 
ATOM   1227  N  N     . CYS A 1  167  ? 73.911  12.107  60.383  1.00 189.27 ? 167  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1  167  ? 73.675  13.353  61.122  1.00 188.85 ? 167  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1  167  ? 72.458  13.226  62.040  1.00 188.51 ? 167  CYS A C     1 
ATOM   1230  O  O     . CYS A 1  167  ? 71.565  12.415  61.785  1.00 188.49 ? 167  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1  167  ? 73.515  14.543  60.165  1.00 188.87 ? 167  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1  167  ? 71.879  14.729  59.403  1.00 188.91 ? 167  CYS A SG    1 
ATOM   1233  N  N     . GLY A 1  168  ? 72.430  14.029  63.101  1.00 188.10 ? 168  GLY A N     1 
ATOM   1234  C  CA    . GLY A 1  168  ? 71.391  13.922  64.125  1.00 187.52 ? 168  GLY A CA    1 
ATOM   1235  C  C     . GLY A 1  168  ? 70.647  15.201  64.471  1.00 187.10 ? 168  GLY A C     1 
ATOM   1236  O  O     . GLY A 1  168  ? 70.513  15.546  65.649  1.00 187.16 ? 168  GLY A O     1 
ATOM   1237  N  N     . ASN A 1  169  ? 70.159  15.902  63.451  1.00 186.56 ? 169  ASN A N     1 
ATOM   1238  C  CA    . ASN A 1  169  ? 69.347  17.101  63.665  1.00 186.00 ? 169  ASN A CA    1 
ATOM   1239  C  C     . ASN A 1  169  ? 67.897  16.768  64.034  1.00 185.58 ? 169  ASN A C     1 
ATOM   1240  O  O     . ASN A 1  169  ? 67.445  15.636  63.850  1.00 185.46 ? 169  ASN A O     1 
ATOM   1241  C  CB    . ASN A 1  169  ? 69.428  18.063  62.464  1.00 186.05 ? 169  ASN A CB    1 
ATOM   1242  C  CG    . ASN A 1  169  ? 69.647  17.348  61.132  1.00 186.00 ? 169  ASN A CG    1 
ATOM   1243  O  OD1   . ASN A 1  169  ? 70.484  17.758  60.329  1.00 186.00 ? 169  ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A 1  169  ? 68.892  16.281  60.892  1.00 186.10 ? 169  ASN A ND2   1 
ATOM   1245  N  N     . THR A 1  170  ? 67.186  17.758  64.570  1.00 185.08 ? 170  THR A N     1 
ATOM   1246  C  CA    . THR A 1  170  ? 65.805  17.589  65.033  1.00 184.56 ? 170  THR A CA    1 
ATOM   1247  C  C     . THR A 1  170  ? 64.773  17.448  63.905  1.00 184.20 ? 170  THR A C     1 
ATOM   1248  O  O     . THR A 1  170  ? 64.866  18.110  62.867  1.00 184.17 ? 170  THR A O     1 
ATOM   1249  C  CB    . THR A 1  170  ? 65.380  18.734  65.992  1.00 184.59 ? 170  THR A CB    1 
ATOM   1250  O  OG1   . THR A 1  170  ? 66.244  19.866  65.814  1.00 184.57 ? 170  THR A OG1   1 
ATOM   1251  C  CG2   . THR A 1  170  ? 65.467  18.281  67.434  1.00 184.51 ? 170  THR A CG2   1 
ATOM   1252  N  N     . GLN A 1  171  ? 63.795  16.572  64.131  1.00 183.69 ? 171  GLN A N     1 
ATOM   1253  C  CA    . GLN A 1  171  ? 62.679  16.340  63.211  1.00 183.21 ? 171  GLN A CA    1 
ATOM   1254  C  C     . GLN A 1  171  ? 61.509  17.273  63.561  1.00 182.78 ? 171  GLN A C     1 
ATOM   1255  O  O     . GLN A 1  171  ? 61.199  17.460  64.742  1.00 182.83 ? 171  GLN A O     1 
ATOM   1256  C  CB    . GLN A 1  171  ? 62.236  14.866  63.281  1.00 183.29 ? 171  GLN A CB    1 
ATOM   1257  C  CG    . GLN A 1  171  ? 61.247  14.411  62.191  1.00 183.35 ? 171  GLN A CG    1 
ATOM   1258  C  CD    . GLN A 1  171  ? 60.609  13.047  62.470  1.00 183.20 ? 171  GLN A CD    1 
ATOM   1259  O  OE1   . GLN A 1  171  ? 60.735  12.118  61.671  1.00 183.04 ? 171  GLN A OE1   1 
ATOM   1260  N  NE2   . GLN A 1  171  ? 59.915  12.931  63.600  1.00 183.07 ? 171  GLN A NE2   1 
ATOM   1261  N  N     . PRO A 1  172  ? 60.868  17.873  62.536  1.00 182.25 ? 172  PRO A N     1 
ATOM   1262  C  CA    . PRO A 1  172  ? 59.732  18.792  62.698  1.00 181.80 ? 172  PRO A CA    1 
ATOM   1263  C  C     . PRO A 1  172  ? 58.474  18.208  63.349  1.00 181.31 ? 172  PRO A C     1 
ATOM   1264  O  O     . PRO A 1  172  ? 58.310  16.990  63.416  1.00 181.21 ? 172  PRO A O     1 
ATOM   1265  C  CB    . PRO A 1  172  ? 59.416  19.207  61.257  1.00 181.81 ? 172  PRO A CB    1 
ATOM   1266  C  CG    . PRO A 1  172  ? 60.671  18.972  60.508  1.00 182.04 ? 172  PRO A CG    1 
ATOM   1267  C  CD    . PRO A 1  172  ? 61.241  17.739  61.116  1.00 182.21 ? 172  PRO A CD    1 
ATOM   1268  N  N     . THR A 1  173  ? 57.607  19.101  63.825  1.00 180.81 ? 173  THR A N     1 
ATOM   1269  C  CA    . THR A 1  173  ? 56.280  18.748  64.325  1.00 180.33 ? 173  THR A CA    1 
ATOM   1270  C  C     . THR A 1  173  ? 55.283  18.972  63.183  1.00 180.00 ? 173  THR A C     1 
ATOM   1271  O  O     . THR A 1  173  ? 54.626  20.019  63.117  1.00 180.03 ? 173  THR A O     1 
ATOM   1272  C  CB    . THR A 1  173  ? 55.884  19.618  65.546  1.00 180.36 ? 173  THR A CB    1 
ATOM   1273  O  OG1   . THR A 1  173  ? 57.025  19.830  66.388  1.00 180.29 ? 173  THR A OG1   1 
ATOM   1274  C  CG2   . THR A 1  173  ? 54.766  18.959  66.352  1.00 180.30 ? 173  THR A CG2   1 
ATOM   1275  N  N     . ILE A 1  174  ? 55.179  17.985  62.289  1.00 179.47 ? 174  ILE A N     1 
ATOM   1276  C  CA    . ILE A 1  174  ? 54.486  18.146  60.998  1.00 178.80 ? 174  ILE A CA    1 
ATOM   1277  C  C     . ILE A 1  174  ? 52.957  18.258  61.088  1.00 178.48 ? 174  ILE A C     1 
ATOM   1278  O  O     . ILE A 1  174  ? 52.302  17.463  61.764  1.00 178.40 ? 174  ILE A O     1 
ATOM   1279  C  CB    . ILE A 1  174  ? 54.925  17.074  59.966  1.00 178.74 ? 174  ILE A CB    1 
ATOM   1280  C  CG1   . ILE A 1  174  ? 56.390  17.305  59.577  1.00 178.55 ? 174  ILE A CG1   1 
ATOM   1281  C  CG2   . ILE A 1  174  ? 54.041  17.125  58.731  1.00 178.82 ? 174  ILE A CG2   1 
ATOM   1282  C  CD1   . ILE A 1  174  ? 56.925  16.387  58.500  1.00 178.56 ? 174  ILE A CD1   1 
ATOM   1283  N  N     . ARG A 1  175  ? 52.415  19.246  60.376  1.00 178.06 ? 175  ARG A N     1 
ATOM   1284  C  CA    . ARG A 1  175  ? 51.004  19.608  60.456  1.00 177.66 ? 175  ARG A CA    1 
ATOM   1285  C  C     . ARG A 1  175  ? 50.327  19.591  59.081  1.00 177.40 ? 175  ARG A C     1 
ATOM   1286  O  O     . ARG A 1  175  ? 50.984  19.755  58.049  1.00 177.24 ? 175  ARG A O     1 
ATOM   1287  C  CB    . ARG A 1  175  ? 50.869  20.995  61.096  1.00 177.71 ? 175  ARG A CB    1 
ATOM   1288  C  CG    . ARG A 1  175  ? 49.586  21.223  61.884  1.00 177.57 ? 175  ARG A CG    1 
ATOM   1289  C  CD    . ARG A 1  175  ? 49.613  22.558  62.626  1.00 177.49 ? 175  ARG A CD    1 
ATOM   1290  N  NE    . ARG A 1  175  ? 49.148  23.683  61.810  1.00 176.97 ? 175  ARG A NE    1 
ATOM   1291  C  CZ    . ARG A 1  175  ? 49.939  24.529  61.150  1.00 176.60 ? 175  ARG A CZ    1 
ATOM   1292  N  NH1   . ARG A 1  175  ? 51.258  24.394  61.189  1.00 176.40 ? 175  ARG A NH1   1 
ATOM   1293  N  NH2   . ARG A 1  175  ? 49.405  25.517  60.446  1.00 176.35 ? 175  ARG A NH2   1 
ATOM   1294  N  N     . LYS A 1  176  ? 49.011  19.391  59.086  1.00 177.12 ? 176  LYS A N     1 
ATOM   1295  C  CA    . LYS A 1  176  ? 48.203  19.400  57.872  1.00 176.88 ? 176  LYS A CA    1 
ATOM   1296  C  C     . LYS A 1  176  ? 47.660  20.804  57.604  1.00 176.82 ? 176  LYS A C     1 
ATOM   1297  O  O     . LYS A 1  176  ? 46.835  21.312  58.369  1.00 176.76 ? 176  LYS A O     1 
ATOM   1298  C  CB    . LYS A 1  176  ? 47.047  18.393  57.994  1.00 176.89 ? 176  LYS A CB    1 
ATOM   1299  C  CG    . LYS A 1  176  ? 46.237  18.172  56.713  1.00 176.75 ? 176  LYS A CG    1 
ATOM   1300  C  CD    . LYS A 1  176  ? 44.916  17.457  56.992  1.00 176.64 ? 176  LYS A CD    1 
ATOM   1301  C  CE    . LYS A 1  176  ? 44.047  17.385  55.741  1.00 176.25 ? 176  LYS A CE    1 
ATOM   1302  N  NZ    . LYS A 1  176  ? 42.642  16.993  56.045  1.00 175.76 ? 176  LYS A NZ    1 
ATOM   1303  N  N     . ASP A 1  177  ? 48.139  21.427  56.526  1.00 176.73 ? 177  ASP A N     1 
ATOM   1304  C  CA    . ASP A 1  177  ? 47.601  22.706  56.052  1.00 176.64 ? 177  ASP A CA    1 
ATOM   1305  C  C     . ASP A 1  177  ? 47.101  22.564  54.617  1.00 176.48 ? 177  ASP A C     1 
ATOM   1306  O  O     . ASP A 1  177  ? 47.834  22.843  53.665  1.00 176.37 ? 177  ASP A O     1 
ATOM   1307  C  CB    . ASP A 1  177  ? 48.645  23.830  56.155  1.00 176.72 ? 177  ASP A CB    1 
ATOM   1308  C  CG    . ASP A 1  177  ? 48.043  25.227  55.954  1.00 176.88 ? 177  ASP A CG    1 
ATOM   1309  O  OD1   . ASP A 1  177  ? 47.338  25.449  54.945  1.00 176.99 ? 177  ASP A OD1   1 
ATOM   1310  O  OD2   . ASP A 1  177  ? 48.287  26.115  56.803  1.00 177.02 ? 177  ASP A OD2   1 
ATOM   1311  N  N     . GLY A 1  178  ? 45.851  22.120  54.484  1.00 176.39 ? 178  GLY A N     1 
ATOM   1312  C  CA    . GLY A 1  178  ? 45.196  21.931  53.188  1.00 176.29 ? 178  GLY A CA    1 
ATOM   1313  C  C     . GLY A 1  178  ? 45.973  21.067  52.211  1.00 176.23 ? 178  GLY A C     1 
ATOM   1314  O  O     . GLY A 1  178  ? 45.747  19.859  52.110  1.00 176.19 ? 178  GLY A O     1 
ATOM   1315  N  N     . LEU A 1  179  ? 46.894  21.702  51.493  1.00 176.19 ? 179  LEU A N     1 
ATOM   1316  C  CA    . LEU A 1  179  ? 47.703  21.040  50.477  1.00 176.11 ? 179  LEU A CA    1 
ATOM   1317  C  C     . LEU A 1  179  ? 49.114  20.760  50.988  1.00 176.11 ? 179  LEU A C     1 
ATOM   1318  O  O     . LEU A 1  179  ? 49.692  19.723  50.667  1.00 176.10 ? 179  LEU A O     1 
ATOM   1319  C  CB    . LEU A 1  179  ? 47.788  21.912  49.219  1.00 176.12 ? 179  LEU A CB    1 
ATOM   1320  C  CG    . LEU A 1  179  ? 46.502  22.504  48.634  1.00 176.12 ? 179  LEU A CG    1 
ATOM   1321  C  CD1   . LEU A 1  179  ? 46.773  23.833  47.935  1.00 176.11 ? 179  LEU A CD1   1 
ATOM   1322  C  CD2   . LEU A 1  179  ? 45.837  21.520  47.694  1.00 176.00 ? 179  LEU A CD2   1 
ATOM   1323  N  N     . LYS A 1  180  ? 49.651  21.689  51.783  1.00 176.07 ? 180  LYS A N     1 
ATOM   1324  C  CA    . LYS A 1  180  ? 51.057  21.665  52.207  1.00 175.98 ? 180  LYS A CA    1 
ATOM   1325  C  C     . LYS A 1  180  ? 51.264  21.179  53.642  1.00 176.07 ? 180  LYS A C     1 
ATOM   1326  O  O     . LYS A 1  180  ? 50.314  21.092  54.425  1.00 176.03 ? 180  LYS A O     1 
ATOM   1327  C  CB    . LYS A 1  180  ? 51.690  23.051  52.038  1.00 175.86 ? 180  LYS A CB    1 
ATOM   1328  C  CG    . LYS A 1  180  ? 52.033  23.430  50.605  1.00 175.62 ? 180  LYS A CG    1 
ATOM   1329  C  CD    . LYS A 1  180  ? 50.880  24.142  49.914  1.00 175.29 ? 180  LYS A CD    1 
ATOM   1330  C  CE    . LYS A 1  180  ? 51.246  24.543  48.497  1.00 175.22 ? 180  LYS A CE    1 
ATOM   1331  N  NZ    . LYS A 1  180  ? 52.183  25.702  48.459  1.00 175.08 ? 180  LYS A NZ    1 
ATOM   1332  N  N     . LEU A 1  181  ? 52.521  20.875  53.972  1.00 176.21 ? 181  LEU A N     1 
ATOM   1333  C  CA    . LEU A 1  181  ? 52.903  20.369  55.293  1.00 176.29 ? 181  LEU A CA    1 
ATOM   1334  C  C     . LEU A 1  181  ? 54.054  21.173  55.917  1.00 176.50 ? 181  LEU A C     1 
ATOM   1335  O  O     . LEU A 1  181  ? 55.153  21.244  55.356  1.00 176.49 ? 181  LEU A O     1 
ATOM   1336  C  CB    . LEU A 1  181  ? 53.279  18.888  55.202  1.00 176.16 ? 181  LEU A CB    1 
ATOM   1337  C  CG    . LEU A 1  181  ? 52.248  17.936  54.595  1.00 175.75 ? 181  LEU A CG    1 
ATOM   1338  C  CD1   . LEU A 1  181  ? 52.901  16.623  54.218  1.00 175.41 ? 181  LEU A CD1   1 
ATOM   1339  C  CD2   . LEU A 1  181  ? 51.076  17.715  55.541  1.00 175.41 ? 181  LEU A CD2   1 
ATOM   1340  N  N     . VAL A 1  182  ? 53.786  21.765  57.080  1.00 176.74 ? 182  VAL A N     1 
ATOM   1341  C  CA    . VAL A 1  182  ? 54.740  22.634  57.784  1.00 177.00 ? 182  VAL A CA    1 
ATOM   1342  C  C     . VAL A 1  182  ? 55.524  21.830  58.847  1.00 177.18 ? 182  VAL A C     1 
ATOM   1343  O  O     . VAL A 1  182  ? 55.475  20.597  58.842  1.00 177.25 ? 182  VAL A O     1 
ATOM   1344  C  CB    . VAL A 1  182  ? 54.015  23.871  58.403  1.00 177.00 ? 182  VAL A CB    1 
ATOM   1345  C  CG1   . VAL A 1  182  ? 54.996  24.999  58.704  1.00 177.10 ? 182  VAL A CG1   1 
ATOM   1346  C  CG2   . VAL A 1  182  ? 52.930  24.383  57.462  1.00 176.90 ? 182  VAL A CG2   1 
ATOM   1347  N  N     . GLY A 1  183  ? 56.252  22.515  59.736  1.00 177.33 ? 183  GLY A N     1 
ATOM   1348  C  CA    . GLY A 1  183  ? 57.036  21.849  60.787  1.00 177.45 ? 183  GLY A CA    1 
ATOM   1349  C  C     . GLY A 1  183  ? 57.805  22.735  61.762  1.00 177.51 ? 183  GLY A C     1 
ATOM   1350  O  O     . GLY A 1  183  ? 58.303  23.803  61.397  1.00 177.49 ? 183  GLY A O     1 
ATOM   1351  N  N     . SER A 1  184  ? 57.908  22.272  63.007  1.00 177.55 ? 184  SER A N     1 
ATOM   1352  C  CA    . SER A 1  184  ? 58.629  22.985  64.060  1.00 177.59 ? 184  SER A CA    1 
ATOM   1353  C  C     . SER A 1  184  ? 60.075  22.487  64.165  1.00 177.66 ? 184  SER A C     1 
ATOM   1354  O  O     . SER A 1  184  ? 60.487  21.625  63.391  1.00 177.66 ? 184  SER A O     1 
ATOM   1355  C  CB    . SER A 1  184  ? 57.897  22.827  65.391  1.00 177.53 ? 184  SER A CB    1 
ATOM   1356  O  OG    . SER A 1  184  ? 58.326  23.804  66.317  1.00 177.60 ? 184  SER A OG    1 
ATOM   1357  N  N     . TRP A 1  185  ? 60.843  23.034  65.111  1.00 177.78 ? 185  TRP A N     1 
ATOM   1358  C  CA    . TRP A 1  185  ? 62.270  22.692  65.273  1.00 177.85 ? 185  TRP A CA    1 
ATOM   1359  C  C     . TRP A 1  185  ? 62.849  23.065  66.649  1.00 177.78 ? 185  TRP A C     1 
ATOM   1360  O  O     . TRP A 1  185  ? 62.445  24.066  67.246  1.00 177.79 ? 185  TRP A O     1 
ATOM   1361  C  CB    . TRP A 1  185  ? 63.121  23.367  64.175  1.00 177.93 ? 185  TRP A CB    1 
ATOM   1362  C  CG    . TRP A 1  185  ? 63.502  22.474  63.004  1.00 178.00 ? 185  TRP A CG    1 
ATOM   1363  C  CD1   . TRP A 1  185  ? 64.368  21.415  63.027  1.00 178.07 ? 185  TRP A CD1   1 
ATOM   1364  C  CD2   . TRP A 1  185  ? 63.050  22.587  61.646  1.00 178.00 ? 185  TRP A CD2   1 
ATOM   1365  N  NE1   . TRP A 1  185  ? 64.471  20.854  61.776  1.00 177.95 ? 185  TRP A NE1   1 
ATOM   1366  C  CE2   . TRP A 1  185  ? 63.675  21.552  60.909  1.00 177.93 ? 185  TRP A CE2   1 
ATOM   1367  C  CE3   . TRP A 1  185  ? 62.174  23.455  60.981  1.00 178.02 ? 185  TRP A CE3   1 
ATOM   1368  C  CZ2   . TRP A 1  185  ? 63.451  21.363  59.542  1.00 177.85 ? 185  TRP A CZ2   1 
ATOM   1369  C  CZ3   . TRP A 1  185  ? 61.952  23.264  59.620  1.00 177.98 ? 185  TRP A CZ3   1 
ATOM   1370  C  CH2   . TRP A 1  185  ? 62.588  22.224  58.918  1.00 177.90 ? 185  TRP A CH2   1 
ATOM   1371  N  N     . LYS A 1  186  ? 63.785  22.244  67.137  1.00 177.67 ? 186  LYS A N     1 
ATOM   1372  C  CA    . LYS A 1  186  ? 64.717  22.611  68.220  1.00 177.55 ? 186  LYS A CA    1 
ATOM   1373  C  C     . LYS A 1  186  ? 65.863  21.608  68.330  1.00 177.51 ? 186  LYS A C     1 
ATOM   1374  O  O     . LYS A 1  186  ? 66.873  21.724  67.637  1.00 177.43 ? 186  LYS A O     1 
ATOM   1375  C  CB    . LYS A 1  186  ? 64.024  22.766  69.580  1.00 177.58 ? 186  LYS A CB    1 
ATOM   1376  C  CG    . LYS A 1  186  ? 64.981  23.202  70.703  1.00 177.50 ? 186  LYS A CG    1 
ATOM   1377  C  CD    . LYS A 1  186  ? 64.255  23.786  71.909  1.00 177.43 ? 186  LYS A CD    1 
ATOM   1378  C  CE    . LYS A 1  186  ? 63.994  25.275  71.739  1.00 177.04 ? 186  LYS A CE    1 
ATOM   1379  N  NZ    . LYS A 1  186  ? 63.216  25.829  72.878  1.00 176.93 ? 186  LYS A NZ    1 
ATOM   1380  N  N     . LEU A 1  199  ? 57.604  26.431  61.758  1.00 158.65 ? 199  LEU A N     1 
ATOM   1381  C  CA    . LEU A 1  199  ? 58.659  27.345  61.327  1.00 158.69 ? 199  LEU A CA    1 
ATOM   1382  C  C     . LEU A 1  199  ? 58.770  27.432  59.791  1.00 158.70 ? 199  LEU A C     1 
ATOM   1383  O  O     . LEU A 1  199  ? 58.153  28.308  59.175  1.00 158.80 ? 199  LEU A O     1 
ATOM   1384  C  CB    . LEU A 1  199  ? 60.006  26.974  61.978  1.00 158.72 ? 199  LEU A CB    1 
ATOM   1385  C  CG    . LEU A 1  199  ? 60.332  27.465  63.399  1.00 158.63 ? 199  LEU A CG    1 
ATOM   1386  C  CD1   . LEU A 1  199  ? 59.633  26.647  64.479  1.00 158.47 ? 199  LEU A CD1   1 
ATOM   1387  C  CD2   . LEU A 1  199  ? 61.835  27.446  63.630  1.00 158.65 ? 199  LEU A CD2   1 
ATOM   1388  N  N     . ARG A 1  200  ? 59.548  26.527  59.189  1.00 158.56 ? 200  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  200  ? 59.769  26.477  57.733  1.00 158.37 ? 200  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  200  ? 58.852  25.446  57.065  1.00 158.14 ? 200  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  200  ? 58.717  24.324  57.556  1.00 158.18 ? 200  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  200  ? 61.250  26.177  57.439  1.00 158.36 ? 200  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  200  ? 61.540  25.329  56.198  1.00 158.40 ? 200  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  200  ? 62.923  24.695  56.288  1.00 158.65 ? 200  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  200  ? 62.971  23.362  55.683  1.00 159.28 ? 200  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  200  ? 63.965  22.488  55.843  1.00 159.67 ? 200  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  200  ? 65.019  22.782  56.598  1.00 159.82 ? 200  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  200  ? 63.900  21.304  55.250  1.00 159.88 ? 200  ARG A NH2   1 
ATOM   1399  N  N     . VAL A 1  201  ? 58.231  25.829  55.947  1.00 157.85 ? 201  VAL A N     1 
ATOM   1400  C  CA    . VAL A 1  201  ? 57.275  24.959  55.238  1.00 157.50 ? 201  VAL A CA    1 
ATOM   1401  C  C     . VAL A 1  201  ? 57.964  24.101  54.168  1.00 157.17 ? 201  VAL A C     1 
ATOM   1402  O  O     . VAL A 1  201  ? 58.718  24.615  53.335  1.00 157.10 ? 201  VAL A O     1 
ATOM   1403  C  CB    . VAL A 1  201  ? 56.105  25.764  54.602  1.00 157.57 ? 201  VAL A CB    1 
ATOM   1404  C  CG1   . VAL A 1  201  ? 54.953  24.836  54.238  1.00 157.50 ? 201  VAL A CG1   1 
ATOM   1405  C  CG2   . VAL A 1  201  ? 55.613  26.864  55.547  1.00 157.65 ? 201  VAL A CG2   1 
ATOM   1406  N  N     . LEU A 1  202  ? 57.686  22.798  54.195  1.00 156.75 ? 202  LEU A N     1 
ATOM   1407  C  CA    . LEU A 1  202  ? 58.386  21.828  53.347  1.00 156.34 ? 202  LEU A CA    1 
ATOM   1408  C  C     . LEU A 1  202  ? 57.862  21.792  51.912  1.00 155.94 ? 202  LEU A C     1 
ATOM   1409  O  O     . LEU A 1  202  ? 56.742  21.342  51.658  1.00 155.88 ? 202  LEU A O     1 
ATOM   1410  C  CB    . LEU A 1  202  ? 58.356  20.426  53.973  1.00 156.37 ? 202  LEU A CB    1 
ATOM   1411  C  CG    . LEU A 1  202  ? 59.134  20.233  55.281  1.00 156.32 ? 202  LEU A CG    1 
ATOM   1412  C  CD1   . LEU A 1  202  ? 58.216  20.353  56.493  1.00 155.96 ? 202  LEU A CD1   1 
ATOM   1413  C  CD2   . LEU A 1  202  ? 59.836  18.889  55.285  1.00 156.33 ? 202  LEU A CD2   1 
ATOM   1414  N  N     . SER A 1  203  ? 58.687  22.270  50.984  1.00 155.43 ? 203  SER A N     1 
ATOM   1415  C  CA    . SER A 1  203  ? 58.349  22.270  49.561  1.00 154.94 ? 203  SER A CA    1 
ATOM   1416  C  C     . SER A 1  203  ? 58.399  20.856  48.990  1.00 154.53 ? 203  SER A C     1 
ATOM   1417  O  O     . SER A 1  203  ? 59.122  19.998  49.500  1.00 154.48 ? 203  SER A O     1 
ATOM   1418  C  CB    . SER A 1  203  ? 59.285  23.198  48.776  1.00 155.00 ? 203  SER A CB    1 
ATOM   1419  O  OG    . SER A 1  203  ? 58.992  23.179  47.386  1.00 154.92 ? 203  SER A OG    1 
ATOM   1420  N  N     . THR A 1  204  ? 57.637  20.641  47.921  1.00 153.94 ? 204  THR A N     1 
ATOM   1421  C  CA    . THR A 1  204  ? 57.446  19.324  47.318  1.00 153.34 ? 204  THR A CA    1 
ATOM   1422  C  C     . THR A 1  204  ? 58.746  18.647  46.894  1.00 152.96 ? 204  THR A C     1 
ATOM   1423  O  O     . THR A 1  204  ? 58.965  17.468  47.194  1.00 152.90 ? 204  THR A O     1 
ATOM   1424  C  CB    . THR A 1  204  ? 56.537  19.408  46.078  1.00 153.36 ? 204  THR A CB    1 
ATOM   1425  O  OG1   . THR A 1  204  ? 55.563  20.443  46.256  1.00 153.17 ? 204  THR A OG1   1 
ATOM   1426  C  CG2   . THR A 1  204  ? 55.836  18.084  45.844  1.00 153.37 ? 204  THR A CG2   1 
ATOM   1427  N  N     . GLU A 1  205  ? 59.598  19.399  46.200  1.00 152.37 ? 205  GLU A N     1 
ATOM   1428  C  CA    . GLU A 1  205  ? 60.807  18.848  45.596  1.00 151.82 ? 205  GLU A CA    1 
ATOM   1429  C  C     . GLU A 1  205  ? 61.861  18.426  46.626  1.00 151.29 ? 205  GLU A C     1 
ATOM   1430  O  O     . GLU A 1  205  ? 62.760  17.638  46.315  1.00 151.23 ? 205  GLU A O     1 
ATOM   1431  C  CB    . GLU A 1  205  ? 61.393  19.830  44.584  1.00 151.91 ? 205  GLU A CB    1 
ATOM   1432  C  CG    . GLU A 1  205  ? 62.247  19.163  43.515  1.00 152.21 ? 205  GLU A CG    1 
ATOM   1433  C  CD    . GLU A 1  205  ? 62.635  20.108  42.402  1.00 152.51 ? 205  GLU A CD    1 
ATOM   1434  O  OE1   . GLU A 1  205  ? 63.179  21.192  42.706  1.00 152.62 ? 205  GLU A OE1   1 
ATOM   1435  O  OE2   . GLU A 1  205  ? 62.402  19.759  41.223  1.00 152.62 ? 205  GLU A OE2   1 
ATOM   1436  N  N     . GLU A 1  206  ? 61.747  18.955  47.842  1.00 150.60 ? 206  GLU A N     1 
ATOM   1437  C  CA    . GLU A 1  206  ? 62.572  18.505  48.959  1.00 149.90 ? 206  GLU A CA    1 
ATOM   1438  C  C     . GLU A 1  206  ? 62.246  17.058  49.297  1.00 149.51 ? 206  GLU A C     1 
ATOM   1439  O  O     . GLU A 1  206  ? 63.147  16.223  49.393  1.00 149.48 ? 206  GLU A O     1 
ATOM   1440  C  CB    . GLU A 1  206  ? 62.360  19.390  50.189  1.00 149.89 ? 206  GLU A CB    1 
ATOM   1441  C  CG    . GLU A 1  206  ? 63.418  20.466  50.380  1.00 149.40 ? 206  GLU A CG    1 
ATOM   1442  C  CD    . GLU A 1  206  ? 64.537  20.040  51.311  1.00 148.79 ? 206  GLU A CD    1 
ATOM   1443  O  OE1   . GLU A 1  206  ? 65.031  18.899  51.187  1.00 148.51 ? 206  GLU A OE1   1 
ATOM   1444  O  OE2   . GLU A 1  206  ? 64.929  20.857  52.169  1.00 148.61 ? 206  GLU A OE2   1 
ATOM   1445  N  N     . ILE A 1  207  ? 60.954  16.769  49.453  1.00 148.91 ? 207  ILE A N     1 
ATOM   1446  C  CA    . ILE A 1  207  ? 60.487  15.442  49.853  1.00 148.29 ? 207  ILE A CA    1 
ATOM   1447  C  C     . ILE A 1  207  ? 60.769  14.392  48.778  1.00 147.99 ? 207  ILE A C     1 
ATOM   1448  O  O     . ILE A 1  207  ? 61.157  13.267  49.098  1.00 147.92 ? 207  ILE A O     1 
ATOM   1449  C  CB    . ILE A 1  207  ? 58.987  15.441  50.241  1.00 148.21 ? 207  ILE A CB    1 
ATOM   1450  C  CG1   . ILE A 1  207  ? 58.694  16.503  51.299  1.00 148.13 ? 207  ILE A CG1   1 
ATOM   1451  C  CG2   . ILE A 1  207  ? 58.580  14.104  50.805  1.00 147.94 ? 207  ILE A CG2   1 
ATOM   1452  C  CD1   . ILE A 1  207  ? 57.974  17.709  50.772  1.00 148.22 ? 207  ILE A CD1   1 
ATOM   1453  N  N     . LEU A 1  208  ? 60.580  14.763  47.513  1.00 147.58 ? 208  LEU A N     1 
ATOM   1454  C  CA    . LEU A 1  208  ? 60.955  13.904  46.389  1.00 147.32 ? 208  LEU A CA    1 
ATOM   1455  C  C     . LEU A 1  208  ? 62.360  13.343  46.619  1.00 147.09 ? 208  LEU A C     1 
ATOM   1456  O  O     . LEU A 1  208  ? 62.531  12.135  46.798  1.00 147.02 ? 208  LEU A O     1 
ATOM   1457  C  CB    . LEU A 1  208  ? 60.924  14.699  45.075  1.00 147.32 ? 208  LEU A CB    1 
ATOM   1458  C  CG    . LEU A 1  208  ? 61.115  14.087  43.671  1.00 147.36 ? 208  LEU A CG    1 
ATOM   1459  C  CD1   . LEU A 1  208  ? 62.218  14.856  42.937  1.00 147.20 ? 208  LEU A CD1   1 
ATOM   1460  C  CD2   . LEU A 1  208  ? 61.421  12.586  43.633  1.00 146.90 ? 208  LEU A CD2   1 
ATOM   1461  N  N     . ASN A 1  209  ? 63.349  14.237  46.635  1.00 146.79 ? 209  ASN A N     1 
ATOM   1462  C  CA    . ASN A 1  209  ? 64.762  13.868  46.744  1.00 146.34 ? 209  ASN A CA    1 
ATOM   1463  C  C     . ASN A 1  209  ? 65.097  13.138  48.041  1.00 145.98 ? 209  ASN A C     1 
ATOM   1464  O  O     . ASN A 1  209  ? 66.027  12.332  48.075  1.00 146.06 ? 209  ASN A O     1 
ATOM   1465  C  CB    . ASN A 1  209  ? 65.662  15.100  46.577  1.00 146.38 ? 209  ASN A CB    1 
ATOM   1466  C  CG    . ASN A 1  209  ? 67.115  14.734  46.304  1.00 146.37 ? 209  ASN A CG    1 
ATOM   1467  O  OD1   . ASN A 1  209  ? 67.428  14.092  45.299  1.00 146.31 ? 209  ASN A OD1   1 
ATOM   1468  N  ND2   . ASN A 1  209  ? 68.011  15.148  47.198  1.00 146.35 ? 209  ASN A ND2   1 
ATOM   1469  N  N     . ILE A 1  210  ? 64.345  13.422  49.101  1.00 145.43 ? 210  ILE A N     1 
ATOM   1470  C  CA    . ILE A 1  210  ? 64.520  12.713  50.369  1.00 144.92 ? 210  ILE A CA    1 
ATOM   1471  C  C     . ILE A 1  210  ? 63.990  11.276  50.247  1.00 144.40 ? 210  ILE A C     1 
ATOM   1472  O  O     . ILE A 1  210  ? 64.656  10.328  50.677  1.00 144.40 ? 210  ILE A O     1 
ATOM   1473  C  CB    . ILE A 1  210  ? 63.900  13.500  51.577  1.00 145.05 ? 210  ILE A CB    1 
ATOM   1474  C  CG1   . ILE A 1  210  ? 64.647  14.830  51.812  1.00 145.15 ? 210  ILE A CG1   1 
ATOM   1475  C  CG2   . ILE A 1  210  ? 63.847  12.647  52.864  1.00 144.92 ? 210  ILE A CG2   1 
ATOM   1476  C  CD1   . ILE A 1  210  ? 66.170  14.723  52.033  1.00 144.94 ? 210  ILE A CD1   1 
ATOM   1477  N  N     . PHE A 1  211  ? 62.818  11.117  49.631  1.00 143.62 ? 211  PHE A N     1 
ATOM   1478  C  CA    . PHE A 1  211  ? 62.252  9.788   49.391  1.00 142.86 ? 211  PHE A CA    1 
ATOM   1479  C  C     . PHE A 1  211  ? 63.013  9.008   48.323  1.00 142.53 ? 211  PHE A C     1 
ATOM   1480  O  O     . PHE A 1  211  ? 63.056  7.780   48.367  1.00 142.53 ? 211  PHE A O     1 
ATOM   1481  C  CB    . PHE A 1  211  ? 60.771  9.871   49.005  1.00 142.66 ? 211  PHE A CB    1 
ATOM   1482  C  CG    . PHE A 1  211  ? 59.826  9.857   50.181  1.00 142.38 ? 211  PHE A CG    1 
ATOM   1483  C  CD1   . PHE A 1  211  ? 60.056  9.034   51.279  1.00 142.20 ? 211  PHE A CD1   1 
ATOM   1484  C  CD2   . PHE A 1  211  ? 58.681  10.645  50.173  1.00 141.92 ? 211  PHE A CD2   1 
ATOM   1485  C  CE1   . PHE A 1  211  ? 59.170  9.021   52.360  1.00 141.76 ? 211  PHE A CE1   1 
ATOM   1486  C  CE2   . PHE A 1  211  ? 57.795  10.634  51.247  1.00 141.35 ? 211  PHE A CE2   1 
ATOM   1487  C  CZ    . PHE A 1  211  ? 58.040  9.824   52.339  1.00 141.54 ? 211  PHE A CZ    1 
ATOM   1488  N  N     . LYS A 1  212  ? 63.605  9.725   47.370  1.00 142.06 ? 212  LYS A N     1 
ATOM   1489  C  CA    . LYS A 1  212  ? 64.326  9.114   46.248  1.00 141.59 ? 212  LYS A CA    1 
ATOM   1490  C  C     . LYS A 1  212  ? 65.551  8.315   46.716  1.00 141.29 ? 212  LYS A C     1 
ATOM   1491  O  O     . LYS A 1  212  ? 65.840  7.241   46.177  1.00 141.23 ? 212  LYS A O     1 
ATOM   1492  C  CB    . LYS A 1  212  ? 64.743  10.193  45.243  1.00 141.60 ? 212  LYS A CB    1 
ATOM   1493  C  CG    . LYS A 1  212  ? 64.736  9.761   43.789  1.00 141.32 ? 212  LYS A CG    1 
ATOM   1494  C  CD    . LYS A 1  212  ? 65.069  10.944  42.902  1.00 141.24 ? 212  LYS A CD    1 
ATOM   1495  C  CE    . LYS A 1  212  ? 64.410  10.820  41.546  1.00 141.32 ? 212  LYS A CE    1 
ATOM   1496  N  NZ    . LYS A 1  212  ? 64.474  12.105  40.798  1.00 141.46 ? 212  LYS A NZ    1 
ATOM   1497  N  N     . HIS A 1  213  ? 66.252  8.846   47.722  1.00 140.86 ? 213  HIS A N     1 
ATOM   1498  C  CA    . HIS A 1  213  ? 67.459  8.217   48.282  1.00 140.29 ? 213  HIS A CA    1 
ATOM   1499  C  C     . HIS A 1  213  ? 67.147  7.184   49.387  1.00 139.87 ? 213  HIS A C     1 
ATOM   1500  O  O     . HIS A 1  213  ? 68.068  6.653   50.013  1.00 139.88 ? 213  HIS A O     1 
ATOM   1501  C  CB    . HIS A 1  213  ? 68.469  9.279   48.798  1.00 140.27 ? 213  HIS A CB    1 
ATOM   1502  C  CG    . HIS A 1  213  ? 69.418  9.806   47.753  1.00 139.93 ? 213  HIS A CG    1 
ATOM   1503  N  ND1   . HIS A 1  213  ? 69.984  9.012   46.775  1.00 139.58 ? 213  HIS A ND1   1 
ATOM   1504  C  CD2   . HIS A 1  213  ? 69.930  11.047  47.566  1.00 139.57 ? 213  HIS A CD2   1 
ATOM   1505  C  CE1   . HIS A 1  213  ? 70.780  9.745   46.017  1.00 139.12 ? 213  HIS A CE1   1 
ATOM   1506  N  NE2   . HIS A 1  213  ? 70.767  10.983  46.478  1.00 139.28 ? 213  HIS A NE2   1 
ATOM   1507  N  N     . ILE A 1  214  ? 65.865  6.897   49.622  1.00 139.26 ? 214  ILE A N     1 
ATOM   1508  C  CA    . ILE A 1  214  ? 65.468  5.894   50.624  1.00 138.70 ? 214  ILE A CA    1 
ATOM   1509  C  C     . ILE A 1  214  ? 65.989  4.501   50.274  1.00 138.37 ? 214  ILE A C     1 
ATOM   1510  O  O     . ILE A 1  214  ? 65.939  4.086   49.112  1.00 138.29 ? 214  ILE A O     1 
ATOM   1511  C  CB    . ILE A 1  214  ? 63.931  5.874   50.868  1.00 138.66 ? 214  ILE A CB    1 
ATOM   1512  C  CG1   . ILE A 1  214  ? 63.552  6.862   51.976  1.00 138.58 ? 214  ILE A CG1   1 
ATOM   1513  C  CG2   . ILE A 1  214  ? 63.432  4.484   51.248  1.00 138.39 ? 214  ILE A CG2   1 
ATOM   1514  C  CD1   . ILE A 1  214  ? 64.030  6.466   53.376  1.00 138.43 ? 214  ILE A CD1   1 
ATOM   1515  N  N     . SER A 1  215  ? 66.492  3.801   51.294  1.00 137.94 ? 215  SER A N     1 
ATOM   1516  C  CA    . SER A 1  215  ? 67.107  2.476   51.140  1.00 137.43 ? 215  SER A CA    1 
ATOM   1517  C  C     . SER A 1  215  ? 66.121  1.397   50.686  1.00 136.92 ? 215  SER A C     1 
ATOM   1518  O  O     . SER A 1  215  ? 64.918  1.494   50.926  1.00 136.89 ? 215  SER A O     1 
ATOM   1519  C  CB    . SER A 1  215  ? 67.817  2.054   52.433  1.00 137.53 ? 215  SER A CB    1 
ATOM   1520  O  OG    . SER A 1  215  ? 68.319  0.730   52.345  1.00 137.63 ? 215  SER A OG    1 
ATOM   1521  N  N     . VAL A 1  216  ? 66.655  0.368   50.035  1.00 136.27 ? 216  VAL A N     1 
ATOM   1522  C  CA    . VAL A 1  216  ? 65.845  -0.656  49.380  1.00 135.62 ? 216  VAL A CA    1 
ATOM   1523  C  C     . VAL A 1  216  ? 64.977  -1.440  50.376  1.00 135.26 ? 216  VAL A C     1 
ATOM   1524  O  O     . VAL A 1  216  ? 63.770  -1.557  50.182  1.00 135.04 ? 216  VAL A O     1 
ATOM   1525  C  CB    . VAL A 1  216  ? 66.720  -1.601  48.506  1.00 135.66 ? 216  VAL A CB    1 
ATOM   1526  C  CG1   . VAL A 1  216  ? 65.869  -2.303  47.459  1.00 135.52 ? 216  VAL A CG1   1 
ATOM   1527  C  CG2   . VAL A 1  216  ? 67.855  -0.823  47.824  1.00 135.34 ? 216  VAL A CG2   1 
ATOM   1528  N  N     . LYS A 1  217  ? 65.592  -1.952  51.441  1.00 134.96 ? 217  LYS A N     1 
ATOM   1529  C  CA    . LYS A 1  217  ? 64.870  -2.676  52.494  1.00 134.65 ? 217  LYS A CA    1 
ATOM   1530  C  C     . LYS A 1  217  ? 64.105  -1.749  53.432  1.00 134.43 ? 217  LYS A C     1 
ATOM   1531  O  O     . LYS A 1  217  ? 63.423  -2.210  54.349  1.00 134.33 ? 217  LYS A O     1 
ATOM   1532  C  CB    . LYS A 1  217  ? 65.815  -3.566  53.307  1.00 134.66 ? 217  LYS A CB    1 
ATOM   1533  C  CG    . LYS A 1  217  ? 65.727  -5.044  52.982  1.00 134.58 ? 217  LYS A CG    1 
ATOM   1534  C  CD    . LYS A 1  217  ? 66.603  -5.847  53.927  1.00 134.92 ? 217  LYS A CD    1 
ATOM   1535  C  CE    . LYS A 1  217  ? 66.842  -7.254  53.397  1.00 135.34 ? 217  LYS A CE    1 
ATOM   1536  N  NZ    . LYS A 1  217  ? 68.008  -7.916  54.053  1.00 135.34 ? 217  LYS A NZ    1 
ATOM   1537  N  N     . ASP A 1  218  ? 64.229  -0.446  53.208  1.00 134.23 ? 218  ASP A N     1 
ATOM   1538  C  CA    . ASP A 1  218  ? 63.451  0.531   53.958  1.00 134.15 ? 218  ASP A CA    1 
ATOM   1539  C  C     . ASP A 1  218  ? 61.987  0.597   53.473  1.00 134.00 ? 218  ASP A C     1 
ATOM   1540  O  O     . ASP A 1  218  ? 61.090  0.917   54.255  1.00 134.02 ? 218  ASP A O     1 
ATOM   1541  C  CB    . ASP A 1  218  ? 64.121  1.914   53.917  1.00 134.22 ? 218  ASP A CB    1 
ATOM   1542  C  CG    . ASP A 1  218  ? 65.371  1.996   54.791  1.00 134.18 ? 218  ASP A CG    1 
ATOM   1543  O  OD1   . ASP A 1  218  ? 65.720  0.987   55.440  1.00 134.34 ? 218  ASP A OD1   1 
ATOM   1544  O  OD2   . ASP A 1  218  ? 66.005  3.078   54.827  1.00 133.88 ? 218  ASP A OD2   1 
ATOM   1545  N  N     . PHE A 1  219  ? 61.754  0.287   52.194  1.00 133.61 ? 219  PHE A N     1 
ATOM   1546  C  CA    . PHE A 1  219  ? 60.400  0.234   51.639  1.00 133.17 ? 219  PHE A CA    1 
ATOM   1547  C  C     . PHE A 1  219  ? 59.595  -0.880  52.278  1.00 132.80 ? 219  PHE A C     1 
ATOM   1548  O  O     . PHE A 1  219  ? 58.662  -0.633  53.036  1.00 132.66 ? 219  PHE A O     1 
ATOM   1549  C  CB    . PHE A 1  219  ? 60.429  -0.062  50.142  1.00 133.36 ? 219  PHE A CB    1 
ATOM   1550  C  CG    . PHE A 1  219  ? 61.108  0.975   49.319  1.00 133.52 ? 219  PHE A CG    1 
ATOM   1551  C  CD1   . PHE A 1  219  ? 62.046  0.599   48.366  1.00 133.72 ? 219  PHE A CD1   1 
ATOM   1552  C  CD2   . PHE A 1  219  ? 60.801  2.319   49.466  1.00 133.83 ? 219  PHE A CD2   1 
ATOM   1553  C  CE1   . PHE A 1  219  ? 62.680  1.545   47.575  1.00 134.00 ? 219  PHE A CE1   1 
ATOM   1554  C  CE2   . PHE A 1  219  ? 61.434  3.277   48.679  1.00 134.31 ? 219  PHE A CE2   1 
ATOM   1555  C  CZ    . PHE A 1  219  ? 62.377  2.889   47.732  1.00 134.04 ? 219  PHE A CZ    1 
ATOM   1556  N  N     . THR A 1  220  ? 59.982  -2.110  51.940  1.00 132.36 ? 220  THR A N     1 
ATOM   1557  C  CA    . THR A 1  220  ? 59.276  -3.342  52.308  1.00 131.95 ? 220  THR A CA    1 
ATOM   1558  C  C     . THR A 1  220  ? 58.946  -3.417  53.802  1.00 131.63 ? 220  THR A C     1 
ATOM   1559  O  O     . THR A 1  220  ? 57.922  -3.985  54.202  1.00 131.54 ? 220  THR A O     1 
ATOM   1560  C  CB    . THR A 1  220  ? 60.087  -4.590  51.852  1.00 131.96 ? 220  THR A CB    1 
ATOM   1561  O  OG1   . THR A 1  220  ? 60.412  -4.466  50.459  1.00 131.60 ? 220  THR A OG1   1 
ATOM   1562  C  CG2   . THR A 1  220  ? 59.301  -5.886  52.066  1.00 132.12 ? 220  THR A CG2   1 
ATOM   1563  N  N     . SER A 1  221  ? 59.817  -2.828  54.614  1.00 131.25 ? 221  SER A N     1 
ATOM   1564  C  CA    . SER A 1  221  ? 59.580  -2.728  56.046  1.00 130.86 ? 221  SER A CA    1 
ATOM   1565  C  C     . SER A 1  221  ? 58.347  -1.869  56.366  1.00 130.41 ? 221  SER A C     1 
ATOM   1566  O  O     . SER A 1  221  ? 57.576  -2.208  57.265  1.00 130.35 ? 221  SER A O     1 
ATOM   1567  C  CB    . SER A 1  221  ? 60.841  -2.245  56.787  1.00 130.99 ? 221  SER A CB    1 
ATOM   1568  O  OG    . SER A 1  221  ? 61.687  -1.451  55.966  1.00 131.01 ? 221  SER A OG    1 
ATOM   1569  N  N     . LEU A 1  222  ? 58.154  -0.783  55.617  1.00 129.86 ? 222  LEU A N     1 
ATOM   1570  C  CA    . LEU A 1  222  ? 56.991  0.097   55.812  1.00 129.38 ? 222  LEU A CA    1 
ATOM   1571  C  C     . LEU A 1  222  ? 55.820  -0.188  54.854  1.00 129.07 ? 222  LEU A C     1 
ATOM   1572  O  O     . LEU A 1  222  ? 54.905  0.628   54.695  1.00 128.91 ? 222  LEU A O     1 
ATOM   1573  C  CB    . LEU A 1  222  ? 57.394  1.584   55.806  1.00 129.39 ? 222  LEU A CB    1 
ATOM   1574  C  CG    . LEU A 1  222  ? 58.574  2.111   54.987  1.00 129.20 ? 222  LEU A CG    1 
ATOM   1575  C  CD1   . LEU A 1  222  ? 58.185  2.388   53.548  1.00 129.44 ? 222  LEU A CD1   1 
ATOM   1576  C  CD2   . LEU A 1  222  ? 59.105  3.373   55.629  1.00 129.23 ? 222  LEU A CD2   1 
ATOM   1577  N  N     . GLY A 1  223  ? 55.857  -1.362  54.231  1.00 128.73 ? 223  GLY A N     1 
ATOM   1578  C  CA    . GLY A 1  223  ? 54.745  -1.857  53.425  1.00 128.12 ? 223  GLY A CA    1 
ATOM   1579  C  C     . GLY A 1  223  ? 54.686  -1.285  52.028  1.00 127.65 ? 223  GLY A C     1 
ATOM   1580  O  O     . GLY A 1  223  ? 53.734  -0.585  51.684  1.00 127.61 ? 223  GLY A O     1 
ATOM   1581  N  N     . PHE A 1  224  ? 55.710  -1.576  51.230  1.00 127.21 ? 224  PHE A N     1 
ATOM   1582  C  CA    . PHE A 1  224  ? 55.738  -1.188  49.824  1.00 126.83 ? 224  PHE A CA    1 
ATOM   1583  C  C     . PHE A 1  224  ? 56.015  -2.396  48.941  1.00 126.44 ? 224  PHE A C     1 
ATOM   1584  O  O     . PHE A 1  224  ? 55.521  -3.486  49.250  1.00 126.30 ? 224  PHE A O     1 
ATOM   1585  C  CB    . PHE A 1  224  ? 56.710  -0.031  49.590  1.00 126.97 ? 224  PHE A CB    1 
ATOM   1586  C  CG    . PHE A 1  224  ? 56.081  1.316   49.793  1.00 127.61 ? 224  PHE A CG    1 
ATOM   1587  C  CD1   . PHE A 1  224  ? 55.691  1.736   51.069  1.00 128.40 ? 224  PHE A CD1   1 
ATOM   1588  C  CD2   . PHE A 1  224  ? 55.844  2.157   48.710  1.00 128.02 ? 224  PHE A CD2   1 
ATOM   1589  C  CE1   . PHE A 1  224  ? 55.082  2.980   51.271  1.00 128.55 ? 224  PHE A CE1   1 
ATOM   1590  C  CE2   . PHE A 1  224  ? 55.242  3.410   48.898  1.00 128.53 ? 224  PHE A CE2   1 
ATOM   1591  C  CZ    . PHE A 1  224  ? 54.863  3.822   50.183  1.00 128.30 ? 224  PHE A CZ    1 
ATOM   1592  N  N     . ASN A 1  225  ? 56.775  -2.215  47.854  1.00 126.08 ? 225  ASN A N     1 
ATOM   1593  C  CA    . ASN A 1  225  ? 57.050  -3.312  46.906  1.00 125.73 ? 225  ASN A CA    1 
ATOM   1594  C  C     . ASN A 1  225  ? 58.006  -2.968  45.752  1.00 125.43 ? 225  ASN A C     1 
ATOM   1595  O  O     . ASN A 1  225  ? 57.703  -3.235  44.585  1.00 125.20 ? 225  ASN A O     1 
ATOM   1596  C  CB    . ASN A 1  225  ? 55.731  -3.875  46.344  1.00 125.79 ? 225  ASN A CB    1 
ATOM   1597  C  CG    . ASN A 1  225  ? 55.766  -5.384  46.134  1.00 125.74 ? 225  ASN A CG    1 
ATOM   1598  O  OD1   . ASN A 1  225  ? 54.938  -6.110  46.687  1.00 125.61 ? 225  ASN A OD1   1 
ATOM   1599  N  ND2   . ASN A 1  225  ? 56.711  -5.859  45.323  1.00 125.70 ? 225  ASN A ND2   1 
ATOM   1600  N  N     . GLU A 1  226  ? 59.154  -2.387  46.092  1.00 125.24 ? 226  GLU A N     1 
ATOM   1601  C  CA    . GLU A 1  226  ? 60.259  -2.130  45.146  1.00 125.17 ? 226  GLU A CA    1 
ATOM   1602  C  C     . GLU A 1  226  ? 59.859  -1.627  43.741  1.00 124.85 ? 226  GLU A C     1 
ATOM   1603  O  O     . GLU A 1  226  ? 59.941  -0.432  43.459  1.00 124.90 ? 226  GLU A O     1 
ATOM   1604  C  CB    . GLU A 1  226  ? 61.199  -3.350  45.046  1.00 125.14 ? 226  GLU A CB    1 
ATOM   1605  C  CG    . GLU A 1  226  ? 62.521  -3.069  44.314  1.00 125.40 ? 226  GLU A CG    1 
ATOM   1606  C  CD    . GLU A 1  226  ? 63.405  -4.303  44.135  1.00 125.50 ? 226  GLU A CD    1 
ATOM   1607  O  OE1   . GLU A 1  226  ? 64.649  -4.143  44.081  1.00 125.81 ? 226  GLU A OE1   1 
ATOM   1608  O  OE2   . GLU A 1  226  ? 62.864  -5.429  44.045  1.00 125.76 ? 226  GLU A OE2   1 
ATOM   1609  N  N     . VAL A 1  227  ? 59.438  -2.548  42.875  1.00 124.41 ? 227  VAL A N     1 
ATOM   1610  C  CA    . VAL A 1  227  ? 59.220  -2.244  41.460  1.00 123.93 ? 227  VAL A CA    1 
ATOM   1611  C  C     . VAL A 1  227  ? 57.779  -1.800  41.139  1.00 123.61 ? 227  VAL A C     1 
ATOM   1612  O  O     . VAL A 1  227  ? 57.525  -1.233  40.068  1.00 123.71 ? 227  VAL A O     1 
ATOM   1613  C  CB    . VAL A 1  227  ? 59.637  -3.429  40.537  1.00 123.90 ? 227  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1  227  ? 60.395  -2.914  39.322  1.00 123.88 ? 227  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1  227  ? 60.499  -4.428  41.286  1.00 123.86 ? 227  VAL A CG2   1 
ATOM   1616  N  N     . PHE A 1  228  ? 56.849  -2.041  42.066  1.00 122.95 ? 228  PHE A N     1 
ATOM   1617  C  CA    . PHE A 1  228  ? 55.422  -1.771  41.826  1.00 122.27 ? 228  PHE A CA    1 
ATOM   1618  C  C     . PHE A 1  228  ? 54.926  -0.447  42.392  1.00 122.10 ? 228  PHE A C     1 
ATOM   1619  O  O     . PHE A 1  228  ? 54.081  0.211   41.783  1.00 122.02 ? 228  PHE A O     1 
ATOM   1620  C  CB    . PHE A 1  228  ? 54.564  -2.930  42.335  1.00 121.97 ? 228  PHE A CB    1 
ATOM   1621  C  CG    . PHE A 1  228  ? 54.457  -4.067  41.365  1.00 121.46 ? 228  PHE A CG    1 
ATOM   1622  C  CD1   . PHE A 1  228  ? 53.229  -4.428  40.840  1.00 121.13 ? 228  PHE A CD1   1 
ATOM   1623  C  CD2   . PHE A 1  228  ? 55.586  -4.766  40.956  1.00 121.26 ? 228  PHE A CD2   1 
ATOM   1624  C  CE1   . PHE A 1  228  ? 53.120  -5.475  39.931  1.00 120.95 ? 228  PHE A CE1   1 
ATOM   1625  C  CE2   . PHE A 1  228  ? 55.485  -5.811  40.044  1.00 121.08 ? 228  PHE A CE2   1 
ATOM   1626  C  CZ    . PHE A 1  228  ? 54.249  -6.165  39.533  1.00 120.97 ? 228  PHE A CZ    1 
ATOM   1627  N  N     . SER A 1  229  ? 55.444  -0.077  43.562  1.00 122.00 ? 229  SER A N     1 
ATOM   1628  C  CA    . SER A 1  229  ? 55.180  1.229   44.172  1.00 121.90 ? 229  SER A CA    1 
ATOM   1629  C  C     . SER A 1  229  ? 56.351  1.709   45.059  1.00 122.00 ? 229  SER A C     1 
ATOM   1630  O  O     . SER A 1  229  ? 56.885  0.951   45.878  1.00 122.07 ? 229  SER A O     1 
ATOM   1631  C  CB    . SER A 1  229  ? 53.834  1.252   44.921  1.00 121.70 ? 229  SER A CB    1 
ATOM   1632  O  OG    . SER A 1  229  ? 53.899  0.608   46.177  1.00 121.18 ? 229  SER A OG    1 
ATOM   1633  N  N     . ARG A 1  230  ? 56.744  2.967   44.856  1.00 121.97 ? 230  ARG A N     1 
ATOM   1634  C  CA    . ARG A 1  230  ? 57.831  3.628   45.586  1.00 121.81 ? 230  ARG A CA    1 
ATOM   1635  C  C     . ARG A 1  230  ? 57.434  5.074   45.912  1.00 121.70 ? 230  ARG A C     1 
ATOM   1636  O  O     . ARG A 1  230  ? 56.869  5.760   45.059  1.00 121.83 ? 230  ARG A O     1 
ATOM   1637  C  CB    . ARG A 1  230  ? 59.104  3.647   44.739  1.00 121.84 ? 230  ARG A CB    1 
ATOM   1638  C  CG    . ARG A 1  230  ? 60.078  2.510   44.977  1.00 121.58 ? 230  ARG A CG    1 
ATOM   1639  C  CD    . ARG A 1  230  ? 61.177  2.562   43.929  1.00 120.95 ? 230  ARG A CD    1 
ATOM   1640  N  NE    . ARG A 1  230  ? 62.403  1.896   44.350  1.00 120.35 ? 230  ARG A NE    1 
ATOM   1641  C  CZ    . ARG A 1  230  ? 63.525  1.875   43.636  1.00 120.31 ? 230  ARG A CZ    1 
ATOM   1642  N  NH1   . ARG A 1  230  ? 63.580  2.476   42.455  1.00 120.43 ? 230  ARG A NH1   1 
ATOM   1643  N  NH2   . ARG A 1  230  ? 64.596  1.250   44.099  1.00 120.32 ? 230  ARG A NH2   1 
ATOM   1644  N  N     . PRO A 1  231  ? 57.732  5.543   47.140  1.00 121.45 ? 231  PRO A N     1 
ATOM   1645  C  CA    . PRO A 1  231  ? 57.349  6.877   47.612  1.00 121.22 ? 231  PRO A CA    1 
ATOM   1646  C  C     . PRO A 1  231  ? 57.745  8.070   46.733  1.00 120.91 ? 231  PRO A C     1 
ATOM   1647  O  O     . PRO A 1  231  ? 57.170  9.144   46.897  1.00 120.90 ? 231  PRO A O     1 
ATOM   1648  C  CB    . PRO A 1  231  ? 58.029  6.964   48.977  1.00 121.33 ? 231  PRO A CB    1 
ATOM   1649  C  CG    . PRO A 1  231  ? 58.083  5.554   49.433  1.00 121.43 ? 231  PRO A CG    1 
ATOM   1650  C  CD    . PRO A 1  231  ? 58.432  4.790   48.193  1.00 121.41 ? 231  PRO A CD    1 
ATOM   1651  N  N     . GLU A 1  232  ? 58.693  7.907   45.813  1.00 120.54 ? 232  GLU A N     1 
ATOM   1652  C  CA    . GLU A 1  232  ? 58.945  8.981   44.847  1.00 120.36 ? 232  GLU A CA    1 
ATOM   1653  C  C     . GLU A 1  232  ? 57.874  9.008   43.761  1.00 120.08 ? 232  GLU A C     1 
ATOM   1654  O  O     . GLU A 1  232  ? 57.808  9.943   42.961  1.00 120.15 ? 232  GLU A O     1 
ATOM   1655  C  CB    . GLU A 1  232  ? 60.349  8.913   44.232  1.00 120.55 ? 232  GLU A CB    1 
ATOM   1656  C  CG    . GLU A 1  232  ? 60.522  7.955   43.059  1.00 120.78 ? 232  GLU A CG    1 
ATOM   1657  C  CD    . GLU A 1  232  ? 61.470  6.812   43.371  1.00 121.29 ? 232  GLU A CD    1 
ATOM   1658  O  OE1   . GLU A 1  232  ? 61.235  6.087   44.368  1.00 121.21 ? 232  GLU A OE1   1 
ATOM   1659  O  OE2   . GLU A 1  232  ? 62.455  6.644   42.615  1.00 121.36 ? 232  GLU A OE2   1 
ATOM   1660  N  N     . TRP A 1  233  ? 57.049  7.965   43.746  1.00 119.68 ? 233  TRP A N     1 
ATOM   1661  C  CA    . TRP A 1  233  ? 55.907  7.875   42.851  1.00 119.24 ? 233  TRP A CA    1 
ATOM   1662  C  C     . TRP A 1  233  ? 54.665  8.382   43.561  1.00 119.08 ? 233  TRP A C     1 
ATOM   1663  O  O     . TRP A 1  233  ? 53.824  9.013   42.945  1.00 118.93 ? 233  TRP A O     1 
ATOM   1664  C  CB    . TRP A 1  233  ? 55.724  6.443   42.342  1.00 119.10 ? 233  TRP A CB    1 
ATOM   1665  C  CG    . TRP A 1  233  ? 56.970  5.899   41.694  1.00 119.06 ? 233  TRP A CG    1 
ATOM   1666  C  CD1   . TRP A 1  233  ? 58.015  6.627   41.203  1.00 119.35 ? 233  TRP A CD1   1 
ATOM   1667  C  CD2   . TRP A 1  233  ? 57.292  4.524   41.443  1.00 119.01 ? 233  TRP A CD2   1 
ATOM   1668  N  NE1   . TRP A 1  233  ? 58.976  5.796   40.682  1.00 119.57 ? 233  TRP A NE1   1 
ATOM   1669  C  CE2   . TRP A 1  233  ? 58.559  4.499   40.812  1.00 119.27 ? 233  TRP A CE2   1 
ATOM   1670  C  CE3   . TRP A 1  233  ? 56.638  3.312   41.689  1.00 118.98 ? 233  TRP A CE3   1 
ATOM   1671  C  CZ2   . TRP A 1  233  ? 59.184  3.306   40.422  1.00 119.14 ? 233  TRP A CZ2   1 
ATOM   1672  C  CZ3   . TRP A 1  233  ? 57.263  2.125   41.304  1.00 119.18 ? 233  TRP A CZ3   1 
ATOM   1673  C  CH2   . TRP A 1  233  ? 58.521  2.134   40.675  1.00 119.12 ? 233  TRP A CH2   1 
ATOM   1674  N  N     . MET A 1  234  ? 54.577  8.135   44.866  1.00 119.17 ? 234  MET A N     1 
ATOM   1675  C  CA    . MET A 1  234  ? 53.481  8.647   45.702  1.00 119.30 ? 234  MET A CA    1 
ATOM   1676  C  C     . MET A 1  234  ? 53.291  10.182  45.606  1.00 119.45 ? 234  MET A C     1 
ATOM   1677  O  O     . MET A 1  234  ? 52.213  10.700  45.918  1.00 119.46 ? 234  MET A O     1 
ATOM   1678  C  CB    . MET A 1  234  ? 53.665  8.209   47.166  1.00 119.28 ? 234  MET A CB    1 
ATOM   1679  C  CG    . MET A 1  234  ? 52.378  8.244   47.994  1.00 119.27 ? 234  MET A CG    1 
ATOM   1680  S  SD    . MET A 1  234  ? 52.554  8.407   49.794  1.00 119.13 ? 234  MET A SD    1 
ATOM   1681  C  CE    . MET A 1  234  ? 52.713  6.695   50.296  1.00 119.20 ? 234  MET A CE    1 
ATOM   1682  N  N     . ILE A 1  235  ? 54.337  10.902  45.195  1.00 119.61 ? 235  ILE A N     1 
ATOM   1683  C  CA    . ILE A 1  235  ? 54.203  12.318  44.816  1.00 119.62 ? 235  ILE A CA    1 
ATOM   1684  C  C     . ILE A 1  235  ? 54.303  12.463  43.309  1.00 119.65 ? 235  ILE A C     1 
ATOM   1685  O  O     . ILE A 1  235  ? 55.062  11.746  42.651  1.00 119.61 ? 235  ILE A O     1 
ATOM   1686  C  CB    . ILE A 1  235  ? 55.220  13.282  45.518  1.00 119.62 ? 235  ILE A CB    1 
ATOM   1687  C  CG1   . ILE A 1  235  ? 56.622  12.661  45.642  1.00 119.46 ? 235  ILE A CG1   1 
ATOM   1688  C  CG2   . ILE A 1  235  ? 54.673  13.747  46.872  1.00 119.52 ? 235  ILE A CG2   1 
ATOM   1689  C  CD1   . ILE A 1  235  ? 57.571  13.014  44.516  1.00 118.90 ? 235  ILE A CD1   1 
ATOM   1690  N  N     . LEU A 1  236  ? 53.540  13.406  42.771  1.00 119.76 ? 236  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1  236  ? 53.356  13.490  41.329  1.00 119.85 ? 236  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1  236  ? 54.458  14.177  40.539  1.00 119.93 ? 236  LEU A C     1 
ATOM   1693  O  O     . LEU A 1  236  ? 54.709  15.375  40.677  1.00 119.81 ? 236  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1  236  ? 51.974  14.035  40.986  1.00 119.77 ? 236  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1  236  ? 50.937  12.914  40.992  1.00 119.58 ? 236  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1  236  ? 49.546  13.490  41.121  1.00 119.87 ? 236  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1  236  ? 51.068  12.041  39.743  1.00 118.99 ? 236  LEU A CD2   1 
ATOM   1698  N  N     . THR A 1  237  ? 55.094  13.385  39.692  1.00 120.09 ? 237  THR A N     1 
ATOM   1699  C  CA    . THR A 1  237  ? 56.165  13.845  38.841  1.00 120.48 ? 237  THR A CA    1 
ATOM   1700  C  C     . THR A 1  237  ? 55.618  14.137  37.447  1.00 120.57 ? 237  THR A C     1 
ATOM   1701  O  O     . THR A 1  237  ? 55.853  15.203  36.877  1.00 120.57 ? 237  THR A O     1 
ATOM   1702  C  CB    . THR A 1  237  ? 57.236  12.749  38.733  1.00 120.57 ? 237  THR A CB    1 
ATOM   1703  O  OG1   . THR A 1  237  ? 57.349  12.067  39.993  1.00 120.58 ? 237  THR A OG1   1 
ATOM   1704  C  CG2   . THR A 1  237  ? 58.600  13.325  38.296  1.00 120.79 ? 237  THR A CG2   1 
ATOM   1705  N  N     . CYS A 1  238  ? 54.876  13.178  36.909  1.00 120.66 ? 238  CYS A N     1 
ATOM   1706  C  CA    . CYS A 1  238  ? 54.438  13.235  35.533  1.00 120.71 ? 238  CYS A CA    1 
ATOM   1707  C  C     . CYS A 1  238  ? 53.011  12.717  35.426  1.00 120.85 ? 238  CYS A C     1 
ATOM   1708  O  O     . CYS A 1  238  ? 52.765  11.512  35.533  1.00 120.84 ? 238  CYS A O     1 
ATOM   1709  C  CB    . CYS A 1  238  ? 55.381  12.407  34.670  1.00 120.62 ? 238  CYS A CB    1 
ATOM   1710  S  SG    . CYS A 1  238  ? 55.394  12.903  32.973  1.00 120.53 ? 238  CYS A SG    1 
ATOM   1711  N  N     . LEU A 1  239  ? 52.078  13.642  35.222  1.00 121.02 ? 239  LEU A N     1 
ATOM   1712  C  CA    . LEU A 1  239  ? 50.658  13.325  35.193  1.00 121.19 ? 239  LEU A CA    1 
ATOM   1713  C  C     . LEU A 1  239  ? 50.229  12.706  33.860  1.00 121.52 ? 239  LEU A C     1 
ATOM   1714  O  O     . LEU A 1  239  ? 50.537  13.249  32.790  1.00 121.18 ? 239  LEU A O     1 
ATOM   1715  C  CB    . LEU A 1  239  ? 49.830  14.571  35.516  1.00 121.10 ? 239  LEU A CB    1 
ATOM   1716  C  CG    . LEU A 1  239  ? 48.300  14.494  35.500  1.00 120.99 ? 239  LEU A CG    1 
ATOM   1717  C  CD1   . LEU A 1  239  ? 47.750  13.629  36.620  1.00 120.76 ? 239  LEU A CD1   1 
ATOM   1718  C  CD2   . LEU A 1  239  ? 47.731  15.892  35.594  1.00 121.15 ? 239  LEU A CD2   1 
ATOM   1719  N  N     . PRO A 1  240  ? 49.521  11.555  33.931  1.00 122.01 ? 240  PRO A N     1 
ATOM   1720  C  CA    . PRO A 1  240  ? 48.985  10.871  32.752  1.00 122.34 ? 240  PRO A CA    1 
ATOM   1721  C  C     . PRO A 1  240  ? 47.701  11.538  32.251  1.00 122.69 ? 240  PRO A C     1 
ATOM   1722  O  O     . PRO A 1  240  ? 46.880  12.017  33.055  1.00 122.75 ? 240  PRO A O     1 
ATOM   1723  C  CB    . PRO A 1  240  ? 48.704  9.455   33.261  1.00 122.26 ? 240  PRO A CB    1 
ATOM   1724  C  CG    . PRO A 1  240  ? 48.408  9.634   34.708  1.00 122.18 ? 240  PRO A CG    1 
ATOM   1725  C  CD    . PRO A 1  240  ? 49.198  10.829  35.177  1.00 122.03 ? 240  PRO A CD    1 
ATOM   1726  N  N     . VAL A 1  241  ? 47.547  11.558  30.928  1.00 122.89 ? 241  VAL A N     1 
ATOM   1727  C  CA    . VAL A 1  241  ? 46.481  12.304  30.261  1.00 122.93 ? 241  VAL A CA    1 
ATOM   1728  C  C     . VAL A 1  241  ? 45.401  11.356  29.737  1.00 122.85 ? 241  VAL A C     1 
ATOM   1729  O  O     . VAL A 1  241  ? 45.615  10.663  28.737  1.00 122.94 ? 241  VAL A O     1 
ATOM   1730  C  CB    . VAL A 1  241  ? 47.040  13.162  29.100  1.00 122.98 ? 241  VAL A CB    1 
ATOM   1731  C  CG1   . VAL A 1  241  ? 45.987  14.136  28.607  1.00 123.14 ? 241  VAL A CG1   1 
ATOM   1732  C  CG2   . VAL A 1  241  ? 48.297  13.915  29.532  1.00 123.08 ? 241  VAL A CG2   1 
ATOM   1733  N  N     . PRO A 1  242  ? 44.237  11.324  30.416  1.00 122.73 ? 242  PRO A N     1 
ATOM   1734  C  CA    . PRO A 1  242  ? 43.152  10.400  30.079  1.00 122.71 ? 242  PRO A CA    1 
ATOM   1735  C  C     . PRO A 1  242  ? 42.522  10.711  28.729  1.00 122.75 ? 242  PRO A C     1 
ATOM   1736  O  O     . PRO A 1  242  ? 42.006  11.808  28.534  1.00 122.69 ? 242  PRO A O     1 
ATOM   1737  C  CB    . PRO A 1  242  ? 42.143  10.601  31.210  1.00 122.65 ? 242  PRO A CB    1 
ATOM   1738  C  CG    . PRO A 1  242  ? 42.435  11.940  31.755  1.00 122.77 ? 242  PRO A CG    1 
ATOM   1739  C  CD    . PRO A 1  242  ? 43.897  12.183  31.563  1.00 122.68 ? 242  PRO A CD    1 
ATOM   1740  N  N     . PRO A 1  243  ? 42.563  9.739   27.803  1.00 122.89 ? 243  PRO A N     1 
ATOM   1741  C  CA    . PRO A 1  243  ? 42.140  9.867   26.410  1.00 123.05 ? 243  PRO A CA    1 
ATOM   1742  C  C     . PRO A 1  243  ? 40.664  10.252  26.242  1.00 123.15 ? 243  PRO A C     1 
ATOM   1743  O  O     . PRO A 1  243  ? 39.890  10.172  27.204  1.00 123.12 ? 243  PRO A O     1 
ATOM   1744  C  CB    . PRO A 1  243  ? 42.404  8.467   25.837  1.00 122.97 ? 243  PRO A CB    1 
ATOM   1745  C  CG    . PRO A 1  243  ? 42.393  7.581   27.013  1.00 123.04 ? 243  PRO A CG    1 
ATOM   1746  C  CD    . PRO A 1  243  ? 43.040  8.378   28.086  1.00 122.99 ? 243  PRO A CD    1 
ATOM   1747  N  N     . PRO A 1  244  ? 40.282  10.682  25.022  1.00 123.20 ? 244  PRO A N     1 
ATOM   1748  C  CA    . PRO A 1  244  ? 38.917  11.103  24.715  1.00 123.28 ? 244  PRO A CA    1 
ATOM   1749  C  C     . PRO A 1  244  ? 37.796  10.226  25.304  1.00 123.44 ? 244  PRO A C     1 
ATOM   1750  O  O     . PRO A 1  244  ? 36.991  10.750  26.058  1.00 123.43 ? 244  PRO A O     1 
ATOM   1751  C  CB    . PRO A 1  244  ? 38.882  11.134  23.176  1.00 123.35 ? 244  PRO A CB    1 
ATOM   1752  C  CG    . PRO A 1  244  ? 40.254  10.690  22.713  1.00 123.17 ? 244  PRO A CG    1 
ATOM   1753  C  CD    . PRO A 1  244  ? 41.173  10.833  23.858  1.00 123.08 ? 244  PRO A CD    1 
ATOM   1754  N  N     . PRO A 1  245  ? 37.745  8.911   24.988  1.00 123.71 ? 245  PRO A N     1 
ATOM   1755  C  CA    . PRO A 1  245  ? 36.635  8.072   25.463  1.00 124.09 ? 245  PRO A CA    1 
ATOM   1756  C  C     . PRO A 1  245  ? 36.409  8.027   26.974  1.00 124.61 ? 245  PRO A C     1 
ATOM   1757  O  O     . PRO A 1  245  ? 35.526  7.303   27.436  1.00 124.67 ? 245  PRO A O     1 
ATOM   1758  C  CB    . PRO A 1  245  ? 37.021  6.677   24.967  1.00 123.98 ? 245  PRO A CB    1 
ATOM   1759  C  CG    . PRO A 1  245  ? 37.853  6.935   23.784  1.00 123.88 ? 245  PRO A CG    1 
ATOM   1760  C  CD    . PRO A 1  245  ? 38.674  8.118   24.165  1.00 123.77 ? 245  PRO A CD    1 
ATOM   1761  N  N     . VAL A 1  246  ? 37.189  8.791   27.731  1.00 125.34 ? 246  VAL A N     1 
ATOM   1762  C  CA    . VAL A 1  246  ? 36.997  8.879   29.175  1.00 126.18 ? 246  VAL A CA    1 
ATOM   1763  C  C     . VAL A 1  246  ? 36.412  10.239  29.572  1.00 126.98 ? 246  VAL A C     1 
ATOM   1764  O  O     . VAL A 1  246  ? 36.086  10.456  30.738  1.00 126.93 ? 246  VAL A O     1 
ATOM   1765  C  CB    . VAL A 1  246  ? 38.310  8.620   29.955  1.00 126.07 ? 246  VAL A CB    1 
ATOM   1766  C  CG1   . VAL A 1  246  ? 37.996  8.091   31.332  1.00 126.01 ? 246  VAL A CG1   1 
ATOM   1767  C  CG2   . VAL A 1  246  ? 39.198  7.620   29.227  1.00 126.02 ? 246  VAL A CG2   1 
ATOM   1768  N  N     . ARG A 1  247  ? 36.292  11.140  28.589  1.00 128.21 ? 247  ARG A N     1 
ATOM   1769  C  CA    . ARG A 1  247  ? 35.752  12.518  28.754  1.00 129.36 ? 247  ARG A CA    1 
ATOM   1770  C  C     . ARG A 1  247  ? 35.401  13.188  27.397  1.00 130.34 ? 247  ARG A C     1 
ATOM   1771  O  O     . ARG A 1  247  ? 36.046  14.173  27.005  1.00 130.34 ? 247  ARG A O     1 
ATOM   1772  C  CB    . ARG A 1  247  ? 36.722  13.415  29.555  1.00 129.23 ? 247  ARG A CB    1 
ATOM   1773  C  CG    . ARG A 1  247  ? 38.198  13.137  29.292  1.00 128.88 ? 247  ARG A CG    1 
ATOM   1774  C  CD    . ARG A 1  247  ? 39.084  14.351  29.483  1.00 127.86 ? 247  ARG A CD    1 
ATOM   1775  N  NE    . ARG A 1  247  ? 40.384  14.132  28.847  1.00 126.82 ? 247  ARG A NE    1 
ATOM   1776  C  CZ    . ARG A 1  247  ? 40.624  14.291  27.547  1.00 126.18 ? 247  ARG A CZ    1 
ATOM   1777  N  NH1   . ARG A 1  247  ? 39.657  14.675  26.730  1.00 126.56 ? 247  ARG A NH1   1 
ATOM   1778  N  NH2   . ARG A 1  247  ? 41.833  14.060  27.059  1.00 125.70 ? 247  ARG A NH2   1 
ATOM   1779  N  N     . PRO A 1  248  ? 34.360  12.674  26.697  1.00 131.29 ? 248  PRO A N     1 
ATOM   1780  C  CA    . PRO A 1  248  ? 34.082  12.996  25.288  1.00 132.18 ? 248  PRO A CA    1 
ATOM   1781  C  C     . PRO A 1  248  ? 33.632  14.438  24.999  1.00 133.24 ? 248  PRO A C     1 
ATOM   1782  O  O     . PRO A 1  248  ? 34.397  15.375  25.237  1.00 133.39 ? 248  PRO A O     1 
ATOM   1783  C  CB    . PRO A 1  248  ? 32.982  11.992  24.904  1.00 132.08 ? 248  PRO A CB    1 
ATOM   1784  C  CG    . PRO A 1  248  ? 32.926  11.000  26.013  1.00 131.59 ? 248  PRO A CG    1 
ATOM   1785  C  CD    . PRO A 1  248  ? 33.361  11.730  27.228  1.00 131.27 ? 248  PRO A CD    1 
ATOM   1786  N  N     . SER A 1  249  ? 32.415  14.600  24.473  1.00 134.46 ? 249  SER A N     1 
ATOM   1787  C  CA    . SER A 1  249  ? 31.928  15.892  23.987  1.00 135.74 ? 249  SER A CA    1 
ATOM   1788  C  C     . SER A 1  249  ? 30.438  15.849  23.645  1.00 136.90 ? 249  SER A C     1 
ATOM   1789  O  O     . SER A 1  249  ? 29.647  15.281  24.396  1.00 136.86 ? 249  SER A O     1 
ATOM   1790  C  CB    . SER A 1  249  ? 32.739  16.330  22.762  1.00 135.61 ? 249  SER A CB    1 
ATOM   1791  O  OG    . SER A 1  249  ? 32.797  15.292  21.798  1.00 135.44 ? 249  SER A OG    1 
ATOM   1792  N  N     . ILE A 1  250  ? 30.088  16.453  22.503  1.00 138.61 ? 250  ILE A N     1 
ATOM   1793  C  CA    . ILE A 1  250  ? 28.713  16.565  21.923  1.00 140.20 ? 250  ILE A CA    1 
ATOM   1794  C  C     . ILE A 1  250  ? 27.506  16.914  22.830  1.00 141.17 ? 250  ILE A C     1 
ATOM   1795  O  O     . ILE A 1  250  ? 27.449  16.538  24.008  1.00 141.33 ? 250  ILE A O     1 
ATOM   1796  C  CB    . ILE A 1  250  ? 28.327  15.399  20.907  1.00 140.25 ? 250  ILE A CB    1 
ATOM   1797  C  CG1   . ILE A 1  250  ? 28.479  13.983  21.524  1.00 140.40 ? 250  ILE A CG1   1 
ATOM   1798  C  CG2   . ILE A 1  250  ? 29.027  15.595  19.541  1.00 140.29 ? 250  ILE A CG2   1 
ATOM   1799  C  CD1   . ILE A 1  250  ? 29.801  13.241  21.237  1.00 140.13 ? 250  ILE A CD1   1 
ATOM   1800  N  N     . SER A 1  251  ? 26.552  17.642  22.242  1.00 142.32 ? 251  SER A N     1 
ATOM   1801  C  CA    . SER A 1  251  ? 25.291  18.016  22.893  1.00 143.45 ? 251  SER A CA    1 
ATOM   1802  C  C     . SER A 1  251  ? 24.244  18.445  21.845  1.00 144.34 ? 251  SER A C     1 
ATOM   1803  O  O     . SER A 1  251  ? 23.982  17.707  20.886  1.00 144.45 ? 251  SER A O     1 
ATOM   1804  C  CB    . SER A 1  251  ? 25.514  19.102  23.967  1.00 143.36 ? 251  SER A CB    1 
ATOM   1805  O  OG    . SER A 1  251  ? 26.267  20.199  23.473  1.00 143.37 ? 251  SER A OG    1 
ATOM   1806  N  N     . PHE A 1  252  ? 23.652  19.628  22.037  1.00 145.44 ? 252  PHE A N     1 
ATOM   1807  C  CA    . PHE A 1  252  ? 22.709  20.239  21.081  1.00 146.46 ? 252  PHE A CA    1 
ATOM   1808  C  C     . PHE A 1  252  ? 23.422  20.739  19.808  1.00 146.95 ? 252  PHE A C     1 
ATOM   1809  O  O     . PHE A 1  252  ? 22.790  21.324  18.918  1.00 147.10 ? 252  PHE A O     1 
ATOM   1810  C  CB    . PHE A 1  252  ? 21.944  21.403  21.757  1.00 146.60 ? 252  PHE A CB    1 
ATOM   1811  C  CG    . PHE A 1  252  ? 22.841  22.403  22.476  1.00 147.12 ? 252  PHE A CG    1 
ATOM   1812  C  CD1   . PHE A 1  252  ? 23.458  23.446  21.779  1.00 147.54 ? 252  PHE A CD1   1 
ATOM   1813  C  CD2   . PHE A 1  252  ? 23.062  22.301  23.852  1.00 147.44 ? 252  PHE A CD2   1 
ATOM   1814  C  CE1   . PHE A 1  252  ? 24.287  24.361  22.440  1.00 147.81 ? 252  PHE A CE1   1 
ATOM   1815  C  CE2   . PHE A 1  252  ? 23.890  23.211  24.525  1.00 147.48 ? 252  PHE A CE2   1 
ATOM   1816  C  CZ    . PHE A 1  252  ? 24.501  24.241  23.817  1.00 147.55 ? 252  PHE A CZ    1 
ATOM   1817  N  N     . ASN A 1  253  ? 24.727  20.454  19.726  1.00 147.46 ? 253  ASN A N     1 
ATOM   1818  C  CA    . ASN A 1  253  ? 25.690  21.153  18.848  1.00 147.72 ? 253  ASN A CA    1 
ATOM   1819  C  C     . ASN A 1  253  ? 25.562  21.044  17.311  1.00 147.76 ? 253  ASN A C     1 
ATOM   1820  O  O     . ASN A 1  253  ? 24.452  20.968  16.768  1.00 147.77 ? 253  ASN A O     1 
ATOM   1821  C  CB    . ASN A 1  253  ? 27.154  20.920  19.327  1.00 147.80 ? 253  ASN A CB    1 
ATOM   1822  C  CG    . ASN A 1  253  ? 27.549  19.433  19.435  1.00 148.06 ? 253  ASN A CG    1 
ATOM   1823  O  OD1   . ASN A 1  253  ? 26.706  18.532  19.438  1.00 148.53 ? 253  ASN A OD1   1 
ATOM   1824  N  ND2   . ASN A 1  253  ? 28.853  19.187  19.540  1.00 148.05 ? 253  ASN A ND2   1 
ATOM   1825  N  N     . GLU A 1  254  ? 26.718  21.043  16.639  1.00 147.78 ? 254  GLU A N     1 
ATOM   1826  C  CA    . GLU A 1  254  ? 26.833  21.147  15.179  1.00 147.75 ? 254  GLU A CA    1 
ATOM   1827  C  C     . GLU A 1  254  ? 26.227  22.462  14.670  1.00 147.66 ? 254  GLU A C     1 
ATOM   1828  O  O     . GLU A 1  254  ? 25.021  22.542  14.428  1.00 147.52 ? 254  GLU A O     1 
ATOM   1829  C  CB    . GLU A 1  254  ? 26.249  19.913  14.475  1.00 147.80 ? 254  GLU A CB    1 
ATOM   1830  C  CG    . GLU A 1  254  ? 27.230  18.732  14.317  1.00 147.88 ? 254  GLU A CG    1 
ATOM   1831  C  CD    . GLU A 1  254  ? 27.617  18.047  15.632  1.00 147.52 ? 254  GLU A CD    1 
ATOM   1832  O  OE1   . GLU A 1  254  ? 27.094  16.947  15.912  1.00 147.22 ? 254  GLU A OE1   1 
ATOM   1833  O  OE2   . GLU A 1  254  ? 28.456  18.598  16.376  1.00 147.53 ? 254  GLU A OE2   1 
ATOM   1834  N  N     . SER A 1  255  ? 27.062  23.494  14.520  1.00 147.65 ? 255  SER A N     1 
ATOM   1835  C  CA    . SER A 1  255  ? 28.530  23.394  14.676  1.00 147.67 ? 255  SER A CA    1 
ATOM   1836  C  C     . SER A 1  255  ? 29.145  23.748  16.051  1.00 147.55 ? 255  SER A C     1 
ATOM   1837  O  O     . SER A 1  255  ? 30.345  23.527  16.260  1.00 147.52 ? 255  SER A O     1 
ATOM   1838  C  CB    . SER A 1  255  ? 29.230  24.213  13.583  1.00 147.67 ? 255  SER A CB    1 
ATOM   1839  O  OG    . SER A 1  255  ? 29.337  23.473  12.381  1.00 147.91 ? 255  SER A OG    1 
ATOM   1840  N  N     . GLN A 1  256  ? 28.340  24.276  16.977  1.00 147.35 ? 256  GLN A N     1 
ATOM   1841  C  CA    . GLN A 1  256  ? 28.852  24.765  18.271  1.00 147.07 ? 256  GLN A CA    1 
ATOM   1842  C  C     . GLN A 1  256  ? 28.165  24.164  19.513  1.00 146.88 ? 256  GLN A C     1 
ATOM   1843  O  O     . GLN A 1  256  ? 26.954  24.360  19.686  1.00 146.94 ? 256  GLN A O     1 
ATOM   1844  C  CB    . GLN A 1  256  ? 28.743  26.294  18.332  1.00 147.04 ? 256  GLN A CB    1 
ATOM   1845  C  CG    . GLN A 1  256  ? 29.821  27.038  17.571  1.00 146.95 ? 256  GLN A CG    1 
ATOM   1846  C  CD    . GLN A 1  256  ? 29.352  28.399  17.109  1.00 146.93 ? 256  GLN A CD    1 
ATOM   1847  O  OE1   . GLN A 1  256  ? 28.472  28.507  16.252  1.00 147.18 ? 256  GLN A OE1   1 
ATOM   1848  N  NE2   . GLN A 1  256  ? 29.939  29.448  17.671  1.00 146.74 ? 256  GLN A NE2   1 
ATOM   1849  N  N     . ARG A 1  257  ? 28.892  23.443  20.386  1.00 146.47 ? 257  ARG A N     1 
ATOM   1850  C  CA    . ARG A 1  257  ? 30.315  23.022  20.248  1.00 145.92 ? 257  ARG A CA    1 
ATOM   1851  C  C     . ARG A 1  257  ? 30.758  22.043  21.364  1.00 145.39 ? 257  ARG A C     1 
ATOM   1852  O  O     . ARG A 1  257  ? 31.705  21.273  21.181  1.00 145.30 ? 257  ARG A O     1 
ATOM   1853  C  CB    . ARG A 1  257  ? 31.283  24.220  20.166  1.00 146.04 ? 257  ARG A CB    1 
ATOM   1854  C  CG    . ARG A 1  257  ? 31.141  25.276  21.260  1.00 146.12 ? 257  ARG A CG    1 
ATOM   1855  C  CD    . ARG A 1  257  ? 31.823  26.578  20.857  1.00 145.97 ? 257  ARG A CD    1 
ATOM   1856  N  NE    . ARG A 1  257  ? 31.691  27.589  21.902  1.00 146.03 ? 257  ARG A NE    1 
ATOM   1857  C  CZ    . ARG A 1  257  ? 32.621  27.864  22.812  1.00 146.08 ? 257  ARG A CZ    1 
ATOM   1858  N  NH1   . ARG A 1  257  ? 33.781  27.214  22.815  1.00 146.05 ? 257  ARG A NH1   1 
ATOM   1859  N  NH2   . ARG A 1  257  ? 32.391  28.802  23.720  1.00 145.99 ? 257  ARG A NH2   1 
ATOM   1860  N  N     . GLY A 1  258  ? 30.058  22.107  22.501  1.00 144.77 ? 258  GLY A N     1 
ATOM   1861  C  CA    . GLY A 1  258  ? 30.209  21.231  23.686  1.00 143.88 ? 258  GLY A CA    1 
ATOM   1862  C  C     . GLY A 1  258  ? 31.441  20.386  23.995  1.00 143.19 ? 258  GLY A C     1 
ATOM   1863  O  O     . GLY A 1  258  ? 31.889  19.594  23.162  1.00 143.16 ? 258  GLY A O     1 
ATOM   1864  N  N     . GLU A 1  259  ? 31.954  20.537  25.222  1.00 142.42 ? 259  GLU A N     1 
ATOM   1865  C  CA    . GLU A 1  259  ? 33.073  19.735  25.743  1.00 141.54 ? 259  GLU A CA    1 
ATOM   1866  C  C     . GLU A 1  259  ? 32.796  19.159  27.134  1.00 140.92 ? 259  GLU A C     1 
ATOM   1867  O  O     . GLU A 1  259  ? 32.181  19.817  27.979  1.00 140.78 ? 259  GLU A O     1 
ATOM   1868  C  CB    . GLU A 1  259  ? 34.372  20.548  25.773  1.00 141.57 ? 259  GLU A CB    1 
ATOM   1869  C  CG    . GLU A 1  259  ? 35.172  20.532  24.464  1.00 141.46 ? 259  GLU A CG    1 
ATOM   1870  C  CD    . GLU A 1  259  ? 35.882  19.205  24.192  1.00 141.32 ? 259  GLU A CD    1 
ATOM   1871  O  OE1   . GLU A 1  259  ? 36.104  18.421  25.143  1.00 141.22 ? 259  GLU A OE1   1 
ATOM   1872  O  OE2   . GLU A 1  259  ? 36.225  18.951  23.016  1.00 141.15 ? 259  GLU A OE2   1 
ATOM   1873  N  N     . ASP A 1  260  ? 33.269  17.931  27.356  1.00 140.18 ? 260  ASP A N     1 
ATOM   1874  C  CA    . ASP A 1  260  ? 33.062  17.214  28.620  1.00 139.41 ? 260  ASP A CA    1 
ATOM   1875  C  C     . ASP A 1  260  ? 33.971  17.708  29.723  1.00 138.75 ? 260  ASP A C     1 
ATOM   1876  O  O     . ASP A 1  260  ? 35.069  18.195  29.465  1.00 138.77 ? 260  ASP A O     1 
ATOM   1877  C  CB    . ASP A 1  260  ? 33.207  15.698  28.448  1.00 139.48 ? 260  ASP A CB    1 
ATOM   1878  C  CG    . ASP A 1  260  ? 31.864  14.980  28.439  1.00 139.57 ? 260  ASP A CG    1 
ATOM   1879  O  OD1   . ASP A 1  260  ? 31.043  15.235  29.350  1.00 139.65 ? 260  ASP A OD1   1 
ATOM   1880  O  OD2   . ASP A 1  260  ? 31.630  14.159  27.525  1.00 139.36 ? 260  ASP A OD2   1 
ATOM   1881  N  N     . ASP A 1  261  ? 33.507  17.540  30.955  1.00 137.90 ? 261  ASP A N     1 
ATOM   1882  C  CA    . ASP A 1  261  ? 33.968  18.351  32.074  1.00 137.09 ? 261  ASP A CA    1 
ATOM   1883  C  C     . ASP A 1  261  ? 35.295  17.962  32.742  1.00 136.40 ? 261  ASP A C     1 
ATOM   1884  O  O     . ASP A 1  261  ? 35.792  18.686  33.601  1.00 136.26 ? 261  ASP A O     1 
ATOM   1885  C  CB    . ASP A 1  261  ? 32.833  18.514  33.095  1.00 137.21 ? 261  ASP A CB    1 
ATOM   1886  C  CG    . ASP A 1  261  ? 31.899  19.688  32.766  1.00 137.43 ? 261  ASP A CG    1 
ATOM   1887  O  OD1   . ASP A 1  261  ? 31.814  20.101  31.584  1.00 137.46 ? 261  ASP A OD1   1 
ATOM   1888  O  OD2   . ASP A 1  261  ? 31.242  20.199  33.701  1.00 137.75 ? 261  ASP A OD2   1 
ATOM   1889  N  N     . LEU A 1  262  ? 35.876  16.835  32.347  1.00 135.64 ? 262  LEU A N     1 
ATOM   1890  C  CA    . LEU A 1  262  ? 37.219  16.501  32.805  1.00 134.98 ? 262  LEU A CA    1 
ATOM   1891  C  C     . LEU A 1  262  ? 38.271  17.106  31.902  1.00 134.72 ? 262  LEU A C     1 
ATOM   1892  O  O     . LEU A 1  262  ? 39.432  17.214  32.282  1.00 134.70 ? 262  LEU A O     1 
ATOM   1893  C  CB    . LEU A 1  262  ? 37.426  14.995  32.892  1.00 134.87 ? 262  LEU A CB    1 
ATOM   1894  C  CG    . LEU A 1  262  ? 36.912  14.273  34.135  1.00 134.62 ? 262  LEU A CG    1 
ATOM   1895  C  CD1   . LEU A 1  262  ? 37.627  12.944  34.225  1.00 134.39 ? 262  LEU A CD1   1 
ATOM   1896  C  CD2   . LEU A 1  262  ? 37.115  15.081  35.423  1.00 134.19 ? 262  LEU A CD2   1 
ATOM   1897  N  N     . THR A 1  263  ? 37.861  17.499  30.703  1.00 134.47 ? 263  THR A N     1 
ATOM   1898  C  CA    . THR A 1  263  ? 38.757  18.168  29.771  1.00 134.27 ? 263  THR A CA    1 
ATOM   1899  C  C     . THR A 1  263  ? 38.944  19.646  30.149  1.00 134.16 ? 263  THR A C     1 
ATOM   1900  O  O     . THR A 1  263  ? 39.812  20.326  29.597  1.00 134.23 ? 263  THR A O     1 
ATOM   1901  C  CB    . THR A 1  263  ? 38.268  18.047  28.307  1.00 134.29 ? 263  THR A CB    1 
ATOM   1902  O  OG1   . THR A 1  263  ? 37.426  16.894  28.158  1.00 134.24 ? 263  THR A OG1   1 
ATOM   1903  C  CG2   . THR A 1  263  ? 39.459  17.945  27.355  1.00 134.17 ? 263  THR A CG2   1 
ATOM   1904  N  N     . PHE A 1  264  ? 38.132  20.133  31.090  1.00 133.95 ? 264  PHE A N     1 
ATOM   1905  C  CA    . PHE A 1  264  ? 38.255  21.501  31.606  1.00 133.74 ? 264  PHE A CA    1 
ATOM   1906  C  C     . PHE A 1  264  ? 39.435  21.633  32.556  1.00 133.84 ? 264  PHE A C     1 
ATOM   1907  O  O     . PHE A 1  264  ? 40.293  22.491  32.361  1.00 133.92 ? 264  PHE A O     1 
ATOM   1908  C  CB    . PHE A 1  264  ? 36.967  21.955  32.303  1.00 133.51 ? 264  PHE A CB    1 
ATOM   1909  C  CG    . PHE A 1  264  ? 35.975  22.620  31.389  1.00 133.08 ? 264  PHE A CG    1 
ATOM   1910  C  CD1   . PHE A 1  264  ? 34.819  23.181  31.907  1.00 132.65 ? 264  PHE A CD1   1 
ATOM   1911  C  CD2   . PHE A 1  264  ? 36.198  22.699  30.016  1.00 132.68 ? 264  PHE A CD2   1 
ATOM   1912  C  CE1   . PHE A 1  264  ? 33.895  23.786  31.075  1.00 132.42 ? 264  PHE A CE1   1 
ATOM   1913  C  CE2   . PHE A 1  264  ? 35.280  23.310  29.180  1.00 132.35 ? 264  PHE A CE2   1 
ATOM   1914  C  CZ    . PHE A 1  264  ? 34.128  23.849  29.709  1.00 132.46 ? 264  PHE A CZ    1 
ATOM   1915  N  N     . LYS A 1  265  ? 39.482  20.786  33.582  1.00 133.89 ? 265  LYS A N     1 
ATOM   1916  C  CA    . LYS A 1  265  ? 40.597  20.818  34.520  1.00 134.01 ? 265  LYS A CA    1 
ATOM   1917  C  C     . LYS A 1  265  ? 41.888  20.399  33.854  1.00 133.98 ? 265  LYS A C     1 
ATOM   1918  O  O     . LYS A 1  265  ? 42.960  20.848  34.245  1.00 134.03 ? 265  LYS A O     1 
ATOM   1919  C  CB    . LYS A 1  265  ? 40.320  19.978  35.756  1.00 134.01 ? 265  LYS A CB    1 
ATOM   1920  C  CG    . LYS A 1  265  ? 39.768  20.805  36.896  1.00 134.51 ? 265  LYS A CG    1 
ATOM   1921  C  CD    . LYS A 1  265  ? 39.319  19.936  38.047  1.00 135.83 ? 265  LYS A CD    1 
ATOM   1922  C  CE    . LYS A 1  265  ? 38.130  19.042  37.671  1.00 136.50 ? 265  LYS A CE    1 
ATOM   1923  N  NZ    . LYS A 1  265  ? 36.840  19.791  37.643  1.00 136.73 ? 265  LYS A NZ    1 
ATOM   1924  N  N     . LEU A 1  266  ? 41.778  19.560  32.831  1.00 134.04 ? 266  LEU A N     1 
ATOM   1925  C  CA    . LEU A 1  266  ? 42.919  19.267  31.974  1.00 134.29 ? 266  LEU A CA    1 
ATOM   1926  C  C     . LEU A 1  266  ? 43.522  20.538  31.359  1.00 134.49 ? 266  LEU A C     1 
ATOM   1927  O  O     . LEU A 1  266  ? 44.699  20.555  30.986  1.00 134.57 ? 266  LEU A O     1 
ATOM   1928  C  CB    . LEU A 1  266  ? 42.553  18.245  30.887  1.00 134.28 ? 266  LEU A CB    1 
ATOM   1929  C  CG    . LEU A 1  266  ? 43.013  16.787  31.055  1.00 134.10 ? 266  LEU A CG    1 
ATOM   1930  C  CD1   . LEU A 1  266  ? 44.506  16.620  30.767  1.00 133.53 ? 266  LEU A CD1   1 
ATOM   1931  C  CD2   . LEU A 1  266  ? 42.672  16.235  32.432  1.00 134.29 ? 266  LEU A CD2   1 
ATOM   1932  N  N     . ALA A 1  267  ? 42.725  21.601  31.271  1.00 134.68 ? 267  ALA A N     1 
ATOM   1933  C  CA    . ALA A 1  267  ? 43.241  22.893  30.828  1.00 134.93 ? 267  ALA A CA    1 
ATOM   1934  C  C     . ALA A 1  267  ? 43.656  23.742  32.020  1.00 135.09 ? 267  ALA A C     1 
ATOM   1935  O  O     . ALA A 1  267  ? 44.757  24.291  32.040  1.00 135.05 ? 267  ALA A O     1 
ATOM   1936  C  CB    . ALA A 1  267  ? 42.219  23.624  29.970  1.00 134.95 ? 267  ALA A CB    1 
ATOM   1937  N  N     . ASP A 1  268  ? 42.773  23.832  33.014  1.00 135.34 ? 268  ASP A N     1 
ATOM   1938  C  CA    . ASP A 1  268  ? 43.036  24.598  34.229  1.00 135.72 ? 268  ASP A CA    1 
ATOM   1939  C  C     . ASP A 1  268  ? 44.386  24.244  34.838  1.00 135.92 ? 268  ASP A C     1 
ATOM   1940  O  O     . ASP A 1  268  ? 45.056  25.102  35.413  1.00 135.97 ? 268  ASP A O     1 
ATOM   1941  C  CB    . ASP A 1  268  ? 41.913  24.397  35.248  1.00 135.77 ? 268  ASP A CB    1 
ATOM   1942  C  CG    . ASP A 1  268  ? 40.623  25.101  34.846  1.00 136.10 ? 268  ASP A CG    1 
ATOM   1943  O  OD1   . ASP A 1  268  ? 40.609  25.787  33.799  1.00 136.45 ? 268  ASP A OD1   1 
ATOM   1944  O  OD2   . ASP A 1  268  ? 39.618  24.973  35.583  1.00 136.40 ? 268  ASP A OD2   1 
ATOM   1945  N  N     . ILE A 1  269  ? 44.778  22.980  34.697  1.00 136.18 ? 269  ILE A N     1 
ATOM   1946  C  CA    . ILE A 1  269  ? 46.110  22.534  35.078  1.00 136.47 ? 269  ILE A CA    1 
ATOM   1947  C  C     . ILE A 1  269  ? 47.138  23.026  34.076  1.00 136.81 ? 269  ILE A C     1 
ATOM   1948  O  O     . ILE A 1  269  ? 48.106  23.682  34.454  1.00 136.90 ? 269  ILE A O     1 
ATOM   1949  C  CB    . ILE A 1  269  ? 46.181  20.997  35.227  1.00 136.43 ? 269  ILE A CB    1 
ATOM   1950  C  CG1   . ILE A 1  269  ? 45.777  20.601  36.644  1.00 136.56 ? 269  ILE A CG1   1 
ATOM   1951  C  CG2   . ILE A 1  269  ? 47.583  20.458  34.933  1.00 136.14 ? 269  ILE A CG2   1 
ATOM   1952  C  CD1   . ILE A 1  269  ? 45.215  19.211  36.748  1.00 137.21 ? 269  ILE A CD1   1 
ATOM   1953  N  N     . LEU A 1  270  ? 46.918  22.735  32.800  1.00 137.27 ? 270  LEU A N     1 
ATOM   1954  C  CA    . LEU A 1  270  ? 47.941  22.994  31.797  1.00 137.88 ? 270  LEU A CA    1 
ATOM   1955  C  C     . LEU A 1  270  ? 48.256  24.487  31.595  1.00 138.45 ? 270  LEU A C     1 
ATOM   1956  O  O     . LEU A 1  270  ? 49.397  24.843  31.286  1.00 138.51 ? 270  LEU A O     1 
ATOM   1957  C  CB    . LEU A 1  270  ? 47.593  22.303  30.482  1.00 137.73 ? 270  LEU A CB    1 
ATOM   1958  C  CG    . LEU A 1  270  ? 48.799  21.720  29.746  1.00 137.41 ? 270  LEU A CG    1 
ATOM   1959  C  CD1   . LEU A 1  270  ? 48.459  20.365  29.202  1.00 136.94 ? 270  LEU A CD1   1 
ATOM   1960  C  CD2   . LEU A 1  270  ? 49.292  22.642  28.638  1.00 137.41 ? 270  LEU A CD2   1 
ATOM   1961  N  N     . LYS A 1  271  ? 47.254  25.347  31.788  1.00 139.13 ? 271  LYS A N     1 
ATOM   1962  C  CA    . LYS A 1  271  ? 47.451  26.805  31.743  1.00 139.74 ? 271  LYS A CA    1 
ATOM   1963  C  C     . LYS A 1  271  ? 48.291  27.280  32.931  1.00 140.06 ? 271  LYS A C     1 
ATOM   1964  O  O     . LYS A 1  271  ? 49.212  28.083  32.767  1.00 140.08 ? 271  LYS A O     1 
ATOM   1965  C  CB    . LYS A 1  271  ? 46.101  27.544  31.676  1.00 139.77 ? 271  LYS A CB    1 
ATOM   1966  C  CG    . LYS A 1  271  ? 46.160  29.053  31.963  1.00 139.91 ? 271  LYS A CG    1 
ATOM   1967  C  CD    . LYS A 1  271  ? 44.950  29.799  31.394  1.00 139.78 ? 271  LYS A CD    1 
ATOM   1968  C  CE    . LYS A 1  271  ? 45.310  30.617  30.147  1.00 139.79 ? 271  LYS A CE    1 
ATOM   1969  N  NZ    . LYS A 1  271  ? 45.828  29.797  29.012  1.00 139.77 ? 271  LYS A NZ    1 
ATOM   1970  N  N     . ALA A 1  272  ? 47.972  26.765  34.116  1.00 140.49 ? 272  ALA A N     1 
ATOM   1971  C  CA    . ALA A 1  272  ? 48.744  27.047  35.322  1.00 140.93 ? 272  ALA A CA    1 
ATOM   1972  C  C     . ALA A 1  272  ? 50.057  26.260  35.363  1.00 141.21 ? 272  ALA A C     1 
ATOM   1973  O  O     . ALA A 1  272  ? 50.836  26.400  36.306  1.00 141.22 ? 272  ALA A O     1 
ATOM   1974  C  CB    . ALA A 1  272  ? 47.910  26.775  36.566  1.00 140.92 ? 272  ALA A CB    1 
ATOM   1975  N  N     . ASN A 1  273  ? 50.291  25.430  34.346  1.00 141.62 ? 273  ASN A N     1 
ATOM   1976  C  CA    . ASN A 1  273  ? 51.576  24.757  34.173  1.00 142.10 ? 273  ASN A CA    1 
ATOM   1977  C  C     . ASN A 1  273  ? 52.479  25.546  33.228  1.00 142.68 ? 273  ASN A C     1 
ATOM   1978  O  O     . ASN A 1  273  ? 53.663  25.730  33.513  1.00 142.73 ? 273  ASN A O     1 
ATOM   1979  C  CB    . ASN A 1  273  ? 51.396  23.319  33.688  1.00 141.88 ? 273  ASN A CB    1 
ATOM   1980  C  CG    . ASN A 1  273  ? 52.531  22.407  34.131  1.00 141.42 ? 273  ASN A CG    1 
ATOM   1981  O  OD1   . ASN A 1  273  ? 52.583  21.966  35.281  1.00 140.40 ? 273  ASN A OD1   1 
ATOM   1982  N  ND2   . ASN A 1  273  ? 53.436  22.107  33.208  1.00 141.03 ? 273  ASN A ND2   1 
ATOM   1983  N  N     . ILE A 1  274  ? 51.927  26.016  32.108  1.00 143.38 ? 274  ILE A N     1 
ATOM   1984  C  CA    . ILE A 1  274  ? 52.612  27.039  31.316  1.00 144.10 ? 274  ILE A CA    1 
ATOM   1985  C  C     . ILE A 1  274  ? 52.335  28.378  32.007  1.00 144.74 ? 274  ILE A C     1 
ATOM   1986  O  O     . ILE A 1  274  ? 51.642  29.256  31.489  1.00 144.82 ? 274  ILE A O     1 
ATOM   1987  C  CB    . ILE A 1  274  ? 52.234  27.021  29.807  1.00 144.04 ? 274  ILE A CB    1 
ATOM   1988  C  CG1   . ILE A 1  274  ? 52.619  25.676  29.177  1.00 144.09 ? 274  ILE A CG1   1 
ATOM   1989  C  CG2   . ILE A 1  274  ? 52.944  28.155  29.060  1.00 144.18 ? 274  ILE A CG2   1 
ATOM   1990  C  CD1   . ILE A 1  274  ? 52.651  25.666  27.650  1.00 143.94 ? 274  ILE A CD1   1 
ATOM   1991  N  N     . SER A 1  275  ? 52.874  28.475  33.218  1.00 145.57 ? 275  SER A N     1 
ATOM   1992  C  CA    . SER A 1  275  ? 52.758  29.624  34.109  1.00 146.35 ? 275  SER A CA    1 
ATOM   1993  C  C     . SER A 1  275  ? 53.993  29.553  35.000  1.00 146.91 ? 275  SER A C     1 
ATOM   1994  O  O     . SER A 1  275  ? 54.361  30.524  35.663  1.00 146.94 ? 275  SER A O     1 
ATOM   1995  C  CB    . SER A 1  275  ? 51.478  29.525  34.949  1.00 146.29 ? 275  SER A CB    1 
ATOM   1996  O  OG    . SER A 1  275  ? 51.335  30.615  35.843  1.00 146.15 ? 275  SER A OG    1 
ATOM   1997  N  N     . LEU A 1  276  ? 54.622  28.379  34.991  1.00 147.66 ? 276  LEU A N     1 
ATOM   1998  C  CA    . LEU A 1  276  ? 55.878  28.123  35.688  1.00 148.39 ? 276  LEU A CA    1 
ATOM   1999  C  C     . LEU A 1  276  ? 57.002  27.835  34.690  1.00 149.05 ? 276  LEU A C     1 
ATOM   2000  O  O     . LEU A 1  276  ? 58.024  27.244  35.041  1.00 149.07 ? 276  LEU A O     1 
ATOM   2001  C  CB    . LEU A 1  276  ? 55.724  26.950  36.664  1.00 148.35 ? 276  LEU A CB    1 
ATOM   2002  C  CG    . LEU A 1  276  ? 55.195  27.178  38.084  1.00 148.14 ? 276  LEU A CG    1 
ATOM   2003  C  CD1   . LEU A 1  276  ? 53.736  27.602  38.092  1.00 147.77 ? 276  LEU A CD1   1 
ATOM   2004  C  CD2   . LEU A 1  276  ? 55.383  25.906  38.901  1.00 148.20 ? 276  LEU A CD2   1 
ATOM   2005  N  N     . GLU A 1  277  ? 56.794  28.243  33.443  1.00 149.95 ? 277  GLU A N     1 
ATOM   2006  C  CA    . GLU A 1  277  ? 57.839  28.206  32.424  1.00 150.89 ? 277  GLU A CA    1 
ATOM   2007  C  C     . GLU A 1  277  ? 58.136  29.618  31.923  1.00 151.40 ? 277  GLU A C     1 
ATOM   2008  O  O     . GLU A 1  277  ? 59.261  29.917  31.511  1.00 151.41 ? 277  GLU A O     1 
ATOM   2009  C  CB    . GLU A 1  277  ? 57.445  27.296  31.262  1.00 150.94 ? 277  GLU A CB    1 
ATOM   2010  C  CG    . GLU A 1  277  ? 57.610  25.813  31.550  1.00 151.42 ? 277  GLU A CG    1 
ATOM   2011  C  CD    . GLU A 1  277  ? 58.036  25.031  30.320  1.00 152.31 ? 277  GLU A CD    1 
ATOM   2012  O  OE1   . GLU A 1  277  ? 59.221  25.127  29.927  1.00 152.93 ? 277  GLU A OE1   1 
ATOM   2013  O  OE2   . GLU A 1  277  ? 57.189  24.313  29.748  1.00 152.56 ? 277  GLU A OE2   1 
ATOM   2014  N  N     . THR A 1  278  ? 57.108  30.469  31.959  1.00 152.09 ? 278  THR A N     1 
ATOM   2015  C  CA    . THR A 1  278  ? 57.237  31.901  31.688  1.00 152.66 ? 278  THR A CA    1 
ATOM   2016  C  C     . THR A 1  278  ? 57.413  32.657  33.022  1.00 153.11 ? 278  THR A C     1 
ATOM   2017  O  O     . THR A 1  278  ? 56.991  33.809  33.169  1.00 153.17 ? 278  THR A O     1 
ATOM   2018  C  CB    . THR A 1  278  ? 56.030  32.450  30.864  1.00 152.64 ? 278  THR A CB    1 
ATOM   2019  O  OG1   . THR A 1  278  ? 55.575  31.455  29.937  1.00 152.43 ? 278  THR A OG1   1 
ATOM   2020  C  CG2   . THR A 1  278  ? 56.419  33.709  30.086  1.00 152.73 ? 278  THR A CG2   1 
ATOM   2021  N  N     . LEU A 1  279  ? 58.029  31.976  33.990  1.00 153.64 ? 279  LEU A N     1 
ATOM   2022  C  CA    . LEU A 1  279  ? 58.517  32.595  35.223  1.00 154.19 ? 279  LEU A CA    1 
ATOM   2023  C  C     . LEU A 1  279  ? 59.901  32.055  35.597  1.00 154.77 ? 279  LEU A C     1 
ATOM   2024  O  O     . LEU A 1  279  ? 60.707  32.767  36.195  1.00 154.89 ? 279  LEU A O     1 
ATOM   2025  C  CB    . LEU A 1  279  ? 57.528  32.420  36.383  1.00 154.00 ? 279  LEU A CB    1 
ATOM   2026  C  CG    . LEU A 1  279  ? 56.281  33.314  36.448  1.00 153.65 ? 279  LEU A CG    1 
ATOM   2027  C  CD1   . LEU A 1  279  ? 55.473  33.008  37.697  1.00 153.10 ? 279  LEU A CD1   1 
ATOM   2028  C  CD2   . LEU A 1  279  ? 56.627  34.800  36.401  1.00 153.28 ? 279  LEU A CD2   1 
ATOM   2029  N  N     . GLU A 1  280  ? 60.174  30.802  35.233  1.00 155.49 ? 280  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1  280  ? 61.495  30.200  35.451  1.00 156.19 ? 280  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1  280  ? 62.456  30.528  34.304  1.00 156.67 ? 280  GLU A C     1 
ATOM   2032  O  O     . GLU A 1  280  ? 63.555  31.043  34.537  1.00 156.67 ? 280  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1  280  ? 61.386  28.687  35.686  1.00 156.15 ? 280  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1  280  ? 60.867  28.319  37.084  1.00 156.21 ? 280  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1  280  ? 60.583  26.830  37.267  1.00 156.16 ? 280  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1  280  ? 61.015  26.022  36.418  1.00 156.29 ? 280  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1  280  ? 59.927  26.465  38.269  1.00 155.75 ? 280  GLU A OE2   1 
ATOM   2038  N  N     . HIS A 1  281  ? 62.035  30.241  33.073  1.00 157.30 ? 281  HIS A N     1 
ATOM   2039  C  CA    . HIS A 1  281  ? 62.771  30.688  31.890  1.00 157.91 ? 281  HIS A CA    1 
ATOM   2040  C  C     . HIS A 1  281  ? 62.240  32.035  31.364  1.00 158.24 ? 281  HIS A C     1 
ATOM   2041  O  O     . HIS A 1  281  ? 62.141  32.263  30.154  1.00 158.28 ? 281  HIS A O     1 
ATOM   2042  C  CB    . HIS A 1  281  ? 62.806  29.600  30.811  1.00 157.96 ? 281  HIS A CB    1 
ATOM   2043  C  CG    . HIS A 1  281  ? 63.922  28.617  30.993  1.00 158.24 ? 281  HIS A CG    1 
ATOM   2044  N  ND1   . HIS A 1  281  ? 65.137  28.743  30.352  1.00 158.35 ? 281  HIS A ND1   1 
ATOM   2045  C  CD2   . HIS A 1  281  ? 64.014  27.504  31.758  1.00 158.48 ? 281  HIS A CD2   1 
ATOM   2046  C  CE1   . HIS A 1  281  ? 65.926  27.744  30.708  1.00 158.37 ? 281  HIS A CE1   1 
ATOM   2047  N  NE2   . HIS A 1  281  ? 65.268  26.979  31.560  1.00 158.55 ? 281  HIS A NE2   1 
ATOM   2048  N  N     . ASN A 1  282  ? 61.896  32.905  32.317  1.00 158.64 ? 282  ASN A N     1 
ATOM   2049  C  CA    . ASN A 1  282  ? 61.555  34.316  32.102  1.00 158.95 ? 282  ASN A CA    1 
ATOM   2050  C  C     . ASN A 1  282  ? 61.846  35.105  33.385  1.00 159.23 ? 282  ASN A C     1 
ATOM   2051  O  O     . ASN A 1  282  ? 62.333  34.537  34.373  1.00 159.16 ? 282  ASN A O     1 
ATOM   2052  C  CB    . ASN A 1  282  ? 60.086  34.489  31.695  1.00 158.90 ? 282  ASN A CB    1 
ATOM   2053  C  CG    . ASN A 1  282  ? 59.915  34.851  30.229  1.00 158.71 ? 282  ASN A CG    1 
ATOM   2054  O  OD1   . ASN A 1  282  ? 60.130  34.027  29.341  1.00 158.53 ? 282  ASN A OD1   1 
ATOM   2055  N  ND2   . ASN A 1  282  ? 59.497  36.086  29.974  1.00 158.45 ? 282  ASN A ND2   1 
ATOM   2056  N  N     . GLY A 1  283  ? 61.545  36.404  33.370  1.00 159.55 ? 283  GLY A N     1 
ATOM   2057  C  CA    . GLY A 1  283  ? 61.785  37.277  34.520  1.00 159.92 ? 283  GLY A CA    1 
ATOM   2058  C  C     . GLY A 1  283  ? 61.198  36.732  35.808  1.00 160.17 ? 283  GLY A C     1 
ATOM   2059  O  O     . GLY A 1  283  ? 59.992  36.826  36.031  1.00 160.20 ? 283  GLY A O     1 
ATOM   2060  N  N     . ALA A 1  284  ? 62.062  36.160  36.647  1.00 160.40 ? 284  ALA A N     1 
ATOM   2061  C  CA    . ALA A 1  284  ? 61.655  35.525  37.904  1.00 160.70 ? 284  ALA A CA    1 
ATOM   2062  C  C     . ALA A 1  284  ? 61.562  36.521  39.071  1.00 160.96 ? 284  ALA A C     1 
ATOM   2063  O  O     . ALA A 1  284  ? 62.590  37.013  39.543  1.00 160.98 ? 284  ALA A O     1 
ATOM   2064  C  CB    . ALA A 1  284  ? 62.609  34.379  38.247  1.00 160.60 ? 284  ALA A CB    1 
ATOM   2065  N  N     . PRO A 1  285  ? 60.326  36.838  39.524  1.00 161.22 ? 285  PRO A N     1 
ATOM   2066  C  CA    . PRO A 1  285  ? 60.056  37.779  40.616  1.00 161.41 ? 285  PRO A CA    1 
ATOM   2067  C  C     . PRO A 1  285  ? 59.830  37.186  42.033  1.00 161.55 ? 285  PRO A C     1 
ATOM   2068  O  O     . PRO A 1  285  ? 58.830  37.506  42.687  1.00 161.53 ? 285  PRO A O     1 
ATOM   2069  C  CB    . PRO A 1  285  ? 58.789  38.506  40.125  1.00 161.41 ? 285  PRO A CB    1 
ATOM   2070  C  CG    . PRO A 1  285  ? 58.194  37.601  39.027  1.00 161.29 ? 285  PRO A CG    1 
ATOM   2071  C  CD    . PRO A 1  285  ? 59.059  36.369  38.943  1.00 161.26 ? 285  PRO A CD    1 
ATOM   2072  N  N     . HIS A 1  286  ? 60.760  36.341  42.486  1.00 161.71 ? 286  HIS A N     1 
ATOM   2073  C  CA    . HIS A 1  286  ? 60.881  35.892  43.899  1.00 161.82 ? 286  HIS A CA    1 
ATOM   2074  C  C     . HIS A 1  286  ? 59.639  35.291  44.599  1.00 161.65 ? 286  HIS A C     1 
ATOM   2075  O  O     . HIS A 1  286  ? 59.439  34.072  44.570  1.00 161.60 ? 286  HIS A O     1 
ATOM   2076  C  CB    . HIS A 1  286  ? 61.508  36.997  44.788  1.00 161.99 ? 286  HIS A CB    1 
ATOM   2077  C  CG    . HIS A 1  286  ? 63.012  36.991  44.823  1.00 162.51 ? 286  HIS A CG    1 
ATOM   2078  N  ND1   . HIS A 1  286  ? 63.748  35.930  45.310  1.00 162.87 ? 286  HIS A ND1   1 
ATOM   2079  C  CD2   . HIS A 1  286  ? 63.914  37.938  44.467  1.00 162.84 ? 286  HIS A CD2   1 
ATOM   2080  C  CE1   . HIS A 1  286  ? 65.037  36.213  45.229  1.00 162.91 ? 286  HIS A CE1   1 
ATOM   2081  N  NE2   . HIS A 1  286  ? 65.165  37.427  44.723  1.00 163.04 ? 286  HIS A NE2   1 
ATOM   2082  N  N     . HIS A 1  287  ? 58.833  36.148  45.233  1.00 161.46 ? 287  HIS A N     1 
ATOM   2083  C  CA    . HIS A 1  287  ? 57.792  35.726  46.189  1.00 161.24 ? 287  HIS A CA    1 
ATOM   2084  C  C     . HIS A 1  287  ? 56.388  35.639  45.561  1.00 160.86 ? 287  HIS A C     1 
ATOM   2085  O  O     . HIS A 1  287  ? 55.377  35.635  46.270  1.00 160.79 ? 287  HIS A O     1 
ATOM   2086  C  CB    . HIS A 1  287  ? 57.790  36.681  47.401  1.00 161.42 ? 287  HIS A CB    1 
ATOM   2087  C  CG    . HIS A 1  287  ? 57.783  35.997  48.742  1.00 161.82 ? 287  HIS A CG    1 
ATOM   2088  N  ND1   . HIS A 1  287  ? 58.477  34.832  48.997  1.00 162.15 ? 287  HIS A ND1   1 
ATOM   2089  C  CD2   . HIS A 1  287  ? 57.207  36.352  49.917  1.00 162.03 ? 287  HIS A CD2   1 
ATOM   2090  C  CE1   . HIS A 1  287  ? 58.305  34.484  50.261  1.00 162.05 ? 287  HIS A CE1   1 
ATOM   2091  N  NE2   . HIS A 1  287  ? 57.540  35.391  50.842  1.00 161.96 ? 287  HIS A NE2   1 
ATOM   2092  N  N     . ALA A 1  288  ? 56.338  35.565  44.232  1.00 160.39 ? 288  ALA A N     1 
ATOM   2093  C  CA    . ALA A 1  288  ? 55.081  35.400  43.497  1.00 159.86 ? 288  ALA A CA    1 
ATOM   2094  C  C     . ALA A 1  288  ? 55.088  34.167  42.577  1.00 159.51 ? 288  ALA A C     1 
ATOM   2095  O  O     . ALA A 1  288  ? 54.105  33.902  41.882  1.00 159.50 ? 288  ALA A O     1 
ATOM   2096  C  CB    . ALA A 1  288  ? 54.750  36.665  42.713  1.00 159.85 ? 288  ALA A CB    1 
ATOM   2097  N  N     . ILE A 1  289  ? 56.197  33.424  42.571  1.00 159.03 ? 289  ILE A N     1 
ATOM   2098  C  CA    . ILE A 1  289  ? 56.280  32.130  41.882  1.00 158.50 ? 289  ILE A CA    1 
ATOM   2099  C  C     . ILE A 1  289  ? 55.500  31.107  42.703  1.00 158.02 ? 289  ILE A C     1 
ATOM   2100  O  O     . ILE A 1  289  ? 54.742  30.300  42.161  1.00 157.97 ? 289  ILE A O     1 
ATOM   2101  C  CB    . ILE A 1  289  ? 57.748  31.617  41.739  1.00 158.55 ? 289  ILE A CB    1 
ATOM   2102  C  CG1   . ILE A 1  289  ? 58.702  32.733  41.287  1.00 158.71 ? 289  ILE A CG1   1 
ATOM   2103  C  CG2   . ILE A 1  289  ? 57.817  30.425  40.781  1.00 158.44 ? 289  ILE A CG2   1 
ATOM   2104  C  CD1   . ILE A 1  289  ? 60.173  32.493  41.658  1.00 158.60 ? 289  ILE A CD1   1 
ATOM   2105  N  N     . GLU A 1  290  ? 55.696  31.175  44.020  1.00 157.42 ? 290  GLU A N     1 
ATOM   2106  C  CA    . GLU A 1  290  ? 55.071  30.285  45.003  1.00 156.82 ? 290  GLU A CA    1 
ATOM   2107  C  C     . GLU A 1  290  ? 53.537  30.303  44.962  1.00 156.20 ? 290  GLU A C     1 
ATOM   2108  O  O     . GLU A 1  290  ? 52.899  29.323  45.359  1.00 156.27 ? 290  GLU A O     1 
ATOM   2109  C  CB    . GLU A 1  290  ? 55.570  30.630  46.414  1.00 156.94 ? 290  GLU A CB    1 
ATOM   2110  C  CG    . GLU A 1  290  ? 57.095  30.525  46.584  1.00 157.44 ? 290  GLU A CG    1 
ATOM   2111  C  CD    . GLU A 1  290  ? 57.676  31.538  47.575  1.00 157.95 ? 290  GLU A CD    1 
ATOM   2112  O  OE1   . GLU A 1  290  ? 58.627  32.261  47.195  1.00 157.64 ? 290  GLU A OE1   1 
ATOM   2113  O  OE2   . GLU A 1  290  ? 57.189  31.614  48.726  1.00 158.32 ? 290  GLU A OE2   1 
ATOM   2114  N  N     . GLU A 1  291  ? 52.960  31.415  44.491  1.00 155.25 ? 291  GLU A N     1 
ATOM   2115  C  CA    . GLU A 1  291  ? 51.510  31.530  44.256  1.00 154.21 ? 291  GLU A CA    1 
ATOM   2116  C  C     . GLU A 1  291  ? 51.016  30.503  43.245  1.00 153.36 ? 291  GLU A C     1 
ATOM   2117  O  O     . GLU A 1  291  ? 50.016  29.817  43.483  1.00 153.37 ? 291  GLU A O     1 
ATOM   2118  C  CB    . GLU A 1  291  ? 51.130  32.928  43.753  1.00 154.30 ? 291  GLU A CB    1 
ATOM   2119  C  CG    . GLU A 1  291  ? 50.292  33.757  44.721  1.00 154.34 ? 291  GLU A CG    1 
ATOM   2120  C  CD    . GLU A 1  291  ? 49.303  34.671  44.005  1.00 154.08 ? 291  GLU A CD    1 
ATOM   2121  O  OE1   . GLU A 1  291  ? 48.480  34.149  43.222  1.00 153.65 ? 291  GLU A OE1   1 
ATOM   2122  O  OE2   . GLU A 1  291  ? 49.341  35.902  44.236  1.00 154.02 ? 291  GLU A OE2   1 
ATOM   2123  N  N     . ALA A 1  292  ? 51.721  30.413  42.118  1.00 152.09 ? 292  ALA A N     1 
ATOM   2124  C  CA    . ALA A 1  292  ? 51.369  29.490  41.043  1.00 150.74 ? 292  ALA A CA    1 
ATOM   2125  C  C     . ALA A 1  292  ? 51.665  28.040  41.418  1.00 149.71 ? 292  ALA A C     1 
ATOM   2126  O  O     . ALA A 1  292  ? 50.934  27.134  41.019  1.00 149.68 ? 292  ALA A O     1 
ATOM   2127  C  CB    . ALA A 1  292  ? 52.080  29.877  39.758  1.00 150.74 ? 292  ALA A CB    1 
ATOM   2128  N  N     . GLU A 1  293  ? 52.722  27.829  42.199  1.00 148.31 ? 293  GLU A N     1 
ATOM   2129  C  CA    . GLU A 1  293  ? 53.096  26.491  42.661  1.00 146.99 ? 293  GLU A CA    1 
ATOM   2130  C  C     . GLU A 1  293  ? 52.024  25.875  43.552  1.00 145.73 ? 293  GLU A C     1 
ATOM   2131  O  O     . GLU A 1  293  ? 51.966  24.656  43.711  1.00 145.59 ? 293  GLU A O     1 
ATOM   2132  C  CB    . GLU A 1  293  ? 54.442  26.520  43.394  1.00 147.18 ? 293  GLU A CB    1 
ATOM   2133  C  CG    . GLU A 1  293  ? 55.646  26.788  42.482  1.00 147.46 ? 293  GLU A CG    1 
ATOM   2134  C  CD    . GLU A 1  293  ? 56.980  26.348  43.082  1.00 147.37 ? 293  GLU A CD    1 
ATOM   2135  O  OE1   . GLU A 1  293  ? 57.072  25.204  43.586  1.00 147.57 ? 293  GLU A OE1   1 
ATOM   2136  O  OE2   . GLU A 1  293  ? 57.942  27.148  43.030  1.00 147.53 ? 293  GLU A OE2   1 
ATOM   2137  N  N     . SER A 1  294  ? 51.181  26.731  44.122  1.00 144.18 ? 294  SER A N     1 
ATOM   2138  C  CA    . SER A 1  294  ? 50.069  26.302  44.966  1.00 142.69 ? 294  SER A CA    1 
ATOM   2139  C  C     . SER A 1  294  ? 48.711  26.376  44.252  1.00 141.57 ? 294  SER A C     1 
ATOM   2140  O  O     . SER A 1  294  ? 47.710  25.864  44.763  1.00 141.49 ? 294  SER A O     1 
ATOM   2141  C  CB    . SER A 1  294  ? 50.045  27.109  46.264  1.00 142.76 ? 294  SER A CB    1 
ATOM   2142  O  OG    . SER A 1  294  ? 50.420  28.452  46.033  1.00 142.63 ? 294  SER A OG    1 
ATOM   2143  N  N     . LEU A 1  295  ? 48.682  27.023  43.086  1.00 139.96 ? 295  LEU A N     1 
ATOM   2144  C  CA    . LEU A 1  295  ? 47.521  26.969  42.189  1.00 138.27 ? 295  LEU A CA    1 
ATOM   2145  C  C     . LEU A 1  295  ? 47.873  26.271  40.876  1.00 136.99 ? 295  LEU A C     1 
ATOM   2146  O  O     . LEU A 1  295  ? 47.374  26.626  39.810  1.00 136.76 ? 295  LEU A O     1 
ATOM   2147  C  CB    . LEU A 1  295  ? 46.902  28.354  41.950  1.00 138.39 ? 295  LEU A CB    1 
ATOM   2148  C  CG    . LEU A 1  295  ? 45.633  28.678  42.753  1.00 138.33 ? 295  LEU A CG    1 
ATOM   2149  C  CD1   . LEU A 1  295  ? 45.958  29.129  44.179  1.00 138.42 ? 295  LEU A CD1   1 
ATOM   2150  C  CD2   . LEU A 1  295  ? 44.785  29.729  42.042  1.00 138.19 ? 295  LEU A CD2   1 
ATOM   2151  N  N     . LEU A 1  296  ? 48.779  25.304  40.980  1.00 135.39 ? 296  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  296  ? 48.969  24.272  39.976  1.00 133.86 ? 296  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  296  ? 48.815  22.970  40.729  1.00 132.90 ? 296  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  296  ? 48.262  21.999  40.221  1.00 132.73 ? 296  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  296  ? 50.359  24.340  39.355  1.00 133.87 ? 296  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  296  ? 50.756  23.124  38.513  1.00 133.45 ? 296  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  296  ? 50.114  23.199  37.155  1.00 133.25 ? 296  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  296  ? 52.258  23.004  38.379  1.00 133.60 ? 296  LEU A CD2   1 
ATOM   2159  N  N     . GLN A 1  297  ? 49.325  22.974  41.955  1.00 131.71 ? 297  GLN A N     1 
ATOM   2160  C  CA    . GLN A 1  297  ? 49.088  21.909  42.908  1.00 130.59 ? 297  GLN A CA    1 
ATOM   2161  C  C     . GLN A 1  297  ? 47.592  21.773  43.189  1.00 129.77 ? 297  GLN A C     1 
ATOM   2162  O  O     . GLN A 1  297  ? 47.099  20.662  43.354  1.00 129.75 ? 297  GLN A O     1 
ATOM   2163  C  CB    . GLN A 1  297  ? 49.881  22.182  44.194  1.00 130.68 ? 297  GLN A CB    1 
ATOM   2164  C  CG    . GLN A 1  297  ? 49.210  21.775  45.508  1.00 130.79 ? 297  GLN A CG    1 
ATOM   2165  C  CD    . GLN A 1  297  ? 49.238  20.279  45.778  1.00 130.99 ? 297  GLN A CD    1 
ATOM   2166  O  OE1   . GLN A 1  297  ? 48.735  19.822  46.806  1.00 130.99 ? 297  GLN A OE1   1 
ATOM   2167  N  NE2   . GLN A 1  297  ? 49.827  19.511  44.862  1.00 130.77 ? 297  GLN A NE2   1 
ATOM   2168  N  N     . PHE A 1  298  ? 46.881  22.904  43.209  1.00 128.62 ? 298  PHE A N     1 
ATOM   2169  C  CA    . PHE A 1  298  ? 45.444  22.946  43.539  1.00 127.34 ? 298  PHE A CA    1 
ATOM   2170  C  C     . PHE A 1  298  ? 44.498  22.414  42.456  1.00 126.36 ? 298  PHE A C     1 
ATOM   2171  O  O     . PHE A 1  298  ? 43.391  21.970  42.763  1.00 126.21 ? 298  PHE A O     1 
ATOM   2172  C  CB    . PHE A 1  298  ? 45.019  24.366  43.935  1.00 127.40 ? 298  PHE A CB    1 
ATOM   2173  C  CG    . PHE A 1  298  ? 43.559  24.489  44.304  1.00 127.35 ? 298  PHE A CG    1 
ATOM   2174  C  CD1   . PHE A 1  298  ? 43.109  24.106  45.568  1.00 127.26 ? 298  PHE A CD1   1 
ATOM   2175  C  CD2   . PHE A 1  298  ? 42.636  24.994  43.390  1.00 127.08 ? 298  PHE A CD2   1 
ATOM   2176  C  CE1   . PHE A 1  298  ? 41.765  24.223  45.914  1.00 126.88 ? 298  PHE A CE1   1 
ATOM   2177  C  CE2   . PHE A 1  298  ? 41.291  25.114  43.728  1.00 126.68 ? 298  PHE A CE2   1 
ATOM   2178  C  CZ    . PHE A 1  298  ? 40.856  24.728  44.992  1.00 126.80 ? 298  PHE A CZ    1 
ATOM   2179  N  N     . HIS A 1  299  ? 44.907  22.475  41.196  1.00 125.10 ? 299  HIS A N     1 
ATOM   2180  C  CA    . HIS A 1  299  ? 44.067  21.922  40.148  1.00 123.86 ? 299  HIS A CA    1 
ATOM   2181  C  C     . HIS A 1  299  ? 44.273  20.429  39.984  1.00 123.08 ? 299  HIS A C     1 
ATOM   2182  O  O     . HIS A 1  299  ? 43.319  19.715  39.695  1.00 123.08 ? 299  HIS A O     1 
ATOM   2183  C  CB    . HIS A 1  299  ? 44.235  22.673  38.839  1.00 123.78 ? 299  HIS A CB    1 
ATOM   2184  C  CG    . HIS A 1  299  ? 43.704  24.067  38.888  1.00 123.69 ? 299  HIS A CG    1 
ATOM   2185  N  ND1   . HIS A 1  299  ? 44.067  25.038  37.980  1.00 123.75 ? 299  HIS A ND1   1 
ATOM   2186  C  CD2   . HIS A 1  299  ? 42.852  24.662  39.755  1.00 123.59 ? 299  HIS A CD2   1 
ATOM   2187  C  CE1   . HIS A 1  299  ? 43.449  26.167  38.275  1.00 123.74 ? 299  HIS A CE1   1 
ATOM   2188  N  NE2   . HIS A 1  299  ? 42.705  25.966  39.348  1.00 123.91 ? 299  HIS A NE2   1 
ATOM   2189  N  N     . VAL A 1  300  ? 45.505  19.963  40.190  1.00 122.01 ? 300  VAL A N     1 
ATOM   2190  C  CA    . VAL A 1  300  ? 45.792  18.524  40.255  1.00 120.94 ? 300  VAL A CA    1 
ATOM   2191  C  C     . VAL A 1  300  ? 45.126  17.948  41.495  1.00 120.31 ? 300  VAL A C     1 
ATOM   2192  O  O     . VAL A 1  300  ? 44.665  16.808  41.505  1.00 120.10 ? 300  VAL A O     1 
ATOM   2193  C  CB    . VAL A 1  300  ? 47.313  18.222  40.296  1.00 120.93 ? 300  VAL A CB    1 
ATOM   2194  C  CG1   . VAL A 1  300  ? 47.573  16.715  40.316  1.00 120.30 ? 300  VAL A CG1   1 
ATOM   2195  C  CG2   . VAL A 1  300  ? 48.019  18.854  39.108  1.00 120.97 ? 300  VAL A CG2   1 
ATOM   2196  N  N     . ALA A 1  301  ? 45.064  18.764  42.536  1.00 119.63 ? 301  ALA A N     1 
ATOM   2197  C  CA    . ALA A 1  301  ? 44.490  18.348  43.799  1.00 119.12 ? 301  ALA A CA    1 
ATOM   2198  C  C     . ALA A 1  301  ? 42.964  18.338  43.785  1.00 118.75 ? 301  ALA A C     1 
ATOM   2199  O  O     . ALA A 1  301  ? 42.342  17.938  44.774  1.00 118.67 ? 301  ALA A O     1 
ATOM   2200  C  CB    . ALA A 1  301  ? 45.002  19.232  44.917  1.00 119.24 ? 301  ALA A CB    1 
ATOM   2201  N  N     . THR A 1  302  ? 42.363  18.789  42.682  1.00 118.24 ? 302  THR A N     1 
ATOM   2202  C  CA    . THR A 1  302  ? 40.904  18.751  42.538  1.00 117.71 ? 302  THR A CA    1 
ATOM   2203  C  C     . THR A 1  302  ? 40.442  17.813  41.423  1.00 117.36 ? 302  THR A C     1 
ATOM   2204  O  O     . THR A 1  302  ? 39.583  16.964  41.650  1.00 117.29 ? 302  THR A O     1 
ATOM   2205  C  CB    . THR A 1  302  ? 40.285  20.149  42.403  1.00 117.66 ? 302  THR A CB    1 
ATOM   2206  O  OG1   . THR A 1  302  ? 40.255  20.759  43.696  1.00 118.04 ? 302  THR A OG1   1 
ATOM   2207  C  CG2   . THR A 1  302  ? 38.862  20.058  41.904  1.00 117.54 ? 302  THR A CG2   1 
ATOM   2208  N  N     . TYR A 1  303  ? 41.022  17.963  40.234  1.00 116.88 ? 303  TYR A N     1 
ATOM   2209  C  CA    . TYR A 1  303  ? 40.791  17.043  39.116  1.00 116.31 ? 303  TYR A CA    1 
ATOM   2210  C  C     . TYR A 1  303  ? 40.786  15.600  39.581  1.00 116.44 ? 303  TYR A C     1 
ATOM   2211  O  O     . TYR A 1  303  ? 40.073  14.767  39.036  1.00 116.53 ? 303  TYR A O     1 
ATOM   2212  C  CB    . TYR A 1  303  ? 41.863  17.269  38.050  1.00 115.86 ? 303  TYR A CB    1 
ATOM   2213  C  CG    . TYR A 1  303  ? 42.296  16.061  37.255  1.00 114.80 ? 303  TYR A CG    1 
ATOM   2214  C  CD1   . TYR A 1  303  ? 41.761  15.808  36.006  1.00 114.12 ? 303  TYR A CD1   1 
ATOM   2215  C  CD2   . TYR A 1  303  ? 43.273  15.202  37.735  1.00 113.77 ? 303  TYR A CD2   1 
ATOM   2216  C  CE1   . TYR A 1  303  ? 42.163  14.723  35.268  1.00 113.72 ? 303  TYR A CE1   1 
ATOM   2217  C  CE2   . TYR A 1  303  ? 43.682  14.114  37.002  1.00 113.79 ? 303  TYR A CE2   1 
ATOM   2218  C  CZ    . TYR A 1  303  ? 43.123  13.883  35.765  1.00 114.22 ? 303  TYR A CZ    1 
ATOM   2219  O  OH    . TYR A 1  303  ? 43.520  12.803  35.017  1.00 114.84 ? 303  TYR A OH    1 
ATOM   2220  N  N     . MET A 1  304  ? 41.590  15.332  40.603  1.00 116.63 ? 304  MET A N     1 
ATOM   2221  C  CA    . MET A 1  304  ? 41.727  14.015  41.192  1.00 116.87 ? 304  MET A CA    1 
ATOM   2222  C  C     . MET A 1  304  ? 40.598  13.749  42.188  1.00 117.17 ? 304  MET A C     1 
ATOM   2223  O  O     . MET A 1  304  ? 40.080  12.639  42.262  1.00 117.03 ? 304  MET A O     1 
ATOM   2224  C  CB    . MET A 1  304  ? 43.086  13.923  41.893  1.00 116.68 ? 304  MET A CB    1 
ATOM   2225  C  CG    . MET A 1  304  ? 43.677  12.528  42.007  1.00 116.33 ? 304  MET A CG    1 
ATOM   2226  S  SD    . MET A 1  304  ? 44.636  12.007  40.568  1.00 115.90 ? 304  MET A SD    1 
ATOM   2227  C  CE    . MET A 1  304  ? 46.011  13.149  40.615  1.00 116.03 ? 304  MET A CE    1 
ATOM   2228  N  N     . ASP A 1  305  ? 40.216  14.784  42.932  1.00 117.86 ? 305  ASP A N     1 
ATOM   2229  C  CA    . ASP A 1  305  ? 39.329  14.662  44.091  1.00 118.67 ? 305  ASP A CA    1 
ATOM   2230  C  C     . ASP A 1  305  ? 38.997  16.058  44.622  1.00 119.25 ? 305  ASP A C     1 
ATOM   2231  O  O     . ASP A 1  305  ? 39.831  16.957  44.567  1.00 119.23 ? 305  ASP A O     1 
ATOM   2232  C  CB    . ASP A 1  305  ? 40.031  13.840  45.187  1.00 118.68 ? 305  ASP A CB    1 
ATOM   2233  C  CG    . ASP A 1  305  ? 39.149  13.566  46.405  1.00 118.77 ? 305  ASP A CG    1 
ATOM   2234  O  OD1   . ASP A 1  305  ? 37.926  13.802  46.346  1.00 119.22 ? 305  ASP A OD1   1 
ATOM   2235  O  OD2   . ASP A 1  305  ? 39.690  13.100  47.431  1.00 118.81 ? 305  ASP A OD2   1 
ATOM   2236  N  N     . ASN A 1  306  ? 37.782  16.244  45.130  1.00 120.13 ? 306  ASN A N     1 
ATOM   2237  C  CA    . ASN A 1  306  ? 37.482  17.459  45.886  1.00 121.06 ? 306  ASN A CA    1 
ATOM   2238  C  C     . ASN A 1  306  ? 36.309  17.367  46.865  1.00 121.95 ? 306  ASN A C     1 
ATOM   2239  O  O     . ASN A 1  306  ? 35.146  17.318  46.464  1.00 121.84 ? 306  ASN A O     1 
ATOM   2240  C  CB    . ASN A 1  306  ? 37.364  18.687  44.967  1.00 120.77 ? 306  ASN A CB    1 
ATOM   2241  C  CG    . ASN A 1  306  ? 36.033  18.774  44.272  1.00 120.18 ? 306  ASN A CG    1 
ATOM   2242  O  OD1   . ASN A 1  306  ? 35.419  19.837  44.228  1.00 119.34 ? 306  ASN A OD1   1 
ATOM   2243  N  ND2   . ASN A 1  306  ? 35.566  17.653  43.737  1.00 119.94 ? 306  ASN A ND2   1 
ATOM   2244  N  N     . ASP A 1  307  ? 36.649  17.312  48.152  1.00 123.31 ? 307  ASP A N     1 
ATOM   2245  C  CA    . ASP A 1  307  ? 35.688  17.505  49.243  1.00 124.74 ? 307  ASP A CA    1 
ATOM   2246  C  C     . ASP A 1  307  ? 36.376  17.839  50.587  1.00 125.61 ? 307  ASP A C     1 
ATOM   2247  O  O     . ASP A 1  307  ? 35.713  17.958  51.630  1.00 125.73 ? 307  ASP A O     1 
ATOM   2248  C  CB    . ASP A 1  307  ? 34.738  16.307  49.375  1.00 124.78 ? 307  ASP A CB    1 
ATOM   2249  C  CG    . ASP A 1  307  ? 33.304  16.734  49.653  1.00 125.02 ? 307  ASP A CG    1 
ATOM   2250  O  OD1   . ASP A 1  307  ? 33.031  17.227  50.769  1.00 125.19 ? 307  ASP A OD1   1 
ATOM   2251  O  OD2   . ASP A 1  307  ? 32.453  16.581  48.752  1.00 125.20 ? 307  ASP A OD2   1 
ATOM   2252  N  N     . ILE A 1  308  ? 37.701  18.003  50.542  1.00 126.57 ? 308  ILE A N     1 
ATOM   2253  C  CA    . ILE A 1  308  ? 38.503  18.434  51.693  1.00 127.44 ? 308  ILE A CA    1 
ATOM   2254  C  C     . ILE A 1  308  ? 38.086  19.845  52.124  1.00 128.29 ? 308  ILE A C     1 
ATOM   2255  O  O     . ILE A 1  308  ? 38.233  20.793  51.339  1.00 128.55 ? 308  ILE A O     1 
ATOM   2256  C  CB    . ILE A 1  308  ? 40.021  18.482  51.352  1.00 127.29 ? 308  ILE A CB    1 
ATOM   2257  C  CG1   . ILE A 1  308  ? 40.337  17.777  50.021  1.00 126.83 ? 308  ILE A CG1   1 
ATOM   2258  C  CG2   . ILE A 1  308  ? 40.851  17.949  52.516  1.00 127.37 ? 308  ILE A CG2   1 
ATOM   2259  C  CD1   . ILE A 1  308  ? 40.295  18.688  48.795  1.00 125.69 ? 308  ILE A CD1   1 
ATOM   2260  N  N     . ALA A 1  309  ? 37.580  19.983  53.356  1.00 129.08 ? 309  ALA A N     1 
ATOM   2261  C  CA    . ALA A 1  309  ? 37.083  21.275  53.873  1.00 129.84 ? 309  ALA A CA    1 
ATOM   2262  C  C     . ALA A 1  309  ? 37.967  22.489  53.519  1.00 130.46 ? 309  ALA A C     1 
ATOM   2263  O  O     . ALA A 1  309  ? 39.191  22.462  53.681  1.00 130.58 ? 309  ALA A O     1 
ATOM   2264  C  CB    . ALA A 1  309  ? 36.844  21.197  55.375  1.00 129.72 ? 309  ALA A CB    1 
ATOM   2265  N  N     . GLY A 1  310  ? 37.326  23.544  53.025  1.00 131.12 ? 310  GLY A N     1 
ATOM   2266  C  CA    . GLY A 1  310  ? 38.028  24.720  52.529  1.00 132.01 ? 310  GLY A CA    1 
ATOM   2267  C  C     . GLY A 1  310  ? 37.263  25.339  51.378  1.00 132.71 ? 310  GLY A C     1 
ATOM   2268  O  O     . GLY A 1  310  ? 36.357  26.144  51.591  1.00 132.69 ? 310  GLY A O     1 
ATOM   2269  N  N     . GLN A 1  311  ? 37.619  24.952  50.155  1.00 133.47 ? 311  GLN A N     1 
ATOM   2270  C  CA    . GLN A 1  311  ? 37.009  25.522  48.947  1.00 134.34 ? 311  GLN A CA    1 
ATOM   2271  C  C     . GLN A 1  311  ? 36.765  24.466  47.855  1.00 134.60 ? 311  GLN A C     1 
ATOM   2272  O  O     . GLN A 1  311  ? 37.688  23.730  47.503  1.00 134.70 ? 311  GLN A O     1 
ATOM   2273  C  CB    . GLN A 1  311  ? 37.889  26.654  48.385  1.00 134.41 ? 311  GLN A CB    1 
ATOM   2274  C  CG    . GLN A 1  311  ? 37.889  27.963  49.208  1.00 134.95 ? 311  GLN A CG    1 
ATOM   2275  C  CD    . GLN A 1  311  ? 38.652  29.121  48.541  1.00 134.79 ? 311  GLN A CD    1 
ATOM   2276  O  OE1   . GLN A 1  311  ? 38.885  29.126  47.328  1.00 135.44 ? 311  GLN A OE1   1 
ATOM   2277  N  NE2   . GLN A 1  311  ? 39.030  30.112  49.345  1.00 134.66 ? 311  GLN A NE2   1 
ATOM   2278  N  N     . PRO A 1  312  ? 35.518  24.378  47.329  1.00 134.88 ? 312  PRO A N     1 
ATOM   2279  C  CA    . PRO A 1  312  ? 35.170  23.520  46.174  1.00 135.01 ? 312  PRO A CA    1 
ATOM   2280  C  C     . PRO A 1  312  ? 35.753  23.996  44.820  1.00 135.13 ? 312  PRO A C     1 
ATOM   2281  O  O     . PRO A 1  312  ? 36.969  23.940  44.643  1.00 135.01 ? 312  PRO A O     1 
ATOM   2282  C  CB    . PRO A 1  312  ? 33.629  23.528  46.177  1.00 135.02 ? 312  PRO A CB    1 
ATOM   2283  C  CG    . PRO A 1  312  ? 33.232  24.090  47.522  1.00 134.92 ? 312  PRO A CG    1 
ATOM   2284  C  CD    . PRO A 1  312  ? 34.324  25.056  47.863  1.00 134.86 ? 312  PRO A CD    1 
ATOM   2285  N  N     . GLN A 1  313  ? 34.902  24.423  43.878  1.00 135.39 ? 313  GLN A N     1 
ATOM   2286  C  CA    . GLN A 1  313  ? 35.351  25.027  42.600  1.00 135.70 ? 313  GLN A CA    1 
ATOM   2287  C  C     . GLN A 1  313  ? 34.230  25.696  41.765  1.00 135.86 ? 313  GLN A C     1 
ATOM   2288  O  O     . GLN A 1  313  ? 33.218  26.115  42.324  1.00 135.80 ? 313  GLN A O     1 
ATOM   2289  C  CB    . GLN A 1  313  ? 36.164  24.038  41.764  1.00 135.69 ? 313  GLN A CB    1 
ATOM   2290  C  CG    . GLN A 1  313  ? 37.151  24.701  40.809  1.00 136.03 ? 313  GLN A CG    1 
ATOM   2291  C  CD    . GLN A 1  313  ? 38.128  23.718  40.199  1.00 136.51 ? 313  GLN A CD    1 
ATOM   2292  O  OE1   . GLN A 1  313  ? 38.334  23.704  38.985  1.00 136.77 ? 313  GLN A OE1   1 
ATOM   2293  N  NE2   . GLN A 1  313  ? 38.735  22.886  41.037  1.00 136.62 ? 313  GLN A NE2   1 
ATOM   2294  N  N     . ALA A 1  314  ? 34.408  25.788  40.442  1.00 136.21 ? 314  ALA A N     1 
ATOM   2295  C  CA    . ALA A 1  314  ? 33.562  26.660  39.607  1.00 136.67 ? 314  ALA A CA    1 
ATOM   2296  C  C     . ALA A 1  314  ? 33.239  26.188  38.169  1.00 136.99 ? 314  ALA A C     1 
ATOM   2297  O  O     . ALA A 1  314  ? 32.848  25.035  37.966  1.00 137.03 ? 314  ALA A O     1 
ATOM   2298  C  CB    . ALA A 1  314  ? 34.137  28.084  39.594  1.00 136.75 ? 314  ALA A CB    1 
ATOM   2299  N  N     . LEU A 1  315  ? 33.414  27.098  37.196  1.00 137.38 ? 315  LEU A N     1 
ATOM   2300  C  CA    . LEU A 1  315  ? 32.869  26.994  35.813  1.00 137.73 ? 315  LEU A CA    1 
ATOM   2301  C  C     . LEU A 1  315  ? 33.423  25.822  34.907  1.00 138.03 ? 315  LEU A C     1 
ATOM   2302  O  O     . LEU A 1  315  ? 33.002  24.678  35.124  1.00 138.09 ? 315  LEU A O     1 
ATOM   2303  C  CB    . LEU A 1  315  ? 32.843  28.376  35.109  1.00 137.67 ? 315  LEU A CB    1 
ATOM   2304  C  CG    . LEU A 1  315  ? 32.313  29.716  35.679  1.00 137.53 ? 315  LEU A CG    1 
ATOM   2305  C  CD1   . LEU A 1  315  ? 30.890  29.650  36.232  1.00 137.20 ? 315  LEU A CD1   1 
ATOM   2306  C  CD2   . LEU A 1  315  ? 33.261  30.360  36.704  1.00 137.45 ? 315  LEU A CD2   1 
ATOM   2307  N  N     . GLN A 1  316  ? 34.301  26.034  33.902  1.00 138.29 ? 316  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1  316  ? 34.819  27.324  33.379  1.00 138.49 ? 316  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1  316  ? 34.285  27.625  31.948  1.00 138.48 ? 316  GLN A C     1 
ATOM   2310  O  O     . GLN A 1  316  ? 34.722  28.589  31.289  1.00 138.58 ? 316  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1  316  ? 36.366  27.358  33.416  1.00 138.52 ? 316  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1  316  ? 37.007  28.770  33.456  1.00 138.73 ? 316  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1  316  ? 37.278  29.291  34.874  1.00 138.87 ? 316  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1  316  ? 36.737  30.323  35.285  1.00 138.83 ? 316  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1  316  ? 38.125  28.581  35.617  1.00 138.69 ? 316  GLN A NE2   1 
ATOM   2316  N  N     . LYS A 1  317  ? 33.355  26.779  31.481  1.00 138.27 ? 317  LYS A N     1 
ATOM   2317  C  CA    . LYS A 1  317  ? 32.463  27.079  30.333  1.00 137.87 ? 317  LYS A CA    1 
ATOM   2318  C  C     . LYS A 1  317  ? 31.026  26.541  30.586  1.00 137.39 ? 317  LYS A C     1 
ATOM   2319  O  O     . LYS A 1  317  ? 30.278  26.222  29.647  1.00 137.29 ? 317  LYS A O     1 
ATOM   2320  C  CB    . LYS A 1  317  ? 33.051  26.587  28.993  1.00 137.95 ? 317  LYS A CB    1 
ATOM   2321  C  CG    . LYS A 1  317  ? 32.722  27.463  27.775  1.00 138.05 ? 317  LYS A CG    1 
ATOM   2322  C  CD    . LYS A 1  317  ? 33.638  28.686  27.686  1.00 138.28 ? 317  LYS A CD    1 
ATOM   2323  C  CE    . LYS A 1  317  ? 33.054  29.751  26.767  1.00 138.61 ? 317  LYS A CE    1 
ATOM   2324  N  NZ    . LYS A 1  317  ? 33.863  31.004  26.753  1.00 138.59 ? 317  LYS A NZ    1 
ATOM   2325  N  N     . SER A 1  318  ? 30.680  26.443  31.878  1.00 136.66 ? 318  SER A N     1 
ATOM   2326  C  CA    . SER A 1  318  ? 29.315  26.177  32.378  1.00 135.77 ? 318  SER A CA    1 
ATOM   2327  C  C     . SER A 1  318  ? 29.047  26.877  33.744  1.00 134.89 ? 318  SER A C     1 
ATOM   2328  O  O     . SER A 1  318  ? 29.553  27.980  33.983  1.00 134.79 ? 318  SER A O     1 
ATOM   2329  C  CB    . SER A 1  318  ? 28.981  24.668  32.390  1.00 135.95 ? 318  SER A CB    1 
ATOM   2330  O  OG    . SER A 1  318  ? 30.126  23.851  32.598  1.00 136.25 ? 318  SER A OG    1 
ATOM   2331  N  N     . GLY A 1  319  ? 28.250  26.257  34.620  1.00 133.77 ? 319  GLY A N     1 
ATOM   2332  C  CA    . GLY A 1  319  ? 27.885  26.860  35.913  1.00 132.17 ? 319  GLY A CA    1 
ATOM   2333  C  C     . GLY A 1  319  ? 28.791  26.502  37.083  1.00 131.05 ? 319  GLY A C     1 
ATOM   2334  O  O     . GLY A 1  319  ? 29.790  27.178  37.327  1.00 130.95 ? 319  GLY A O     1 
ATOM   2335  N  N     . ARG A 1  320  ? 28.410  25.456  37.824  1.00 129.84 ? 320  ARG A N     1 
ATOM   2336  C  CA    . ARG A 1  320  ? 29.217  24.859  38.909  1.00 128.52 ? 320  ARG A CA    1 
ATOM   2337  C  C     . ARG A 1  320  ? 29.000  23.333  38.866  1.00 127.24 ? 320  ARG A C     1 
ATOM   2338  O  O     . ARG A 1  320  ? 28.558  22.817  37.830  1.00 127.28 ? 320  ARG A O     1 
ATOM   2339  C  CB    . ARG A 1  320  ? 28.813  25.406  40.292  1.00 128.70 ? 320  ARG A CB    1 
ATOM   2340  C  CG    . ARG A 1  320  ? 28.346  26.847  40.352  1.00 129.40 ? 320  ARG A CG    1 
ATOM   2341  C  CD    . ARG A 1  320  ? 26.855  26.904  40.598  1.00 130.64 ? 320  ARG A CD    1 
ATOM   2342  N  NE    . ARG A 1  320  ? 26.287  28.189  40.202  1.00 131.83 ? 320  ARG A NE    1 
ATOM   2343  C  CZ    . ARG A 1  320  ? 25.641  28.405  39.058  1.00 132.30 ? 320  ARG A CZ    1 
ATOM   2344  N  NH1   . ARG A 1  320  ? 25.472  27.416  38.187  1.00 132.25 ? 320  ARG A NH1   1 
ATOM   2345  N  NH2   . ARG A 1  320  ? 25.154  29.610  38.785  1.00 132.75 ? 320  ARG A NH2   1 
ATOM   2346  N  N     . PRO A 1  321  ? 29.342  22.593  39.953  1.00 125.83 ? 321  PRO A N     1 
ATOM   2347  C  CA    . PRO A 1  321  ? 30.265  22.793  41.067  1.00 124.49 ? 321  PRO A CA    1 
ATOM   2348  C  C     . PRO A 1  321  ? 31.433  21.808  40.939  1.00 123.05 ? 321  PRO A C     1 
ATOM   2349  O  O     . PRO A 1  321  ? 31.808  21.158  41.918  1.00 122.96 ? 321  PRO A O     1 
ATOM   2350  C  CB    . PRO A 1  321  ? 29.403  22.409  42.270  1.00 124.56 ? 321  PRO A CB    1 
ATOM   2351  C  CG    . PRO A 1  321  ? 28.437  21.333  41.706  1.00 125.33 ? 321  PRO A CG    1 
ATOM   2352  C  CD    . PRO A 1  321  ? 28.566  21.360  40.184  1.00 125.83 ? 321  PRO A CD    1 
ATOM   2353  N  N     . VAL A 1  322  ? 31.983  21.730  39.724  1.00 121.27 ? 322  VAL A N     1 
ATOM   2354  C  CA    . VAL A 1  322  ? 32.944  20.701  39.255  1.00 119.44 ? 322  VAL A CA    1 
ATOM   2355  C  C     . VAL A 1  322  ? 32.657  19.224  39.523  1.00 118.10 ? 322  VAL A C     1 
ATOM   2356  O  O     . VAL A 1  322  ? 31.571  18.837  39.955  1.00 118.07 ? 322  VAL A O     1 
ATOM   2357  C  CB    . VAL A 1  322  ? 34.440  21.019  39.539  1.00 119.43 ? 322  VAL A CB    1 
ATOM   2358  C  CG1   . VAL A 1  322  ? 34.822  22.350  38.918  1.00 119.84 ? 322  VAL A CG1   1 
ATOM   2359  C  CG2   . VAL A 1  322  ? 34.770  20.952  41.028  1.00 119.52 ? 322  VAL A CG2   1 
ATOM   2360  N  N     . LYS A 1  323  ? 33.671  18.415  39.239  1.00 116.33 ? 323  LYS A N     1 
ATOM   2361  C  CA    . LYS A 1  323  ? 33.508  16.989  39.019  1.00 114.61 ? 323  LYS A CA    1 
ATOM   2362  C  C     . LYS A 1  323  ? 34.556  16.231  39.808  1.00 112.88 ? 323  LYS A C     1 
ATOM   2363  O  O     . LYS A 1  323  ? 34.415  16.093  41.022  1.00 112.72 ? 323  LYS A O     1 
ATOM   2364  C  CB    . LYS A 1  323  ? 33.597  16.679  37.515  1.00 115.08 ? 323  LYS A CB    1 
ATOM   2365  C  CG    . LYS A 1  323  ? 34.301  17.775  36.657  1.00 115.93 ? 323  LYS A CG    1 
ATOM   2366  C  CD    . LYS A 1  323  ? 33.350  18.943  36.259  1.00 116.55 ? 323  LYS A CD    1 
ATOM   2367  C  CE    . LYS A 1  323  ? 34.103  20.234  35.875  1.00 116.22 ? 323  LYS A CE    1 
ATOM   2368  N  NZ    . LYS A 1  323  ? 33.211  21.436  35.767  1.00 116.17 ? 323  LYS A NZ    1 
ATOM   2369  N  N     . SER A 1  324  ? 35.599  15.758  39.126  1.00 110.68 ? 324  SER A N     1 
ATOM   2370  C  CA    . SER A 1  324  ? 36.727  15.051  39.750  1.00 108.74 ? 324  SER A CA    1 
ATOM   2371  C  C     . SER A 1  324  ? 36.621  13.542  39.606  1.00 107.23 ? 324  SER A C     1 
ATOM   2372  O  O     . SER A 1  324  ? 35.647  12.932  40.059  1.00 107.14 ? 324  SER A O     1 
ATOM   2373  C  CB    . SER A 1  324  ? 36.898  15.416  41.235  1.00 108.93 ? 324  SER A CB    1 
ATOM   2374  O  OG    . SER A 1  324  ? 35.957  14.746  42.065  1.00 108.54 ? 324  SER A OG    1 
ATOM   2375  N  N     . ILE A 1  325  ? 37.646  12.945  39.005  1.00 105.10 ? 325  ILE A N     1 
ATOM   2376  C  CA    . ILE A 1  325  ? 37.685  11.505  38.796  1.00 102.94 ? 325  ILE A CA    1 
ATOM   2377  C  C     . ILE A 1  325  ? 37.230  10.742  40.060  1.00 101.89 ? 325  ILE A C     1 
ATOM   2378  O  O     . ILE A 1  325  ? 36.626  9.681   39.951  1.00 101.87 ? 325  ILE A O     1 
ATOM   2379  C  CB    . ILE A 1  325  ? 39.068  11.029  38.257  1.00 102.80 ? 325  ILE A CB    1 
ATOM   2380  C  CG1   . ILE A 1  325  ? 39.531  11.921  37.104  1.00 101.96 ? 325  ILE A CG1   1 
ATOM   2381  C  CG2   . ILE A 1  325  ? 38.996  9.597   37.773  1.00 102.76 ? 325  ILE A CG2   1 
ATOM   2382  C  CD1   . ILE A 1  325  ? 40.626  11.328  36.239  1.00 101.32 ? 325  ILE A CD1   1 
ATOM   2383  N  N     . ARG A 1  326  ? 37.468  11.303  41.244  1.00 100.36 ? 326  ARG A N     1 
ATOM   2384  C  CA    . ARG A 1  326  ? 37.035  10.666  42.491  1.00 99.03  ? 326  ARG A CA    1 
ATOM   2385  C  C     . ARG A 1  326  ? 35.529  10.459  42.586  1.00 98.17  ? 326  ARG A C     1 
ATOM   2386  O  O     . ARG A 1  326  ? 35.086  9.351   42.883  1.00 98.27  ? 326  ARG A O     1 
ATOM   2387  C  CB    . ARG A 1  326  ? 37.511  11.446  43.714  1.00 99.08  ? 326  ARG A CB    1 
ATOM   2388  C  CG    . ARG A 1  326  ? 37.390  10.688  45.034  1.00 98.78  ? 326  ARG A CG    1 
ATOM   2389  C  CD    . ARG A 1  326  ? 36.098  10.972  45.767  1.00 98.40  ? 326  ARG A CD    1 
ATOM   2390  N  NE    . ARG A 1  326  ? 36.246  10.688  47.191  1.00 99.22  ? 326  ARG A NE    1 
ATOM   2391  C  CZ    . ARG A 1  326  ? 35.684  11.397  48.170  1.00 100.01 ? 326  ARG A CZ    1 
ATOM   2392  N  NH1   . ARG A 1  326  ? 34.923  12.452  47.895  1.00 100.03 ? 326  ARG A NH1   1 
ATOM   2393  N  NH2   . ARG A 1  326  ? 35.888  11.058  49.438  1.00 100.54 ? 326  ARG A NH2   1 
ATOM   2394  N  N     . ALA A 1  327  ? 34.748  11.516  42.358  1.00 96.91  ? 327  ALA A N     1 
ATOM   2395  C  CA    . ALA A 1  327  ? 33.280  11.432  42.493  1.00 95.76  ? 327  ALA A CA    1 
ATOM   2396  C  C     . ALA A 1  327  ? 32.597  10.684  41.339  1.00 94.86  ? 327  ALA A C     1 
ATOM   2397  O  O     . ALA A 1  327  ? 31.436  10.276  41.444  1.00 94.70  ? 327  ALA A O     1 
ATOM   2398  C  CB    . ALA A 1  327  ? 32.665  12.810  42.684  1.00 95.86  ? 327  ALA A CB    1 
ATOM   2399  N  N     . ARG A 1  328  ? 33.336  10.505  40.248  1.00 93.66  ? 328  ARG A N     1 
ATOM   2400  C  CA    . ARG A 1  328  ? 32.931  9.636   39.151  1.00 92.46  ? 328  ARG A CA    1 
ATOM   2401  C  C     . ARG A 1  328  ? 32.967  8.155   39.518  1.00 91.47  ? 328  ARG A C     1 
ATOM   2402  O  O     . ARG A 1  328  ? 32.441  7.322   38.783  1.00 91.26  ? 328  ARG A O     1 
ATOM   2403  C  CB    . ARG A 1  328  ? 33.861  9.839   37.967  1.00 92.54  ? 328  ARG A CB    1 
ATOM   2404  C  CG    . ARG A 1  328  ? 33.380  10.816  36.944  1.00 92.96  ? 328  ARG A CG    1 
ATOM   2405  C  CD    . ARG A 1  328  ? 34.026  10.474  35.622  1.00 93.60  ? 328  ARG A CD    1 
ATOM   2406  N  NE    . ARG A 1  328  ? 33.797  11.496  34.611  1.00 93.72  ? 328  ARG A NE    1 
ATOM   2407  C  CZ    . ARG A 1  328  ? 34.492  11.593  33.484  1.00 93.41  ? 328  ARG A CZ    1 
ATOM   2408  N  NH1   . ARG A 1  328  ? 35.471  10.727  33.219  1.00 92.40  ? 328  ARG A NH1   1 
ATOM   2409  N  NH2   . ARG A 1  328  ? 34.200  12.564  32.629  1.00 93.35  ? 328  ARG A NH2   1 
ATOM   2410  N  N     . LEU A 1  329  ? 33.617  7.828   40.629  1.00 90.24  ? 329  LEU A N     1 
ATOM   2411  C  CA    . LEU A 1  329  ? 33.771  6.447   41.034  1.00 89.21  ? 329  LEU A CA    1 
ATOM   2412  C  C     . LEU A 1  329  ? 33.086  6.192   42.352  1.00 88.80  ? 329  LEU A C     1 
ATOM   2413  O  O     . LEU A 1  329  ? 32.602  5.089   42.594  1.00 88.75  ? 329  LEU A O     1 
ATOM   2414  C  CB    . LEU A 1  329  ? 35.243  6.071   41.142  1.00 89.09  ? 329  LEU A CB    1 
ATOM   2415  C  CG    . LEU A 1  329  ? 36.161  6.262   39.932  1.00 88.86  ? 329  LEU A CG    1 
ATOM   2416  C  CD1   . LEU A 1  329  ? 37.484  5.549   40.153  1.00 89.04  ? 329  LEU A CD1   1 
ATOM   2417  C  CD2   . LEU A 1  329  ? 35.527  5.752   38.669  1.00 88.99  ? 329  LEU A CD2   1 
ATOM   2418  N  N     . LYS A 1  330  ? 33.047  7.215   43.201  1.00 88.37  ? 330  LYS A N     1 
ATOM   2419  C  CA    . LYS A 1  330  ? 32.401  7.109   44.509  1.00 87.87  ? 330  LYS A CA    1 
ATOM   2420  C  C     . LYS A 1  330  ? 31.003  6.550   44.352  1.00 87.43  ? 330  LYS A C     1 
ATOM   2421  O  O     . LYS A 1  330  ? 30.264  6.917   43.433  1.00 87.42  ? 330  LYS A O     1 
ATOM   2422  C  CB    . LYS A 1  330  ? 32.345  8.455   45.233  1.00 87.93  ? 330  LYS A CB    1 
ATOM   2423  C  CG    . LYS A 1  330  ? 31.845  8.344   46.658  1.00 87.77  ? 330  LYS A CG    1 
ATOM   2424  C  CD    . LYS A 1  330  ? 30.682  9.280   46.922  1.00 87.92  ? 330  LYS A CD    1 
ATOM   2425  C  CE    . LYS A 1  330  ? 29.852  8.778   48.097  1.00 88.42  ? 330  LYS A CE    1 
ATOM   2426  N  NZ    . LYS A 1  330  ? 28.902  9.798   48.629  1.00 88.82  ? 330  LYS A NZ    1 
ATOM   2427  N  N     . GLY A 1  331  ? 30.658  5.665   45.275  1.00 86.97  ? 331  GLY A N     1 
ATOM   2428  C  CA    . GLY A 1  331  ? 29.465  4.843   45.176  1.00 86.57  ? 331  GLY A CA    1 
ATOM   2429  C  C     . GLY A 1  331  ? 28.110  5.518   45.044  1.00 86.04  ? 331  GLY A C     1 
ATOM   2430  O  O     . GLY A 1  331  ? 27.948  6.722   45.330  1.00 85.67  ? 331  GLY A O     1 
ATOM   2431  N  N     . LYS A 1  332  ? 27.147  4.686   44.627  1.00 85.44  ? 332  LYS A N     1 
ATOM   2432  C  CA    . LYS A 1  332  ? 25.766  5.047   44.338  1.00 84.80  ? 332  LYS A CA    1 
ATOM   2433  C  C     . LYS A 1  332  ? 25.748  6.004   43.167  1.00 84.71  ? 332  LYS A C     1 
ATOM   2434  O  O     . LYS A 1  332  ? 26.057  7.184   43.333  1.00 84.95  ? 332  LYS A O     1 
ATOM   2435  C  CB    . LYS A 1  332  ? 25.062  5.630   45.577  1.00 84.66  ? 332  LYS A CB    1 
ATOM   2436  C  CG    . LYS A 1  332  ? 23.546  5.480   45.563  1.00 83.81  ? 332  LYS A CG    1 
ATOM   2437  C  CD    . LYS A 1  332  ? 23.125  4.161   44.926  1.00 82.87  ? 332  LYS A CD    1 
ATOM   2438  C  CE    . LYS A 1  332  ? 21.747  3.735   45.381  1.00 82.54  ? 332  LYS A CE    1 
ATOM   2439  N  NZ    . LYS A 1  332  ? 21.336  2.392   44.839  1.00 82.25  ? 332  LYS A NZ    1 
ATOM   2440  N  N     . GLU A 1  333  ? 25.404  5.490   41.985  1.00 84.42  ? 333  GLU A N     1 
ATOM   2441  C  CA    . GLU A 1  333  ? 25.480  6.250   40.708  1.00 84.33  ? 333  GLU A CA    1 
ATOM   2442  C  C     . GLU A 1  333  ? 26.916  6.382   40.174  1.00 83.77  ? 333  GLU A C     1 
ATOM   2443  O  O     . GLU A 1  333  ? 27.127  6.836   39.052  1.00 83.77  ? 333  GLU A O     1 
ATOM   2444  C  CB    . GLU A 1  333  ? 24.826  7.651   40.792  1.00 84.45  ? 333  GLU A CB    1 
ATOM   2445  C  CG    . GLU A 1  333  ? 23.394  7.687   41.322  1.00 85.53  ? 333  GLU A CG    1 
ATOM   2446  C  CD    . GLU A 1  333  ? 22.339  7.419   40.257  1.00 87.01  ? 333  GLU A CD    1 
ATOM   2447  O  OE1   . GLU A 1  333  ? 22.420  6.382   39.553  1.00 86.39  ? 333  GLU A OE1   1 
ATOM   2448  O  OE2   . GLU A 1  333  ? 21.410  8.254   40.141  1.00 88.35  ? 333  GLU A OE2   1 
ATOM   2449  N  N     . GLY A 1  334  ? 27.895  6.012   40.987  1.00 83.20  ? 334  GLY A N     1 
ATOM   2450  C  CA    . GLY A 1  334  ? 29.271  5.997   40.551  1.00 82.73  ? 334  GLY A CA    1 
ATOM   2451  C  C     . GLY A 1  334  ? 29.569  4.746   39.737  1.00 82.63  ? 334  GLY A C     1 
ATOM   2452  O  O     . GLY A 1  334  ? 29.007  3.670   39.987  1.00 82.83  ? 334  GLY A O     1 
ATOM   2453  N  N     . ARG A 1  335  ? 30.454  4.914   38.753  1.00 82.11  ? 335  ARG A N     1 
ATOM   2454  C  CA    . ARG A 1  335  ? 31.055  3.844   37.951  1.00 81.23  ? 335  ARG A CA    1 
ATOM   2455  C  C     . ARG A 1  335  ? 31.117  2.481   38.621  1.00 80.78  ? 335  ARG A C     1 
ATOM   2456  O  O     . ARG A 1  335  ? 31.039  1.469   37.933  1.00 81.05  ? 335  ARG A O     1 
ATOM   2457  C  CB    . ARG A 1  335  ? 32.473  4.259   37.565  1.00 81.15  ? 335  ARG A CB    1 
ATOM   2458  C  CG    . ARG A 1  335  ? 33.070  3.580   36.351  1.00 81.80  ? 335  ARG A CG    1 
ATOM   2459  C  CD    . ARG A 1  335  ? 32.472  4.087   35.056  1.00 83.96  ? 335  ARG A CD    1 
ATOM   2460  N  NE    . ARG A 1  335  ? 31.486  5.144   35.275  1.00 86.42  ? 335  ARG A NE    1 
ATOM   2461  C  CZ    . ARG A 1  335  ? 31.712  6.451   35.147  1.00 87.71  ? 335  ARG A CZ    1 
ATOM   2462  N  NH1   . ARG A 1  335  ? 32.912  6.891   34.786  1.00 88.73  ? 335  ARG A NH1   1 
ATOM   2463  N  NH2   . ARG A 1  335  ? 30.729  7.321   35.379  1.00 87.32  ? 335  ARG A NH2   1 
ATOM   2464  N  N     . ILE A 1  336  ? 31.275  2.430   39.942  1.00 79.97  ? 336  ILE A N     1 
ATOM   2465  C  CA    . ILE A 1  336  ? 31.349  1.124   40.571  1.00 79.39  ? 336  ILE A CA    1 
ATOM   2466  C  C     . ILE A 1  336  ? 30.009  0.573   41.050  1.00 79.01  ? 336  ILE A C     1 
ATOM   2467  O  O     . ILE A 1  336  ? 29.464  -0.349  40.416  1.00 79.13  ? 336  ILE A O     1 
ATOM   2468  C  CB    . ILE A 1  336  ? 32.499  0.982   41.588  1.00 79.43  ? 336  ILE A CB    1 
ATOM   2469  C  CG1   . ILE A 1  336  ? 33.824  0.874   40.812  1.00 79.45  ? 336  ILE A CG1   1 
ATOM   2470  C  CG2   . ILE A 1  336  ? 32.277  -0.254  42.497  1.00 79.49  ? 336  ILE A CG2   1 
ATOM   2471  C  CD1   . ILE A 1  336  ? 34.941  0.065   41.485  1.00 79.53  ? 336  ILE A CD1   1 
ATOM   2472  N  N     . ARG A 1  337  ? 29.461  1.123   42.129  1.00 78.21  ? 337  ARG A N     1 
ATOM   2473  C  CA    . ARG A 1  337  ? 28.226  0.549   42.644  1.00 77.71  ? 337  ARG A CA    1 
ATOM   2474  C  C     . ARG A 1  337  ? 27.000  0.897   41.772  1.00 77.69  ? 337  ARG A C     1 
ATOM   2475  O  O     . ARG A 1  337  ? 25.845  0.610   42.157  1.00 77.65  ? 337  ARG A O     1 
ATOM   2476  C  CB    . ARG A 1  337  ? 27.994  0.929   44.101  1.00 77.59  ? 337  ARG A CB    1 
ATOM   2477  C  CG    . ARG A 1  337  ? 27.233  -0.167  44.850  1.00 76.84  ? 337  ARG A CG    1 
ATOM   2478  C  CD    . ARG A 1  337  ? 26.097  0.357   45.713  1.00 73.79  ? 337  ARG A CD    1 
ATOM   2479  N  NE    . ARG A 1  337  ? 26.583  1.258   46.739  1.00 71.56  ? 337  ARG A NE    1 
ATOM   2480  C  CZ    . ARG A 1  337  ? 25.812  1.892   47.603  1.00 70.57  ? 337  ARG A CZ    1 
ATOM   2481  N  NH1   . ARG A 1  337  ? 24.491  1.714   47.594  1.00 69.79  ? 337  ARG A NH1   1 
ATOM   2482  N  NH2   . ARG A 1  337  ? 26.378  2.704   48.481  1.00 70.86  ? 337  ARG A NH2   1 
ATOM   2483  N  N     . GLY A 1  338  ? 27.267  1.481   40.593  1.00 77.25  ? 338  GLY A N     1 
ATOM   2484  C  CA    . GLY A 1  338  ? 26.227  1.972   39.683  1.00 76.45  ? 338  GLY A CA    1 
ATOM   2485  C  C     . GLY A 1  338  ? 26.339  1.525   38.235  1.00 76.02  ? 338  GLY A C     1 
ATOM   2486  O  O     . GLY A 1  338  ? 25.374  1.634   37.475  1.00 76.09  ? 338  GLY A O     1 
ATOM   2487  N  N     . ASN A 1  339  ? 27.503  1.020   37.841  1.00 75.58  ? 339  ASN A N     1 
ATOM   2488  C  CA    . ASN A 1  339  ? 27.731  0.613   36.443  1.00 75.17  ? 339  ASN A CA    1 
ATOM   2489  C  C     . ASN A 1  339  ? 28.466  -0.702  36.267  1.00 74.68  ? 339  ASN A C     1 
ATOM   2490  O  O     . ASN A 1  339  ? 28.697  -1.141  35.133  1.00 74.63  ? 339  ASN A O     1 
ATOM   2491  C  CB    . ASN A 1  339  ? 28.497  1.696   35.693  1.00 75.31  ? 339  ASN A CB    1 
ATOM   2492  C  CG    . ASN A 1  339  ? 27.614  2.821   35.274  1.00 76.17  ? 339  ASN A CG    1 
ATOM   2493  O  OD1   . ASN A 1  339  ? 26.602  2.601   34.616  1.00 77.77  ? 339  ASN A OD1   1 
ATOM   2494  N  ND2   . ASN A 1  339  ? 27.975  4.045   35.658  1.00 76.92  ? 339  ASN A ND2   1 
ATOM   2495  N  N     . LEU A 1  340  ? 28.855  -1.303  37.390  1.00 73.74  ? 340  LEU A N     1 
ATOM   2496  C  CA    . LEU A 1  340  ? 29.547  -2.566  37.376  1.00 72.68  ? 340  LEU A CA    1 
ATOM   2497  C  C     . LEU A 1  340  ? 28.762  -3.555  38.189  1.00 72.37  ? 340  LEU A C     1 
ATOM   2498  O  O     . LEU A 1  340  ? 28.323  -4.587  37.675  1.00 72.18  ? 340  LEU A O     1 
ATOM   2499  C  CB    . LEU A 1  340  ? 30.951  -2.394  37.917  1.00 72.38  ? 340  LEU A CB    1 
ATOM   2500  C  CG    . LEU A 1  340  ? 31.858  -1.731  36.890  1.00 71.89  ? 340  LEU A CG    1 
ATOM   2501  C  CD1   . LEU A 1  340  ? 33.233  -1.581  37.467  1.00 72.84  ? 340  LEU A CD1   1 
ATOM   2502  C  CD2   . LEU A 1  340  ? 31.925  -2.536  35.610  1.00 70.96  ? 340  LEU A CD2   1 
ATOM   2503  N  N     . MET A 1  341  ? 28.557  -3.214  39.454  1.00 71.92  ? 341  MET A N     1 
ATOM   2504  C  CA    . MET A 1  341  ? 27.697  -4.003  40.323  1.00 71.79  ? 341  MET A CA    1 
ATOM   2505  C  C     . MET A 1  341  ? 26.251  -4.111  39.769  1.00 71.34  ? 341  MET A C     1 
ATOM   2506  O  O     . MET A 1  341  ? 25.582  -5.140  39.944  1.00 71.30  ? 341  MET A O     1 
ATOM   2507  C  CB    . MET A 1  341  ? 27.726  -3.431  41.750  1.00 71.81  ? 341  MET A CB    1 
ATOM   2508  C  CG    . MET A 1  341  ? 29.084  -3.552  42.441  1.00 72.83  ? 341  MET A CG    1 
ATOM   2509  S  SD    . MET A 1  341  ? 29.670  -5.261  42.761  1.00 75.87  ? 341  MET A SD    1 
ATOM   2510  C  CE    . MET A 1  341  ? 28.846  -5.631  44.291  1.00 74.43  ? 341  MET A CE    1 
ATOM   2511  N  N     . GLY A 1  342  ? 25.797  -3.057  39.083  1.00 70.66  ? 342  GLY A N     1 
ATOM   2512  C  CA    . GLY A 1  342  ? 24.422  -2.958  38.607  1.00 69.79  ? 342  GLY A CA    1 
ATOM   2513  C  C     . GLY A 1  342  ? 24.325  -2.200  37.297  1.00 69.27  ? 342  GLY A C     1 
ATOM   2514  O  O     . GLY A 1  342  ? 24.373  -0.967  37.275  1.00 69.19  ? 342  GLY A O     1 
ATOM   2515  N  N     . LYS A 1  343  ? 24.182  -2.948  36.205  1.00 68.56  ? 343  LYS A N     1 
ATOM   2516  C  CA    . LYS A 1  343  ? 24.110  -2.373  34.864  1.00 67.74  ? 343  LYS A CA    1 
ATOM   2517  C  C     . LYS A 1  343  ? 22.681  -2.300  34.383  1.00 66.99  ? 343  LYS A C     1 
ATOM   2518  O  O     . LYS A 1  343  ? 21.873  -3.146  34.740  1.00 67.23  ? 343  LYS A O     1 
ATOM   2519  C  CB    . LYS A 1  343  ? 24.864  -3.249  33.875  1.00 67.68  ? 343  LYS A CB    1 
ATOM   2520  C  CG    . LYS A 1  343  ? 26.336  -3.410  34.113  1.00 68.44  ? 343  LYS A CG    1 
ATOM   2521  C  CD    . LYS A 1  343  ? 26.718  -4.803  33.644  1.00 71.04  ? 343  LYS A CD    1 
ATOM   2522  C  CE    . LYS A 1  343  ? 28.214  -4.980  33.421  1.00 72.77  ? 343  LYS A CE    1 
ATOM   2523  N  NZ    . LYS A 1  343  ? 28.613  -4.741  32.002  1.00 72.70  ? 343  LYS A NZ    1 
ATOM   2524  N  N     . ARG A 1  344  ? 22.380  -1.297  33.562  1.00 65.96  ? 344  ARG A N     1 
ATOM   2525  C  CA    . ARG A 1  344  ? 21.155  -1.286  32.772  1.00 65.21  ? 344  ARG A CA    1 
ATOM   2526  C  C     . ARG A 1  344  ? 21.350  -2.300  31.637  1.00 64.33  ? 344  ARG A C     1 
ATOM   2527  O  O     . ARG A 1  344  ? 22.448  -2.405  31.100  1.00 64.63  ? 344  ARG A O     1 
ATOM   2528  C  CB    . ARG A 1  344  ? 20.946  0.107   32.199  1.00 65.56  ? 344  ARG A CB    1 
ATOM   2529  C  CG    . ARG A 1  344  ? 19.581  0.702   32.460  1.00 66.76  ? 344  ARG A CG    1 
ATOM   2530  C  CD    . ARG A 1  344  ? 19.651  2.236   32.474  1.00 68.35  ? 344  ARG A CD    1 
ATOM   2531  N  NE    . ARG A 1  344  ? 19.086  2.832   33.692  1.00 70.37  ? 344  ARG A NE    1 
ATOM   2532  C  CZ    . ARG A 1  344  ? 18.080  2.332   34.421  1.00 71.69  ? 344  ARG A CZ    1 
ATOM   2533  N  NH1   . ARG A 1  344  ? 17.461  1.208   34.075  1.00 72.57  ? 344  ARG A NH1   1 
ATOM   2534  N  NH2   . ARG A 1  344  ? 17.671  2.980   35.503  1.00 71.95  ? 344  ARG A NH2   1 
ATOM   2535  N  N     . VAL A 1  345  ? 20.313  -3.054  31.269  1.00 63.08  ? 345  VAL A N     1 
ATOM   2536  C  CA    . VAL A 1  345  ? 20.503  -4.236  30.402  1.00 61.62  ? 345  VAL A CA    1 
ATOM   2537  C  C     . VAL A 1  345  ? 19.429  -4.497  29.361  1.00 60.99  ? 345  VAL A C     1 
ATOM   2538  O  O     . VAL A 1  345  ? 18.271  -4.094  29.523  1.00 60.97  ? 345  VAL A O     1 
ATOM   2539  C  CB    . VAL A 1  345  ? 20.573  -5.502  31.227  1.00 61.48  ? 345  VAL A CB    1 
ATOM   2540  C  CG1   . VAL A 1  345  ? 21.623  -5.354  32.289  1.00 61.59  ? 345  VAL A CG1   1 
ATOM   2541  C  CG2   . VAL A 1  345  ? 19.190  -5.827  31.840  1.00 60.80  ? 345  VAL A CG2   1 
ATOM   2542  N  N     . ASP A 1  346  ? 19.813  -5.245  28.329  1.00 59.92  ? 346  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1  346  ? 18.932  -5.506  27.187  1.00 59.04  ? 346  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1  346  ? 17.894  -6.612  27.419  1.00 57.48  ? 346  ASP A C     1 
ATOM   2545  O  O     . ASP A 1  346  ? 17.823  -7.160  28.510  1.00 57.64  ? 346  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1  346  ? 19.774  -5.771  25.935  1.00 59.61  ? 346  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1  346  ? 20.419  -4.495  25.392  1.00 61.91  ? 346  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1  346  ? 19.804  -3.399  25.533  1.00 61.64  ? 346  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1  346  ? 21.542  -4.592  24.826  1.00 65.87  ? 346  ASP A OD2   1 
ATOM   2550  N  N     . PHE A 1  347  ? 17.087  -6.909  26.393  1.00 55.46  ? 347  PHE A N     1 
ATOM   2551  C  CA    . PHE A 1  347  ? 16.081  -7.963  26.416  1.00 53.24  ? 347  PHE A CA    1 
ATOM   2552  C  C     . PHE A 1  347  ? 15.568  -8.047  27.807  1.00 52.09  ? 347  PHE A C     1 
ATOM   2553  O  O     . PHE A 1  347  ? 16.095  -8.807  28.616  1.00 52.40  ? 347  PHE A O     1 
ATOM   2554  C  CB    . PHE A 1  347  ? 16.647  -9.314  26.003  1.00 53.36  ? 347  PHE A CB    1 
ATOM   2555  C  CG    . PHE A 1  347  ? 17.606  -9.234  24.869  1.00 53.91  ? 347  PHE A CG    1 
ATOM   2556  C  CD1   . PHE A 1  347  ? 18.976  -9.295  25.100  1.00 53.76  ? 347  PHE A CD1   1 
ATOM   2557  C  CD2   . PHE A 1  347  ? 17.145  -9.057  23.568  1.00 54.13  ? 347  PHE A CD2   1 
ATOM   2558  C  CE1   . PHE A 1  347  ? 19.874  -9.203  24.047  1.00 55.04  ? 347  PHE A CE1   1 
ATOM   2559  C  CE2   . PHE A 1  347  ? 18.033  -8.965  22.508  1.00 55.00  ? 347  PHE A CE2   1 
ATOM   2560  C  CZ    . PHE A 1  347  ? 19.406  -9.042  22.744  1.00 54.94  ? 347  PHE A CZ    1 
ATOM   2561  N  N     . SER A 1  348  ? 14.554  -7.220  28.064  1.00 50.28  ? 348  SER A N     1 
ATOM   2562  C  CA    . SER A 1  348  ? 13.846  -7.090  29.313  1.00 47.74  ? 348  SER A CA    1 
ATOM   2563  C  C     . SER A 1  348  ? 12.593  -6.301  28.998  1.00 46.57  ? 348  SER A C     1 
ATOM   2564  O  O     . SER A 1  348  ? 12.327  -5.967  27.855  1.00 45.56  ? 348  SER A O     1 
ATOM   2565  C  CB    . SER A 1  348  ? 14.674  -6.289  30.278  1.00 47.97  ? 348  SER A CB    1 
ATOM   2566  O  OG    . SER A 1  348  ? 14.889  -5.001  29.728  1.00 49.03  ? 348  SER A OG    1 
ATOM   2567  N  N     . ALA A 1  349  ? 11.832  -5.966  30.032  1.00 46.41  ? 349  ALA A N     1 
ATOM   2568  C  CA    . ALA A 1  349  ? 10.440  -5.516  29.875  1.00 45.90  ? 349  ALA A CA    1 
ATOM   2569  C  C     . ALA A 1  349  ? 9.800   -5.449  31.199  1.00 44.84  ? 349  ALA A C     1 
ATOM   2570  O  O     . ALA A 1  349  ? 10.259  -6.165  32.098  1.00 44.17  ? 349  ALA A O     1 
ATOM   2571  C  CB    . ALA A 1  349  ? 9.648   -6.525  29.044  1.00 46.83  ? 349  ALA A CB    1 
ATOM   2572  N  N     . ARG A 1  350  ? 8.712   -4.664  31.283  1.00 44.17  ? 350  ARG A N     1 
ATOM   2573  C  CA    . ARG A 1  350  ? 7.872   -4.557  32.508  1.00 44.02  ? 350  ARG A CA    1 
ATOM   2574  C  C     . ARG A 1  350  ? 6.519   -3.931  32.323  1.00 44.08  ? 350  ARG A C     1 
ATOM   2575  O  O     . ARG A 1  350  ? 6.395   -2.950  31.631  1.00 44.57  ? 350  ARG A O     1 
ATOM   2576  C  CB    . ARG A 1  350  ? 8.648   -3.834  33.624  1.00 44.10  ? 350  ARG A CB    1 
ATOM   2577  C  CG    . ARG A 1  350  ? 8.073   -2.606  34.261  1.00 42.51  ? 350  ARG A CG    1 
ATOM   2578  C  CD    . ARG A 1  350  ? 9.265   -1.718  34.464  1.00 42.98  ? 350  ARG A CD    1 
ATOM   2579  N  NE    . ARG A 1  350  ? 9.190   -0.806  35.596  1.00 46.05  ? 350  ARG A NE    1 
ATOM   2580  C  CZ    . ARG A 1  350  ? 9.487   -1.116  36.865  1.00 48.23  ? 350  ARG A CZ    1 
ATOM   2581  N  NH1   . ARG A 1  350  ? 9.847   -2.351  37.231  1.00 48.61  ? 350  ARG A NH1   1 
ATOM   2582  N  NH2   . ARG A 1  350  ? 9.410   -0.175  37.795  1.00 49.43  ? 350  ARG A NH2   1 
ATOM   2583  N  N     . THR A 1  351  ? 5.494   -4.480  32.948  1.00 44.67  ? 351  THR A N     1 
ATOM   2584  C  CA    . THR A 1  351  ? 4.184   -3.839  32.892  1.00 45.74  ? 351  THR A CA    1 
ATOM   2585  C  C     . THR A 1  351  ? 3.553   -3.791  34.245  1.00 46.29  ? 351  THR A C     1 
ATOM   2586  O  O     . THR A 1  351  ? 4.153   -4.267  35.213  1.00 46.42  ? 351  THR A O     1 
ATOM   2587  C  CB    . THR A 1  351  ? 3.205   -4.646  32.075  1.00 45.87  ? 351  THR A CB    1 
ATOM   2588  O  OG1   . THR A 1  351  ? 3.719   -4.881  30.756  1.00 47.09  ? 351  THR A OG1   1 
ATOM   2589  C  CG2   . THR A 1  351  ? 1.872   -3.906  32.002  1.00 45.95  ? 351  THR A CG2   1 
ATOM   2590  N  N     . VAL A 1  352  ? 2.330   -3.251  34.297  1.00 47.28  ? 352  VAL A N     1 
ATOM   2591  C  CA    . VAL A 1  352  ? 1.395   -3.546  35.396  1.00 49.12  ? 352  VAL A CA    1 
ATOM   2592  C  C     . VAL A 1  352  ? 1.118   -5.051  35.471  1.00 50.20  ? 352  VAL A C     1 
ATOM   2593  O  O     . VAL A 1  352  ? 1.176   -5.763  34.470  1.00 50.86  ? 352  VAL A O     1 
ATOM   2594  C  CB    . VAL A 1  352  ? 0.016   -2.884  35.244  1.00 48.77  ? 352  VAL A CB    1 
ATOM   2595  C  CG1   . VAL A 1  352  ? -0.835  -3.203  36.479  1.00 50.02  ? 352  VAL A CG1   1 
ATOM   2596  C  CG2   . VAL A 1  352  ? 0.130   -1.405  35.116  1.00 49.44  ? 352  VAL A CG2   1 
ATOM   2597  N  N     . ILE A 1  353  ? 0.793   -5.538  36.655  1.00 51.34  ? 353  ILE A N     1 
ATOM   2598  C  CA    . ILE A 1  353  ? 0.531   -6.942  36.785  1.00 52.95  ? 353  ILE A CA    1 
ATOM   2599  C  C     . ILE A 1  353  ? -0.845  -7.173  37.356  1.00 54.29  ? 353  ILE A C     1 
ATOM   2600  O  O     . ILE A 1  353  ? -1.396  -6.299  38.046  1.00 54.41  ? 353  ILE A O     1 
ATOM   2601  C  CB    . ILE A 1  353  ? 1.590   -7.633  37.630  1.00 52.97  ? 353  ILE A CB    1 
ATOM   2602  C  CG1   . ILE A 1  353  ? 1.746   -6.945  39.011  1.00 54.17  ? 353  ILE A CG1   1 
ATOM   2603  C  CG2   . ILE A 1  353  ? 2.908   -7.645  36.874  1.00 53.28  ? 353  ILE A CG2   1 
ATOM   2604  C  CD1   . ILE A 1  353  ? 0.660   -7.275  40.118  1.00 54.35  ? 353  ILE A CD1   1 
ATOM   2605  N  N     . SER A 1  354  ? -1.350  -8.377  37.084  1.00 55.96  ? 354  SER A N     1 
ATOM   2606  C  CA    . SER A 1  354  ? -2.739  -8.774  37.280  1.00 57.66  ? 354  SER A CA    1 
ATOM   2607  C  C     . SER A 1  354  ? -2.858  -10.291 37.404  1.00 58.75  ? 354  SER A C     1 
ATOM   2608  O  O     . SER A 1  354  ? -2.209  -11.040 36.683  1.00 59.29  ? 354  SER A O     1 
ATOM   2609  C  CB    . SER A 1  354  ? -3.621  -8.262  36.125  1.00 57.89  ? 354  SER A CB    1 
ATOM   2610  O  OG    . SER A 1  354  ? -2.888  -8.064  34.925  1.00 59.23  ? 354  SER A OG    1 
ATOM   2611  N  N     . GLY A 1  355  ? -3.719  -10.748 38.306  1.00 60.29  ? 355  GLY A N     1 
ATOM   2612  C  CA    . GLY A 1  355  ? -3.734  -12.177 38.702  1.00 61.30  ? 355  GLY A CA    1 
ATOM   2613  C  C     . GLY A 1  355  ? -4.753  -13.125 38.083  1.00 61.59  ? 355  GLY A C     1 
ATOM   2614  O  O     . GLY A 1  355  ? -5.979  -13.049 38.376  1.00 61.23  ? 355  GLY A O     1 
ATOM   2615  N  N     . ASP A 1  356  ? -4.224  -14.048 37.276  1.00 61.60  ? 356  ASP A N     1 
ATOM   2616  C  CA    . ASP A 1  356  ? -5.048  -14.908 36.433  1.00 61.85  ? 356  ASP A CA    1 
ATOM   2617  C  C     . ASP A 1  356  ? -5.371  -16.322 36.939  1.00 61.22  ? 356  ASP A C     1 
ATOM   2618  O  O     . ASP A 1  356  ? -4.686  -17.289 36.577  1.00 60.73  ? 356  ASP A O     1 
ATOM   2619  C  CB    . ASP A 1  356  ? -4.465  -14.984 35.033  1.00 61.94  ? 356  ASP A CB    1 
ATOM   2620  C  CG    . ASP A 1  356  ? -5.499  -15.386 34.004  1.00 63.83  ? 356  ASP A CG    1 
ATOM   2621  O  OD1   . ASP A 1  356  ? -6.575  -15.964 34.371  1.00 65.16  ? 356  ASP A OD1   1 
ATOM   2622  O  OD2   . ASP A 1  356  ? -5.223  -15.111 32.815  1.00 64.64  ? 356  ASP A OD2   1 
ATOM   2623  N  N     . PRO A 1  357  ? -6.470  -16.446 37.707  1.00 61.06  ? 357  PRO A N     1 
ATOM   2624  C  CA    . PRO A 1  357  ? -6.926  -17.740 38.248  1.00 61.00  ? 357  PRO A CA    1 
ATOM   2625  C  C     . PRO A 1  357  ? -6.813  -18.924 37.253  1.00 60.41  ? 357  PRO A C     1 
ATOM   2626  O  O     . PRO A 1  357  ? -6.601  -20.084 37.655  1.00 60.32  ? 357  PRO A O     1 
ATOM   2627  C  CB    . PRO A 1  357  ? -8.412  -17.475 38.640  1.00 61.25  ? 357  PRO A CB    1 
ATOM   2628  C  CG    . PRO A 1  357  ? -8.713  -16.006 38.250  1.00 61.18  ? 357  PRO A CG    1 
ATOM   2629  C  CD    . PRO A 1  357  ? -7.367  -15.340 38.105  1.00 61.04  ? 357  PRO A CD    1 
ATOM   2630  N  N     . ASN A 1  358  ? -6.942  -18.653 35.963  1.00 59.64  ? 358  ASN A N     1 
ATOM   2631  C  CA    . ASN A 1  358  ? -6.966  -19.779 35.047  1.00 58.87  ? 358  ASN A CA    1 
ATOM   2632  C  C     . ASN A 1  358  ? -5.637  -20.047 34.321  1.00 58.37  ? 358  ASN A C     1 
ATOM   2633  O  O     . ASN A 1  358  ? -5.603  -20.703 33.266  1.00 58.01  ? 358  ASN A O     1 
ATOM   2634  C  CB    . ASN A 1  358  ? -8.275  -19.808 34.230  1.00 58.67  ? 358  ASN A CB    1 
ATOM   2635  C  CG    . ASN A 1  358  ? -9.490  -20.196 35.131  1.00 58.79  ? 358  ASN A CG    1 
ATOM   2636  O  OD1   . ASN A 1  358  ? -9.381  -21.128 35.916  1.00 58.90  ? 358  ASN A OD1   1 
ATOM   2637  N  ND2   . ASN A 1  358  ? -10.606 -19.458 35.056  1.00 58.48  ? 358  ASN A ND2   1 
ATOM   2638  N  N     . LEU A 1  359  ? -4.564  -19.531 34.959  1.00 57.70  ? 359  LEU A N     1 
ATOM   2639  C  CA    . LEU A 1  359  ? -3.135  -19.768 34.631  1.00 57.05  ? 359  LEU A CA    1 
ATOM   2640  C  C     . LEU A 1  359  ? -2.495  -20.742 35.624  1.00 56.68  ? 359  LEU A C     1 
ATOM   2641  O  O     . LEU A 1  359  ? -2.882  -20.753 36.796  1.00 56.96  ? 359  LEU A O     1 
ATOM   2642  C  CB    . LEU A 1  359  ? -2.348  -18.455 34.670  1.00 56.83  ? 359  LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1  359  ? -2.412  -17.476 33.494  1.00 56.47  ? 359  LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1  359  ? -1.188  -16.601 33.533  1.00 56.73  ? 359  LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1  359  ? -2.474  -18.158 32.136  1.00 55.71  ? 359  LEU A CD2   1 
ATOM   2646  N  N     . GLU A 1  360  ? -1.537  -21.564 35.182  1.00 56.02  ? 360  GLU A N     1 
ATOM   2647  C  CA    . GLU A 1  360  ? -0.919  -22.528 36.117  1.00 55.80  ? 360  GLU A CA    1 
ATOM   2648  C  C     . GLU A 1  360  ? 0.140   -21.761 36.905  1.00 54.78  ? 360  GLU A C     1 
ATOM   2649  O  O     . GLU A 1  360  ? 0.416   -20.591 36.571  1.00 54.95  ? 360  GLU A O     1 
ATOM   2650  C  CB    . GLU A 1  360  ? -0.347  -23.799 35.425  1.00 56.33  ? 360  GLU A CB    1 
ATOM   2651  C  CG    . GLU A 1  360  ? -1.382  -24.764 34.710  1.00 59.61  ? 360  GLU A CG    1 
ATOM   2652  C  CD    . GLU A 1  360  ? -2.375  -25.564 35.660  1.00 63.30  ? 360  GLU A CD    1 
ATOM   2653  O  OE1   . GLU A 1  360  ? -2.720  -26.751 35.354  1.00 63.40  ? 360  GLU A OE1   1 
ATOM   2654  O  OE2   . GLU A 1  360  ? -2.829  -25.011 36.696  1.00 64.15  ? 360  GLU A OE2   1 
ATOM   2655  N  N     . LEU A 1  361  ? 0.722   -22.396 37.935  1.00 53.30  ? 361  LEU A N     1 
ATOM   2656  C  CA    . LEU A 1  361  ? 1.689   -21.723 38.831  1.00 51.18  ? 361  LEU A CA    1 
ATOM   2657  C  C     . LEU A 1  361  ? 2.905   -21.241 38.095  1.00 50.84  ? 361  LEU A C     1 
ATOM   2658  O  O     . LEU A 1  361  ? 3.057   -20.042 37.886  1.00 50.90  ? 361  LEU A O     1 
ATOM   2659  C  CB    . LEU A 1  361  ? 2.110   -22.604 40.004  1.00 51.00  ? 361  LEU A CB    1 
ATOM   2660  C  CG    . LEU A 1  361  ? 2.277   -21.944 41.378  1.00 49.52  ? 361  LEU A CG    1 
ATOM   2661  C  CD1   . LEU A 1  361  ? 1.204   -20.870 41.668  1.00 46.80  ? 361  LEU A CD1   1 
ATOM   2662  C  CD2   . LEU A 1  361  ? 2.341   -22.977 42.495  1.00 49.23  ? 361  LEU A CD2   1 
ATOM   2663  N  N     . ASP A 1  362  ? 3.743   -22.161 37.662  1.00 50.20  ? 362  ASP A N     1 
ATOM   2664  C  CA    . ASP A 1  362  ? 4.964   -21.786 36.948  1.00 51.03  ? 362  ASP A CA    1 
ATOM   2665  C  C     . ASP A 1  362  ? 4.828   -20.868 35.724  1.00 50.07  ? 362  ASP A C     1 
ATOM   2666  O  O     . ASP A 1  362  ? 5.810   -20.647 35.015  1.00 49.63  ? 362  ASP A O     1 
ATOM   2667  C  CB    . ASP A 1  362  ? 5.716   -23.029 36.531  1.00 51.92  ? 362  ASP A CB    1 
ATOM   2668  C  CG    . ASP A 1  362  ? 4.810   -24.038 35.912  1.00 55.63  ? 362  ASP A CG    1 
ATOM   2669  O  OD1   . ASP A 1  362  ? 5.239   -25.216 35.772  1.00 60.34  ? 362  ASP A OD1   1 
ATOM   2670  O  OD2   . ASP A 1  362  ? 3.654   -23.642 35.583  1.00 58.65  ? 362  ASP A OD2   1 
ATOM   2671  N  N     . GLN A 1  363  ? 3.641   -20.310 35.508  1.00 49.38  ? 363  GLN A N     1 
ATOM   2672  C  CA    . GLN A 1  363  ? 3.395   -19.480 34.329  1.00 48.98  ? 363  GLN A CA    1 
ATOM   2673  C  C     . GLN A 1  363  ? 3.448   -17.923 34.507  1.00 48.67  ? 363  GLN A C     1 
ATOM   2674  O  O     . GLN A 1  363  ? 3.557   -17.432 35.640  1.00 49.17  ? 363  GLN A O     1 
ATOM   2675  C  CB    . GLN A 1  363  ? 2.109   -19.954 33.657  1.00 48.99  ? 363  GLN A CB    1 
ATOM   2676  C  CG    . GLN A 1  363  ? 2.229   -21.359 33.104  1.00 48.87  ? 363  GLN A CG    1 
ATOM   2677  C  CD    . GLN A 1  363  ? 1.190   -21.645 32.063  1.00 48.99  ? 363  GLN A CD    1 
ATOM   2678  O  OE1   . GLN A 1  363  ? -0.011  -21.701 32.368  1.00 49.07  ? 363  GLN A OE1   1 
ATOM   2679  N  NE2   . GLN A 1  363  ? 1.633   -21.812 30.813  1.00 48.58  ? 363  GLN A NE2   1 
ATOM   2680  N  N     . VAL A 1  364  ? 3.307   -17.184 33.388  1.00 47.68  ? 364  VAL A N     1 
ATOM   2681  C  CA    . VAL A 1  364  ? 3.752   -15.782 33.199  1.00 46.51  ? 364  VAL A CA    1 
ATOM   2682  C  C     . VAL A 1  364  ? 2.925   -15.121 32.055  1.00 45.61  ? 364  VAL A C     1 
ATOM   2683  O  O     . VAL A 1  364  ? 3.259   -15.248 30.859  1.00 45.69  ? 364  VAL A O     1 
ATOM   2684  C  CB    . VAL A 1  364  ? 5.333   -15.762 32.842  1.00 46.67  ? 364  VAL A CB    1 
ATOM   2685  C  CG1   . VAL A 1  364  ? 5.589   -15.765 31.338  1.00 46.55  ? 364  VAL A CG1   1 
ATOM   2686  C  CG2   . VAL A 1  364  ? 6.097   -14.584 33.441  1.00 46.56  ? 364  VAL A CG2   1 
ATOM   2687  N  N     . GLY A 1  365  ? 1.853   -14.424 32.389  1.00 44.33  ? 365  GLY A N     1 
ATOM   2688  C  CA    . GLY A 1  365  ? 1.038   -13.793 31.340  1.00 43.06  ? 365  GLY A CA    1 
ATOM   2689  C  C     . GLY A 1  365  ? 1.745   -12.622 30.691  1.00 42.38  ? 365  GLY A C     1 
ATOM   2690  O  O     . GLY A 1  365  ? 1.782   -11.519 31.259  1.00 41.25  ? 365  GLY A O     1 
ATOM   2691  N  N     . VAL A 1  366  ? 2.325   -12.884 29.508  1.00 42.72  ? 366  VAL A N     1 
ATOM   2692  C  CA    . VAL A 1  366  ? 3.151   -11.899 28.722  1.00 42.55  ? 366  VAL A CA    1 
ATOM   2693  C  C     . VAL A 1  366  ? 2.522   -11.289 27.447  1.00 43.90  ? 366  VAL A C     1 
ATOM   2694  O  O     . VAL A 1  366  ? 2.424   -11.973 26.406  1.00 43.80  ? 366  VAL A O     1 
ATOM   2695  C  CB    . VAL A 1  366  ? 4.476   -12.457 28.331  1.00 41.17  ? 366  VAL A CB    1 
ATOM   2696  C  CG1   . VAL A 1  366  ? 5.160   -11.486 27.442  1.00 40.27  ? 366  VAL A CG1   1 
ATOM   2697  C  CG2   . VAL A 1  366  ? 5.276   -12.671 29.549  1.00 40.69  ? 366  VAL A CG2   1 
ATOM   2698  N  N     . PRO A 1  367  ? 2.118   -9.993  27.517  1.00 44.98  ? 367  PRO A N     1 
ATOM   2699  C  CA    . PRO A 1  367  ? 1.293   -9.425  26.458  1.00 45.56  ? 367  PRO A CA    1 
ATOM   2700  C  C     . PRO A 1  367  ? 1.996   -9.583  25.121  1.00 46.49  ? 367  PRO A C     1 
ATOM   2701  O  O     . PRO A 1  367  ? 3.231   -9.379  25.025  1.00 46.57  ? 367  PRO A O     1 
ATOM   2702  C  CB    . PRO A 1  367  ? 1.147   -7.953  26.860  1.00 45.24  ? 367  PRO A CB    1 
ATOM   2703  C  CG    . PRO A 1  367  ? 2.196   -7.695  27.884  1.00 44.99  ? 367  PRO A CG    1 
ATOM   2704  C  CD    . PRO A 1  367  ? 2.440   -8.999  28.561  1.00 45.42  ? 367  PRO A CD    1 
ATOM   2705  N  N     . LYS A 1  368  ? 1.219   -10.004 24.121  1.00 47.32  ? 368  LYS A N     1 
ATOM   2706  C  CA    . LYS A 1  368  ? 1.680   -10.090 22.722  1.00 48.01  ? 368  LYS A CA    1 
ATOM   2707  C  C     . LYS A 1  368  ? 2.668   -8.963  22.384  1.00 48.41  ? 368  LYS A C     1 
ATOM   2708  O  O     . LYS A 1  368  ? 3.839   -9.234  22.068  1.00 48.31  ? 368  LYS A O     1 
ATOM   2709  C  CB    . LYS A 1  368  ? 0.484   -10.062 21.754  1.00 47.87  ? 368  LYS A CB    1 
ATOM   2710  C  CG    . LYS A 1  368  ? 0.594   -11.049 20.612  1.00 48.43  ? 368  LYS A CG    1 
ATOM   2711  C  CD    . LYS A 1  368  ? -0.665  -11.946 20.434  1.00 49.33  ? 368  LYS A CD    1 
ATOM   2712  C  CE    . LYS A 1  368  ? -1.690  -11.351 19.432  1.00 50.97  ? 368  LYS A CE    1 
ATOM   2713  N  NZ    . LYS A 1  368  ? -2.594  -12.385 18.817  1.00 50.00  ? 368  LYS A NZ    1 
ATOM   2714  N  N     . SER A 1  369  ? 2.187   -7.718  22.481  1.00 48.62  ? 369  SER A N     1 
ATOM   2715  C  CA    . SER A 1  369  ? 2.996   -6.512  22.298  1.00 49.45  ? 369  SER A CA    1 
ATOM   2716  C  C     . SER A 1  369  ? 4.472   -6.637  22.792  1.00 50.10  ? 369  SER A C     1 
ATOM   2717  O  O     . SER A 1  369  ? 5.445   -6.270  22.065  1.00 49.90  ? 369  SER A O     1 
ATOM   2718  C  CB    . SER A 1  369  ? 2.259   -5.320  22.930  1.00 49.18  ? 369  SER A CB    1 
ATOM   2719  O  OG    . SER A 1  369  ? 3.118   -4.288  23.401  1.00 50.07  ? 369  SER A OG    1 
ATOM   2720  N  N     . ILE A 1  370  ? 4.619   -7.173  24.011  1.00 50.44  ? 370  ILE A N     1 
ATOM   2721  C  CA    . ILE A 1  370  ? 5.928   -7.355  24.646  1.00 50.83  ? 370  ILE A CA    1 
ATOM   2722  C  C     . ILE A 1  370  ? 6.718   -8.503  23.957  1.00 52.33  ? 370  ILE A C     1 
ATOM   2723  O  O     . ILE A 1  370  ? 7.866   -8.313  23.447  1.00 51.68  ? 370  ILE A O     1 
ATOM   2724  C  CB    . ILE A 1  370  ? 5.784   -7.508  26.197  1.00 49.81  ? 370  ILE A CB    1 
ATOM   2725  C  CG1   . ILE A 1  370  ? 5.566   -6.131  26.811  1.00 47.46  ? 370  ILE A CG1   1 
ATOM   2726  C  CG2   . ILE A 1  370  ? 6.997   -8.141  26.829  1.00 49.71  ? 370  ILE A CG2   1 
ATOM   2727  C  CD1   . ILE A 1  370  ? 6.439   -5.805  27.961  1.00 43.23  ? 370  ILE A CD1   1 
ATOM   2728  N  N     . ALA A 1  371  ? 6.066   -9.672  23.913  1.00 53.57  ? 371  ALA A N     1 
ATOM   2729  C  CA    . ALA A 1  371  ? 6.622   -10.863 23.264  1.00 54.47  ? 371  ALA A CA    1 
ATOM   2730  C  C     . ALA A 1  371  ? 6.821   -10.629 21.766  1.00 54.91  ? 371  ALA A C     1 
ATOM   2731  O  O     . ALA A 1  371  ? 7.514   -11.399 21.089  1.00 54.86  ? 371  ALA A O     1 
ATOM   2732  C  CB    . ALA A 1  371  ? 5.725   -12.084 23.527  1.00 54.39  ? 371  ALA A CB    1 
ATOM   2733  N  N     . LYS A 1  372  ? 6.212   -9.556  21.272  1.00 55.50  ? 372  LYS A N     1 
ATOM   2734  C  CA    . LYS A 1  372  ? 6.369   -9.151  19.898  1.00 56.65  ? 372  LYS A CA    1 
ATOM   2735  C  C     . LYS A 1  372  ? 7.759   -8.499  19.610  1.00 57.27  ? 372  LYS A C     1 
ATOM   2736  O  O     . LYS A 1  372  ? 8.171   -8.370  18.435  1.00 56.59  ? 372  LYS A O     1 
ATOM   2737  C  CB    . LYS A 1  372  ? 5.191   -8.251  19.484  1.00 57.01  ? 372  LYS A CB    1 
ATOM   2738  C  CG    . LYS A 1  372  ? 3.883   -8.983  19.010  1.00 56.49  ? 372  LYS A CG    1 
ATOM   2739  C  CD    . LYS A 1  372  ? 3.299   -8.267  17.752  1.00 55.93  ? 372  LYS A CD    1 
ATOM   2740  C  CE    . LYS A 1  372  ? 1.839   -7.834  17.915  1.00 55.64  ? 372  LYS A CE    1 
ATOM   2741  N  NZ    . LYS A 1  372  ? 1.495   -6.567  17.175  1.00 54.43  ? 372  LYS A NZ    1 
ATOM   2742  N  N     . THR A 1  373  ? 8.478   -8.151  20.692  1.00 58.16  ? 373  THR A N     1 
ATOM   2743  C  CA    . THR A 1  373  ? 9.755   -7.376  20.644  1.00 58.73  ? 373  THR A CA    1 
ATOM   2744  C  C     . THR A 1  373  ? 11.037  -8.094  21.104  1.00 58.79  ? 373  THR A C     1 
ATOM   2745  O  O     . THR A 1  373  ? 12.044  -8.060  20.388  1.00 59.12  ? 373  THR A O     1 
ATOM   2746  C  CB    . THR A 1  373  ? 9.673   -6.130  21.520  1.00 58.73  ? 373  THR A CB    1 
ATOM   2747  O  OG1   . THR A 1  373  ? 8.294   -5.733  21.674  1.00 60.64  ? 373  THR A OG1   1 
ATOM   2748  C  CG2   . THR A 1  373  ? 10.534  -5.020  20.935  1.00 57.86  ? 373  THR A CG2   1 
ATOM   2749  N  N     . LEU A 1  374  ? 10.994  -8.691  22.307  1.00 58.74  ? 374  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1  374  ? 12.098  -9.472  22.908  1.00 58.32  ? 374  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1  374  ? 12.496  -10.613 21.986  1.00 58.86  ? 374  LEU A C     1 
ATOM   2752  O  O     . LEU A 1  374  ? 11.723  -11.031 21.149  1.00 58.65  ? 374  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1  374  ? 11.675  -10.023 24.274  1.00 57.78  ? 374  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1  374  ? 11.149  -8.993  25.274  1.00 56.15  ? 374  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1  374  ? 9.800   -9.336  25.798  1.00 53.89  ? 374  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1  374  ? 12.105  -8.829  26.397  1.00 54.69  ? 374  LEU A CD2   1 
ATOM   2757  N  N     . THR A 1  375  ? 13.698  -11.131 22.120  1.00 60.05  ? 375  THR A N     1 
ATOM   2758  C  CA    . THR A 1  375  ? 14.165  -12.014 21.073  1.00 61.63  ? 375  THR A CA    1 
ATOM   2759  C  C     . THR A 1  375  ? 15.296  -12.982 21.465  1.00 62.84  ? 375  THR A C     1 
ATOM   2760  O  O     . THR A 1  375  ? 16.416  -12.574 21.792  1.00 63.16  ? 375  THR A O     1 
ATOM   2761  C  CB    . THR A 1  375  ? 14.464  -11.213 19.744  1.00 61.37  ? 375  THR A CB    1 
ATOM   2762  O  OG1   . THR A 1  375  ? 14.973  -12.097 18.739  1.00 61.77  ? 375  THR A OG1   1 
ATOM   2763  C  CG2   . THR A 1  375  ? 15.455  -10.073 19.966  1.00 61.51  ? 375  THR A CG2   1 
ATOM   2764  N  N     . TYR A 1  376  ? 14.985  -14.270 21.404  1.00 64.03  ? 376  TYR A N     1 
ATOM   2765  C  CA    . TYR A 1  376  ? 15.967  -15.302 21.634  1.00 65.36  ? 376  TYR A CA    1 
ATOM   2766  C  C     . TYR A 1  376  ? 16.701  -15.762 20.352  1.00 66.39  ? 376  TYR A C     1 
ATOM   2767  O  O     . TYR A 1  376  ? 16.064  -16.180 19.386  1.00 66.14  ? 376  TYR A O     1 
ATOM   2768  C  CB    . TYR A 1  376  ? 15.266  -16.462 22.314  1.00 65.64  ? 376  TYR A CB    1 
ATOM   2769  C  CG    . TYR A 1  376  ? 16.142  -17.656 22.610  1.00 65.97  ? 376  TYR A CG    1 
ATOM   2770  C  CD1   . TYR A 1  376  ? 16.094  -18.275 23.854  1.00 65.57  ? 376  TYR A CD1   1 
ATOM   2771  C  CD2   . TYR A 1  376  ? 16.987  -18.184 21.639  1.00 64.75  ? 376  TYR A CD2   1 
ATOM   2772  C  CE1   . TYR A 1  376  ? 16.864  -19.354 24.116  1.00 65.19  ? 376  TYR A CE1   1 
ATOM   2773  C  CE2   . TYR A 1  376  ? 17.757  -19.258 21.897  1.00 65.33  ? 376  TYR A CE2   1 
ATOM   2774  C  CZ    . TYR A 1  376  ? 17.691  -19.851 23.135  1.00 66.03  ? 376  TYR A CZ    1 
ATOM   2775  O  OH    . TYR A 1  376  ? 18.477  -20.952 23.385  1.00 67.58  ? 376  TYR A OH    1 
ATOM   2776  N  N     . PRO A 1  377  ? 18.049  -15.696 20.354  1.00 67.77  ? 377  PRO A N     1 
ATOM   2777  C  CA    . PRO A 1  377  ? 18.868  -16.149 19.227  1.00 68.76  ? 377  PRO A CA    1 
ATOM   2778  C  C     . PRO A 1  377  ? 19.005  -17.659 19.177  1.00 69.66  ? 377  PRO A C     1 
ATOM   2779  O  O     . PRO A 1  377  ? 19.662  -18.262 20.038  1.00 69.69  ? 377  PRO A O     1 
ATOM   2780  C  CB    . PRO A 1  377  ? 20.240  -15.504 19.483  1.00 68.91  ? 377  PRO A CB    1 
ATOM   2781  C  CG    . PRO A 1  377  ? 20.300  -15.268 20.940  1.00 68.89  ? 377  PRO A CG    1 
ATOM   2782  C  CD    . PRO A 1  377  ? 18.876  -15.169 21.457  1.00 68.24  ? 377  PRO A CD    1 
ATOM   2783  N  N     . GLU A 1  378  ? 18.394  -18.239 18.143  1.00 70.77  ? 378  GLU A N     1 
ATOM   2784  C  CA    . GLU A 1  378  ? 18.295  -19.687 17.935  1.00 71.59  ? 378  GLU A CA    1 
ATOM   2785  C  C     . GLU A 1  378  ? 19.091  -20.108 16.710  1.00 72.08  ? 378  GLU A C     1 
ATOM   2786  O  O     . GLU A 1  378  ? 19.177  -19.349 15.743  1.00 71.76  ? 378  GLU A O     1 
ATOM   2787  C  CB    . GLU A 1  378  ? 16.823  -20.052 17.733  1.00 71.63  ? 378  GLU A CB    1 
ATOM   2788  C  CG    . GLU A 1  378  ? 16.506  -21.527 17.802  1.00 71.49  ? 378  GLU A CG    1 
ATOM   2789  C  CD    . GLU A 1  378  ? 15.067  -21.788 18.207  1.00 71.28  ? 378  GLU A CD    1 
ATOM   2790  O  OE1   . GLU A 1  378  ? 14.398  -20.866 18.733  1.00 70.04  ? 378  GLU A OE1   1 
ATOM   2791  O  OE2   . GLU A 1  378  ? 14.616  -22.931 18.008  1.00 71.26  ? 378  GLU A OE2   1 
ATOM   2792  N  N     . VAL A 1  379  ? 19.651  -21.316 16.740  1.00 73.08  ? 379  VAL A N     1 
ATOM   2793  C  CA    . VAL A 1  379  ? 20.439  -21.796 15.597  1.00 74.40  ? 379  VAL A CA    1 
ATOM   2794  C  C     . VAL A 1  379  ? 19.656  -22.686 14.611  1.00 75.65  ? 379  VAL A C     1 
ATOM   2795  O  O     . VAL A 1  379  ? 18.800  -23.481 15.021  1.00 75.83  ? 379  VAL A O     1 
ATOM   2796  C  CB    . VAL A 1  379  ? 21.763  -22.478 16.016  1.00 74.09  ? 379  VAL A CB    1 
ATOM   2797  C  CG1   . VAL A 1  379  ? 22.751  -22.495 14.847  1.00 73.51  ? 379  VAL A CG1   1 
ATOM   2798  C  CG2   . VAL A 1  379  ? 22.381  -21.753 17.185  1.00 74.27  ? 379  VAL A CG2   1 
ATOM   2799  N  N     . VAL A 1  380  ? 19.958  -22.515 13.312  1.00 76.98  ? 380  VAL A N     1 
ATOM   2800  C  CA    . VAL A 1  380  ? 19.499  -23.395 12.225  1.00 77.87  ? 380  VAL A CA    1 
ATOM   2801  C  C     . VAL A 1  380  ? 20.051  -24.781 12.484  1.00 78.69  ? 380  VAL A C     1 
ATOM   2802  O  O     . VAL A 1  380  ? 21.275  -24.991 12.489  1.00 78.69  ? 380  VAL A O     1 
ATOM   2803  C  CB    . VAL A 1  380  ? 20.020  -22.964 10.822  1.00 77.66  ? 380  VAL A CB    1 
ATOM   2804  C  CG1   . VAL A 1  380  ? 19.449  -23.861 9.740   1.00 77.19  ? 380  VAL A CG1   1 
ATOM   2805  C  CG2   . VAL A 1  380  ? 19.656  -21.553 10.521  1.00 78.14  ? 380  VAL A CG2   1 
ATOM   2806  N  N     . THR A 1  381  ? 19.140  -25.724 12.693  1.00 79.56  ? 381  THR A N     1 
ATOM   2807  C  CA    . THR A 1  381  ? 19.521  -27.076 13.044  1.00 80.37  ? 381  THR A CA    1 
ATOM   2808  C  C     . THR A 1  381  ? 18.490  -28.067 12.476  1.00 80.88  ? 381  THR A C     1 
ATOM   2809  O  O     . THR A 1  381  ? 17.298  -27.792 12.498  1.00 80.87  ? 381  THR A O     1 
ATOM   2810  C  CB    . THR A 1  381  ? 19.761  -27.174 14.587  1.00 80.32  ? 381  THR A CB    1 
ATOM   2811  O  OG1   . THR A 1  381  ? 20.817  -28.099 14.865  1.00 80.93  ? 381  THR A OG1   1 
ATOM   2812  C  CG2   . THR A 1  381  ? 18.487  -27.511 15.383  1.00 80.29  ? 381  THR A CG2   1 
ATOM   2813  N  N     . PRO A 1  382  ? 18.947  -29.210 11.931  1.00 81.53  ? 382  PRO A N     1 
ATOM   2814  C  CA    . PRO A 1  382  ? 18.002  -30.113 11.261  1.00 81.82  ? 382  PRO A CA    1 
ATOM   2815  C  C     . PRO A 1  382  ? 16.648  -30.240 11.967  1.00 81.91  ? 382  PRO A C     1 
ATOM   2816  O  O     . PRO A 1  382  ? 15.617  -30.364 11.313  1.00 81.58  ? 382  PRO A O     1 
ATOM   2817  C  CB    . PRO A 1  382  ? 18.743  -31.458 11.266  1.00 82.16  ? 382  PRO A CB    1 
ATOM   2818  C  CG    . PRO A 1  382  ? 20.210  -31.108 11.294  1.00 81.91  ? 382  PRO A CG    1 
ATOM   2819  C  CD    . PRO A 1  382  ? 20.334  -29.727 11.907  1.00 81.61  ? 382  PRO A CD    1 
ATOM   2820  N  N     . TYR A 1  383  ? 16.667  -30.185 13.292  1.00 82.39  ? 383  TYR A N     1 
ATOM   2821  C  CA    . TYR A 1  383  ? 15.476  -30.404 14.101  1.00 83.42  ? 383  TYR A CA    1 
ATOM   2822  C  C     . TYR A 1  383  ? 14.449  -29.257 14.040  1.00 83.63  ? 383  TYR A C     1 
ATOM   2823  O  O     . TYR A 1  383  ? 13.272  -29.469 14.362  1.00 83.87  ? 383  TYR A O     1 
ATOM   2824  C  CB    . TYR A 1  383  ? 15.869  -30.683 15.567  1.00 83.89  ? 383  TYR A CB    1 
ATOM   2825  C  CG    . TYR A 1  383  ? 17.191  -31.394 15.719  1.00 84.66  ? 383  TYR A CG    1 
ATOM   2826  C  CD1   . TYR A 1  383  ? 18.210  -30.854 16.501  1.00 85.50  ? 383  TYR A CD1   1 
ATOM   2827  C  CD2   . TYR A 1  383  ? 17.437  -32.602 15.059  1.00 85.84  ? 383  TYR A CD2   1 
ATOM   2828  C  CE1   . TYR A 1  383  ? 19.462  -31.511 16.627  1.00 86.05  ? 383  TYR A CE1   1 
ATOM   2829  C  CE2   . TYR A 1  383  ? 18.681  -33.263 15.174  1.00 86.33  ? 383  TYR A CE2   1 
ATOM   2830  C  CZ    . TYR A 1  383  ? 19.685  -32.714 15.958  1.00 85.41  ? 383  TYR A CZ    1 
ATOM   2831  O  OH    . TYR A 1  383  ? 20.888  -33.372 16.073  1.00 84.32  ? 383  TYR A OH    1 
ATOM   2832  N  N     . ASN A 1  384  ? 14.888  -28.061 13.625  1.00 83.61  ? 384  ASN A N     1 
ATOM   2833  C  CA    . ASN A 1  384  ? 14.070  -26.828 13.733  1.00 83.16  ? 384  ASN A CA    1 
ATOM   2834  C  C     . ASN A 1  384  ? 13.708  -26.054 12.446  1.00 83.08  ? 384  ASN A C     1 
ATOM   2835  O  O     . ASN A 1  384  ? 12.739  -25.287 12.452  1.00 83.22  ? 384  ASN A O     1 
ATOM   2836  C  CB    . ASN A 1  384  ? 14.652  -25.864 14.792  1.00 82.93  ? 384  ASN A CB    1 
ATOM   2837  C  CG    . ASN A 1  384  ? 15.989  -25.204 14.369  1.00 82.61  ? 384  ASN A CG    1 
ATOM   2838  O  OD1   . ASN A 1  384  ? 16.439  -25.291 13.227  1.00 81.13  ? 384  ASN A OD1   1 
ATOM   2839  N  ND2   . ASN A 1  384  ? 16.616  -24.527 15.322  1.00 83.23  ? 384  ASN A ND2   1 
ATOM   2840  N  N     . ILE A 1  385  ? 14.465  -26.253 11.362  1.00 82.77  ? 385  ILE A N     1 
ATOM   2841  C  CA    . ILE A 1  385  ? 14.310  -25.443 10.145  1.00 82.33  ? 385  ILE A CA    1 
ATOM   2842  C  C     . ILE A 1  385  ? 12.848  -25.365 9.744   1.00 82.55  ? 385  ILE A C     1 
ATOM   2843  O  O     . ILE A 1  385  ? 12.391  -24.310 9.337   1.00 82.70  ? 385  ILE A O     1 
ATOM   2844  C  CB    . ILE A 1  385  ? 15.145  -25.958 8.937   1.00 82.18  ? 385  ILE A CB    1 
ATOM   2845  C  CG1   . ILE A 1  385  ? 16.455  -26.581 9.388   1.00 82.05  ? 385  ILE A CG1   1 
ATOM   2846  C  CG2   . ILE A 1  385  ? 15.453  -24.837 7.957   1.00 81.35  ? 385  ILE A CG2   1 
ATOM   2847  C  CD1   . ILE A 1  385  ? 16.992  -27.529 8.389   1.00 82.48  ? 385  ILE A CD1   1 
ATOM   2848  N  N     . ASP A 1  386  ? 12.116  -26.474 9.885   1.00 82.77  ? 386  ASP A N     1 
ATOM   2849  C  CA    . ASP A 1  386  ? 10.667  -26.525 9.558   1.00 82.95  ? 386  ASP A CA    1 
ATOM   2850  C  C     . ASP A 1  386  ? 9.777   -25.586 10.390  1.00 82.21  ? 386  ASP A C     1 
ATOM   2851  O  O     . ASP A 1  386  ? 8.842   -24.979 9.857   1.00 81.90  ? 386  ASP A O     1 
ATOM   2852  C  CB    . ASP A 1  386  ? 10.124  -27.963 9.636   1.00 83.55  ? 386  ASP A CB    1 
ATOM   2853  C  CG    . ASP A 1  386  ? 10.524  -28.815 8.425   1.00 84.76  ? 386  ASP A CG    1 
ATOM   2854  O  OD1   . ASP A 1  386  ? 9.654   -29.558 7.893   1.00 85.14  ? 386  ASP A OD1   1 
ATOM   2855  O  OD2   . ASP A 1  386  ? 11.706  -28.740 8.010   1.00 86.53  ? 386  ASP A OD2   1 
ATOM   2856  N  N     . ARG A 1  387  ? 10.056  -25.494 11.687  1.00 81.36  ? 387  ARG A N     1 
ATOM   2857  C  CA    . ARG A 1  387  ? 9.481   -24.441 12.480  1.00 80.90  ? 387  ARG A CA    1 
ATOM   2858  C  C     . ARG A 1  387  ? 10.143  -23.194 11.970  1.00 79.95  ? 387  ARG A C     1 
ATOM   2859  O  O     . ARG A 1  387  ? 9.605   -22.535 11.095  1.00 80.03  ? 387  ARG A O     1 
ATOM   2860  C  CB    . ARG A 1  387  ? 9.759   -24.631 13.968  1.00 81.09  ? 387  ARG A CB    1 
ATOM   2861  C  CG    . ARG A 1  387  ? 8.990   -23.663 14.904  1.00 81.77  ? 387  ARG A CG    1 
ATOM   2862  C  CD    . ARG A 1  387  ? 9.287   -23.982 16.379  1.00 82.22  ? 387  ARG A CD    1 
ATOM   2863  N  NE    . ARG A 1  387  ? 10.675  -24.428 16.539  1.00 84.84  ? 387  ARG A NE    1 
ATOM   2864  C  CZ    . ARG A 1  387  ? 11.660  -23.708 17.076  1.00 85.60  ? 387  ARG A CZ    1 
ATOM   2865  N  NH1   . ARG A 1  387  ? 11.435  -22.489 17.565  1.00 85.41  ? 387  ARG A NH1   1 
ATOM   2866  N  NH2   . ARG A 1  387  ? 12.880  -24.226 17.138  1.00 86.29  ? 387  ARG A NH2   1 
ATOM   2867  N  N     . LEU A 1  388  ? 11.344  -22.912 12.458  1.00 79.08  ? 388  LEU A N     1 
ATOM   2868  C  CA    . LEU A 1  388  ? 11.995  -21.630 12.179  1.00 78.38  ? 388  LEU A CA    1 
ATOM   2869  C  C     . LEU A 1  388  ? 11.762  -21.008 10.780  1.00 78.16  ? 388  LEU A C     1 
ATOM   2870  O  O     . LEU A 1  388  ? 11.296  -19.873 10.700  1.00 78.10  ? 388  LEU A O     1 
ATOM   2871  C  CB    . LEU A 1  388  ? 13.480  -21.657 12.572  1.00 78.30  ? 388  LEU A CB    1 
ATOM   2872  C  CG    . LEU A 1  388  ? 13.784  -21.128 13.979  1.00 77.06  ? 388  LEU A CG    1 
ATOM   2873  C  CD1   . LEU A 1  388  ? 15.141  -21.547 14.507  1.00 76.51  ? 388  LEU A CD1   1 
ATOM   2874  C  CD2   . LEU A 1  388  ? 13.692  -19.636 13.960  1.00 76.21  ? 388  LEU A CD2   1 
ATOM   2875  N  N     . THR A 1  389  ? 12.054  -21.738 9.697   1.00 77.63  ? 389  THR A N     1 
ATOM   2876  C  CA    . THR A 1  389  ? 11.851  -21.209 8.332   1.00 77.10  ? 389  THR A CA    1 
ATOM   2877  C  C     . THR A 1  389  ? 10.478  -20.558 8.175   1.00 76.85  ? 389  THR A C     1 
ATOM   2878  O  O     . THR A 1  389  ? 10.367  -19.466 7.616   1.00 76.74  ? 389  THR A O     1 
ATOM   2879  C  CB    . THR A 1  389  ? 12.197  -22.252 7.195   1.00 77.14  ? 389  THR A CB    1 
ATOM   2880  O  OG1   . THR A 1  389  ? 13.310  -21.780 6.414   1.00 76.84  ? 389  THR A OG1   1 
ATOM   2881  C  CG2   . THR A 1  389  ? 11.027  -22.509 6.260   1.00 77.03  ? 389  THR A CG2   1 
ATOM   2882  N  N     . GLN A 1  390  ? 9.453   -21.220 8.702   1.00 76.64  ? 390  GLN A N     1 
ATOM   2883  C  CA    . GLN A 1  390  ? 8.101   -20.680 8.708   1.00 76.71  ? 390  GLN A CA    1 
ATOM   2884  C  C     . GLN A 1  390  ? 8.015   -19.387 9.529   1.00 76.76  ? 390  GLN A C     1 
ATOM   2885  O  O     . GLN A 1  390  ? 7.285   -18.460 9.162   1.00 76.88  ? 390  GLN A O     1 
ATOM   2886  C  CB    . GLN A 1  390  ? 7.106   -21.739 9.212   1.00 76.81  ? 390  GLN A CB    1 
ATOM   2887  C  CG    . GLN A 1  390  ? 5.922   -21.198 10.031  1.00 76.54  ? 390  GLN A CG    1 
ATOM   2888  C  CD    . GLN A 1  390  ? 4.588   -21.724 9.548   1.00 76.46  ? 390  GLN A CD    1 
ATOM   2889  O  OE1   . GLN A 1  390  ? 4.421   -22.928 9.360   1.00 76.23  ? 390  GLN A OE1   1 
ATOM   2890  N  NE2   . GLN A 1  390  ? 3.626   -20.821 9.342   1.00 76.73  ? 390  GLN A NE2   1 
ATOM   2891  N  N     . LEU A 1  391  ? 8.769   -19.331 10.626  1.00 76.67  ? 391  LEU A N     1 
ATOM   2892  C  CA    . LEU A 1  391  ? 8.781   -18.167 11.505  1.00 76.70  ? 391  LEU A CA    1 
ATOM   2893  C  C     . LEU A 1  391  ? 9.319   -16.932 10.792  1.00 76.70  ? 391  LEU A C     1 
ATOM   2894  O  O     . LEU A 1  391  ? 8.726   -15.863 10.897  1.00 76.78  ? 391  LEU A O     1 
ATOM   2895  C  CB    . LEU A 1  391  ? 9.574   -18.451 12.789  1.00 76.77  ? 391  LEU A CB    1 
ATOM   2896  C  CG    . LEU A 1  391  ? 8.982   -19.427 13.832  1.00 77.08  ? 391  LEU A CG    1 
ATOM   2897  C  CD1   . LEU A 1  391  ? 10.033  -19.971 14.798  1.00 76.45  ? 391  LEU A CD1   1 
ATOM   2898  C  CD2   . LEU A 1  391  ? 7.881   -18.779 14.648  1.00 77.46  ? 391  LEU A CD2   1 
ATOM   2899  N  N     . VAL A 1  392  ? 10.417  -17.087 10.050  1.00 76.81  ? 392  VAL A N     1 
ATOM   2900  C  CA    . VAL A 1  392  ? 11.013  -15.974 9.289   1.00 76.89  ? 392  VAL A CA    1 
ATOM   2901  C  C     . VAL A 1  392  ? 10.051  -15.428 8.219   1.00 77.49  ? 392  VAL A C     1 
ATOM   2902  O  O     . VAL A 1  392  ? 9.922   -14.212 8.061   1.00 77.77  ? 392  VAL A O     1 
ATOM   2903  C  CB    . VAL A 1  392  ? 12.390  -16.320 8.657   1.00 76.55  ? 392  VAL A CB    1 
ATOM   2904  C  CG1   . VAL A 1  392  ? 13.083  -15.075 8.232   1.00 75.96  ? 392  VAL A CG1   1 
ATOM   2905  C  CG2   . VAL A 1  392  ? 13.280  -17.016 9.642   1.00 76.24  ? 392  VAL A CG2   1 
ATOM   2906  N  N     . ARG A 1  393  ? 9.368   -16.317 7.497   1.00 77.98  ? 393  ARG A N     1 
ATOM   2907  C  CA    . ARG A 1  393  ? 8.283   -15.887 6.597   1.00 78.37  ? 393  ARG A CA    1 
ATOM   2908  C  C     . ARG A 1  393  ? 7.156   -15.235 7.390   1.00 77.77  ? 393  ARG A C     1 
ATOM   2909  O  O     . ARG A 1  393  ? 6.657   -14.177 7.016   1.00 77.55  ? 393  ARG A O     1 
ATOM   2910  C  CB    . ARG A 1  393  ? 7.748   -17.042 5.734   1.00 78.54  ? 393  ARG A CB    1 
ATOM   2911  C  CG    . ARG A 1  393  ? 8.603   -17.345 4.490   1.00 79.37  ? 393  ARG A CG    1 
ATOM   2912  C  CD    . ARG A 1  393  ? 7.994   -18.464 3.655   1.00 79.68  ? 393  ARG A CD    1 
ATOM   2913  N  NE    . ARG A 1  393  ? 8.894   -18.913 2.590   1.00 82.84  ? 393  ARG A NE    1 
ATOM   2914  C  CZ    . ARG A 1  393  ? 8.894   -20.140 2.064   1.00 84.28  ? 393  ARG A CZ    1 
ATOM   2915  N  NH1   . ARG A 1  393  ? 8.044   -21.060 2.518   1.00 85.27  ? 393  ARG A NH1   1 
ATOM   2916  N  NH2   . ARG A 1  393  ? 9.751   -20.456 1.091   1.00 84.26  ? 393  ARG A NH2   1 
ATOM   2917  N  N     . ASN A 1  394  ? 6.797   -15.846 8.512   1.00 77.51  ? 394  ASN A N     1 
ATOM   2918  C  CA    . ASN A 1  394  ? 5.735   -15.313 9.348   1.00 77.44  ? 394  ASN A CA    1 
ATOM   2919  C  C     . ASN A 1  394  ? 5.946   -13.867 9.818   1.00 77.41  ? 394  ASN A C     1 
ATOM   2920  O  O     . ASN A 1  394  ? 5.026   -13.237 10.380  1.00 77.53  ? 394  ASN A O     1 
ATOM   2921  C  CB    . ASN A 1  394  ? 5.439   -16.233 10.521  1.00 77.24  ? 394  ASN A CB    1 
ATOM   2922  C  CG    . ASN A 1  394  ? 3.969   -16.263 10.856  1.00 77.29  ? 394  ASN A CG    1 
ATOM   2923  O  OD1   . ASN A 1  394  ? 3.153   -15.574 10.226  1.00 76.74  ? 394  ASN A OD1   1 
ATOM   2924  N  ND2   . ASN A 1  394  ? 3.612   -17.065 11.846  1.00 77.55  ? 394  ASN A ND2   1 
ATOM   2925  N  N     . GLY A 1  395  ? 7.154   -13.357 9.574   1.00 77.06  ? 395  GLY A N     1 
ATOM   2926  C  CA    . GLY A 1  395  ? 7.433   -11.927 9.635   1.00 76.69  ? 395  GLY A CA    1 
ATOM   2927  C  C     . GLY A 1  395  ? 7.378   -11.212 10.985  1.00 76.32  ? 395  GLY A C     1 
ATOM   2928  O  O     . GLY A 1  395  ? 6.608   -11.590 11.878  1.00 75.76  ? 395  GLY A O     1 
ATOM   2929  N  N     . PRO A 1  396  ? 8.191   -10.138 11.119  1.00 76.06  ? 396  PRO A N     1 
ATOM   2930  C  CA    . PRO A 1  396  ? 8.353   -9.403  12.366  1.00 75.40  ? 396  PRO A CA    1 
ATOM   2931  C  C     . PRO A 1  396  ? 7.105   -8.756  12.897  1.00 74.91  ? 396  PRO A C     1 
ATOM   2932  O  O     . PRO A 1  396  ? 7.225   -7.979  13.821  1.00 74.21  ? 396  PRO A O     1 
ATOM   2933  C  CB    . PRO A 1  396  ? 9.372   -8.305  12.000  1.00 75.42  ? 396  PRO A CB    1 
ATOM   2934  C  CG    . PRO A 1  396  ? 10.050  -8.770  10.764  1.00 75.06  ? 396  PRO A CG    1 
ATOM   2935  C  CD    . PRO A 1  396  ? 9.039   -9.581  10.037  1.00 75.86  ? 396  PRO A CD    1 
ATOM   2936  N  N     . ASN A 1  397  ? 5.927   -9.045  12.346  1.00 75.46  ? 397  ASN A N     1 
ATOM   2937  C  CA    . ASN A 1  397  ? 4.709   -8.350  12.840  1.00 76.82  ? 397  ASN A CA    1 
ATOM   2938  C  C     . ASN A 1  397  ? 3.455   -9.116  13.357  1.00 76.92  ? 397  ASN A C     1 
ATOM   2939  O  O     . ASN A 1  397  ? 2.878   -8.697  14.374  1.00 76.83  ? 397  ASN A O     1 
ATOM   2940  C  CB    . ASN A 1  397  ? 4.333   -7.176  11.925  1.00 77.11  ? 397  ASN A CB    1 
ATOM   2941  C  CG    . ASN A 1  397  ? 5.477   -6.170  11.778  1.00 78.79  ? 397  ASN A CG    1 
ATOM   2942  O  OD1   . ASN A 1  397  ? 6.599   -6.434  12.218  1.00 79.67  ? 397  ASN A OD1   1 
ATOM   2943  N  ND2   . ASN A 1  397  ? 5.201   -5.021  11.153  1.00 80.58  ? 397  ASN A ND2   1 
ATOM   2944  N  N     . GLU A 1  398  ? 3.043   -10.201 12.672  1.00 77.16  ? 398  GLU A N     1 
ATOM   2945  C  CA    . GLU A 1  398  ? 2.043   -11.182 13.204  1.00 76.89  ? 398  GLU A CA    1 
ATOM   2946  C  C     . GLU A 1  398  ? 2.755   -11.936 14.343  1.00 75.97  ? 398  GLU A C     1 
ATOM   2947  O  O     . GLU A 1  398  ? 3.981   -11.849 14.426  1.00 75.49  ? 398  GLU A O     1 
ATOM   2948  C  CB    . GLU A 1  398  ? 1.529   -12.160 12.096  1.00 77.26  ? 398  GLU A CB    1 
ATOM   2949  C  CG    . GLU A 1  398  ? 0.102   -12.817 12.358  1.00 77.63  ? 398  GLU A CG    1 
ATOM   2950  C  CD    . GLU A 1  398  ? -0.190  -14.143 11.573  1.00 77.66  ? 398  GLU A CD    1 
ATOM   2951  O  OE1   . GLU A 1  398  ? -0.571  -14.080 10.380  1.00 78.76  ? 398  GLU A OE1   1 
ATOM   2952  O  OE2   . GLU A 1  398  ? -0.090  -15.250 12.165  1.00 77.48  ? 398  GLU A OE2   1 
ATOM   2953  N  N     . HIS A 1  399  ? 2.046   -12.660 15.223  1.00 75.03  ? 399  HIS A N     1 
ATOM   2954  C  CA    . HIS A 1  399  ? 2.811   -13.307 16.310  1.00 74.08  ? 399  HIS A CA    1 
ATOM   2955  C  C     . HIS A 1  399  ? 4.003   -14.264 15.934  1.00 73.01  ? 399  HIS A C     1 
ATOM   2956  O  O     . HIS A 1  399  ? 5.063   -13.763 15.561  1.00 72.54  ? 399  HIS A O     1 
ATOM   2957  C  CB    . HIS A 1  399  ? 2.015   -13.787 17.534  1.00 73.97  ? 399  HIS A CB    1 
ATOM   2958  C  CG    . HIS A 1  399  ? 2.922   -14.314 18.604  1.00 74.56  ? 399  HIS A CG    1 
ATOM   2959  N  ND1   . HIS A 1  399  ? 3.804   -13.503 19.285  1.00 74.73  ? 399  HIS A ND1   1 
ATOM   2960  C  CD2   . HIS A 1  399  ? 3.183   -15.576 19.018  1.00 75.67  ? 399  HIS A CD2   1 
ATOM   2961  C  CE1   . HIS A 1  399  ? 4.532   -14.235 20.109  1.00 75.23  ? 399  HIS A CE1   1 
ATOM   2962  N  NE2   . HIS A 1  399  ? 4.174   -15.497 19.966  1.00 76.16  ? 399  HIS A NE2   1 
ATOM   2963  N  N     . PRO A 1  400  ? 3.845   -15.611 16.025  1.00 72.00  ? 400  PRO A N     1 
ATOM   2964  C  CA    . PRO A 1  400  ? 5.101   -16.371 16.139  1.00 71.51  ? 400  PRO A CA    1 
ATOM   2965  C  C     . PRO A 1  400  ? 6.099   -16.142 14.967  1.00 71.01  ? 400  PRO A C     1 
ATOM   2966  O  O     . PRO A 1  400  ? 6.063   -16.850 13.959  1.00 70.84  ? 400  PRO A O     1 
ATOM   2967  C  CB    . PRO A 1  400  ? 4.623   -17.828 16.252  1.00 71.38  ? 400  PRO A CB    1 
ATOM   2968  C  CG    . PRO A 1  400  ? 3.182   -17.731 16.648  1.00 71.14  ? 400  PRO A CG    1 
ATOM   2969  C  CD    . PRO A 1  400  ? 2.677   -16.510 15.980  1.00 71.72  ? 400  PRO A CD    1 
ATOM   2970  N  N     . GLY A 1  401  ? 6.980   -15.151 15.128  1.00 70.32  ? 401  GLY A N     1 
ATOM   2971  C  CA    . GLY A 1  401  ? 7.832   -14.661 14.046  1.00 69.71  ? 401  GLY A CA    1 
ATOM   2972  C  C     . GLY A 1  401  ? 9.102   -13.991 14.523  1.00 69.30  ? 401  GLY A C     1 
ATOM   2973  O  O     . GLY A 1  401  ? 9.509   -14.154 15.663  1.00 69.28  ? 401  GLY A O     1 
ATOM   2974  N  N     . ALA A 1  402  ? 9.740   -13.220 13.659  1.00 69.09  ? 402  ALA A N     1 
ATOM   2975  C  CA    . ALA A 1  402  ? 11.121  -12.874 13.930  1.00 68.91  ? 402  ALA A CA    1 
ATOM   2976  C  C     . ALA A 1  402  ? 11.719  -11.747 13.091  1.00 68.87  ? 402  ALA A C     1 
ATOM   2977  O  O     . ALA A 1  402  ? 11.467  -11.614 11.887  1.00 68.62  ? 402  ALA A O     1 
ATOM   2978  C  CB    . ALA A 1  402  ? 11.982  -14.124 13.808  1.00 68.69  ? 402  ALA A CB    1 
ATOM   2979  N  N     . LYS A 1  403  ? 12.515  -10.937 13.775  1.00 68.81  ? 403  LYS A N     1 
ATOM   2980  C  CA    . LYS A 1  403  ? 13.376  -9.953  13.167  1.00 68.69  ? 403  LYS A CA    1 
ATOM   2981  C  C     . LYS A 1  403  ? 14.732  -10.577 13.087  1.00 68.67  ? 403  LYS A C     1 
ATOM   2982  O  O     . LYS A 1  403  ? 14.927  -11.693 13.545  1.00 68.34  ? 403  LYS A O     1 
ATOM   2983  C  CB    . LYS A 1  403  ? 13.431  -8.685  14.026  1.00 68.72  ? 403  LYS A CB    1 
ATOM   2984  C  CG    . LYS A 1  403  ? 13.108  -8.871  15.525  1.00 69.01  ? 403  LYS A CG    1 
ATOM   2985  C  CD    . LYS A 1  403  ? 11.603  -8.725  15.880  1.00 69.08  ? 403  LYS A CD    1 
ATOM   2986  C  CE    . LYS A 1  403  ? 11.185  -7.264  16.179  1.00 69.28  ? 403  LYS A CE    1 
ATOM   2987  N  NZ    . LYS A 1  403  ? 11.447  -6.867  17.590  1.00 69.13  ? 403  LYS A NZ    1 
ATOM   2988  N  N     . TYR A 1  404  ? 15.659  -9.856  12.479  1.00 69.33  ? 404  TYR A N     1 
ATOM   2989  C  CA    . TYR A 1  404  ? 17.081  -10.256 12.360  1.00 70.04  ? 404  TYR A CA    1 
ATOM   2990  C  C     . TYR A 1  404  ? 17.414  -11.741 12.078  1.00 69.84  ? 404  TYR A C     1 
ATOM   2991  O  O     . TYR A 1  404  ? 17.081  -12.646 12.848  1.00 69.62  ? 404  TYR A O     1 
ATOM   2992  C  CB    . TYR A 1  404  ? 17.894  -9.714  13.541  1.00 70.62  ? 404  TYR A CB    1 
ATOM   2993  C  CG    . TYR A 1  404  ? 17.429  -8.351  14.027  1.00 71.62  ? 404  TYR A CG    1 
ATOM   2994  C  CD1   . TYR A 1  404  ? 16.517  -8.244  15.092  1.00 72.68  ? 404  TYR A CD1   1 
ATOM   2995  C  CD2   . TYR A 1  404  ? 17.899  -7.170  13.434  1.00 71.63  ? 404  TYR A CD2   1 
ATOM   2996  C  CE1   . TYR A 1  404  ? 16.080  -6.997  15.563  1.00 73.00  ? 404  TYR A CE1   1 
ATOM   2997  C  CE2   . TYR A 1  404  ? 17.469  -5.910  13.891  1.00 72.56  ? 404  TYR A CE2   1 
ATOM   2998  C  CZ    . TYR A 1  404  ? 16.551  -5.831  14.961  1.00 73.20  ? 404  TYR A CZ    1 
ATOM   2999  O  OH    . TYR A 1  404  ? 16.106  -4.604  15.441  1.00 72.57  ? 404  TYR A OH    1 
ATOM   3000  N  N     . VAL A 1  405  ? 18.078  -11.966 10.954  1.00 69.84  ? 405  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1  405  ? 18.546  -13.284 10.607  1.00 70.43  ? 405  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1  405  ? 20.049  -13.214 10.312  1.00 71.45  ? 405  VAL A C     1 
ATOM   3003  O  O     . VAL A 1  405  ? 20.481  -12.433 9.465   1.00 71.38  ? 405  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1  405  ? 17.730  -13.850 9.456   1.00 69.96  ? 405  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1  405  ? 18.523  -14.835 8.657   1.00 70.29  ? 405  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1  405  ? 16.506  -14.506 9.996   1.00 69.63  ? 405  VAL A CG2   1 
ATOM   3007  N  N     . ILE A 1  406  ? 20.830  -14.025 11.032  1.00 72.62  ? 406  ILE A N     1 
ATOM   3008  C  CA    . ILE A 1  406  ? 22.290  -13.914 11.058  1.00 73.86  ? 406  ILE A CA    1 
ATOM   3009  C  C     . ILE A 1  406  ? 22.985  -15.060 10.331  1.00 74.89  ? 406  ILE A C     1 
ATOM   3010  O  O     . ILE A 1  406  ? 22.561  -16.207 10.440  1.00 74.58  ? 406  ILE A O     1 
ATOM   3011  C  CB    . ILE A 1  406  ? 22.833  -13.811 12.503  1.00 73.82  ? 406  ILE A CB    1 
ATOM   3012  C  CG1   . ILE A 1  406  ? 22.183  -12.650 13.261  1.00 73.13  ? 406  ILE A CG1   1 
ATOM   3013  C  CG2   . ILE A 1  406  ? 24.368  -13.686 12.523  1.00 74.61  ? 406  ILE A CG2   1 
ATOM   3014  C  CD1   . ILE A 1  406  ? 21.147  -13.096 14.262  1.00 72.89  ? 406  ILE A CD1   1 
ATOM   3015  N  N     . ARG A 1  407  ? 24.082  -14.723 9.642   1.00 76.51  ? 407  ARG A N     1 
ATOM   3016  C  CA    . ARG A 1  407  ? 24.687  -15.562 8.598   1.00 78.24  ? 407  ARG A CA    1 
ATOM   3017  C  C     . ARG A 1  407  ? 26.099  -16.075 8.907   1.00 79.37  ? 407  ARG A C     1 
ATOM   3018  O  O     . ARG A 1  407  ? 26.650  -15.785 9.972   1.00 79.30  ? 407  ARG A O     1 
ATOM   3019  C  CB    . ARG A 1  407  ? 24.717  -14.787 7.274   1.00 78.11  ? 407  ARG A CB    1 
ATOM   3020  C  CG    . ARG A 1  407  ? 23.348  -14.441 6.684   1.00 78.31  ? 407  ARG A CG    1 
ATOM   3021  C  CD    . ARG A 1  407  ? 23.462  -13.457 5.532   1.00 78.43  ? 407  ARG A CD    1 
ATOM   3022  N  NE    . ARG A 1  407  ? 24.564  -13.798 4.638   1.00 80.66  ? 407  ARG A NE    1 
ATOM   3023  C  CZ    . ARG A 1  407  ? 25.024  -13.016 3.664   1.00 81.04  ? 407  ARG A CZ    1 
ATOM   3024  N  NH1   . ARG A 1  407  ? 24.466  -11.832 3.436   1.00 81.53  ? 407  ARG A NH1   1 
ATOM   3025  N  NH2   . ARG A 1  407  ? 26.042  -13.426 2.913   1.00 80.32  ? 407  ARG A NH2   1 
ATOM   3026  N  N     . ASP A 1  408  ? 26.654  -16.850 7.963   1.00 81.13  ? 408  ASP A N     1 
ATOM   3027  C  CA    . ASP A 1  408  ? 28.072  -17.290 7.972   1.00 82.90  ? 408  ASP A CA    1 
ATOM   3028  C  C     . ASP A 1  408  ? 28.963  -16.084 8.248   1.00 83.77  ? 408  ASP A C     1 
ATOM   3029  O  O     . ASP A 1  408  ? 29.701  -16.040 9.240   1.00 83.98  ? 408  ASP A O     1 
ATOM   3030  C  CB    . ASP A 1  408  ? 28.490  -17.912 6.610   1.00 83.01  ? 408  ASP A CB    1 
ATOM   3031  C  CG    . ASP A 1  408  ? 28.125  -19.400 6.476   1.00 83.43  ? 408  ASP A CG    1 
ATOM   3032  O  OD1   . ASP A 1  408  ? 27.410  -19.757 5.503   1.00 83.20  ? 408  ASP A OD1   1 
ATOM   3033  O  OD2   . ASP A 1  408  ? 28.567  -20.212 7.324   1.00 83.68  ? 408  ASP A OD2   1 
ATOM   3034  N  N     . SER A 1  409  ? 28.847  -15.102 7.356   1.00 84.75  ? 409  SER A N     1 
ATOM   3035  C  CA    . SER A 1  409  ? 29.534  -13.821 7.441   1.00 85.60  ? 409  SER A CA    1 
ATOM   3036  C  C     . SER A 1  409  ? 29.276  -13.048 8.741   1.00 86.09  ? 409  SER A C     1 
ATOM   3037  O  O     . SER A 1  409  ? 29.949  -12.062 9.024   1.00 86.34  ? 409  SER A O     1 
ATOM   3038  C  CB    . SER A 1  409  ? 29.127  -12.968 6.243   1.00 85.68  ? 409  SER A CB    1 
ATOM   3039  O  OG    . SER A 1  409  ? 27.738  -13.097 5.997   1.00 85.38  ? 409  SER A OG    1 
ATOM   3040  N  N     . GLY A 1  410  ? 28.311  -13.493 9.536   1.00 86.64  ? 410  GLY A N     1 
ATOM   3041  C  CA    . GLY A 1  410  ? 28.003  -12.818 10.796  1.00 87.33  ? 410  GLY A CA    1 
ATOM   3042  C  C     . GLY A 1  410  ? 27.594  -11.368 10.583  1.00 87.61  ? 410  GLY A C     1 
ATOM   3043  O  O     . GLY A 1  410  ? 28.024  -10.477 11.332  1.00 88.01  ? 410  GLY A O     1 
ATOM   3044  N  N     . ASP A 1  411  ? 26.786  -11.146 9.539   1.00 87.38  ? 411  ASP A N     1 
ATOM   3045  C  CA    . ASP A 1  411  ? 26.195  -9.842  9.212   1.00 86.81  ? 411  ASP A CA    1 
ATOM   3046  C  C     . ASP A 1  411  ? 24.736  -9.907  9.557   1.00 85.92  ? 411  ASP A C     1 
ATOM   3047  O  O     . ASP A 1  411  ? 24.245  -10.967 9.922   1.00 85.85  ? 411  ASP A O     1 
ATOM   3048  C  CB    . ASP A 1  411  ? 26.368  -9.540  7.730   1.00 87.04  ? 411  ASP A CB    1 
ATOM   3049  C  CG    . ASP A 1  411  ? 27.800  -9.731  7.275   1.00 88.14  ? 411  ASP A CG    1 
ATOM   3050  O  OD1   . ASP A 1  411  ? 28.668  -9.948  8.150   1.00 87.95  ? 411  ASP A OD1   1 
ATOM   3051  O  OD2   . ASP A 1  411  ? 28.061  -9.666  6.050   1.00 90.28  ? 411  ASP A OD2   1 
ATOM   3052  N  N     . ARG A 1  412  ? 24.032  -8.790  9.443   1.00 84.98  ? 412  ARG A N     1 
ATOM   3053  C  CA    . ARG A 1  412  ? 22.664  -8.762  9.929   1.00 84.09  ? 412  ARG A CA    1 
ATOM   3054  C  C     . ARG A 1  412  ? 21.608  -8.573  8.844   1.00 83.03  ? 412  ARG A C     1 
ATOM   3055  O  O     . ARG A 1  412  ? 21.643  -7.611  8.085   1.00 82.78  ? 412  ARG A O     1 
ATOM   3056  C  CB    . ARG A 1  412  ? 22.518  -7.712  11.021  1.00 84.44  ? 412  ARG A CB    1 
ATOM   3057  C  CG    . ARG A 1  412  ? 21.777  -8.217  12.237  1.00 85.64  ? 412  ARG A CG    1 
ATOM   3058  C  CD    . ARG A 1  412  ? 21.888  -7.224  13.392  1.00 88.45  ? 412  ARG A CD    1 
ATOM   3059  N  NE    . ARG A 1  412  ? 21.091  -7.645  14.545  1.00 89.81  ? 412  ARG A NE    1 
ATOM   3060  C  CZ    . ARG A 1  412  ? 21.577  -8.259  15.621  1.00 90.21  ? 412  ARG A CZ    1 
ATOM   3061  N  NH1   . ARG A 1  412  ? 22.878  -8.530  15.726  1.00 90.47  ? 412  ARG A NH1   1 
ATOM   3062  N  NH2   . ARG A 1  412  ? 20.752  -8.604  16.597  1.00 89.96  ? 412  ARG A NH2   1 
ATOM   3063  N  N     . ILE A 1  413  ? 20.681  -9.526  8.783   1.00 81.91  ? 413  ILE A N     1 
ATOM   3064  C  CA    . ILE A 1  413  ? 19.462  -9.425  7.973   1.00 80.72  ? 413  ILE A CA    1 
ATOM   3065  C  C     . ILE A 1  413  ? 18.341  -8.786  8.811   1.00 79.75  ? 413  ILE A C     1 
ATOM   3066  O  O     . ILE A 1  413  ? 18.017  -9.274  9.885   1.00 79.41  ? 413  ILE A O     1 
ATOM   3067  C  CB    . ILE A 1  413  ? 19.013  -10.824 7.458   1.00 80.77  ? 413  ILE A CB    1 
ATOM   3068  C  CG1   . ILE A 1  413  ? 19.816  -11.245 6.224   1.00 79.66  ? 413  ILE A CG1   1 
ATOM   3069  C  CG2   . ILE A 1  413  ? 17.501  -10.844 7.151   1.00 80.83  ? 413  ILE A CG2   1 
ATOM   3070  C  CD1   . ILE A 1  413  ? 21.287  -11.207 6.400   1.00 79.23  ? 413  ILE A CD1   1 
ATOM   3071  N  N     . ASP A 1  414  ? 17.761  -7.697  8.319   1.00 78.59  ? 414  ASP A N     1 
ATOM   3072  C  CA    . ASP A 1  414  ? 16.833  -6.911  9.124   1.00 77.96  ? 414  ASP A CA    1 
ATOM   3073  C  C     . ASP A 1  414  ? 15.392  -7.068  8.646   1.00 77.72  ? 414  ASP A C     1 
ATOM   3074  O  O     . ASP A 1  414  ? 14.810  -6.187  8.005   1.00 77.63  ? 414  ASP A O     1 
ATOM   3075  C  CB    . ASP A 1  414  ? 17.260  -5.437  9.159   1.00 77.93  ? 414  ASP A CB    1 
ATOM   3076  C  CG    . ASP A 1  414  ? 16.408  -4.589  10.111  1.00 76.70  ? 414  ASP A CG    1 
ATOM   3077  O  OD1   . ASP A 1  414  ? 15.276  -4.987  10.445  1.00 74.51  ? 414  ASP A OD1   1 
ATOM   3078  O  OD2   . ASP A 1  414  ? 16.872  -3.507  10.515  1.00 75.86  ? 414  ASP A OD2   1 
ATOM   3079  N  N     . LEU A 1  415  ? 14.803  -8.193  9.013   1.00 77.24  ? 415  LEU A N     1 
ATOM   3080  C  CA    . LEU A 1  415  ? 13.564  -8.645  8.408   1.00 76.73  ? 415  LEU A CA    1 
ATOM   3081  C  C     . LEU A 1  415  ? 12.470  -7.591  8.197   1.00 76.56  ? 415  LEU A C     1 
ATOM   3082  O  O     . LEU A 1  415  ? 11.635  -7.756  7.314   1.00 76.76  ? 415  LEU A O     1 
ATOM   3083  C  CB    . LEU A 1  415  ? 13.024  -9.853  9.175   1.00 76.57  ? 415  LEU A CB    1 
ATOM   3084  C  CG    . LEU A 1  415  ? 13.895  -11.102 9.081   1.00 75.83  ? 415  LEU A CG    1 
ATOM   3085  C  CD1   . LEU A 1  415  ? 13.441  -12.117 10.088  1.00 75.51  ? 415  LEU A CD1   1 
ATOM   3086  C  CD2   . LEU A 1  415  ? 13.866  -11.684 7.687   1.00 75.10  ? 415  LEU A CD2   1 
ATOM   3087  N  N     . ARG A 1  416  ? 12.469  -6.516  8.982   1.00 76.22  ? 416  ARG A N     1 
ATOM   3088  C  CA    . ARG A 1  416  ? 11.347  -5.566  8.916   1.00 75.85  ? 416  ARG A CA    1 
ATOM   3089  C  C     . ARG A 1  416  ? 11.486  -4.561  7.762   1.00 75.20  ? 416  ARG A C     1 
ATOM   3090  O  O     . ARG A 1  416  ? 10.530  -3.879  7.408   1.00 74.93  ? 416  ARG A O     1 
ATOM   3091  C  CB    . ARG A 1  416  ? 11.017  -4.932  10.293  1.00 75.85  ? 416  ARG A CB    1 
ATOM   3092  C  CG    . ARG A 1  416  ? 11.953  -3.853  10.767  1.00 77.02  ? 416  ARG A CG    1 
ATOM   3093  C  CD    . ARG A 1  416  ? 12.176  -3.900  12.265  1.00 79.30  ? 416  ARG A CD    1 
ATOM   3094  N  NE    . ARG A 1  416  ? 13.327  -3.067  12.625  1.00 83.04  ? 416  ARG A NE    1 
ATOM   3095  C  CZ    . ARG A 1  416  ? 13.259  -1.856  13.184  1.00 85.68  ? 416  ARG A CZ    1 
ATOM   3096  N  NH1   . ARG A 1  416  ? 12.082  -1.306  13.494  1.00 87.50  ? 416  ARG A NH1   1 
ATOM   3097  N  NH2   . ARG A 1  416  ? 14.380  -1.194  13.454  1.00 86.41  ? 416  ARG A NH2   1 
ATOM   3098  N  N     . TYR A 1  417  ? 12.676  -4.491  7.173   1.00 74.74  ? 417  TYR A N     1 
ATOM   3099  C  CA    . TYR A 1  417  ? 12.854  -3.864  5.864   1.00 74.56  ? 417  TYR A CA    1 
ATOM   3100  C  C     . TYR A 1  417  ? 13.433  -4.982  5.000   1.00 74.56  ? 417  TYR A C     1 
ATOM   3101  O  O     . TYR A 1  417  ? 12.866  -6.079  4.995   1.00 74.66  ? 417  TYR A O     1 
ATOM   3102  C  CB    . TYR A 1  417  ? 13.743  -2.600  5.928   1.00 74.47  ? 417  TYR A CB    1 
ATOM   3103  C  CG    . TYR A 1  417  ? 13.532  -1.737  7.177   1.00 74.67  ? 417  TYR A CG    1 
ATOM   3104  C  CD1   . TYR A 1  417  ? 14.618  -1.294  7.951   1.00 74.54  ? 417  TYR A CD1   1 
ATOM   3105  C  CD2   . TYR A 1  417  ? 12.242  -1.376  7.593   1.00 74.69  ? 417  TYR A CD2   1 
ATOM   3106  C  CE1   . TYR A 1  417  ? 14.411  -0.519  9.104   1.00 74.32  ? 417  TYR A CE1   1 
ATOM   3107  C  CE2   . TYR A 1  417  ? 12.031  -0.615  8.741   1.00 74.12  ? 417  TYR A CE2   1 
ATOM   3108  C  CZ    . TYR A 1  417  ? 13.107  -0.193  9.489   1.00 74.06  ? 417  TYR A CZ    1 
ATOM   3109  O  OH    . TYR A 1  417  ? 12.851  0.556   10.613  1.00 73.67  ? 417  TYR A OH    1 
ATOM   3110  N  N     . SER A 1  418  ? 14.548  -4.735  4.300   1.00 74.42  ? 418  SER A N     1 
ATOM   3111  C  CA    . SER A 1  418  ? 15.254  -5.772  3.512   1.00 73.98  ? 418  SER A CA    1 
ATOM   3112  C  C     . SER A 1  418  ? 14.446  -6.318  2.322   1.00 74.35  ? 418  SER A C     1 
ATOM   3113  O  O     . SER A 1  418  ? 13.335  -6.843  2.493   1.00 74.77  ? 418  SER A O     1 
ATOM   3114  C  CB    . SER A 1  418  ? 15.718  -6.919  4.421   1.00 73.70  ? 418  SER A CB    1 
ATOM   3115  O  OG    . SER A 1  418  ? 16.245  -7.999  3.675   1.00 72.32  ? 418  SER A OG    1 
ATOM   3116  N  N     . LYS A 1  419  ? 15.015  -6.204  1.124   1.00 74.34  ? 419  LYS A N     1 
ATOM   3117  C  CA    . LYS A 1  419  ? 14.372  -6.666  -0.104  1.00 74.44  ? 419  LYS A CA    1 
ATOM   3118  C  C     . LYS A 1  419  ? 14.114  -8.182  -0.181  1.00 74.99  ? 419  LYS A C     1 
ATOM   3119  O  O     . LYS A 1  419  ? 13.179  -8.599  -0.850  1.00 75.34  ? 419  LYS A O     1 
ATOM   3120  C  CB    . LYS A 1  419  ? 15.178  -6.224  -1.321  1.00 74.14  ? 419  LYS A CB    1 
ATOM   3121  C  CG    . LYS A 1  419  ? 16.384  -7.109  -1.613  1.00 73.85  ? 419  LYS A CG    1 
ATOM   3122  C  CD    . LYS A 1  419  ? 17.025  -6.802  -2.943  1.00 73.25  ? 419  LYS A CD    1 
ATOM   3123  C  CE    . LYS A 1  419  ? 17.944  -5.610  -2.831  1.00 73.10  ? 419  LYS A CE    1 
ATOM   3124  N  NZ    . LYS A 1  419  ? 17.234  -4.382  -2.381  1.00 73.43  ? 419  LYS A NZ    1 
ATOM   3125  N  N     . ARG A 1  420  ? 14.935  -9.001  0.476   1.00 75.51  ? 420  ARG A N     1 
ATOM   3126  C  CA    . ARG A 1  420  ? 14.742  -10.455 0.451   1.00 76.34  ? 420  ARG A CA    1 
ATOM   3127  C  C     . ARG A 1  420  ? 14.024  -11.001 1.695   1.00 76.46  ? 420  ARG A C     1 
ATOM   3128  O  O     . ARG A 1  420  ? 14.254  -12.132 2.105   1.00 76.38  ? 420  ARG A O     1 
ATOM   3129  C  CB    . ARG A 1  420  ? 16.077  -11.172 0.241   1.00 76.01  ? 420  ARG A CB    1 
ATOM   3130  C  CG    . ARG A 1  420  ? 16.456  -11.350 -1.213  1.00 77.13  ? 420  ARG A CG    1 
ATOM   3131  C  CD    . ARG A 1  420  ? 17.839  -11.995 -1.384  1.00 77.97  ? 420  ARG A CD    1 
ATOM   3132  N  NE    . ARG A 1  420  ? 17.810  -13.444 -1.629  1.00 81.53  ? 420  ARG A NE    1 
ATOM   3133  C  CZ    . ARG A 1  420  ? 18.885  -14.243 -1.649  1.00 82.76  ? 420  ARG A CZ    1 
ATOM   3134  N  NH1   . ARG A 1  420  ? 20.110  -13.763 -1.429  1.00 83.20  ? 420  ARG A NH1   1 
ATOM   3135  N  NH2   . ARG A 1  420  ? 18.738  -15.544 -1.883  1.00 83.43  ? 420  ARG A NH2   1 
ATOM   3136  N  N     . ALA A 1  421  ? 13.127  -10.211 2.275   1.00 77.09  ? 421  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1  421  ? 12.570  -10.525 3.599   1.00 77.87  ? 421  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1  421  ? 11.401  -11.536 3.613   1.00 78.67  ? 421  ALA A C     1 
ATOM   3139  O  O     . ALA A 1  421  ? 10.877  -11.899 4.691   1.00 78.29  ? 421  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1  421  ? 12.189  -9.241  4.318   1.00 77.62  ? 421  ALA A CB    1 
ATOM   3141  N  N     . GLY A 1  422  ? 11.003  -11.973 2.411   1.00 79.59  ? 422  GLY A N     1 
ATOM   3142  C  CA    . GLY A 1  422  ? 9.999   -13.037 2.202   1.00 80.16  ? 422  GLY A CA    1 
ATOM   3143  C  C     . GLY A 1  422  ? 10.619  -14.128 1.337   1.00 80.48  ? 422  GLY A C     1 
ATOM   3144  O  O     . GLY A 1  422  ? 10.000  -14.665 0.418   1.00 80.40  ? 422  GLY A O     1 
ATOM   3145  N  N     . ASP A 1  423  ? 11.860  -14.454 1.657   1.00 80.80  ? 423  ASP A N     1 
ATOM   3146  C  CA    . ASP A 1  423  ? 12.675  -15.288 0.815   1.00 81.23  ? 423  ASP A CA    1 
ATOM   3147  C  C     . ASP A 1  423  ? 13.599  -16.124 1.716   1.00 81.82  ? 423  ASP A C     1 
ATOM   3148  O  O     . ASP A 1  423  ? 13.150  -17.124 2.297   1.00 82.09  ? 423  ASP A O     1 
ATOM   3149  C  CB    . ASP A 1  423  ? 13.456  -14.396 -0.157  1.00 80.96  ? 423  ASP A CB    1 
ATOM   3150  C  CG    . ASP A 1  423  ? 14.403  -15.171 -1.017  1.00 80.04  ? 423  ASP A CG    1 
ATOM   3151  O  OD1   . ASP A 1  423  ? 13.952  -15.684 -2.060  1.00 79.58  ? 423  ASP A OD1   1 
ATOM   3152  O  OD2   . ASP A 1  423  ? 15.592  -15.265 -0.638  1.00 78.16  ? 423  ASP A OD2   1 
ATOM   3153  N  N     . ILE A 1  424  ? 14.866  -15.700 1.836   1.00 82.08  ? 424  ILE A N     1 
ATOM   3154  C  CA    . ILE A 1  424  ? 15.866  -16.275 2.756   1.00 81.97  ? 424  ILE A CA    1 
ATOM   3155  C  C     . ILE A 1  424  ? 15.871  -17.800 2.875   1.00 82.15  ? 424  ILE A C     1 
ATOM   3156  O  O     . ILE A 1  424  ? 14.879  -18.427 3.257   1.00 81.58  ? 424  ILE A O     1 
ATOM   3157  C  CB    . ILE A 1  424  ? 15.856  -15.593 4.182   1.00 81.88  ? 424  ILE A CB    1 
ATOM   3158  C  CG1   . ILE A 1  424  ? 14.492  -14.976 4.537   1.00 81.19  ? 424  ILE A CG1   1 
ATOM   3159  C  CG2   . ILE A 1  424  ? 16.908  -14.505 4.260   1.00 81.45  ? 424  ILE A CG2   1 
ATOM   3160  C  CD1   . ILE A 1  424  ? 13.462  -15.963 5.066   1.00 80.44  ? 424  ILE A CD1   1 
ATOM   3161  N  N     . GLN A 1  425  ? 17.008  -18.396 2.551   1.00 82.69  ? 425  GLN A N     1 
ATOM   3162  C  CA    . GLN A 1  425  ? 17.100  -19.845 2.610   1.00 83.47  ? 425  GLN A CA    1 
ATOM   3163  C  C     . GLN A 1  425  ? 18.006  -20.366 3.750   1.00 83.36  ? 425  GLN A C     1 
ATOM   3164  O  O     . GLN A 1  425  ? 19.170  -20.737 3.524   1.00 83.38  ? 425  GLN A O     1 
ATOM   3165  C  CB    . GLN A 1  425  ? 17.466  -20.415 1.228   1.00 83.86  ? 425  GLN A CB    1 
ATOM   3166  C  CG    . GLN A 1  425  ? 16.474  -20.047 0.090   1.00 85.35  ? 425  GLN A CG    1 
ATOM   3167  C  CD    . GLN A 1  425  ? 15.029  -20.560 0.303   1.00 87.45  ? 425  GLN A CD    1 
ATOM   3168  O  OE1   . GLN A 1  425  ? 14.704  -21.177 1.329   1.00 88.76  ? 425  GLN A OE1   1 
ATOM   3169  N  NE2   . GLN A 1  425  ? 14.161  -20.296 -0.681  1.00 87.10  ? 425  GLN A NE2   1 
ATOM   3170  N  N     . LEU A 1  426  ? 17.438  -20.393 4.966   1.00 83.08  ? 426  LEU A N     1 
ATOM   3171  C  CA    . LEU A 1  426  ? 18.141  -20.771 6.206   1.00 82.51  ? 426  LEU A CA    1 
ATOM   3172  C  C     . LEU A 1  426  ? 19.138  -21.906 5.974   1.00 82.60  ? 426  LEU A C     1 
ATOM   3173  O  O     . LEU A 1  426  ? 18.759  -23.065 5.831   1.00 82.70  ? 426  LEU A O     1 
ATOM   3174  C  CB    . LEU A 1  426  ? 17.134  -21.142 7.296   1.00 82.25  ? 426  LEU A CB    1 
ATOM   3175  C  CG    . LEU A 1  426  ? 16.050  -20.135 7.688   1.00 81.07  ? 426  LEU A CG    1 
ATOM   3176  C  CD1   . LEU A 1  426  ? 15.298  -20.599 8.930   1.00 79.66  ? 426  LEU A CD1   1 
ATOM   3177  C  CD2   . LEU A 1  426  ? 16.671  -18.786 7.938   1.00 80.36  ? 426  LEU A CD2   1 
ATOM   3178  N  N     . GLN A 1  427  ? 20.418  -21.549 5.933   1.00 82.57  ? 427  GLN A N     1 
ATOM   3179  C  CA    . GLN A 1  427  ? 21.455  -22.402 5.359   1.00 82.29  ? 427  GLN A CA    1 
ATOM   3180  C  C     . GLN A 1  427  ? 22.347  -23.126 6.388   1.00 81.94  ? 427  GLN A C     1 
ATOM   3181  O  O     . GLN A 1  427  ? 23.545  -23.298 6.160   1.00 82.11  ? 427  GLN A O     1 
ATOM   3182  C  CB    . GLN A 1  427  ? 22.292  -21.568 4.374   1.00 82.38  ? 427  GLN A CB    1 
ATOM   3183  C  CG    . GLN A 1  427  ? 23.065  -22.362 3.318   1.00 83.35  ? 427  GLN A CG    1 
ATOM   3184  C  CD    . GLN A 1  427  ? 22.184  -23.295 2.504   1.00 84.27  ? 427  GLN A CD    1 
ATOM   3185  O  OE1   . GLN A 1  427  ? 21.121  -22.899 2.014   1.00 83.84  ? 427  GLN A OE1   1 
ATOM   3186  N  NE2   . GLN A 1  427  ? 22.630  -24.546 2.349   1.00 84.55  ? 427  GLN A NE2   1 
ATOM   3187  N  N     . TYR A 1  428  ? 21.750  -23.570 7.498   1.00 81.41  ? 428  TYR A N     1 
ATOM   3188  C  CA    . TYR A 1  428  ? 22.434  -24.385 8.530   1.00 80.72  ? 428  TYR A CA    1 
ATOM   3189  C  C     . TYR A 1  428  ? 23.599  -23.711 9.255   1.00 79.88  ? 428  TYR A C     1 
ATOM   3190  O  O     . TYR A 1  428  ? 24.649  -23.454 8.659   1.00 80.14  ? 428  TYR A O     1 
ATOM   3191  C  CB    . TYR A 1  428  ? 22.877  -25.755 7.983   1.00 81.01  ? 428  TYR A CB    1 
ATOM   3192  C  CG    . TYR A 1  428  ? 21.831  -26.840 8.119   1.00 81.51  ? 428  TYR A CG    1 
ATOM   3193  C  CD1   . TYR A 1  428  ? 21.467  -27.627 7.022   1.00 82.37  ? 428  TYR A CD1   1 
ATOM   3194  C  CD2   . TYR A 1  428  ? 21.196  -27.077 9.343   1.00 81.49  ? 428  TYR A CD2   1 
ATOM   3195  C  CE1   . TYR A 1  428  ? 20.497  -28.628 7.143   1.00 82.30  ? 428  TYR A CE1   1 
ATOM   3196  C  CE2   . TYR A 1  428  ? 20.233  -28.065 9.468   1.00 81.28  ? 428  TYR A CE2   1 
ATOM   3197  C  CZ    . TYR A 1  428  ? 19.893  -28.843 8.373   1.00 81.66  ? 428  TYR A CZ    1 
ATOM   3198  O  OH    . TYR A 1  428  ? 18.942  -29.824 8.492   1.00 81.34  ? 428  TYR A OH    1 
ATOM   3199  N  N     . GLY A 1  429  ? 23.416  -23.453 10.548  1.00 78.63  ? 429  GLY A N     1 
ATOM   3200  C  CA    . GLY A 1  429  ? 24.442  -22.792 11.358  1.00 76.61  ? 429  GLY A CA    1 
ATOM   3201  C  C     . GLY A 1  429  ? 24.327  -21.287 11.261  1.00 75.07  ? 429  GLY A C     1 
ATOM   3202  O  O     . GLY A 1  429  ? 25.339  -20.591 11.214  1.00 74.86  ? 429  GLY A O     1 
ATOM   3203  N  N     . TRP A 1  430  ? 23.078  -20.812 11.205  1.00 73.51  ? 430  TRP A N     1 
ATOM   3204  C  CA    . TRP A 1  430  ? 22.706  -19.393 11.143  1.00 71.75  ? 430  TRP A CA    1 
ATOM   3205  C  C     . TRP A 1  430  ? 21.825  -19.155 12.343  1.00 71.01  ? 430  TRP A C     1 
ATOM   3206  O  O     . TRP A 1  430  ? 21.248  -20.101 12.851  1.00 71.13  ? 430  TRP A O     1 
ATOM   3207  C  CB    . TRP A 1  430  ? 21.874  -19.121 9.886   1.00 71.01  ? 430  TRP A CB    1 
ATOM   3208  C  CG    . TRP A 1  430  ? 22.642  -19.048 8.602   1.00 70.13  ? 430  TRP A CG    1 
ATOM   3209  C  CD1   . TRP A 1  430  ? 23.857  -19.604 8.335   1.00 68.99  ? 430  TRP A CD1   1 
ATOM   3210  C  CD2   . TRP A 1  430  ? 22.227  -18.399 7.398   1.00 69.35  ? 430  TRP A CD2   1 
ATOM   3211  N  NE1   . TRP A 1  430  ? 24.236  -19.322 7.052   1.00 68.77  ? 430  TRP A NE1   1 
ATOM   3212  C  CE2   . TRP A 1  430  ? 23.253  -18.589 6.448   1.00 68.90  ? 430  TRP A CE2   1 
ATOM   3213  C  CE3   . TRP A 1  430  ? 21.092  -17.664 7.032   1.00 69.03  ? 430  TRP A CE3   1 
ATOM   3214  C  CZ2   . TRP A 1  430  ? 23.183  -18.074 5.155   1.00 69.48  ? 430  TRP A CZ2   1 
ATOM   3215  C  CZ3   . TRP A 1  430  ? 21.021  -17.153 5.743   1.00 69.22  ? 430  TRP A CZ3   1 
ATOM   3216  C  CH2   . TRP A 1  430  ? 22.061  -17.362 4.820   1.00 69.52  ? 430  TRP A CH2   1 
ATOM   3217  N  N     . LYS A 1  431  ? 21.696  -17.916 12.804  1.00 70.07  ? 431  LYS A N     1 
ATOM   3218  C  CA    . LYS A 1  431  ? 20.766  -17.633 13.910  1.00 69.21  ? 431  LYS A CA    1 
ATOM   3219  C  C     . LYS A 1  431  ? 19.519  -16.940 13.421  1.00 68.03  ? 431  LYS A C     1 
ATOM   3220  O  O     . LYS A 1  431  ? 19.595  -16.009 12.632  1.00 67.91  ? 431  LYS A O     1 
ATOM   3221  C  CB    . LYS A 1  431  ? 21.401  -16.740 14.986  1.00 69.50  ? 431  LYS A CB    1 
ATOM   3222  C  CG    . LYS A 1  431  ? 22.382  -17.403 15.964  1.00 70.21  ? 431  LYS A CG    1 
ATOM   3223  C  CD    . LYS A 1  431  ? 22.957  -16.373 16.969  1.00 70.10  ? 431  LYS A CD    1 
ATOM   3224  C  CE    . LYS A 1  431  ? 24.401  -16.702 17.379  1.00 71.70  ? 431  LYS A CE    1 
ATOM   3225  N  NZ    . LYS A 1  431  ? 25.350  -16.818 16.218  1.00 71.70  ? 431  LYS A NZ    1 
ATOM   3226  N  N     . VAL A 1  432  ? 18.368  -17.366 13.915  1.00 66.97  ? 432  VAL A N     1 
ATOM   3227  C  CA    . VAL A 1  432  ? 17.137  -16.615 13.680  1.00 66.04  ? 432  VAL A CA    1 
ATOM   3228  C  C     . VAL A 1  432  ? 16.616  -16.084 14.995  1.00 65.42  ? 432  VAL A C     1 
ATOM   3229  O  O     . VAL A 1  432  ? 16.315  -16.860 15.889  1.00 65.55  ? 432  VAL A O     1 
ATOM   3230  C  CB    . VAL A 1  432  ? 16.053  -17.488 13.083  1.00 66.00  ? 432  VAL A CB    1 
ATOM   3231  C  CG1   . VAL A 1  432  ? 14.745  -16.741 13.075  1.00 65.48  ? 432  VAL A CG1   1 
ATOM   3232  C  CG2   . VAL A 1  432  ? 16.438  -17.938 11.683  1.00 66.18  ? 432  VAL A CG2   1 
ATOM   3233  N  N     . GLU A 1  433  ? 16.503  -14.772 15.125  1.00 64.66  ? 433  GLU A N     1 
ATOM   3234  C  CA    . GLU A 1  433  ? 16.140  -14.204 16.412  1.00 64.33  ? 433  GLU A CA    1 
ATOM   3235  C  C     . GLU A 1  433  ? 14.636  -14.152 16.520  1.00 63.50  ? 433  GLU A C     1 
ATOM   3236  O  O     . GLU A 1  433  ? 14.034  -13.219 16.052  1.00 64.05  ? 433  GLU A O     1 
ATOM   3237  C  CB    . GLU A 1  433  ? 16.760  -12.815 16.576  1.00 64.39  ? 433  GLU A CB    1 
ATOM   3238  C  CG    . GLU A 1  433  ? 18.196  -12.848 17.133  1.00 65.61  ? 433  GLU A CG    1 
ATOM   3239  C  CD    . GLU A 1  433  ? 18.930  -11.509 17.062  1.00 65.40  ? 433  GLU A CD    1 
ATOM   3240  O  OE1   . GLU A 1  433  ? 18.396  -10.492 17.580  1.00 67.45  ? 433  GLU A OE1   1 
ATOM   3241  O  OE2   . GLU A 1  433  ? 20.056  -11.493 16.510  1.00 64.73  ? 433  GLU A OE2   1 
ATOM   3242  N  N     . ARG A 1  434  ? 14.017  -15.153 17.125  1.00 62.46  ? 434  ARG A N     1 
ATOM   3243  C  CA    . ARG A 1  434  ? 12.567  -15.267 17.046  1.00 61.62  ? 434  ARG A CA    1 
ATOM   3244  C  C     . ARG A 1  434  ? 11.840  -14.446 18.101  1.00 60.88  ? 434  ARG A C     1 
ATOM   3245  O  O     . ARG A 1  434  ? 12.477  -13.866 18.953  1.00 60.73  ? 434  ARG A O     1 
ATOM   3246  C  CB    . ARG A 1  434  ? 12.143  -16.738 17.103  1.00 61.99  ? 434  ARG A CB    1 
ATOM   3247  C  CG    . ARG A 1  434  ? 12.986  -17.666 17.982  1.00 63.14  ? 434  ARG A CG    1 
ATOM   3248  C  CD    . ARG A 1  434  ? 12.095  -18.773 18.581  1.00 66.92  ? 434  ARG A CD    1 
ATOM   3249  N  NE    . ARG A 1  434  ? 11.739  -18.507 19.986  1.00 69.91  ? 434  ARG A NE    1 
ATOM   3250  C  CZ    . ARG A 1  434  ? 12.083  -19.284 21.022  1.00 71.27  ? 434  ARG A CZ    1 
ATOM   3251  N  NH1   . ARG A 1  434  ? 12.769  -20.416 20.823  1.00 71.76  ? 434  ARG A NH1   1 
ATOM   3252  N  NH2   . ARG A 1  434  ? 11.740  -18.940 22.265  1.00 70.77  ? 434  ARG A NH2   1 
ATOM   3253  N  N     . HIS A 1  435  ? 10.511  -14.377 18.032  1.00 60.30  ? 435  HIS A N     1 
ATOM   3254  C  CA    . HIS A 1  435  ? 9.715   -13.857 19.147  1.00 60.04  ? 435  HIS A CA    1 
ATOM   3255  C  C     . HIS A 1  435  ? 9.834   -14.880 20.234  1.00 59.75  ? 435  HIS A C     1 
ATOM   3256  O  O     . HIS A 1  435  ? 10.193  -16.028 19.974  1.00 59.46  ? 435  HIS A O     1 
ATOM   3257  C  CB    . HIS A 1  435  ? 8.213   -13.709 18.822  1.00 60.22  ? 435  HIS A CB    1 
ATOM   3258  C  CG    . HIS A 1  435  ? 7.885   -12.632 17.825  1.00 61.83  ? 435  HIS A CG    1 
ATOM   3259  N  ND1   . HIS A 1  435  ? 7.984   -11.281 18.103  1.00 62.61  ? 435  HIS A ND1   1 
ATOM   3260  C  CD2   . HIS A 1  435  ? 7.423   -12.712 16.556  1.00 62.73  ? 435  HIS A CD2   1 
ATOM   3261  C  CE1   . HIS A 1  435  ? 7.627   -10.581 17.041  1.00 62.08  ? 435  HIS A CE1   1 
ATOM   3262  N  NE2   . HIS A 1  435  ? 7.286   -11.427 16.087  1.00 63.96  ? 435  HIS A NE2   1 
ATOM   3263  N  N     . ILE A 1  436  ? 9.515   -14.460 21.452  1.00 59.78  ? 436  ILE A N     1 
ATOM   3264  C  CA    . ILE A 1  436  ? 9.387   -15.360 22.593  1.00 60.02  ? 436  ILE A CA    1 
ATOM   3265  C  C     . ILE A 1  436  ? 8.025   -16.032 22.449  1.00 60.42  ? 436  ILE A C     1 
ATOM   3266  O  O     . ILE A 1  436  ? 7.046   -15.352 22.144  1.00 60.94  ? 436  ILE A O     1 
ATOM   3267  C  CB    . ILE A 1  436  ? 9.468   -14.559 23.902  1.00 59.73  ? 436  ILE A CB    1 
ATOM   3268  C  CG1   . ILE A 1  436  ? 10.916  -14.360 24.368  1.00 60.67  ? 436  ILE A CG1   1 
ATOM   3269  C  CG2   . ILE A 1  436  ? 8.781   -15.280 25.013  1.00 60.17  ? 436  ILE A CG2   1 
ATOM   3270  C  CD1   . ILE A 1  436  ? 11.933  -13.744 23.366  1.00 62.18  ? 436  ILE A CD1   1 
ATOM   3271  N  N     . MET A 1  437  ? 7.939   -17.350 22.619  1.00 60.86  ? 437  MET A N     1 
ATOM   3272  C  CA    . MET A 1  437  ? 6.636   -18.039 22.424  1.00 61.34  ? 437  MET A CA    1 
ATOM   3273  C  C     . MET A 1  437  ? 6.213   -18.821 23.660  1.00 61.22  ? 437  MET A C     1 
ATOM   3274  O  O     . MET A 1  437  ? 6.868   -18.746 24.702  1.00 61.42  ? 437  MET A O     1 
ATOM   3275  C  CB    . MET A 1  437  ? 6.634   -18.963 21.189  1.00 61.87  ? 437  MET A CB    1 
ATOM   3276  C  CG    . MET A 1  437  ? 7.620   -18.606 20.003  1.00 62.13  ? 437  MET A CG    1 
ATOM   3277  S  SD    . MET A 1  437  ? 7.370   -19.610 18.487  1.00 61.60  ? 437  MET A SD    1 
ATOM   3278  C  CE    . MET A 1  437  ? 7.920   -21.254 19.056  1.00 60.16  ? 437  MET A CE    1 
ATOM   3279  N  N     . ASP A 1  438  ? 5.128   -19.578 23.566  1.00 61.11  ? 438  ASP A N     1 
ATOM   3280  C  CA    . ASP A 1  438  ? 4.654   -20.264 24.766  1.00 61.34  ? 438  ASP A CA    1 
ATOM   3281  C  C     . ASP A 1  438  ? 5.722   -21.195 25.285  1.00 61.83  ? 438  ASP A C     1 
ATOM   3282  O  O     . ASP A 1  438  ? 6.591   -21.657 24.524  1.00 62.19  ? 438  ASP A O     1 
ATOM   3283  C  CB    . ASP A 1  438  ? 3.366   -21.051 24.527  1.00 61.17  ? 438  ASP A CB    1 
ATOM   3284  C  CG    . ASP A 1  438  ? 2.122   -20.217 24.726  1.00 59.98  ? 438  ASP A CG    1 
ATOM   3285  O  OD1   . ASP A 1  438  ? 2.239   -19.117 25.295  1.00 58.58  ? 438  ASP A OD1   1 
ATOM   3286  O  OD2   . ASP A 1  438  ? 1.033   -20.665 24.302  1.00 59.04  ? 438  ASP A OD2   1 
ATOM   3287  N  N     . ASN A 1  439  ? 5.649   -21.465 26.583  1.00 61.97  ? 439  ASN A N     1 
ATOM   3288  C  CA    . ASN A 1  439  ? 6.584   -22.366 27.237  1.00 62.38  ? 439  ASN A CA    1 
ATOM   3289  C  C     . ASN A 1  439  ? 8.028   -21.986 27.006  1.00 62.50  ? 439  ASN A C     1 
ATOM   3290  O  O     . ASN A 1  439  ? 8.743   -22.620 26.194  1.00 62.81  ? 439  ASN A O     1 
ATOM   3291  C  CB    . ASN A 1  439  ? 6.329   -23.803 26.814  1.00 62.45  ? 439  ASN A CB    1 
ATOM   3292  C  CG    . ASN A 1  439  ? 5.004   -24.295 27.295  1.00 63.32  ? 439  ASN A CG    1 
ATOM   3293  O  OD1   . ASN A 1  439  ? 4.543   -23.906 28.375  1.00 63.69  ? 439  ASN A OD1   1 
ATOM   3294  N  ND2   . ASN A 1  439  ? 4.362   -25.147 26.499  1.00 64.81  ? 439  ASN A ND2   1 
ATOM   3295  N  N     . ASP A 1  440  ? 8.430   -20.929 27.716  1.00 62.20  ? 440  ASP A N     1 
ATOM   3296  C  CA    . ASP A 1  440  ? 9.808   -20.454 27.717  1.00 62.02  ? 440  ASP A CA    1 
ATOM   3297  C  C     . ASP A 1  440  ? 10.324  -20.019 29.100  1.00 61.28  ? 440  ASP A C     1 
ATOM   3298  O  O     . ASP A 1  440  ? 9.542   -19.757 30.024  1.00 60.98  ? 440  ASP A O     1 
ATOM   3299  C  CB    . ASP A 1  440  ? 10.021  -19.352 26.661  1.00 62.31  ? 440  ASP A CB    1 
ATOM   3300  C  CG    . ASP A 1  440  ? 10.492  -19.907 25.315  1.00 63.44  ? 440  ASP A CG    1 
ATOM   3301  O  OD1   . ASP A 1  440  ? 11.316  -20.850 25.298  1.00 64.13  ? 440  ASP A OD1   1 
ATOM   3302  O  OD2   . ASP A 1  440  ? 10.033  -19.398 24.269  1.00 64.70  ? 440  ASP A OD2   1 
ATOM   3303  N  N     . PRO A 1  441  ? 11.663  -19.979 29.244  1.00 60.59  ? 441  PRO A N     1 
ATOM   3304  C  CA    . PRO A 1  441  ? 12.276  -19.546 30.488  1.00 59.59  ? 441  PRO A CA    1 
ATOM   3305  C  C     . PRO A 1  441  ? 12.317  -18.019 30.570  1.00 58.51  ? 441  PRO A C     1 
ATOM   3306  O  O     . PRO A 1  441  ? 13.052  -17.362 29.816  1.00 58.61  ? 441  PRO A O     1 
ATOM   3307  C  CB    . PRO A 1  441  ? 13.710  -20.126 30.398  1.00 60.03  ? 441  PRO A CB    1 
ATOM   3308  C  CG    . PRO A 1  441  ? 13.825  -20.845 29.042  1.00 60.13  ? 441  PRO A CG    1 
ATOM   3309  C  CD    . PRO A 1  441  ? 12.674  -20.357 28.227  1.00 60.45  ? 441  PRO A CD    1 
ATOM   3310  N  N     . VAL A 1  442  ? 11.528  -17.450 31.469  1.00 57.04  ? 442  VAL A N     1 
ATOM   3311  C  CA    . VAL A 1  442  ? 11.618  -16.008 31.725  1.00 55.43  ? 442  VAL A CA    1 
ATOM   3312  C  C     . VAL A 1  442  ? 11.879  -15.733 33.196  1.00 54.74  ? 442  VAL A C     1 
ATOM   3313  O  O     . VAL A 1  442  ? 11.332  -16.419 34.061  1.00 55.33  ? 442  VAL A O     1 
ATOM   3314  C  CB    . VAL A 1  442  ? 10.374  -15.278 31.268  1.00 54.89  ? 442  VAL A CB    1 
ATOM   3315  C  CG1   . VAL A 1  442  ? 10.558  -14.823 29.873  1.00 55.15  ? 442  VAL A CG1   1 
ATOM   3316  C  CG2   . VAL A 1  442  ? 9.188   -16.190 31.343  1.00 54.47  ? 442  VAL A CG2   1 
ATOM   3317  N  N     . LEU A 1  443  ? 12.728  -14.756 33.484  1.00 53.37  ? 443  LEU A N     1 
ATOM   3318  C  CA    . LEU A 1  443  ? 13.105  -14.505 34.850  1.00 52.26  ? 443  LEU A CA    1 
ATOM   3319  C  C     . LEU A 1  443  ? 12.322  -13.343 35.275  1.00 51.61  ? 443  LEU A C     1 
ATOM   3320  O  O     . LEU A 1  443  ? 12.519  -12.232 34.820  1.00 50.75  ? 443  LEU A O     1 
ATOM   3321  C  CB    . LEU A 1  443  ? 14.569  -14.187 34.993  1.00 52.78  ? 443  LEU A CB    1 
ATOM   3322  C  CG    . LEU A 1  443  ? 15.132  -14.325 36.406  1.00 53.60  ? 443  LEU A CG    1 
ATOM   3323  C  CD1   . LEU A 1  443  ? 16.351  -13.423 36.517  1.00 54.45  ? 443  LEU A CD1   1 
ATOM   3324  C  CD2   . LEU A 1  443  ? 14.132  -14.026 37.521  1.00 53.13  ? 443  LEU A CD2   1 
ATOM   3325  N  N     . PHE A 1  444  ? 11.415  -13.634 36.179  1.00 51.86  ? 444  PHE A N     1 
ATOM   3326  C  CA    . PHE A 1  444  ? 10.404  -12.702 36.560  1.00 51.92  ? 444  PHE A CA    1 
ATOM   3327  C  C     . PHE A 1  444  ? 10.684  -12.322 37.988  1.00 51.91  ? 444  PHE A C     1 
ATOM   3328  O  O     . PHE A 1  444  ? 10.607  -13.186 38.875  1.00 51.93  ? 444  PHE A O     1 
ATOM   3329  C  CB    . PHE A 1  444  ? 9.046   -13.376 36.442  1.00 51.72  ? 444  PHE A CB    1 
ATOM   3330  C  CG    . PHE A 1  444  ? 7.929   -12.422 36.215  1.00 52.92  ? 444  PHE A CG    1 
ATOM   3331  C  CD1   . PHE A 1  444  ? 7.879   -11.663 35.031  1.00 52.60  ? 444  PHE A CD1   1 
ATOM   3332  C  CD2   . PHE A 1  444  ? 6.905   -12.272 37.193  1.00 52.69  ? 444  PHE A CD2   1 
ATOM   3333  C  CE1   . PHE A 1  444  ? 6.819   -10.758 34.832  1.00 54.40  ? 444  PHE A CE1   1 
ATOM   3334  C  CE2   . PHE A 1  444  ? 5.836   -11.390 37.010  1.00 50.72  ? 444  PHE A CE2   1 
ATOM   3335  C  CZ    . PHE A 1  444  ? 5.771   -10.634 35.846  1.00 52.33  ? 444  PHE A CZ    1 
ATOM   3336  N  N     . ASN A 1  445  ? 11.051  -11.049 38.206  1.00 51.79  ? 445  ASN A N     1 
ATOM   3337  C  CA    . ASN A 1  445  ? 11.175  -10.512 39.578  1.00 51.52  ? 445  ASN A CA    1 
ATOM   3338  C  C     . ASN A 1  445  ? 10.277  -9.322  39.980  1.00 51.33  ? 445  ASN A C     1 
ATOM   3339  O  O     . ASN A 1  445  ? 9.151   -9.131  39.486  1.00 51.06  ? 445  ASN A O     1 
ATOM   3340  C  CB    . ASN A 1  445  ? 12.643  -10.254 39.948  1.00 51.22  ? 445  ASN A CB    1 
ATOM   3341  C  CG    . ASN A 1  445  ? 13.157  -8.965  39.396  1.00 51.17  ? 445  ASN A CG    1 
ATOM   3342  O  OD1   . ASN A 1  445  ? 12.817  -8.601  38.279  1.00 51.76  ? 445  ASN A OD1   1 
ATOM   3343  N  ND2   . ASN A 1  445  ? 13.968  -8.252  40.174  1.00 50.00  ? 445  ASN A ND2   1 
ATOM   3344  N  N     . ARG A 1  446  ? 10.805  -8.550  40.910  1.00 51.36  ? 446  ARG A N     1 
ATOM   3345  C  CA    . ARG A 1  446  ? 10.110  -7.446  41.499  1.00 52.36  ? 446  ARG A CA    1 
ATOM   3346  C  C     . ARG A 1  446  ? 11.119  -6.704  42.358  1.00 53.00  ? 446  ARG A C     1 
ATOM   3347  O  O     . ARG A 1  446  ? 12.025  -7.317  42.927  1.00 53.39  ? 446  ARG A O     1 
ATOM   3348  C  CB    . ARG A 1  446  ? 8.974   -7.966  42.389  1.00 52.68  ? 446  ARG A CB    1 
ATOM   3349  C  CG    . ARG A 1  446  ? 7.751   -7.067  42.448  1.00 52.24  ? 446  ARG A CG    1 
ATOM   3350  C  CD    . ARG A 1  446  ? 6.702   -7.571  43.377  1.00 49.86  ? 446  ARG A CD    1 
ATOM   3351  N  NE    . ARG A 1  446  ? 5.972   -6.417  43.882  1.00 52.65  ? 446  ARG A NE    1 
ATOM   3352  C  CZ    . ARG A 1  446  ? 6.269   -5.760  45.003  1.00 54.08  ? 446  ARG A CZ    1 
ATOM   3353  N  NH1   . ARG A 1  446  ? 7.285   -6.166  45.762  1.00 56.05  ? 446  ARG A NH1   1 
ATOM   3354  N  NH2   . ARG A 1  446  ? 5.540   -4.707  45.378  1.00 52.82  ? 446  ARG A NH2   1 
ATOM   3355  N  N     . GLN A 1  447  ? 10.995  -5.386  42.420  1.00 53.56  ? 447  GLN A N     1 
ATOM   3356  C  CA    . GLN A 1  447  ? 11.695  -4.612  43.420  1.00 54.34  ? 447  GLN A CA    1 
ATOM   3357  C  C     . GLN A 1  447  ? 10.614  -4.356  44.423  1.00 54.85  ? 447  GLN A C     1 
ATOM   3358  O  O     . GLN A 1  447  ? 9.443   -4.216  44.026  1.00 55.21  ? 447  GLN A O     1 
ATOM   3359  C  CB    . GLN A 1  447  ? 12.172  -3.285  42.864  1.00 54.44  ? 447  GLN A CB    1 
ATOM   3360  C  CG    . GLN A 1  447  ? 13.205  -3.409  41.786  1.00 56.51  ? 447  GLN A CG    1 
ATOM   3361  C  CD    . GLN A 1  447  ? 12.610  -3.753  40.435  1.00 59.65  ? 447  GLN A CD    1 
ATOM   3362  O  OE1   . GLN A 1  447  ? 11.430  -3.455  40.142  1.00 59.38  ? 447  GLN A OE1   1 
ATOM   3363  N  NE2   . GLN A 1  447  ? 13.427  -4.387  39.591  1.00 60.72  ? 447  GLN A NE2   1 
ATOM   3364  N  N     . PRO A 1  448  ? 10.983  -4.290  45.715  1.00 55.18  ? 448  PRO A N     1 
ATOM   3365  C  CA    . PRO A 1  448  ? 12.346  -4.458  46.094  1.00 55.93  ? 448  PRO A CA    1 
ATOM   3366  C  C     . PRO A 1  448  ? 12.635  -5.943  46.344  1.00 57.31  ? 448  PRO A C     1 
ATOM   3367  O  O     . PRO A 1  448  ? 11.922  -6.609  47.115  1.00 57.44  ? 448  PRO A O     1 
ATOM   3368  C  CB    . PRO A 1  448  ? 12.430  -3.636  47.388  1.00 55.77  ? 448  PRO A CB    1 
ATOM   3369  C  CG    . PRO A 1  448  ? 11.052  -3.224  47.717  1.00 54.67  ? 448  PRO A CG    1 
ATOM   3370  C  CD    . PRO A 1  448  ? 10.154  -4.044  46.901  1.00 54.83  ? 448  PRO A CD    1 
ATOM   3371  N  N     . SER A 1  449  ? 13.662  -6.462  45.677  1.00 58.66  ? 449  SER A N     1 
ATOM   3372  C  CA    . SER A 1  449  ? 14.016  -7.879  45.806  1.00 59.93  ? 449  SER A CA    1 
ATOM   3373  C  C     . SER A 1  449  ? 14.792  -8.175  47.104  1.00 60.59  ? 449  SER A C     1 
ATOM   3374  O  O     . SER A 1  449  ? 15.835  -7.563  47.379  1.00 61.17  ? 449  SER A O     1 
ATOM   3375  C  CB    . SER A 1  449  ? 14.825  -8.328  44.583  1.00 60.20  ? 449  SER A CB    1 
ATOM   3376  O  OG    . SER A 1  449  ? 15.974  -7.505  44.390  1.00 60.84  ? 449  SER A OG    1 
ATOM   3377  N  N     . LEU A 1  450  ? 14.290  -9.108  47.906  1.00 60.97  ? 450  LEU A N     1 
ATOM   3378  C  CA    . LEU A 1  450  ? 14.963  -9.451  49.167  1.00 61.26  ? 450  LEU A CA    1 
ATOM   3379  C  C     . LEU A 1  450  ? 15.097  -10.969 49.403  1.00 61.62  ? 450  LEU A C     1 
ATOM   3380  O  O     . LEU A 1  450  ? 15.663  -11.378 50.411  1.00 61.63  ? 450  LEU A O     1 
ATOM   3381  C  CB    . LEU A 1  450  ? 14.276  -8.768  50.361  1.00 61.25  ? 450  LEU A CB    1 
ATOM   3382  C  CG    . LEU A 1  450  ? 13.272  -7.621  50.121  1.00 61.28  ? 450  LEU A CG    1 
ATOM   3383  C  CD1   . LEU A 1  450  ? 11.795  -8.054  50.254  1.00 61.01  ? 450  LEU A CD1   1 
ATOM   3384  C  CD2   . LEU A 1  450  ? 13.554  -6.509  51.097  1.00 62.63  ? 450  LEU A CD2   1 
ATOM   3385  N  N     . HIS A 1  451  ? 14.573  -11.790 48.482  1.00 62.06  ? 451  HIS A N     1 
ATOM   3386  C  CA    . HIS A 1  451  ? 14.863  -13.237 48.431  1.00 62.53  ? 451  HIS A CA    1 
ATOM   3387  C  C     . HIS A 1  451  ? 15.542  -13.694 47.122  1.00 63.06  ? 451  HIS A C     1 
ATOM   3388  O  O     . HIS A 1  451  ? 15.411  -13.053 46.069  1.00 62.95  ? 451  HIS A O     1 
ATOM   3389  C  CB    . HIS A 1  451  ? 13.578  -14.039 48.515  1.00 62.53  ? 451  HIS A CB    1 
ATOM   3390  C  CG    . HIS A 1  451  ? 12.637  -13.566 49.558  1.00 62.97  ? 451  HIS A CG    1 
ATOM   3391  N  ND1   . HIS A 1  451  ? 11.402  -13.036 49.260  1.00 63.34  ? 451  HIS A ND1   1 
ATOM   3392  C  CD2   . HIS A 1  451  ? 12.745  -13.553 50.905  1.00 63.67  ? 451  HIS A CD2   1 
ATOM   3393  C  CE1   . HIS A 1  451  ? 10.794  -12.704 50.386  1.00 64.50  ? 451  HIS A CE1   1 
ATOM   3394  N  NE2   . HIS A 1  451  ? 11.588  -13.012 51.398  1.00 63.92  ? 451  HIS A NE2   1 
ATOM   3395  N  N     . LYS A 1  452  ? 16.227  -14.838 47.179  1.00 63.36  ? 452  LYS A N     1 
ATOM   3396  C  CA    . LYS A 1  452  ? 16.343  -15.677 45.982  1.00 63.39  ? 452  LYS A CA    1 
ATOM   3397  C  C     . LYS A 1  452  ? 14.947  -15.722 45.329  1.00 62.93  ? 452  LYS A C     1 
ATOM   3398  O  O     . LYS A 1  452  ? 14.835  -15.578 44.111  1.00 62.73  ? 452  LYS A O     1 
ATOM   3399  C  CB    . LYS A 1  452  ? 16.831  -17.100 46.314  1.00 63.16  ? 452  LYS A CB    1 
ATOM   3400  C  CG    . LYS A 1  452  ? 16.186  -17.732 47.563  1.00 63.71  ? 452  LYS A CG    1 
ATOM   3401  C  CD    . LYS A 1  452  ? 16.301  -19.259 47.638  1.00 64.27  ? 452  LYS A CD    1 
ATOM   3402  C  CE    . LYS A 1  452  ? 17.397  -19.847 46.723  1.00 68.07  ? 452  LYS A CE    1 
ATOM   3403  N  NZ    . LYS A 1  452  ? 18.836  -19.628 47.096  1.00 68.87  ? 452  LYS A NZ    1 
ATOM   3404  N  N     . MET A 1  453  ? 13.899  -15.856 46.163  1.00 62.48  ? 453  MET A N     1 
ATOM   3405  C  CA    . MET A 1  453  ? 12.502  -15.969 45.705  1.00 62.05  ? 453  MET A CA    1 
ATOM   3406  C  C     . MET A 1  453  ? 11.773  -14.736 45.273  1.00 61.00  ? 453  MET A C     1 
ATOM   3407  O  O     . MET A 1  453  ? 10.657  -14.870 44.802  1.00 61.01  ? 453  MET A O     1 
ATOM   3408  C  CB    . MET A 1  453  ? 11.605  -16.625 46.728  1.00 62.32  ? 453  MET A CB    1 
ATOM   3409  C  CG    . MET A 1  453  ? 11.727  -18.102 46.746  1.00 65.02  ? 453  MET A CG    1 
ATOM   3410  S  SD    . MET A 1  453  ? 12.584  -18.466 48.259  1.00 71.09  ? 453  MET A SD    1 
ATOM   3411  C  CE    . MET A 1  453  ? 11.567  -17.479 49.405  1.00 69.28  ? 453  MET A CE    1 
ATOM   3412  N  N     . SER A 1  454  ? 12.335  -13.548 45.455  1.00 60.00  ? 454  SER A N     1 
ATOM   3413  C  CA    . SER A 1  454  ? 11.745  -12.400 44.781  1.00 59.00  ? 454  SER A CA    1 
ATOM   3414  C  C     . SER A 1  454  ? 11.787  -12.713 43.277  1.00 58.26  ? 454  SER A C     1 
ATOM   3415  O  O     . SER A 1  454  ? 10.792  -12.525 42.573  1.00 58.07  ? 454  SER A O     1 
ATOM   3416  C  CB    . SER A 1  454  ? 12.459  -11.088 45.128  1.00 59.17  ? 454  SER A CB    1 
ATOM   3417  O  OG    . SER A 1  454  ? 11.660  -10.265 45.970  1.00 59.00  ? 454  SER A OG    1 
ATOM   3418  N  N     . MET A 1  455  ? 12.925  -13.249 42.824  1.00 57.08  ? 455  MET A N     1 
ATOM   3419  C  CA    . MET A 1  455  ? 13.144  -13.650 41.439  1.00 55.92  ? 455  MET A CA    1 
ATOM   3420  C  C     . MET A 1  455  ? 12.963  -15.143 41.198  1.00 55.32  ? 455  MET A C     1 
ATOM   3421  O  O     . MET A 1  455  ? 13.297  -15.952 42.055  1.00 55.17  ? 455  MET A O     1 
ATOM   3422  C  CB    . MET A 1  455  ? 14.567  -13.370 41.099  1.00 56.05  ? 455  MET A CB    1 
ATOM   3423  C  CG    . MET A 1  455  ? 14.838  -12.026 40.707  1.00 56.16  ? 455  MET A CG    1 
ATOM   3424  S  SD    . MET A 1  455  ? 16.350  -12.265 39.795  1.00 60.64  ? 455  MET A SD    1 
ATOM   3425  C  CE    . MET A 1  455  ? 16.535  -10.614 39.070  1.00 59.20  ? 455  MET A CE    1 
ATOM   3426  N  N     . MET A 1  456  ? 12.481  -15.513 40.015  1.00 54.55  ? 456  MET A N     1 
ATOM   3427  C  CA    . MET A 1  456  ? 12.398  -16.925 39.610  1.00 53.80  ? 456  MET A CA    1 
ATOM   3428  C  C     . MET A 1  456  ? 11.966  -17.059 38.162  1.00 53.14  ? 456  MET A C     1 
ATOM   3429  O  O     . MET A 1  456  ? 11.542  -16.086 37.545  1.00 52.76  ? 456  MET A O     1 
ATOM   3430  C  CB    . MET A 1  456  ? 11.498  -17.756 40.554  1.00 54.13  ? 456  MET A CB    1 
ATOM   3431  C  CG    . MET A 1  456  ? 10.148  -17.115 40.981  1.00 54.32  ? 456  MET A CG    1 
ATOM   3432  S  SD    . MET A 1  456  ? 9.794   -17.251 42.761  1.00 54.22  ? 456  MET A SD    1 
ATOM   3433  C  CE    . MET A 1  456  ? 8.543   -18.521 42.831  1.00 53.91  ? 456  MET A CE    1 
ATOM   3434  N  N     . ALA A 1  457  ? 12.094  -18.263 37.618  1.00 52.85  ? 457  ALA A N     1 
ATOM   3435  C  CA    . ALA A 1  457  ? 11.768  -18.495 36.219  1.00 52.81  ? 457  ALA A CA    1 
ATOM   3436  C  C     . ALA A 1  457  ? 10.328  -18.898 36.088  1.00 52.89  ? 457  ALA A C     1 
ATOM   3437  O  O     . ALA A 1  457  ? 9.833   -19.705 36.867  1.00 53.29  ? 457  ALA A O     1 
ATOM   3438  C  CB    . ALA A 1  457  ? 12.668  -19.551 35.614  1.00 52.61  ? 457  ALA A CB    1 
ATOM   3439  N  N     . HIS A 1  458  ? 9.640   -18.318 35.114  1.00 53.04  ? 458  HIS A N     1 
ATOM   3440  C  CA    . HIS A 1  458  ? 8.304   -18.814 34.735  1.00 53.45  ? 458  HIS A CA    1 
ATOM   3441  C  C     . HIS A 1  458  ? 8.260   -19.343 33.260  1.00 52.90  ? 458  HIS A C     1 
ATOM   3442  O  O     . HIS A 1  458  ? 9.258   -19.244 32.489  1.00 52.90  ? 458  HIS A O     1 
ATOM   3443  C  CB    . HIS A 1  458  ? 7.188   -17.776 34.982  1.00 53.37  ? 458  HIS A CB    1 
ATOM   3444  C  CG    . HIS A 1  458  ? 6.986   -17.397 36.421  1.00 55.03  ? 458  HIS A CG    1 
ATOM   3445  N  ND1   . HIS A 1  458  ? 5.758   -17.487 37.046  1.00 57.38  ? 458  HIS A ND1   1 
ATOM   3446  C  CD2   . HIS A 1  458  ? 7.828   -16.860 37.336  1.00 56.40  ? 458  HIS A CD2   1 
ATOM   3447  C  CE1   . HIS A 1  458  ? 5.854   -17.035 38.284  1.00 57.40  ? 458  HIS A CE1   1 
ATOM   3448  N  NE2   . HIS A 1  458  ? 7.102   -16.653 38.487  1.00 57.30  ? 458  HIS A NE2   1 
ATOM   3449  N  N     . ARG A 1  459  ? 7.114   -19.938 32.908  1.00 51.51  ? 459  ARG A N     1 
ATOM   3450  C  CA    . ARG A 1  459  ? 6.844   -20.390 31.567  1.00 50.03  ? 459  ARG A CA    1 
ATOM   3451  C  C     . ARG A 1  459  ? 5.944   -19.319 31.015  1.00 49.34  ? 459  ARG A C     1 
ATOM   3452  O  O     . ARG A 1  459  ? 5.103   -18.817 31.742  1.00 49.41  ? 459  ARG A O     1 
ATOM   3453  C  CB    . ARG A 1  459  ? 6.133   -21.742 31.589  1.00 50.18  ? 459  ARG A CB    1 
ATOM   3454  C  CG    . ARG A 1  459  ? 7.058   -22.947 31.794  1.00 50.77  ? 459  ARG A CG    1 
ATOM   3455  C  CD    . ARG A 1  459  ? 6.341   -24.156 32.387  1.00 51.80  ? 459  ARG A CD    1 
ATOM   3456  N  NE    . ARG A 1  459  ? 5.428   -24.762 31.420  1.00 54.85  ? 459  ARG A NE    1 
ATOM   3457  C  CZ    . ARG A 1  459  ? 4.095   -24.802 31.525  1.00 56.79  ? 459  ARG A CZ    1 
ATOM   3458  N  NH1   . ARG A 1  459  ? 3.473   -24.279 32.581  1.00 56.84  ? 459  ARG A NH1   1 
ATOM   3459  N  NH2   . ARG A 1  459  ? 3.375   -25.386 30.562  1.00 57.71  ? 459  ARG A NH2   1 
ATOM   3460  N  N     . VAL A 1  460  ? 6.149   -18.968 29.741  1.00 48.55  ? 460  VAL A N     1 
ATOM   3461  C  CA    . VAL A 1  460  ? 5.472   -17.878 29.025  1.00 47.06  ? 460  VAL A CA    1 
ATOM   3462  C  C     . VAL A 1  460  ? 4.196   -18.316 28.376  1.00 46.92  ? 460  VAL A C     1 
ATOM   3463  O  O     . VAL A 1  460  ? 4.193   -19.200 27.505  1.00 46.71  ? 460  VAL A O     1 
ATOM   3464  C  CB    . VAL A 1  460  ? 6.283   -17.437 27.821  1.00 46.87  ? 460  VAL A CB    1 
ATOM   3465  C  CG1   . VAL A 1  460  ? 6.397   -15.976 27.803  1.00 47.16  ? 460  VAL A CG1   1 
ATOM   3466  C  CG2   . VAL A 1  460  ? 7.636   -18.055 27.828  1.00 45.68  ? 460  VAL A CG2   1 
ATOM   3467  N  N     . LYS A 1  461  ? 3.107   -17.682 28.767  1.00 46.88  ? 461  LYS A N     1 
ATOM   3468  C  CA    . LYS A 1  461  ? 1.891   -17.775 27.962  1.00 46.94  ? 461  LYS A CA    1 
ATOM   3469  C  C     . LYS A 1  461  ? 1.665   -16.404 27.326  1.00 46.22  ? 461  LYS A C     1 
ATOM   3470  O  O     . LYS A 1  461  ? 1.496   -15.419 28.036  1.00 46.68  ? 461  LYS A O     1 
ATOM   3471  C  CB    . LYS A 1  461  ? 0.673   -18.264 28.780  1.00 47.17  ? 461  LYS A CB    1 
ATOM   3472  C  CG    . LYS A 1  461  ? -0.620  -18.511 27.951  1.00 47.79  ? 461  LYS A CG    1 
ATOM   3473  C  CD    . LYS A 1  461  ? -0.806  -19.999 27.493  1.00 49.43  ? 461  LYS A CD    1 
ATOM   3474  C  CE    . LYS A 1  461  ? -2.229  -20.289 26.884  1.00 49.01  ? 461  LYS A CE    1 
ATOM   3475  N  NZ    . LYS A 1  461  ? -2.487  -19.751 25.490  1.00 47.12  ? 461  LYS A NZ    1 
ATOM   3476  N  N     . VAL A 1  462  ? 1.721   -16.337 25.999  1.00 45.18  ? 462  VAL A N     1 
ATOM   3477  C  CA    . VAL A 1  462  ? 1.501   -15.082 25.294  1.00 44.32  ? 462  VAL A CA    1 
ATOM   3478  C  C     . VAL A 1  462  ? -0.022  -14.832 25.285  1.00 43.91  ? 462  VAL A C     1 
ATOM   3479  O  O     . VAL A 1  462  ? -0.815  -15.773 25.120  1.00 44.00  ? 462  VAL A O     1 
ATOM   3480  C  CB    . VAL A 1  462  ? 2.132   -15.085 23.849  1.00 44.47  ? 462  VAL A CB    1 
ATOM   3481  C  CG1   . VAL A 1  462  ? 2.197   -13.679 23.301  1.00 44.53  ? 462  VAL A CG1   1 
ATOM   3482  C  CG2   . VAL A 1  462  ? 3.541   -15.663 23.840  1.00 44.03  ? 462  VAL A CG2   1 
ATOM   3483  N  N     . ILE A 1  463  ? -0.430  -13.578 25.467  1.00 43.09  ? 463  ILE A N     1 
ATOM   3484  C  CA    . ILE A 1  463  ? -1.820  -13.279 25.779  1.00 42.47  ? 463  ILE A CA    1 
ATOM   3485  C  C     . ILE A 1  463  ? -2.376  -12.001 25.134  1.00 43.56  ? 463  ILE A C     1 
ATOM   3486  O  O     . ILE A 1  463  ? -1.636  -11.232 24.502  1.00 43.33  ? 463  ILE A O     1 
ATOM   3487  C  CB    . ILE A 1  463  ? -2.073  -13.210 27.359  1.00 41.89  ? 463  ILE A CB    1 
ATOM   3488  C  CG1   . ILE A 1  463  ? -0.811  -12.818 28.149  1.00 39.31  ? 463  ILE A CG1   1 
ATOM   3489  C  CG2   . ILE A 1  463  ? -2.684  -14.519 27.903  1.00 40.69  ? 463  ILE A CG2   1 
ATOM   3490  C  CD1   . ILE A 1  463  ? -0.590  -11.333 28.341  1.00 32.84  ? 463  ILE A CD1   1 
ATOM   3491  N  N     . PRO A 1  464  ? -3.705  -11.760 25.322  1.00 44.44  ? 464  PRO A N     1 
ATOM   3492  C  CA    . PRO A 1  464  ? -4.305  -10.424 25.105  1.00 44.40  ? 464  PRO A CA    1 
ATOM   3493  C  C     . PRO A 1  464  ? -3.881  -9.431  26.195  1.00 43.97  ? 464  PRO A C     1 
ATOM   3494  O  O     . PRO A 1  464  ? -3.151  -9.825  27.099  1.00 43.75  ? 464  PRO A O     1 
ATOM   3495  C  CB    . PRO A 1  464  ? -5.815  -10.701 25.177  1.00 44.18  ? 464  PRO A CB    1 
ATOM   3496  C  CG    . PRO A 1  464  ? -5.941  -11.936 25.965  1.00 43.62  ? 464  PRO A CG    1 
ATOM   3497  C  CD    . PRO A 1  464  ? -4.728  -12.750 25.743  1.00 44.49  ? 464  PRO A CD    1 
ATOM   3498  N  N     . TYR A 1  465  ? -4.313  -8.170  26.090  1.00 43.78  ? 465  TYR A N     1 
ATOM   3499  C  CA    . TYR A 1  465  ? -4.076  -7.143  27.128  1.00 44.04  ? 465  TYR A CA    1 
ATOM   3500  C  C     . TYR A 1  465  ? -2.619  -6.902  27.583  1.00 43.39  ? 465  TYR A C     1 
ATOM   3501  O  O     . TYR A 1  465  ? -1.902  -7.779  28.096  1.00 43.05  ? 465  TYR A O     1 
ATOM   3502  C  CB    . TYR A 1  465  ? -5.051  -7.308  28.339  1.00 45.47  ? 465  TYR A CB    1 
ATOM   3503  C  CG    . TYR A 1  465  ? -6.420  -7.648  27.840  1.00 46.21  ? 465  TYR A CG    1 
ATOM   3504  C  CD1   . TYR A 1  465  ? -6.840  -8.957  27.796  1.00 47.28  ? 465  TYR A CD1   1 
ATOM   3505  C  CD2   . TYR A 1  465  ? -7.240  -6.676  27.296  1.00 48.03  ? 465  TYR A CD2   1 
ATOM   3506  C  CE1   . TYR A 1  465  ? -8.054  -9.305  27.266  1.00 48.81  ? 465  TYR A CE1   1 
ATOM   3507  C  CE2   . TYR A 1  465  ? -8.470  -6.996  26.752  1.00 49.70  ? 465  TYR A CE2   1 
ATOM   3508  C  CZ    . TYR A 1  465  ? -8.875  -8.326  26.738  1.00 49.63  ? 465  TYR A CZ    1 
ATOM   3509  O  OH    . TYR A 1  465  ? -10.101 -8.702  26.206  1.00 50.30  ? 465  TYR A OH    1 
ATOM   3510  N  N     . SER A 1  466  ? -2.233  -5.651  27.411  1.00 42.49  ? 466  SER A N     1 
ATOM   3511  C  CA    . SER A 1  466  ? -0.908  -5.119  27.711  1.00 41.73  ? 466  SER A CA    1 
ATOM   3512  C  C     . SER A 1  466  ? -0.299  -5.378  29.107  1.00 40.84  ? 466  SER A C     1 
ATOM   3513  O  O     . SER A 1  466  ? 0.651   -4.707  29.470  1.00 40.99  ? 466  SER A O     1 
ATOM   3514  C  CB    . SER A 1  466  ? -0.984  -3.603  27.491  1.00 41.80  ? 466  SER A CB    1 
ATOM   3515  O  OG    . SER A 1  466  ? -2.211  -3.257  26.832  1.00 42.60  ? 466  SER A OG    1 
ATOM   3516  N  N     . THR A 1  467  ? -0.818  -6.321  29.884  1.00 39.80  ? 467  THR A N     1 
ATOM   3517  C  CA    . THR A 1  467  ? -0.379  -6.470  31.275  1.00 39.00  ? 467  THR A CA    1 
ATOM   3518  C  C     . THR A 1  467  ? 0.311   -7.830  31.452  1.00 39.18  ? 467  THR A C     1 
ATOM   3519  O  O     . THR A 1  467  ? 0.130   -8.722  30.602  1.00 39.44  ? 467  THR A O     1 
ATOM   3520  C  CB    . THR A 1  467  ? -1.556  -6.396  32.231  1.00 38.70  ? 467  THR A CB    1 
ATOM   3521  O  OG1   . THR A 1  467  ? -2.068  -7.721  32.417  1.00 38.55  ? 467  THR A OG1   1 
ATOM   3522  C  CG2   . THR A 1  467  ? -2.674  -5.486  31.667  1.00 38.10  ? 467  THR A CG2   1 
ATOM   3523  N  N     . PHE A 1  468  ? 1.143   -7.970  32.501  1.00 38.90  ? 468  PHE A N     1 
ATOM   3524  C  CA    . PHE A 1  468  ? 1.660   -9.277  32.967  1.00 38.13  ? 468  PHE A CA    1 
ATOM   3525  C  C     . PHE A 1  468  ? 0.643   -9.903  33.962  1.00 38.09  ? 468  PHE A C     1 
ATOM   3526  O  O     . PHE A 1  468  ? 0.279   -9.324  35.015  1.00 38.12  ? 468  PHE A O     1 
ATOM   3527  C  CB    . PHE A 1  468  ? 2.963   -9.146  33.719  1.00 37.64  ? 468  PHE A CB    1 
ATOM   3528  C  CG    . PHE A 1  468  ? 4.148   -8.896  32.881  1.00 38.67  ? 468  PHE A CG    1 
ATOM   3529  C  CD1   . PHE A 1  468  ? 4.843   -7.705  32.989  1.00 39.59  ? 468  PHE A CD1   1 
ATOM   3530  C  CD2   . PHE A 1  468  ? 4.651   -9.874  32.038  1.00 39.98  ? 468  PHE A CD2   1 
ATOM   3531  C  CE1   . PHE A 1  468  ? 5.988   -7.496  32.237  1.00 37.35  ? 468  PHE A CE1   1 
ATOM   3532  C  CE2   . PHE A 1  468  ? 5.813   -9.669  31.291  1.00 35.57  ? 468  PHE A CE2   1 
ATOM   3533  C  CZ    . PHE A 1  468  ? 6.457   -8.490  31.390  1.00 36.69  ? 468  PHE A CZ    1 
ATOM   3534  N  N     . ARG A 1  469  ? 0.229   -11.113 33.627  1.00 36.93  ? 469  ARG A N     1 
ATOM   3535  C  CA    . ARG A 1  469  ? -0.774  -11.823 34.335  1.00 35.25  ? 469  ARG A CA    1 
ATOM   3536  C  C     . ARG A 1  469  ? -0.055  -12.977 35.059  1.00 35.40  ? 469  ARG A C     1 
ATOM   3537  O  O     . ARG A 1  469  ? 0.636   -13.778 34.411  1.00 36.29  ? 469  ARG A O     1 
ATOM   3538  C  CB    . ARG A 1  469  ? -1.794  -12.314 33.294  1.00 34.59  ? 469  ARG A CB    1 
ATOM   3539  C  CG    . ARG A 1  469  ? -2.234  -11.235 32.301  1.00 33.20  ? 469  ARG A CG    1 
ATOM   3540  C  CD    . ARG A 1  469  ? -3.553  -11.525 31.633  1.00 33.60  ? 469  ARG A CD    1 
ATOM   3541  N  NE    . ARG A 1  469  ? -4.630  -10.732 32.261  1.00 42.26  ? 469  ARG A NE    1 
ATOM   3542  C  CZ    . ARG A 1  469  ? -5.345  -11.024 33.399  1.00 43.95  ? 469  ARG A CZ    1 
ATOM   3543  N  NH1   . ARG A 1  469  ? -5.142  -12.130 34.157  1.00 41.12  ? 469  ARG A NH1   1 
ATOM   3544  N  NH2   . ARG A 1  469  ? -6.294  -10.165 33.807  1.00 42.95  ? 469  ARG A NH2   1 
ATOM   3545  N  N     . LEU A 1  470  ? -0.159  -13.076 36.383  1.00 34.96  ? 470  LEU A N     1 
ATOM   3546  C  CA    . LEU A 1  470  ? 0.374   -14.288 37.054  1.00 35.01  ? 470  LEU A CA    1 
ATOM   3547  C  C     . LEU A 1  470  ? -0.587  -14.962 38.025  1.00 35.43  ? 470  LEU A C     1 
ATOM   3548  O  O     . LEU A 1  470  ? -1.557  -14.315 38.504  1.00 36.16  ? 470  LEU A O     1 
ATOM   3549  C  CB    . LEU A 1  470  ? 1.708   -14.011 37.739  1.00 34.74  ? 470  LEU A CB    1 
ATOM   3550  C  CG    . LEU A 1  470  ? 1.881   -12.636 38.376  1.00 34.45  ? 470  LEU A CG    1 
ATOM   3551  C  CD1   . LEU A 1  470  ? 1.186   -12.561 39.750  1.00 36.85  ? 470  LEU A CD1   1 
ATOM   3552  C  CD2   . LEU A 1  470  ? 3.349   -12.310 38.497  1.00 32.95  ? 470  LEU A CD2   1 
ATOM   3553  N  N     . ASN A 1  471  ? -0.319  -16.242 38.329  1.00 35.22  ? 471  ASN A N     1 
ATOM   3554  C  CA    . ASN A 1  471  ? -1.201  -17.048 39.234  1.00 35.24  ? 471  ASN A CA    1 
ATOM   3555  C  C     . ASN A 1  471  ? -1.268  -16.537 40.712  1.00 35.11  ? 471  ASN A C     1 
ATOM   3556  O  O     . ASN A 1  471  ? -0.231  -16.644 41.381  1.00 36.62  ? 471  ASN A O     1 
ATOM   3557  C  CB    . ASN A 1  471  ? -0.743  -18.530 39.193  1.00 35.72  ? 471  ASN A CB    1 
ATOM   3558  C  CG    . ASN A 1  471  ? -1.573  -19.450 40.125  1.00 37.31  ? 471  ASN A CG    1 
ATOM   3559  O  OD1   . ASN A 1  471  ? -1.627  -19.221 41.341  1.00 39.15  ? 471  ASN A OD1   1 
ATOM   3560  N  ND2   . ASN A 1  471  ? -2.196  -20.509 39.555  1.00 37.42  ? 471  ASN A ND2   1 
ATOM   3561  N  N     . LEU A 1  472  ? -2.409  -16.026 41.162  1.00 33.22  ? 472  LEU A N     1 
ATOM   3562  C  CA    . LEU A 1  472  ? -2.541  -15.532 42.528  1.00 32.49  ? 472  LEU A CA    1 
ATOM   3563  C  C     . LEU A 1  472  ? -1.553  -16.222 43.462  1.00 33.19  ? 472  LEU A C     1 
ATOM   3564  O  O     . LEU A 1  472  ? -0.797  -15.565 44.177  1.00 32.14  ? 472  LEU A O     1 
ATOM   3565  C  CB    . LEU A 1  472  ? -3.971  -15.732 43.034  1.00 30.94  ? 472  LEU A CB    1 
ATOM   3566  C  CG    . LEU A 1  472  ? -5.081  -15.078 42.207  1.00 25.29  ? 472  LEU A CG    1 
ATOM   3567  C  CD1   . LEU A 1  472  ? -6.310  -15.972 42.155  1.00 20.17  ? 472  LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A 1  472  ? -5.432  -13.708 42.767  1.00 12.43  ? 472  LEU A CD2   1 
ATOM   3569  N  N     . SER A 1  473  ? -1.565  -17.551 43.451  1.00 34.78  ? 473  SER A N     1 
ATOM   3570  C  CA    . SER A 1  473  ? -0.671  -18.332 44.296  1.00 36.61  ? 473  SER A CA    1 
ATOM   3571  C  C     . SER A 1  473  ? 0.725   -17.720 44.337  1.00 37.69  ? 473  SER A C     1 
ATOM   3572  O  O     . SER A 1  473  ? 1.312   -17.560 45.408  1.00 38.05  ? 473  SER A O     1 
ATOM   3573  C  CB    . SER A 1  473  ? -0.596  -19.779 43.804  1.00 36.77  ? 473  SER A CB    1 
ATOM   3574  O  OG    . SER A 1  473  ? -1.310  -20.649 44.665  1.00 39.47  ? 473  SER A OG    1 
ATOM   3575  N  N     . VAL A 1  474  ? 1.250   -17.378 43.165  1.00 38.83  ? 474  VAL A N     1 
ATOM   3576  C  CA    . VAL A 1  474  ? 2.577   -16.782 43.066  1.00 40.30  ? 474  VAL A CA    1 
ATOM   3577  C  C     . VAL A 1  474  ? 2.542   -15.296 43.407  1.00 40.85  ? 474  VAL A C     1 
ATOM   3578  O  O     . VAL A 1  474  ? 3.170   -14.480 42.733  1.00 41.38  ? 474  VAL A O     1 
ATOM   3579  C  CB    . VAL A 1  474  ? 3.172   -16.961 41.656  1.00 40.36  ? 474  VAL A CB    1 
ATOM   3580  C  CG1   . VAL A 1  474  ? 2.901   -15.729 40.806  1.00 41.13  ? 474  VAL A CG1   1 
ATOM   3581  C  CG2   . VAL A 1  474  ? 4.664   -17.241 41.742  1.00 40.52  ? 474  VAL A CG2   1 
ATOM   3582  N  N     . THR A 1  475  ? 1.804   -14.953 44.458  1.00 42.02  ? 475  THR A N     1 
ATOM   3583  C  CA    . THR A 1  475  ? 1.685   -13.566 44.891  1.00 42.03  ? 475  THR A CA    1 
ATOM   3584  C  C     . THR A 1  475  ? 2.405   -13.339 46.216  1.00 42.67  ? 475  THR A C     1 
ATOM   3585  O  O     . THR A 1  475  ? 2.316   -12.261 46.804  1.00 43.00  ? 475  THR A O     1 
ATOM   3586  C  CB    . THR A 1  475  ? 0.212   -13.145 45.039  1.00 41.76  ? 475  THR A CB    1 
ATOM   3587  O  OG1   . THR A 1  475  ? 0.071   -11.760 44.700  1.00 37.10  ? 475  THR A OG1   1 
ATOM   3588  C  CG2   . THR A 1  475  ? -0.264  -13.363 46.467  1.00 39.58  ? 475  THR A CG2   1 
ATOM   3589  N  N     . SER A 1  476  ? 3.118   -14.360 46.679  1.00 42.70  ? 476  SER A N     1 
ATOM   3590  C  CA    . SER A 1  476  ? 3.855   -14.273 47.934  1.00 43.22  ? 476  SER A CA    1 
ATOM   3591  C  C     . SER A 1  476  ? 5.305   -13.869 47.696  1.00 43.66  ? 476  SER A C     1 
ATOM   3592  O  O     . SER A 1  476  ? 5.674   -12.708 47.875  1.00 43.89  ? 476  SER A O     1 
ATOM   3593  C  CB    . SER A 1  476  ? 3.796   -15.607 48.683  1.00 43.32  ? 476  SER A CB    1 
ATOM   3594  O  OG    . SER A 1  476  ? 2.843   -15.563 49.730  1.00 43.58  ? 476  SER A OG    1 
ATOM   3595  N  N     . PRO A 1  477  ? 6.125   -14.834 47.291  1.00 44.30  ? 477  PRO A N     1 
ATOM   3596  C  CA    . PRO A 1  477  ? 7.544   -14.579 47.025  1.00 45.01  ? 477  PRO A CA    1 
ATOM   3597  C  C     . PRO A 1  477  ? 7.775   -13.169 46.492  1.00 45.23  ? 477  PRO A C     1 
ATOM   3598  O  O     . PRO A 1  477  ? 8.481   -12.380 47.122  1.00 45.13  ? 477  PRO A O     1 
ATOM   3599  C  CB    . PRO A 1  477  ? 7.884   -15.611 45.948  1.00 45.16  ? 477  PRO A CB    1 
ATOM   3600  C  CG    . PRO A 1  477  ? 6.596   -15.848 45.243  1.00 45.04  ? 477  PRO A CG    1 
ATOM   3601  C  CD    . PRO A 1  477  ? 5.527   -15.738 46.293  1.00 44.60  ? 477  PRO A CD    1 
ATOM   3602  N  N     . TYR A 1  478  ? 7.184   -12.862 45.343  1.00 45.41  ? 478  TYR A N     1 
ATOM   3603  C  CA    . TYR A 1  478  ? 7.330   -11.545 44.734  1.00 46.20  ? 478  TYR A CA    1 
ATOM   3604  C  C     . TYR A 1  478  ? 6.872   -10.445 45.686  1.00 47.45  ? 478  TYR A C     1 
ATOM   3605  O  O     . TYR A 1  478  ? 7.517   -9.403  45.802  1.00 48.41  ? 478  TYR A O     1 
ATOM   3606  C  CB    . TYR A 1  478  ? 6.542   -11.469 43.425  1.00 45.71  ? 478  TYR A CB    1 
ATOM   3607  C  CG    . TYR A 1  478  ? 7.020   -12.436 42.366  1.00 45.03  ? 478  TYR A CG    1 
ATOM   3608  C  CD1   . TYR A 1  478  ? 6.400   -13.666 42.191  1.00 43.30  ? 478  TYR A CD1   1 
ATOM   3609  C  CD2   . TYR A 1  478  ? 8.092   -12.120 41.542  1.00 45.29  ? 478  TYR A CD2   1 
ATOM   3610  C  CE1   . TYR A 1  478  ? 6.833   -14.554 41.224  1.00 45.22  ? 478  TYR A CE1   1 
ATOM   3611  C  CE2   . TYR A 1  478  ? 8.532   -13.002 40.572  1.00 44.40  ? 478  TYR A CE2   1 
ATOM   3612  C  CZ    . TYR A 1  478  ? 7.899   -14.217 40.418  1.00 45.76  ? 478  TYR A CZ    1 
ATOM   3613  O  OH    . TYR A 1  478  ? 8.334   -15.097 39.454  1.00 45.88  ? 478  TYR A OH    1 
ATOM   3614  N  N     . ASN A 1  479  ? 5.755   -10.684 46.365  1.00 48.43  ? 479  ASN A N     1 
ATOM   3615  C  CA    . ASN A 1  479  ? 5.209   -9.715  47.308  1.00 49.72  ? 479  ASN A CA    1 
ATOM   3616  C  C     . ASN A 1  479  ? 4.638   -8.487  46.607  1.00 50.07  ? 479  ASN A C     1 
ATOM   3617  O  O     . ASN A 1  479  ? 5.374   -7.571  46.241  1.00 49.52  ? 479  ASN A O     1 
ATOM   3618  C  CB    . ASN A 1  479  ? 6.275   -9.294  48.322  1.00 50.17  ? 479  ASN A CB    1 
ATOM   3619  C  CG    . ASN A 1  479  ? 5.739   -8.334  49.365  1.00 53.32  ? 479  ASN A CG    1 
ATOM   3620  O  OD1   . ASN A 1  479  ? 4.900   -8.699  50.189  1.00 57.10  ? 479  ASN A OD1   1 
ATOM   3621  N  ND2   . ASN A 1  479  ? 6.223   -7.097  49.336  1.00 54.50  ? 479  ASN A ND2   1 
ATOM   3622  N  N     . ALA A 1  480  ? 3.321   -8.475  46.424  1.00 51.08  ? 480  ALA A N     1 
ATOM   3623  C  CA    . ALA A 1  480  ? 2.650   -7.360  45.768  1.00 52.50  ? 480  ALA A CA    1 
ATOM   3624  C  C     . ALA A 1  480  ? 1.306   -7.788  45.188  1.00 54.43  ? 480  ALA A C     1 
ATOM   3625  O  O     . ALA A 1  480  ? 1.234   -8.717  44.383  1.00 55.30  ? 480  ALA A O     1 
ATOM   3626  C  CB    . ALA A 1  480  ? 3.536   -6.773  44.680  1.00 51.52  ? 480  ALA A CB    1 
ATOM   3627  N  N     . ASP A 1  481  ? 0.244   -7.104  45.601  1.00 55.60  ? 481  ASP A N     1 
ATOM   3628  C  CA    . ASP A 1  481  ? -1.099  -7.411  45.122  1.00 56.59  ? 481  ASP A CA    1 
ATOM   3629  C  C     . ASP A 1  481  ? -1.340  -6.810  43.741  1.00 56.63  ? 481  ASP A C     1 
ATOM   3630  O  O     . ASP A 1  481  ? -0.397  -6.544  42.996  1.00 56.63  ? 481  ASP A O     1 
ATOM   3631  C  CB    . ASP A 1  481  ? -2.150  -6.899  46.109  1.00 57.31  ? 481  ASP A CB    1 
ATOM   3632  C  CG    . ASP A 1  481  ? -1.587  -5.885  47.086  1.00 59.81  ? 481  ASP A CG    1 
ATOM   3633  O  OD1   . ASP A 1  481  ? -1.173  -4.794  46.641  1.00 60.62  ? 481  ASP A OD1   1 
ATOM   3634  O  OD2   . ASP A 1  481  ? -1.558  -6.180  48.300  1.00 62.54  ? 481  ASP A OD2   1 
ATOM   3635  N  N     . PHE A 1  482  ? -2.609  -6.599  43.406  1.00 56.20  ? 482  PHE A N     1 
ATOM   3636  C  CA    . PHE A 1  482  ? -2.970  -6.035  42.130  1.00 55.82  ? 482  PHE A CA    1 
ATOM   3637  C  C     . PHE A 1  482  ? -3.521  -4.629  42.219  1.00 55.67  ? 482  PHE A C     1 
ATOM   3638  O  O     . PHE A 1  482  ? -4.320  -4.226  41.388  1.00 55.80  ? 482  PHE A O     1 
ATOM   3639  C  CB    . PHE A 1  482  ? -3.855  -7.021  41.391  1.00 56.21  ? 482  PHE A CB    1 
ATOM   3640  C  CG    . PHE A 1  482  ? -3.307  -8.440  41.427  1.00 57.60  ? 482  PHE A CG    1 
ATOM   3641  C  CD1   . PHE A 1  482  ? -3.859  -9.396  42.282  1.00 56.19  ? 482  PHE A CD1   1 
ATOM   3642  C  CD2   . PHE A 1  482  ? -2.183  -8.798  40.623  1.00 60.36  ? 482  PHE A CD2   1 
ATOM   3643  C  CE1   . PHE A 1  482  ? -3.345  -10.674 42.332  1.00 57.71  ? 482  PHE A CE1   1 
ATOM   3644  C  CE2   . PHE A 1  482  ? -1.629  -10.102 40.652  1.00 59.27  ? 482  PHE A CE2   1 
ATOM   3645  C  CZ    . PHE A 1  482  ? -2.217  -11.046 41.516  1.00 59.30  ? 482  PHE A CZ    1 
ATOM   3646  N  N     . ASP A 1  483  ? -3.043  -3.875  43.218  1.00 55.60  ? 483  ASP A N     1 
ATOM   3647  C  CA    . ASP A 1  483  ? -3.245  -2.406  43.297  1.00 55.34  ? 483  ASP A CA    1 
ATOM   3648  C  C     . ASP A 1  483  ? -2.338  -1.466  42.466  1.00 55.24  ? 483  ASP A C     1 
ATOM   3649  O  O     . ASP A 1  483  ? -2.379  -0.266  42.706  1.00 55.07  ? 483  ASP A O     1 
ATOM   3650  C  CB    . ASP A 1  483  ? -3.316  -1.911  44.766  1.00 55.46  ? 483  ASP A CB    1 
ATOM   3651  C  CG    . ASP A 1  483  ? -1.975  -1.984  45.535  1.00 55.57  ? 483  ASP A CG    1 
ATOM   3652  O  OD1   . ASP A 1  483  ? -1.928  -1.481  46.692  1.00 53.97  ? 483  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP A 1  483  ? -0.965  -2.538  45.031  1.00 60.64  ? 483  ASP A OD2   1 
ATOM   3654  N  N     . GLY A 1  484  ? -1.530  -1.984  41.529  1.00 55.23  ? 484  GLY A N     1 
ATOM   3655  C  CA    . GLY A 1  484  ? -0.757  -1.123  40.616  1.00 55.84  ? 484  GLY A CA    1 
ATOM   3656  C  C     . GLY A 1  484  ? 0.729   -1.407  40.376  1.00 56.60  ? 484  GLY A C     1 
ATOM   3657  O  O     . GLY A 1  484  ? 1.339   -0.894  39.398  1.00 56.48  ? 484  GLY A O     1 
ATOM   3658  N  N     . ASP A 1  485  ? 1.316   -2.219  41.269  1.00 56.98  ? 485  ASP A N     1 
ATOM   3659  C  CA    . ASP A 1  485  ? 2.746   -2.694  41.199  1.00 56.66  ? 485  ASP A CA    1 
ATOM   3660  C  C     . ASP A 1  485  ? 3.189   -3.277  39.820  1.00 55.90  ? 485  ASP A C     1 
ATOM   3661  O  O     . ASP A 1  485  ? 2.472   -4.056  39.233  1.00 55.66  ? 485  ASP A O     1 
ATOM   3662  C  CB    . ASP A 1  485  ? 3.063   -3.647  42.401  1.00 56.78  ? 485  ASP A CB    1 
ATOM   3663  C  CG    . ASP A 1  485  ? 1.774   -4.056  43.235  1.00 59.23  ? 485  ASP A CG    1 
ATOM   3664  O  OD1   . ASP A 1  485  ? 0.680   -3.505  42.934  1.00 59.69  ? 485  ASP A OD1   1 
ATOM   3665  O  OD2   . ASP A 1  485  ? 1.856   -4.978  44.115  1.00 60.44  ? 485  ASP A OD2   1 
ATOM   3666  N  N     . GLU A 1  486  ? 4.339   -2.846  39.297  1.00 55.82  ? 486  GLU A N     1 
ATOM   3667  C  CA    . GLU A 1  486  ? 4.922   -3.336  38.005  1.00 55.91  ? 486  GLU A CA    1 
ATOM   3668  C  C     . GLU A 1  486  ? 5.786   -4.567  38.258  1.00 54.75  ? 486  GLU A C     1 
ATOM   3669  O  O     . GLU A 1  486  ? 6.251   -4.730  39.377  1.00 54.74  ? 486  GLU A O     1 
ATOM   3670  C  CB    . GLU A 1  486  ? 5.822   -2.241  37.364  1.00 56.02  ? 486  GLU A CB    1 
ATOM   3671  C  CG    . GLU A 1  486  ? 5.203   -1.306  36.252  1.00 57.12  ? 486  GLU A CG    1 
ATOM   3672  C  CD    . GLU A 1  486  ? 5.953   0.057   36.076  1.00 57.29  ? 486  GLU A CD    1 
ATOM   3673  O  OE1   . GLU A 1  486  ? 6.084   0.795   37.091  1.00 60.31  ? 486  GLU A OE1   1 
ATOM   3674  O  OE2   . GLU A 1  486  ? 6.384   0.412   34.934  1.00 57.12  ? 486  GLU A OE2   1 
ATOM   3675  N  N     . MET A 1  487  ? 6.042   -5.412  37.258  1.00 54.00  ? 487  MET A N     1 
ATOM   3676  C  CA    . MET A 1  487  ? 7.131   -6.431  37.427  1.00 54.76  ? 487  MET A CA    1 
ATOM   3677  C  C     . MET A 1  487  ? 8.157   -6.589  36.246  1.00 53.96  ? 487  MET A C     1 
ATOM   3678  O  O     . MET A 1  487  ? 7.898   -6.122  35.168  1.00 53.50  ? 487  MET A O     1 
ATOM   3679  C  CB    . MET A 1  487  ? 6.557   -7.785  37.900  1.00 54.90  ? 487  MET A CB    1 
ATOM   3680  C  CG    . MET A 1  487  ? 5.731   -7.696  39.199  1.00 55.64  ? 487  MET A CG    1 
ATOM   3681  S  SD    . MET A 1  487  ? 5.329   -9.221  40.109  1.00 56.46  ? 487  MET A SD    1 
ATOM   3682  C  CE    . MET A 1  487  ? 3.705   -9.624  39.488  1.00 52.05  ? 487  MET A CE    1 
ATOM   3683  N  N     . ASN A 1  488  ? 9.311   -7.222  36.438  1.00 53.97  ? 488  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  488  ? 10.312  -7.284  35.331  1.00 55.12  ? 488  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  488  ? 10.670  -8.663  34.715  1.00 55.44  ? 488  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  488  ? 10.848  -9.664  35.441  1.00 56.02  ? 488  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  488  ? 11.624  -6.563  35.693  1.00 55.43  ? 488  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  488  ? 11.399  -5.174  36.266  1.00 56.98  ? 488  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  488  ? 10.262  -4.792  36.572  1.00 58.40  ? 488  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  488  ? 12.495  -4.413  36.435  1.00 57.04  ? 488  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  489  ? 10.807  -8.697  33.382  1.00 54.85  ? 489  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  489  ? 11.069  -9.933  32.653  1.00 54.69  ? 489  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  489  ? 12.433  -9.810  32.075  1.00 55.38  ? 489  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  489  ? 12.797  -8.738  31.618  1.00 56.94  ? 489  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  489  ? 10.151  -10.025 31.471  1.00 54.39  ? 489  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  489  ? 9.928   -11.405 30.875  1.00 54.53  ? 489  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  489  ? 8.570   -11.967 31.407  1.00 57.88  ? 489  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  489  ? 9.890   -11.304 29.379  1.00 52.34  ? 489  LEU A CD2   1 
ATOM   3699  N  N     . HIS A 1  490  ? 13.205  -10.887 32.054  1.00 55.06  ? 490  HIS A N     1 
ATOM   3700  C  CA    . HIS A 1  490  ? 14.533  -10.828 31.477  1.00 53.85  ? 490  HIS A CA    1 
ATOM   3701  C  C     . HIS A 1  490  ? 14.645  -12.075 30.621  1.00 54.60  ? 490  HIS A C     1 
ATOM   3702  O  O     . HIS A 1  490  ? 14.690  -13.186 31.125  1.00 54.52  ? 490  HIS A O     1 
ATOM   3703  C  CB    . HIS A 1  490  ? 15.591  -10.825 32.579  1.00 53.01  ? 490  HIS A CB    1 
ATOM   3704  C  CG    . HIS A 1  490  ? 15.630  -9.574  33.405  1.00 51.49  ? 490  HIS A CG    1 
ATOM   3705  N  ND1   . HIS A 1  490  ? 16.340  -8.459  33.033  1.00 51.21  ? 490  HIS A ND1   1 
ATOM   3706  C  CD2   . HIS A 1  490  ? 15.093  -9.282  34.614  1.00 51.48  ? 490  HIS A CD2   1 
ATOM   3707  C  CE1   . HIS A 1  490  ? 16.222  -7.527  33.963  1.00 50.87  ? 490  HIS A CE1   1 
ATOM   3708  N  NE2   . HIS A 1  490  ? 15.469  -8.000  34.935  1.00 49.80  ? 490  HIS A NE2   1 
ATOM   3709  N  N     . VAL A 1  491  ? 14.664  -11.919 29.314  1.00 55.80  ? 491  VAL A N     1 
ATOM   3710  C  CA    . VAL A 1  491  ? 14.767  -13.097 28.464  1.00 57.47  ? 491  VAL A CA    1 
ATOM   3711  C  C     . VAL A 1  491  ? 16.213  -13.549 28.119  1.00 58.65  ? 491  VAL A C     1 
ATOM   3712  O  O     . VAL A 1  491  ? 16.894  -12.905 27.330  1.00 58.69  ? 491  VAL A O     1 
ATOM   3713  C  CB    . VAL A 1  491  ? 13.981  -12.907 27.176  1.00 57.52  ? 491  VAL A CB    1 
ATOM   3714  C  CG1   . VAL A 1  491  ? 13.657  -14.260 26.583  1.00 58.10  ? 491  VAL A CG1   1 
ATOM   3715  C  CG2   . VAL A 1  491  ? 12.705  -12.124 27.448  1.00 57.45  ? 491  VAL A CG2   1 
ATOM   3716  N  N     . PRO A 1  492  ? 16.649  -14.700 28.664  1.00 59.83  ? 492  PRO A N     1 
ATOM   3717  C  CA    . PRO A 1  492  ? 18.001  -15.253 28.506  1.00 60.47  ? 492  PRO A CA    1 
ATOM   3718  C  C     . PRO A 1  492  ? 18.319  -15.523 27.055  1.00 61.37  ? 492  PRO A C     1 
ATOM   3719  O  O     . PRO A 1  492  ? 17.412  -15.693 26.253  1.00 60.93  ? 492  PRO A O     1 
ATOM   3720  C  CB    . PRO A 1  492  ? 17.903  -16.602 29.214  1.00 60.72  ? 492  PRO A CB    1 
ATOM   3721  C  CG    . PRO A 1  492  ? 16.410  -16.931 29.235  1.00 60.51  ? 492  PRO A CG    1 
ATOM   3722  C  CD    . PRO A 1  492  ? 15.778  -15.598 29.450  1.00 60.03  ? 492  PRO A CD    1 
ATOM   3723  N  N     . GLN A 1  493  ? 19.601  -15.597 26.728  1.00 62.95  ? 493  GLN A N     1 
ATOM   3724  C  CA    . GLN A 1  493  ? 20.035  -15.733 25.328  1.00 64.59  ? 493  GLN A CA    1 
ATOM   3725  C  C     . GLN A 1  493  ? 20.863  -16.976 25.040  1.00 65.36  ? 493  GLN A C     1 
ATOM   3726  O  O     . GLN A 1  493  ? 20.860  -17.445 23.907  1.00 65.45  ? 493  GLN A O     1 
ATOM   3727  C  CB    . GLN A 1  493  ? 20.808  -14.496 24.847  1.00 64.65  ? 493  GLN A CB    1 
ATOM   3728  C  CG    . GLN A 1  493  ? 20.219  -13.147 25.278  1.00 66.48  ? 493  GLN A CG    1 
ATOM   3729  C  CD    . GLN A 1  493  ? 18.909  -12.804 24.581  1.00 68.23  ? 493  GLN A CD    1 
ATOM   3730  O  OE1   . GLN A 1  493  ? 18.912  -12.106 23.566  1.00 70.13  ? 493  GLN A OE1   1 
ATOM   3731  N  NE2   . GLN A 1  493  ? 17.787  -13.294 25.117  1.00 67.60  ? 493  GLN A NE2   1 
ATOM   3732  N  N     . SER A 1  494  ? 21.586  -17.488 26.041  1.00 66.66  ? 494  SER A N     1 
ATOM   3733  C  CA    . SER A 1  494  ? 22.296  -18.780 25.922  1.00 67.90  ? 494  SER A CA    1 
ATOM   3734  C  C     . SER A 1  494  ? 21.394  -19.936 26.305  1.00 68.37  ? 494  SER A C     1 
ATOM   3735  O  O     . SER A 1  494  ? 20.572  -19.827 27.230  1.00 68.57  ? 494  SER A O     1 
ATOM   3736  C  CB    . SER A 1  494  ? 23.547  -18.861 26.811  1.00 68.07  ? 494  SER A CB    1 
ATOM   3737  O  OG    . SER A 1  494  ? 24.471  -17.810 26.577  1.00 69.77  ? 494  SER A OG    1 
ATOM   3738  N  N     . GLU A 1  495  ? 21.581  -21.046 25.600  1.00 68.93  ? 495  GLU A N     1 
ATOM   3739  C  CA    . GLU A 1  495  ? 20.901  -22.303 25.892  1.00 69.81  ? 495  GLU A CA    1 
ATOM   3740  C  C     . GLU A 1  495  ? 21.051  -22.796 27.344  1.00 70.16  ? 495  GLU A C     1 
ATOM   3741  O  O     . GLU A 1  495  ? 20.184  -23.510 27.861  1.00 70.27  ? 495  GLU A O     1 
ATOM   3742  C  CB    . GLU A 1  495  ? 21.375  -23.380 24.914  1.00 70.09  ? 495  GLU A CB    1 
ATOM   3743  C  CG    . GLU A 1  495  ? 20.344  -23.763 23.882  1.00 71.02  ? 495  GLU A CG    1 
ATOM   3744  C  CD    . GLU A 1  495  ? 19.113  -24.407 24.516  1.00 72.01  ? 495  GLU A CD    1 
ATOM   3745  O  OE1   . GLU A 1  495  ? 18.002  -24.236 23.952  1.00 73.29  ? 495  GLU A OE1   1 
ATOM   3746  O  OE2   . GLU A 1  495  ? 19.254  -25.069 25.577  1.00 70.53  ? 495  GLU A OE2   1 
ATOM   3747  N  N     . GLU A 1  496  ? 22.161  -22.424 27.984  1.00 70.49  ? 496  GLU A N     1 
ATOM   3748  C  CA    . GLU A 1  496  ? 22.395  -22.729 29.390  1.00 70.58  ? 496  GLU A CA    1 
ATOM   3749  C  C     . GLU A 1  496  ? 21.726  -21.672 30.214  1.00 70.43  ? 496  GLU A C     1 
ATOM   3750  O  O     . GLU A 1  496  ? 21.025  -21.984 31.167  1.00 70.43  ? 496  GLU A O     1 
ATOM   3751  C  CB    . GLU A 1  496  ? 23.879  -22.725 29.701  1.00 70.83  ? 496  GLU A CB    1 
ATOM   3752  C  CG    . GLU A 1  496  ? 24.635  -21.619 29.007  1.00 71.63  ? 496  GLU A CG    1 
ATOM   3753  C  CD    . GLU A 1  496  ? 26.026  -22.044 28.593  1.00 73.89  ? 496  GLU A CD    1 
ATOM   3754  O  OE1   . GLU A 1  496  ? 26.595  -21.350 27.729  1.00 76.20  ? 496  GLU A OE1   1 
ATOM   3755  O  OE2   . GLU A 1  496  ? 26.555  -23.062 29.116  1.00 74.27  ? 496  GLU A OE2   1 
ATOM   3756  N  N     . THR A 1  497  ? 21.941  -20.417 29.833  1.00 70.27  ? 497  THR A N     1 
ATOM   3757  C  CA    . THR A 1  497  ? 21.284  -19.304 30.487  1.00 70.31  ? 497  THR A CA    1 
ATOM   3758  C  C     . THR A 1  497  ? 19.808  -19.646 30.598  1.00 70.24  ? 497  THR A C     1 
ATOM   3759  O  O     . THR A 1  497  ? 19.134  -19.261 31.570  1.00 70.07  ? 497  THR A O     1 
ATOM   3760  C  CB    . THR A 1  497  ? 21.547  -17.987 29.746  1.00 70.32  ? 497  THR A CB    1 
ATOM   3761  O  OG1   . THR A 1  497  ? 22.963  -17.774 29.691  1.00 70.52  ? 497  THR A OG1   1 
ATOM   3762  C  CG2   . THR A 1  497  ? 20.922  -16.812 30.475  1.00 70.63  ? 497  THR A CG2   1 
ATOM   3763  N  N     . ARG A 1  498  ? 19.335  -20.418 29.618  1.00 70.22  ? 498  ARG A N     1 
ATOM   3764  C  CA    . ARG A 1  498  ? 18.052  -21.102 29.735  1.00 70.39  ? 498  ARG A CA    1 
ATOM   3765  C  C     . ARG A 1  498  ? 18.111  -22.088 30.891  1.00 70.21  ? 498  ARG A C     1 
ATOM   3766  O  O     . ARG A 1  498  ? 17.686  -21.760 32.007  1.00 70.55  ? 498  ARG A O     1 
ATOM   3767  C  CB    . ARG A 1  498  ? 17.686  -21.844 28.460  1.00 70.32  ? 498  ARG A CB    1 
ATOM   3768  C  CG    . ARG A 1  498  ? 17.873  -21.050 27.225  1.00 70.98  ? 498  ARG A CG    1 
ATOM   3769  C  CD    . ARG A 1  498  ? 17.282  -21.782 26.067  1.00 73.35  ? 498  ARG A CD    1 
ATOM   3770  N  NE    . ARG A 1  498  ? 16.043  -21.148 25.651  1.00 75.42  ? 498  ARG A NE    1 
ATOM   3771  C  CZ    . ARG A 1  498  ? 14.863  -21.749 25.602  1.00 77.46  ? 498  ARG A CZ    1 
ATOM   3772  N  NH1   . ARG A 1  498  ? 14.750  -23.041 25.915  1.00 77.67  ? 498  ARG A NH1   1 
ATOM   3773  N  NH2   . ARG A 1  498  ? 13.801  -21.051 25.214  1.00 79.08  ? 498  ARG A NH2   1 
ATOM   3774  N  N     . ALA A 1  499  ? 18.660  -23.275 30.626  1.00 69.55  ? 499  ALA A N     1 
ATOM   3775  C  CA    . ALA A 1  499  ? 18.714  -24.352 31.613  1.00 69.14  ? 499  ALA A CA    1 
ATOM   3776  C  C     . ALA A 1  499  ? 18.763  -23.828 33.059  1.00 68.99  ? 499  ALA A C     1 
ATOM   3777  O  O     . ALA A 1  499  ? 17.872  -24.119 33.865  1.00 68.65  ? 499  ALA A O     1 
ATOM   3778  C  CB    . ALA A 1  499  ? 19.897  -25.263 31.321  1.00 69.00  ? 499  ALA A CB    1 
ATOM   3779  N  N     . GLU A 1  500  ? 19.783  -23.009 33.333  1.00 68.89  ? 500  GLU A N     1 
ATOM   3780  C  CA    . GLU A 1  500  ? 20.122  -22.444 34.648  1.00 68.82  ? 500  GLU A CA    1 
ATOM   3781  C  C     . GLU A 1  500  ? 18.965  -21.669 35.291  1.00 69.00  ? 500  GLU A C     1 
ATOM   3782  O  O     . GLU A 1  500  ? 18.938  -21.463 36.516  1.00 68.95  ? 500  GLU A O     1 
ATOM   3783  C  CB    . GLU A 1  500  ? 21.319  -21.517 34.461  1.00 68.76  ? 500  GLU A CB    1 
ATOM   3784  C  CG    . GLU A 1  500  ? 22.356  -21.469 35.572  1.00 68.65  ? 500  GLU A CG    1 
ATOM   3785  C  CD    . GLU A 1  500  ? 23.571  -20.631 35.154  1.00 68.85  ? 500  GLU A CD    1 
ATOM   3786  O  OE1   . GLU A 1  500  ? 23.687  -19.459 35.577  1.00 67.57  ? 500  GLU A OE1   1 
ATOM   3787  O  OE2   . GLU A 1  500  ? 24.389  -21.134 34.352  1.00 70.32  ? 500  GLU A OE2   1 
ATOM   3788  N  N     . LEU A 1  501  ? 18.034  -21.221 34.450  1.00 68.94  ? 501  LEU A N     1 
ATOM   3789  C  CA    . LEU A 1  501  ? 16.778  -20.660 34.906  1.00 68.96  ? 501  LEU A CA    1 
ATOM   3790  C  C     . LEU A 1  501  ? 15.756  -21.752 35.223  1.00 68.86  ? 501  LEU A C     1 
ATOM   3791  O  O     . LEU A 1  501  ? 15.146  -21.735 36.289  1.00 69.06  ? 501  LEU A O     1 
ATOM   3792  C  CB    . LEU A 1  501  ? 16.203  -19.737 33.844  1.00 69.05  ? 501  LEU A CB    1 
ATOM   3793  C  CG    . LEU A 1  501  ? 16.777  -18.343 33.667  1.00 70.16  ? 501  LEU A CG    1 
ATOM   3794  C  CD1   . LEU A 1  501  ? 15.827  -17.533 32.801  1.00 71.41  ? 501  LEU A CD1   1 
ATOM   3795  C  CD2   . LEU A 1  501  ? 16.941  -17.657 35.004  1.00 71.51  ? 501  LEU A CD2   1 
ATOM   3796  N  N     . SER A 1  502  ? 15.577  -22.694 34.296  1.00 68.46  ? 502  SER A N     1 
ATOM   3797  C  CA    . SER A 1  502  ? 14.526  -23.717 34.392  1.00 68.07  ? 502  SER A CA    1 
ATOM   3798  C  C     . SER A 1  502  ? 14.834  -24.847 35.386  1.00 68.13  ? 502  SER A C     1 
ATOM   3799  O  O     . SER A 1  502  ? 13.921  -25.491 35.924  1.00 67.68  ? 502  SER A O     1 
ATOM   3800  C  CB    . SER A 1  502  ? 14.233  -24.288 33.001  1.00 68.14  ? 502  SER A CB    1 
ATOM   3801  O  OG    . SER A 1  502  ? 15.319  -24.065 32.116  1.00 67.25  ? 502  SER A OG    1 
ATOM   3802  N  N     . GLN A 1  503  ? 16.127  -25.081 35.616  1.00 68.22  ? 503  GLN A N     1 
ATOM   3803  C  CA    . GLN A 1  503  ? 16.597  -26.139 36.526  1.00 68.08  ? 503  GLN A CA    1 
ATOM   3804  C  C     . GLN A 1  503  ? 16.780  -25.644 37.961  1.00 68.03  ? 503  GLN A C     1 
ATOM   3805  O  O     . GLN A 1  503  ? 16.481  -26.377 38.912  1.00 68.22  ? 503  GLN A O     1 
ATOM   3806  C  CB    . GLN A 1  503  ? 17.933  -26.734 36.051  1.00 67.96  ? 503  GLN A CB    1 
ATOM   3807  C  CG    . GLN A 1  503  ? 18.011  -27.089 34.588  1.00 67.65  ? 503  GLN A CG    1 
ATOM   3808  C  CD    . GLN A 1  503  ? 16.872  -27.958 34.149  1.00 67.53  ? 503  GLN A CD    1 
ATOM   3809  O  OE1   . GLN A 1  503  ? 16.021  -27.524 33.380  1.00 69.00  ? 503  GLN A OE1   1 
ATOM   3810  N  NE2   . GLN A 1  503  ? 16.833  -29.187 34.645  1.00 67.02  ? 503  GLN A NE2   1 
ATOM   3811  N  N     . LEU A 1  504  ? 17.294  -24.417 38.104  1.00 67.57  ? 504  LEU A N     1 
ATOM   3812  C  CA    . LEU A 1  504  ? 17.639  -23.855 39.412  1.00 66.87  ? 504  LEU A CA    1 
ATOM   3813  C  C     . LEU A 1  504  ? 16.638  -22.801 39.867  1.00 66.39  ? 504  LEU A C     1 
ATOM   3814  O  O     . LEU A 1  504  ? 16.211  -22.837 41.016  1.00 66.87  ? 504  LEU A O     1 
ATOM   3815  C  CB    . LEU A 1  504  ? 19.050  -23.262 39.406  1.00 66.77  ? 504  LEU A CB    1 
ATOM   3816  C  CG    . LEU A 1  504  ? 20.254  -24.144 39.070  1.00 66.83  ? 504  LEU A CG    1 
ATOM   3817  C  CD1   . LEU A 1  504  ? 20.114  -24.768 37.724  1.00 67.08  ? 504  LEU A CD1   1 
ATOM   3818  C  CD2   . LEU A 1  504  ? 21.523  -23.323 39.075  1.00 67.02  ? 504  LEU A CD2   1 
ATOM   3819  N  N     . CYS A 1  505  ? 16.258  -21.881 38.977  1.00 65.36  ? 505  CYS A N     1 
ATOM   3820  C  CA    . CYS A 1  505  ? 15.413  -20.745 39.356  1.00 64.68  ? 505  CYS A CA    1 
ATOM   3821  C  C     . CYS A 1  505  ? 13.921  -21.045 39.293  1.00 63.72  ? 505  CYS A C     1 
ATOM   3822  O  O     . CYS A 1  505  ? 13.136  -20.470 40.042  1.00 63.67  ? 505  CYS A O     1 
ATOM   3823  C  CB    . CYS A 1  505  ? 15.710  -19.538 38.470  1.00 64.84  ? 505  CYS A CB    1 
ATOM   3824  S  SG    . CYS A 1  505  ? 17.438  -19.005 38.462  1.00 67.70  ? 505  CYS A SG    1 
ATOM   3825  N  N     . ALA A 1  506  ? 13.547  -21.948 38.391  1.00 62.70  ? 506  ALA A N     1 
ATOM   3826  C  CA    . ALA A 1  506  ? 12.150  -22.244 38.060  1.00 61.31  ? 506  ALA A CA    1 
ATOM   3827  C  C     . ALA A 1  506  ? 11.272  -22.354 39.278  1.00 60.29  ? 506  ALA A C     1 
ATOM   3828  O  O     . ALA A 1  506  ? 11.719  -22.800 40.325  1.00 60.19  ? 506  ALA A O     1 
ATOM   3829  C  CB    . ALA A 1  506  ? 12.069  -23.505 37.241  1.00 61.53  ? 506  ALA A CB    1 
ATOM   3830  N  N     . VAL A 1  507  ? 10.014  -21.981 39.109  1.00 59.35  ? 507  VAL A N     1 
ATOM   3831  C  CA    . VAL A 1  507  ? 9.152   -21.609 40.226  1.00 58.94  ? 507  VAL A CA    1 
ATOM   3832  C  C     . VAL A 1  507  ? 8.810   -22.695 41.223  1.00 58.79  ? 507  VAL A C     1 
ATOM   3833  O  O     . VAL A 1  507  ? 8.948   -22.492 42.423  1.00 58.43  ? 507  VAL A O     1 
ATOM   3834  C  CB    . VAL A 1  507  ? 7.884   -20.851 39.730  1.00 59.41  ? 507  VAL A CB    1 
ATOM   3835  C  CG1   . VAL A 1  507  ? 6.668   -20.909 40.749  1.00 58.15  ? 507  VAL A CG1   1 
ATOM   3836  C  CG2   . VAL A 1  507  ? 8.268   -19.414 39.318  1.00 58.68  ? 507  VAL A CG2   1 
ATOM   3837  N  N     . PRO A 1  508  ? 8.399   -23.866 40.747  1.00 59.00  ? 508  PRO A N     1 
ATOM   3838  C  CA    . PRO A 1  508  ? 7.958   -24.811 41.773  1.00 59.34  ? 508  PRO A CA    1 
ATOM   3839  C  C     . PRO A 1  508  ? 9.091   -25.204 42.726  1.00 59.53  ? 508  PRO A C     1 
ATOM   3840  O  O     . PRO A 1  508  ? 8.869   -25.297 43.944  1.00 59.59  ? 508  PRO A O     1 
ATOM   3841  C  CB    . PRO A 1  508  ? 7.442   -26.007 40.968  1.00 59.38  ? 508  PRO A CB    1 
ATOM   3842  C  CG    . PRO A 1  508  ? 7.243   -25.461 39.567  1.00 59.92  ? 508  PRO A CG    1 
ATOM   3843  C  CD    . PRO A 1  508  ? 8.313   -24.431 39.394  1.00 59.10  ? 508  PRO A CD    1 
ATOM   3844  N  N     . LEU A 1  509  ? 10.299  -25.392 42.189  1.00 59.53  ? 509  LEU A N     1 
ATOM   3845  C  CA    . LEU A 1  509  ? 11.452  -25.632 43.041  1.00 59.73  ? 509  LEU A CA    1 
ATOM   3846  C  C     . LEU A 1  509  ? 11.738  -24.455 43.995  1.00 59.87  ? 509  LEU A C     1 
ATOM   3847  O  O     . LEU A 1  509  ? 12.814  -24.431 44.603  1.00 60.65  ? 509  LEU A O     1 
ATOM   3848  C  CB    . LEU A 1  509  ? 12.715  -25.886 42.233  1.00 59.78  ? 509  LEU A CB    1 
ATOM   3849  C  CG    . LEU A 1  509  ? 12.801  -26.614 40.902  1.00 61.06  ? 509  LEU A CG    1 
ATOM   3850  C  CD1   . LEU A 1  509  ? 14.139  -26.264 40.276  1.00 61.78  ? 509  LEU A CD1   1 
ATOM   3851  C  CD2   . LEU A 1  509  ? 12.679  -28.124 41.038  1.00 62.95  ? 509  LEU A CD2   1 
ATOM   3852  N  N     . GLN A 1  510  ? 10.835  -23.474 44.119  1.00 59.13  ? 510  GLN A N     1 
ATOM   3853  C  CA    . GLN A 1  510  ? 11.008  -22.475 45.166  1.00 58.81  ? 510  GLN A CA    1 
ATOM   3854  C  C     . GLN A 1  510  ? 9.985   -22.697 46.228  1.00 58.75  ? 510  GLN A C     1 
ATOM   3855  O  O     . GLN A 1  510  ? 10.054  -22.044 47.271  1.00 59.10  ? 510  GLN A O     1 
ATOM   3856  C  CB    . GLN A 1  510  ? 10.864  -21.022 44.689  1.00 58.81  ? 510  GLN A CB    1 
ATOM   3857  C  CG    . GLN A 1  510  ? 11.977  -20.389 43.814  1.00 59.52  ? 510  GLN A CG    1 
ATOM   3858  C  CD    . GLN A 1  510  ? 13.369  -20.993 43.972  1.00 59.81  ? 510  GLN A CD    1 
ATOM   3859  O  OE1   . GLN A 1  510  ? 13.923  -21.057 45.071  1.00 60.54  ? 510  GLN A OE1   1 
ATOM   3860  N  NE2   . GLN A 1  510  ? 13.944  -21.420 42.855  1.00 59.21  ? 510  GLN A NE2   1 
ATOM   3861  N  N     . ILE A 1  511  ? 9.041   -23.606 45.970  1.00 58.72  ? 511  ILE A N     1 
ATOM   3862  C  CA    . ILE A 1  511  ? 7.807   -23.702 46.780  1.00 58.85  ? 511  ILE A CA    1 
ATOM   3863  C  C     . ILE A 1  511  ? 8.089   -23.827 48.283  1.00 59.23  ? 511  ILE A C     1 
ATOM   3864  O  O     . ILE A 1  511  ? 7.527   -23.094 49.083  1.00 59.09  ? 511  ILE A O     1 
ATOM   3865  C  CB    . ILE A 1  511  ? 6.827   -24.816 46.281  1.00 58.72  ? 511  ILE A CB    1 
ATOM   3866  C  CG1   . ILE A 1  511  ? 6.122   -24.387 44.997  1.00 57.38  ? 511  ILE A CG1   1 
ATOM   3867  C  CG2   . ILE A 1  511  ? 5.750   -25.130 47.332  1.00 58.78  ? 511  ILE A CG2   1 
ATOM   3868  C  CD1   . ILE A 1  511  ? 5.658   -25.538 44.159  1.00 56.00  ? 511  ILE A CD1   1 
ATOM   3869  N  N     . VAL A 1  512  ? 8.988   -24.730 48.650  1.00 59.85  ? 512  VAL A N     1 
ATOM   3870  C  CA    . VAL A 1  512  ? 9.386   -24.893 50.042  1.00 60.39  ? 512  VAL A CA    1 
ATOM   3871  C  C     . VAL A 1  512  ? 10.746  -24.189 50.264  1.00 60.70  ? 512  VAL A C     1 
ATOM   3872  O  O     . VAL A 1  512  ? 11.788  -24.646 49.773  1.00 60.69  ? 512  VAL A O     1 
ATOM   3873  C  CB    . VAL A 1  512  ? 9.408   -26.388 50.378  1.00 60.42  ? 512  VAL A CB    1 
ATOM   3874  C  CG1   . VAL A 1  512  ? 10.844  -26.965 50.338  1.00 60.83  ? 512  VAL A CG1   1 
ATOM   3875  C  CG2   . VAL A 1  512  ? 8.692   -26.660 51.690  1.00 60.75  ? 512  VAL A CG2   1 
ATOM   3876  N  N     . SER A 1  513  ? 10.725  -23.057 50.965  1.00 61.14  ? 513  SER A N     1 
ATOM   3877  C  CA    . SER A 1  513  ? 11.883  -22.143 50.966  1.00 61.60  ? 513  SER A CA    1 
ATOM   3878  C  C     . SER A 1  513  ? 12.889  -22.319 52.107  1.00 61.71  ? 513  SER A C     1 
ATOM   3879  O  O     . SER A 1  513  ? 12.478  -22.429 53.280  1.00 61.82  ? 513  SER A O     1 
ATOM   3880  C  CB    . SER A 1  513  ? 11.430  -20.686 50.965  1.00 61.86  ? 513  SER A CB    1 
ATOM   3881  O  OG    . SER A 1  513  ? 12.392  -19.872 51.649  1.00 62.11  ? 513  SER A OG    1 
ATOM   3882  N  N     . PRO A 1  514  ? 14.208  -22.263 51.771  1.00 61.58  ? 514  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1  514  ? 15.285  -22.442 52.744  1.00 61.37  ? 514  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1  514  ? 15.066  -21.512 53.907  1.00 61.21  ? 514  PRO A C     1 
ATOM   3885  O  O     . PRO A 1  514  ? 15.265  -21.879 55.046  1.00 61.62  ? 514  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1  514  ? 16.552  -22.022 51.983  1.00 61.23  ? 514  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1  514  ? 16.071  -21.356 50.736  1.00 61.97  ? 514  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1  514  ? 14.746  -21.987 50.427  1.00 61.84  ? 514  PRO A CD    1 
ATOM   3889  N  N     . GLN A 1  515  ? 14.594  -20.317 53.628  1.00 61.14  ? 515  GLN A N     1 
ATOM   3890  C  CA    . GLN A 1  515  ? 14.505  -19.324 54.664  1.00 61.02  ? 515  GLN A CA    1 
ATOM   3891  C  C     . GLN A 1  515  ? 14.079  -19.944 55.966  1.00 60.24  ? 515  GLN A C     1 
ATOM   3892  O  O     . GLN A 1  515  ? 14.748  -19.776 56.978  1.00 59.95  ? 515  GLN A O     1 
ATOM   3893  C  CB    . GLN A 1  515  ? 13.513  -18.255 54.260  1.00 61.32  ? 515  GLN A CB    1 
ATOM   3894  C  CG    . GLN A 1  515  ? 13.590  -17.017 55.090  1.00 63.29  ? 515  GLN A CG    1 
ATOM   3895  C  CD    . GLN A 1  515  ? 13.018  -15.879 54.323  1.00 67.39  ? 515  GLN A CD    1 
ATOM   3896  O  OE1   . GLN A 1  515  ? 13.523  -15.540 53.253  1.00 69.47  ? 515  GLN A OE1   1 
ATOM   3897  N  NE2   . GLN A 1  515  ? 11.927  -15.300 54.825  1.00 69.22  ? 515  GLN A NE2   1 
ATOM   3898  N  N     . SER A 1  516  ? 12.983  -20.694 55.901  1.00 60.02  ? 516  SER A N     1 
ATOM   3899  C  CA    . SER A 1  516  ? 12.209  -21.058 57.073  1.00 60.20  ? 516  SER A CA    1 
ATOM   3900  C  C     . SER A 1  516  ? 11.652  -22.472 56.981  1.00 60.38  ? 516  SER A C     1 
ATOM   3901  O  O     . SER A 1  516  ? 10.576  -22.737 57.535  1.00 60.58  ? 516  SER A O     1 
ATOM   3902  C  CB    . SER A 1  516  ? 11.017  -20.107 57.240  1.00 60.13  ? 516  SER A CB    1 
ATOM   3903  O  OG    . SER A 1  516  ? 11.394  -18.749 57.366  1.00 60.95  ? 516  SER A OG    1 
ATOM   3904  N  N     . ASN A 1  517  ? 12.357  -23.375 56.287  1.00 60.28  ? 517  ASN A N     1 
ATOM   3905  C  CA    . ASN A 1  517  ? 11.983  -24.813 56.234  1.00 59.80  ? 517  ASN A CA    1 
ATOM   3906  C  C     . ASN A 1  517  ? 10.461  -25.092 56.219  1.00 59.22  ? 517  ASN A C     1 
ATOM   3907  O  O     . ASN A 1  517  ? 9.966   -26.052 56.814  1.00 58.82  ? 517  ASN A O     1 
ATOM   3908  C  CB    . ASN A 1  517  ? 12.672  -25.597 57.365  1.00 59.91  ? 517  ASN A CB    1 
ATOM   3909  C  CG    . ASN A 1  517  ? 12.430  -24.976 58.743  1.00 60.56  ? 517  ASN A CG    1 
ATOM   3910  O  OD1   . ASN A 1  517  ? 11.289  -24.800 59.196  1.00 59.33  ? 517  ASN A OD1   1 
ATOM   3911  N  ND2   . ASN A 1  517  ? 13.514  -24.624 59.407  1.00 62.76  ? 517  ASN A ND2   1 
ATOM   3912  N  N     . LYS A 1  518  ? 9.727   -24.208 55.558  1.00 58.89  ? 518  LYS A N     1 
ATOM   3913  C  CA    . LYS A 1  518  ? 8.334   -24.462 55.190  1.00 58.52  ? 518  LYS A CA    1 
ATOM   3914  C  C     . LYS A 1  518  ? 8.090   -23.821 53.791  1.00 58.05  ? 518  LYS A C     1 
ATOM   3915  O  O     . LYS A 1  518  ? 8.958   -23.070 53.288  1.00 58.27  ? 518  LYS A O     1 
ATOM   3916  C  CB    . LYS A 1  518  ? 7.340   -24.012 56.309  1.00 58.63  ? 518  LYS A CB    1 
ATOM   3917  C  CG    . LYS A 1  518  ? 6.762   -22.589 56.242  1.00 57.73  ? 518  LYS A CG    1 
ATOM   3918  C  CD    . LYS A 1  518  ? 7.657   -21.579 56.935  1.00 57.42  ? 518  LYS A CD    1 
ATOM   3919  C  CE    . LYS A 1  518  ? 6.908   -20.307 57.322  1.00 57.23  ? 518  LYS A CE    1 
ATOM   3920  N  NZ    . LYS A 1  518  ? 6.108   -19.749 56.195  1.00 55.90  ? 518  LYS A NZ    1 
ATOM   3921  N  N     . PRO A 1  519  ? 6.949   -24.137 53.142  1.00 57.04  ? 519  PRO A N     1 
ATOM   3922  C  CA    . PRO A 1  519  ? 6.700   -23.539 51.854  1.00 56.47  ? 519  PRO A CA    1 
ATOM   3923  C  C     . PRO A 1  519  ? 6.531   -22.026 51.986  1.00 56.12  ? 519  PRO A C     1 
ATOM   3924  O  O     . PRO A 1  519  ? 6.374   -21.526 53.106  1.00 56.59  ? 519  PRO A O     1 
ATOM   3925  C  CB    . PRO A 1  519  ? 5.379   -24.178 51.440  1.00 56.50  ? 519  PRO A CB    1 
ATOM   3926  C  CG    . PRO A 1  519  ? 4.725   -24.518 52.701  1.00 56.49  ? 519  PRO A CG    1 
ATOM   3927  C  CD    . PRO A 1  519  ? 5.839   -25.019 53.533  1.00 57.07  ? 519  PRO A CD    1 
ATOM   3928  N  N     . CYS A 1  520  ? 6.567   -21.313 50.855  1.00 55.16  ? 520  CYS A N     1 
ATOM   3929  C  CA    . CYS A 1  520  ? 6.397   -19.858 50.827  1.00 53.75  ? 520  CYS A CA    1 
ATOM   3930  C  C     . CYS A 1  520  ? 5.287   -19.385 49.888  1.00 52.45  ? 520  CYS A C     1 
ATOM   3931  O  O     . CYS A 1  520  ? 4.924   -18.202 49.921  1.00 52.56  ? 520  CYS A O     1 
ATOM   3932  C  CB    . CYS A 1  520  ? 7.737   -19.141 50.521  1.00 54.44  ? 520  CYS A CB    1 
ATOM   3933  S  SG    . CYS A 1  520  ? 8.404   -19.199 48.792  1.00 55.03  ? 520  CYS A SG    1 
ATOM   3934  N  N     . MET A 1  521  ? 4.764   -20.293 49.058  1.00 50.62  ? 521  MET A N     1 
ATOM   3935  C  CA    . MET A 1  521  ? 3.618   -20.001 48.193  1.00 49.74  ? 521  MET A CA    1 
ATOM   3936  C  C     . MET A 1  521  ? 2.485   -20.877 48.701  1.00 48.65  ? 521  MET A C     1 
ATOM   3937  O  O     . MET A 1  521  ? 2.672   -22.094 48.775  1.00 48.56  ? 521  MET A O     1 
ATOM   3938  C  CB    . MET A 1  521  ? 3.940   -20.317 46.731  1.00 49.15  ? 521  MET A CB    1 
ATOM   3939  C  CG    . MET A 1  521  ? 5.458   -20.377 46.457  1.00 51.40  ? 521  MET A CG    1 
ATOM   3940  S  SD    . MET A 1  521  ? 6.156   -19.818 44.857  1.00 51.45  ? 521  MET A SD    1 
ATOM   3941  C  CE    . MET A 1  521  ? 5.577   -21.191 43.860  1.00 52.99  ? 521  MET A CE    1 
ATOM   3942  N  N     . GLY A 1  522  ? 1.342   -20.278 49.022  1.00 47.26  ? 522  GLY A N     1 
ATOM   3943  C  CA    . GLY A 1  522  ? 0.185   -21.024 49.480  1.00 45.20  ? 522  GLY A CA    1 
ATOM   3944  C  C     . GLY A 1  522  ? -1.116  -20.326 49.131  1.00 43.88  ? 522  GLY A C     1 
ATOM   3945  O  O     . GLY A 1  522  ? -1.246  -19.115 49.308  1.00 43.80  ? 522  GLY A O     1 
ATOM   3946  N  N     . ILE A 1  523  ? -2.081  -21.092 48.631  1.00 42.11  ? 523  ILE A N     1 
ATOM   3947  C  CA    . ILE A 1  523  ? -3.380  -20.541 48.257  1.00 40.49  ? 523  ILE A CA    1 
ATOM   3948  C  C     . ILE A 1  523  ? -3.744  -19.355 49.143  1.00 38.48  ? 523  ILE A C     1 
ATOM   3949  O  O     . ILE A 1  523  ? -3.317  -19.278 50.295  1.00 38.42  ? 523  ILE A O     1 
ATOM   3950  C  CB    . ILE A 1  523  ? -4.492  -21.602 48.352  1.00 41.13  ? 523  ILE A CB    1 
ATOM   3951  C  CG1   . ILE A 1  523  ? -4.394  -22.584 47.183  1.00 42.23  ? 523  ILE A CG1   1 
ATOM   3952  C  CG2   . ILE A 1  523  ? -5.860  -20.938 48.383  1.00 40.73  ? 523  ILE A CG2   1 
ATOM   3953  C  CD1   . ILE A 1  523  ? -3.343  -23.656 47.373  1.00 39.73  ? 523  ILE A CD1   1 
ATOM   3954  N  N     . VAL A 1  524  ? -4.558  -18.448 48.602  1.00 35.41  ? 524  VAL A N     1 
ATOM   3955  C  CA    . VAL A 1  524  ? -5.031  -17.274 49.337  1.00 29.98  ? 524  VAL A CA    1 
ATOM   3956  C  C     . VAL A 1  524  ? -6.263  -16.643 48.676  1.00 28.63  ? 524  VAL A C     1 
ATOM   3957  O  O     . VAL A 1  524  ? -6.663  -17.045 47.583  1.00 27.92  ? 524  VAL A O     1 
ATOM   3958  C  CB    . VAL A 1  524  ? -3.928  -16.208 49.468  1.00 31.25  ? 524  VAL A CB    1 
ATOM   3959  C  CG1   . VAL A 1  524  ? -3.215  -16.344 50.804  1.00 30.87  ? 524  VAL A CG1   1 
ATOM   3960  C  CG2   . VAL A 1  524  ? -2.942  -16.321 48.315  1.00 28.67  ? 524  VAL A CG2   1 
ATOM   3961  N  N     . GLN A 1  525  ? -6.857  -15.655 49.344  1.00 24.50  ? 525  GLN A N     1 
ATOM   3962  C  CA    . GLN A 1  525  ? -8.043  -14.965 48.830  1.00 20.70  ? 525  GLN A CA    1 
ATOM   3963  C  C     . GLN A 1  525  ? -9.120  -15.960 48.406  1.00 18.78  ? 525  GLN A C     1 
ATOM   3964  O  O     . GLN A 1  525  ? -8.846  -17.156 48.299  1.00 17.34  ? 525  GLN A O     1 
ATOM   3965  C  CB    . GLN A 1  525  ? -7.670  -14.060 47.654  1.00 17.22  ? 525  GLN A CB    1 
ATOM   3966  C  CG    . GLN A 1  525  ? -6.717  -12.933 48.016  1.00 7.50   ? 525  GLN A CG    1 
ATOM   3967  C  CD    . GLN A 1  525  ? -7.442  -11.654 48.386  1.00 2.53   ? 525  GLN A CD    1 
ATOM   3968  O  OE1   . GLN A 1  525  ? -8.324  -11.194 47.660  1.00 2.00   ? 525  GLN A OE1   1 
ATOM   3969  N  NE2   . GLN A 1  525  ? -7.073  -11.071 49.520  1.00 2.00   ? 525  GLN A NE2   1 
ATOM   3970  N  N     . ASP A 1  526  ? -10.341 -15.484 48.164  1.00 16.69  ? 526  ASP A N     1 
ATOM   3971  C  CA    . ASP A 1  526  ? -11.418 -16.427 47.743  1.00 17.09  ? 526  ASP A CA    1 
ATOM   3972  C  C     . ASP A 1  526  ? -10.989 -17.893 47.950  1.00 20.05  ? 526  ASP A C     1 
ATOM   3973  O  O     . ASP A 1  526  ? -11.015 -18.424 49.039  1.00 20.37  ? 526  ASP A O     1 
ATOM   3974  C  CB    . ASP A 1  526  ? -12.004 -16.189 46.332  1.00 12.83  ? 526  ASP A CB    1 
ATOM   3975  C  CG    . ASP A 1  526  ? -12.378 -14.726 46.088  1.00 9.28   ? 526  ASP A CG    1 
ATOM   3976  O  OD1   . ASP A 1  526  ? -11.917 -13.878 46.950  1.00 2.00   ? 526  ASP A OD1   1 
ATOM   3977  O  OD2   . ASP A 1  526  ? -13.101 -14.398 45.060  1.00 2.43   ? 526  ASP A OD2   1 
ATOM   3978  N  N     . THR A 1  527  ? -10.582 -18.565 46.894  1.00 24.96  ? 527  THR A N     1 
ATOM   3979  C  CA    . THR A 1  527  ? -9.851  -19.862 47.014  1.00 27.47  ? 527  THR A CA    1 
ATOM   3980  C  C     . THR A 1  527  ? -9.884  -20.382 48.451  1.00 29.31  ? 527  THR A C     1 
ATOM   3981  O  O     . THR A 1  527  ? -10.620 -21.328 48.690  1.00 28.73  ? 527  THR A O     1 
ATOM   3982  C  CB    . THR A 1  527  ? -8.340  -19.837 46.390  1.00 27.33  ? 527  THR A CB    1 
ATOM   3983  O  OG1   . THR A 1  527  ? -8.110  -18.602 45.670  1.00 26.34  ? 527  THR A OG1   1 
ATOM   3984  C  CG2   . THR A 1  527  ? -8.079  -21.076 45.492  1.00 24.21  ? 527  THR A CG2   1 
ATOM   3985  N  N     . LEU A 1  528  ? -9.110  -19.756 49.365  1.00 31.97  ? 528  LEU A N     1 
ATOM   3986  C  CA    . LEU A 1  528  ? -9.116  -20.102 50.796  1.00 34.98  ? 528  LEU A CA    1 
ATOM   3987  C  C     . LEU A 1  528  ? -10.438 -19.730 51.483  1.00 36.92  ? 528  LEU A C     1 
ATOM   3988  O  O     . LEU A 1  528  ? -11.113 -20.603 52.048  1.00 37.54  ? 528  LEU A O     1 
ATOM   3989  C  CB    . LEU A 1  528  ? -7.947  -19.476 51.557  1.00 35.01  ? 528  LEU A CB    1 
ATOM   3990  C  CG    . LEU A 1  528  ? -8.162  -19.380 53.093  1.00 34.94  ? 528  LEU A CG    1 
ATOM   3991  C  CD1   . LEU A 1  528  ? -8.471  -20.713 53.740  1.00 34.06  ? 528  LEU A CD1   1 
ATOM   3992  C  CD2   . LEU A 1  528  ? -6.994  -18.718 53.848  1.00 35.42  ? 528  LEU A CD2   1 
ATOM   3993  N  N     . CYS A 1  529  ? -10.817 -18.450 51.434  1.00 39.16  ? 529  CYS A N     1 
ATOM   3994  C  CA    . CYS A 1  529  ? -12.141 -18.015 51.934  1.00 40.52  ? 529  CYS A CA    1 
ATOM   3995  C  C     . CYS A 1  529  ? -13.316 -18.821 51.408  1.00 41.64  ? 529  CYS A C     1 
ATOM   3996  O  O     . CYS A 1  529  ? -14.343 -18.770 52.019  1.00 43.08  ? 529  CYS A O     1 
ATOM   3997  C  CB    . CYS A 1  529  ? -12.366 -16.482 51.788  1.00 40.59  ? 529  CYS A CB    1 
ATOM   3998  S  SG    . CYS A 1  529  ? -13.832 -15.824 50.787  1.00 40.16  ? 529  CYS A SG    1 
ATOM   3999  N  N     . GLY A 1  530  ? -13.169 -19.589 50.336  1.00 43.00  ? 530  GLY A N     1 
ATOM   4000  C  CA    . GLY A 1  530  ? -14.221 -20.539 49.920  1.00 45.61  ? 530  GLY A CA    1 
ATOM   4001  C  C     . GLY A 1  530  ? -13.935 -22.044 50.043  1.00 47.48  ? 530  GLY A C     1 
ATOM   4002  O  O     . GLY A 1  530  ? -14.835 -22.876 49.993  1.00 47.17  ? 530  GLY A O     1 
ATOM   4003  N  N     . ILE A 1  531  ? -12.664 -22.392 50.175  1.00 49.71  ? 531  ILE A N     1 
ATOM   4004  C  CA    . ILE A 1  531  ? -12.229 -23.768 50.284  1.00 51.32  ? 531  ILE A CA    1 
ATOM   4005  C  C     . ILE A 1  531  ? -12.634 -24.180 51.664  1.00 52.32  ? 531  ILE A C     1 
ATOM   4006  O  O     . ILE A 1  531  ? -12.784 -25.350 51.945  1.00 52.42  ? 531  ILE A O     1 
ATOM   4007  C  CB    . ILE A 1  531  ? -10.686 -23.871 50.140  1.00 51.42  ? 531  ILE A CB    1 
ATOM   4008  C  CG1   . ILE A 1  531  ? -10.292 -25.166 49.428  1.00 51.58  ? 531  ILE A CG1   1 
ATOM   4009  C  CG2   . ILE A 1  531  ? -9.993  -23.688 51.506  1.00 51.82  ? 531  ILE A CG2   1 
ATOM   4010  C  CD1   . ILE A 1  531  ? -8.982  -25.789 49.892  1.00 52.23  ? 531  ILE A CD1   1 
ATOM   4011  N  N     . ARG A 1  532  ? -12.782 -23.192 52.532  1.00 53.99  ? 532  ARG A N     1 
ATOM   4012  C  CA    . ARG A 1  532  ? -13.434 -23.402 53.801  1.00 56.30  ? 532  ARG A CA    1 
ATOM   4013  C  C     . ARG A 1  532  ? -14.933 -23.658 53.544  1.00 57.62  ? 532  ARG A C     1 
ATOM   4014  O  O     . ARG A 1  532  ? -15.501 -24.699 53.956  1.00 57.49  ? 532  ARG A O     1 
ATOM   4015  C  CB    . ARG A 1  532  ? -13.242 -22.185 54.702  1.00 56.33  ? 532  ARG A CB    1 
ATOM   4016  C  CG    . ARG A 1  532  ? -13.567 -22.456 56.142  1.00 57.37  ? 532  ARG A CG    1 
ATOM   4017  C  CD    . ARG A 1  532  ? -14.169 -21.237 56.792  1.00 59.97  ? 532  ARG A CD    1 
ATOM   4018  N  NE    . ARG A 1  532  ? -15.524 -21.499 57.273  1.00 61.36  ? 532  ARG A NE    1 
ATOM   4019  C  CZ    . ARG A 1  532  ? -16.567 -20.686 57.106  1.00 62.01  ? 532  ARG A CZ    1 
ATOM   4020  N  NH1   . ARG A 1  532  ? -16.445 -19.512 56.496  1.00 61.60  ? 532  ARG A NH1   1 
ATOM   4021  N  NH2   . ARG A 1  532  ? -17.745 -21.044 57.587  1.00 63.83  ? 532  ARG A NH2   1 
ATOM   4022  N  N     . LYS A 1  533  ? -15.557 -22.709 52.838  1.00 59.12  ? 533  LYS A N     1 
ATOM   4023  C  CA    . LYS A 1  533  ? -16.977 -22.801 52.475  1.00 60.25  ? 533  LYS A CA    1 
ATOM   4024  C  C     . LYS A 1  533  ? -17.317 -24.163 51.836  1.00 61.22  ? 533  LYS A C     1 
ATOM   4025  O  O     . LYS A 1  533  ? -18.183 -24.882 52.333  1.00 61.50  ? 533  LYS A O     1 
ATOM   4026  C  CB    . LYS A 1  533  ? -17.406 -21.613 51.595  1.00 59.76  ? 533  LYS A CB    1 
ATOM   4027  C  CG    . LYS A 1  533  ? -17.279 -20.262 52.272  1.00 59.30  ? 533  LYS A CG    1 
ATOM   4028  C  CD    . LYS A 1  533  ? -18.302 -19.271 51.772  1.00 59.73  ? 533  LYS A CD    1 
ATOM   4029  C  CE    . LYS A 1  533  ? -19.676 -19.478 52.444  1.00 60.73  ? 533  LYS A CE    1 
ATOM   4030  N  NZ    . LYS A 1  533  ? -20.748 -18.546 51.925  1.00 60.59  ? 533  LYS A NZ    1 
ATOM   4031  N  N     . LEU A 1  534  ? -16.595 -24.525 50.777  1.00 62.49  ? 534  LEU A N     1 
ATOM   4032  C  CA    . LEU A 1  534  ? -16.812 -25.776 50.049  1.00 63.65  ? 534  LEU A CA    1 
ATOM   4033  C  C     . LEU A 1  534  ? -16.784 -26.985 50.957  1.00 64.90  ? 534  LEU A C     1 
ATOM   4034  O  O     . LEU A 1  534  ? -17.408 -28.004 50.648  1.00 64.66  ? 534  LEU A O     1 
ATOM   4035  C  CB    . LEU A 1  534  ? -15.715 -25.960 48.982  1.00 64.03  ? 534  LEU A CB    1 
ATOM   4036  C  CG    . LEU A 1  534  ? -15.585 -27.299 48.231  1.00 63.36  ? 534  LEU A CG    1 
ATOM   4037  C  CD1   . LEU A 1  534  ? -16.816 -27.542 47.379  1.00 63.49  ? 534  LEU A CD1   1 
ATOM   4038  C  CD2   . LEU A 1  534  ? -14.325 -27.362 47.387  1.00 62.51  ? 534  LEU A CD2   1 
ATOM   4039  N  N     . THR A 1  535  ? -16.045 -26.857 52.062  1.00 66.43  ? 535  THR A N     1 
ATOM   4040  C  CA    . THR A 1  535  ? -15.662 -27.995 52.895  1.00 68.09  ? 535  THR A CA    1 
ATOM   4041  C  C     . THR A 1  535  ? -16.521 -28.180 54.139  1.00 69.21  ? 535  THR A C     1 
ATOM   4042  O  O     . THR A 1  535  ? -16.551 -29.266 54.706  1.00 69.56  ? 535  THR A O     1 
ATOM   4043  C  CB    . THR A 1  535  ? -14.168 -27.935 53.279  1.00 68.12  ? 535  THR A CB    1 
ATOM   4044  O  OG1   . THR A 1  535  ? -13.389 -28.666 52.320  1.00 68.51  ? 535  THR A OG1   1 
ATOM   4045  C  CG2   . THR A 1  535  ? -13.945 -28.534 54.630  1.00 68.20  ? 535  THR A CG2   1 
ATOM   4046  N  N     . LEU A 1  536  ? -17.212 -27.129 54.564  1.00 70.58  ? 536  LEU A N     1 
ATOM   4047  C  CA    . LEU A 1  536  ? -18.246 -27.268 55.585  1.00 72.07  ? 536  LEU A CA    1 
ATOM   4048  C  C     . LEU A 1  536  ? -18.997 -28.605 55.473  1.00 72.82  ? 536  LEU A C     1 
ATOM   4049  O  O     . LEU A 1  536  ? -19.258 -29.108 54.367  1.00 72.70  ? 536  LEU A O     1 
ATOM   4050  C  CB    . LEU A 1  536  ? -19.255 -26.115 55.471  1.00 72.45  ? 536  LEU A CB    1 
ATOM   4051  C  CG    . LEU A 1  536  ? -19.109 -24.762 56.193  1.00 73.33  ? 536  LEU A CG    1 
ATOM   4052  C  CD1   . LEU A 1  536  ? -19.795 -23.614 55.400  1.00 73.10  ? 536  LEU A CD1   1 
ATOM   4053  C  CD2   . LEU A 1  536  ? -19.666 -24.860 57.629  1.00 73.81  ? 536  LEU A CD2   1 
ATOM   4054  N  N     . ARG A 1  537  ? -19.338 -29.169 56.629  1.00 73.99  ? 537  ARG A N     1 
ATOM   4055  C  CA    . ARG A 1  537  ? -20.230 -30.333 56.717  1.00 75.25  ? 537  ARG A CA    1 
ATOM   4056  C  C     . ARG A 1  537  ? -21.566 -30.080 56.032  1.00 74.93  ? 537  ARG A C     1 
ATOM   4057  O  O     . ARG A 1  537  ? -22.132 -30.977 55.421  1.00 74.85  ? 537  ARG A O     1 
ATOM   4058  C  CB    . ARG A 1  537  ? -20.513 -30.682 58.189  1.00 75.65  ? 537  ARG A CB    1 
ATOM   4059  C  CG    . ARG A 1  537  ? -19.721 -31.859 58.784  1.00 76.99  ? 537  ARG A CG    1 
ATOM   4060  C  CD    . ARG A 1  537  ? -20.474 -32.460 59.985  1.00 76.83  ? 537  ARG A CD    1 
ATOM   4061  N  NE    . ARG A 1  537  ? -19.907 -32.046 61.266  1.00 79.52  ? 537  ARG A NE    1 
ATOM   4062  C  CZ    . ARG A 1  537  ? -19.203 -32.846 62.065  1.00 80.69  ? 537  ARG A CZ    1 
ATOM   4063  N  NH1   . ARG A 1  537  ? -18.980 -34.110 61.721  1.00 81.12  ? 537  ARG A NH1   1 
ATOM   4064  N  NH2   . ARG A 1  537  ? -18.722 -32.385 63.214  1.00 81.32  ? 537  ARG A NH2   1 
ATOM   4065  N  N     . ASP A 1  538  ? -22.065 -28.854 56.156  1.00 75.10  ? 538  ASP A N     1 
ATOM   4066  C  CA    . ASP A 1  538  ? -23.372 -28.484 55.619  1.00 75.60  ? 538  ASP A CA    1 
ATOM   4067  C  C     . ASP A 1  538  ? -23.371 -28.264 54.102  1.00 75.56  ? 538  ASP A C     1 
ATOM   4068  O  O     . ASP A 1  538  ? -24.427 -28.003 53.514  1.00 75.57  ? 538  ASP A O     1 
ATOM   4069  C  CB    . ASP A 1  538  ? -23.940 -27.249 56.361  1.00 76.11  ? 538  ASP A CB    1 
ATOM   4070  C  CG    . ASP A 1  538  ? -24.980 -27.621 57.478  1.00 76.99  ? 538  ASP A CG    1 
ATOM   4071  O  OD1   . ASP A 1  538  ? -25.529 -28.749 57.455  1.00 77.22  ? 538  ASP A OD1   1 
ATOM   4072  O  OD2   . ASP A 1  538  ? -25.259 -26.773 58.369  1.00 76.64  ? 538  ASP A OD2   1 
ATOM   4073  N  N     . THR A 1  539  ? -22.191 -28.376 53.479  1.00 75.62  ? 539  THR A N     1 
ATOM   4074  C  CA    . THR A 1  539  ? -22.041 -28.193 52.032  1.00 75.20  ? 539  THR A CA    1 
ATOM   4075  C  C     . THR A 1  539  ? -22.086 -29.528 51.304  1.00 75.54  ? 539  THR A C     1 
ATOM   4076  O  O     . THR A 1  539  ? -21.137 -30.318 51.354  1.00 75.21  ? 539  THR A O     1 
ATOM   4077  C  CB    . THR A 1  539  ? -20.770 -27.411 51.654  1.00 74.82  ? 539  THR A CB    1 
ATOM   4078  O  OG1   . THR A 1  539  ? -20.783 -26.140 52.298  1.00 73.50  ? 539  THR A OG1   1 
ATOM   4079  C  CG2   . THR A 1  539  ? -20.735 -27.161 50.168  1.00 75.18  ? 539  THR A CG2   1 
ATOM   4080  N  N     . PHE A 1  540  ? -23.226 -29.757 50.653  1.00 76.08  ? 540  PHE A N     1 
ATOM   4081  C  CA    . PHE A 1  540  ? -23.459 -30.912 49.800  1.00 76.73  ? 540  PHE A CA    1 
ATOM   4082  C  C     . PHE A 1  540  ? -23.706 -30.468 48.355  1.00 77.02  ? 540  PHE A C     1 
ATOM   4083  O  O     . PHE A 1  540  ? -24.478 -29.535 48.102  1.00 77.15  ? 540  PHE A O     1 
ATOM   4084  C  CB    . PHE A 1  540  ? -24.661 -31.727 50.294  1.00 76.82  ? 540  PHE A CB    1 
ATOM   4085  C  CG    . PHE A 1  540  ? -24.424 -32.473 51.593  1.00 77.45  ? 540  PHE A CG    1 
ATOM   4086  C  CD1   . PHE A 1  540  ? -25.333 -32.354 52.652  1.00 77.55  ? 540  PHE A CD1   1 
ATOM   4087  C  CD2   . PHE A 1  540  ? -23.313 -33.311 51.754  1.00 77.68  ? 540  PHE A CD2   1 
ATOM   4088  C  CE1   . PHE A 1  540  ? -25.133 -33.041 53.855  1.00 77.32  ? 540  PHE A CE1   1 
ATOM   4089  C  CE2   . PHE A 1  540  ? -23.107 -34.004 52.951  1.00 77.66  ? 540  PHE A CE2   1 
ATOM   4090  C  CZ    . PHE A 1  540  ? -24.022 -33.866 54.006  1.00 77.43  ? 540  PHE A CZ    1 
ATOM   4091  N  N     . ILE A 1  541  ? -23.062 -31.161 47.417  1.00 77.23  ? 541  ILE A N     1 
ATOM   4092  C  CA    . ILE A 1  541  ? -23.141 -30.837 45.997  1.00 77.47  ? 541  ILE A CA    1 
ATOM   4093  C  C     . ILE A 1  541  ? -23.871 -31.891 45.161  1.00 77.83  ? 541  ILE A C     1 
ATOM   4094  O  O     . ILE A 1  541  ? -23.399 -33.027 45.041  1.00 77.98  ? 541  ILE A O     1 
ATOM   4095  C  CB    . ILE A 1  541  ? -21.750 -30.695 45.426  1.00 77.35  ? 541  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A 1  541  ? -20.981 -29.641 46.216  1.00 77.49  ? 541  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A 1  541  ? -21.836 -30.348 43.957  1.00 77.48  ? 541  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A 1  541  ? -19.579 -29.409 45.707  1.00 78.17  ? 541  ILE A CD1   1 
ATOM   4099  N  N     . GLU A 1  542  ? -25.004 -31.510 44.565  1.00 78.09  ? 542  GLU A N     1 
ATOM   4100  C  CA    . GLU A 1  542  ? -25.755 -32.446 43.721  1.00 78.30  ? 542  GLU A CA    1 
ATOM   4101  C  C     . GLU A 1  542  ? -25.154 -32.597 42.322  1.00 77.88  ? 542  GLU A C     1 
ATOM   4102  O  O     . GLU A 1  542  ? -24.256 -31.839 41.948  1.00 77.78  ? 542  GLU A O     1 
ATOM   4103  C  CB    . GLU A 1  542  ? -27.257 -32.147 43.697  1.00 78.15  ? 542  GLU A CB    1 
ATOM   4104  C  CG    . GLU A 1  542  ? -27.660 -30.684 43.624  1.00 78.89  ? 542  GLU A CG    1 
ATOM   4105  C  CD    . GLU A 1  542  ? -29.189 -30.506 43.692  1.00 79.80  ? 542  GLU A CD    1 
ATOM   4106  O  OE1   . GLU A 1  542  ? -29.901 -31.463 44.110  1.00 81.50  ? 542  GLU A OE1   1 
ATOM   4107  O  OE2   . GLU A 1  542  ? -29.684 -29.411 43.318  1.00 81.17  ? 542  GLU A OE2   1 
ATOM   4108  N  N     . LEU A 1  543  ? -25.663 -33.572 41.569  1.00 77.69  ? 543  LEU A N     1 
ATOM   4109  C  CA    . LEU A 1  543  ? -24.971 -34.147 40.404  1.00 77.63  ? 543  LEU A CA    1 
ATOM   4110  C  C     . LEU A 1  543  ? -24.445 -33.183 39.337  1.00 77.81  ? 543  LEU A C     1 
ATOM   4111  O  O     . LEU A 1  543  ? -23.271 -33.255 38.960  1.00 78.02  ? 543  LEU A O     1 
ATOM   4112  C  CB    . LEU A 1  543  ? -25.839 -35.218 39.740  1.00 77.51  ? 543  LEU A CB    1 
ATOM   4113  C  CG    . LEU A 1  543  ? -25.362 -35.774 38.393  1.00 77.00  ? 543  LEU A CG    1 
ATOM   4114  C  CD1   . LEU A 1  543  ? -24.026 -36.526 38.502  1.00 76.44  ? 543  LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A 1  543  ? -26.444 -36.666 37.826  1.00 76.53  ? 543  LEU A CD2   1 
ATOM   4116  N  N     . ASP A 1  544  ? -25.326 -32.317 38.844  1.00 77.84  ? 544  ASP A N     1 
ATOM   4117  C  CA    . ASP A 1  544  ? -25.022 -31.378 37.752  1.00 77.92  ? 544  ASP A CA    1 
ATOM   4118  C  C     . ASP A 1  544  ? -23.699 -30.593 37.879  1.00 77.08  ? 544  ASP A C     1 
ATOM   4119  O  O     . ASP A 1  544  ? -22.925 -30.511 36.916  1.00 76.72  ? 544  ASP A O     1 
ATOM   4120  C  CB    . ASP A 1  544  ? -26.216 -30.432 37.520  1.00 78.64  ? 544  ASP A CB    1 
ATOM   4121  C  CG    . ASP A 1  544  ? -26.830 -29.891 38.826  1.00 80.92  ? 544  ASP A CG    1 
ATOM   4122  O  OD1   . ASP A 1  544  ? -26.302 -30.171 39.939  1.00 83.38  ? 544  ASP A OD1   1 
ATOM   4123  O  OD2   . ASP A 1  544  ? -27.860 -29.175 38.722  1.00 83.19  ? 544  ASP A OD2   1 
ATOM   4124  N  N     . GLN A 1  545  ? -23.468 -30.012 39.059  1.00 76.33  ? 545  GLN A N     1 
ATOM   4125  C  CA    . GLN A 1  545  ? -22.185 -29.383 39.409  1.00 75.75  ? 545  GLN A CA    1 
ATOM   4126  C  C     . GLN A 1  545  ? -21.080 -30.442 39.386  1.00 74.87  ? 545  GLN A C     1 
ATOM   4127  O  O     . GLN A 1  545  ? -20.105 -30.326 38.640  1.00 74.76  ? 545  GLN A O     1 
ATOM   4128  C  CB    . GLN A 1  545  ? -22.242 -28.752 40.820  1.00 75.92  ? 545  GLN A CB    1 
ATOM   4129  C  CG    . GLN A 1  545  ? -22.372 -27.211 40.931  1.00 76.21  ? 545  GLN A CG    1 
ATOM   4130  C  CD    . GLN A 1  545  ? -22.818 -26.736 42.349  1.00 76.14  ? 545  GLN A CD    1 
ATOM   4131  O  OE1   . GLN A 1  545  ? -22.459 -25.636 42.796  1.00 76.35  ? 545  GLN A OE1   1 
ATOM   4132  N  NE2   . GLN A 1  545  ? -23.606 -27.566 43.041  1.00 75.61  ? 545  GLN A NE2   1 
ATOM   4133  N  N     . VAL A 1  546  ? -21.265 -31.485 40.194  1.00 73.77  ? 546  VAL A N     1 
ATOM   4134  C  CA    . VAL A 1  546  ? -20.233 -32.482 40.444  1.00 72.60  ? 546  VAL A CA    1 
ATOM   4135  C  C     . VAL A 1  546  ? -19.532 -32.924 39.169  1.00 72.20  ? 546  VAL A C     1 
ATOM   4136  O  O     . VAL A 1  546  ? -18.350 -33.266 39.192  1.00 72.07  ? 546  VAL A O     1 
ATOM   4137  C  CB    . VAL A 1  546  ? -20.794 -33.675 41.226  1.00 72.48  ? 546  VAL A CB    1 
ATOM   4138  C  CG1   . VAL A 1  546  ? -19.745 -34.765 41.411  1.00 72.02  ? 546  VAL A CG1   1 
ATOM   4139  C  CG2   . VAL A 1  546  ? -21.286 -33.200 42.576  1.00 72.28  ? 546  VAL A CG2   1 
ATOM   4140  N  N     . LEU A 1  547  ? -20.240 -32.877 38.048  1.00 71.69  ? 547  LEU A N     1 
ATOM   4141  C  CA    . LEU A 1  547  ? -19.629 -33.270 36.784  1.00 71.24  ? 547  LEU A CA    1 
ATOM   4142  C  C     . LEU A 1  547  ? -18.764 -32.163 36.171  1.00 70.91  ? 547  LEU A C     1 
ATOM   4143  O  O     . LEU A 1  547  ? -17.634 -32.425 35.770  1.00 70.99  ? 547  LEU A O     1 
ATOM   4144  C  CB    . LEU A 1  547  ? -20.665 -33.830 35.813  1.00 71.08  ? 547  LEU A CB    1 
ATOM   4145  C  CG    . LEU A 1  547  ? -21.547 -34.874 36.514  1.00 71.30  ? 547  LEU A CG    1 
ATOM   4146  C  CD1   . LEU A 1  547  ? -22.977 -34.828 35.987  1.00 72.20  ? 547  LEU A CD1   1 
ATOM   4147  C  CD2   . LEU A 1  547  ? -20.966 -36.270 36.427  1.00 70.43  ? 547  LEU A CD2   1 
ATOM   4148  N  N     . ASN A 1  548  ? -19.252 -30.928 36.117  1.00 70.39  ? 548  ASN A N     1 
ATOM   4149  C  CA    . ASN A 1  548  ? -18.390 -29.850 35.643  1.00 69.93  ? 548  ASN A CA    1 
ATOM   4150  C  C     . ASN A 1  548  ? -17.121 -29.782 36.492  1.00 69.79  ? 548  ASN A C     1 
ATOM   4151  O  O     . ASN A 1  548  ? -16.016 -29.888 35.950  1.00 70.15  ? 548  ASN A O     1 
ATOM   4152  C  CB    . ASN A 1  548  ? -19.108 -28.501 35.617  1.00 70.01  ? 548  ASN A CB    1 
ATOM   4153  C  CG    . ASN A 1  548  ? -20.074 -28.372 34.452  1.00 70.47  ? 548  ASN A CG    1 
ATOM   4154  O  OD1   . ASN A 1  548  ? -19.678 -28.367 33.289  1.00 70.53  ? 548  ASN A OD1   1 
ATOM   4155  N  ND2   . ASN A 1  548  ? -21.355 -28.255 34.766  1.00 72.15  ? 548  ASN A ND2   1 
ATOM   4156  N  N     . MET A 1  549  ? -17.285 -29.637 37.813  1.00 69.15  ? 549  MET A N     1 
ATOM   4157  C  CA    . MET A 1  549  ? -16.168 -29.633 38.773  1.00 68.48  ? 549  MET A CA    1 
ATOM   4158  C  C     . MET A 1  549  ? -15.149 -30.722 38.458  1.00 68.04  ? 549  MET A C     1 
ATOM   4159  O  O     . MET A 1  549  ? -13.999 -30.451 38.129  1.00 67.60  ? 549  MET A O     1 
ATOM   4160  C  CB    . MET A 1  549  ? -16.669 -29.870 40.192  1.00 68.20  ? 549  MET A CB    1 
ATOM   4161  C  CG    . MET A 1  549  ? -17.754 -28.968 40.649  1.00 68.11  ? 549  MET A CG    1 
ATOM   4162  S  SD    . MET A 1  549  ? -17.687 -28.881 42.443  1.00 69.38  ? 549  MET A SD    1 
ATOM   4163  C  CE    . MET A 1  549  ? -18.832 -27.530 42.742  1.00 69.30  ? 549  MET A CE    1 
ATOM   4164  N  N     . LEU A 1  550  ? -15.596 -31.965 38.573  1.00 67.81  ? 550  LEU A N     1 
ATOM   4165  C  CA    . LEU A 1  550  ? -14.777 -33.103 38.235  1.00 67.60  ? 550  LEU A CA    1 
ATOM   4166  C  C     . LEU A 1  550  ? -14.030 -32.829 36.942  1.00 67.67  ? 550  LEU A C     1 
ATOM   4167  O  O     . LEU A 1  550  ? -12.815 -33.000 36.873  1.00 67.60  ? 550  LEU A O     1 
ATOM   4168  C  CB    . LEU A 1  550  ? -15.650 -34.356 38.100  1.00 67.59  ? 550  LEU A CB    1 
ATOM   4169  C  CG    . LEU A 1  550  ? -15.421 -35.582 38.984  1.00 66.90  ? 550  LEU A CG    1 
ATOM   4170  C  CD1   . LEU A 1  550  ? -14.419 -35.301 40.086  1.00 66.79  ? 550  LEU A CD1   1 
ATOM   4171  C  CD2   . LEU A 1  550  ? -16.721 -36.129 39.533  1.00 65.92  ? 550  LEU A CD2   1 
ATOM   4172  N  N     . TYR A 1  551  ? -14.762 -32.378 35.926  1.00 67.80  ? 551  TYR A N     1 
ATOM   4173  C  CA    . TYR A 1  551  ? -14.175 -32.201 34.614  1.00 67.98  ? 551  TYR A CA    1 
ATOM   4174  C  C     . TYR A 1  551  ? -13.190 -31.069 34.658  1.00 68.35  ? 551  TYR A C     1 
ATOM   4175  O  O     . TYR A 1  551  ? -12.171 -31.113 33.966  1.00 68.75  ? 551  TYR A O     1 
ATOM   4176  C  CB    . TYR A 1  551  ? -15.223 -31.948 33.526  1.00 67.69  ? 551  TYR A CB    1 
ATOM   4177  C  CG    . TYR A 1  551  ? -14.614 -31.886 32.142  1.00 67.26  ? 551  TYR A CG    1 
ATOM   4178  C  CD1   . TYR A 1  551  ? -13.387 -32.495 31.878  1.00 66.78  ? 551  TYR A CD1   1 
ATOM   4179  C  CD2   . TYR A 1  551  ? -15.261 -31.241 31.099  1.00 67.34  ? 551  TYR A CD2   1 
ATOM   4180  C  CE1   . TYR A 1  551  ? -12.810 -32.450 30.633  1.00 67.15  ? 551  TYR A CE1   1 
ATOM   4181  C  CE2   . TYR A 1  551  ? -14.686 -31.193 29.826  1.00 67.68  ? 551  TYR A CE2   1 
ATOM   4182  C  CZ    . TYR A 1  551  ? -13.458 -31.806 29.607  1.00 67.46  ? 551  TYR A CZ    1 
ATOM   4183  O  OH    . TYR A 1  551  ? -12.863 -31.777 28.367  1.00 67.18  ? 551  TYR A OH    1 
ATOM   4184  N  N     . TRP A 1  552  ? -13.500 -30.073 35.484  1.00 68.52  ? 552  TRP A N     1 
ATOM   4185  C  CA    . TRP A 1  552  ? -12.688 -28.872 35.638  1.00 68.91  ? 552  TRP A CA    1 
ATOM   4186  C  C     . TRP A 1  552  ? -11.194 -29.121 35.976  1.00 69.10  ? 552  TRP A C     1 
ATOM   4187  O  O     . TRP A 1  552  ? -10.292 -28.445 35.441  1.00 68.54  ? 552  TRP A O     1 
ATOM   4188  C  CB    . TRP A 1  552  ? -13.334 -27.990 36.691  1.00 69.02  ? 552  TRP A CB    1 
ATOM   4189  C  CG    . TRP A 1  552  ? -13.844 -26.703 36.168  1.00 69.42  ? 552  TRP A CG    1 
ATOM   4190  C  CD1   . TRP A 1  552  ? -15.110 -26.202 36.291  1.00 69.10  ? 552  TRP A CD1   1 
ATOM   4191  C  CD2   . TRP A 1  552  ? -13.084 -25.717 35.465  1.00 69.98  ? 552  TRP A CD2   1 
ATOM   4192  N  NE1   . TRP A 1  552  ? -15.183 -24.964 35.706  1.00 68.87  ? 552  TRP A NE1   1 
ATOM   4193  C  CE2   . TRP A 1  552  ? -13.954 -24.642 35.190  1.00 69.89  ? 552  TRP A CE2   1 
ATOM   4194  C  CE3   . TRP A 1  552  ? -11.741 -25.637 35.040  1.00 69.38  ? 552  TRP A CE3   1 
ATOM   4195  C  CZ2   . TRP A 1  552  ? -13.532 -23.502 34.490  1.00 70.39  ? 552  TRP A CZ2   1 
ATOM   4196  C  CZ3   . TRP A 1  552  ? -11.321 -24.510 34.353  1.00 68.88  ? 552  TRP A CZ3   1 
ATOM   4197  C  CH2   . TRP A 1  552  ? -12.214 -23.458 34.078  1.00 69.46  ? 552  TRP A CH2   1 
ATOM   4198  N  N     . VAL A 1  553  ? -10.959 -30.096 36.856  1.00 69.48  ? 553  VAL A N     1 
ATOM   4199  C  CA    . VAL A 1  553  ? -9.624  -30.554 37.206  1.00 69.63  ? 553  VAL A CA    1 
ATOM   4200  C  C     . VAL A 1  553  ? -9.038  -31.393 36.082  1.00 70.79  ? 553  VAL A C     1 
ATOM   4201  O  O     . VAL A 1  553  ? -9.620  -32.399 35.687  1.00 70.42  ? 553  VAL A O     1 
ATOM   4202  C  CB    . VAL A 1  553  ? -9.630  -31.319 38.523  1.00 69.14  ? 553  VAL A CB    1 
ATOM   4203  C  CG1   . VAL A 1  553  ? -8.627  -32.447 38.498  1.00 68.79  ? 553  VAL A CG1   1 
ATOM   4204  C  CG2   . VAL A 1  553  ? -9.337  -30.377 39.650  1.00 67.86  ? 553  VAL A CG2   1 
ATOM   4205  N  N     . PRO A 1  554  ? -7.861  -30.976 35.578  1.00 72.31  ? 554  PRO A N     1 
ATOM   4206  C  CA    . PRO A 1  554  ? -7.275  -31.442 34.306  1.00 73.40  ? 554  PRO A CA    1 
ATOM   4207  C  C     . PRO A 1  554  ? -6.533  -32.765 34.373  1.00 74.23  ? 554  PRO A C     1 
ATOM   4208  O  O     . PRO A 1  554  ? -5.946  -33.174 33.372  1.00 74.44  ? 554  PRO A O     1 
ATOM   4209  C  CB    . PRO A 1  554  ? -6.278  -30.329 33.944  1.00 73.59  ? 554  PRO A CB    1 
ATOM   4210  C  CG    . PRO A 1  554  ? -5.910  -29.677 35.270  1.00 73.34  ? 554  PRO A CG    1 
ATOM   4211  C  CD    . PRO A 1  554  ? -6.996  -29.996 36.270  1.00 72.48  ? 554  PRO A CD    1 
ATOM   4212  N  N     . ASP A 1  555  ? -6.544  -33.408 35.539  1.00 75.18  ? 555  ASP A N     1 
ATOM   4213  C  CA    . ASP A 1  555  ? -5.842  -34.678 35.744  1.00 76.14  ? 555  ASP A CA    1 
ATOM   4214  C  C     . ASP A 1  555  ? -6.812  -35.780 36.188  1.00 76.26  ? 555  ASP A C     1 
ATOM   4215  O  O     . ASP A 1  555  ? -6.386  -36.858 36.612  1.00 76.36  ? 555  ASP A O     1 
ATOM   4216  C  CB    . ASP A 1  555  ? -4.735  -34.533 36.808  1.00 76.65  ? 555  ASP A CB    1 
ATOM   4217  C  CG    . ASP A 1  555  ? -3.967  -33.202 36.721  1.00 78.12  ? 555  ASP A CG    1 
ATOM   4218  O  OD1   . ASP A 1  555  ? -4.612  -32.120 36.714  1.00 77.88  ? 555  ASP A OD1   1 
ATOM   4219  O  OD2   . ASP A 1  555  ? -2.706  -33.248 36.710  1.00 80.39  ? 555  ASP A OD2   1 
ATOM   4220  N  N     . TRP A 1  556  ? -8.111  -35.502 36.097  1.00 76.49  ? 556  TRP A N     1 
ATOM   4221  C  CA    . TRP A 1  556  ? -9.143  -36.391 36.633  1.00 76.63  ? 556  TRP A CA    1 
ATOM   4222  C  C     . TRP A 1  556  ? -9.324  -37.641 35.790  1.00 76.40  ? 556  TRP A C     1 
ATOM   4223  O  O     . TRP A 1  556  ? -9.587  -37.546 34.590  1.00 76.28  ? 556  TRP A O     1 
ATOM   4224  C  CB    . TRP A 1  556  ? -10.477 -35.649 36.765  1.00 77.08  ? 556  TRP A CB    1 
ATOM   4225  C  CG    . TRP A 1  556  ? -11.613 -36.538 37.140  1.00 77.10  ? 556  TRP A CG    1 
ATOM   4226  C  CD1   . TRP A 1  556  ? -11.741 -37.251 38.286  1.00 77.63  ? 556  TRP A CD1   1 
ATOM   4227  C  CD2   . TRP A 1  556  ? -12.775 -36.812 36.363  1.00 76.86  ? 556  TRP A CD2   1 
ATOM   4228  N  NE1   . TRP A 1  556  ? -12.915 -37.957 38.277  1.00 77.75  ? 556  TRP A NE1   1 
ATOM   4229  C  CE2   . TRP A 1  556  ? -13.570 -37.705 37.106  1.00 76.97  ? 556  TRP A CE2   1 
ATOM   4230  C  CE3   . TRP A 1  556  ? -13.222 -36.390 35.111  1.00 77.49  ? 556  TRP A CE3   1 
ATOM   4231  C  CZ2   . TRP A 1  556  ? -14.792 -38.180 36.647  1.00 77.39  ? 556  TRP A CZ2   1 
ATOM   4232  C  CZ3   . TRP A 1  556  ? -14.443 -36.866 34.646  1.00 77.78  ? 556  TRP A CZ3   1 
ATOM   4233  C  CH2   . TRP A 1  556  ? -15.210 -37.757 35.412  1.00 77.72  ? 556  TRP A CH2   1 
ATOM   4234  N  N     . ASP A 1  557  ? -9.215  -38.800 36.440  1.00 76.21  ? 557  ASP A N     1 
ATOM   4235  C  CA    . ASP A 1  557  ? -9.151  -40.094 35.749  1.00 76.21  ? 557  ASP A CA    1 
ATOM   4236  C  C     . ASP A 1  557  ? -10.438 -40.500 35.028  1.00 75.69  ? 557  ASP A C     1 
ATOM   4237  O  O     . ASP A 1  557  ? -10.440 -41.456 34.233  1.00 75.70  ? 557  ASP A O     1 
ATOM   4238  C  CB    . ASP A 1  557  ? -8.671  -41.212 36.689  1.00 76.68  ? 557  ASP A CB    1 
ATOM   4239  C  CG    . ASP A 1  557  ? -9.684  -41.552 37.782  1.00 78.31  ? 557  ASP A CG    1 
ATOM   4240  O  OD1   . ASP A 1  557  ? -10.537 -40.686 38.091  1.00 80.31  ? 557  ASP A OD1   1 
ATOM   4241  O  OD2   . ASP A 1  557  ? -9.620  -42.685 38.334  1.00 79.68  ? 557  ASP A OD2   1 
ATOM   4242  N  N     . GLY A 1  558  ? -11.521 -39.771 35.294  1.00 74.93  ? 558  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1  558  ? -12.803 -40.047 34.649  1.00 73.70  ? 558  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1  558  ? -13.725 -40.925 35.476  1.00 72.58  ? 558  GLY A C     1 
ATOM   4245  O  O     . GLY A 1  558  ? -14.765 -41.368 34.997  1.00 72.47  ? 558  GLY A O     1 
ATOM   4246  N  N     . VAL A 1  559  ? -13.353 -41.157 36.727  1.00 71.54  ? 559  VAL A N     1 
ATOM   4247  C  CA    . VAL A 1  559  ? -14.094 -42.070 37.576  1.00 70.75  ? 559  VAL A CA    1 
ATOM   4248  C  C     . VAL A 1  559  ? -14.816 -41.352 38.715  1.00 70.11  ? 559  VAL A C     1 
ATOM   4249  O  O     . VAL A 1  559  ? -14.254 -41.124 39.805  1.00 70.11  ? 559  VAL A O     1 
ATOM   4250  C  CB    . VAL A 1  559  ? -13.185 -43.165 38.126  1.00 70.96  ? 559  VAL A CB    1 
ATOM   4251  C  CG1   . VAL A 1  559  ? -14.024 -44.272 38.762  1.00 71.33  ? 559  VAL A CG1   1 
ATOM   4252  C  CG2   . VAL A 1  559  ? -12.298 -43.718 37.006  1.00 71.13  ? 559  VAL A CG2   1 
ATOM   4253  N  N     . ILE A 1  560  ? -16.072 -41.004 38.430  1.00 69.10  ? 560  ILE A N     1 
ATOM   4254  C  CA    . ILE A 1  560  ? -16.974 -40.316 39.349  1.00 67.89  ? 560  ILE A CA    1 
ATOM   4255  C  C     . ILE A 1  560  ? -16.994 -41.039 40.679  1.00 67.43  ? 560  ILE A C     1 
ATOM   4256  O  O     . ILE A 1  560  ? -17.398 -42.189 40.744  1.00 67.23  ? 560  ILE A O     1 
ATOM   4257  C  CB    . ILE A 1  560  ? -18.423 -40.324 38.815  1.00 67.71  ? 560  ILE A CB    1 
ATOM   4258  C  CG1   . ILE A 1  560  ? -18.472 -40.037 37.306  1.00 67.29  ? 560  ILE A CG1   1 
ATOM   4259  C  CG2   . ILE A 1  560  ? -19.323 -39.398 39.640  1.00 67.47  ? 560  ILE A CG2   1 
ATOM   4260  C  CD1   . ILE A 1  560  ? -18.336 -38.592 36.916  1.00 67.15  ? 560  ILE A CD1   1 
ATOM   4261  N  N     . PRO A 1  561  ? -16.534 -40.374 41.743  1.00 67.18  ? 561  PRO A N     1 
ATOM   4262  C  CA    . PRO A 1  561  ? -16.630 -40.953 43.075  1.00 66.93  ? 561  PRO A CA    1 
ATOM   4263  C  C     . PRO A 1  561  ? -18.064 -41.219 43.504  1.00 66.39  ? 561  PRO A C     1 
ATOM   4264  O  O     . PRO A 1  561  ? -18.984 -40.449 43.210  1.00 65.87  ? 561  PRO A O     1 
ATOM   4265  C  CB    . PRO A 1  561  ? -15.988 -39.893 43.982  1.00 67.17  ? 561  PRO A CB    1 
ATOM   4266  C  CG    . PRO A 1  561  ? -16.020 -38.633 43.196  1.00 67.26  ? 561  PRO A CG    1 
ATOM   4267  C  CD    . PRO A 1  561  ? -15.870 -39.062 41.764  1.00 67.41  ? 561  PRO A CD    1 
ATOM   4268  N  N     . THR A 1  562  ? -18.227 -42.333 44.193  1.00 66.09  ? 562  THR A N     1 
ATOM   4269  C  CA    . THR A 1  562  ? -19.510 -42.749 44.675  1.00 65.91  ? 562  THR A CA    1 
ATOM   4270  C  C     . THR A 1  562  ? -19.929 -41.693 45.686  1.00 65.81  ? 562  THR A C     1 
ATOM   4271  O  O     . THR A 1  562  ? -19.102 -41.234 46.476  1.00 65.93  ? 562  THR A O     1 
ATOM   4272  C  CB    . THR A 1  562  ? -19.385 -44.111 45.313  1.00 65.88  ? 562  THR A CB    1 
ATOM   4273  O  OG1   . THR A 1  562  ? -18.303 -44.814 44.688  1.00 66.10  ? 562  THR A OG1   1 
ATOM   4274  C  CG2   . THR A 1  562  ? -20.662 -44.902 45.142  1.00 66.04  ? 562  THR A CG2   1 
ATOM   4275  N  N     . PRO A 1  563  ? -21.206 -41.280 45.650  1.00 65.50  ? 563  PRO A N     1 
ATOM   4276  C  CA    . PRO A 1  563  ? -21.598 -40.114 46.401  1.00 65.27  ? 563  PRO A CA    1 
ATOM   4277  C  C     . PRO A 1  563  ? -21.823 -40.510 47.825  1.00 65.18  ? 563  PRO A C     1 
ATOM   4278  O  O     . PRO A 1  563  ? -22.373 -41.571 48.067  1.00 65.49  ? 563  PRO A O     1 
ATOM   4279  C  CB    . PRO A 1  563  ? -22.920 -39.726 45.751  1.00 65.08  ? 563  PRO A CB    1 
ATOM   4280  C  CG    . PRO A 1  563  ? -23.495 -40.986 45.326  1.00 65.27  ? 563  PRO A CG    1 
ATOM   4281  C  CD    . PRO A 1  563  ? -22.354 -41.882 44.955  1.00 65.56  ? 563  PRO A CD    1 
ATOM   4282  N  N     . ALA A 1  564  ? -21.395 -39.673 48.757  1.00 65.30  ? 564  ALA A N     1 
ATOM   4283  C  CA    . ALA A 1  564  ? -21.609 -39.936 50.176  1.00 65.73  ? 564  ALA A CA    1 
ATOM   4284  C  C     . ALA A 1  564  ? -23.066 -40.210 50.463  1.00 65.82  ? 564  ALA A C     1 
ATOM   4285  O  O     . ALA A 1  564  ? -23.410 -41.074 51.259  1.00 65.86  ? 564  ALA A O     1 
ATOM   4286  C  CB    . ALA A 1  564  ? -21.136 -38.776 51.004  1.00 66.02  ? 564  ALA A CB    1 
ATOM   4287  N  N     . ILE A 1  565  ? -23.914 -39.467 49.787  1.00 66.15  ? 565  ILE A N     1 
ATOM   4288  C  CA    . ILE A 1  565  ? -25.326 -39.638 49.908  1.00 67.02  ? 565  ILE A CA    1 
ATOM   4289  C  C     . ILE A 1  565  ? -25.769 -40.434 48.694  1.00 67.66  ? 565  ILE A C     1 
ATOM   4290  O  O     . ILE A 1  565  ? -25.360 -40.135 47.582  1.00 67.75  ? 565  ILE A O     1 
ATOM   4291  C  CB    . ILE A 1  565  ? -25.973 -38.257 49.999  1.00 67.06  ? 565  ILE A CB    1 
ATOM   4292  C  CG1   . ILE A 1  565  ? -25.657 -37.660 51.372  1.00 67.83  ? 565  ILE A CG1   1 
ATOM   4293  C  CG2   . ILE A 1  565  ? -27.467 -38.306 49.763  1.00 66.84  ? 565  ILE A CG2   1 
ATOM   4294  C  CD1   . ILE A 1  565  ? -25.300 -36.191 51.354  1.00 69.30  ? 565  ILE A CD1   1 
ATOM   4295  N  N     . ILE A 1  566  ? -26.572 -41.471 48.922  1.00 68.65  ? 566  ILE A N     1 
ATOM   4296  C  CA    . ILE A 1  566  ? -27.127 -42.308 47.857  1.00 69.60  ? 566  ILE A CA    1 
ATOM   4297  C  C     . ILE A 1  566  ? -28.623 -42.525 48.106  1.00 70.59  ? 566  ILE A C     1 
ATOM   4298  O  O     . ILE A 1  566  ? -29.310 -43.196 47.350  1.00 70.78  ? 566  ILE A O     1 
ATOM   4299  C  CB    . ILE A 1  566  ? -26.371 -43.655 47.777  1.00 69.46  ? 566  ILE A CB    1 
ATOM   4300  C  CG1   . ILE A 1  566  ? -26.179 -44.073 46.317  1.00 70.14  ? 566  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE A 1  566  ? -27.061 -44.746 48.604  1.00 68.81  ? 566  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE A 1  566  ? -24.927 -44.916 46.072  1.00 70.75  ? 566  ILE A CD1   1 
ATOM   4303  N  N     . LYS A 1  567  ? -29.101 -41.899 49.174  1.00 72.00  ? 567  LYS A N     1 
ATOM   4304  C  CA    . LYS A 1  567  ? -30.436 -42.062 49.748  1.00 73.57  ? 567  LYS A CA    1 
ATOM   4305  C  C     . LYS A 1  567  ? -31.539 -41.347 48.930  1.00 73.85  ? 567  LYS A C     1 
ATOM   4306  O  O     . LYS A 1  567  ? -31.467 -41.360 47.700  1.00 73.95  ? 567  LYS A O     1 
ATOM   4307  C  CB    . LYS A 1  567  ? -30.360 -41.530 51.176  1.00 73.78  ? 567  LYS A CB    1 
ATOM   4308  C  CG    . LYS A 1  567  ? -29.637 -40.185 51.248  1.00 75.60  ? 567  LYS A CG    1 
ATOM   4309  C  CD    . LYS A 1  567  ? -29.046 -39.888 52.618  1.00 78.97  ? 567  LYS A CD    1 
ATOM   4310  C  CE    . LYS A 1  567  ? -27.547 -40.190 52.696  1.00 79.71  ? 567  LYS A CE    1 
ATOM   4311  N  NZ    . LYS A 1  567  ? -26.829 -39.262 53.630  1.00 80.33  ? 567  LYS A NZ    1 
ATOM   4312  N  N     . PRO A 1  568  ? -32.567 -40.741 49.599  1.00 74.23  ? 568  PRO A N     1 
ATOM   4313  C  CA    . PRO A 1  568  ? -33.609 -39.935 48.949  1.00 74.30  ? 568  PRO A CA    1 
ATOM   4314  C  C     . PRO A 1  568  ? -33.115 -39.017 47.836  1.00 74.67  ? 568  PRO A C     1 
ATOM   4315  O  O     . PRO A 1  568  ? -33.901 -38.650 46.957  1.00 75.11  ? 568  PRO A O     1 
ATOM   4316  C  CB    . PRO A 1  568  ? -34.157 -39.075 50.098  1.00 74.29  ? 568  PRO A CB    1 
ATOM   4317  C  CG    . PRO A 1  568  ? -33.345 -39.426 51.307  1.00 74.38  ? 568  PRO A CG    1 
ATOM   4318  C  CD    . PRO A 1  568  ? -32.837 -40.795 51.043  1.00 74.27  ? 568  PRO A CD    1 
ATOM   4319  N  N     . LYS A 1  569  ? -31.837 -38.643 47.892  1.00 74.63  ? 569  LYS A N     1 
ATOM   4320  C  CA    . LYS A 1  569  ? -31.163 -37.894 46.833  1.00 74.58  ? 569  LYS A CA    1 
ATOM   4321  C  C     . LYS A 1  569  ? -29.829 -38.570 46.647  1.00 74.63  ? 569  LYS A C     1 
ATOM   4322  O  O     . LYS A 1  569  ? -29.477 -39.433 47.444  1.00 74.89  ? 569  LYS A O     1 
ATOM   4323  C  CB    . LYS A 1  569  ? -30.909 -36.462 47.283  1.00 74.50  ? 569  LYS A CB    1 
ATOM   4324  C  CG    . LYS A 1  569  ? -31.268 -35.391 46.286  1.00 74.62  ? 569  LYS A CG    1 
ATOM   4325  C  CD    . LYS A 1  569  ? -32.613 -34.760 46.679  1.00 74.70  ? 569  LYS A CD    1 
ATOM   4326  C  CE    . LYS A 1  569  ? -32.964 -33.651 45.721  1.00 75.73  ? 569  LYS A CE    1 
ATOM   4327  N  NZ    . LYS A 1  569  ? -32.483 -32.322 46.183  1.00 77.32  ? 569  LYS A NZ    1 
ATOM   4328  N  N     . PRO A 1  570  ? -29.110 -38.253 45.562  1.00 74.68  ? 570  PRO A N     1 
ATOM   4329  C  CA    . PRO A 1  570  ? -27.686 -38.550 45.476  1.00 74.65  ? 570  PRO A CA    1 
ATOM   4330  C  C     . PRO A 1  570  ? -26.793 -37.308 45.525  1.00 74.39  ? 570  PRO A C     1 
ATOM   4331  O  O     . PRO A 1  570  ? -26.576 -36.677 44.493  1.00 74.47  ? 570  PRO A O     1 
ATOM   4332  C  CB    . PRO A 1  570  ? -27.574 -39.193 44.094  1.00 74.81  ? 570  PRO A CB    1 
ATOM   4333  C  CG    . PRO A 1  570  ? -28.811 -38.618 43.295  1.00 75.32  ? 570  PRO A CG    1 
ATOM   4334  C  CD    . PRO A 1  570  ? -29.611 -37.771 44.268  1.00 74.88  ? 570  PRO A CD    1 
ATOM   4335  N  N     . LEU A 1  571  ? -26.281 -36.961 46.705  1.00 74.10  ? 571  LEU A N     1 
ATOM   4336  C  CA    . LEU A 1  571  ? -25.336 -35.847 46.834  1.00 73.77  ? 571  LEU A CA    1 
ATOM   4337  C  C     . LEU A 1  571  ? -23.961 -36.336 47.233  1.00 73.73  ? 571  LEU A C     1 
ATOM   4338  O  O     . LEU A 1  571  ? -23.800 -37.468 47.678  1.00 74.23  ? 571  LEU A O     1 
ATOM   4339  C  CB    . LEU A 1  571  ? -25.808 -34.824 47.860  1.00 73.49  ? 571  LEU A CB    1 
ATOM   4340  C  CG    . LEU A 1  571  ? -27.193 -34.248 47.631  1.00 73.84  ? 571  LEU A CG    1 
ATOM   4341  C  CD1   . LEU A 1  571  ? -28.133 -34.716 48.737  1.00 73.46  ? 571  LEU A CD1   1 
ATOM   4342  C  CD2   . LEU A 1  571  ? -27.115 -32.739 47.585  1.00 74.02  ? 571  LEU A CD2   1 
ATOM   4343  N  N     . TRP A 1  572  ? -22.969 -35.474 47.064  1.00 73.45  ? 572  TRP A N     1 
ATOM   4344  C  CA    . TRP A 1  572  ? -21.630 -35.711 47.569  1.00 73.33  ? 572  TRP A CA    1 
ATOM   4345  C  C     . TRP A 1  572  ? -21.420 -34.711 48.711  1.00 73.64  ? 572  TRP A C     1 
ATOM   4346  O  O     . TRP A 1  572  ? -22.245 -33.832 48.902  1.00 73.92  ? 572  TRP A O     1 
ATOM   4347  C  CB    . TRP A 1  572  ? -20.635 -35.433 46.448  1.00 72.98  ? 572  TRP A CB    1 
ATOM   4348  C  CG    . TRP A 1  572  ? -20.664 -36.394 45.278  1.00 72.50  ? 572  TRP A CG    1 
ATOM   4349  C  CD1   . TRP A 1  572  ? -19.620 -37.149 44.830  1.00 72.55  ? 572  TRP A CD1   1 
ATOM   4350  C  CD2   . TRP A 1  572  ? -21.766 -36.683 44.399  1.00 71.87  ? 572  TRP A CD2   1 
ATOM   4351  N  NE1   . TRP A 1  572  ? -19.999 -37.899 43.739  1.00 72.56  ? 572  TRP A NE1   1 
ATOM   4352  C  CE2   . TRP A 1  572  ? -21.309 -37.632 43.452  1.00 71.86  ? 572  TRP A CE2   1 
ATOM   4353  C  CE3   . TRP A 1  572  ? -23.087 -36.241 44.318  1.00 71.54  ? 572  TRP A CE3   1 
ATOM   4354  C  CZ2   . TRP A 1  572  ? -22.122 -38.140 42.444  1.00 71.62  ? 572  TRP A CZ2   1 
ATOM   4355  C  CZ3   . TRP A 1  572  ? -23.899 -36.758 43.317  1.00 72.35  ? 572  TRP A CZ3   1 
ATOM   4356  C  CH2   . TRP A 1  572  ? -23.412 -37.694 42.394  1.00 72.02  ? 572  TRP A CH2   1 
ATOM   4357  N  N     . SER A 1  573  ? -20.343 -34.827 49.481  1.00 73.98  ? 573  SER A N     1 
ATOM   4358  C  CA    . SER A 1  573  ? -19.914 -33.686 50.309  1.00 74.45  ? 573  SER A CA    1 
ATOM   4359  C  C     . SER A 1  573  ? -18.937 -32.778 49.547  1.00 74.55  ? 573  SER A C     1 
ATOM   4360  O  O     . SER A 1  573  ? -18.256 -33.222 48.611  1.00 74.74  ? 573  SER A O     1 
ATOM   4361  C  CB    . SER A 1  573  ? -19.258 -34.132 51.612  1.00 74.62  ? 573  SER A CB    1 
ATOM   4362  O  OG    . SER A 1  573  ? -18.562 -33.046 52.223  1.00 74.89  ? 573  SER A OG    1 
ATOM   4363  N  N     . GLY A 1  574  ? -18.865 -31.509 49.951  1.00 74.39  ? 574  GLY A N     1 
ATOM   4364  C  CA    . GLY A 1  574  ? -17.871 -30.592 49.390  1.00 73.84  ? 574  GLY A CA    1 
ATOM   4365  C  C     . GLY A 1  574  ? -16.501 -31.247 49.443  1.00 73.55  ? 574  GLY A C     1 
ATOM   4366  O  O     . GLY A 1  574  ? -15.759 -31.281 48.447  1.00 73.41  ? 574  GLY A O     1 
ATOM   4367  N  N     . LYS A 1  575  ? -16.187 -31.801 50.613  1.00 73.11  ? 575  LYS A N     1 
ATOM   4368  C  CA    . LYS A 1  575  ? -14.949 -32.537 50.819  1.00 72.46  ? 575  LYS A CA    1 
ATOM   4369  C  C     . LYS A 1  575  ? -14.781 -33.549 49.693  1.00 71.87  ? 575  LYS A C     1 
ATOM   4370  O  O     . LYS A 1  575  ? -13.770 -33.540 48.994  1.00 71.43  ? 575  LYS A O     1 
ATOM   4371  C  CB    . LYS A 1  575  ? -14.969 -33.231 52.184  1.00 72.52  ? 575  LYS A CB    1 
ATOM   4372  C  CG    . LYS A 1  575  ? -15.069 -32.290 53.383  1.00 72.20  ? 575  LYS A CG    1 
ATOM   4373  C  CD    . LYS A 1  575  ? -15.258 -33.101 54.645  1.00 72.98  ? 575  LYS A CD    1 
ATOM   4374  C  CE    . LYS A 1  575  ? -16.010 -32.335 55.731  1.00 74.30  ? 575  LYS A CE    1 
ATOM   4375  N  NZ    . LYS A 1  575  ? -15.215 -32.078 56.969  1.00 74.37  ? 575  LYS A NZ    1 
ATOM   4376  N  N     . GLN A 1  576  ? -15.825 -34.360 49.503  1.00 71.43  ? 576  GLN A N     1 
ATOM   4377  C  CA    . GLN A 1  576  ? -15.861 -35.489 48.561  1.00 70.99  ? 576  GLN A CA    1 
ATOM   4378  C  C     . GLN A 1  576  ? -15.029 -35.332 47.300  1.00 70.27  ? 576  GLN A C     1 
ATOM   4379  O  O     . GLN A 1  576  ? -14.264 -36.241 46.963  1.00 70.08  ? 576  GLN A O     1 
ATOM   4380  C  CB    . GLN A 1  576  ? -17.307 -35.806 48.162  1.00 71.27  ? 576  GLN A CB    1 
ATOM   4381  C  CG    . GLN A 1  576  ? -18.074 -36.699 49.128  1.00 72.52  ? 576  GLN A CG    1 
ATOM   4382  C  CD    . GLN A 1  576  ? -18.241 -38.116 48.606  1.00 74.74  ? 576  GLN A CD    1 
ATOM   4383  O  OE1   . GLN A 1  576  ? -19.347 -38.537 48.256  1.00 74.42  ? 576  GLN A OE1   1 
ATOM   4384  N  NE2   . GLN A 1  576  ? -17.135 -38.858 48.537  1.00 76.61  ? 576  GLN A NE2   1 
ATOM   4385  N  N     . ILE A 1  577  ? -15.196 -34.195 46.611  1.00 69.53  ? 577  ILE A N     1 
ATOM   4386  C  CA    . ILE A 1  577  ? -14.579 -33.965 45.285  1.00 68.81  ? 577  ILE A CA    1 
ATOM   4387  C  C     . ILE A 1  577  ? -13.371 -33.067 45.298  1.00 68.31  ? 577  ILE A C     1 
ATOM   4388  O  O     . ILE A 1  577  ? -12.560 -33.104 44.372  1.00 68.24  ? 577  ILE A O     1 
ATOM   4389  C  CB    . ILE A 1  577  ? -15.547 -33.366 44.250  1.00 68.59  ? 577  ILE A CB    1 
ATOM   4390  C  CG1   . ILE A 1  577  ? -16.411 -32.292 44.893  1.00 68.92  ? 577  ILE A CG1   1 
ATOM   4391  C  CG2   . ILE A 1  577  ? -16.372 -34.447 43.568  1.00 68.83  ? 577  ILE A CG2   1 
ATOM   4392  C  CD1   . ILE A 1  577  ? -15.823 -30.926 44.755  1.00 68.84  ? 577  ILE A CD1   1 
ATOM   4393  N  N     . LEU A 1  578  ? -13.272 -32.224 46.320  1.00 67.88  ? 578  LEU A N     1 
ATOM   4394  C  CA    . LEU A 1  578  ? -12.040 -31.490 46.544  1.00 67.24  ? 578  LEU A CA    1 
ATOM   4395  C  C     . LEU A 1  578  ? -10.973 -32.563 46.594  1.00 67.36  ? 578  LEU A C     1 
ATOM   4396  O  O     . LEU A 1  578  ? -9.886  -32.407 46.038  1.00 67.60  ? 578  LEU A O     1 
ATOM   4397  C  CB    . LEU A 1  578  ? -12.107 -30.711 47.853  1.00 66.68  ? 578  LEU A CB    1 
ATOM   4398  C  CG    . LEU A 1  578  ? -10.818 -30.122 48.416  1.00 65.22  ? 578  LEU A CG    1 
ATOM   4399  C  CD1   . LEU A 1  578  ? -9.967  -29.402 47.379  1.00 62.94  ? 578  LEU A CD1   1 
ATOM   4400  C  CD2   . LEU A 1  578  ? -11.192 -29.199 49.552  1.00 65.18  ? 578  LEU A CD2   1 
ATOM   4401  N  N     . SER A 1  579  ? -11.353 -33.682 47.208  1.00 67.19  ? 579  SER A N     1 
ATOM   4402  C  CA    . SER A 1  579  ? -10.514 -34.847 47.411  1.00 67.12  ? 579  SER A CA    1 
ATOM   4403  C  C     . SER A 1  579  ? -10.044 -35.451 46.100  1.00 66.83  ? 579  SER A C     1 
ATOM   4404  O  O     . SER A 1  579  ? -9.163  -36.314 46.082  1.00 66.75  ? 579  SER A O     1 
ATOM   4405  C  CB    . SER A 1  579  ? -11.302 -35.886 48.204  1.00 67.43  ? 579  SER A CB    1 
ATOM   4406  O  OG    . SER A 1  579  ? -12.292 -35.266 49.017  1.00 68.10  ? 579  SER A OG    1 
ATOM   4407  N  N     . VAL A 1  580  ? -10.655 -35.000 45.010  1.00 66.68  ? 580  VAL A N     1 
ATOM   4408  C  CA    . VAL A 1  580  ? -10.203 -35.330 43.653  1.00 66.70  ? 580  VAL A CA    1 
ATOM   4409  C  C     . VAL A 1  580  ? -8.959  -34.499 43.233  1.00 66.75  ? 580  VAL A C     1 
ATOM   4410  O  O     . VAL A 1  580  ? -8.151  -34.912 42.380  1.00 66.36  ? 580  VAL A O     1 
ATOM   4411  C  CB    . VAL A 1  580  ? -11.382 -35.223 42.653  1.00 66.40  ? 580  VAL A CB    1 
ATOM   4412  C  CG1   . VAL A 1  580  ? -10.907 -35.114 41.215  1.00 66.32  ? 580  VAL A CG1   1 
ATOM   4413  C  CG2   . VAL A 1  580  ? -12.264 -36.425 42.820  1.00 66.07  ? 580  VAL A CG2   1 
ATOM   4414  N  N     . ALA A 1  581  ? -8.806  -33.346 43.869  1.00 66.76  ? 581  ALA A N     1 
ATOM   4415  C  CA    . ALA A 1  581  ? -7.681  -32.488 43.614  1.00 67.23  ? 581  ALA A CA    1 
ATOM   4416  C  C     . ALA A 1  581  ? -6.429  -33.040 44.296  1.00 67.91  ? 581  ALA A C     1 
ATOM   4417  O  O     . ALA A 1  581  ? -5.306  -32.910 43.762  1.00 68.30  ? 581  ALA A O     1 
ATOM   4418  C  CB    . ALA A 1  581  ? -7.991  -31.098 44.101  1.00 66.96  ? 581  ALA A CB    1 
ATOM   4419  N  N     . ILE A 1  582  ? -6.614  -33.650 45.467  1.00 68.35  ? 582  ILE A N     1 
ATOM   4420  C  CA    . ILE A 1  582  ? -5.489  -34.161 46.241  1.00 68.93  ? 582  ILE A CA    1 
ATOM   4421  C  C     . ILE A 1  582  ? -5.073  -35.518 45.694  1.00 70.37  ? 582  ILE A C     1 
ATOM   4422  O  O     . ILE A 1  582  ? -5.931  -36.381 45.501  1.00 70.74  ? 582  ILE A O     1 
ATOM   4423  C  CB    . ILE A 1  582  ? -5.828  -34.267 47.718  1.00 68.39  ? 582  ILE A CB    1 
ATOM   4424  C  CG1   . ILE A 1  582  ? -5.991  -32.878 48.315  1.00 66.79  ? 582  ILE A CG1   1 
ATOM   4425  C  CG2   . ILE A 1  582  ? -4.738  -35.004 48.442  1.00 68.60  ? 582  ILE A CG2   1 
ATOM   4426  C  CD1   . ILE A 1  582  ? -6.523  -32.865 49.710  1.00 65.47  ? 582  ILE A CD1   1 
ATOM   4427  N  N     . PRO A 1  583  ? -3.770  -35.693 45.385  1.00 71.73  ? 583  PRO A N     1 
ATOM   4428  C  CA    . PRO A 1  583  ? -3.195  -36.910 44.760  1.00 73.21  ? 583  PRO A CA    1 
ATOM   4429  C  C     . PRO A 1  583  ? -3.364  -38.254 45.513  1.00 74.52  ? 583  PRO A C     1 
ATOM   4430  O  O     . PRO A 1  583  ? -4.449  -38.529 46.022  1.00 74.81  ? 583  PRO A O     1 
ATOM   4431  C  CB    . PRO A 1  583  ? -1.717  -36.526 44.546  1.00 72.99  ? 583  PRO A CB    1 
ATOM   4432  C  CG    . PRO A 1  583  ? -1.746  -35.042 44.462  1.00 72.14  ? 583  PRO A CG    1 
ATOM   4433  C  CD    . PRO A 1  583  ? -2.740  -34.652 45.519  1.00 71.56  ? 583  PRO A CD    1 
ATOM   4434  N  N     . ASN A 1  584  ? -2.329  -39.100 45.531  1.00 76.01  ? 584  ASN A N     1 
ATOM   4435  C  CA    . ASN A 1  584  ? -2.413  -40.403 46.210  1.00 77.46  ? 584  ASN A CA    1 
ATOM   4436  C  C     . ASN A 1  584  ? -1.186  -40.741 47.074  1.00 78.19  ? 584  ASN A C     1 
ATOM   4437  O  O     . ASN A 1  584  ? -0.045  -40.591 46.636  1.00 78.17  ? 584  ASN A O     1 
ATOM   4438  C  CB    . ASN A 1  584  ? -2.715  -41.529 45.200  1.00 77.65  ? 584  ASN A CB    1 
ATOM   4439  C  CG    . ASN A 1  584  ? -4.016  -41.290 44.412  1.00 78.40  ? 584  ASN A CG    1 
ATOM   4440  O  OD1   . ASN A 1  584  ? -5.121  -41.547 44.898  1.00 78.64  ? 584  ASN A OD1   1 
ATOM   4441  N  ND2   . ASN A 1  584  ? -3.876  -40.799 43.188  1.00 79.46  ? 584  ASN A ND2   1 
ATOM   4442  N  N     . GLY A 1  585  ? -1.438  -41.193 48.301  1.00 79.19  ? 585  GLY A N     1 
ATOM   4443  C  CA    . GLY A 1  585  ? -0.372  -41.549 49.245  1.00 80.48  ? 585  GLY A CA    1 
ATOM   4444  C  C     . GLY A 1  585  ? -0.151  -40.410 50.224  1.00 81.44  ? 585  GLY A C     1 
ATOM   4445  O  O     . GLY A 1  585  ? 0.588   -40.549 51.225  1.00 81.74  ? 585  GLY A O     1 
ATOM   4446  N  N     . ILE A 1  586  ? -0.794  -39.278 49.919  1.00 81.86  ? 586  ILE A N     1 
ATOM   4447  C  CA    . ILE A 1  586  ? -0.771  -38.096 50.772  1.00 82.07  ? 586  ILE A CA    1 
ATOM   4448  C  C     . ILE A 1  586  ? -1.528  -38.408 52.056  1.00 82.80  ? 586  ILE A C     1 
ATOM   4449  O  O     . ILE A 1  586  ? -2.714  -38.751 52.025  1.00 82.70  ? 586  ILE A O     1 
ATOM   4450  C  CB    . ILE A 1  586  ? -1.403  -36.886 50.051  1.00 81.68  ? 586  ILE A CB    1 
ATOM   4451  C  CG1   . ILE A 1  586  ? -0.662  -36.584 48.740  1.00 80.87  ? 586  ILE A CG1   1 
ATOM   4452  C  CG2   . ILE A 1  586  ? -1.500  -35.677 50.972  1.00 81.01  ? 586  ILE A CG2   1 
ATOM   4453  C  CD1   . ILE A 1  586  ? 0.846   -36.592 48.817  1.00 79.36  ? 586  ILE A CD1   1 
ATOM   4454  N  N     . HIS A 1  587  ? -0.829  -38.339 53.180  1.00 83.54  ? 587  HIS A N     1 
ATOM   4455  C  CA    . HIS A 1  587  ? -1.510  -38.503 54.451  1.00 84.46  ? 587  HIS A CA    1 
ATOM   4456  C  C     . HIS A 1  587  ? -1.282  -37.273 55.292  1.00 84.58  ? 587  HIS A C     1 
ATOM   4457  O  O     . HIS A 1  587  ? -0.183  -36.718 55.316  1.00 84.48  ? 587  HIS A O     1 
ATOM   4458  C  CB    . HIS A 1  587  ? -1.067  -39.775 55.186  1.00 84.80  ? 587  HIS A CB    1 
ATOM   4459  C  CG    . HIS A 1  587  ? -1.275  -41.045 54.406  1.00 86.39  ? 587  HIS A CG    1 
ATOM   4460  N  ND1   . HIS A 1  587  ? -2.343  -41.242 53.553  1.00 87.42  ? 587  HIS A ND1   1 
ATOM   4461  C  CD2   . HIS A 1  587  ? -0.555  -42.195 54.372  1.00 87.42  ? 587  HIS A CD2   1 
ATOM   4462  C  CE1   . HIS A 1  587  ? -2.265  -42.451 53.021  1.00 87.45  ? 587  HIS A CE1   1 
ATOM   4463  N  NE2   . HIS A 1  587  ? -1.190  -43.048 53.501  1.00 87.60  ? 587  HIS A NE2   1 
ATOM   4464  N  N     . LEU A 1  588  ? -2.334  -36.822 55.955  1.00 84.99  ? 588  LEU A N     1 
ATOM   4465  C  CA    . LEU A 1  588  ? -2.218  -35.643 56.780  1.00 85.56  ? 588  LEU A CA    1 
ATOM   4466  C  C     . LEU A 1  588  ? -3.057  -35.773 58.023  1.00 86.07  ? 588  LEU A C     1 
ATOM   4467  O  O     . LEU A 1  588  ? -4.209  -36.209 57.974  1.00 85.97  ? 588  LEU A O     1 
ATOM   4468  C  CB    . LEU A 1  588  ? -2.613  -34.389 56.004  1.00 85.72  ? 588  LEU A CB    1 
ATOM   4469  C  CG    . LEU A 1  588  ? -1.762  -33.127 56.198  1.00 85.57  ? 588  LEU A CG    1 
ATOM   4470  C  CD1   . LEU A 1  588  ? -0.398  -33.310 55.555  1.00 85.86  ? 588  LEU A CD1   1 
ATOM   4471  C  CD2   . LEU A 1  588  ? -2.449  -31.885 55.631  1.00 85.31  ? 588  LEU A CD2   1 
ATOM   4472  N  N     . GLN A 1  589  ? -2.452  -35.377 59.133  1.00 86.67  ? 589  GLN A N     1 
ATOM   4473  C  CA    . GLN A 1  589  ? -3.033  -35.545 60.437  1.00 87.50  ? 589  GLN A CA    1 
ATOM   4474  C  C     . GLN A 1  589  ? -2.887  -34.224 61.162  1.00 87.84  ? 589  GLN A C     1 
ATOM   4475  O  O     . GLN A 1  589  ? -1.878  -33.536 60.970  1.00 87.80  ? 589  GLN A O     1 
ATOM   4476  C  CB    . GLN A 1  589  ? -2.256  -36.627 61.168  1.00 87.67  ? 589  GLN A CB    1 
ATOM   4477  C  CG    . GLN A 1  589  ? -3.129  -37.600 61.929  1.00 88.69  ? 589  GLN A CG    1 
ATOM   4478  C  CD    . GLN A 1  589  ? -2.345  -38.784 62.458  1.00 89.77  ? 589  GLN A CD    1 
ATOM   4479  O  OE1   . GLN A 1  589  ? -1.325  -38.621 63.138  1.00 90.57  ? 589  GLN A OE1   1 
ATOM   4480  N  NE2   . GLN A 1  589  ? -2.822  -39.989 62.152  1.00 89.70  ? 589  GLN A NE2   1 
ATOM   4481  N  N     . ARG A 1  590  ? -3.875  -33.864 61.986  1.00 88.37  ? 590  ARG A N     1 
ATOM   4482  C  CA    . ARG A 1  590  ? -3.801  -32.603 62.735  1.00 89.25  ? 590  ARG A CA    1 
ATOM   4483  C  C     . ARG A 1  590  ? -4.057  -32.686 64.246  1.00 90.00  ? 590  ARG A C     1 
ATOM   4484  O  O     . ARG A 1  590  ? -3.119  -32.804 65.039  1.00 90.10  ? 590  ARG A O     1 
ATOM   4485  C  CB    . ARG A 1  590  ? -4.675  -31.509 62.092  1.00 89.14  ? 590  ARG A CB    1 
ATOM   4486  C  CG    . ARG A 1  590  ? -4.386  -30.084 62.630  1.00 89.22  ? 590  ARG A CG    1 
ATOM   4487  C  CD    . ARG A 1  590  ? -5.032  -28.952 61.803  1.00 89.02  ? 590  ARG A CD    1 
ATOM   4488  N  NE    . ARG A 1  590  ? -4.284  -28.455 60.627  1.00 88.93  ? 590  ARG A NE    1 
ATOM   4489  C  CZ    . ARG A 1  590  ? -3.049  -28.803 60.227  1.00 88.50  ? 590  ARG A CZ    1 
ATOM   4490  N  NH1   . ARG A 1  590  ? -2.303  -29.693 60.877  1.00 88.00  ? 590  ARG A NH1   1 
ATOM   4491  N  NH2   . ARG A 1  590  ? -2.543  -28.247 59.136  1.00 88.17  ? 590  ARG A NH2   1 
ATOM   4492  N  N     . PHE A 1  591  ? -5.332  -32.624 64.624  1.00 91.12  ? 591  PHE A N     1 
ATOM   4493  C  CA    . PHE A 1  591  ? -5.779  -32.360 66.005  1.00 92.15  ? 591  PHE A CA    1 
ATOM   4494  C  C     . PHE A 1  591  ? -5.553  -30.906 66.425  1.00 92.78  ? 591  PHE A C     1 
ATOM   4495  O  O     . PHE A 1  591  ? -4.460  -30.344 66.242  1.00 92.82  ? 591  PHE A O     1 
ATOM   4496  C  CB    . PHE A 1  591  ? -5.188  -33.353 67.014  1.00 92.35  ? 591  PHE A CB    1 
ATOM   4497  C  CG    . PHE A 1  591  ? -5.434  -34.783 66.654  1.00 92.64  ? 591  PHE A CG    1 
ATOM   4498  C  CD1   . PHE A 1  591  ? -4.418  -35.552 66.095  1.00 92.88  ? 591  PHE A CD1   1 
ATOM   4499  C  CD2   . PHE A 1  591  ? -6.691  -35.357 66.853  1.00 92.74  ? 591  PHE A CD2   1 
ATOM   4500  C  CE1   . PHE A 1  591  ? -4.646  -36.873 65.748  1.00 93.59  ? 591  PHE A CE1   1 
ATOM   4501  C  CE2   . PHE A 1  591  ? -6.935  -36.674 66.510  1.00 92.95  ? 591  PHE A CE2   1 
ATOM   4502  C  CZ    . PHE A 1  591  ? -5.913  -37.438 65.954  1.00 93.41  ? 591  PHE A CZ    1 
ATOM   4503  N  N     . ASP A 1  592  ? -6.612  -30.306 66.968  1.00 93.47  ? 592  ASP A N     1 
ATOM   4504  C  CA    . ASP A 1  592  ? -6.651  -28.883 67.293  1.00 94.28  ? 592  ASP A CA    1 
ATOM   4505  C  C     . ASP A 1  592  ? -7.069  -28.719 68.747  1.00 94.61  ? 592  ASP A C     1 
ATOM   4506  O  O     . ASP A 1  592  ? -6.432  -29.254 69.647  1.00 94.72  ? 592  ASP A O     1 
ATOM   4507  C  CB    . ASP A 1  592  ? -7.629  -28.148 66.353  1.00 94.42  ? 592  ASP A CB    1 
ATOM   4508  C  CG    . ASP A 1  592  ? -6.930  -27.196 65.381  1.00 95.09  ? 592  ASP A CG    1 
ATOM   4509  O  OD1   . ASP A 1  592  ? -6.117  -26.349 65.849  1.00 96.26  ? 592  ASP A OD1   1 
ATOM   4510  O  OD2   . ASP A 1  592  ? -7.216  -27.279 64.161  1.00 94.50  ? 592  ASP A OD2   1 
ATOM   4511  N  N     . GLU A 1  593  ? -8.142  -27.974 68.973  1.00 95.21  ? 593  GLU A N     1 
ATOM   4512  C  CA    . GLU A 1  593  ? -8.741  -27.913 70.283  1.00 95.86  ? 593  GLU A CA    1 
ATOM   4513  C  C     . GLU A 1  593  ? -9.511  -29.202 70.535  1.00 95.87  ? 593  GLU A C     1 
ATOM   4514  O  O     . GLU A 1  593  ? -8.902  -30.214 70.875  1.00 95.99  ? 593  GLU A O     1 
ATOM   4515  C  CB    . GLU A 1  593  ? -9.609  -26.662 70.427  1.00 96.19  ? 593  GLU A CB    1 
ATOM   4516  C  CG    . GLU A 1  593  ? -8.799  -25.372 70.634  1.00 98.06  ? 593  GLU A CG    1 
ATOM   4517  C  CD    . GLU A 1  593  ? -7.925  -25.404 71.902  1.00 100.74 ? 593  GLU A CD    1 
ATOM   4518  O  OE1   . GLU A 1  593  ? -6.992  -26.248 71.969  1.00 101.14 ? 593  GLU A OE1   1 
ATOM   4519  O  OE2   . GLU A 1  593  ? -8.164  -24.574 72.820  1.00 101.97 ? 593  GLU A OE2   1 
ATOM   4520  N  N     . GLY A 1  594  ? -10.825 -29.195 70.328  1.00 95.94  ? 594  GLY A N     1 
ATOM   4521  C  CA    . GLY A 1  594  ? -11.650 -30.358 70.676  1.00 96.07  ? 594  GLY A CA    1 
ATOM   4522  C  C     . GLY A 1  594  ? -11.610 -31.586 69.763  1.00 96.09  ? 594  GLY A C     1 
ATOM   4523  O  O     . GLY A 1  594  ? -12.630 -32.278 69.635  1.00 96.28  ? 594  GLY A O     1 
ATOM   4524  N  N     . THR A 1  595  ? -10.447 -31.888 69.167  1.00 95.79  ? 595  THR A N     1 
ATOM   4525  C  CA    . THR A 1  595  ? -10.327 -32.930 68.112  1.00 95.46  ? 595  THR A CA    1 
ATOM   4526  C  C     . THR A 1  595  ? -10.191 -34.388 68.596  1.00 95.10  ? 595  THR A C     1 
ATOM   4527  O  O     . THR A 1  595  ? -9.117  -34.841 68.998  1.00 94.96  ? 595  THR A O     1 
ATOM   4528  C  CB    . THR A 1  595  ? -9.192  -32.611 67.120  1.00 95.45  ? 595  THR A CB    1 
ATOM   4529  O  OG1   . THR A 1  595  ? -9.150  -31.205 66.879  1.00 95.83  ? 595  THR A OG1   1 
ATOM   4530  C  CG2   . THR A 1  595  ? -9.417  -33.324 65.802  1.00 95.48  ? 595  THR A CG2   1 
ATOM   4531  N  N     . THR A 1  596  ? -11.291 -35.122 68.496  1.00 94.79  ? 596  THR A N     1 
ATOM   4532  C  CA    . THR A 1  596  ? -11.418 -36.415 69.135  1.00 94.79  ? 596  THR A CA    1 
ATOM   4533  C  C     . THR A 1  596  ? -11.875 -37.521 68.179  1.00 94.70  ? 596  THR A C     1 
ATOM   4534  O  O     . THR A 1  596  ? -12.898 -38.177 68.437  1.00 94.90  ? 596  THR A O     1 
ATOM   4535  C  CB    . THR A 1  596  ? -12.431 -36.343 70.315  1.00 94.97  ? 596  THR A CB    1 
ATOM   4536  O  OG1   . THR A 1  596  ? -13.771 -36.263 69.806  1.00 95.01  ? 596  THR A OG1   1 
ATOM   4537  C  CG2   . THR A 1  596  ? -12.151 -35.136 71.233  1.00 95.33  ? 596  THR A CG2   1 
ATOM   4538  N  N     . LEU A 1  597  ? -11.128 -37.731 67.086  1.00 94.35  ? 597  LEU A N     1 
ATOM   4539  C  CA    . LEU A 1  597  ? -11.405 -38.812 66.099  1.00 93.88  ? 597  LEU A CA    1 
ATOM   4540  C  C     . LEU A 1  597  ? -12.868 -38.834 65.611  1.00 93.67  ? 597  LEU A C     1 
ATOM   4541  O  O     . LEU A 1  597  ? -13.296 -39.759 64.905  1.00 93.50  ? 597  LEU A O     1 
ATOM   4542  C  CB    . LEU A 1  597  ? -10.996 -40.184 66.658  1.00 93.82  ? 597  LEU A CB    1 
ATOM   4543  C  CG    . LEU A 1  597  ? -9.685  -40.247 67.454  1.00 93.78  ? 597  LEU A CG    1 
ATOM   4544  C  CD1   . LEU A 1  597  ? -9.736  -41.317 68.561  1.00 93.38  ? 597  LEU A CD1   1 
ATOM   4545  C  CD2   . LEU A 1  597  ? -8.481  -40.431 66.526  1.00 93.55  ? 597  LEU A CD2   1 
ATOM   4546  N  N     . LEU A 1  598  ? -13.610 -37.801 66.019  1.00 93.45  ? 598  LEU A N     1 
ATOM   4547  C  CA    . LEU A 1  598  ? -15.002 -37.534 65.633  1.00 93.06  ? 598  LEU A CA    1 
ATOM   4548  C  C     . LEU A 1  598  ? -15.257 -36.017 65.454  1.00 92.79  ? 598  LEU A C     1 
ATOM   4549  O  O     . LEU A 1  598  ? -16.280 -35.609 64.891  1.00 92.77  ? 598  LEU A O     1 
ATOM   4550  C  CB    . LEU A 1  598  ? -15.975 -38.103 66.675  1.00 92.88  ? 598  LEU A CB    1 
ATOM   4551  C  CG    . LEU A 1  598  ? -16.497 -39.530 66.532  1.00 92.62  ? 598  LEU A CG    1 
ATOM   4552  C  CD1   . LEU A 1  598  ? -17.839 -39.634 67.251  1.00 92.58  ? 598  LEU A CD1   1 
ATOM   4553  C  CD2   . LEU A 1  598  ? -16.633 -39.951 65.070  1.00 92.08  ? 598  LEU A CD2   1 
ATOM   4554  N  N     . SER A 1  599  ? -14.315 -35.206 65.941  1.00 92.31  ? 599  SER A N     1 
ATOM   4555  C  CA    . SER A 1  599  ? -14.401 -33.746 65.936  1.00 91.90  ? 599  SER A CA    1 
ATOM   4556  C  C     . SER A 1  599  ? -15.826 -33.214 65.884  1.00 91.68  ? 599  SER A C     1 
ATOM   4557  O  O     . SER A 1  599  ? -16.327 -32.867 64.815  1.00 91.77  ? 599  SER A O     1 
ATOM   4558  C  CB    . SER A 1  599  ? -13.550 -33.144 64.809  1.00 92.03  ? 599  SER A CB    1 
ATOM   4559  O  OG    . SER A 1  599  ? -14.035 -33.493 63.523  1.00 91.76  ? 599  SER A OG    1 
ATOM   4560  N  N     . PRO A 1  600  ? -16.500 -33.174 67.039  1.00 91.50  ? 600  PRO A N     1 
ATOM   4561  C  CA    . PRO A 1  600  ? -17.772 -32.451 67.129  1.00 91.26  ? 600  PRO A CA    1 
ATOM   4562  C  C     . PRO A 1  600  ? -17.532 -30.924 67.121  1.00 90.78  ? 600  PRO A C     1 
ATOM   4563  O  O     . PRO A 1  600  ? -18.161 -30.154 67.864  1.00 90.48  ? 600  PRO A O     1 
ATOM   4564  C  CB    . PRO A 1  600  ? -18.380 -32.959 68.451  1.00 91.53  ? 600  PRO A CB    1 
ATOM   4565  C  CG    . PRO A 1  600  ? -17.509 -34.155 68.880  1.00 91.73  ? 600  PRO A CG    1 
ATOM   4566  C  CD    . PRO A 1  600  ? -16.154 -33.824 68.313  1.00 91.68  ? 600  PRO A CD    1 
ATOM   4567  N  N     . LYS A 1  601  ? -16.588 -30.525 66.274  1.00 90.16  ? 601  LYS A N     1 
ATOM   4568  C  CA    . LYS A 1  601  ? -16.346 -29.149 65.905  1.00 89.55  ? 601  LYS A CA    1 
ATOM   4569  C  C     . LYS A 1  601  ? -16.034 -29.137 64.412  1.00 88.96  ? 601  LYS A C     1 
ATOM   4570  O  O     . LYS A 1  601  ? -15.969 -28.081 63.783  1.00 88.66  ? 601  LYS A O     1 
ATOM   4571  C  CB    . LYS A 1  601  ? -15.182 -28.605 66.721  1.00 89.46  ? 601  LYS A CB    1 
ATOM   4572  C  CG    . LYS A 1  601  ? -15.603 -27.590 67.771  1.00 90.84  ? 601  LYS A CG    1 
ATOM   4573  C  CD    . LYS A 1  601  ? -15.035 -27.886 69.170  1.00 93.14  ? 601  LYS A CD    1 
ATOM   4574  C  CE    . LYS A 1  601  ? -16.074 -28.616 70.056  1.00 93.87  ? 601  LYS A CE    1 
ATOM   4575  N  NZ    . LYS A 1  601  ? -15.716 -28.683 71.512  1.00 93.65  ? 601  LYS A NZ    1 
ATOM   4576  N  N     . ASP A 1  602  ? -15.909 -30.345 63.856  1.00 88.58  ? 602  ASP A N     1 
ATOM   4577  C  CA    . ASP A 1  602  ? -15.181 -30.631 62.606  1.00 88.35  ? 602  ASP A CA    1 
ATOM   4578  C  C     . ASP A 1  602  ? -13.740 -30.088 62.732  1.00 88.15  ? 602  ASP A C     1 
ATOM   4579  O  O     . ASP A 1  602  ? -13.015 -30.000 61.743  1.00 88.34  ? 602  ASP A O     1 
ATOM   4580  C  CB    . ASP A 1  602  ? -15.923 -30.105 61.352  1.00 88.52  ? 602  ASP A CB    1 
ATOM   4581  C  CG    . ASP A 1  602  ? -16.104 -31.179 60.227  1.00 88.63  ? 602  ASP A CG    1 
ATOM   4582  O  OD1   . ASP A 1  602  ? -15.995 -32.405 60.484  1.00 88.97  ? 602  ASP A OD1   1 
ATOM   4583  O  OD2   . ASP A 1  602  ? -16.398 -30.778 59.071  1.00 87.44  ? 602  ASP A OD2   1 
ATOM   4584  N  N     . ASN A 1  603  ? -13.347 -29.738 63.968  1.00 87.70  ? 603  ASN A N     1 
ATOM   4585  C  CA    . ASN A 1  603  ? -11.988 -29.287 64.331  1.00 86.89  ? 603  ASN A CA    1 
ATOM   4586  C  C     . ASN A 1  603  ? -10.900 -30.234 63.841  1.00 86.02  ? 603  ASN A C     1 
ATOM   4587  O  O     . ASN A 1  603  ? -11.160 -31.402 63.551  1.00 86.08  ? 603  ASN A O     1 
ATOM   4588  C  CB    . ASN A 1  603  ? -11.866 -29.137 65.860  1.00 87.21  ? 603  ASN A CB    1 
ATOM   4589  C  CG    . ASN A 1  603  ? -11.657 -27.673 66.322  1.00 88.33  ? 603  ASN A CG    1 
ATOM   4590  O  OD1   . ASN A 1  603  ? -11.216 -26.810 65.550  1.00 89.28  ? 603  ASN A OD1   1 
ATOM   4591  N  ND2   . ASN A 1  603  ? -11.951 -27.407 67.606  1.00 89.09  ? 603  ASN A ND2   1 
ATOM   4592  N  N     . GLY A 1  604  ? -9.676  -29.734 63.755  1.00 84.94  ? 604  GLY A N     1 
ATOM   4593  C  CA    . GLY A 1  604  ? -8.567  -30.565 63.314  1.00 83.73  ? 604  GLY A CA    1 
ATOM   4594  C  C     . GLY A 1  604  ? -8.679  -30.929 61.852  1.00 82.87  ? 604  GLY A C     1 
ATOM   4595  O  O     . GLY A 1  604  ? -9.392  -30.269 61.104  1.00 82.65  ? 604  GLY A O     1 
ATOM   4596  N  N     . MET A 1  605  ? -7.968  -31.982 61.458  1.00 82.21  ? 605  MET A N     1 
ATOM   4597  C  CA    . MET A 1  605  ? -7.885  -32.422 60.057  1.00 82.01  ? 605  MET A CA    1 
ATOM   4598  C  C     . MET A 1  605  ? -7.322  -33.842 59.943  1.00 81.60  ? 605  MET A C     1 
ATOM   4599  O  O     . MET A 1  605  ? -6.312  -34.159 60.585  1.00 82.05  ? 605  MET A O     1 
ATOM   4600  C  CB    . MET A 1  605  ? -7.011  -31.454 59.214  1.00 81.93  ? 605  MET A CB    1 
ATOM   4601  C  CG    . MET A 1  605  ? -6.672  -31.946 57.770  1.00 81.58  ? 605  MET A CG    1 
ATOM   4602  S  SD    . MET A 1  605  ? -7.803  -31.465 56.424  1.00 79.74  ? 605  MET A SD    1 
ATOM   4603  C  CE    . MET A 1  605  ? -9.301  -32.382 56.754  1.00 78.79  ? 605  MET A CE    1 
ATOM   4604  N  N     . LEU A 1  606  ? -7.951  -34.680 59.116  1.00 80.60  ? 606  LEU A N     1 
ATOM   4605  C  CA    . LEU A 1  606  ? -7.367  -35.976 58.773  1.00 79.70  ? 606  LEU A CA    1 
ATOM   4606  C  C     . LEU A 1  606  ? -7.479  -36.334 57.290  1.00 79.17  ? 606  LEU A C     1 
ATOM   4607  O  O     . LEU A 1  606  ? -8.576  -36.481 56.752  1.00 79.13  ? 606  LEU A O     1 
ATOM   4608  C  CB    . LEU A 1  606  ? -7.944  -37.084 59.647  1.00 79.55  ? 606  LEU A CB    1 
ATOM   4609  C  CG    . LEU A 1  606  ? -7.579  -38.500 59.216  1.00 79.43  ? 606  LEU A CG    1 
ATOM   4610  C  CD1   . LEU A 1  606  ? -6.072  -38.739 59.336  1.00 79.93  ? 606  LEU A CD1   1 
ATOM   4611  C  CD2   . LEU A 1  606  ? -8.376  -39.511 60.016  1.00 79.29  ? 606  LEU A CD2   1 
ATOM   4612  N  N     . ILE A 1  607  ? -6.331  -36.495 56.641  1.00 78.51  ? 607  ILE A N     1 
ATOM   4613  C  CA    . ILE A 1  607  ? -6.300  -36.808 55.220  1.00 77.99  ? 607  ILE A CA    1 
ATOM   4614  C  C     . ILE A 1  607  ? -5.596  -38.132 54.998  1.00 77.81  ? 607  ILE A C     1 
ATOM   4615  O  O     . ILE A 1  607  ? -4.369  -38.201 55.098  1.00 77.59  ? 607  ILE A O     1 
ATOM   4616  C  CB    . ILE A 1  607  ? -5.603  -35.687 54.415  1.00 77.93  ? 607  ILE A CB    1 
ATOM   4617  C  CG1   . ILE A 1  607  ? -6.539  -34.490 54.248  1.00 77.72  ? 607  ILE A CG1   1 
ATOM   4618  C  CG2   . ILE A 1  607  ? -5.166  -36.173 53.045  1.00 77.93  ? 607  ILE A CG2   1 
ATOM   4619  C  CD1   . ILE A 1  607  ? -5.883  -33.283 53.619  1.00 77.26  ? 607  ILE A CD1   1 
ATOM   4620  N  N     . ILE A 1  608  ? -6.383  -39.175 54.710  1.00 77.67  ? 608  ILE A N     1 
ATOM   4621  C  CA    . ILE A 1  608  ? -5.855  -40.517 54.426  1.00 77.56  ? 608  ILE A CA    1 
ATOM   4622  C  C     . ILE A 1  608  ? -5.968  -40.815 52.947  1.00 77.78  ? 608  ILE A C     1 
ATOM   4623  O  O     . ILE A 1  608  ? -7.071  -40.886 52.408  1.00 77.79  ? 608  ILE A O     1 
ATOM   4624  C  CB    . ILE A 1  608  ? -6.580  -41.634 55.196  1.00 77.30  ? 608  ILE A CB    1 
ATOM   4625  C  CG1   . ILE A 1  608  ? -6.477  -41.443 56.716  1.00 77.70  ? 608  ILE A CG1   1 
ATOM   4626  C  CG2   . ILE A 1  608  ? -6.004  -42.972 54.805  1.00 77.26  ? 608  ILE A CG2   1 
ATOM   4627  C  CD1   . ILE A 1  608  ? -5.080  -41.716 57.344  1.00 78.47  ? 608  ILE A CD1   1 
ATOM   4628  N  N     . ASP A 1  609  ? -4.817  -40.990 52.302  1.00 78.22  ? 609  ASP A N     1 
ATOM   4629  C  CA    . ASP A 1  609  ? -4.717  -41.085 50.842  1.00 78.68  ? 609  ASP A CA    1 
ATOM   4630  C  C     . ASP A 1  609  ? -5.375  -39.860 50.169  1.00 78.78  ? 609  ASP A C     1 
ATOM   4631  O  O     . ASP A 1  609  ? -5.675  -38.865 50.832  1.00 78.90  ? 609  ASP A O     1 
ATOM   4632  C  CB    . ASP A 1  609  ? -5.315  -42.414 50.344  1.00 78.79  ? 609  ASP A CB    1 
ATOM   4633  C  CG    . ASP A 1  609  ? -4.605  -42.957 49.104  1.00 79.21  ? 609  ASP A CG    1 
ATOM   4634  O  OD1   . ASP A 1  609  ? -3.650  -42.308 48.625  1.00 79.60  ? 609  ASP A OD1   1 
ATOM   4635  O  OD2   . ASP A 1  609  ? -5.005  -44.037 48.607  1.00 79.19  ? 609  ASP A OD2   1 
ATOM   4636  N  N     . GLY A 1  610  ? -5.614  -39.927 48.864  1.00 78.84  ? 610  GLY A N     1 
ATOM   4637  C  CA    . GLY A 1  610  ? -6.261  -38.824 48.145  1.00 78.72  ? 610  GLY A CA    1 
ATOM   4638  C  C     . GLY A 1  610  ? -7.522  -38.257 48.779  1.00 78.51  ? 610  GLY A C     1 
ATOM   4639  O  O     . GLY A 1  610  ? -7.999  -37.191 48.387  1.00 78.57  ? 610  GLY A O     1 
ATOM   4640  N  N     . GLN A 1  611  ? -8.051  -38.961 49.773  1.00 78.12  ? 611  GLN A N     1 
ATOM   4641  C  CA    . GLN A 1  611  ? -9.347  -38.630 50.318  1.00 77.77  ? 611  GLN A CA    1 
ATOM   4642  C  C     . GLN A 1  611  ? -9.209  -37.941 51.654  1.00 77.13  ? 611  GLN A C     1 
ATOM   4643  O  O     . GLN A 1  611  ? -8.369  -38.313 52.474  1.00 77.00  ? 611  GLN A O     1 
ATOM   4644  C  CB    . GLN A 1  611  ? -10.209 -39.889 50.453  1.00 77.99  ? 611  GLN A CB    1 
ATOM   4645  C  CG    . GLN A 1  611  ? -10.550 -40.588 49.127  1.00 79.93  ? 611  GLN A CG    1 
ATOM   4646  C  CD    . GLN A 1  611  ? -11.662 -39.892 48.323  1.00 82.87  ? 611  GLN A CD    1 
ATOM   4647  O  OE1   . GLN A 1  611  ? -12.863 -40.069 48.597  1.00 84.34  ? 611  GLN A OE1   1 
ATOM   4648  N  NE2   . GLN A 1  611  ? -11.264 -39.125 47.306  1.00 83.76  ? 611  GLN A NE2   1 
ATOM   4649  N  N     . ILE A 1  612  ? -10.037 -36.922 51.853  1.00 76.54  ? 612  ILE A N     1 
ATOM   4650  C  CA    . ILE A 1  612  ? -10.173 -36.283 53.156  1.00 75.88  ? 612  ILE A CA    1 
ATOM   4651  C  C     . ILE A 1  612  ? -11.261 -37.006 53.943  1.00 75.56  ? 612  ILE A C     1 
ATOM   4652  O  O     . ILE A 1  612  ? -12.355 -37.286 53.429  1.00 75.66  ? 612  ILE A O     1 
ATOM   4653  C  CB    . ILE A 1  612  ? -10.428 -34.744 53.064  1.00 75.84  ? 612  ILE A CB    1 
ATOM   4654  C  CG1   . ILE A 1  612  ? -11.889 -34.377 53.314  1.00 75.11  ? 612  ILE A CG1   1 
ATOM   4655  C  CG2   . ILE A 1  612  ? -9.913  -34.161 51.730  1.00 76.14  ? 612  ILE A CG2   1 
ATOM   4656  C  CD1   . ILE A 1  612  ? -12.027 -33.031 53.937  1.00 74.02  ? 612  ILE A CD1   1 
ATOM   4657  N  N     . ILE A 1  613  ? -10.938 -37.326 55.188  1.00 74.97  ? 613  ILE A N     1 
ATOM   4658  C  CA    . ILE A 1  613  ? -11.763 -38.204 55.996  1.00 74.34  ? 613  ILE A CA    1 
ATOM   4659  C  C     . ILE A 1  613  ? -12.630 -37.402 56.967  1.00 74.20  ? 613  ILE A C     1 
ATOM   4660  O  O     . ILE A 1  613  ? -13.811 -37.700 57.132  1.00 74.40  ? 613  ILE A O     1 
ATOM   4661  C  CB    . ILE A 1  613  ? -10.881 -39.226 56.743  1.00 74.24  ? 613  ILE A CB    1 
ATOM   4662  C  CG1   . ILE A 1  613  ? -9.987  -40.003 55.763  1.00 73.56  ? 613  ILE A CG1   1 
ATOM   4663  C  CG2   . ILE A 1  613  ? -11.711 -40.143 57.616  1.00 74.54  ? 613  ILE A CG2   1 
ATOM   4664  C  CD1   . ILE A 1  613  ? -10.684 -41.040 54.937  1.00 72.54  ? 613  ILE A CD1   1 
ATOM   4665  N  N     . PHE A 1  614  ? -12.043 -36.396 57.611  1.00 73.82  ? 614  PHE A N     1 
ATOM   4666  C  CA    . PHE A 1  614  ? -12.801 -35.463 58.446  1.00 73.78  ? 614  PHE A CA    1 
ATOM   4667  C  C     . PHE A 1  614  ? -11.991 -34.197 58.705  1.00 73.27  ? 614  PHE A C     1 
ATOM   4668  O  O     . PHE A 1  614  ? -10.761 -34.229 58.721  1.00 73.24  ? 614  PHE A O     1 
ATOM   4669  C  CB    . PHE A 1  614  ? -13.283 -36.124 59.765  1.00 74.33  ? 614  PHE A CB    1 
ATOM   4670  C  CG    . PHE A 1  614  ? -12.283 -36.049 60.911  1.00 75.63  ? 614  PHE A CG    1 
ATOM   4671  C  CD1   . PHE A 1  614  ? -12.482 -35.164 61.978  1.00 75.85  ? 614  PHE A CD1   1 
ATOM   4672  C  CD2   . PHE A 1  614  ? -11.147 -36.868 60.928  1.00 76.64  ? 614  PHE A CD2   1 
ATOM   4673  C  CE1   . PHE A 1  614  ? -11.564 -35.088 63.029  1.00 75.50  ? 614  PHE A CE1   1 
ATOM   4674  C  CE2   . PHE A 1  614  ? -10.221 -36.792 61.981  1.00 76.25  ? 614  PHE A CE2   1 
ATOM   4675  C  CZ    . PHE A 1  614  ? -10.434 -35.901 63.029  1.00 75.69  ? 614  PHE A CZ    1 
ATOM   4676  N  N     . GLY A 1  615  ? -12.688 -33.086 58.909  1.00 72.79  ? 615  GLY A N     1 
ATOM   4677  C  CA    . GLY A 1  615  ? -12.040 -31.823 59.202  1.00 72.23  ? 615  GLY A CA    1 
ATOM   4678  C  C     . GLY A 1  615  ? -12.539 -30.786 58.238  1.00 71.89  ? 615  GLY A C     1 
ATOM   4679  O  O     . GLY A 1  615  ? -13.152 -31.132 57.242  1.00 71.67  ? 615  GLY A O     1 
ATOM   4680  N  N     . VAL A 1  616  ? -12.288 -29.517 58.549  1.00 71.99  ? 616  VAL A N     1 
ATOM   4681  C  CA    . VAL A 1  616  ? -12.677 -28.389 57.702  1.00 72.05  ? 616  VAL A CA    1 
ATOM   4682  C  C     . VAL A 1  616  ? -11.415 -27.713 57.133  1.00 72.38  ? 616  VAL A C     1 
ATOM   4683  O  O     . VAL A 1  616  ? -10.570 -27.217 57.890  1.00 72.60  ? 616  VAL A O     1 
ATOM   4684  C  CB    . VAL A 1  616  ? -13.615 -27.398 58.467  1.00 71.74  ? 616  VAL A CB    1 
ATOM   4685  C  CG1   . VAL A 1  616  ? -13.636 -26.047 57.823  1.00 72.06  ? 616  VAL A CG1   1 
ATOM   4686  C  CG2   . VAL A 1  616  ? -15.029 -27.934 58.521  1.00 71.87  ? 616  VAL A CG2   1 
ATOM   4687  N  N     . VAL A 1  617  ? -11.289 -27.713 55.805  1.00 72.59  ? 617  VAL A N     1 
ATOM   4688  C  CA    . VAL A 1  617  ? -10.096 -27.205 55.141  1.00 73.18  ? 617  VAL A CA    1 
ATOM   4689  C  C     . VAL A 1  617  ? -9.993  -25.677 55.131  1.00 73.97  ? 617  VAL A C     1 
ATOM   4690  O  O     . VAL A 1  617  ? -10.896 -24.981 54.625  1.00 73.79  ? 617  VAL A O     1 
ATOM   4691  C  CB    . VAL A 1  617  ? -9.985  -27.672 53.694  1.00 73.12  ? 617  VAL A CB    1 
ATOM   4692  C  CG1   . VAL A 1  617  ? -8.538  -27.455 53.189  1.00 72.97  ? 617  VAL A CG1   1 
ATOM   4693  C  CG2   . VAL A 1  617  ? -10.390 -29.106 53.573  1.00 72.68  ? 617  VAL A CG2   1 
ATOM   4694  N  N     . GLU A 1  618  ? -8.865  -25.191 55.676  1.00 74.68  ? 618  GLU A N     1 
ATOM   4695  C  CA    . GLU A 1  618  ? -8.483  -23.766 55.719  1.00 75.14  ? 618  GLU A CA    1 
ATOM   4696  C  C     . GLU A 1  618  ? -6.967  -23.579 55.847  1.00 75.05  ? 618  GLU A C     1 
ATOM   4697  O  O     . GLU A 1  618  ? -6.204  -24.520 55.613  1.00 75.16  ? 618  GLU A O     1 
ATOM   4698  C  CB    . GLU A 1  618  ? -9.223  -23.001 56.839  1.00 75.47  ? 618  GLU A CB    1 
ATOM   4699  C  CG    . GLU A 1  618  ? -8.947  -23.478 58.276  1.00 76.54  ? 618  GLU A CG    1 
ATOM   4700  C  CD    . GLU A 1  618  ? -7.550  -23.103 58.763  1.00 76.90  ? 618  GLU A CD    1 
ATOM   4701  O  OE1   . GLU A 1  618  ? -7.331  -21.935 59.171  1.00 75.20  ? 618  GLU A OE1   1 
ATOM   4702  O  OE2   . GLU A 1  618  ? -6.671  -23.993 58.714  1.00 77.43  ? 618  GLU A OE2   1 
ATOM   4703  N  N     . LYS A 1  619  ? -6.565  -22.365 56.248  1.00 75.07  ? 619  LYS A N     1 
ATOM   4704  C  CA    . LYS A 1  619  ? -5.155  -21.903 56.332  1.00 74.84  ? 619  LYS A CA    1 
ATOM   4705  C  C     . LYS A 1  619  ? -4.142  -22.912 56.850  1.00 74.74  ? 619  LYS A C     1 
ATOM   4706  O  O     . LYS A 1  619  ? -3.233  -23.267 56.131  1.00 74.26  ? 619  LYS A O     1 
ATOM   4707  C  CB    . LYS A 1  619  ? -5.048  -20.603 57.154  1.00 74.92  ? 619  LYS A CB    1 
ATOM   4708  C  CG    . LYS A 1  619  ? -3.621  -20.154 57.483  1.00 74.29  ? 619  LYS A CG    1 
ATOM   4709  C  CD    . LYS A 1  619  ? -3.190  -18.937 56.683  1.00 72.93  ? 619  LYS A CD    1 
ATOM   4710  C  CE    . LYS A 1  619  ? -3.025  -17.743 57.590  1.00 71.49  ? 619  LYS A CE    1 
ATOM   4711  N  NZ    . LYS A 1  619  ? -2.578  -16.557 56.830  1.00 69.90  ? 619  LYS A NZ    1 
ATOM   4712  N  N     . LYS A 1  620  ? -4.292  -23.355 58.094  1.00 75.27  ? 620  LYS A N     1 
ATOM   4713  C  CA    . LYS A 1  620  ? -3.328  -24.283 58.704  1.00 75.90  ? 620  LYS A CA    1 
ATOM   4714  C  C     . LYS A 1  620  ? -2.920  -25.382 57.720  1.00 75.77  ? 620  LYS A C     1 
ATOM   4715  O  O     . LYS A 1  620  ? -1.725  -25.674 57.552  1.00 75.86  ? 620  LYS A O     1 
ATOM   4716  C  CB    . LYS A 1  620  ? -3.873  -24.894 60.013  1.00 76.26  ? 620  LYS A CB    1 
ATOM   4717  C  CG    . LYS A 1  620  ? -3.982  -23.916 61.193  1.00 77.49  ? 620  LYS A CG    1 
ATOM   4718  C  CD    . LYS A 1  620  ? -4.995  -24.411 62.223  1.00 80.01  ? 620  LYS A CD    1 
ATOM   4719  C  CE    . LYS A 1  620  ? -5.407  -23.287 63.185  1.00 82.21  ? 620  LYS A CE    1 
ATOM   4720  N  NZ    . LYS A 1  620  ? -6.513  -23.675 64.138  1.00 83.25  ? 620  LYS A NZ    1 
ATOM   4721  N  N     . THR A 1  621  ? -3.923  -25.952 57.053  1.00 75.61  ? 621  THR A N     1 
ATOM   4722  C  CA    . THR A 1  621  ? -3.744  -27.039 56.088  1.00 75.34  ? 621  THR A CA    1 
ATOM   4723  C  C     . THR A 1  621  ? -3.123  -26.559 54.775  1.00 75.17  ? 621  THR A C     1 
ATOM   4724  O  O     . THR A 1  621  ? -2.043  -26.999 54.376  1.00 74.69  ? 621  THR A O     1 
ATOM   4725  C  CB    . THR A 1  621  ? -5.106  -27.659 55.776  1.00 75.31  ? 621  THR A CB    1 
ATOM   4726  O  OG1   . THR A 1  621  ? -5.967  -27.461 56.906  1.00 75.75  ? 621  THR A OG1   1 
ATOM   4727  C  CG2   . THR A 1  621  ? -4.973  -29.139 55.448  1.00 74.82  ? 621  THR A CG2   1 
ATOM   4728  N  N     . VAL A 1  622  ? -3.815  -25.640 54.115  1.00 75.24  ? 622  VAL A N     1 
ATOM   4729  C  CA    . VAL A 1  622  ? -3.446  -25.250 52.777  1.00 75.51  ? 622  VAL A CA    1 
ATOM   4730  C  C     . VAL A 1  622  ? -2.561  -23.998 52.735  1.00 76.46  ? 622  VAL A C     1 
ATOM   4731  O  O     . VAL A 1  622  ? -1.873  -23.765 51.732  1.00 77.20  ? 622  VAL A O     1 
ATOM   4732  C  CB    . VAL A 1  622  ? -4.688  -25.103 51.889  1.00 75.19  ? 622  VAL A CB    1 
ATOM   4733  C  CG1   . VAL A 1  622  ? -5.301  -23.731 52.039  1.00 75.21  ? 622  VAL A CG1   1 
ATOM   4734  C  CG2   . VAL A 1  622  ? -4.350  -25.409 50.443  1.00 74.32  ? 622  VAL A CG2   1 
ATOM   4735  N  N     . GLY A 1  623  ? -2.563  -23.192 53.803  1.00 76.96  ? 623  GLY A N     1 
ATOM   4736  C  CA    . GLY A 1  623  ? -1.653  -22.024 53.904  1.00 77.08  ? 623  GLY A CA    1 
ATOM   4737  C  C     . GLY A 1  623  ? -0.218  -22.474 53.708  1.00 77.18  ? 623  GLY A C     1 
ATOM   4738  O  O     . GLY A 1  623  ? 0.069   -23.678 53.745  1.00 77.28  ? 623  GLY A O     1 
ATOM   4739  N  N     . SER A 1  624  ? 0.697   -21.535 53.485  1.00 77.31  ? 624  SER A N     1 
ATOM   4740  C  CA    . SER A 1  624  ? 2.098   -21.930 53.254  1.00 76.96  ? 624  SER A CA    1 
ATOM   4741  C  C     . SER A 1  624  ? 2.737   -22.463 54.549  1.00 77.06  ? 624  SER A C     1 
ATOM   4742  O  O     . SER A 1  624  ? 3.961   -22.514 54.683  1.00 77.03  ? 624  SER A O     1 
ATOM   4743  C  CB    . SER A 1  624  ? 2.918   -20.816 52.579  1.00 76.65  ? 624  SER A CB    1 
ATOM   4744  O  OG    . SER A 1  624  ? 2.868   -19.601 53.300  1.00 75.52  ? 624  SER A OG    1 
ATOM   4745  N  N     . SER A 1  625  ? 1.867   -22.889 55.471  1.00 77.02  ? 625  SER A N     1 
ATOM   4746  C  CA    . SER A 1  625  ? 2.225   -23.498 56.756  1.00 77.04  ? 625  SER A CA    1 
ATOM   4747  C  C     . SER A 1  625  ? 3.242   -24.646 56.693  1.00 77.10  ? 625  SER A C     1 
ATOM   4748  O  O     . SER A 1  625  ? 3.528   -25.204 55.632  1.00 76.87  ? 625  SER A O     1 
ATOM   4749  C  CB    . SER A 1  625  ? 0.961   -23.989 57.464  1.00 76.75  ? 625  SER A CB    1 
ATOM   4750  O  OG    . SER A 1  625  ? -0.094  -23.081 57.235  1.00 76.64  ? 625  SER A OG    1 
ATOM   4751  N  N     . ASN A 1  626  ? 3.758   -24.981 57.871  1.00 77.19  ? 626  ASN A N     1 
ATOM   4752  C  CA    . ASN A 1  626  ? 4.759   -26.011 58.093  1.00 77.21  ? 626  ASN A CA    1 
ATOM   4753  C  C     . ASN A 1  626  ? 4.165   -27.427 57.988  1.00 76.61  ? 626  ASN A C     1 
ATOM   4754  O  O     . ASN A 1  626  ? 4.597   -28.258 57.168  1.00 76.12  ? 626  ASN A O     1 
ATOM   4755  C  CB    . ASN A 1  626  ? 5.306   -25.781 59.506  1.00 77.95  ? 626  ASN A CB    1 
ATOM   4756  C  CG    . ASN A 1  626  ? 6.702   -26.358 59.727  1.00 80.29  ? 626  ASN A CG    1 
ATOM   4757  O  OD1   . ASN A 1  626  ? 7.054   -27.425 59.210  1.00 83.17  ? 626  ASN A OD1   1 
ATOM   4758  N  ND2   . ASN A 1  626  ? 7.504   -25.650 60.535  1.00 82.64  ? 626  ASN A ND2   1 
ATOM   4759  N  N     . GLY A 1  627  ? 3.162   -27.687 58.831  1.00 76.19  ? 627  GLY A N     1 
ATOM   4760  C  CA    . GLY A 1  627  ? 2.568   -29.024 58.965  1.00 75.34  ? 627  GLY A CA    1 
ATOM   4761  C  C     . GLY A 1  627  ? 1.482   -29.313 57.959  1.00 74.52  ? 627  GLY A C     1 
ATOM   4762  O  O     . GLY A 1  627  ? 0.820   -30.344 58.032  1.00 74.47  ? 627  GLY A O     1 
ATOM   4763  N  N     . GLY A 1  628  ? 1.326   -28.390 57.013  1.00 73.95  ? 628  GLY A N     1 
ATOM   4764  C  CA    . GLY A 1  628  ? 0.278   -28.428 55.998  1.00 72.58  ? 628  GLY A CA    1 
ATOM   4765  C  C     . GLY A 1  628  ? 0.605   -29.174 54.718  1.00 71.48  ? 628  GLY A C     1 
ATOM   4766  O  O     . GLY A 1  628  ? 1.659   -29.810 54.592  1.00 71.21  ? 628  GLY A O     1 
ATOM   4767  N  N     . LEU A 1  629  ? -0.314  -29.058 53.763  1.00 70.50  ? 629  LEU A N     1 
ATOM   4768  C  CA    . LEU A 1  629  ? -0.395  -29.967 52.631  1.00 69.38  ? 629  LEU A CA    1 
ATOM   4769  C  C     . LEU A 1  629  ? 0.683   -29.700 51.624  1.00 69.35  ? 629  LEU A C     1 
ATOM   4770  O  O     . LEU A 1  629  ? 1.270   -30.642 51.110  1.00 69.56  ? 629  LEU A O     1 
ATOM   4771  C  CB    . LEU A 1  629  ? -1.765  -29.883 51.953  1.00 68.80  ? 629  LEU A CB    1 
ATOM   4772  C  CG    . LEU A 1  629  ? -2.245  -31.043 51.090  1.00 67.00  ? 629  LEU A CG    1 
ATOM   4773  C  CD1   . LEU A 1  629  ? -3.745  -30.973 50.985  1.00 66.31  ? 629  LEU A CD1   1 
ATOM   4774  C  CD2   . LEU A 1  629  ? -1.637  -30.993 49.725  1.00 64.70  ? 629  LEU A CD2   1 
ATOM   4775  N  N     . ILE A 1  630  ? 0.947   -28.428 51.331  1.00 69.12  ? 630  ILE A N     1 
ATOM   4776  C  CA    . ILE A 1  630  ? 1.861   -28.122 50.242  1.00 68.81  ? 630  ILE A CA    1 
ATOM   4777  C  C     . ILE A 1  630  ? 3.220   -28.672 50.622  1.00 69.00  ? 630  ILE A C     1 
ATOM   4778  O  O     . ILE A 1  630  ? 3.799   -29.471 49.878  1.00 68.93  ? 630  ILE A O     1 
ATOM   4779  C  CB    . ILE A 1  630  ? 1.910   -26.635 49.862  1.00 68.65  ? 630  ILE A CB    1 
ATOM   4780  C  CG1   . ILE A 1  630  ? 0.504   -26.054 49.763  1.00 67.74  ? 630  ILE A CG1   1 
ATOM   4781  C  CG2   . ILE A 1  630  ? 2.610   -26.453 48.525  1.00 68.75  ? 630  ILE A CG2   1 
ATOM   4782  C  CD1   . ILE A 1  630  ? 0.110   -25.374 51.006  1.00 66.68  ? 630  ILE A CD1   1 
ATOM   4783  N  N     . HIS A 1  631  ? 3.693   -28.297 51.806  1.00 69.23  ? 631  HIS A N     1 
ATOM   4784  C  CA    . HIS A 1  631  ? 4.919   -28.871 52.342  1.00 69.66  ? 631  HIS A CA    1 
ATOM   4785  C  C     . HIS A 1  631  ? 4.988   -30.354 52.020  1.00 69.40  ? 631  HIS A C     1 
ATOM   4786  O  O     . HIS A 1  631  ? 5.979   -30.829 51.468  1.00 69.56  ? 631  HIS A O     1 
ATOM   4787  C  CB    . HIS A 1  631  ? 4.971   -28.708 53.856  1.00 70.18  ? 631  HIS A CB    1 
ATOM   4788  C  CG    . HIS A 1  631  ? 6.360   -28.710 54.412  1.00 71.60  ? 631  HIS A CG    1 
ATOM   4789  N  ND1   . HIS A 1  631  ? 7.339   -29.572 53.965  1.00 72.67  ? 631  HIS A ND1   1 
ATOM   4790  C  CD2   . HIS A 1  631  ? 6.937   -27.946 55.371  1.00 72.44  ? 631  HIS A CD2   1 
ATOM   4791  C  CE1   . HIS A 1  631  ? 8.458   -29.338 54.628  1.00 73.55  ? 631  HIS A CE1   1 
ATOM   4792  N  NE2   . HIS A 1  631  ? 8.240   -28.357 55.487  1.00 72.78  ? 631  HIS A NE2   1 
ATOM   4793  N  N     . VAL A 1  632  ? 3.907   -31.057 52.351  1.00 69.20  ? 632  VAL A N     1 
ATOM   4794  C  CA    . VAL A 1  632  ? 3.823   -32.516 52.277  1.00 69.15  ? 632  VAL A CA    1 
ATOM   4795  C  C     . VAL A 1  632  ? 3.900   -33.051 50.841  1.00 69.41  ? 632  VAL A C     1 
ATOM   4796  O  O     . VAL A 1  632  ? 4.708   -33.940 50.555  1.00 69.25  ? 632  VAL A O     1 
ATOM   4797  C  CB    . VAL A 1  632  ? 2.544   -33.054 53.013  1.00 68.89  ? 632  VAL A CB    1 
ATOM   4798  C  CG1   . VAL A 1  632  ? 2.463   -34.564 52.950  1.00 68.35  ? 632  VAL A CG1   1 
ATOM   4799  C  CG2   . VAL A 1  632  ? 2.539   -32.610 54.455  1.00 68.59  ? 632  VAL A CG2   1 
ATOM   4800  N  N     . VAL A 1  633  ? 3.070   -32.495 49.952  1.00 69.80  ? 633  VAL A N     1 
ATOM   4801  C  CA    . VAL A 1  633  ? 2.919   -33.000 48.570  1.00 69.85  ? 633  VAL A CA    1 
ATOM   4802  C  C     . VAL A 1  633  ? 4.167   -32.737 47.738  1.00 70.05  ? 633  VAL A C     1 
ATOM   4803  O  O     . VAL A 1  633  ? 4.449   -33.476 46.788  1.00 70.13  ? 633  VAL A O     1 
ATOM   4804  C  CB    . VAL A 1  633  ? 1.635   -32.457 47.849  1.00 69.75  ? 633  VAL A CB    1 
ATOM   4805  C  CG1   . VAL A 1  633  ? 1.709   -32.662 46.331  1.00 69.56  ? 633  VAL A CG1   1 
ATOM   4806  C  CG2   . VAL A 1  633  ? 0.392   -33.126 48.397  1.00 68.98  ? 633  VAL A CG2   1 
ATOM   4807  N  N     . THR A 1  634  ? 4.913   -31.696 48.100  1.00 70.15  ? 634  THR A N     1 
ATOM   4808  C  CA    . THR A 1  634  ? 6.187   -31.461 47.461  1.00 70.34  ? 634  THR A CA    1 
ATOM   4809  C  C     . THR A 1  634  ? 7.137   -32.593 47.824  1.00 71.12  ? 634  THR A C     1 
ATOM   4810  O  O     . THR A 1  634  ? 7.501   -33.389 46.952  1.00 71.37  ? 634  THR A O     1 
ATOM   4811  C  CB    . THR A 1  634  ? 6.806   -30.140 47.854  1.00 70.04  ? 634  THR A CB    1 
ATOM   4812  O  OG1   . THR A 1  634  ? 5.774   -29.197 48.141  1.00 69.11  ? 634  THR A OG1   1 
ATOM   4813  C  CG2   . THR A 1  634  ? 7.680   -29.638 46.717  1.00 69.80  ? 634  THR A CG2   1 
ATOM   4814  N  N     . ARG A 1  635  ? 7.509   -32.683 49.104  1.00 71.67  ? 635  ARG A N     1 
ATOM   4815  C  CA    . ARG A 1  635  ? 8.493   -33.670 49.561  1.00 72.27  ? 635  ARG A CA    1 
ATOM   4816  C  C     . ARG A 1  635  ? 8.090   -35.077 49.170  1.00 72.61  ? 635  ARG A C     1 
ATOM   4817  O  O     . ARG A 1  635  ? 8.926   -35.933 48.898  1.00 72.69  ? 635  ARG A O     1 
ATOM   4818  C  CB    . ARG A 1  635  ? 8.674   -33.590 51.071  1.00 72.30  ? 635  ARG A CB    1 
ATOM   4819  C  CG    . ARG A 1  635  ? 9.596   -32.481 51.495  1.00 73.33  ? 635  ARG A CG    1 
ATOM   4820  C  CD    . ARG A 1  635  ? 11.051  -32.866 51.252  1.00 74.98  ? 635  ARG A CD    1 
ATOM   4821  N  NE    . ARG A 1  635  ? 11.914  -31.689 51.194  1.00 74.81  ? 635  ARG A NE    1 
ATOM   4822  C  CZ    . ARG A 1  635  ? 12.394  -31.167 50.072  1.00 74.49  ? 635  ARG A CZ    1 
ATOM   4823  N  NH1   . ARG A 1  635  ? 12.104  -31.727 48.897  1.00 74.11  ? 635  ARG A NH1   1 
ATOM   4824  N  NH2   . ARG A 1  635  ? 13.162  -30.080 50.134  1.00 74.25  ? 635  ARG A NH2   1 
ATOM   4825  N  N     . GLU A 1  636  ? 6.789   -35.297 49.122  1.00 73.12  ? 636  GLU A N     1 
ATOM   4826  C  CA    . GLU A 1  636  ? 6.261   -36.604 48.835  1.00 73.66  ? 636  GLU A CA    1 
ATOM   4827  C  C     . GLU A 1  636  ? 6.407   -36.954 47.374  1.00 73.20  ? 636  GLU A C     1 
ATOM   4828  O  O     . GLU A 1  636  ? 7.100   -37.908 47.051  1.00 73.18  ? 636  GLU A O     1 
ATOM   4829  C  CB    . GLU A 1  636  ? 4.785   -36.658 49.220  1.00 74.31  ? 636  GLU A CB    1 
ATOM   4830  C  CG    . GLU A 1  636  ? 4.339   -38.007 49.733  1.00 76.73  ? 636  GLU A CG    1 
ATOM   4831  C  CD    . GLU A 1  636  ? 4.812   -38.282 51.158  1.00 80.26  ? 636  GLU A CD    1 
ATOM   4832  O  OE1   . GLU A 1  636  ? 4.473   -39.378 51.664  1.00 82.51  ? 636  GLU A OE1   1 
ATOM   4833  O  OE2   . GLU A 1  636  ? 5.505   -37.419 51.770  1.00 80.49  ? 636  GLU A OE2   1 
ATOM   4834  N  N     . LYS A 1  637  ? 5.778   -36.151 46.510  1.00 72.88  ? 637  LYS A N     1 
ATOM   4835  C  CA    . LYS A 1  637  ? 5.475   -36.527 45.121  1.00 72.50  ? 637  LYS A CA    1 
ATOM   4836  C  C     . LYS A 1  637  ? 6.291   -35.814 44.036  1.00 72.12  ? 637  LYS A C     1 
ATOM   4837  O  O     . LYS A 1  637  ? 6.440   -36.311 42.926  1.00 71.68  ? 637  LYS A O     1 
ATOM   4838  C  CB    . LYS A 1  637  ? 3.975   -36.347 44.851  1.00 72.38  ? 637  LYS A CB    1 
ATOM   4839  C  CG    . LYS A 1  637  ? 3.088   -37.213 45.731  1.00 72.99  ? 637  LYS A CG    1 
ATOM   4840  C  CD    . LYS A 1  637  ? 1.792   -37.657 45.020  1.00 74.79  ? 637  LYS A CD    1 
ATOM   4841  C  CE    . LYS A 1  637  ? 1.842   -39.120 44.483  1.00 75.07  ? 637  LYS A CE    1 
ATOM   4842  N  NZ    . LYS A 1  637  ? 0.489   -39.701 44.138  1.00 73.68  ? 637  LYS A NZ    1 
ATOM   4843  N  N     . GLY A 1  638  ? 6.813   -34.647 44.365  1.00 72.13  ? 638  GLY A N     1 
ATOM   4844  C  CA    . GLY A 1  638  ? 7.530   -33.834 43.395  1.00 72.58  ? 638  GLY A CA    1 
ATOM   4845  C  C     . GLY A 1  638  ? 7.259   -32.349 43.593  1.00 72.67  ? 638  GLY A C     1 
ATOM   4846  O  O     . GLY A 1  638  ? 6.222   -31.968 44.141  1.00 73.05  ? 638  GLY A O     1 
ATOM   4847  N  N     . PRO A 1  639  ? 8.198   -31.487 43.176  1.00 72.34  ? 639  PRO A N     1 
ATOM   4848  C  CA    . PRO A 1  639  ? 7.767   -30.116 43.123  1.00 72.22  ? 639  PRO A CA    1 
ATOM   4849  C  C     . PRO A 1  639  ? 6.618   -30.048 42.113  1.00 72.53  ? 639  PRO A C     1 
ATOM   4850  O  O     . PRO A 1  639  ? 5.507   -29.655 42.460  1.00 72.38  ? 639  PRO A O     1 
ATOM   4851  C  CB    . PRO A 1  639  ? 9.008   -29.395 42.616  1.00 72.09  ? 639  PRO A CB    1 
ATOM   4852  C  CG    . PRO A 1  639  ? 9.829   -30.441 41.978  1.00 71.74  ? 639  PRO A CG    1 
ATOM   4853  C  CD    . PRO A 1  639  ? 9.595   -31.649 42.754  1.00 72.09  ? 639  PRO A CD    1 
ATOM   4854  N  N     . GLN A 1  640  ? 6.899   -30.489 40.889  1.00 72.75  ? 640  GLN A N     1 
ATOM   4855  C  CA    . GLN A 1  640  ? 5.933   -30.606 39.799  1.00 72.94  ? 640  GLN A CA    1 
ATOM   4856  C  C     . GLN A 1  640  ? 4.527   -31.000 40.206  1.00 72.62  ? 640  GLN A C     1 
ATOM   4857  O  O     . GLN A 1  640  ? 3.590   -30.238 40.036  1.00 72.89  ? 640  GLN A O     1 
ATOM   4858  C  CB    . GLN A 1  640  ? 6.454   -31.640 38.825  1.00 73.22  ? 640  GLN A CB    1 
ATOM   4859  C  CG    . GLN A 1  640  ? 7.816   -31.295 38.334  1.00 75.12  ? 640  GLN A CG    1 
ATOM   4860  C  CD    . GLN A 1  640  ? 7.761   -30.129 37.382  1.00 78.33  ? 640  GLN A CD    1 
ATOM   4861  O  OE1   . GLN A 1  640  ? 6.737   -29.913 36.703  1.00 78.79  ? 640  GLN A OE1   1 
ATOM   4862  N  NE2   . GLN A 1  640  ? 8.859   -29.361 37.313  1.00 79.94  ? 640  GLN A NE2   1 
ATOM   4863  N  N     . VAL A 1  641  ? 4.387   -32.207 40.727  1.00 72.26  ? 641  VAL A N     1 
ATOM   4864  C  CA    . VAL A 1  641  ? 3.102   -32.736 41.154  1.00 72.16  ? 641  VAL A CA    1 
ATOM   4865  C  C     . VAL A 1  641  ? 2.443   -31.818 42.155  1.00 71.43  ? 641  VAL A C     1 
ATOM   4866  O  O     . VAL A 1  641  ? 1.218   -31.816 42.310  1.00 71.27  ? 641  VAL A O     1 
ATOM   4867  C  CB    . VAL A 1  641  ? 3.314   -34.051 41.885  1.00 72.78  ? 641  VAL A CB    1 
ATOM   4868  C  CG1   . VAL A 1  641  ? 1.959   -34.786 42.112  1.00 73.26  ? 641  VAL A CG1   1 
ATOM   4869  C  CG2   . VAL A 1  641  ? 4.370   -34.908 41.141  1.00 73.50  ? 641  VAL A CG2   1 
ATOM   4870  N  N     . CYS A 1  642  ? 3.290   -31.072 42.853  1.00 70.70  ? 642  CYS A N     1 
ATOM   4871  C  CA    . CYS A 1  642  ? 2.875   -30.155 43.884  1.00 69.72  ? 642  CYS A CA    1 
ATOM   4872  C  C     . CYS A 1  642  ? 2.499   -28.816 43.260  1.00 68.73  ? 642  CYS A C     1 
ATOM   4873  O  O     . CYS A 1  642  ? 1.548   -28.177 43.697  1.00 69.03  ? 642  CYS A O     1 
ATOM   4874  C  CB    . CYS A 1  642  ? 3.998   -30.011 44.903  1.00 69.75  ? 642  CYS A CB    1 
ATOM   4875  S  SG    . CYS A 1  642  ? 4.137   -28.402 45.672  1.00 71.68  ? 642  CYS A SG    1 
ATOM   4876  N  N     . ALA A 1  643  ? 3.236   -28.404 42.231  1.00 67.37  ? 643  ALA A N     1 
ATOM   4877  C  CA    . ALA A 1  643  ? 2.894   -27.215 41.451  1.00 65.96  ? 643  ALA A CA    1 
ATOM   4878  C  C     . ALA A 1  643  ? 1.508   -27.362 40.815  1.00 65.09  ? 643  ALA A C     1 
ATOM   4879  O  O     . ALA A 1  643  ? 0.630   -26.527 41.014  1.00 64.42  ? 643  ALA A O     1 
ATOM   4880  C  CB    . ALA A 1  643  ? 3.965   -26.962 40.382  1.00 65.98  ? 643  ALA A CB    1 
ATOM   4881  N  N     . LYS A 1  644  ? 1.319   -28.449 40.069  1.00 64.55  ? 644  LYS A N     1 
ATOM   4882  C  CA    . LYS A 1  644  ? 0.032   -28.769 39.457  1.00 64.31  ? 644  LYS A CA    1 
ATOM   4883  C  C     . LYS A 1  644  ? -1.070  -28.982 40.490  1.00 63.57  ? 644  LYS A C     1 
ATOM   4884  O  O     . LYS A 1  644  ? -2.261  -28.920 40.158  1.00 63.50  ? 644  LYS A O     1 
ATOM   4885  C  CB    . LYS A 1  644  ? 0.149   -29.998 38.554  1.00 64.61  ? 644  LYS A CB    1 
ATOM   4886  C  CG    . LYS A 1  644  ? -1.102  -30.235 37.689  1.00 66.54  ? 644  LYS A CG    1 
ATOM   4887  C  CD    . LYS A 1  644  ? -0.760  -30.659 36.251  1.00 69.08  ? 644  LYS A CD    1 
ATOM   4888  C  CE    . LYS A 1  644  ? -1.782  -30.105 35.242  1.00 69.34  ? 644  LYS A CE    1 
ATOM   4889  N  NZ    . LYS A 1  644  ? -1.766  -30.885 33.960  1.00 70.53  ? 644  LYS A NZ    1 
ATOM   4890  N  N     . LEU A 1  645  ? -0.659  -29.234 41.733  1.00 62.59  ? 645  LEU A N     1 
ATOM   4891  C  CA    . LEU A 1  645  ? -1.574  -29.358 42.854  1.00 61.39  ? 645  LEU A CA    1 
ATOM   4892  C  C     . LEU A 1  645  ? -2.238  -28.027 43.157  1.00 60.81  ? 645  LEU A C     1 
ATOM   4893  O  O     . LEU A 1  645  ? -3.435  -27.983 43.415  1.00 61.17  ? 645  LEU A O     1 
ATOM   4894  C  CB    . LEU A 1  645  ? -0.863  -29.893 44.094  1.00 61.02  ? 645  LEU A CB    1 
ATOM   4895  C  CG    . LEU A 1  645  ? -1.543  -29.557 45.422  1.00 61.01  ? 645  LEU A CG    1 
ATOM   4896  C  CD1   . LEU A 1  645  ? -2.795  -30.404 45.684  1.00 59.44  ? 645  LEU A CD1   1 
ATOM   4897  C  CD2   . LEU A 1  645  ? -0.535  -29.671 46.554  1.00 61.22  ? 645  LEU A CD2   1 
ATOM   4898  N  N     . PHE A 1  646  ? -1.473  -26.944 43.120  1.00 59.91  ? 646  PHE A N     1 
ATOM   4899  C  CA    . PHE A 1  646  ? -2.034  -25.625 43.387  1.00 59.46  ? 646  PHE A CA    1 
ATOM   4900  C  C     . PHE A 1  646  ? -3.284  -25.395 42.541  1.00 59.83  ? 646  PHE A C     1 
ATOM   4901  O  O     . PHE A 1  646  ? -4.431  -25.347 43.054  1.00 60.07  ? 646  PHE A O     1 
ATOM   4902  C  CB    . PHE A 1  646  ? -0.998  -24.543 43.075  1.00 58.93  ? 646  PHE A CB    1 
ATOM   4903  C  CG    . PHE A 1  646  ? -0.164  -24.157 44.247  1.00 57.49  ? 646  PHE A CG    1 
ATOM   4904  C  CD1   . PHE A 1  646  ? 0.924   -24.936 44.626  1.00 56.30  ? 646  PHE A CD1   1 
ATOM   4905  C  CD2   . PHE A 1  646  ? -0.475  -23.021 44.981  1.00 56.36  ? 646  PHE A CD2   1 
ATOM   4906  C  CE1   . PHE A 1  646  ? 1.678   -24.604 45.720  1.00 55.79  ? 646  PHE A CE1   1 
ATOM   4907  C  CE2   . PHE A 1  646  ? 0.276   -22.665 46.081  1.00 55.95  ? 646  PHE A CE2   1 
ATOM   4908  C  CZ    . PHE A 1  646  ? 1.360   -23.461 46.453  1.00 56.88  ? 646  PHE A CZ    1 
ATOM   4909  N  N     . GLY A 1  647  ? -3.037  -25.285 41.232  1.00 59.63  ? 647  GLY A N     1 
ATOM   4910  C  CA    . GLY A 1  647  ? -4.051  -24.955 40.234  1.00 59.06  ? 647  GLY A CA    1 
ATOM   4911  C  C     . GLY A 1  647  ? -5.185  -25.957 40.090  1.00 58.38  ? 647  GLY A C     1 
ATOM   4912  O  O     . GLY A 1  647  ? -6.121  -25.743 39.312  1.00 58.49  ? 647  GLY A O     1 
ATOM   4913  N  N     . ASN A 1  648  ? -5.117  -27.058 40.815  1.00 57.33  ? 648  ASN A N     1 
ATOM   4914  C  CA    . ASN A 1  648  ? -6.267  -27.906 40.838  1.00 56.91  ? 648  ASN A CA    1 
ATOM   4915  C  C     . ASN A 1  648  ? -7.160  -27.504 41.997  1.00 56.56  ? 648  ASN A C     1 
ATOM   4916  O  O     . ASN A 1  648  ? -8.402  -27.397 41.859  1.00 56.22  ? 648  ASN A O     1 
ATOM   4917  C  CB    . ASN A 1  648  ? -5.850  -29.367 40.849  1.00 56.97  ? 648  ASN A CB    1 
ATOM   4918  C  CG    . ASN A 1  648  ? -5.178  -29.761 39.559  1.00 57.32  ? 648  ASN A CG    1 
ATOM   4919  O  OD1   . ASN A 1  648  ? -5.093  -28.957 38.633  1.00 57.32  ? 648  ASN A OD1   1 
ATOM   4920  N  ND2   . ASN A 1  648  ? -4.700  -30.992 39.483  1.00 58.60  ? 648  ASN A ND2   1 
ATOM   4921  N  N     . ILE A 1  649  ? -6.522  -27.221 43.128  1.00 56.04  ? 649  ILE A N     1 
ATOM   4922  C  CA    . ILE A 1  649  ? -7.283  -26.884 44.311  1.00 55.75  ? 649  ILE A CA    1 
ATOM   4923  C  C     . ILE A 1  649  ? -8.028  -25.646 43.917  1.00 55.70  ? 649  ILE A C     1 
ATOM   4924  O  O     . ILE A 1  649  ? -9.242  -25.569 44.091  1.00 55.68  ? 649  ILE A O     1 
ATOM   4925  C  CB    . ILE A 1  649  ? -6.415  -26.685 45.553  1.00 55.70  ? 649  ILE A CB    1 
ATOM   4926  C  CG1   . ILE A 1  649  ? -5.284  -27.723 45.550  1.00 55.61  ? 649  ILE A CG1   1 
ATOM   4927  C  CG2   . ILE A 1  649  ? -7.285  -26.777 46.788  1.00 55.30  ? 649  ILE A CG2   1 
ATOM   4928  C  CD1   . ILE A 1  649  ? -4.826  -28.234 46.894  1.00 55.73  ? 649  ILE A CD1   1 
ATOM   4929  N  N     . GLN A 1  650  ? -7.290  -24.721 43.306  1.00 55.64  ? 650  GLN A N     1 
ATOM   4930  C  CA    . GLN A 1  650  ? -7.863  -23.537 42.650  1.00 55.69  ? 650  GLN A CA    1 
ATOM   4931  C  C     . GLN A 1  650  ? -9.053  -23.802 41.669  1.00 56.08  ? 650  GLN A C     1 
ATOM   4932  O  O     . GLN A 1  650  ? -10.232 -23.486 41.966  1.00 55.50  ? 650  GLN A O     1 
ATOM   4933  C  CB    . GLN A 1  650  ? -6.736  -22.767 41.940  1.00 55.12  ? 650  GLN A CB    1 
ATOM   4934  C  CG    . GLN A 1  650  ? -6.551  -21.353 42.423  1.00 52.84  ? 650  GLN A CG    1 
ATOM   4935  C  CD    . GLN A 1  650  ? -5.114  -21.007 42.622  1.00 49.67  ? 650  GLN A CD    1 
ATOM   4936  O  OE1   . GLN A 1  650  ? -4.244  -21.865 42.531  1.00 49.58  ? 650  GLN A OE1   1 
ATOM   4937  N  NE2   . GLN A 1  650  ? -4.847  -19.740 42.899  1.00 48.94  ? 650  GLN A NE2   1 
ATOM   4938  N  N     . LYS A 1  651  ? -8.722  -24.372 40.509  1.00 56.39  ? 651  LYS A N     1 
ATOM   4939  C  CA    . LYS A 1  651  ? -9.683  -24.551 39.444  1.00 56.98  ? 651  LYS A CA    1 
ATOM   4940  C  C     . LYS A 1  651  ? -11.042 -24.993 39.992  1.00 56.88  ? 651  LYS A C     1 
ATOM   4941  O  O     . LYS A 1  651  ? -12.071 -24.415 39.617  1.00 57.16  ? 651  LYS A O     1 
ATOM   4942  C  CB    . LYS A 1  651  ? -9.142  -25.485 38.363  1.00 56.50  ? 651  LYS A CB    1 
ATOM   4943  C  CG    . LYS A 1  651  ? -8.350  -24.767 37.305  1.00 57.14  ? 651  LYS A CG    1 
ATOM   4944  C  CD    . LYS A 1  651  ? -7.870  -25.722 36.180  1.00 58.66  ? 651  LYS A CD    1 
ATOM   4945  C  CE    . LYS A 1  651  ? -6.305  -25.915 36.087  1.00 60.28  ? 651  LYS A CE    1 
ATOM   4946  N  NZ    . LYS A 1  651  ? -5.557  -24.832 35.330  1.00 58.54  ? 651  LYS A NZ    1 
ATOM   4947  N  N     . VAL A 1  652  ? -11.052 -25.970 40.900  1.00 56.69  ? 652  VAL A N     1 
ATOM   4948  C  CA    . VAL A 1  652  ? -12.310 -26.329 41.550  1.00 56.90  ? 652  VAL A CA    1 
ATOM   4949  C  C     . VAL A 1  652  ? -12.787 -25.255 42.517  1.00 57.24  ? 652  VAL A C     1 
ATOM   4950  O  O     . VAL A 1  652  ? -13.951 -24.844 42.435  1.00 57.83  ? 652  VAL A O     1 
ATOM   4951  C  CB    . VAL A 1  652  ? -12.265 -27.623 42.369  1.00 56.81  ? 652  VAL A CB    1 
ATOM   4952  C  CG1   . VAL A 1  652  ? -13.698 -28.079 42.678  1.00 55.53  ? 652  VAL A CG1   1 
ATOM   4953  C  CG2   . VAL A 1  652  ? -11.484 -28.688 41.650  1.00 57.51  ? 652  VAL A CG2   1 
ATOM   4954  N  N     . VAL A 1  653  ? -11.923 -24.827 43.449  1.00 56.86  ? 653  VAL A N     1 
ATOM   4955  C  CA    . VAL A 1  653  ? -12.419 -24.025 44.560  1.00 56.18  ? 653  VAL A CA    1 
ATOM   4956  C  C     . VAL A 1  653  ? -13.063 -22.804 43.964  1.00 56.51  ? 653  VAL A C     1 
ATOM   4957  O  O     . VAL A 1  653  ? -14.210 -22.505 44.297  1.00 56.97  ? 653  VAL A O     1 
ATOM   4958  C  CB    . VAL A 1  653  ? -11.365 -23.657 45.643  1.00 56.09  ? 653  VAL A CB    1 
ATOM   4959  C  CG1   . VAL A 1  653  ? -11.993 -22.778 46.737  1.00 54.91  ? 653  VAL A CG1   1 
ATOM   4960  C  CG2   . VAL A 1  653  ? -10.795 -24.899 46.269  1.00 54.91  ? 653  VAL A CG2   1 
ATOM   4961  N  N     . ASN A 1  654  ? -12.371 -22.132 43.043  1.00 56.65  ? 654  ASN A N     1 
ATOM   4962  C  CA    . ASN A 1  654  ? -12.896 -20.858 42.539  1.00 56.91  ? 654  ASN A CA    1 
ATOM   4963  C  C     . ASN A 1  654  ? -14.252 -21.129 41.923  1.00 56.65  ? 654  ASN A C     1 
ATOM   4964  O  O     . ASN A 1  654  ? -15.168 -20.330 42.069  1.00 56.62  ? 654  ASN A O     1 
ATOM   4965  C  CB    . ASN A 1  654  ? -11.982 -20.148 41.501  1.00 57.35  ? 654  ASN A CB    1 
ATOM   4966  C  CG    . ASN A 1  654  ? -10.488 -20.493 41.645  1.00 57.55  ? 654  ASN A CG    1 
ATOM   4967  O  OD1   . ASN A 1  654  ? -9.829  -20.141 42.644  1.00 57.38  ? 654  ASN A OD1   1 
ATOM   4968  N  ND2   . ASN A 1  654  ? -9.945  -21.155 40.620  1.00 56.01  ? 654  ASN A ND2   1 
ATOM   4969  N  N     . PHE A 1  655  ? -14.367 -22.274 41.247  1.00 56.72  ? 655  PHE A N     1 
ATOM   4970  C  CA    . PHE A 1  655  ? -15.586 -22.629 40.525  1.00 56.71  ? 655  PHE A CA    1 
ATOM   4971  C  C     . PHE A 1  655  ? -16.728 -22.768 41.505  1.00 56.37  ? 655  PHE A C     1 
ATOM   4972  O  O     . PHE A 1  655  ? -17.682 -21.981 41.433  1.00 56.74  ? 655  PHE A O     1 
ATOM   4973  C  CB    . PHE A 1  655  ? -15.423 -23.899 39.683  1.00 57.33  ? 655  PHE A CB    1 
ATOM   4974  C  CG    . PHE A 1  655  ? -16.687 -24.346 39.024  1.00 58.31  ? 655  PHE A CG    1 
ATOM   4975  C  CD1   . PHE A 1  655  ? -16.951 -24.004 37.707  1.00 60.71  ? 655  PHE A CD1   1 
ATOM   4976  C  CD2   . PHE A 1  655  ? -17.631 -25.089 39.726  1.00 59.85  ? 655  PHE A CD2   1 
ATOM   4977  C  CE1   . PHE A 1  655  ? -18.143 -24.407 37.071  1.00 62.24  ? 655  PHE A CE1   1 
ATOM   4978  C  CE2   . PHE A 1  655  ? -18.826 -25.492 39.119  1.00 61.77  ? 655  PHE A CE2   1 
ATOM   4979  C  CZ    . PHE A 1  655  ? -19.081 -25.155 37.777  1.00 61.43  ? 655  PHE A CZ    1 
ATOM   4980  N  N     . TRP A 1  656  ? -16.632 -23.736 42.428  1.00 55.43  ? 656  TRP A N     1 
ATOM   4981  C  CA    . TRP A 1  656  ? -17.641 -23.862 43.464  1.00 54.32  ? 656  TRP A CA    1 
ATOM   4982  C  C     . TRP A 1  656  ? -18.059 -22.497 43.932  1.00 53.77  ? 656  TRP A C     1 
ATOM   4983  O  O     . TRP A 1  656  ? -19.244 -22.148 43.868  1.00 53.88  ? 656  TRP A O     1 
ATOM   4984  C  CB    . TRP A 1  656  ? -17.165 -24.600 44.695  1.00 54.24  ? 656  TRP A CB    1 
ATOM   4985  C  CG    . TRP A 1  656  ? -18.317 -24.684 45.628  1.00 54.44  ? 656  TRP A CG    1 
ATOM   4986  C  CD1   . TRP A 1  656  ? -19.436 -25.436 45.455  1.00 55.38  ? 656  TRP A CD1   1 
ATOM   4987  C  CD2   . TRP A 1  656  ? -18.523 -23.939 46.827  1.00 53.80  ? 656  TRP A CD2   1 
ATOM   4988  N  NE1   . TRP A 1  656  ? -20.313 -25.229 46.484  1.00 55.59  ? 656  TRP A NE1   1 
ATOM   4989  C  CE2   . TRP A 1  656  ? -19.770 -24.318 47.345  1.00 54.07  ? 656  TRP A CE2   1 
ATOM   4990  C  CE3   . TRP A 1  656  ? -17.765 -23.014 47.527  1.00 54.76  ? 656  TRP A CE3   1 
ATOM   4991  C  CZ2   . TRP A 1  656  ? -20.275 -23.805 48.527  1.00 54.33  ? 656  TRP A CZ2   1 
ATOM   4992  C  CZ3   . TRP A 1  656  ? -18.277 -22.494 48.703  1.00 54.88  ? 656  TRP A CZ3   1 
ATOM   4993  C  CH2   . TRP A 1  656  ? -19.517 -22.891 49.187  1.00 54.47  ? 656  TRP A CH2   1 
ATOM   4994  N  N     . LEU A 1  657  ? -17.068 -21.738 44.404  1.00 53.09  ? 657  LEU A N     1 
ATOM   4995  C  CA    . LEU A 1  657  ? -17.284 -20.395 44.935  1.00 52.64  ? 657  LEU A CA    1 
ATOM   4996  C  C     . LEU A 1  657  ? -18.077 -19.501 43.989  1.00 52.70  ? 657  LEU A C     1 
ATOM   4997  O  O     . LEU A 1  657  ? -18.956 -18.738 44.437  1.00 52.83  ? 657  LEU A O     1 
ATOM   4998  C  CB    . LEU A 1  657  ? -15.970 -19.726 45.319  1.00 52.10  ? 657  LEU A CB    1 
ATOM   4999  C  CG    . LEU A 1  657  ? -16.171 -18.351 45.950  1.00 52.36  ? 657  LEU A CG    1 
ATOM   5000  C  CD1   . LEU A 1  657  ? -16.264 -18.424 47.466  1.00 53.96  ? 657  LEU A CD1   1 
ATOM   5001  C  CD2   . LEU A 1  657  ? -15.048 -17.436 45.557  1.00 54.31  ? 657  LEU A CD2   1 
ATOM   5002  N  N     . LEU A 1  658  ? -17.788 -19.607 42.688  1.00 52.72  ? 658  LEU A N     1 
ATOM   5003  C  CA    . LEU A 1  658  ? -18.405 -18.710 41.720  1.00 52.49  ? 658  LEU A CA    1 
ATOM   5004  C  C     . LEU A 1  658  ? -19.900 -18.867 41.868  1.00 52.18  ? 658  LEU A C     1 
ATOM   5005  O  O     . LEU A 1  658  ? -20.632 -17.901 42.104  1.00 52.23  ? 658  LEU A O     1 
ATOM   5006  C  CB    . LEU A 1  658  ? -17.953 -18.982 40.289  1.00 52.13  ? 658  LEU A CB    1 
ATOM   5007  C  CG    . LEU A 1  658  ? -18.803 -18.261 39.239  1.00 52.39  ? 658  LEU A CG    1 
ATOM   5008  C  CD1   . LEU A 1  658  ? -18.764 -16.746 39.389  1.00 52.41  ? 658  LEU A CD1   1 
ATOM   5009  C  CD2   . LEU A 1  658  ? -18.341 -18.654 37.865  1.00 54.68  ? 658  LEU A CD2   1 
ATOM   5010  N  N     . HIS A 1  659  ? -20.344 -20.102 41.800  1.00 51.77  ? 659  HIS A N     1 
ATOM   5011  C  CA    . HIS A 1  659  ? -21.751 -20.320 41.865  1.00 51.91  ? 659  HIS A CA    1 
ATOM   5012  C  C     . HIS A 1  659  ? -22.248 -20.404 43.325  1.00 50.85  ? 659  HIS A C     1 
ATOM   5013  O  O     . HIS A 1  659  ? -23.360 -20.837 43.549  1.00 51.12  ? 659  HIS A O     1 
ATOM   5014  C  CB    . HIS A 1  659  ? -22.172 -21.512 40.958  1.00 52.74  ? 659  HIS A CB    1 
ATOM   5015  C  CG    . HIS A 1  659  ? -21.521 -21.513 39.588  1.00 55.31  ? 659  HIS A CG    1 
ATOM   5016  N  ND1   . HIS A 1  659  ? -21.765 -20.543 38.634  1.00 57.03  ? 659  HIS A ND1   1 
ATOM   5017  C  CD2   . HIS A 1  659  ? -20.646 -22.381 39.014  1.00 56.89  ? 659  HIS A CD2   1 
ATOM   5018  C  CE1   . HIS A 1  659  ? -21.060 -20.804 37.543  1.00 57.21  ? 659  HIS A CE1   1 
ATOM   5019  N  NE2   . HIS A 1  659  ? -20.373 -21.915 37.745  1.00 57.08  ? 659  HIS A NE2   1 
ATOM   5020  N  N     . ASN A 1  660  ? -21.456 -19.973 44.314  1.00 49.77  ? 660  ASN A N     1 
ATOM   5021  C  CA    . ASN A 1  660  ? -22.036 -19.737 45.663  1.00 48.94  ? 660  ASN A CA    1 
ATOM   5022  C  C     . ASN A 1  660  ? -22.250 -18.281 46.069  1.00 47.96  ? 660  ASN A C     1 
ATOM   5023  O  O     . ASN A 1  660  ? -23.357 -17.879 46.486  1.00 48.03  ? 660  ASN A O     1 
ATOM   5024  C  CB    . ASN A 1  660  ? -21.288 -20.416 46.819  1.00 49.18  ? 660  ASN A CB    1 
ATOM   5025  C  CG    . ASN A 1  660  ? -22.091 -20.320 48.165  1.00 50.08  ? 660  ASN A CG    1 
ATOM   5026  O  OD1   . ASN A 1  660  ? -23.119 -20.995 48.340  1.00 49.31  ? 660  ASN A OD1   1 
ATOM   5027  N  ND2   . ASN A 1  660  ? -21.635 -19.460 49.086  1.00 49.89  ? 660  ASN A ND2   1 
ATOM   5028  N  N     . GLY A 1  661  ? -21.173 -17.508 45.994  1.00 46.27  ? 661  GLY A N     1 
ATOM   5029  C  CA    . GLY A 1  661  ? -21.207 -16.114 46.419  1.00 44.23  ? 661  GLY A CA    1 
ATOM   5030  C  C     . GLY A 1  661  ? -20.274 -15.889 47.590  1.00 42.61  ? 661  GLY A C     1 
ATOM   5031  O  O     . GLY A 1  661  ? -19.613 -16.835 48.054  1.00 42.85  ? 661  GLY A O     1 
ATOM   5032  N  N     . PHE A 1  662  ? -20.189 -14.631 48.024  1.00 40.37  ? 662  PHE A N     1 
ATOM   5033  C  CA    . PHE A 1  662  ? -19.636 -14.232 49.322  1.00 38.41  ? 662  PHE A CA    1 
ATOM   5034  C  C     . PHE A 1  662  ? -19.302 -12.765 49.175  1.00 39.47  ? 662  PHE A C     1 
ATOM   5035  O  O     . PHE A 1  662  ? -19.257 -12.263 48.076  1.00 39.60  ? 662  PHE A O     1 
ATOM   5036  C  CB    . PHE A 1  662  ? -18.451 -15.103 49.681  1.00 36.00  ? 662  PHE A CB    1 
ATOM   5037  C  CG    . PHE A 1  662  ? -17.872 -14.889 51.056  1.00 30.72  ? 662  PHE A CG    1 
ATOM   5038  C  CD1   . PHE A 1  662  ? -17.499 -16.013 51.822  1.00 26.18  ? 662  PHE A CD1   1 
ATOM   5039  C  CD2   . PHE A 1  662  ? -17.597 -13.620 51.540  1.00 23.76  ? 662  PHE A CD2   1 
ATOM   5040  C  CE1   . PHE A 1  662  ? -16.874 -15.874 53.044  1.00 23.84  ? 662  PHE A CE1   1 
ATOM   5041  C  CE2   . PHE A 1  662  ? -17.009 -13.458 52.748  1.00 22.91  ? 662  PHE A CE2   1 
ATOM   5042  C  CZ    . PHE A 1  662  ? -16.636 -14.585 53.515  1.00 26.60  ? 662  PHE A CZ    1 
ATOM   5043  N  N     . SER A 1  663  ? -19.110 -12.058 50.267  1.00 41.13  ? 663  SER A N     1 
ATOM   5044  C  CA    . SER A 1  663  ? -19.285 -10.621 50.222  1.00 43.54  ? 663  SER A CA    1 
ATOM   5045  C  C     . SER A 1  663  ? -18.877 -9.948  51.528  1.00 44.79  ? 663  SER A C     1 
ATOM   5046  O  O     . SER A 1  663  ? -18.070 -10.485 52.309  1.00 44.78  ? 663  SER A O     1 
ATOM   5047  C  CB    . SER A 1  663  ? -20.771 -10.320 49.981  1.00 44.34  ? 663  SER A CB    1 
ATOM   5048  O  OG    . SER A 1  663  ? -21.080 -10.405 48.603  1.00 46.01  ? 663  SER A OG    1 
ATOM   5049  N  N     . THR A 1  664  ? -19.443 -8.763  51.747  1.00 46.04  ? 664  THR A N     1 
ATOM   5050  C  CA    . THR A 1  664  ? -19.426 -8.095  53.033  1.00 46.92  ? 664  THR A CA    1 
ATOM   5051  C  C     . THR A 1  664  ? -20.263 -6.815  52.936  1.00 48.26  ? 664  THR A C     1 
ATOM   5052  O  O     . THR A 1  664  ? -19.830 -5.841  52.286  1.00 48.82  ? 664  THR A O     1 
ATOM   5053  C  CB    . THR A 1  664  ? -17.977 -7.789  53.531  1.00 46.31  ? 664  THR A CB    1 
ATOM   5054  O  OG1   . THR A 1  664  ? -17.367 -8.999  54.002  1.00 44.41  ? 664  THR A OG1   1 
ATOM   5055  C  CG2   . THR A 1  664  ? -17.992 -6.785  54.677  1.00 46.08  ? 664  THR A CG2   1 
ATOM   5056  N  N     . GLY A 1  665  ? -21.459 -6.836  53.541  1.00 48.82  ? 665  GLY A N     1 
ATOM   5057  C  CA    . GLY A 1  665  ? -22.235 -5.610  53.793  1.00 49.36  ? 665  GLY A CA    1 
ATOM   5058  C  C     . GLY A 1  665  ? -21.812 -5.005  55.118  1.00 50.08  ? 665  GLY A C     1 
ATOM   5059  O  O     . GLY A 1  665  ? -21.007 -5.600  55.851  1.00 49.64  ? 665  GLY A O     1 
ATOM   5060  N  N     . ILE A 1  666  ? -22.328 -3.825  55.441  1.00 51.12  ? 666  ILE A N     1 
ATOM   5061  C  CA    . ILE A 1  666  ? -22.007 -3.253  56.741  1.00 52.41  ? 666  ILE A CA    1 
ATOM   5062  C  C     . ILE A 1  666  ? -22.767 -4.037  57.817  1.00 54.05  ? 666  ILE A C     1 
ATOM   5063  O  O     . ILE A 1  666  ? -22.376 -4.020  58.995  1.00 54.52  ? 666  ILE A O     1 
ATOM   5064  C  CB    . ILE A 1  666  ? -22.262 -1.719  56.880  1.00 52.12  ? 666  ILE A CB    1 
ATOM   5065  C  CG1   . ILE A 1  666  ? -22.335 -1.008  55.546  1.00 51.05  ? 666  ILE A CG1   1 
ATOM   5066  C  CG2   . ILE A 1  666  ? -21.187 -1.057  57.715  1.00 52.07  ? 666  ILE A CG2   1 
ATOM   5067  C  CD1   . ILE A 1  666  ? -23.677 -0.441  55.294  1.00 51.23  ? 666  ILE A CD1   1 
ATOM   5068  N  N     . GLY A 1  667  ? -23.836 -4.738  57.414  1.00 55.25  ? 667  GLY A N     1 
ATOM   5069  C  CA    . GLY A 1  667  ? -24.488 -5.731  58.293  1.00 56.95  ? 667  GLY A CA    1 
ATOM   5070  C  C     . GLY A 1  667  ? -23.536 -6.785  58.879  1.00 57.96  ? 667  GLY A C     1 
ATOM   5071  O  O     . GLY A 1  667  ? -23.811 -7.429  59.905  1.00 57.56  ? 667  GLY A O     1 
ATOM   5072  N  N     . ASP A 1  668  ? -22.409 -6.957  58.199  1.00 59.30  ? 668  ASP A N     1 
ATOM   5073  C  CA    . ASP A 1  668  ? -21.318 -7.790  58.678  1.00 60.66  ? 668  ASP A CA    1 
ATOM   5074  C  C     . ASP A 1  668  ? -20.638 -7.144  59.901  1.00 61.44  ? 668  ASP A C     1 
ATOM   5075  O  O     . ASP A 1  668  ? -19.871 -7.801  60.630  1.00 61.55  ? 668  ASP A O     1 
ATOM   5076  C  CB    . ASP A 1  668  ? -20.326 -8.083  57.528  1.00 60.38  ? 668  ASP A CB    1 
ATOM   5077  C  CG    . ASP A 1  668  ? -20.853 -9.159  56.545  1.00 61.18  ? 668  ASP A CG    1 
ATOM   5078  O  OD1   . ASP A 1  668  ? -21.300 -10.255 57.002  1.00 62.04  ? 668  ASP A OD1   1 
ATOM   5079  O  OD2   . ASP A 1  668  ? -20.819 -8.917  55.309  1.00 60.13  ? 668  ASP A OD2   1 
ATOM   5080  N  N     . THR A 1  669  ? -20.946 -5.863  60.123  1.00 62.25  ? 669  THR A N     1 
ATOM   5081  C  CA    . THR A 1  669  ? -20.383 -5.094  61.229  1.00 62.96  ? 669  THR A CA    1 
ATOM   5082  C  C     . THR A 1  669  ? -21.454 -4.334  62.003  1.00 63.54  ? 669  THR A C     1 
ATOM   5083  O  O     . THR A 1  669  ? -21.203 -3.244  62.508  1.00 63.50  ? 669  THR A O     1 
ATOM   5084  C  CB    . THR A 1  669  ? -19.189 -4.140  60.794  1.00 63.01  ? 669  THR A CB    1 
ATOM   5085  O  OG1   . THR A 1  669  ? -19.439 -3.544  59.513  1.00 62.09  ? 669  THR A OG1   1 
ATOM   5086  C  CG2   . THR A 1  669  ? -17.888 -4.906  60.735  1.00 62.97  ? 669  THR A CG2   1 
ATOM   5087  N  N     . ILE A 1  670  ? -22.651 -4.903  62.093  1.00 64.56  ? 670  ILE A N     1 
ATOM   5088  C  CA    . ILE A 1  670  ? -23.592 -4.441  63.114  1.00 65.94  ? 670  ILE A CA    1 
ATOM   5089  C  C     . ILE A 1  670  ? -23.373 -5.324  64.331  1.00 66.99  ? 670  ILE A C     1 
ATOM   5090  O  O     . ILE A 1  670  ? -22.504 -6.200  64.314  1.00 67.19  ? 670  ILE A O     1 
ATOM   5091  C  CB    . ILE A 1  670  ? -25.081 -4.505  62.694  1.00 65.71  ? 670  ILE A CB    1 
ATOM   5092  C  CG1   . ILE A 1  670  ? -25.273 -4.269  61.193  1.00 66.52  ? 670  ILE A CG1   1 
ATOM   5093  C  CG2   . ILE A 1  670  ? -25.893 -3.515  63.511  1.00 65.48  ? 670  ILE A CG2   1 
ATOM   5094  C  CD1   . ILE A 1  670  ? -24.883 -2.864  60.673  1.00 68.07  ? 670  ILE A CD1   1 
ATOM   5095  N  N     . ALA A 1  671  ? -24.141 -5.090  65.391  1.00 68.33  ? 671  ALA A N     1 
ATOM   5096  C  CA    . ALA A 1  671  ? -24.122 -5.962  66.557  1.00 69.51  ? 671  ALA A CA    1 
ATOM   5097  C  C     . ALA A 1  671  ? -25.406 -5.817  67.353  1.00 70.52  ? 671  ALA A C     1 
ATOM   5098  O  O     . ALA A 1  671  ? -25.964 -4.720  67.455  1.00 70.39  ? 671  ALA A O     1 
ATOM   5099  C  CB    . ALA A 1  671  ? -22.911 -5.664  67.417  1.00 69.39  ? 671  ALA A CB    1 
ATOM   5100  N  N     . ASP A 1  672  ? -25.862 -6.934  67.912  1.00 72.12  ? 672  ASP A N     1 
ATOM   5101  C  CA    . ASP A 1  672  ? -27.108 -7.005  68.687  1.00 73.93  ? 672  ASP A CA    1 
ATOM   5102  C  C     . ASP A 1  672  ? -27.261 -5.886  69.708  1.00 74.89  ? 672  ASP A C     1 
ATOM   5103  O  O     . ASP A 1  672  ? -26.325 -5.589  70.449  1.00 75.17  ? 672  ASP A O     1 
ATOM   5104  C  CB    . ASP A 1  672  ? -27.183 -8.341  69.418  1.00 74.00  ? 672  ASP A CB    1 
ATOM   5105  C  CG    . ASP A 1  672  ? -28.504 -9.037  69.225  1.00 75.63  ? 672  ASP A CG    1 
ATOM   5106  O  OD1   . ASP A 1  672  ? -29.480 -8.352  68.828  1.00 77.70  ? 672  ASP A OD1   1 
ATOM   5107  O  OD2   . ASP A 1  672  ? -28.564 -10.273 69.457  1.00 77.07  ? 672  ASP A OD2   1 
ATOM   5108  N  N     . GLY A 1  673  ? -28.442 -5.270  69.738  1.00 76.08  ? 673  GLY A N     1 
ATOM   5109  C  CA    . GLY A 1  673  ? -28.748 -4.212  70.702  1.00 77.41  ? 673  GLY A CA    1 
ATOM   5110  C  C     . GLY A 1  673  ? -28.328 -4.590  72.112  1.00 78.47  ? 673  GLY A C     1 
ATOM   5111  O  O     . GLY A 1  673  ? -27.444 -3.952  72.682  1.00 78.26  ? 673  GLY A O     1 
ATOM   5112  N  N     . PRO A 1  674  ? -28.948 -5.644  72.679  1.00 79.46  ? 674  PRO A N     1 
ATOM   5113  C  CA    . PRO A 1  674  ? -28.602 -6.143  74.010  1.00 80.39  ? 674  PRO A CA    1 
ATOM   5114  C  C     . PRO A 1  674  ? -27.130 -6.482  74.201  1.00 81.35  ? 674  PRO A C     1 
ATOM   5115  O  O     . PRO A 1  674  ? -26.740 -6.842  75.313  1.00 81.69  ? 674  PRO A O     1 
ATOM   5116  C  CB    . PRO A 1  674  ? -29.440 -7.422  74.141  1.00 80.39  ? 674  PRO A CB    1 
ATOM   5117  C  CG    . PRO A 1  674  ? -29.875 -7.752  72.752  1.00 80.06  ? 674  PRO A CG    1 
ATOM   5118  C  CD    . PRO A 1  674  ? -30.052 -6.424  72.097  1.00 79.61  ? 674  PRO A CD    1 
ATOM   5119  N  N     . THR A 1  675  ? -26.327 -6.395  73.140  1.00 82.36  ? 675  THR A N     1 
ATOM   5120  C  CA    . THR A 1  675  ? -24.876 -6.463  73.293  1.00 83.35  ? 675  THR A CA    1 
ATOM   5121  C  C     . THR A 1  675  ? -24.351 -5.048  73.211  1.00 84.49  ? 675  THR A C     1 
ATOM   5122  O  O     . THR A 1  675  ? -23.581 -4.622  74.071  1.00 85.00  ? 675  THR A O     1 
ATOM   5123  C  CB    . THR A 1  675  ? -24.193 -7.332  72.249  1.00 82.91  ? 675  THR A CB    1 
ATOM   5124  O  OG1   . THR A 1  675  ? -25.182 -8.001  71.473  1.00 82.71  ? 675  THR A OG1   1 
ATOM   5125  C  CG2   . THR A 1  675  ? -23.339 -8.365  72.933  1.00 82.95  ? 675  THR A CG2   1 
ATOM   5126  N  N     . MET A 1  676  ? -24.796 -4.306  72.200  1.00 85.63  ? 676  MET A N     1 
ATOM   5127  C  CA    . MET A 1  676  ? -24.498 -2.876  72.119  1.00 86.58  ? 676  MET A CA    1 
ATOM   5128  C  C     . MET A 1  676  ? -24.717 -2.161  73.450  1.00 87.14  ? 676  MET A C     1 
ATOM   5129  O  O     . MET A 1  676  ? -24.002 -1.214  73.772  1.00 87.38  ? 676  MET A O     1 
ATOM   5130  C  CB    . MET A 1  676  ? -25.278 -2.205  70.989  1.00 86.60  ? 676  MET A CB    1 
ATOM   5131  C  CG    . MET A 1  676  ? -24.545 -2.301  69.688  1.00 86.92  ? 676  MET A CG    1 
ATOM   5132  S  SD    . MET A 1  676  ? -22.765 -2.161  69.999  1.00 88.02  ? 676  MET A SD    1 
ATOM   5133  C  CE    . MET A 1  676  ? -22.394 -0.510  69.398  1.00 88.69  ? 676  MET A CE    1 
ATOM   5134  N  N     . ARG A 1  677  ? -25.684 -2.634  74.227  1.00 87.64  ? 677  ARG A N     1 
ATOM   5135  C  CA    . ARG A 1  677  ? -25.811 -2.210  75.605  1.00 88.36  ? 677  ARG A CA    1 
ATOM   5136  C  C     . ARG A 1  677  ? -24.612 -2.722  76.392  1.00 88.51  ? 677  ARG A C     1 
ATOM   5137  O  O     . ARG A 1  677  ? -23.841 -1.935  76.922  1.00 88.74  ? 677  ARG A O     1 
ATOM   5138  C  CB    . ARG A 1  677  ? -27.099 -2.749  76.205  1.00 88.61  ? 677  ARG A CB    1 
ATOM   5139  C  CG    . ARG A 1  677  ? -27.720 -1.860  77.249  1.00 89.36  ? 677  ARG A CG    1 
ATOM   5140  C  CD    . ARG A 1  677  ? -29.216 -2.000  77.173  1.00 90.39  ? 677  ARG A CD    1 
ATOM   5141  N  NE    . ARG A 1  677  ? -29.646 -1.984  75.776  1.00 91.24  ? 677  ARG A NE    1 
ATOM   5142  C  CZ    . ARG A 1  677  ? -30.859 -2.325  75.354  1.00 92.65  ? 677  ARG A CZ    1 
ATOM   5143  N  NH1   . ARG A 1  677  ? -31.790 -2.708  76.225  1.00 94.21  ? 677  ARG A NH1   1 
ATOM   5144  N  NH2   . ARG A 1  677  ? -31.145 -2.283  74.055  1.00 92.31  ? 677  ARG A NH2   1 
ATOM   5145  N  N     . GLU A 1  678  ? -24.437 -4.038  76.434  1.00 88.74  ? 678  GLU A N     1 
ATOM   5146  C  CA    . GLU A 1  678  ? -23.414 -4.650  77.272  1.00 89.26  ? 678  GLU A CA    1 
ATOM   5147  C  C     . GLU A 1  678  ? -22.008 -4.139  77.051  1.00 89.12  ? 678  GLU A C     1 
ATOM   5148  O  O     . GLU A 1  678  ? -21.179 -4.220  77.950  1.00 89.23  ? 678  GLU A O     1 
ATOM   5149  C  CB    . GLU A 1  678  ? -23.433 -6.169  77.161  1.00 89.49  ? 678  GLU A CB    1 
ATOM   5150  C  CG    . GLU A 1  678  ? -24.129 -6.825  78.347  1.00 91.97  ? 678  GLU A CG    1 
ATOM   5151  C  CD    . GLU A 1  678  ? -23.595 -8.218  78.665  1.00 94.86  ? 678  GLU A CD    1 
ATOM   5152  O  OE1   . GLU A 1  678  ? -23.422 -8.546  79.872  1.00 95.58  ? 678  GLU A OE1   1 
ATOM   5153  O  OE2   . GLU A 1  678  ? -23.350 -8.981  77.700  1.00 96.34  ? 678  GLU A OE2   1 
ATOM   5154  N  N     . ILE A 1  679  ? -21.751 -3.601  75.865  1.00 89.12  ? 679  ILE A N     1 
ATOM   5155  C  CA    . ILE A 1  679  ? -20.431 -3.094  75.518  1.00 89.04  ? 679  ILE A CA    1 
ATOM   5156  C  C     . ILE A 1  679  ? -20.242 -1.693  76.105  1.00 89.66  ? 679  ILE A C     1 
ATOM   5157  O  O     . ILE A 1  679  ? -19.203 -1.391  76.697  1.00 89.68  ? 679  ILE A O     1 
ATOM   5158  C  CB    . ILE A 1  679  ? -20.227 -3.110  74.003  1.00 88.56  ? 679  ILE A CB    1 
ATOM   5159  C  CG1   . ILE A 1  679  ? -20.335 -4.534  73.497  1.00 87.61  ? 679  ILE A CG1   1 
ATOM   5160  C  CG2   . ILE A 1  679  ? -18.865 -2.611  73.643  1.00 88.41  ? 679  ILE A CG2   1 
ATOM   5161  C  CD1   . ILE A 1  679  ? -21.074 -4.648  72.208  1.00 86.69  ? 679  ILE A CD1   1 
ATOM   5162  N  N     . THR A 1  680  ? -21.252 -0.842  75.957  1.00 90.26  ? 680  THR A N     1 
ATOM   5163  C  CA    . THR A 1  680  ? -21.226 0.465   76.603  1.00 90.91  ? 680  THR A CA    1 
ATOM   5164  C  C     . THR A 1  680  ? -21.202 0.288   78.121  1.00 91.23  ? 680  THR A C     1 
ATOM   5165  O  O     . THR A 1  680  ? -20.404 0.918   78.806  1.00 91.53  ? 680  THR A O     1 
ATOM   5166  C  CB    . THR A 1  680  ? -22.405 1.356   76.165  1.00 90.91  ? 680  THR A CB    1 
ATOM   5167  O  OG1   . THR A 1  680  ? -22.244 1.715   74.786  1.00 91.18  ? 680  THR A OG1   1 
ATOM   5168  C  CG2   . THR A 1  680  ? -22.464 2.630   77.005  1.00 91.22  ? 680  THR A CG2   1 
ATOM   5169  N  N     . GLU A 1  681  ? -22.049 -0.592  78.646  1.00 91.56  ? 681  GLU A N     1 
ATOM   5170  C  CA    . GLU A 1  681  ? -21.999 -0.892  80.069  1.00 92.03  ? 681  GLU A CA    1 
ATOM   5171  C  C     . GLU A 1  681  ? -20.755 -1.698  80.464  1.00 91.78  ? 681  GLU A C     1 
ATOM   5172  O  O     . GLU A 1  681  ? -20.509 -1.900  81.649  1.00 91.88  ? 681  GLU A O     1 
ATOM   5173  C  CB    . GLU A 1  681  ? -23.313 -1.508  80.588  1.00 92.07  ? 681  GLU A CB    1 
ATOM   5174  C  CG    . GLU A 1  681  ? -23.667 -2.919  80.093  1.00 93.22  ? 681  GLU A CG    1 
ATOM   5175  C  CD    . GLU A 1  681  ? -25.066 -3.408  80.550  1.00 93.36  ? 681  GLU A CD    1 
ATOM   5176  O  OE1   . GLU A 1  681  ? -25.795 -2.637  81.230  1.00 94.66  ? 681  GLU A OE1   1 
ATOM   5177  O  OE2   . GLU A 1  681  ? -25.440 -4.568  80.226  1.00 94.69  ? 681  GLU A OE2   1 
ATOM   5178  N  N     . THR A 1  682  ? -19.964 -2.141  79.481  1.00 91.74  ? 682  THR A N     1 
ATOM   5179  C  CA    . THR A 1  682  ? -18.600 -2.629  79.767  1.00 91.36  ? 682  THR A CA    1 
ATOM   5180  C  C     . THR A 1  682  ? -17.600 -1.479  79.749  1.00 91.31  ? 682  THR A C     1 
ATOM   5181  O  O     . THR A 1  682  ? -16.632 -1.492  80.504  1.00 91.31  ? 682  THR A O     1 
ATOM   5182  C  CB    . THR A 1  682  ? -18.118 -3.776  78.831  1.00 91.16  ? 682  THR A CB    1 
ATOM   5183  O  OG1   . THR A 1  682  ? -17.258 -4.652  79.562  1.00 90.80  ? 682  THR A OG1   1 
ATOM   5184  C  CG2   . THR A 1  682  ? -17.344 -3.250  77.653  1.00 90.68  ? 682  THR A CG2   1 
ATOM   5185  N  N     . ILE A 1  683  ? -17.847 -0.484  78.898  1.00 91.17  ? 683  ILE A N     1 
ATOM   5186  C  CA    . ILE A 1  683  ? -16.956 0.665   78.788  1.00 91.17  ? 683  ILE A CA    1 
ATOM   5187  C  C     . ILE A 1  683  ? -17.090 1.628   79.974  1.00 91.56  ? 683  ILE A C     1 
ATOM   5188  O  O     . ILE A 1  683  ? -16.085 2.096   80.501  1.00 91.53  ? 683  ILE A O     1 
ATOM   5189  C  CB    . ILE A 1  683  ? -17.107 1.392   77.423  1.00 90.89  ? 683  ILE A CB    1 
ATOM   5190  C  CG1   . ILE A 1  683  ? -16.425 0.593   76.316  1.00 89.66  ? 683  ILE A CG1   1 
ATOM   5191  C  CG2   . ILE A 1  683  ? -16.501 2.796   77.469  1.00 91.00  ? 683  ILE A CG2   1 
ATOM   5192  C  CD1   . ILE A 1  683  ? -14.918 0.569   76.407  1.00 87.29  ? 683  ILE A CD1   1 
ATOM   5193  N  N     . ALA A 1  684  ? -18.324 1.897   80.398  1.00 92.23  ? 684  ALA A N     1 
ATOM   5194  C  CA    . ALA A 1  684  ? -18.610 2.830   81.506  1.00 92.81  ? 684  ALA A CA    1 
ATOM   5195  C  C     . ALA A 1  684  ? -17.913 2.472   82.829  1.00 93.06  ? 684  ALA A C     1 
ATOM   5196  O  O     . ALA A 1  684  ? -17.276 3.331   83.448  1.00 92.84  ? 684  ALA A O     1 
ATOM   5197  C  CB    . ALA A 1  684  ? -20.132 2.977   81.717  1.00 92.94  ? 684  ALA A CB    1 
ATOM   5198  N  N     . GLU A 1  685  ? -18.041 1.210   83.248  1.00 93.36  ? 685  GLU A N     1 
ATOM   5199  C  CA    . GLU A 1  685  ? -17.371 0.697   84.446  1.00 93.70  ? 685  GLU A CA    1 
ATOM   5200  C  C     . GLU A 1  685  ? -15.849 0.856   84.364  1.00 93.38  ? 685  GLU A C     1 
ATOM   5201  O  O     . GLU A 1  685  ? -15.203 1.055   85.389  1.00 93.39  ? 685  GLU A O     1 
ATOM   5202  C  CB    . GLU A 1  685  ? -17.740 -0.774  84.700  1.00 93.68  ? 685  GLU A CB    1 
ATOM   5203  C  CG    . GLU A 1  685  ? -17.059 -1.772  83.741  1.00 94.63  ? 685  GLU A CG    1 
ATOM   5204  C  CD    . GLU A 1  685  ? -17.443 -3.236  83.970  1.00 94.74  ? 685  GLU A CD    1 
ATOM   5205  O  OE1   . GLU A 1  685  ? -17.602 -3.660  85.144  1.00 96.32  ? 685  GLU A OE1   1 
ATOM   5206  O  OE2   . GLU A 1  685  ? -17.566 -3.968  82.958  1.00 95.31  ? 685  GLU A OE2   1 
ATOM   5207  N  N     . ALA A 1  686  ? -15.299 0.769   83.148  1.00 93.14  ? 686  ALA A N     1 
ATOM   5208  C  CA    . ALA A 1  686  ? -13.855 0.897   82.910  1.00 92.96  ? 686  ALA A CA    1 
ATOM   5209  C  C     . ALA A 1  686  ? -13.378 2.349   82.726  1.00 92.93  ? 686  ALA A C     1 
ATOM   5210  O  O     . ALA A 1  686  ? -12.213 2.659   82.971  1.00 92.65  ? 686  ALA A O     1 
ATOM   5211  C  CB    . ALA A 1  686  ? -13.427 0.035   81.748  1.00 92.85  ? 686  ALA A CB    1 
ATOM   5212  N  N     . LYS A 1  687  ? -14.273 3.232   82.291  1.00 93.14  ? 687  LYS A N     1 
ATOM   5213  C  CA    . LYS A 1  687  ? -14.026 4.676   82.376  1.00 93.18  ? 687  LYS A CA    1 
ATOM   5214  C  C     . LYS A 1  687  ? -14.204 5.133   83.823  1.00 93.11  ? 687  LYS A C     1 
ATOM   5215  O  O     . LYS A 1  687  ? -13.363 5.865   84.353  1.00 93.15  ? 687  LYS A O     1 
ATOM   5216  C  CB    . LYS A 1  687  ? -14.974 5.471   81.471  1.00 93.31  ? 687  LYS A CB    1 
ATOM   5217  C  CG    . LYS A 1  687  ? -14.517 5.633   80.024  1.00 93.67  ? 687  LYS A CG    1 
ATOM   5218  C  CD    . LYS A 1  687  ? -14.839 7.033   79.473  1.00 94.76  ? 687  LYS A CD    1 
ATOM   5219  C  CE    . LYS A 1  687  ? -16.312 7.220   79.093  1.00 95.41  ? 687  LYS A CE    1 
ATOM   5220  N  NZ    . LYS A 1  687  ? -17.251 7.354   80.254  1.00 95.30  ? 687  LYS A NZ    1 
ATOM   5221  N  N     . LYS A 1  688  ? -15.298 4.683   84.447  1.00 92.79  ? 688  LYS A N     1 
ATOM   5222  C  CA    . LYS A 1  688  ? -15.639 5.018   85.825  1.00 92.51  ? 688  LYS A CA    1 
ATOM   5223  C  C     . LYS A 1  688  ? -14.727 4.288   86.815  1.00 92.13  ? 688  LYS A C     1 
ATOM   5224  O  O     . LYS A 1  688  ? -14.803 4.494   88.021  1.00 92.09  ? 688  LYS A O     1 
ATOM   5225  C  CB    . LYS A 1  688  ? -17.113 4.700   86.070  1.00 92.69  ? 688  LYS A CB    1 
ATOM   5226  C  CG    . LYS A 1  688  ? -17.722 5.309   87.315  1.00 93.47  ? 688  LYS A CG    1 
ATOM   5227  C  CD    . LYS A 1  688  ? -17.962 4.257   88.406  1.00 93.73  ? 688  LYS A CD    1 
ATOM   5228  C  CE    . LYS A 1  688  ? -18.626 4.884   89.631  1.00 94.22  ? 688  LYS A CE    1 
ATOM   5229  N  NZ    . LYS A 1  688  ? -19.864 5.637   89.268  1.00 94.59  ? 688  LYS A NZ    1 
ATOM   5230  N  N     . LYS A 1  689  ? -13.848 3.450   86.289  1.00 91.78  ? 689  LYS A N     1 
ATOM   5231  C  CA    . LYS A 1  689  ? -12.842 2.788   87.094  1.00 91.62  ? 689  LYS A CA    1 
ATOM   5232  C  C     . LYS A 1  689  ? -11.532 3.561   87.059  1.00 91.59  ? 689  LYS A C     1 
ATOM   5233  O  O     . LYS A 1  689  ? -10.826 3.601   88.059  1.00 91.87  ? 689  LYS A O     1 
ATOM   5234  C  CB    . LYS A 1  689  ? -12.649 1.364   86.600  1.00 91.66  ? 689  LYS A CB    1 
ATOM   5235  C  CG    . LYS A 1  689  ? -11.633 0.539   87.331  1.00 91.69  ? 689  LYS A CG    1 
ATOM   5236  C  CD    . LYS A 1  689  ? -11.974 -0.922  87.153  1.00 91.76  ? 689  LYS A CD    1 
ATOM   5237  C  CE    . LYS A 1  689  ? -10.725 -1.753  87.014  1.00 92.35  ? 689  LYS A CE    1 
ATOM   5238  N  NZ    . LYS A 1  689  ? -11.005 -3.195  87.248  1.00 92.55  ? 689  LYS A NZ    1 
ATOM   5239  N  N     . VAL A 1  690  ? -11.210 4.168   85.916  1.00 91.40  ? 690  VAL A N     1 
ATOM   5240  C  CA    . VAL A 1  690  ? -10.059 5.070   85.820  1.00 91.17  ? 690  VAL A CA    1 
ATOM   5241  C  C     . VAL A 1  690  ? -10.331 6.328   86.619  1.00 91.19  ? 690  VAL A C     1 
ATOM   5242  O  O     . VAL A 1  690  ? -9.411  6.909   87.180  1.00 91.27  ? 690  VAL A O     1 
ATOM   5243  C  CB    . VAL A 1  690  ? -9.740  5.475   84.371  1.00 91.14  ? 690  VAL A CB    1 
ATOM   5244  C  CG1   . VAL A 1  690  ? -8.597  6.473   84.327  1.00 90.70  ? 690  VAL A CG1   1 
ATOM   5245  C  CG2   . VAL A 1  690  ? -9.375  4.264   83.553  1.00 91.49  ? 690  VAL A CG2   1 
ATOM   5246  N  N     . LEU A 1  691  ? -11.598 6.738   86.672  1.00 91.25  ? 691  LEU A N     1 
ATOM   5247  C  CA    . LEU A 1  691  ? -12.013 7.898   87.460  1.00 91.24  ? 691  LEU A CA    1 
ATOM   5248  C  C     . LEU A 1  691  ? -11.738 7.698   88.934  1.00 91.45  ? 691  LEU A C     1 
ATOM   5249  O  O     . LEU A 1  691  ? -11.484 8.654   89.639  1.00 91.60  ? 691  LEU A O     1 
ATOM   5250  C  CB    . LEU A 1  691  ? -13.500 8.204   87.271  1.00 91.15  ? 691  LEU A CB    1 
ATOM   5251  C  CG    . LEU A 1  691  ? -14.064 9.406   88.039  1.00 90.63  ? 691  LEU A CG    1 
ATOM   5252  C  CD1   . LEU A 1  691  ? -13.859 10.693  87.257  1.00 89.81  ? 691  LEU A CD1   1 
ATOM   5253  C  CD2   . LEU A 1  691  ? -15.540 9.206   88.384  1.00 90.66  ? 691  LEU A CD2   1 
ATOM   5254  N  N     . ASP A 1  692  ? -11.791 6.461   89.406  1.00 91.84  ? 692  ASP A N     1 
ATOM   5255  C  CA    . ASP A 1  692  ? -11.550 6.210   90.824  1.00 92.34  ? 692  ASP A CA    1 
ATOM   5256  C  C     . ASP A 1  692  ? -10.079 6.048   91.205  1.00 92.49  ? 692  ASP A C     1 
ATOM   5257  O  O     . ASP A 1  692  ? -9.677  6.472   92.289  1.00 92.63  ? 692  ASP A O     1 
ATOM   5258  C  CB    . ASP A 1  692  ? -12.406 5.051   91.330  1.00 92.48  ? 692  ASP A CB    1 
ATOM   5259  C  CG    . ASP A 1  692  ? -13.833 5.484   91.661  1.00 92.60  ? 692  ASP A CG    1 
ATOM   5260  O  OD1   . ASP A 1  692  ? -14.213 6.639   91.339  1.00 92.75  ? 692  ASP A OD1   1 
ATOM   5261  O  OD2   . ASP A 1  692  ? -14.575 4.665   92.246  1.00 92.15  ? 692  ASP A OD2   1 
ATOM   5262  N  N     . VAL A 1  693  ? -9.288  5.444   90.319  1.00 92.66  ? 693  VAL A N     1 
ATOM   5263  C  CA    . VAL A 1  693  ? -7.836  5.426   90.469  1.00 92.84  ? 693  VAL A CA    1 
ATOM   5264  C  C     . VAL A 1  693  ? -7.320  6.859   90.493  1.00 93.35  ? 693  VAL A C     1 
ATOM   5265  O  O     . VAL A 1  693  ? -6.669  7.259   91.450  1.00 93.50  ? 693  VAL A O     1 
ATOM   5266  C  CB    . VAL A 1  693  ? -7.154  4.644   89.345  1.00 92.55  ? 693  VAL A CB    1 
ATOM   5267  C  CG1   . VAL A 1  693  ? -5.663  4.833   89.405  1.00 92.49  ? 693  VAL A CG1   1 
ATOM   5268  C  CG2   . VAL A 1  693  ? -7.478  3.180   89.463  1.00 92.89  ? 693  VAL A CG2   1 
ATOM   5269  N  N     . THR A 1  694  ? -7.635  7.625   89.448  1.00 94.04  ? 694  THR A N     1 
ATOM   5270  C  CA    . THR A 1  694  ? -7.340  9.065   89.376  1.00 94.63  ? 694  THR A CA    1 
ATOM   5271  C  C     . THR A 1  694  ? -7.802  9.814   90.630  1.00 95.22  ? 694  THR A C     1 
ATOM   5272  O  O     . THR A 1  694  ? -7.098  10.678  91.139  1.00 95.20  ? 694  THR A O     1 
ATOM   5273  C  CB    . THR A 1  694  ? -8.003  9.701   88.136  1.00 94.45  ? 694  THR A CB    1 
ATOM   5274  O  OG1   . THR A 1  694  ? -7.607  8.983   86.968  1.00 94.33  ? 694  THR A OG1   1 
ATOM   5275  C  CG2   . THR A 1  694  ? -7.594  11.145  87.971  1.00 94.77  ? 694  THR A CG2   1 
ATOM   5276  N  N     . LYS A 1  695  ? -8.988  9.475   91.121  1.00 96.15  ? 695  LYS A N     1 
ATOM   5277  C  CA    . LYS A 1  695  ? -9.501  10.037  92.366  1.00 97.16  ? 695  LYS A CA    1 
ATOM   5278  C  C     . LYS A 1  695  ? -8.512  9.735   93.493  1.00 97.60  ? 695  LYS A C     1 
ATOM   5279  O  O     . LYS A 1  695  ? -8.019  10.644  94.164  1.00 97.91  ? 695  LYS A O     1 
ATOM   5280  C  CB    . LYS A 1  695  ? -10.901 9.471   92.668  1.00 97.20  ? 695  LYS A CB    1 
ATOM   5281  C  CG    . LYS A 1  695  ? -11.657 10.169  93.799  1.00 97.90  ? 695  LYS A CG    1 
ATOM   5282  C  CD    . LYS A 1  695  ? -13.028 10.711  93.357  1.00 98.20  ? 695  LYS A CD    1 
ATOM   5283  C  CE    . LYS A 1  695  ? -12.941 12.199  92.991  1.00 98.46  ? 695  LYS A CE    1 
ATOM   5284  N  NZ    . LYS A 1  695  ? -14.270 12.816  92.701  1.00 98.42  ? 695  LYS A NZ    1 
ATOM   5285  N  N     . GLU A 1  696  ? -8.209  8.455   93.661  1.00 97.99  ? 696  GLU A N     1 
ATOM   5286  C  CA    . GLU A 1  696  ? -7.233  7.995   94.628  1.00 98.44  ? 696  GLU A CA    1 
ATOM   5287  C  C     . GLU A 1  696  ? -5.864  8.677   94.472  1.00 98.49  ? 696  GLU A C     1 
ATOM   5288  O  O     . GLU A 1  696  ? -5.416  9.349   95.392  1.00 98.74  ? 696  GLU A O     1 
ATOM   5289  C  CB    . GLU A 1  696  ? -7.133  6.478   94.532  1.00 98.62  ? 696  GLU A CB    1 
ATOM   5290  C  CG    . GLU A 1  696  ? -5.876  5.852   95.080  1.00 100.07 ? 696  GLU A CG    1 
ATOM   5291  C  CD    . GLU A 1  696  ? -5.954  4.337   95.062  1.00 102.06 ? 696  GLU A CD    1 
ATOM   5292  O  OE1   . GLU A 1  696  ? -6.857  3.778   95.743  1.00 102.95 ? 696  GLU A OE1   1 
ATOM   5293  O  OE2   . GLU A 1  696  ? -5.115  3.712   94.369  1.00 101.82 ? 696  GLU A OE2   1 
ATOM   5294  N  N     . ALA A 1  697  ? -5.217  8.543   93.317  1.00 98.55  ? 697  ALA A N     1 
ATOM   5295  C  CA    . ALA A 1  697  ? -3.866  9.098   93.111  1.00 98.76  ? 697  ALA A CA    1 
ATOM   5296  C  C     . ALA A 1  697  ? -3.749  10.591  93.421  1.00 98.95  ? 697  ALA A C     1 
ATOM   5297  O  O     . ALA A 1  697  ? -2.643  11.135  93.507  1.00 98.88  ? 697  ALA A O     1 
ATOM   5298  C  CB    . ALA A 1  697  ? -3.383  8.825   91.694  1.00 98.77  ? 697  ALA A CB    1 
ATOM   5299  N  N     . GLN A 1  698  ? -4.898  11.237  93.586  1.00 99.16  ? 698  GLN A N     1 
ATOM   5300  C  CA    . GLN A 1  698  ? -4.964  12.670  93.814  1.00 99.57  ? 698  GLN A CA    1 
ATOM   5301  C  C     . GLN A 1  698  ? -5.052  12.991  95.292  1.00 99.48  ? 698  GLN A C     1 
ATOM   5302  O  O     . GLN A 1  698  ? -4.859  14.137  95.698  1.00 99.48  ? 698  GLN A O     1 
ATOM   5303  C  CB    . GLN A 1  698  ? -6.140  13.282  93.042  1.00 99.59  ? 698  GLN A CB    1 
ATOM   5304  C  CG    . GLN A 1  698  ? -5.833  13.498  91.549  1.00 100.33 ? 698  GLN A CG    1 
ATOM   5305  C  CD    . GLN A 1  698  ? -7.018  13.994  90.724  1.00 100.23 ? 698  GLN A CD    1 
ATOM   5306  O  OE1   . GLN A 1  698  ? -8.186  13.869  91.126  1.00 100.19 ? 698  GLN A OE1   1 
ATOM   5307  N  NE2   . GLN A 1  698  ? -6.715  14.552  89.548  1.00 101.01 ? 698  GLN A NE2   1 
ATOM   5308  N  N     . ALA A 1  699  ? -5.348  11.968  96.087  1.00 99.69  ? 699  ALA A N     1 
ATOM   5309  C  CA    . ALA A 1  699  ? -5.344  12.081  97.543  1.00 100.08 ? 699  ALA A CA    1 
ATOM   5310  C  C     . ALA A 1  699  ? -4.196  11.261  98.127  1.00 100.42 ? 699  ALA A C     1 
ATOM   5311  O  O     . ALA A 1  699  ? -4.290  10.736  99.241  1.00 100.41 ? 699  ALA A O     1 
ATOM   5312  C  CB    . ALA A 1  699  ? -6.675  11.641  98.124  1.00 99.96  ? 699  ALA A CB    1 
ATOM   5313  N  N     . ASN A 1  700  ? -3.126  11.150  97.338  1.00 100.87 ? 700  ASN A N     1 
ATOM   5314  C  CA    . ASN A 1  700  ? -1.843  10.570  97.758  1.00 101.32 ? 700  ASN A CA    1 
ATOM   5315  C  C     . ASN A 1  700  ? -1.947  9.222   98.481  1.00 101.67 ? 700  ASN A C     1 
ATOM   5316  O  O     . ASN A 1  700  ? -1.233  8.966   99.449  1.00 101.86 ? 700  ASN A O     1 
ATOM   5317  C  CB    . ASN A 1  700  ? -1.050  11.586  98.597  1.00 101.18 ? 700  ASN A CB    1 
ATOM   5318  C  CG    . ASN A 1  700  ? 0.446   11.536  98.333  1.00 101.09 ? 700  ASN A CG    1 
ATOM   5319  O  OD1   . ASN A 1  700  ? 0.982   10.539  97.839  1.00 101.23 ? 700  ASN A OD1   1 
ATOM   5320  N  ND2   . ASN A 1  700  ? 1.129   12.623  98.660  1.00 100.94 ? 700  ASN A ND2   1 
ATOM   5321  N  N     . LEU A 1  701  ? -2.847  8.369   98.004  1.00 102.14 ? 701  LEU A N     1 
ATOM   5322  C  CA    . LEU A 1  701  ? -2.965  7.005   98.509  1.00 102.60 ? 701  LEU A CA    1 
ATOM   5323  C  C     . LEU A 1  701  ? -2.377  5.987   97.513  1.00 103.08 ? 701  LEU A C     1 
ATOM   5324  O  O     . LEU A 1  701  ? -2.108  4.838   97.877  1.00 103.06 ? 701  LEU A O     1 
ATOM   5325  C  CB    . LEU A 1  701  ? -4.428  6.669   98.832  1.00 102.52 ? 701  LEU A CB    1 
ATOM   5326  C  CG    . LEU A 1  701  ? -5.248  7.632   99.696  1.00 102.24 ? 701  LEU A CG    1 
ATOM   5327  C  CD1   . LEU A 1  701  ? -6.731  7.324   99.576  1.00 102.05 ? 701  LEU A CD1   1 
ATOM   5328  C  CD2   . LEU A 1  701  ? -4.810  7.575   101.146 1.00 102.47 ? 701  LEU A CD2   1 
ATOM   5329  N  N     . LEU A 1  702  ? -2.178  6.409   96.262  1.00 103.62 ? 702  LEU A N     1 
ATOM   5330  C  CA    . LEU A 1  702  ? -1.546  5.554   95.257  1.00 104.22 ? 702  LEU A CA    1 
ATOM   5331  C  C     . LEU A 1  702  ? -0.111  5.243   95.677  1.00 104.60 ? 702  LEU A C     1 
ATOM   5332  O  O     . LEU A 1  702  ? 0.725   6.147   95.799  1.00 104.58 ? 702  LEU A O     1 
ATOM   5333  C  CB    . LEU A 1  702  ? -1.561  6.212   93.866  1.00 104.30 ? 702  LEU A CB    1 
ATOM   5334  C  CG    . LEU A 1  702  ? -1.586  5.401   92.549  1.00 104.26 ? 702  LEU A CG    1 
ATOM   5335  C  CD1   . LEU A 1  702  ? -0.700  4.152   92.521  1.00 103.97 ? 702  LEU A CD1   1 
ATOM   5336  C  CD2   . LEU A 1  702  ? -3.002  5.027   92.179  1.00 105.03 ? 702  LEU A CD2   1 
ATOM   5337  N  N     . THR A 1  703  ? 0.145   3.954   95.901  1.00 105.16 ? 703  THR A N     1 
ATOM   5338  C  CA    . THR A 1  703  ? 1.450   3.435   96.325  1.00 105.70 ? 703  THR A CA    1 
ATOM   5339  C  C     . THR A 1  703  ? 2.429   3.307   95.146  1.00 105.97 ? 703  THR A C     1 
ATOM   5340  O  O     . THR A 1  703  ? 2.065   2.826   94.066  1.00 106.06 ? 703  THR A O     1 
ATOM   5341  C  CB    . THR A 1  703  ? 1.289   2.059   97.055  1.00 105.76 ? 703  THR A CB    1 
ATOM   5342  O  OG1   . THR A 1  703  ? 0.456   2.220   98.212  1.00 105.75 ? 703  THR A OG1   1 
ATOM   5343  C  CG2   . THR A 1  703  ? 2.640   1.474   97.486  1.00 105.85 ? 703  THR A CG2   1 
ATOM   5344  N  N     . ALA A 1  704  ? 3.671   3.739   95.370  1.00 106.26 ? 704  ALA A N     1 
ATOM   5345  C  CA    . ALA A 1  704  ? 4.740   3.658   94.371  1.00 106.40 ? 704  ALA A CA    1 
ATOM   5346  C  C     . ALA A 1  704  ? 5.277   2.236   94.219  1.00 106.44 ? 704  ALA A C     1 
ATOM   5347  O  O     . ALA A 1  704  ? 6.068   1.766   95.047  1.00 106.36 ? 704  ALA A O     1 
ATOM   5348  C  CB    . ALA A 1  704  ? 5.879   4.623   94.730  1.00 106.51 ? 704  ALA A CB    1 
ATOM   5349  N  N     . LYS A 1  705  ? 4.835   1.560   93.161  1.00 106.54 ? 705  LYS A N     1 
ATOM   5350  C  CA    . LYS A 1  705  ? 5.340   0.226   92.798  1.00 106.73 ? 705  LYS A CA    1 
ATOM   5351  C  C     . LYS A 1  705  ? 6.868   0.288   92.617  1.00 106.32 ? 705  LYS A C     1 
ATOM   5352  O  O     . LYS A 1  705  ? 7.375   1.186   91.930  1.00 106.38 ? 705  LYS A O     1 
ATOM   5353  C  CB    . LYS A 1  705  ? 4.642   -0.281  91.516  1.00 107.02 ? 705  LYS A CB    1 
ATOM   5354  C  CG    . LYS A 1  705  ? 3.117   -0.530  91.654  1.00 107.37 ? 705  LYS A CG    1 
ATOM   5355  C  CD    . LYS A 1  705  ? 2.379   -0.635  90.303  1.00 107.14 ? 705  LYS A CD    1 
ATOM   5356  C  CE    . LYS A 1  705  ? 0.909   -1.060  90.509  1.00 107.38 ? 705  LYS A CE    1 
ATOM   5357  N  NZ    . LYS A 1  705  ? 0.118   -1.228  89.242  1.00 107.55 ? 705  LYS A NZ    1 
ATOM   5358  N  N     . HIS A 1  706  ? 7.600   -0.639  93.241  1.00 105.64 ? 706  HIS A N     1 
ATOM   5359  C  CA    . HIS A 1  706  ? 9.056   -0.500  93.319  1.00 104.95 ? 706  HIS A CA    1 
ATOM   5360  C  C     . HIS A 1  706  ? 9.687   -0.189  91.963  1.00 104.14 ? 706  HIS A C     1 
ATOM   5361  O  O     . HIS A 1  706  ? 9.420   -0.867  90.972  1.00 103.89 ? 706  HIS A O     1 
ATOM   5362  C  CB    . HIS A 1  706  ? 9.733   -1.711  93.975  1.00 105.19 ? 706  HIS A CB    1 
ATOM   5363  C  CG    . HIS A 1  706  ? 11.210  -1.533  94.169  1.00 106.15 ? 706  HIS A CG    1 
ATOM   5364  N  ND1   . HIS A 1  706  ? 11.745  -0.828  95.228  1.00 107.09 ? 706  HIS A ND1   1 
ATOM   5365  C  CD2   . HIS A 1  706  ? 12.264  -1.940  93.420  1.00 107.09 ? 706  HIS A CD2   1 
ATOM   5366  C  CE1   . HIS A 1  706  ? 13.063  -0.820  95.131  1.00 107.34 ? 706  HIS A CE1   1 
ATOM   5367  N  NE2   . HIS A 1  706  ? 13.404  -1.488  94.043  1.00 107.47 ? 706  HIS A NE2   1 
ATOM   5368  N  N     . GLY A 1  707  ? 10.493  0.869   91.940  1.00 103.41 ? 707  GLY A N     1 
ATOM   5369  C  CA    . GLY A 1  707  ? 11.280  1.251   90.769  1.00 102.35 ? 707  GLY A CA    1 
ATOM   5370  C  C     . GLY A 1  707  ? 10.477  1.831   89.622  1.00 101.60 ? 707  GLY A C     1 
ATOM   5371  O  O     . GLY A 1  707  ? 10.487  1.270   88.530  1.00 101.71 ? 707  GLY A O     1 
ATOM   5372  N  N     . MET A 1  708  ? 9.764   2.932   89.890  1.00 100.71 ? 708  MET A N     1 
ATOM   5373  C  CA    . MET A 1  708  ? 9.082   3.785   88.880  1.00 99.71  ? 708  MET A CA    1 
ATOM   5374  C  C     . MET A 1  708  ? 8.487   5.023   89.557  1.00 98.75  ? 708  MET A C     1 
ATOM   5375  O  O     . MET A 1  708  ? 8.305   5.025   90.775  1.00 98.97  ? 708  MET A O     1 
ATOM   5376  C  CB    . MET A 1  708  ? 8.014   3.031   88.051  1.00 99.64  ? 708  MET A CB    1 
ATOM   5377  C  CG    . MET A 1  708  ? 7.077   2.080   88.821  1.00 99.99  ? 708  MET A CG    1 
ATOM   5378  S  SD    . MET A 1  708  ? 5.968   1.031   87.807  1.00 100.46 ? 708  MET A SD    1 
ATOM   5379  C  CE    . MET A 1  708  ? 7.113   0.028   86.841  1.00 99.47  ? 708  MET A CE    1 
ATOM   5380  N  N     . THR A 1  709  ? 8.208   6.069   88.778  1.00 97.48  ? 709  THR A N     1 
ATOM   5381  C  CA    . THR A 1  709  ? 7.552   7.292   89.276  1.00 96.48  ? 709  THR A CA    1 
ATOM   5382  C  C     . THR A 1  709  ? 6.205   6.983   89.945  1.00 95.96  ? 709  THR A C     1 
ATOM   5383  O  O     . THR A 1  709  ? 5.620   5.921   89.697  1.00 96.10  ? 709  THR A O     1 
ATOM   5384  C  CB    . THR A 1  709  ? 7.245   8.263   88.113  1.00 96.35  ? 709  THR A CB    1 
ATOM   5385  O  OG1   . THR A 1  709  ? 8.294   8.214   87.150  1.00 96.29  ? 709  THR A OG1   1 
ATOM   5386  C  CG2   . THR A 1  709  ? 7.068   9.688   88.597  1.00 96.15  ? 709  THR A CG2   1 
ATOM   5387  N  N     . LEU A 1  710  ? 5.706   7.901   90.780  1.00 94.87  ? 710  LEU A N     1 
ATOM   5388  C  CA    . LEU A 1  710  ? 4.308   7.833   91.192  1.00 93.89  ? 710  LEU A CA    1 
ATOM   5389  C  C     . LEU A 1  710  ? 3.401   8.012   89.973  1.00 93.26  ? 710  LEU A C     1 
ATOM   5390  O  O     . LEU A 1  710  ? 2.470   7.237   89.779  1.00 93.35  ? 710  LEU A O     1 
ATOM   5391  C  CB    . LEU A 1  710  ? 3.968   8.829   92.309  1.00 93.96  ? 710  LEU A CB    1 
ATOM   5392  C  CG    . LEU A 1  710  ? 3.750   8.205   93.706  1.00 94.15  ? 710  LEU A CG    1 
ATOM   5393  C  CD1   . LEU A 1  710  ? 4.991   8.360   94.592  1.00 94.62  ? 710  LEU A CD1   1 
ATOM   5394  C  CD2   . LEU A 1  710  ? 2.506   8.751   94.436  1.00 93.43  ? 710  LEU A CD2   1 
ATOM   5395  N  N     . ARG A 1  711  ? 3.699   9.008   89.141  1.00 92.44  ? 711  ARG A N     1 
ATOM   5396  C  CA    . ARG A 1  711  ? 3.014   9.188   87.859  1.00 91.65  ? 711  ARG A CA    1 
ATOM   5397  C  C     . ARG A 1  711  ? 3.082   7.955   86.969  1.00 91.20  ? 711  ARG A C     1 
ATOM   5398  O  O     . ARG A 1  711  ? 2.059   7.494   86.477  1.00 91.13  ? 711  ARG A O     1 
ATOM   5399  C  CB    . ARG A 1  711  ? 3.605   10.365  87.089  1.00 91.73  ? 711  ARG A CB    1 
ATOM   5400  C  CG    . ARG A 1  711  ? 2.964   11.691  87.396  1.00 91.83  ? 711  ARG A CG    1 
ATOM   5401  C  CD    . ARG A 1  711  ? 3.330   12.741  86.363  1.00 91.81  ? 711  ARG A CD    1 
ATOM   5402  N  NE    . ARG A 1  711  ? 2.670   13.998  86.672  1.00 92.45  ? 711  ARG A NE    1 
ATOM   5403  C  CZ    . ARG A 1  711  ? 3.139   14.899  87.530  1.00 93.21  ? 711  ARG A CZ    1 
ATOM   5404  N  NH1   . ARG A 1  711  ? 4.292   14.681  88.154  1.00 93.08  ? 711  ARG A NH1   1 
ATOM   5405  N  NH2   . ARG A 1  711  ? 2.458   16.023  87.757  1.00 93.52  ? 711  ARG A NH2   1 
ATOM   5406  N  N     . GLU A 1  712  ? 4.292   7.435   86.761  1.00 90.68  ? 712  GLU A N     1 
ATOM   5407  C  CA    . GLU A 1  712  ? 4.537   6.317   85.844  1.00 90.09  ? 712  GLU A CA    1 
ATOM   5408  C  C     . GLU A 1  712  ? 3.661   5.110   86.108  1.00 89.33  ? 712  GLU A C     1 
ATOM   5409  O  O     . GLU A 1  712  ? 3.155   4.493   85.174  1.00 88.98  ? 712  GLU A O     1 
ATOM   5410  C  CB    . GLU A 1  712  ? 5.999   5.887   85.889  1.00 90.43  ? 712  GLU A CB    1 
ATOM   5411  C  CG    . GLU A 1  712  ? 6.890   6.525   84.835  1.00 91.49  ? 712  GLU A CG    1 
ATOM   5412  C  CD    . GLU A 1  712  ? 8.187   5.742   84.606  1.00 93.39  ? 712  GLU A CD    1 
ATOM   5413  O  OE1   . GLU A 1  712  ? 8.660   5.029   85.526  1.00 94.72  ? 712  GLU A OE1   1 
ATOM   5414  O  OE2   . GLU A 1  712  ? 8.737   5.839   83.490  1.00 94.05  ? 712  GLU A OE2   1 
ATOM   5415  N  N     . SER A 1  713  ? 3.491   4.769   87.379  1.00 88.80  ? 713  SER A N     1 
ATOM   5416  C  CA    . SER A 1  713  ? 2.639   3.645   87.741  1.00 88.59  ? 713  SER A CA    1 
ATOM   5417  C  C     . SER A 1  713  ? 1.156   3.979   87.570  1.00 88.39  ? 713  SER A C     1 
ATOM   5418  O  O     . SER A 1  713  ? 0.320   3.079   87.508  1.00 88.48  ? 713  SER A O     1 
ATOM   5419  C  CB    . SER A 1  713  ? 2.928   3.162   89.161  1.00 88.50  ? 713  SER A CB    1 
ATOM   5420  O  OG    . SER A 1  713  ? 2.414   4.075   90.105  1.00 88.49  ? 713  SER A OG    1 
ATOM   5421  N  N     . PHE A 1  714  ? 0.833   5.266   87.488  1.00 88.09  ? 714  PHE A N     1 
ATOM   5422  C  CA    . PHE A 1  714  ? -0.536  5.682   87.198  1.00 87.85  ? 714  PHE A CA    1 
ATOM   5423  C  C     . PHE A 1  714  ? -0.839  5.623   85.700  1.00 87.78  ? 714  PHE A C     1 
ATOM   5424  O  O     . PHE A 1  714  ? -1.942  5.233   85.322  1.00 87.76  ? 714  PHE A O     1 
ATOM   5425  C  CB    . PHE A 1  714  ? -0.835  7.070   87.777  1.00 87.83  ? 714  PHE A CB    1 
ATOM   5426  C  CG    . PHE A 1  714  ? -2.083  7.711   87.226  1.00 87.42  ? 714  PHE A CG    1 
ATOM   5427  C  CD1   . PHE A 1  714  ? -3.309  7.524   87.855  1.00 86.85  ? 714  PHE A CD1   1 
ATOM   5428  C  CD2   . PHE A 1  714  ? -2.022  8.514   86.082  1.00 86.77  ? 714  PHE A CD2   1 
ATOM   5429  C  CE1   . PHE A 1  714  ? -4.455  8.118   87.356  1.00 86.74  ? 714  PHE A CE1   1 
ATOM   5430  C  CE2   . PHE A 1  714  ? -3.157  9.106   85.568  1.00 86.46  ? 714  PHE A CE2   1 
ATOM   5431  C  CZ    . PHE A 1  714  ? -4.381  8.910   86.207  1.00 87.13  ? 714  PHE A CZ    1 
ATOM   5432  N  N     . GLU A 1  715  ? 0.117   6.020   84.852  1.00 87.71  ? 715  GLU A N     1 
ATOM   5433  C  CA    . GLU A 1  715  ? -0.059  5.849   83.399  1.00 87.71  ? 715  GLU A CA    1 
ATOM   5434  C  C     . GLU A 1  715  ? -0.280  4.375   83.151  1.00 87.54  ? 715  GLU A C     1 
ATOM   5435  O  O     . GLU A 1  715  ? -1.281  3.981   82.557  1.00 87.78  ? 715  GLU A O     1 
ATOM   5436  C  CB    . GLU A 1  715  ? 1.130   6.358   82.560  1.00 87.64  ? 715  GLU A CB    1 
ATOM   5437  C  CG    . GLU A 1  715  ? 1.115   7.870   82.210  1.00 88.43  ? 715  GLU A CG    1 
ATOM   5438  C  CD    . GLU A 1  715  ? -0.239  8.386   81.694  1.00 88.66  ? 715  GLU A CD    1 
ATOM   5439  O  OE1   . GLU A 1  715  ? -0.919  7.629   80.971  1.00 88.06  ? 715  GLU A OE1   1 
ATOM   5440  O  OE2   . GLU A 1  715  ? -0.617  9.546   82.015  1.00 87.95  ? 715  GLU A OE2   1 
ATOM   5441  N  N     . ASP A 1  716  ? 0.633   3.567   83.671  1.00 87.16  ? 716  ASP A N     1 
ATOM   5442  C  CA    . ASP A 1  716  ? 0.527   2.134   83.563  1.00 86.94  ? 716  ASP A CA    1 
ATOM   5443  C  C     . ASP A 1  716  ? -0.777  1.565   84.129  1.00 85.99  ? 716  ASP A C     1 
ATOM   5444  O  O     . ASP A 1  716  ? -1.320  0.624   83.565  1.00 85.89  ? 716  ASP A O     1 
ATOM   5445  C  CB    . ASP A 1  716  ? 1.721   1.485   84.238  1.00 87.75  ? 716  ASP A CB    1 
ATOM   5446  C  CG    . ASP A 1  716  ? 1.961   0.073   83.749  1.00 90.37  ? 716  ASP A CG    1 
ATOM   5447  O  OD1   . ASP A 1  716  ? 1.230   -0.858  84.202  1.00 92.71  ? 716  ASP A OD1   1 
ATOM   5448  O  OD2   . ASP A 1  716  ? 2.893   -0.095  82.915  1.00 93.15  ? 716  ASP A OD2   1 
ATOM   5449  N  N     . ASN A 1  717  ? -1.278  2.118   85.232  1.00 85.10  ? 717  ASN A N     1 
ATOM   5450  C  CA    . ASN A 1  717  ? -2.574  1.681   85.792  1.00 84.30  ? 717  ASN A CA    1 
ATOM   5451  C  C     . ASN A 1  717  ? -3.728  1.930   84.820  1.00 83.98  ? 717  ASN A C     1 
ATOM   5452  O  O     . ASN A 1  717  ? -4.716  1.191   84.795  1.00 83.66  ? 717  ASN A O     1 
ATOM   5453  C  CB    . ASN A 1  717  ? -2.888  2.390   87.126  1.00 84.03  ? 717  ASN A CB    1 
ATOM   5454  C  CG    . ASN A 1  717  ? -2.481  1.584   88.355  1.00 82.90  ? 717  ASN A CG    1 
ATOM   5455  O  OD1   . ASN A 1  717  ? -2.070  0.426   88.262  1.00 82.33  ? 717  ASN A OD1   1 
ATOM   5456  N  ND2   . ASN A 1  717  ? -2.603  2.205   89.522  1.00 81.34  ? 717  ASN A ND2   1 
ATOM   5457  N  N     . VAL A 1  718  ? -3.592  2.989   84.030  1.00 83.63  ? 718  VAL A N     1 
ATOM   5458  C  CA    . VAL A 1  718  ? -4.677  3.447   83.193  1.00 83.47  ? 718  VAL A CA    1 
ATOM   5459  C  C     . VAL A 1  718  ? -4.652  2.712   81.866  1.00 83.16  ? 718  VAL A C     1 
ATOM   5460  O  O     . VAL A 1  718  ? -5.558  1.943   81.586  1.00 83.33  ? 718  VAL A O     1 
ATOM   5461  C  CB    . VAL A 1  718  ? -4.652  4.976   83.004  1.00 83.65  ? 718  VAL A CB    1 
ATOM   5462  C  CG1   . VAL A 1  718  ? -5.713  5.412   82.009  1.00 84.13  ? 718  VAL A CG1   1 
ATOM   5463  C  CG2   . VAL A 1  718  ? -4.882  5.674   84.335  1.00 83.62  ? 718  VAL A CG2   1 
ATOM   5464  N  N     . VAL A 1  719  ? -3.619  2.935   81.059  1.00 82.76  ? 719  VAL A N     1 
ATOM   5465  C  CA    . VAL A 1  719  ? -3.479  2.245   79.771  1.00 82.62  ? 719  VAL A CA    1 
ATOM   5466  C  C     . VAL A 1  719  ? -4.003  0.793   79.867  1.00 82.74  ? 719  VAL A C     1 
ATOM   5467  O  O     . VAL A 1  719  ? -4.904  0.383   79.127  1.00 82.59  ? 719  VAL A O     1 
ATOM   5468  C  CB    . VAL A 1  719  ? -2.000  2.285   79.248  1.00 82.41  ? 719  VAL A CB    1 
ATOM   5469  C  CG1   . VAL A 1  719  ? -1.902  1.774   77.819  1.00 82.72  ? 719  VAL A CG1   1 
ATOM   5470  C  CG2   . VAL A 1  719  ? -1.452  3.676   79.307  1.00 81.72  ? 719  VAL A CG2   1 
ATOM   5471  N  N     . ARG A 1  720  ? -3.454  0.040   80.810  1.00 82.92  ? 720  ARG A N     1 
ATOM   5472  C  CA    . ARG A 1  720  ? -3.858  -1.332  81.028  1.00 83.47  ? 720  ARG A CA    1 
ATOM   5473  C  C     . ARG A 1  720  ? -5.366  -1.480  81.308  1.00 83.14  ? 720  ARG A C     1 
ATOM   5474  O  O     . ARG A 1  720  ? -5.967  -2.444  80.848  1.00 83.40  ? 720  ARG A O     1 
ATOM   5475  C  CB    . ARG A 1  720  ? -3.025  -1.964  82.156  1.00 83.84  ? 720  ARG A CB    1 
ATOM   5476  C  CG    . ARG A 1  720  ? -1.667  -2.653  81.757  1.00 84.62  ? 720  ARG A CG    1 
ATOM   5477  C  CD    . ARG A 1  720  ? -0.996  -3.353  82.990  1.00 84.56  ? 720  ARG A CD    1 
ATOM   5478  N  NE    . ARG A 1  720  ? -2.004  -3.917  83.909  1.00 87.17  ? 720  ARG A NE    1 
ATOM   5479  C  CZ    . ARG A 1  720  ? -2.382  -3.382  85.078  1.00 87.56  ? 720  ARG A CZ    1 
ATOM   5480  N  NH1   . ARG A 1  720  ? -1.819  -2.265  85.539  1.00 87.80  ? 720  ARG A NH1   1 
ATOM   5481  N  NH2   . ARG A 1  720  ? -3.326  -3.976  85.803  1.00 87.39  ? 720  ARG A NH2   1 
ATOM   5482  N  N     . PHE A 1  721  ? -5.973  -0.540  82.040  1.00 82.79  ? 721  PHE A N     1 
ATOM   5483  C  CA    . PHE A 1  721  ? -7.417  -0.612  82.365  1.00 82.41  ? 721  PHE A CA    1 
ATOM   5484  C  C     . PHE A 1  721  ? -8.360  -0.321  81.199  1.00 82.31  ? 721  PHE A C     1 
ATOM   5485  O  O     . PHE A 1  721  ? -9.528  -0.707  81.252  1.00 82.45  ? 721  PHE A O     1 
ATOM   5486  C  CB    . PHE A 1  721  ? -7.794  0.329   83.512  1.00 82.44  ? 721  PHE A CB    1 
ATOM   5487  C  CG    . PHE A 1  721  ? -7.520  -0.214  84.883  1.00 82.42  ? 721  PHE A CG    1 
ATOM   5488  C  CD1   . PHE A 1  721  ? -7.826  0.552   86.000  1.00 81.97  ? 721  PHE A CD1   1 
ATOM   5489  C  CD2   . PHE A 1  721  ? -6.939  -1.472  85.064  1.00 83.28  ? 721  PHE A CD2   1 
ATOM   5490  C  CE1   . PHE A 1  721  ? -7.575  0.077   87.274  1.00 82.54  ? 721  PHE A CE1   1 
ATOM   5491  C  CE2   . PHE A 1  721  ? -6.677  -1.969  86.342  1.00 83.04  ? 721  PHE A CE2   1 
ATOM   5492  C  CZ    . PHE A 1  721  ? -6.995  -1.190  87.451  1.00 83.09  ? 721  PHE A CZ    1 
ATOM   5493  N  N     . LEU A 1  722  ? -7.864  0.380   80.173  1.00 82.19  ? 722  LEU A N     1 
ATOM   5494  C  CA    . LEU A 1  722  ? -8.654  0.738   78.977  1.00 81.85  ? 722  LEU A CA    1 
ATOM   5495  C  C     . LEU A 1  722  ? -8.317  -0.143  77.767  1.00 81.83  ? 722  LEU A C     1 
ATOM   5496  O  O     . LEU A 1  722  ? -9.196  -0.498  76.970  1.00 81.44  ? 722  LEU A O     1 
ATOM   5497  C  CB    . LEU A 1  722  ? -8.455  2.211   78.610  1.00 81.82  ? 722  LEU A CB    1 
ATOM   5498  C  CG    . LEU A 1  722  ? -8.869  3.332   79.565  1.00 80.92  ? 722  LEU A CG    1 
ATOM   5499  C  CD1   . LEU A 1  722  ? -8.145  4.590   79.133  1.00 80.69  ? 722  LEU A CD1   1 
ATOM   5500  C  CD2   . LEU A 1  722  ? -10.370 3.548   79.586  1.00 79.29  ? 722  LEU A CD2   1 
ATOM   5501  N  N     . ASN A 1  723  ? -7.040  -0.485  77.629  1.00 81.94  ? 723  ASN A N     1 
ATOM   5502  C  CA    . ASN A 1  723  ? -6.656  -1.555  76.729  1.00 82.43  ? 723  ASN A CA    1 
ATOM   5503  C  C     . ASN A 1  723  ? -7.423  -2.830  77.038  1.00 82.79  ? 723  ASN A C     1 
ATOM   5504  O  O     . ASN A 1  723  ? -7.654  -3.653  76.152  1.00 82.66  ? 723  ASN A O     1 
ATOM   5505  C  CB    . ASN A 1  723  ? -5.164  -1.823  76.821  1.00 82.51  ? 723  ASN A CB    1 
ATOM   5506  C  CG    . ASN A 1  723  ? -4.374  -1.042  75.799  1.00 82.66  ? 723  ASN A CG    1 
ATOM   5507  O  OD1   . ASN A 1  723  ? -4.410  0.187   75.783  1.00 82.58  ? 723  ASN A OD1   1 
ATOM   5508  N  ND2   . ASN A 1  723  ? -3.654  -1.752  74.934  1.00 82.56  ? 723  ASN A ND2   1 
ATOM   5509  N  N     . GLU A 1  724  ? -7.826  -2.976  78.298  1.00 83.36  ? 724  GLU A N     1 
ATOM   5510  C  CA    . GLU A 1  724  ? -8.598  -4.131  78.728  1.00 83.85  ? 724  GLU A CA    1 
ATOM   5511  C  C     . GLU A 1  724  ? -10.075 -4.013  78.492  1.00 83.47  ? 724  GLU A C     1 
ATOM   5512  O  O     . GLU A 1  724  ? -10.700 -4.994  78.118  1.00 83.64  ? 724  GLU A O     1 
ATOM   5513  C  CB    . GLU A 1  724  ? -8.295  -4.530  80.168  1.00 84.15  ? 724  GLU A CB    1 
ATOM   5514  C  CG    . GLU A 1  724  ? -7.368  -5.754  80.204  1.00 86.95  ? 724  GLU A CG    1 
ATOM   5515  C  CD    . GLU A 1  724  ? -6.564  -5.890  81.488  1.00 90.10  ? 724  GLU A CD    1 
ATOM   5516  O  OE1   . GLU A 1  724  ? -7.066  -5.456  82.559  1.00 92.53  ? 724  GLU A OE1   1 
ATOM   5517  O  OE2   . GLU A 1  724  ? -5.436  -6.445  81.416  1.00 90.08  ? 724  GLU A OE2   1 
ATOM   5518  N  N     . ALA A 1  725  ? -10.642 -2.830  78.685  1.00 83.42  ? 725  ALA A N     1 
ATOM   5519  C  CA    . ALA A 1  725  ? -12.042 -2.653  78.320  1.00 83.53  ? 725  ALA A CA    1 
ATOM   5520  C  C     . ALA A 1  725  ? -12.215 -3.024  76.841  1.00 83.62  ? 725  ALA A C     1 
ATOM   5521  O  O     . ALA A 1  725  ? -13.042 -3.887  76.520  1.00 83.80  ? 725  ALA A O     1 
ATOM   5522  C  CB    . ALA A 1  725  ? -12.535 -1.239  78.609  1.00 83.24  ? 725  ALA A CB    1 
ATOM   5523  N  N     . ARG A 1  726  ? -11.401 -2.430  75.960  1.00 83.39  ? 726  ARG A N     1 
ATOM   5524  C  CA    . ARG A 1  726  ? -11.588 -2.609  74.521  1.00 83.42  ? 726  ARG A CA    1 
ATOM   5525  C  C     . ARG A 1  726  ? -11.571 -4.067  74.099  1.00 83.83  ? 726  ARG A C     1 
ATOM   5526  O  O     . ARG A 1  726  ? -12.286 -4.455  73.171  1.00 83.79  ? 726  ARG A O     1 
ATOM   5527  C  CB    . ARG A 1  726  ? -10.527 -1.876  73.723  1.00 83.39  ? 726  ARG A CB    1 
ATOM   5528  C  CG    . ARG A 1  726  ? -10.600 -2.230  72.246  1.00 82.99  ? 726  ARG A CG    1 
ATOM   5529  C  CD    . ARG A 1  726  ? -9.380  -1.811  71.477  1.00 82.08  ? 726  ARG A CD    1 
ATOM   5530  N  NE    . ARG A 1  726  ? -8.233  -2.664  71.722  1.00 82.09  ? 726  ARG A NE    1 
ATOM   5531  C  CZ    . ARG A 1  726  ? -7.069  -2.215  72.170  1.00 84.19  ? 726  ARG A CZ    1 
ATOM   5532  N  NH1   . ARG A 1  726  ? -6.902  -0.924  72.427  1.00 84.44  ? 726  ARG A NH1   1 
ATOM   5533  N  NH2   . ARG A 1  726  ? -6.060  -3.054  72.356  1.00 86.44  ? 726  ARG A NH2   1 
ATOM   5534  N  N     . ASP A 1  727  ? -10.724 -4.849  74.769  1.00 84.37  ? 727  ASP A N     1 
ATOM   5535  C  CA    . ASP A 1  727  ? -10.538 -6.273  74.477  1.00 84.63  ? 727  ASP A CA    1 
ATOM   5536  C  C     . ASP A 1  727  ? -11.716 -7.066  74.958  1.00 84.66  ? 727  ASP A C     1 
ATOM   5537  O  O     . ASP A 1  727  ? -12.225 -7.916  74.234  1.00 84.82  ? 727  ASP A O     1 
ATOM   5538  C  CB    . ASP A 1  727  ? -9.287  -6.814  75.158  1.00 84.70  ? 727  ASP A CB    1 
ATOM   5539  C  CG    . ASP A 1  727  ? -8.030  -6.467  74.415  1.00 84.92  ? 727  ASP A CG    1 
ATOM   5540  O  OD1   . ASP A 1  727  ? -8.016  -5.439  73.687  1.00 83.72  ? 727  ASP A OD1   1 
ATOM   5541  O  OD2   . ASP A 1  727  ? -7.057  -7.238  74.570  1.00 86.55  ? 727  ASP A OD2   1 
ATOM   5542  N  N     . LYS A 1  728  ? -12.126 -6.790  76.193  1.00 84.60  ? 728  LYS A N     1 
ATOM   5543  C  CA    . LYS A 1  728  ? -13.324 -7.373  76.760  1.00 84.79  ? 728  LYS A CA    1 
ATOM   5544  C  C     . LYS A 1  728  ? -14.509 -7.064  75.844  1.00 84.60  ? 728  LYS A C     1 
ATOM   5545  O  O     . LYS A 1  728  ? -15.301 -7.959  75.525  1.00 84.63  ? 728  LYS A O     1 
ATOM   5546  C  CB    . LYS A 1  728  ? -13.560 -6.830  78.178  1.00 85.07  ? 728  LYS A CB    1 
ATOM   5547  C  CG    . LYS A 1  728  ? -14.805 -7.373  78.892  1.00 86.01  ? 728  LYS A CG    1 
ATOM   5548  C  CD    . LYS A 1  728  ? -14.494 -8.552  79.805  1.00 87.96  ? 728  LYS A CD    1 
ATOM   5549  C  CE    . LYS A 1  728  ? -14.231 -8.097  81.243  1.00 89.12  ? 728  LYS A CE    1 
ATOM   5550  N  NZ    . LYS A 1  728  ? -14.644 -9.125  82.262  1.00 89.53  ? 728  LYS A NZ    1 
ATOM   5551  N  N     . ALA A 1  729  ? -14.607 -5.809  75.405  1.00 84.29  ? 729  ALA A N     1 
ATOM   5552  C  CA    . ALA A 1  729  ? -15.710 -5.372  74.559  1.00 84.25  ? 729  ALA A CA    1 
ATOM   5553  C  C     . ALA A 1  729  ? -15.656 -6.016  73.185  1.00 84.48  ? 729  ALA A C     1 
ATOM   5554  O  O     . ALA A 1  729  ? -16.664 -6.522  72.718  1.00 84.81  ? 729  ALA A O     1 
ATOM   5555  C  CB    . ALA A 1  729  ? -15.717 -3.888  74.435  1.00 84.08  ? 729  ALA A CB    1 
ATOM   5556  N  N     . GLY A 1  730  ? -14.484 -5.995  72.544  1.00 84.69  ? 730  GLY A N     1 
ATOM   5557  C  CA    . GLY A 1  730  ? -14.279 -6.635  71.241  1.00 84.69  ? 730  GLY A CA    1 
ATOM   5558  C  C     . GLY A 1  730  ? -14.653 -8.108  71.245  1.00 84.96  ? 730  GLY A C     1 
ATOM   5559  O  O     . GLY A 1  730  ? -15.453 -8.558  70.411  1.00 84.98  ? 730  GLY A O     1 
ATOM   5560  N  N     . ARG A 1  731  ? -14.078 -8.854  72.192  1.00 85.06  ? 731  ARG A N     1 
ATOM   5561  C  CA    . ARG A 1  731  ? -14.465 -10.252 72.460  1.00 85.45  ? 731  ARG A CA    1 
ATOM   5562  C  C     . ARG A 1  731  ? -15.937 -10.410 72.906  1.00 84.64  ? 731  ARG A C     1 
ATOM   5563  O  O     . ARG A 1  731  ? -16.513 -11.491 72.752  1.00 84.79  ? 731  ARG A O     1 
ATOM   5564  C  CB    . ARG A 1  731  ? -13.543 -10.901 73.511  1.00 85.45  ? 731  ARG A CB    1 
ATOM   5565  C  CG    . ARG A 1  731  ? -12.287 -11.625 72.989  1.00 86.51  ? 731  ARG A CG    1 
ATOM   5566  C  CD    . ARG A 1  731  ? -11.384 -12.109 74.160  1.00 87.52  ? 731  ARG A CD    1 
ATOM   5567  N  NE    . ARG A 1  731  ? -10.868 -11.016 75.012  1.00 91.99  ? 731  ARG A NE    1 
ATOM   5568  C  CZ    . ARG A 1  731  ? -11.382 -10.642 76.195  1.00 93.21  ? 731  ARG A CZ    1 
ATOM   5569  N  NH1   . ARG A 1  731  ? -12.443 -11.266 76.716  1.00 93.57  ? 731  ARG A NH1   1 
ATOM   5570  N  NH2   . ARG A 1  731  ? -10.835 -9.633  76.872  1.00 93.64  ? 731  ARG A NH2   1 
ATOM   5571  N  N     . LEU A 1  732  ? -16.534 -9.359  73.472  1.00 83.64  ? 732  LEU A N     1 
ATOM   5572  C  CA    . LEU A 1  732  ? -17.957 -9.389  73.786  1.00 82.67  ? 732  LEU A CA    1 
ATOM   5573  C  C     . LEU A 1  732  ? -18.758 -9.343  72.491  1.00 82.27  ? 732  LEU A C     1 
ATOM   5574  O  O     . LEU A 1  732  ? -19.860 -9.875  72.421  1.00 82.21  ? 732  LEU A O     1 
ATOM   5575  C  CB    . LEU A 1  732  ? -18.362 -8.230  74.700  1.00 82.60  ? 732  LEU A CB    1 
ATOM   5576  C  CG    . LEU A 1  732  ? -19.373 -8.453  75.846  1.00 82.23  ? 732  LEU A CG    1 
ATOM   5577  C  CD1   . LEU A 1  732  ? -19.688 -7.123  76.508  1.00 82.10  ? 732  LEU A CD1   1 
ATOM   5578  C  CD2   . LEU A 1  732  ? -20.677 -9.139  75.434  1.00 81.12  ? 732  LEU A CD2   1 
ATOM   5579  N  N     . ALA A 1  733  ? -18.197 -8.712  71.466  1.00 81.88  ? 733  ALA A N     1 
ATOM   5580  C  CA    . ALA A 1  733  ? -18.839 -8.658  70.165  1.00 81.70  ? 733  ALA A CA    1 
ATOM   5581  C  C     . ALA A 1  733  ? -18.319 -9.740  69.221  1.00 81.81  ? 733  ALA A C     1 
ATOM   5582  O  O     . ALA A 1  733  ? -18.900 -9.975  68.172  1.00 81.81  ? 733  ALA A O     1 
ATOM   5583  C  CB    . ALA A 1  733  ? -18.675 -7.312  69.557  1.00 81.66  ? 733  ALA A CB    1 
ATOM   5584  N  N     . GLU A 1  734  ? -17.237 -10.411 69.582  1.00 81.89  ? 734  GLU A N     1 
ATOM   5585  C  CA    . GLU A 1  734  ? -16.886 -11.621 68.862  1.00 82.28  ? 734  GLU A CA    1 
ATOM   5586  C  C     . GLU A 1  734  ? -17.879 -12.758 69.169  1.00 81.88  ? 734  GLU A C     1 
ATOM   5587  O  O     . GLU A 1  734  ? -18.259 -13.511 68.267  1.00 81.74  ? 734  GLU A O     1 
ATOM   5588  C  CB    . GLU A 1  734  ? -15.465 -12.035 69.174  1.00 82.59  ? 734  GLU A CB    1 
ATOM   5589  C  CG    . GLU A 1  734  ? -15.016 -13.227 68.371  1.00 85.68  ? 734  GLU A CG    1 
ATOM   5590  C  CD    . GLU A 1  734  ? -13.510 -13.393 68.381  1.00 90.69  ? 734  GLU A CD    1 
ATOM   5591  O  OE1   . GLU A 1  734  ? -12.939 -13.616 69.486  1.00 92.27  ? 734  GLU A OE1   1 
ATOM   5592  O  OE2   . GLU A 1  734  ? -12.897 -13.303 67.280  1.00 93.02  ? 734  GLU A OE2   1 
ATOM   5593  N  N     . VAL A 1  735  ? -18.291 -12.860 70.441  1.00 81.67  ? 735  VAL A N     1 
ATOM   5594  C  CA    . VAL A 1  735  ? -19.348 -13.800 70.920  1.00 81.08  ? 735  VAL A CA    1 
ATOM   5595  C  C     . VAL A 1  735  ? -20.705 -13.546 70.265  1.00 80.44  ? 735  VAL A C     1 
ATOM   5596  O  O     . VAL A 1  735  ? -21.396 -14.491 69.896  1.00 80.45  ? 735  VAL A O     1 
ATOM   5597  C  CB    . VAL A 1  735  ? -19.536 -13.774 72.492  1.00 81.11  ? 735  VAL A CB    1 
ATOM   5598  C  CG1   . VAL A 1  735  ? -20.772 -14.560 72.933  1.00 80.48  ? 735  VAL A CG1   1 
ATOM   5599  C  CG2   . VAL A 1  735  ? -18.298 -14.309 73.211  1.00 81.70  ? 735  VAL A CG2   1 
ATOM   5600  N  N     . ASN A 1  736  ? -21.072 -12.273 70.131  1.00 79.68  ? 736  ASN A N     1 
ATOM   5601  C  CA    . ASN A 1  736  ? -22.349 -11.871 69.540  1.00 78.94  ? 736  ASN A CA    1 
ATOM   5602  C  C     . ASN A 1  736  ? -22.511 -12.220 68.070  1.00 78.32  ? 736  ASN A C     1 
ATOM   5603  O  O     . ASN A 1  736  ? -23.635 -12.359 67.585  1.00 78.03  ? 736  ASN A O     1 
ATOM   5604  C  CB    . ASN A 1  736  ? -22.570 -10.363 69.689  1.00 79.03  ? 736  ASN A CB    1 
ATOM   5605  C  CG    . ASN A 1  736  ? -23.885 -9.918  69.095  1.00 79.13  ? 736  ASN A CG    1 
ATOM   5606  O  OD1   . ASN A 1  736  ? -24.940 -10.458 69.443  1.00 81.02  ? 736  ASN A OD1   1 
ATOM   5607  N  ND2   . ASN A 1  736  ? -23.834 -8.950  68.180  1.00 77.58  ? 736  ASN A ND2   1 
ATOM   5608  N  N     . LEU A 1  737  ? -21.396 -12.333 67.355  1.00 77.72  ? 737  LEU A N     1 
ATOM   5609  C  CA    . LEU A 1  737  ? -21.470 -12.514 65.916  1.00 77.16  ? 737  LEU A CA    1 
ATOM   5610  C  C     . LEU A 1  737  ? -21.908 -13.912 65.509  1.00 76.95  ? 737  LEU A C     1 
ATOM   5611  O  O     . LEU A 1  737  ? -21.401 -14.916 66.016  1.00 77.15  ? 737  LEU A O     1 
ATOM   5612  C  CB    . LEU A 1  737  ? -20.174 -12.100 65.241  1.00 76.90  ? 737  LEU A CB    1 
ATOM   5613  C  CG    . LEU A 1  737  ? -20.083 -10.576 65.096  1.00 76.66  ? 737  LEU A CG    1 
ATOM   5614  C  CD1   . LEU A 1  737  ? -19.033 -10.197 64.013  1.00 76.08  ? 737  LEU A CD1   1 
ATOM   5615  C  CD2   . LEU A 1  737  ? -21.467 -9.911  64.833  1.00 73.92  ? 737  LEU A CD2   1 
ATOM   5616  N  N     . LYS A 1  738  ? -22.879 -13.972 64.605  1.00 76.36  ? 738  LYS A N     1 
ATOM   5617  C  CA    . LYS A 1  738  ? -23.430 -15.254 64.191  1.00 75.60  ? 738  LYS A CA    1 
ATOM   5618  C  C     . LYS A 1  738  ? -22.459 -15.909 63.225  1.00 74.82  ? 738  LYS A C     1 
ATOM   5619  O  O     . LYS A 1  738  ? -21.348 -15.402 63.018  1.00 74.66  ? 738  LYS A O     1 
ATOM   5620  C  CB    . LYS A 1  738  ? -24.819 -15.088 63.556  1.00 75.85  ? 738  LYS A CB    1 
ATOM   5621  C  CG    . LYS A 1  738  ? -25.831 -14.396 64.455  1.00 76.26  ? 738  LYS A CG    1 
ATOM   5622  C  CD    . LYS A 1  738  ? -27.181 -14.259 63.791  1.00 77.13  ? 738  LYS A CD    1 
ATOM   5623  C  CE    . LYS A 1  738  ? -27.828 -12.938 64.169  1.00 78.17  ? 738  LYS A CE    1 
ATOM   5624  N  NZ    . LYS A 1  738  ? -27.254 -11.802 63.359  1.00 78.87  ? 738  LYS A NZ    1 
ATOM   5625  N  N     . ASP A 1  739  ? -22.891 -17.020 62.631  1.00 73.73  ? 739  ASP A N     1 
ATOM   5626  C  CA    . ASP A 1  739  ? -22.032 -17.847 61.788  1.00 72.70  ? 739  ASP A CA    1 
ATOM   5627  C  C     . ASP A 1  739  ? -21.991 -17.441 60.296  1.00 71.72  ? 739  ASP A C     1 
ATOM   5628  O  O     . ASP A 1  739  ? -20.954 -17.572 59.593  1.00 71.04  ? 739  ASP A O     1 
ATOM   5629  C  CB    . ASP A 1  739  ? -22.435 -19.307 61.959  1.00 72.86  ? 739  ASP A CB    1 
ATOM   5630  C  CG    . ASP A 1  739  ? -21.475 -20.076 62.854  1.00 73.69  ? 739  ASP A CG    1 
ATOM   5631  O  OD1   . ASP A 1  739  ? -20.634 -19.461 63.565  1.00 73.86  ? 739  ASP A OD1   1 
ATOM   5632  O  OD2   . ASP A 1  739  ? -21.560 -21.320 62.827  1.00 75.19  ? 739  ASP A OD2   1 
ATOM   5633  N  N     . LEU A 1  740  ? -23.131 -16.938 59.833  1.00 70.39  ? 740  LEU A N     1 
ATOM   5634  C  CA    . LEU A 1  740  ? -23.302 -16.483 58.457  1.00 69.02  ? 740  LEU A CA    1 
ATOM   5635  C  C     . LEU A 1  740  ? -22.533 -15.187 58.141  1.00 67.86  ? 740  LEU A C     1 
ATOM   5636  O  O     . LEU A 1  740  ? -22.593 -14.690 57.016  1.00 67.48  ? 740  LEU A O     1 
ATOM   5637  C  CB    . LEU A 1  740  ? -24.807 -16.312 58.187  1.00 69.02  ? 740  LEU A CB    1 
ATOM   5638  C  CG    . LEU A 1  740  ? -25.574 -15.642 59.335  1.00 68.83  ? 740  LEU A CG    1 
ATOM   5639  C  CD1   . LEU A 1  740  ? -25.808 -14.149 59.056  1.00 67.42  ? 740  LEU A CD1   1 
ATOM   5640  C  CD2   . LEU A 1  740  ? -26.889 -16.372 59.646  1.00 70.07  ? 740  LEU A CD2   1 
ATOM   5641  N  N     . ASN A 1  741  ? -21.811 -14.656 59.131  1.00 66.68  ? 741  ASN A N     1 
ATOM   5642  C  CA    . ASN A 1  741  ? -21.273 -13.291 59.064  1.00 65.51  ? 741  ASN A CA    1 
ATOM   5643  C  C     . ASN A 1  741  ? -19.976 -13.187 58.307  1.00 65.16  ? 741  ASN A C     1 
ATOM   5644  O  O     . ASN A 1  741  ? -18.900 -13.463 58.855  1.00 65.13  ? 741  ASN A O     1 
ATOM   5645  C  CB    . ASN A 1  741  ? -21.085 -12.682 60.451  1.00 65.29  ? 741  ASN A CB    1 
ATOM   5646  C  CG    . ASN A 1  741  ? -20.475 -11.297 60.384  1.00 64.07  ? 741  ASN A CG    1 
ATOM   5647  O  OD1   . ASN A 1  741  ? -21.172 -10.300 60.437  1.00 64.50  ? 741  ASN A OD1   1 
ATOM   5648  N  ND2   . ASN A 1  741  ? -19.180 -11.234 60.235  1.00 62.03  ? 741  ASN A ND2   1 
ATOM   5649  N  N     . ASN A 1  742  ? -20.083 -12.748 57.056  1.00 64.50  ? 742  ASN A N     1 
ATOM   5650  C  CA    . ASN A 1  742  ? -18.965 -12.761 56.106  1.00 63.44  ? 742  ASN A CA    1 
ATOM   5651  C  C     . ASN A 1  742  ? -17.571 -12.446 56.715  1.00 63.58  ? 742  ASN A C     1 
ATOM   5652  O  O     . ASN A 1  742  ? -16.619 -13.162 56.439  1.00 63.77  ? 742  ASN A O     1 
ATOM   5653  C  CB    . ASN A 1  742  ? -19.271 -11.849 54.910  1.00 63.10  ? 742  ASN A CB    1 
ATOM   5654  C  CG    . ASN A 1  742  ? -20.385 -12.387 53.998  1.00 61.53  ? 742  ASN A CG    1 
ATOM   5655  O  OD1   . ASN A 1  742  ? -20.560 -13.608 53.843  1.00 58.37  ? 742  ASN A OD1   1 
ATOM   5656  N  ND2   . ASN A 1  742  ? -21.111 -11.457 53.345  1.00 59.00  ? 742  ASN A ND2   1 
ATOM   5657  N  N     . VAL A 1  743  ? -17.468 -11.390 57.538  1.00 63.38  ? 743  VAL A N     1 
ATOM   5658  C  CA    . VAL A 1  743  ? -16.241 -11.026 58.308  1.00 62.85  ? 743  VAL A CA    1 
ATOM   5659  C  C     . VAL A 1  743  ? -15.768 -12.204 59.199  1.00 62.35  ? 743  VAL A C     1 
ATOM   5660  O  O     . VAL A 1  743  ? -14.747 -12.857 58.918  1.00 62.64  ? 743  VAL A O     1 
ATOM   5661  C  CB    . VAL A 1  743  ? -16.461 -9.730  59.214  1.00 62.58  ? 743  VAL A CB    1 
ATOM   5662  C  CG1   . VAL A 1  743  ? -15.257 -9.423  60.057  1.00 62.10  ? 743  VAL A CG1   1 
ATOM   5663  C  CG2   . VAL A 1  743  ? -16.821 -8.506  58.396  1.00 62.69  ? 743  VAL A CG2   1 
ATOM   5664  N  N     . LYS A 1  744  ? -16.527 -12.450 60.266  1.00 61.23  ? 744  LYS A N     1 
ATOM   5665  C  CA    . LYS A 1  744  ? -16.335 -13.553 61.188  1.00 60.19  ? 744  LYS A CA    1 
ATOM   5666  C  C     . LYS A 1  744  ? -15.924 -14.773 60.411  1.00 59.21  ? 744  LYS A C     1 
ATOM   5667  O  O     . LYS A 1  744  ? -15.220 -15.622 60.935  1.00 58.70  ? 744  LYS A O     1 
ATOM   5668  C  CB    . LYS A 1  744  ? -17.677 -13.865 61.880  1.00 60.85  ? 744  LYS A CB    1 
ATOM   5669  C  CG    . LYS A 1  744  ? -17.645 -14.005 63.405  1.00 60.57  ? 744  LYS A CG    1 
ATOM   5670  C  CD    . LYS A 1  744  ? -18.286 -15.298 63.853  1.00 59.77  ? 744  LYS A CD    1 
ATOM   5671  C  CE    . LYS A 1  744  ? -17.529 -15.841 65.053  1.00 60.92  ? 744  LYS A CE    1 
ATOM   5672  N  NZ    . LYS A 1  744  ? -17.965 -17.203 65.463  1.00 62.48  ? 744  LYS A NZ    1 
ATOM   5673  N  N     . GLN A 1  745  ? -16.393 -14.827 59.159  1.00 58.40  ? 745  GLN A N     1 
ATOM   5674  C  CA    . GLN A 1  745  ? -16.207 -15.940 58.208  1.00 57.85  ? 745  GLN A CA    1 
ATOM   5675  C  C     . GLN A 1  745  ? -14.893 -15.966 57.417  1.00 57.72  ? 745  GLN A C     1 
ATOM   5676  O  O     . GLN A 1  745  ? -14.416 -17.039 57.049  1.00 57.87  ? 745  GLN A O     1 
ATOM   5677  C  CB    . GLN A 1  745  ? -17.319 -15.911 57.184  1.00 57.20  ? 745  GLN A CB    1 
ATOM   5678  C  CG    . GLN A 1  745  ? -18.387 -16.897 57.372  1.00 56.30  ? 745  GLN A CG    1 
ATOM   5679  C  CD    . GLN A 1  745  ? -19.199 -16.995 56.123  1.00 55.87  ? 745  GLN A CD    1 
ATOM   5680  O  OE1   . GLN A 1  745  ? -19.644 -15.980 55.566  1.00 54.30  ? 745  GLN A OE1   1 
ATOM   5681  N  NE2   . GLN A 1  745  ? -19.362 -18.214 55.630  1.00 55.87  ? 745  GLN A NE2   1 
ATOM   5682  N  N     . MET A 1  746  ? -14.352 -14.790 57.103  1.00 57.42  ? 746  MET A N     1 
ATOM   5683  C  CA    . MET A 1  746  ? -13.060 -14.690 56.421  1.00 56.63  ? 746  MET A CA    1 
ATOM   5684  C  C     . MET A 1  746  ? -11.999 -14.946 57.462  1.00 57.46  ? 746  MET A C     1 
ATOM   5685  O  O     . MET A 1  746  ? -10.953 -15.553 57.170  1.00 57.47  ? 746  MET A O     1 
ATOM   5686  C  CB    . MET A 1  746  ? -12.846 -13.306 55.767  1.00 56.77  ? 746  MET A CB    1 
ATOM   5687  C  CG    . MET A 1  746  ? -13.265 -13.210 54.290  1.00 54.93  ? 746  MET A CG    1 
ATOM   5688  S  SD    . MET A 1  746  ? -13.456 -11.523 53.724  1.00 52.85  ? 746  MET A SD    1 
ATOM   5689  C  CE    . MET A 1  746  ? -14.791 -10.987 54.791  1.00 53.64  ? 746  MET A CE    1 
ATOM   5690  N  N     . VAL A 1  747  ? -12.293 -14.482 58.678  1.00 57.73  ? 747  VAL A N     1 
ATOM   5691  C  CA    . VAL A 1  747  ? -11.367 -14.591 59.789  1.00 58.50  ? 747  VAL A CA    1 
ATOM   5692  C  C     . VAL A 1  747  ? -11.396 -16.034 60.253  1.00 59.20  ? 747  VAL A C     1 
ATOM   5693  O  O     . VAL A 1  747  ? -10.425 -16.522 60.834  1.00 58.79  ? 747  VAL A O     1 
ATOM   5694  C  CB    . VAL A 1  747  ? -11.688 -13.581 60.945  1.00 58.54  ? 747  VAL A CB    1 
ATOM   5695  C  CG1   . VAL A 1  747  ? -10.797 -13.831 62.151  1.00 58.73  ? 747  VAL A CG1   1 
ATOM   5696  C  CG2   . VAL A 1  747  ? -11.538 -12.096 60.486  1.00 58.06  ? 747  VAL A CG2   1 
ATOM   5697  N  N     . MET A 1  748  ? -12.513 -16.712 59.965  1.00 60.58  ? 748  MET A N     1 
ATOM   5698  C  CA    . MET A 1  748  ? -12.688 -18.119 60.324  1.00 62.00  ? 748  MET A CA    1 
ATOM   5699  C  C     . MET A 1  748  ? -11.819 -18.943 59.437  1.00 62.23  ? 748  MET A C     1 
ATOM   5700  O  O     . MET A 1  748  ? -11.279 -19.938 59.906  1.00 62.74  ? 748  MET A O     1 
ATOM   5701  C  CB    . MET A 1  748  ? -14.145 -18.596 60.248  1.00 61.74  ? 748  MET A CB    1 
ATOM   5702  C  CG    . MET A 1  748  ? -14.892 -18.517 61.614  1.00 62.92  ? 748  MET A CG    1 
ATOM   5703  S  SD    . MET A 1  748  ? -16.430 -19.493 61.820  1.00 64.28  ? 748  MET A SD    1 
ATOM   5704  C  CE    . MET A 1  748  ? -17.706 -18.311 61.336  1.00 63.65  ? 748  MET A CE    1 
ATOM   5705  N  N     . ALA A 1  749  ? -11.674 -18.510 58.174  1.00 62.91  ? 749  ALA A N     1 
ATOM   5706  C  CA    . ALA A 1  749  ? -10.780 -19.146 57.173  1.00 63.17  ? 749  ALA A CA    1 
ATOM   5707  C  C     . ALA A 1  749  ? -9.371  -18.692 57.416  1.00 63.41  ? 749  ALA A C     1 
ATOM   5708  O  O     . ALA A 1  749  ? -8.453  -19.501 57.439  1.00 63.09  ? 749  ALA A O     1 
ATOM   5709  C  CB    . ALA A 1  749  ? -11.200 -18.802 55.738  1.00 62.95  ? 749  ALA A CB    1 
ATOM   5710  N  N     . GLY A 1  750  ? -9.234  -17.390 57.629  1.00 64.16  ? 750  GLY A N     1 
ATOM   5711  C  CA    . GLY A 1  750  ? -7.957  -16.746 57.828  1.00 65.67  ? 750  GLY A CA    1 
ATOM   5712  C  C     . GLY A 1  750  ? -7.552  -16.157 56.502  1.00 66.87  ? 750  GLY A C     1 
ATOM   5713  O  O     . GLY A 1  750  ? -6.377  -16.208 56.130  1.00 67.61  ? 750  GLY A O     1 
ATOM   5714  N  N     . SER A 1  751  ? -8.520  -15.613 55.766  1.00 67.66  ? 751  SER A N     1 
ATOM   5715  C  CA    . SER A 1  751  ? -8.245  -15.065 54.417  1.00 68.51  ? 751  SER A CA    1 
ATOM   5716  C  C     . SER A 1  751  ? -7.719  -13.629 54.467  1.00 68.49  ? 751  SER A C     1 
ATOM   5717  O  O     . SER A 1  751  ? -6.677  -13.322 53.895  1.00 68.61  ? 751  SER A O     1 
ATOM   5718  C  CB    . SER A 1  751  ? -9.497  -15.120 53.551  1.00 68.77  ? 751  SER A CB    1 
ATOM   5719  O  OG    . SER A 1  751  ? -10.539 -14.371 54.160  1.00 70.03  ? 751  SER A OG    1 
ATOM   5720  N  N     . LYS A 1  752  ? -8.486  -12.757 55.122  1.00 68.71  ? 752  LYS A N     1 
ATOM   5721  C  CA    . LYS A 1  752  ? -8.003  -11.458 55.605  1.00 68.34  ? 752  LYS A CA    1 
ATOM   5722  C  C     . LYS A 1  752  ? -8.590  -11.164 56.983  1.00 68.25  ? 752  LYS A C     1 
ATOM   5723  O  O     . LYS A 1  752  ? -9.703  -11.580 57.316  1.00 67.60  ? 752  LYS A O     1 
ATOM   5724  C  CB    . LYS A 1  752  ? -8.333  -10.317 54.644  1.00 68.01  ? 752  LYS A CB    1 
ATOM   5725  C  CG    . LYS A 1  752  ? -7.435  -10.245 53.440  1.00 66.58  ? 752  LYS A CG    1 
ATOM   5726  C  CD    . LYS A 1  752  ? -6.029  -9.838  53.802  1.00 63.57  ? 752  LYS A CD    1 
ATOM   5727  C  CE    . LYS A 1  752  ? -5.580  -8.642  52.962  1.00 62.70  ? 752  LYS A CE    1 
ATOM   5728  N  NZ    . LYS A 1  752  ? -6.378  -8.402  51.709  1.00 60.54  ? 752  LYS A NZ    1 
ATOM   5729  N  N     . GLY A 1  753  ? -7.788  -10.474 57.781  1.00 68.38  ? 753  GLY A N     1 
ATOM   5730  C  CA    . GLY A 1  753  ? -8.201  -10.002 59.076  1.00 68.28  ? 753  GLY A CA    1 
ATOM   5731  C  C     . GLY A 1  753  ? -7.926  -10.921 60.233  1.00 68.18  ? 753  GLY A C     1 
ATOM   5732  O  O     . GLY A 1  753  ? -7.839  -12.144 60.078  1.00 67.68  ? 753  GLY A O     1 
ATOM   5733  N  N     . SER A 1  754  ? -7.786  -10.282 61.392  1.00 68.66  ? 754  SER A N     1 
ATOM   5734  C  CA    . SER A 1  754  ? -7.796  -10.925 62.701  1.00 69.15  ? 754  SER A CA    1 
ATOM   5735  C  C     . SER A 1  754  ? -9.061  -10.592 63.532  1.00 69.32  ? 754  SER A C     1 
ATOM   5736  O  O     . SER A 1  754  ? -10.167 -10.334 62.997  1.00 69.00  ? 754  SER A O     1 
ATOM   5737  C  CB    . SER A 1  754  ? -6.591  -10.443 63.502  1.00 69.35  ? 754  SER A CB    1 
ATOM   5738  O  OG    . SER A 1  754  ? -6.888  -9.196  64.130  1.00 69.38  ? 754  SER A OG    1 
ATOM   5739  N  N     . PHE A 1  755  ? -8.844  -10.607 64.853  1.00 69.47  ? 755  PHE A N     1 
ATOM   5740  C  CA    . PHE A 1  755  ? -9.821  -10.237 65.877  1.00 69.42  ? 755  PHE A CA    1 
ATOM   5741  C  C     . PHE A 1  755  ? -9.986  -8.727  65.945  1.00 69.14  ? 755  PHE A C     1 
ATOM   5742  O  O     . PHE A 1  755  ? -11.099 -8.210  65.824  1.00 69.26  ? 755  PHE A O     1 
ATOM   5743  C  CB    . PHE A 1  755  ? -9.358  -10.758 67.247  1.00 69.58  ? 755  PHE A CB    1 
ATOM   5744  C  CG    . PHE A 1  755  ? -9.958  -10.021 68.431  1.00 70.07  ? 755  PHE A CG    1 
ATOM   5745  C  CD1   . PHE A 1  755  ? -11.151 -10.454 69.008  1.00 70.50  ? 755  PHE A CD1   1 
ATOM   5746  C  CD2   . PHE A 1  755  ? -9.319  -8.913  68.983  1.00 70.17  ? 755  PHE A CD2   1 
ATOM   5747  C  CE1   . PHE A 1  755  ? -11.709 -9.787  70.105  1.00 70.00  ? 755  PHE A CE1   1 
ATOM   5748  C  CE2   . PHE A 1  755  ? -9.875  -8.241  70.070  1.00 70.67  ? 755  PHE A CE2   1 
ATOM   5749  C  CZ    . PHE A 1  755  ? -11.073 -8.682  70.637  1.00 69.85  ? 755  PHE A CZ    1 
ATOM   5750  N  N     . ILE A 1  756  ? -8.868  -8.030  66.151  1.00 68.61  ? 756  ILE A N     1 
ATOM   5751  C  CA    . ILE A 1  756  ? -8.875  -6.590  66.408  1.00 67.68  ? 756  ILE A CA    1 
ATOM   5752  C  C     . ILE A 1  756  ? -9.669  -5.827  65.352  1.00 66.87  ? 756  ILE A C     1 
ATOM   5753  O  O     . ILE A 1  756  ? -10.396 -4.878  65.675  1.00 66.47  ? 756  ILE A O     1 
ATOM   5754  C  CB    . ILE A 1  756  ? -7.421  -6.030  66.586  1.00 67.99  ? 756  ILE A CB    1 
ATOM   5755  C  CG1   . ILE A 1  756  ? -7.464  -4.677  67.296  1.00 68.35  ? 756  ILE A CG1   1 
ATOM   5756  C  CG2   . ILE A 1  756  ? -6.606  -6.011  65.243  1.00 67.57  ? 756  ILE A CG2   1 
ATOM   5757  C  CD1   . ILE A 1  756  ? -8.416  -4.645  68.478  1.00 68.87  ? 756  ILE A CD1   1 
ATOM   5758  N  N     . ASN A 1  757  ? -9.531  -6.291  64.105  1.00 66.06  ? 757  ASN A N     1 
ATOM   5759  C  CA    . ASN A 1  757  ? -10.235 -5.766  62.940  1.00 65.20  ? 757  ASN A CA    1 
ATOM   5760  C  C     . ASN A 1  757  ? -11.730 -5.691  63.161  1.00 64.74  ? 757  ASN A C     1 
ATOM   5761  O  O     . ASN A 1  757  ? -12.355 -4.713  62.753  1.00 64.66  ? 757  ASN A O     1 
ATOM   5762  C  CB    . ASN A 1  757  ? -9.910  -6.608  61.708  1.00 65.09  ? 757  ASN A CB    1 
ATOM   5763  C  CG    . ASN A 1  757  ? -8.542  -6.282  61.137  1.00 65.25  ? 757  ASN A CG    1 
ATOM   5764  O  OD1   . ASN A 1  757  ? -8.305  -5.152  60.712  1.00 65.00  ? 757  ASN A OD1   1 
ATOM   5765  N  ND2   . ASN A 1  757  ? -7.628  -7.263  61.137  1.00 64.91  ? 757  ASN A ND2   1 
ATOM   5766  N  N     . ILE A 1  758  ? -12.273 -6.724  63.819  1.00 64.13  ? 758  ILE A N     1 
ATOM   5767  C  CA    . ILE A 1  758  ? -13.656 -6.761  64.314  1.00 63.18  ? 758  ILE A CA    1 
ATOM   5768  C  C     . ILE A 1  758  ? -13.848 -5.867  65.528  1.00 62.73  ? 758  ILE A C     1 
ATOM   5769  O  O     . ILE A 1  758  ? -14.645 -4.942  65.475  1.00 62.70  ? 758  ILE A O     1 
ATOM   5770  C  CB    . ILE A 1  758  ? -14.080 -8.190  64.692  1.00 63.10  ? 758  ILE A CB    1 
ATOM   5771  C  CG1   . ILE A 1  758  ? -14.086 -9.078  63.432  1.00 63.13  ? 758  ILE A CG1   1 
ATOM   5772  C  CG2   . ILE A 1  758  ? -15.416 -8.183  65.495  1.00 62.74  ? 758  ILE A CG2   1 
ATOM   5773  C  CD1   . ILE A 1  758  ? -14.707 -10.508 63.593  1.00 63.40  ? 758  ILE A CD1   1 
ATOM   5774  N  N     . ALA A 1  759  ? -13.110 -6.139  66.605  1.00 62.41  ? 759  ALA A N     1 
ATOM   5775  C  CA    . ALA A 1  759  ? -13.241 -5.408  67.881  1.00 62.53  ? 759  ALA A CA    1 
ATOM   5776  C  C     . ALA A 1  759  ? -13.424 -3.903  67.704  1.00 62.60  ? 759  ALA A C     1 
ATOM   5777  O  O     . ALA A 1  759  ? -14.251 -3.269  68.367  1.00 62.31  ? 759  ALA A O     1 
ATOM   5778  C  CB    . ALA A 1  759  ? -12.046 -5.686  68.779  1.00 62.42  ? 759  ALA A CB    1 
ATOM   5779  N  N     . GLN A 1  760  ? -12.645 -3.340  66.792  1.00 62.87  ? 760  GLN A N     1 
ATOM   5780  C  CA    . GLN A 1  760  ? -12.744 -1.931  66.496  1.00 62.95  ? 760  GLN A CA    1 
ATOM   5781  C  C     . GLN A 1  760  ? -14.005 -1.647  65.687  1.00 63.58  ? 760  GLN A C     1 
ATOM   5782  O  O     . GLN A 1  760  ? -14.967 -1.085  66.223  1.00 63.55  ? 760  GLN A O     1 
ATOM   5783  C  CB    . GLN A 1  760  ? -11.481 -1.464  65.807  1.00 62.39  ? 760  GLN A CB    1 
ATOM   5784  C  CG    . GLN A 1  760  ? -10.280 -1.768  66.631  1.00 60.91  ? 760  GLN A CG    1 
ATOM   5785  C  CD    . GLN A 1  760  ? -9.189  -0.787  66.376  1.00 61.65  ? 760  GLN A CD    1 
ATOM   5786  O  OE1   . GLN A 1  760  ? -8.213  -1.082  65.674  1.00 63.20  ? 760  GLN A OE1   1 
ATOM   5787  N  NE2   . GLN A 1  760  ? -9.344  0.410   66.913  1.00 61.55  ? 760  GLN A NE2   1 
ATOM   5788  N  N     . MET A 1  761  ? -14.009 -2.069  64.422  1.00 64.19  ? 761  MET A N     1 
ATOM   5789  C  CA    . MET A 1  761  ? -15.179 -1.933  63.554  1.00 64.51  ? 761  MET A CA    1 
ATOM   5790  C  C     . MET A 1  761  ? -16.531 -1.885  64.296  1.00 65.35  ? 761  MET A C     1 
ATOM   5791  O  O     . MET A 1  761  ? -17.249 -0.902  64.167  1.00 65.66  ? 761  MET A O     1 
ATOM   5792  C  CB    . MET A 1  761  ? -15.167 -2.992  62.439  1.00 64.59  ? 761  MET A CB    1 
ATOM   5793  C  CG    . MET A 1  761  ? -14.039 -2.794  61.373  1.00 63.51  ? 761  MET A CG    1 
ATOM   5794  S  SD    . MET A 1  761  ? -14.452 -3.398  59.692  1.00 63.44  ? 761  MET A SD    1 
ATOM   5795  C  CE    . MET A 1  761  ? -14.101 -5.163  59.755  1.00 61.76  ? 761  MET A CE    1 
ATOM   5796  N  N     . SER A 1  762  ? -16.842 -2.897  65.112  1.00 66.23  ? 762  SER A N     1 
ATOM   5797  C  CA    . SER A 1  762  ? -18.192 -3.056  65.723  1.00 67.00  ? 762  SER A CA    1 
ATOM   5798  C  C     . SER A 1  762  ? -18.425 -2.587  67.179  1.00 67.70  ? 762  SER A C     1 
ATOM   5799  O  O     . SER A 1  762  ? -19.580 -2.376  67.589  1.00 68.12  ? 762  SER A O     1 
ATOM   5800  C  CB    . SER A 1  762  ? -18.660 -4.522  65.614  1.00 66.99  ? 762  SER A CB    1 
ATOM   5801  O  OG    . SER A 1  762  ? -19.402 -4.775  64.427  1.00 66.94  ? 762  SER A OG    1 
ATOM   5802  N  N     . ALA A 1  763  ? -17.372 -2.447  67.977  1.00 68.28  ? 763  ALA A N     1 
ATOM   5803  C  CA    . ALA A 1  763  ? -17.601 -2.222  69.406  1.00 68.89  ? 763  ALA A CA    1 
ATOM   5804  C  C     . ALA A 1  763  ? -16.861 -1.052  70.021  1.00 69.49  ? 763  ALA A C     1 
ATOM   5805  O  O     . ALA A 1  763  ? -17.460 -0.262  70.748  1.00 69.89  ? 763  ALA A O     1 
ATOM   5806  C  CB    . ALA A 1  763  ? -17.321 -3.485  70.191  1.00 68.77  ? 763  ALA A CB    1 
ATOM   5807  N  N     . CYS A 1  764  ? -15.562 -0.950  69.755  1.00 70.33  ? 764  CYS A N     1 
ATOM   5808  C  CA    . CYS A 1  764  ? -14.732 0.112   70.346  1.00 70.73  ? 764  CYS A CA    1 
ATOM   5809  C  C     . CYS A 1  764  ? -13.344 0.181   69.696  1.00 70.81  ? 764  CYS A C     1 
ATOM   5810  O  O     . CYS A 1  764  ? -12.829 -0.825  69.217  1.00 70.86  ? 764  CYS A O     1 
ATOM   5811  C  CB    . CYS A 1  764  ? -14.609 -0.073  71.861  1.00 70.53  ? 764  CYS A CB    1 
ATOM   5812  S  SG    . CYS A 1  764  ? -13.523 1.132   72.637  1.00 71.66  ? 764  CYS A SG    1 
ATOM   5813  N  N     . VAL A 1  765  ? -12.739 1.360   69.674  1.00 70.88  ? 765  VAL A N     1 
ATOM   5814  C  CA    . VAL A 1  765  ? -11.500 1.480   68.942  1.00 71.46  ? 765  VAL A CA    1 
ATOM   5815  C  C     . VAL A 1  765  ? -10.275 1.556   69.853  1.00 72.06  ? 765  VAL A C     1 
ATOM   5816  O  O     . VAL A 1  765  ? -9.140  1.336   69.395  1.00 72.76  ? 765  VAL A O     1 
ATOM   5817  C  CB    . VAL A 1  765  ? -11.510 2.629   67.893  1.00 71.45  ? 765  VAL A CB    1 
ATOM   5818  C  CG1   . VAL A 1  765  ? -12.882 2.771   67.234  1.00 71.21  ? 765  VAL A CG1   1 
ATOM   5819  C  CG2   . VAL A 1  765  ? -11.069 3.908   68.513  1.00 71.44  ? 765  VAL A CG2   1 
ATOM   5820  N  N     . GLY A 1  766  ? -10.492 1.881   71.125  1.00 72.24  ? 766  GLY A N     1 
ATOM   5821  C  CA    . GLY A 1  766  ? -9.408  1.841   72.122  1.00 72.72  ? 766  GLY A CA    1 
ATOM   5822  C  C     . GLY A 1  766  ? -8.533  3.072   72.258  1.00 72.96  ? 766  GLY A C     1 
ATOM   5823  O  O     . GLY A 1  766  ? -8.909  4.159   71.833  1.00 73.18  ? 766  GLY A O     1 
ATOM   5824  N  N     . GLN A 1  767  ? -7.360  2.894   72.854  1.00 73.39  ? 767  GLN A N     1 
ATOM   5825  C  CA    . GLN A 1  767  ? -6.443  4.006   73.118  1.00 74.00  ? 767  GLN A CA    1 
ATOM   5826  C  C     . GLN A 1  767  ? -5.514  4.307   71.950  1.00 74.12  ? 767  GLN A C     1 
ATOM   5827  O  O     . GLN A 1  767  ? -4.985  3.387   71.316  1.00 73.96  ? 767  GLN A O     1 
ATOM   5828  C  CB    . GLN A 1  767  ? -5.593  3.704   74.356  1.00 74.28  ? 767  GLN A CB    1 
ATOM   5829  C  CG    . GLN A 1  767  ? -4.781  4.875   74.880  1.00 74.64  ? 767  GLN A CG    1 
ATOM   5830  C  CD    . GLN A 1  767  ? -5.650  5.852   75.598  1.00 76.02  ? 767  GLN A CD    1 
ATOM   5831  O  OE1   . GLN A 1  767  ? -6.757  6.126   75.158  1.00 77.76  ? 767  GLN A OE1   1 
ATOM   5832  N  NE2   . GLN A 1  767  ? -5.175  6.371   76.721  1.00 76.34  ? 767  GLN A NE2   1 
ATOM   5833  N  N     . GLN A 1  768  ? -5.305  5.594   71.683  1.00 74.27  ? 768  GLN A N     1 
ATOM   5834  C  CA    . GLN A 1  768  ? -4.328  5.996   70.683  1.00 74.55  ? 768  GLN A CA    1 
ATOM   5835  C  C     . GLN A 1  768  ? -2.987  6.278   71.324  1.00 74.54  ? 768  GLN A C     1 
ATOM   5836  O  O     . GLN A 1  768  ? -2.925  6.460   72.536  1.00 74.57  ? 768  GLN A O     1 
ATOM   5837  C  CB    . GLN A 1  768  ? -4.828  7.192   69.885  1.00 74.71  ? 768  GLN A CB    1 
ATOM   5838  C  CG    . GLN A 1  768  ? -5.012  6.874   68.398  1.00 74.90  ? 768  GLN A CG    1 
ATOM   5839  C  CD    . GLN A 1  768  ? -6.114  5.866   68.141  1.00 73.91  ? 768  GLN A CD    1 
ATOM   5840  O  OE1   . GLN A 1  768  ? -7.288  6.200   68.154  1.00 73.36  ? 768  GLN A OE1   1 
ATOM   5841  N  NE2   . GLN A 1  768  ? -5.732  4.627   67.896  1.00 74.24  ? 768  GLN A NE2   1 
ATOM   5842  N  N     . SER A 1  769  ? -1.919  6.300   70.523  1.00 74.70  ? 769  SER A N     1 
ATOM   5843  C  CA    . SER A 1  769  ? -0.568  6.490   71.071  1.00 74.92  ? 769  SER A CA    1 
ATOM   5844  C  C     . SER A 1  769  ? 0.428   7.133   70.124  1.00 74.84  ? 769  SER A C     1 
ATOM   5845  O  O     . SER A 1  769  ? 0.369   6.903   68.914  1.00 74.87  ? 769  SER A O     1 
ATOM   5846  C  CB    . SER A 1  769  ? 0.010   5.147   71.538  1.00 75.32  ? 769  SER A CB    1 
ATOM   5847  O  OG    . SER A 1  769  ? 0.734   4.486   70.505  1.00 75.37  ? 769  SER A OG    1 
ATOM   5848  N  N     . VAL A 1  770  ? 1.340   7.921   70.698  1.00 74.80  ? 770  VAL A N     1 
ATOM   5849  C  CA    . VAL A 1  770  ? 2.559   8.388   70.016  1.00 75.20  ? 770  VAL A CA    1 
ATOM   5850  C  C     . VAL A 1  770  ? 3.784   8.173   70.917  1.00 75.59  ? 770  VAL A C     1 
ATOM   5851  O  O     . VAL A 1  770  ? 3.691   8.343   72.141  1.00 75.83  ? 770  VAL A O     1 
ATOM   5852  C  CB    . VAL A 1  770  ? 2.444   9.856   69.559  1.00 74.98  ? 770  VAL A CB    1 
ATOM   5853  C  CG1   . VAL A 1  770  ? 3.797   10.553  69.548  1.00 75.23  ? 770  VAL A CG1   1 
ATOM   5854  C  CG2   . VAL A 1  770  ? 1.817   9.919   68.186  1.00 75.34  ? 770  VAL A CG2   1 
ATOM   5855  N  N     . GLU A 1  771  ? 4.917   7.792   70.316  1.00 75.85  ? 771  GLU A N     1 
ATOM   5856  C  CA    . GLU A 1  771  ? 6.094   7.346   71.081  1.00 76.32  ? 771  GLU A CA    1 
ATOM   5857  C  C     . GLU A 1  771  ? 5.674   6.524   72.306  1.00 75.64  ? 771  GLU A C     1 
ATOM   5858  O  O     . GLU A 1  771  ? 5.980   6.884   73.439  1.00 75.86  ? 771  GLU A O     1 
ATOM   5859  C  CB    . GLU A 1  771  ? 6.990   8.528   71.511  1.00 76.86  ? 771  GLU A CB    1 
ATOM   5860  C  CG    . GLU A 1  771  ? 8.187   8.833   70.583  1.00 79.63  ? 771  GLU A CG    1 
ATOM   5861  C  CD    . GLU A 1  771  ? 7.873   9.916   69.541  1.00 83.39  ? 771  GLU A CD    1 
ATOM   5862  O  OE1   . GLU A 1  771  ? 7.586   11.087  69.926  1.00 83.62  ? 771  GLU A OE1   1 
ATOM   5863  O  OE2   . GLU A 1  771  ? 7.920   9.589   68.331  1.00 85.35  ? 771  GLU A OE2   1 
ATOM   5864  N  N     . GLY A 1  772  ? 4.942   5.441   72.065  1.00 75.08  ? 772  GLY A N     1 
ATOM   5865  C  CA    . GLY A 1  772  ? 4.447   4.559   73.126  1.00 74.15  ? 772  GLY A CA    1 
ATOM   5866  C  C     . GLY A 1  772  ? 3.853   5.230   74.351  1.00 73.31  ? 772  GLY A C     1 
ATOM   5867  O  O     . GLY A 1  772  ? 3.898   4.675   75.442  1.00 73.43  ? 772  GLY A O     1 
ATOM   5868  N  N     . LYS A 1  773  ? 3.301   6.422   74.185  1.00 72.51  ? 773  LYS A N     1 
ATOM   5869  C  CA    . LYS A 1  773  ? 2.654   7.097   75.297  1.00 72.22  ? 773  LYS A CA    1 
ATOM   5870  C  C     . LYS A 1  773  ? 1.276   7.589   74.872  1.00 72.03  ? 773  LYS A C     1 
ATOM   5871  O  O     . LYS A 1  773  ? 1.103   7.997   73.707  1.00 71.93  ? 773  LYS A O     1 
ATOM   5872  C  CB    . LYS A 1  773  ? 3.511   8.273   75.755  1.00 72.25  ? 773  LYS A CB    1 
ATOM   5873  C  CG    . LYS A 1  773  ? 4.677   7.907   76.658  1.00 71.95  ? 773  LYS A CG    1 
ATOM   5874  C  CD    . LYS A 1  773  ? 5.515   9.140   76.952  1.00 71.39  ? 773  LYS A CD    1 
ATOM   5875  C  CE    . LYS A 1  773  ? 5.967   9.168   78.402  1.00 71.34  ? 773  LYS A CE    1 
ATOM   5876  N  NZ    . LYS A 1  773  ? 6.457   10.547  78.760  1.00 71.60  ? 773  LYS A NZ    1 
ATOM   5877  N  N     . ARG A 1  774  ? 0.299   7.566   75.788  1.00 71.38  ? 774  ARG A N     1 
ATOM   5878  C  CA    . ARG A 1  774  ? -1.013  8.108   75.435  1.00 70.87  ? 774  ARG A CA    1 
ATOM   5879  C  C     . ARG A 1  774  ? -0.930  9.612   75.096  1.00 71.19  ? 774  ARG A C     1 
ATOM   5880  O  O     . ARG A 1  774  ? 0.169   10.201  75.108  1.00 71.22  ? 774  ARG A O     1 
ATOM   5881  C  CB    . ARG A 1  774  ? -2.107  7.749   76.434  1.00 70.28  ? 774  ARG A CB    1 
ATOM   5882  C  CG    . ARG A 1  774  ? -1.922  8.273   77.812  1.00 69.75  ? 774  ARG A CG    1 
ATOM   5883  C  CD    . ARG A 1  774  ? -2.714  7.416   78.807  1.00 68.75  ? 774  ARG A CD    1 
ATOM   5884  N  NE    . ARG A 1  774  ? -4.132  7.764   78.938  1.00 67.19  ? 774  ARG A NE    1 
ATOM   5885  C  CZ    . ARG A 1  774  ? -4.665  8.374   79.994  1.00 66.01  ? 774  ARG A CZ    1 
ATOM   5886  N  NH1   . ARG A 1  774  ? -3.904  8.720   81.026  1.00 65.28  ? 774  ARG A NH1   1 
ATOM   5887  N  NH2   . ARG A 1  774  ? -5.963  8.641   80.011  1.00 65.57  ? 774  ARG A NH2   1 
ATOM   5888  N  N     . ILE A 1  775  ? -2.066  10.218  74.742  1.00 71.26  ? 775  ILE A N     1 
ATOM   5889  C  CA    . ILE A 1  775  ? -2.029  11.431  73.912  1.00 71.15  ? 775  ILE A CA    1 
ATOM   5890  C  C     . ILE A 1  775  ? -1.396  12.583  74.643  1.00 70.76  ? 775  ILE A C     1 
ATOM   5891  O  O     . ILE A 1  775  ? -1.917  12.992  75.694  1.00 70.95  ? 775  ILE A O     1 
ATOM   5892  C  CB    . ILE A 1  775  ? -3.416  11.853  73.429  1.00 71.23  ? 775  ILE A CB    1 
ATOM   5893  C  CG1   . ILE A 1  775  ? -4.085  10.726  72.622  1.00 72.21  ? 775  ILE A CG1   1 
ATOM   5894  C  CG2   . ILE A 1  775  ? -3.305  13.114  72.598  1.00 71.58  ? 775  ILE A CG2   1 
ATOM   5895  C  CD1   . ILE A 1  775  ? -3.533  10.512  71.201  1.00 74.51  ? 775  ILE A CD1   1 
ATOM   5896  N  N     . ALA A 1  776  ? -0.294  13.094  74.074  1.00 69.92  ? 776  ALA A N     1 
ATOM   5897  C  CA    . ALA A 1  776  ? 0.537   14.176  74.668  1.00 69.31  ? 776  ALA A CA    1 
ATOM   5898  C  C     . ALA A 1  776  ? -0.147  15.550  75.005  1.00 68.66  ? 776  ALA A C     1 
ATOM   5899  O  O     . ALA A 1  776  ? -1.299  15.795  74.657  1.00 68.48  ? 776  ALA A O     1 
ATOM   5900  C  CB    . ALA A 1  776  ? 1.803   14.390  73.796  1.00 69.53  ? 776  ALA A CB    1 
ATOM   5901  N  N     . PHE A 1  777  ? 0.573   16.436  75.692  1.00 68.00  ? 777  PHE A N     1 
ATOM   5902  C  CA    . PHE A 1  777  ? 0.068   17.779  76.003  1.00 67.59  ? 777  PHE A CA    1 
ATOM   5903  C  C     . PHE A 1  777  ? 0.755   18.859  75.152  1.00 67.18  ? 777  PHE A C     1 
ATOM   5904  O  O     . PHE A 1  777  ? 1.812   19.372  75.524  1.00 66.84  ? 777  PHE A O     1 
ATOM   5905  C  CB    . PHE A 1  777  ? 0.336   18.119  77.471  1.00 67.89  ? 777  PHE A CB    1 
ATOM   5906  C  CG    . PHE A 1  777  ? -0.652  17.551  78.455  1.00 67.76  ? 777  PHE A CG    1 
ATOM   5907  C  CD1   . PHE A 1  777  ? -0.213  16.773  79.512  1.00 67.93  ? 777  PHE A CD1   1 
ATOM   5908  C  CD2   . PHE A 1  777  ? -1.994  17.842  78.368  1.00 67.34  ? 777  PHE A CD2   1 
ATOM   5909  C  CE1   . PHE A 1  777  ? -1.111  16.277  80.446  1.00 68.13  ? 777  PHE A CE1   1 
ATOM   5910  C  CE2   . PHE A 1  777  ? -2.892  17.357  79.303  1.00 67.72  ? 777  PHE A CE2   1 
ATOM   5911  C  CZ    . PHE A 1  777  ? -2.451  16.576  80.342  1.00 67.97  ? 777  PHE A CZ    1 
ATOM   5912  N  N     . GLY A 1  778  ? 0.164   19.219  74.021  1.00 66.91  ? 778  GLY A N     1 
ATOM   5913  C  CA    . GLY A 1  778  ? 0.759   20.238  73.154  1.00 66.59  ? 778  GLY A CA    1 
ATOM   5914  C  C     . GLY A 1  778  ? 0.448   21.597  73.718  1.00 66.60  ? 778  GLY A C     1 
ATOM   5915  O  O     . GLY A 1  778  ? 1.350   22.394  73.977  1.00 66.40  ? 778  GLY A O     1 
ATOM   5916  N  N     . PHE A 1  779  ? -0.850  21.843  73.911  1.00 66.97  ? 779  PHE A N     1 
ATOM   5917  C  CA    . PHE A 1  779  ? -1.356  22.999  74.661  1.00 67.12  ? 779  PHE A CA    1 
ATOM   5918  C  C     . PHE A 1  779  ? -1.120  22.795  76.146  1.00 67.58  ? 779  PHE A C     1 
ATOM   5919  O  O     . PHE A 1  779  ? -1.484  21.758  76.721  1.00 67.49  ? 779  PHE A O     1 
ATOM   5920  C  CB    . PHE A 1  779  ? -2.836  23.256  74.372  1.00 66.54  ? 779  PHE A CB    1 
ATOM   5921  C  CG    . PHE A 1  779  ? -3.140  23.381  72.907  1.00 66.59  ? 779  PHE A CG    1 
ATOM   5922  C  CD1   . PHE A 1  779  ? -3.992  22.481  72.278  1.00 66.53  ? 779  PHE A CD1   1 
ATOM   5923  C  CD2   . PHE A 1  779  ? -2.542  24.377  72.138  1.00 65.86  ? 779  PHE A CD2   1 
ATOM   5924  C  CE1   . PHE A 1  779  ? -4.246  22.586  70.913  1.00 66.07  ? 779  PHE A CE1   1 
ATOM   5925  C  CE2   . PHE A 1  779  ? -2.806  24.492  70.778  1.00 65.05  ? 779  PHE A CE2   1 
ATOM   5926  C  CZ    . PHE A 1  779  ? -3.653  23.601  70.168  1.00 65.54  ? 779  PHE A CZ    1 
ATOM   5927  N  N     . VAL A 1  780  ? -0.464  23.789  76.735  1.00 67.92  ? 780  VAL A N     1 
ATOM   5928  C  CA    . VAL A 1  780  ? -0.032  23.778  78.121  1.00 68.37  ? 780  VAL A CA    1 
ATOM   5929  C  C     . VAL A 1  780  ? -1.005  23.046  79.044  1.00 68.46  ? 780  VAL A C     1 
ATOM   5930  O  O     . VAL A 1  780  ? -2.162  23.454  79.189  1.00 68.88  ? 780  VAL A O     1 
ATOM   5931  C  CB    . VAL A 1  780  ? 0.172   25.219  78.587  1.00 68.29  ? 780  VAL A CB    1 
ATOM   5932  C  CG1   . VAL A 1  780  ? 0.360   25.288  80.090  1.00 68.79  ? 780  VAL A CG1   1 
ATOM   5933  C  CG2   . VAL A 1  780  ? 1.369   25.797  77.872  1.00 69.42  ? 780  VAL A CG2   1 
ATOM   5934  N  N     . ASP A 1  781  ? -0.537  21.949  79.640  1.00 68.30  ? 781  ASP A N     1 
ATOM   5935  C  CA    . ASP A 1  781  ? -1.335  21.153  80.605  1.00 68.16  ? 781  ASP A CA    1 
ATOM   5936  C  C     . ASP A 1  781  ? -2.763  20.756  80.119  1.00 67.72  ? 781  ASP A C     1 
ATOM   5937  O  O     . ASP A 1  781  ? -3.672  20.526  80.926  1.00 67.69  ? 781  ASP A O     1 
ATOM   5938  C  CB    . ASP A 1  781  ? -1.349  21.823  82.011  1.00 68.37  ? 781  ASP A CB    1 
ATOM   5939  C  CG    . ASP A 1  781  ? -0.129  21.418  82.909  1.00 68.45  ? 781  ASP A CG    1 
ATOM   5940  O  OD1   . ASP A 1  781  ? -0.020  20.215  83.269  1.00 68.11  ? 781  ASP A OD1   1 
ATOM   5941  O  OD2   . ASP A 1  781  ? 0.691   22.309  83.281  1.00 67.49  ? 781  ASP A OD2   1 
ATOM   5942  N  N     . ARG A 1  782  ? -2.927  20.684  78.794  1.00 67.20  ? 782  ARG A N     1 
ATOM   5943  C  CA    . ARG A 1  782  ? -4.118  20.111  78.124  1.00 66.45  ? 782  ARG A CA    1 
ATOM   5944  C  C     . ARG A 1  782  ? -3.769  19.631  76.687  1.00 66.46  ? 782  ARG A C     1 
ATOM   5945  O  O     . ARG A 1  782  ? -2.689  19.949  76.152  1.00 65.99  ? 782  ARG A O     1 
ATOM   5946  C  CB    . ARG A 1  782  ? -5.325  21.067  78.149  1.00 66.07  ? 782  ARG A CB    1 
ATOM   5947  C  CG    . ARG A 1  782  ? -4.952  22.530  78.123  1.00 64.41  ? 782  ARG A CG    1 
ATOM   5948  C  CD    . ARG A 1  782  ? -6.088  23.392  77.709  1.00 61.97  ? 782  ARG A CD    1 
ATOM   5949  N  NE    . ARG A 1  782  ? -5.601  24.456  76.844  1.00 62.12  ? 782  ARG A NE    1 
ATOM   5950  C  CZ    . ARG A 1  782  ? -6.361  25.421  76.338  1.00 62.49  ? 782  ARG A CZ    1 
ATOM   5951  N  NH1   . ARG A 1  782  ? -7.655  25.467  76.634  1.00 63.17  ? 782  ARG A NH1   1 
ATOM   5952  N  NH2   . ARG A 1  782  ? -5.829  26.346  75.541  1.00 61.44  ? 782  ARG A NH2   1 
ATOM   5953  N  N     . THR A 1  783  ? -4.672  18.849  76.086  1.00 66.40  ? 783  THR A N     1 
ATOM   5954  C  CA    . THR A 1  783  ? -4.451  18.264  74.750  1.00 66.10  ? 783  THR A CA    1 
ATOM   5955  C  C     . THR A 1  783  ? -5.016  19.112  73.617  1.00 65.73  ? 783  THR A C     1 
ATOM   5956  O  O     . THR A 1  783  ? -4.345  19.382  72.631  1.00 65.41  ? 783  THR A O     1 
ATOM   5957  C  CB    . THR A 1  783  ? -5.119  16.896  74.612  1.00 66.15  ? 783  THR A CB    1 
ATOM   5958  O  OG1   . THR A 1  783  ? -4.783  16.060  75.728  1.00 66.11  ? 783  THR A OG1   1 
ATOM   5959  C  CG2   . THR A 1  783  ? -4.645  16.254  73.329  1.00 66.58  ? 783  THR A CG2   1 
ATOM   5960  N  N     . LEU A 1  784  ? -6.287  19.469  73.756  1.00 65.72  ? 784  LEU A N     1 
ATOM   5961  C  CA    . LEU A 1  784  ? -6.957  20.381  72.838  1.00 65.38  ? 784  LEU A CA    1 
ATOM   5962  C  C     . LEU A 1  784  ? -7.564  21.557  73.631  1.00 65.26  ? 784  LEU A C     1 
ATOM   5963  O  O     . LEU A 1  784  ? -7.874  21.412  74.826  1.00 65.01  ? 784  LEU A O     1 
ATOM   5964  C  CB    . LEU A 1  784  ? -8.039  19.633  72.049  1.00 65.31  ? 784  LEU A CB    1 
ATOM   5965  C  CG    . LEU A 1  784  ? -7.650  18.466  71.138  1.00 64.12  ? 784  LEU A CG    1 
ATOM   5966  C  CD1   . LEU A 1  784  ? -8.918  17.789  70.674  1.00 62.91  ? 784  LEU A CD1   1 
ATOM   5967  C  CD2   . LEU A 1  784  ? -6.801  18.911  69.949  1.00 63.66  ? 784  LEU A CD2   1 
ATOM   5968  N  N     . PRO A 1  785  ? -7.746  22.720  72.979  1.00 64.91  ? 785  PRO A N     1 
ATOM   5969  C  CA    . PRO A 1  785  ? -8.178  23.816  73.786  1.00 64.99  ? 785  PRO A CA    1 
ATOM   5970  C  C     . PRO A 1  785  ? -9.690  23.764  74.033  1.00 65.42  ? 785  PRO A C     1 
ATOM   5971  O  O     . PRO A 1  785  ? -10.255 24.704  74.609  1.00 65.65  ? 785  PRO A O     1 
ATOM   5972  C  CB    . PRO A 1  785  ? -7.776  25.036  72.952  1.00 64.95  ? 785  PRO A CB    1 
ATOM   5973  C  CG    . PRO A 1  785  ? -7.147  24.511  71.713  1.00 64.76  ? 785  PRO A CG    1 
ATOM   5974  C  CD    . PRO A 1  785  ? -7.617  23.127  71.577  1.00 64.88  ? 785  PRO A CD    1 
ATOM   5975  N  N     . HIS A 1  786  ? -10.334 22.670  73.617  1.00 65.73  ? 786  HIS A N     1 
ATOM   5976  C  CA    . HIS A 1  786  ? -11.719 22.382  74.019  1.00 66.08  ? 786  HIS A CA    1 
ATOM   5977  C  C     . HIS A 1  786  ? -11.735 21.641  75.345  1.00 66.46  ? 786  HIS A C     1 
ATOM   5978  O  O     . HIS A 1  786  ? -12.608 20.813  75.564  1.00 66.79  ? 786  HIS A O     1 
ATOM   5979  C  CB    . HIS A 1  786  ? -12.448 21.529  72.979  1.00 65.78  ? 786  HIS A CB    1 
ATOM   5980  C  CG    . HIS A 1  786  ? -11.955 21.736  71.590  1.00 66.61  ? 786  HIS A CG    1 
ATOM   5981  N  ND1   . HIS A 1  786  ? -12.389 22.775  70.800  1.00 67.58  ? 786  HIS A ND1   1 
ATOM   5982  C  CD2   . HIS A 1  786  ? -11.041 21.056  70.856  1.00 66.91  ? 786  HIS A CD2   1 
ATOM   5983  C  CE1   . HIS A 1  786  ? -11.764 22.724  69.636  1.00 68.31  ? 786  HIS A CE1   1 
ATOM   5984  N  NE2   . HIS A 1  786  ? -10.946 21.686  69.642  1.00 66.95  ? 786  HIS A NE2   1 
ATOM   5985  N  N     . PHE A 1  787  ? -10.771 21.930  76.221  1.00 67.04  ? 787  PHE A N     1 
ATOM   5986  C  CA    . PHE A 1  787  ? -10.595 21.204  77.487  1.00 67.39  ? 787  PHE A CA    1 
ATOM   5987  C  C     . PHE A 1  787  ? -10.061 22.074  78.602  1.00 67.63  ? 787  PHE A C     1 
ATOM   5988  O  O     . PHE A 1  787  ? -9.320  23.034  78.376  1.00 67.65  ? 787  PHE A O     1 
ATOM   5989  C  CB    . PHE A 1  787  ? -9.595  20.061  77.330  1.00 67.70  ? 787  PHE A CB    1 
ATOM   5990  C  CG    . PHE A 1  787  ? -10.166 18.817  76.734  1.00 67.84  ? 787  PHE A CG    1 
ATOM   5991  C  CD1   . PHE A 1  787  ? -9.484  18.160  75.706  1.00 68.02  ? 787  PHE A CD1   1 
ATOM   5992  C  CD2   . PHE A 1  787  ? -11.363 18.289  77.209  1.00 66.81  ? 787  PHE A CD2   1 
ATOM   5993  C  CE1   . PHE A 1  787  ? -9.994  17.012  75.161  1.00 67.96  ? 787  PHE A CE1   1 
ATOM   5994  C  CE2   . PHE A 1  787  ? -11.885 17.149  76.666  1.00 67.03  ? 787  PHE A CE2   1 
ATOM   5995  C  CZ    . PHE A 1  787  ? -11.204 16.505  75.639  1.00 68.05  ? 787  PHE A CZ    1 
ATOM   5996  N  N     . SER A 1  788  ? -10.407 21.692  79.822  1.00 68.06  ? 788  SER A N     1 
ATOM   5997  C  CA    . SER A 1  788  ? -9.837  22.315  81.005  1.00 68.56  ? 788  SER A CA    1 
ATOM   5998  C  C     . SER A 1  788  ? -8.328  22.011  81.034  1.00 69.15  ? 788  SER A C     1 
ATOM   5999  O  O     . SER A 1  788  ? -7.848  21.170  80.268  1.00 69.12  ? 788  SER A O     1 
ATOM   6000  C  CB    . SER A 1  788  ? -10.552 21.791  82.263  1.00 68.31  ? 788  SER A CB    1 
ATOM   6001  O  OG    . SER A 1  788  ? -11.960 21.738  82.074  1.00 66.97  ? 788  SER A OG    1 
ATOM   6002  N  N     . LYS A 1  789  ? -7.574  22.702  81.885  1.00 69.94  ? 789  LYS A N     1 
ATOM   6003  C  CA    . LYS A 1  789  ? -6.199  22.274  82.144  1.00 70.73  ? 789  LYS A CA    1 
ATOM   6004  C  C     . LYS A 1  789  ? -6.189  21.102  83.109  1.00 71.32  ? 789  LYS A C     1 
ATOM   6005  O  O     . LYS A 1  789  ? -7.174  20.849  83.808  1.00 71.43  ? 789  LYS A O     1 
ATOM   6006  C  CB    . LYS A 1  789  ? -5.319  23.427  82.648  1.00 70.62  ? 789  LYS A CB    1 
ATOM   6007  C  CG    . LYS A 1  789  ? -4.398  23.985  81.561  1.00 70.39  ? 789  LYS A CG    1 
ATOM   6008  C  CD    . LYS A 1  789  ? -4.067  25.460  81.734  1.00 68.90  ? 789  LYS A CD    1 
ATOM   6009  C  CE    . LYS A 1  789  ? -3.435  26.012  80.465  1.00 67.66  ? 789  LYS A CE    1 
ATOM   6010  N  NZ    . LYS A 1  789  ? -3.157  27.473  80.516  1.00 67.75  ? 789  LYS A NZ    1 
ATOM   6011  N  N     . ASP A 1  790  ? -5.081  20.372  83.117  1.00 72.22  ? 790  ASP A N     1 
ATOM   6012  C  CA    . ASP A 1  790  ? -4.847  19.312  84.101  1.00 73.30  ? 790  ASP A CA    1 
ATOM   6013  C  C     . ASP A 1  790  ? -6.052  18.343  84.266  1.00 73.78  ? 790  ASP A C     1 
ATOM   6014  O  O     . ASP A 1  790  ? -6.517  18.070  85.381  1.00 73.54  ? 790  ASP A O     1 
ATOM   6015  C  CB    . ASP A 1  790  ? -4.385  19.926  85.441  1.00 73.48  ? 790  ASP A CB    1 
ATOM   6016  C  CG    . ASP A 1  790  ? -3.018  20.669  85.337  1.00 74.09  ? 790  ASP A CG    1 
ATOM   6017  O  OD1   . ASP A 1  790  ? -3.001  21.919  85.156  1.00 73.77  ? 790  ASP A OD1   1 
ATOM   6018  O  OD2   . ASP A 1  790  ? -1.960  19.998  85.461  1.00 74.43  ? 790  ASP A OD2   1 
ATOM   6019  N  N     . ASP A 1  791  ? -6.540  17.854  83.119  1.00 74.63  ? 791  ASP A N     1 
ATOM   6020  C  CA    . ASP A 1  791  ? -7.551  16.779  83.011  1.00 75.17  ? 791  ASP A CA    1 
ATOM   6021  C  C     . ASP A 1  791  ? -6.907  15.475  82.496  1.00 75.81  ? 791  ASP A C     1 
ATOM   6022  O  O     . ASP A 1  791  ? -6.462  15.397  81.329  1.00 75.97  ? 791  ASP A O     1 
ATOM   6023  C  CB    . ASP A 1  791  ? -8.691  17.219  82.074  1.00 75.03  ? 791  ASP A CB    1 
ATOM   6024  C  CG    . ASP A 1  791  ? -9.708  16.109  81.783  1.00 74.46  ? 791  ASP A CG    1 
ATOM   6025  O  OD1   . ASP A 1  791  ? -9.392  14.908  81.910  1.00 73.77  ? 791  ASP A OD1   1 
ATOM   6026  O  OD2   . ASP A 1  791  ? -10.846 16.451  81.401  1.00 74.11  ? 791  ASP A OD2   1 
ATOM   6027  N  N     . TYR A 1  792  ? -6.886  14.458  83.366  1.00 76.25  ? 792  TYR A N     1 
ATOM   6028  C  CA    . TYR A 1  792  ? -6.175  13.195  83.103  1.00 76.59  ? 792  TYR A CA    1 
ATOM   6029  C  C     . TYR A 1  792  ? -7.080  11.980  82.863  1.00 76.76  ? 792  TYR A C     1 
ATOM   6030  O  O     . TYR A 1  792  ? -6.611  10.841  82.895  1.00 76.85  ? 792  TYR A O     1 
ATOM   6031  C  CB    . TYR A 1  792  ? -5.209  12.878  84.246  1.00 76.52  ? 792  TYR A CB    1 
ATOM   6032  C  CG    . TYR A 1  792  ? -3.854  13.557  84.183  1.00 76.50  ? 792  TYR A CG    1 
ATOM   6033  C  CD1   . TYR A 1  792  ? -3.540  14.605  85.045  1.00 76.63  ? 792  TYR A CD1   1 
ATOM   6034  C  CD2   . TYR A 1  792  ? -2.877  13.127  83.295  1.00 76.71  ? 792  TYR A CD2   1 
ATOM   6035  C  CE1   . TYR A 1  792  ? -2.299  15.217  85.010  1.00 76.49  ? 792  TYR A CE1   1 
ATOM   6036  C  CE2   . TYR A 1  792  ? -1.628  13.734  83.258  1.00 76.93  ? 792  TYR A CE2   1 
ATOM   6037  C  CZ    . TYR A 1  792  ? -1.352  14.774  84.117  1.00 76.50  ? 792  TYR A CZ    1 
ATOM   6038  O  OH    . TYR A 1  792  ? -0.126  15.376  84.080  1.00 76.73  ? 792  TYR A OH    1 
ATOM   6039  N  N     . SER A 1  793  ? -8.367  12.215  82.622  1.00 77.04  ? 793  SER A N     1 
ATOM   6040  C  CA    . SER A 1  793  ? -9.294  11.134  82.258  1.00 77.32  ? 793  SER A CA    1 
ATOM   6041  C  C     . SER A 1  793  ? -8.987  10.636  80.827  1.00 77.39  ? 793  SER A C     1 
ATOM   6042  O  O     . SER A 1  793  ? -8.120  11.208  80.158  1.00 77.65  ? 793  SER A O     1 
ATOM   6043  C  CB    . SER A 1  793  ? -10.759 11.581  82.432  1.00 77.30  ? 793  SER A CB    1 
ATOM   6044  O  OG    . SER A 1  793  ? -11.080 12.674  81.588  1.00 77.06  ? 793  SER A OG    1 
ATOM   6045  N  N     . PRO A 1  794  ? -9.679  9.572   80.355  1.00 77.28  ? 794  PRO A N     1 
ATOM   6046  C  CA    . PRO A 1  794  ? -9.331  8.954   79.061  1.00 77.16  ? 794  PRO A CA    1 
ATOM   6047  C  C     . PRO A 1  794  ? -9.808  9.714   77.803  1.00 77.22  ? 794  PRO A C     1 
ATOM   6048  O  O     . PRO A 1  794  ? -9.098  9.731   76.787  1.00 77.10  ? 794  PRO A O     1 
ATOM   6049  C  CB    . PRO A 1  794  ? -10.000 7.585   79.151  1.00 77.14  ? 794  PRO A CB    1 
ATOM   6050  C  CG    . PRO A 1  794  ? -11.170 7.791   80.049  1.00 76.96  ? 794  PRO A CG    1 
ATOM   6051  C  CD    . PRO A 1  794  ? -10.817 8.889   81.005  1.00 77.11  ? 794  PRO A CD    1 
ATOM   6052  N  N     . GLU A 1  795  ? -11.001 10.314  77.876  1.00 77.25  ? 795  GLU A N     1 
ATOM   6053  C  CA    . GLU A 1  795  ? -11.561 11.112  76.781  1.00 77.09  ? 795  GLU A CA    1 
ATOM   6054  C  C     . GLU A 1  795  ? -10.590 12.221  76.466  1.00 76.25  ? 795  GLU A C     1 
ATOM   6055  O  O     . GLU A 1  795  ? -10.298 12.468  75.308  1.00 76.37  ? 795  GLU A O     1 
ATOM   6056  C  CB    . GLU A 1  795  ? -12.951 11.681  77.126  1.00 77.32  ? 795  GLU A CB    1 
ATOM   6057  C  CG    . GLU A 1  795  ? -13.086 12.318  78.526  1.00 80.21  ? 795  GLU A CG    1 
ATOM   6058  C  CD    . GLU A 1  795  ? -13.387 11.294  79.651  1.00 84.67  ? 795  GLU A CD    1 
ATOM   6059  O  OE1   . GLU A 1  795  ? -13.639 11.718  80.819  1.00 86.91  ? 795  GLU A OE1   1 
ATOM   6060  O  OE2   . GLU A 1  795  ? -13.382 10.067  79.365  1.00 85.15  ? 795  GLU A OE2   1 
ATOM   6061  N  N     . SER A 1  796  ? -10.062 12.848  77.514  1.00 75.49  ? 796  SER A N     1 
ATOM   6062  C  CA    . SER A 1  796  ? -9.093  13.927  77.390  1.00 74.93  ? 796  SER A CA    1 
ATOM   6063  C  C     . SER A 1  796  ? -7.788  13.439  76.780  1.00 74.78  ? 796  SER A C     1 
ATOM   6064  O  O     . SER A 1  796  ? -7.142  14.169  76.018  1.00 74.95  ? 796  SER A O     1 
ATOM   6065  C  CB    . SER A 1  796  ? -8.817  14.547  78.761  1.00 74.83  ? 796  SER A CB    1 
ATOM   6066  O  OG    . SER A 1  796  ? -7.821  15.555  78.702  1.00 73.97  ? 796  SER A OG    1 
ATOM   6067  N  N     . LYS A 1  797  ? -7.420  12.200  77.096  1.00 74.32  ? 797  LYS A N     1 
ATOM   6068  C  CA    . LYS A 1  797  ? -6.073  11.696  76.803  1.00 73.90  ? 797  LYS A CA    1 
ATOM   6069  C  C     . LYS A 1  797  ? -5.954  10.697  75.616  1.00 73.65  ? 797  LYS A C     1 
ATOM   6070  O  O     . LYS A 1  797  ? -4.885  10.118  75.372  1.00 73.54  ? 797  LYS A O     1 
ATOM   6071  C  CB    . LYS A 1  797  ? -5.413  11.156  78.090  1.00 73.95  ? 797  LYS A CB    1 
ATOM   6072  C  CG    . LYS A 1  797  ? -5.252  12.174  79.242  1.00 72.76  ? 797  LYS A CG    1 
ATOM   6073  C  CD    . LYS A 1  797  ? -3.844  12.132  79.813  1.00 71.60  ? 797  LYS A CD    1 
ATOM   6074  C  CE    . LYS A 1  797  ? -2.882  12.923  78.914  1.00 71.58  ? 797  LYS A CE    1 
ATOM   6075  N  NZ    . LYS A 1  797  ? -1.582  12.246  78.658  1.00 70.59  ? 797  LYS A NZ    1 
ATOM   6076  N  N     . GLY A 1  798  ? -7.044  10.514  74.878  1.00 73.21  ? 798  GLY A N     1 
ATOM   6077  C  CA    . GLY A 1  798  ? -6.972  9.865   73.572  1.00 72.93  ? 798  GLY A CA    1 
ATOM   6078  C  C     . GLY A 1  798  ? -7.770  8.594   73.410  1.00 72.74  ? 798  GLY A C     1 
ATOM   6079  O  O     . GLY A 1  798  ? -7.441  7.754   72.551  1.00 72.60  ? 798  GLY A O     1 
ATOM   6080  N  N     . PHE A 1  799  ? -8.821  8.455   74.225  1.00 72.43  ? 799  PHE A N     1 
ATOM   6081  C  CA    . PHE A 1  799  ? -9.612  7.225   74.221  1.00 72.11  ? 799  PHE A CA    1 
ATOM   6082  C  C     . PHE A 1  799  ? -10.883 7.300   73.418  1.00 72.26  ? 799  PHE A C     1 
ATOM   6083  O  O     . PHE A 1  799  ? -11.931 7.746   73.902  1.00 72.28  ? 799  PHE A O     1 
ATOM   6084  C  CB    . PHE A 1  799  ? -9.925  6.691   75.615  1.00 71.69  ? 799  PHE A CB    1 
ATOM   6085  C  CG    . PHE A 1  799  ? -10.508 5.306   75.593  1.00 71.15  ? 799  PHE A CG    1 
ATOM   6086  C  CD1   . PHE A 1  799  ? -9.715  4.211   75.247  1.00 70.78  ? 799  PHE A CD1   1 
ATOM   6087  C  CD2   . PHE A 1  799  ? -11.854 5.097   75.887  1.00 70.11  ? 799  PHE A CD2   1 
ATOM   6088  C  CE1   . PHE A 1  799  ? -10.260 2.929   75.210  1.00 70.64  ? 799  PHE A CE1   1 
ATOM   6089  C  CE2   . PHE A 1  799  ? -12.407 3.817   75.856  1.00 69.46  ? 799  PHE A CE2   1 
ATOM   6090  C  CZ    . PHE A 1  799  ? -11.617 2.735   75.511  1.00 70.04  ? 799  PHE A CZ    1 
ATOM   6091  N  N     . VAL A 1  800  ? -10.767 6.809   72.190  1.00 72.29  ? 800  VAL A N     1 
ATOM   6092  C  CA    . VAL A 1  800  ? -11.855 6.783   71.244  1.00 72.02  ? 800  VAL A CA    1 
ATOM   6093  C  C     . VAL A 1  800  ? -12.896 5.807   71.728  1.00 71.93  ? 800  VAL A C     1 
ATOM   6094  O  O     . VAL A 1  800  ? -12.760 4.599   71.604  1.00 71.69  ? 800  VAL A O     1 
ATOM   6095  C  CB    . VAL A 1  800  ? -11.352 6.431   69.858  1.00 71.84  ? 800  VAL A CB    1 
ATOM   6096  C  CG1   . VAL A 1  800  ? -12.409 6.772   68.844  1.00 72.65  ? 800  VAL A CG1   1 
ATOM   6097  C  CG2   . VAL A 1  800  ? -10.080 7.194   69.565  1.00 71.19  ? 800  VAL A CG2   1 
ATOM   6098  N  N     . GLU A 1  801  ? -13.939 6.374   72.294  1.00 72.40  ? 801  GLU A N     1 
ATOM   6099  C  CA    . GLU A 1  801  ? -14.914 5.635   73.072  1.00 73.39  ? 801  GLU A CA    1 
ATOM   6100  C  C     . GLU A 1  801  ? -15.918 4.918   72.177  1.00 73.12  ? 801  GLU A C     1 
ATOM   6101  O  O     . GLU A 1  801  ? -16.597 3.979   72.608  1.00 72.63  ? 801  GLU A O     1 
ATOM   6102  C  CB    . GLU A 1  801  ? -15.619 6.624   73.996  1.00 73.90  ? 801  GLU A CB    1 
ATOM   6103  C  CG    . GLU A 1  801  ? -15.874 6.126   75.394  1.00 76.55  ? 801  GLU A CG    1 
ATOM   6104  C  CD    . GLU A 1  801  ? -17.327 5.805   75.601  1.00 81.04  ? 801  GLU A CD    1 
ATOM   6105  O  OE1   . GLU A 1  801  ? -17.835 4.927   74.857  1.00 82.95  ? 801  GLU A OE1   1 
ATOM   6106  O  OE2   . GLU A 1  801  ? -17.962 6.437   76.493  1.00 83.00  ? 801  GLU A OE2   1 
ATOM   6107  N  N     . ASN A 1  802  ? -15.978 5.364   70.920  1.00 73.25  ? 802  ASN A N     1 
ATOM   6108  C  CA    . ASN A 1  802  ? -16.952 4.871   69.941  1.00 73.05  ? 802  ASN A CA    1 
ATOM   6109  C  C     . ASN A 1  802  ? -16.350 3.882   68.939  1.00 72.40  ? 802  ASN A C     1 
ATOM   6110  O  O     . ASN A 1  802  ? -15.137 3.869   68.731  1.00 72.14  ? 802  ASN A O     1 
ATOM   6111  C  CB    . ASN A 1  802  ? -17.610 6.060   69.217  1.00 73.26  ? 802  ASN A CB    1 
ATOM   6112  C  CG    . ASN A 1  802  ? -18.683 6.763   70.073  1.00 73.69  ? 802  ASN A CG    1 
ATOM   6113  O  OD1   . ASN A 1  802  ? -19.763 6.206   70.321  1.00 73.46  ? 802  ASN A OD1   1 
ATOM   6114  N  ND2   . ASN A 1  802  ? -18.389 7.995   70.507  1.00 73.11  ? 802  ASN A ND2   1 
ATOM   6115  N  N     . SER A 1  803  ? -17.203 3.052   68.342  1.00 71.69  ? 803  SER A N     1 
ATOM   6116  C  CA    . SER A 1  803  ? -16.799 2.126   67.270  1.00 71.46  ? 803  SER A CA    1 
ATOM   6117  C  C     . SER A 1  803  ? -16.677 2.855   65.920  1.00 71.16  ? 803  SER A C     1 
ATOM   6118  O  O     . SER A 1  803  ? -17.013 4.033   65.844  1.00 72.20  ? 803  SER A O     1 
ATOM   6119  C  CB    . SER A 1  803  ? -17.825 1.001   67.179  1.00 71.51  ? 803  SER A CB    1 
ATOM   6120  O  OG    . SER A 1  803  ? -19.066 1.424   67.714  1.00 71.55  ? 803  SER A OG    1 
ATOM   6121  N  N     . TYR A 1  804  ? -16.217 2.200   64.855  1.00 69.90  ? 804  TYR A N     1 
ATOM   6122  C  CA    . TYR A 1  804  ? -16.195 2.873   63.548  1.00 68.90  ? 804  TYR A CA    1 
ATOM   6123  C  C     . TYR A 1  804  ? -17.572 3.022   62.879  1.00 68.40  ? 804  TYR A C     1 
ATOM   6124  O  O     . TYR A 1  804  ? -17.892 4.050   62.284  1.00 67.82  ? 804  TYR A O     1 
ATOM   6125  C  CB    . TYR A 1  804  ? -15.288 2.130   62.615  1.00 69.14  ? 804  TYR A CB    1 
ATOM   6126  C  CG    . TYR A 1  804  ? -13.849 2.466   62.763  1.00 68.47  ? 804  TYR A CG    1 
ATOM   6127  C  CD1   . TYR A 1  804  ? -13.039 1.753   63.634  1.00 68.82  ? 804  TYR A CD1   1 
ATOM   6128  C  CD2   . TYR A 1  804  ? -13.284 3.466   62.001  1.00 67.73  ? 804  TYR A CD2   1 
ATOM   6129  C  CE1   . TYR A 1  804  ? -11.685 2.045   63.759  1.00 69.98  ? 804  TYR A CE1   1 
ATOM   6130  C  CE2   . TYR A 1  804  ? -11.938 3.770   62.112  1.00 69.58  ? 804  TYR A CE2   1 
ATOM   6131  C  CZ    . TYR A 1  804  ? -11.129 3.059   62.988  1.00 70.05  ? 804  TYR A CZ    1 
ATOM   6132  O  OH    . TYR A 1  804  ? -9.773  3.360   63.082  1.00 69.62  ? 804  TYR A OH    1 
ATOM   6133  N  N     . LEU A 1  805  ? -18.353 1.955   62.957  1.00 68.19  ? 805  LEU A N     1 
ATOM   6134  C  CA    . LEU A 1  805  ? -19.796 1.944   62.663  1.00 68.15  ? 805  LEU A CA    1 
ATOM   6135  C  C     . LEU A 1  805  ? -20.632 3.067   63.329  1.00 67.83  ? 805  LEU A C     1 
ATOM   6136  O  O     . LEU A 1  805  ? -21.646 3.508   62.769  1.00 67.75  ? 805  LEU A O     1 
ATOM   6137  C  CB    . LEU A 1  805  ? -20.363 0.578   63.089  1.00 68.24  ? 805  LEU A CB    1 
ATOM   6138  C  CG    . LEU A 1  805  ? -21.801 0.091   62.870  1.00 68.23  ? 805  LEU A CG    1 
ATOM   6139  C  CD1   . LEU A 1  805  ? -22.837 0.751   63.830  1.00 69.18  ? 805  LEU A CD1   1 
ATOM   6140  C  CD2   . LEU A 1  805  ? -22.215 0.185   61.397  1.00 67.60  ? 805  LEU A CD2   1 
ATOM   6141  N  N     . ARG A 1  806  ? -20.233 3.487   64.529  1.00 67.30  ? 806  ARG A N     1 
ATOM   6142  C  CA    . ARG A 1  806  ? -20.924 4.554   65.241  1.00 67.08  ? 806  ARG A CA    1 
ATOM   6143  C  C     . ARG A 1  806  ? -20.479 5.934   64.802  1.00 66.52  ? 806  ARG A C     1 
ATOM   6144  O  O     . ARG A 1  806  ? -21.296 6.858   64.710  1.00 66.30  ? 806  ARG A O     1 
ATOM   6145  C  CB    . ARG A 1  806  ? -20.728 4.401   66.744  1.00 67.56  ? 806  ARG A CB    1 
ATOM   6146  C  CG    . ARG A 1  806  ? -21.989 3.955   67.483  1.00 69.17  ? 806  ARG A CG    1 
ATOM   6147  C  CD    . ARG A 1  806  ? -21.617 3.095   68.639  1.00 71.10  ? 806  ARG A CD    1 
ATOM   6148  N  NE    . ARG A 1  806  ? -22.709 2.926   69.576  1.00 73.45  ? 806  ARG A NE    1 
ATOM   6149  C  CZ    . ARG A 1  806  ? -22.510 2.790   70.883  1.00 76.53  ? 806  ARG A CZ    1 
ATOM   6150  N  NH1   . ARG A 1  806  ? -21.258 2.821   71.346  1.00 77.83  ? 806  ARG A NH1   1 
ATOM   6151  N  NH2   . ARG A 1  806  ? -23.541 2.640   71.728  1.00 76.79  ? 806  ARG A NH2   1 
ATOM   6152  N  N     . GLY A 1  807  ? -19.184 6.051   64.522  1.00 66.12  ? 807  GLY A N     1 
ATOM   6153  C  CA    . GLY A 1  807  ? -18.549 7.310   64.141  1.00 65.74  ? 807  GLY A CA    1 
ATOM   6154  C  C     . GLY A 1  807  ? -17.735 7.847   65.297  1.00 65.42  ? 807  GLY A C     1 
ATOM   6155  O  O     . GLY A 1  807  ? -18.164 7.731   66.443  1.00 65.54  ? 807  GLY A O     1 
ATOM   6156  N  N     . LEU A 1  808  ? -16.562 8.412   64.993  1.00 65.06  ? 808  LEU A N     1 
ATOM   6157  C  CA    . LEU A 1  808  ? -15.677 9.061   65.978  1.00 64.55  ? 808  LEU A CA    1 
ATOM   6158  C  C     . LEU A 1  808  ? -16.114 10.501  66.257  1.00 64.70  ? 808  LEU A C     1 
ATOM   6159  O  O     . LEU A 1  808  ? -16.790 11.107  65.433  1.00 64.98  ? 808  LEU A O     1 
ATOM   6160  C  CB    . LEU A 1  808  ? -14.252 9.078   65.443  1.00 64.61  ? 808  LEU A CB    1 
ATOM   6161  C  CG    . LEU A 1  808  ? -13.393 7.825   65.572  1.00 64.46  ? 808  LEU A CG    1 
ATOM   6162  C  CD1   . LEU A 1  808  ? -14.266 6.591   65.434  1.00 65.12  ? 808  LEU A CD1   1 
ATOM   6163  C  CD2   . LEU A 1  808  ? -12.205 7.809   64.585  1.00 63.49  ? 808  LEU A CD2   1 
ATOM   6164  N  N     . THR A 1  809  ? -15.760 11.053  67.413  1.00 64.62  ? 809  THR A N     1 
ATOM   6165  C  CA    . THR A 1  809  ? -16.064 12.465  67.668  1.00 64.83  ? 809  THR A CA    1 
ATOM   6166  C  C     . THR A 1  809  ? -14.894 13.351  67.217  1.00 64.64  ? 809  THR A C     1 
ATOM   6167  O  O     . THR A 1  809  ? -13.768 12.860  67.107  1.00 64.78  ? 809  THR A O     1 
ATOM   6168  C  CB    . THR A 1  809  ? -16.489 12.766  69.157  1.00 65.16  ? 809  THR A CB    1 
ATOM   6169  O  OG1   . THR A 1  809  ? -16.033 11.738  70.048  1.00 64.77  ? 809  THR A OG1   1 
ATOM   6170  C  CG2   . THR A 1  809  ? -18.006 12.909  69.284  1.00 65.52  ? 809  THR A CG2   1 
ATOM   6171  N  N     . PRO A 1  810  ? -15.161 14.646  66.928  1.00 64.25  ? 810  PRO A N     1 
ATOM   6172  C  CA    . PRO A 1  810  ? -14.132 15.637  66.569  1.00 64.14  ? 810  PRO A CA    1 
ATOM   6173  C  C     . PRO A 1  810  ? -12.792 15.477  67.307  1.00 64.40  ? 810  PRO A C     1 
ATOM   6174  O  O     . PRO A 1  810  ? -11.747 15.446  66.649  1.00 64.41  ? 810  PRO A O     1 
ATOM   6175  C  CB    . PRO A 1  810  ? -14.787 16.962  66.939  1.00 63.91  ? 810  PRO A CB    1 
ATOM   6176  C  CG    . PRO A 1  810  ? -16.223 16.618  67.339  1.00 63.76  ? 810  PRO A CG    1 
ATOM   6177  C  CD    . PRO A 1  810  ? -16.501 15.248  66.913  1.00 63.77  ? 810  PRO A CD    1 
ATOM   6178  N  N     . GLN A 1  811  ? -12.828 15.372  68.643  1.00 64.63  ? 811  GLN A N     1 
ATOM   6179  C  CA    . GLN A 1  811  ? -11.616 15.158  69.461  1.00 65.00  ? 811  GLN A CA    1 
ATOM   6180  C  C     . GLN A 1  811  ? -11.039 13.781  69.196  1.00 64.95  ? 811  GLN A C     1 
ATOM   6181  O  O     . GLN A 1  811  ? -9.853  13.616  68.878  1.00 64.72  ? 811  GLN A O     1 
ATOM   6182  C  CB    . GLN A 1  811  ? -11.905 15.261  70.959  1.00 65.02  ? 811  GLN A CB    1 
ATOM   6183  C  CG    . GLN A 1  811  ? -12.410 16.585  71.435  1.00 66.57  ? 811  GLN A CG    1 
ATOM   6184  C  CD    . GLN A 1  811  ? -13.909 16.586  71.607  1.00 69.25  ? 811  GLN A CD    1 
ATOM   6185  O  OE1   . GLN A 1  811  ? -14.655 16.330  70.660  1.00 70.51  ? 811  GLN A OE1   1 
ATOM   6186  N  NE2   . GLN A 1  811  ? -14.364 16.869  72.824  1.00 70.35  ? 811  GLN A NE2   1 
ATOM   6187  N  N     . GLU A 1  812  ? -11.902 12.787  69.352  1.00 65.04  ? 812  GLU A N     1 
ATOM   6188  C  CA    . GLU A 1  812  ? -11.555 11.431  69.014  1.00 65.22  ? 812  GLU A CA    1 
ATOM   6189  C  C     . GLU A 1  812  ? -10.832 11.476  67.688  1.00 64.68  ? 812  GLU A C     1 
ATOM   6190  O  O     . GLU A 1  812  ? -9.689  11.019  67.611  1.00 64.54  ? 812  GLU A O     1 
ATOM   6191  C  CB    . GLU A 1  812  ? -12.806 10.555  68.926  1.00 65.44  ? 812  GLU A CB    1 
ATOM   6192  C  CG    . GLU A 1  812  ? -13.606 10.497  70.230  1.00 67.65  ? 812  GLU A CG    1 
ATOM   6193  C  CD    . GLU A 1  812  ? -14.492 9.252   70.360  1.00 70.23  ? 812  GLU A CD    1 
ATOM   6194  O  OE1   . GLU A 1  812  ? -15.088 8.808   69.345  1.00 72.05  ? 812  GLU A OE1   1 
ATOM   6195  O  OE2   . GLU A 1  812  ? -14.593 8.722   71.493  1.00 71.28  ? 812  GLU A OE2   1 
ATOM   6196  N  N     . PHE A 1  813  ? -11.467 12.082  66.672  1.00 64.10  ? 813  PHE A N     1 
ATOM   6197  C  CA    . PHE A 1  813  ? -10.916 12.050  65.322  1.00 63.46  ? 813  PHE A CA    1 
ATOM   6198  C  C     . PHE A 1  813  ? -9.517  12.555  65.338  1.00 63.60  ? 813  PHE A C     1 
ATOM   6199  O  O     . PHE A 1  813  ? -8.596  11.837  64.930  1.00 63.94  ? 813  PHE A O     1 
ATOM   6200  C  CB    . PHE A 1  813  ? -11.700 12.837  64.278  1.00 62.91  ? 813  PHE A CB    1 
ATOM   6201  C  CG    . PHE A 1  813  ? -11.149 12.667  62.877  1.00 62.36  ? 813  PHE A CG    1 
ATOM   6202  C  CD1   . PHE A 1  813  ? -10.181 11.677  62.601  1.00 62.45  ? 813  PHE A CD1   1 
ATOM   6203  C  CD2   . PHE A 1  813  ? -11.602 13.450  61.831  1.00 61.52  ? 813  PHE A CD2   1 
ATOM   6204  C  CE1   . PHE A 1  813  ? -9.655  11.485  61.315  1.00 61.45  ? 813  PHE A CE1   1 
ATOM   6205  C  CE2   . PHE A 1  813  ? -11.095 13.263  60.538  1.00 61.47  ? 813  PHE A CE2   1 
ATOM   6206  C  CZ    . PHE A 1  813  ? -10.113 12.276  60.284  1.00 61.73  ? 813  PHE A CZ    1 
ATOM   6207  N  N     . PHE A 1  814  ? -9.348  13.784  65.817  1.00 63.42  ? 814  PHE A N     1 
ATOM   6208  C  CA    . PHE A 1  814  ? -8.029  14.373  65.776  1.00 63.35  ? 814  PHE A CA    1 
ATOM   6209  C  C     . PHE A 1  814  ? -6.999  13.516  66.504  1.00 63.41  ? 814  PHE A C     1 
ATOM   6210  O  O     . PHE A 1  814  ? -5.892  13.341  66.004  1.00 63.37  ? 814  PHE A O     1 
ATOM   6211  C  CB    . PHE A 1  814  ? -8.000  15.820  66.257  1.00 63.19  ? 814  PHE A CB    1 
ATOM   6212  C  CG    . PHE A 1  814  ? -6.693  16.507  65.971  1.00 62.95  ? 814  PHE A CG    1 
ATOM   6213  C  CD1   . PHE A 1  814  ? -6.326  16.812  64.667  1.00 62.42  ? 814  PHE A CD1   1 
ATOM   6214  C  CD2   . PHE A 1  814  ? -5.817  16.816  66.996  1.00 62.57  ? 814  PHE A CD2   1 
ATOM   6215  C  CE1   . PHE A 1  814  ? -5.129  17.426  64.397  1.00 61.91  ? 814  PHE A CE1   1 
ATOM   6216  C  CE2   . PHE A 1  814  ? -4.621  17.429  66.729  1.00 62.27  ? 814  PHE A CE2   1 
ATOM   6217  C  CZ    . PHE A 1  814  ? -4.274  17.728  65.427  1.00 62.39  ? 814  PHE A CZ    1 
ATOM   6218  N  N     . PHE A 1  815  ? -7.372  12.957  67.654  1.00 63.60  ? 815  PHE A N     1 
ATOM   6219  C  CA    . PHE A 1  815  ? -6.446  12.101  68.402  1.00 63.88  ? 815  PHE A CA    1 
ATOM   6220  C  C     . PHE A 1  815  ? -5.953  10.943  67.551  1.00 64.14  ? 815  PHE A C     1 
ATOM   6221  O  O     . PHE A 1  815  ? -4.753  10.748  67.361  1.00 64.15  ? 815  PHE A O     1 
ATOM   6222  C  CB    . PHE A 1  815  ? -7.110  11.517  69.640  1.00 63.69  ? 815  PHE A CB    1 
ATOM   6223  C  CG    . PHE A 1  815  ? -7.547  12.527  70.633  1.00 62.97  ? 815  PHE A CG    1 
ATOM   6224  C  CD1   . PHE A 1  815  ? -8.755  12.362  71.300  1.00 62.31  ? 815  PHE A CD1   1 
ATOM   6225  C  CD2   . PHE A 1  815  ? -6.761  13.627  70.917  1.00 62.05  ? 815  PHE A CD2   1 
ATOM   6226  C  CE1   . PHE A 1  815  ? -9.178  13.271  72.234  1.00 61.86  ? 815  PHE A CE1   1 
ATOM   6227  C  CE2   . PHE A 1  815  ? -7.179  14.544  71.847  1.00 62.42  ? 815  PHE A CE2   1 
ATOM   6228  C  CZ    . PHE A 1  815  ? -8.392  14.364  72.518  1.00 62.37  ? 815  PHE A CZ    1 
ATOM   6229  N  N     . HIS A 1  816  ? -6.904  10.165  67.058  1.00 64.61  ? 816  HIS A N     1 
ATOM   6230  C  CA    . HIS A 1  816  ? -6.610  9.043   66.181  1.00 65.06  ? 816  HIS A CA    1 
ATOM   6231  C  C     . HIS A 1  816  ? -5.830  9.537   64.954  1.00 65.38  ? 816  HIS A C     1 
ATOM   6232  O  O     . HIS A 1  816  ? -4.983  8.814   64.414  1.00 65.35  ? 816  HIS A O     1 
ATOM   6233  C  CB    . HIS A 1  816  ? -7.918  8.323   65.811  1.00 65.03  ? 816  HIS A CB    1 
ATOM   6234  C  CG    . HIS A 1  816  ? -7.775  7.307   64.727  1.00 64.41  ? 816  HIS A CG    1 
ATOM   6235  N  ND1   . HIS A 1  816  ? -6.680  6.484   64.619  1.00 63.93  ? 816  HIS A ND1   1 
ATOM   6236  C  CD2   . HIS A 1  816  ? -8.598  6.976   63.706  1.00 65.17  ? 816  HIS A CD2   1 
ATOM   6237  C  CE1   . HIS A 1  816  ? -6.828  5.694   63.570  1.00 64.88  ? 816  HIS A CE1   1 
ATOM   6238  N  NE2   . HIS A 1  816  ? -7.984  5.971   62.999  1.00 65.13  ? 816  HIS A NE2   1 
ATOM   6239  N  N     . ALA A 1  817  ? -6.100  10.777  64.544  1.00 65.39  ? 817  ALA A N     1 
ATOM   6240  C  CA    . ALA A 1  817  ? -5.323  11.394  63.506  1.00 65.64  ? 817  ALA A CA    1 
ATOM   6241  C  C     . ALA A 1  817  ? -3.878  11.446  63.945  1.00 66.22  ? 817  ALA A C     1 
ATOM   6242  O  O     . ALA A 1  817  ? -3.013  11.121  63.158  1.00 66.37  ? 817  ALA A O     1 
ATOM   6243  C  CB    . ALA A 1  817  ? -5.823  12.747  63.211  1.00 65.60  ? 817  ALA A CB    1 
ATOM   6244  N  N     . MET A 1  818  ? -3.620  11.817  65.202  1.00 67.21  ? 818  MET A N     1 
ATOM   6245  C  CA    . MET A 1  818  ? -2.241  11.899  65.737  1.00 68.26  ? 818  MET A CA    1 
ATOM   6246  C  C     . MET A 1  818  ? -1.603  10.538  65.817  1.00 69.03  ? 818  MET A C     1 
ATOM   6247  O  O     . MET A 1  818  ? -0.381  10.427  65.792  1.00 68.72  ? 818  MET A O     1 
ATOM   6248  C  CB    . MET A 1  818  ? -2.199  12.488  67.141  1.00 68.06  ? 818  MET A CB    1 
ATOM   6249  C  CG    . MET A 1  818  ? -2.514  13.959  67.266  1.00 68.49  ? 818  MET A CG    1 
ATOM   6250  S  SD    . MET A 1  818  ? -2.827  14.353  69.006  1.00 68.65  ? 818  MET A SD    1 
ATOM   6251  C  CE    . MET A 1  818  ? -1.377  13.602  69.755  1.00 69.05  ? 818  MET A CE    1 
ATOM   6252  N  N     . GLY A 1  819  ? -2.443  9.514   65.954  1.00 70.48  ? 819  GLY A N     1 
ATOM   6253  C  CA    . GLY A 1  819  ? -1.997  8.118   65.958  1.00 72.45  ? 819  GLY A CA    1 
ATOM   6254  C  C     . GLY A 1  819  ? -1.460  7.735   64.588  1.00 73.72  ? 819  GLY A C     1 
ATOM   6255  O  O     . GLY A 1  819  ? -0.353  8.136   64.217  1.00 73.78  ? 819  GLY A O     1 
ATOM   6256  N  N     . GLY A 1  820  ? -2.255  6.978   63.832  1.00 74.73  ? 820  GLY A N     1 
ATOM   6257  C  CA    . GLY A 1  820  ? -1.937  6.609   62.453  1.00 75.84  ? 820  GLY A CA    1 
ATOM   6258  C  C     . GLY A 1  820  ? -0.853  7.456   61.812  1.00 76.63  ? 820  GLY A C     1 
ATOM   6259  O  O     . GLY A 1  820  ? 0.043   6.924   61.153  1.00 76.89  ? 820  GLY A O     1 
ATOM   6260  N  N     . ARG A 1  821  ? -0.917  8.771   62.013  1.00 77.30  ? 821  ARG A N     1 
ATOM   6261  C  CA    . ARG A 1  821  ? 0.113   9.663   61.498  1.00 78.38  ? 821  ARG A CA    1 
ATOM   6262  C  C     . ARG A 1  821  ? 1.516   9.169   61.854  1.00 79.12  ? 821  ARG A C     1 
ATOM   6263  O  O     . ARG A 1  821  ? 2.480   9.533   61.196  1.00 79.21  ? 821  ARG A O     1 
ATOM   6264  C  CB    . ARG A 1  821  ? -0.103  11.093  61.988  1.00 78.41  ? 821  ARG A CB    1 
ATOM   6265  C  CG    . ARG A 1  821  ? 0.902   12.118  61.478  1.00 78.53  ? 821  ARG A CG    1 
ATOM   6266  C  CD    . ARG A 1  821  ? 0.605   12.639  60.079  1.00 79.22  ? 821  ARG A CD    1 
ATOM   6267  N  NE    . ARG A 1  821  ? 1.255   13.935  59.938  1.00 80.40  ? 821  ARG A NE    1 
ATOM   6268  C  CZ    . ARG A 1  821  ? 0.623   15.089  59.760  1.00 80.84  ? 821  ARG A CZ    1 
ATOM   6269  N  NH1   . ARG A 1  821  ? -0.697  15.125  59.639  1.00 81.13  ? 821  ARG A NH1   1 
ATOM   6270  N  NH2   . ARG A 1  821  ? 1.324   16.210  59.682  1.00 81.56  ? 821  ARG A NH2   1 
ATOM   6271  N  N     . GLU A 1  822  ? 1.621   8.326   62.876  1.00 80.18  ? 822  GLU A N     1 
ATOM   6272  C  CA    . GLU A 1  822  ? 2.906   7.734   63.248  1.00 81.33  ? 822  GLU A CA    1 
ATOM   6273  C  C     . GLU A 1  822  ? 3.265   6.558   62.360  1.00 82.09  ? 822  GLU A C     1 
ATOM   6274  O  O     . GLU A 1  822  ? 4.422   6.404   61.976  1.00 82.16  ? 822  GLU A O     1 
ATOM   6275  C  CB    . GLU A 1  822  ? 2.910   7.289   64.704  1.00 81.21  ? 822  GLU A CB    1 
ATOM   6276  C  CG    . GLU A 1  822  ? 4.281   7.023   65.245  1.00 81.52  ? 822  GLU A CG    1 
ATOM   6277  C  CD    . GLU A 1  822  ? 4.269   6.950   66.748  1.00 83.51  ? 822  GLU A CD    1 
ATOM   6278  O  OE1   . GLU A 1  822  ? 4.582   7.982   67.396  1.00 83.60  ? 822  GLU A OE1   1 
ATOM   6279  O  OE2   . GLU A 1  822  ? 3.923   5.864   67.281  1.00 84.58  ? 822  GLU A OE2   1 
ATOM   6280  N  N     . GLY A 1  823  ? 2.272   5.726   62.054  1.00 83.16  ? 823  GLY A N     1 
ATOM   6281  C  CA    . GLY A 1  823  ? 2.465   4.552   61.200  1.00 84.57  ? 823  GLY A CA    1 
ATOM   6282  C  C     . GLY A 1  823  ? 3.058   4.971   59.869  1.00 85.56  ? 823  GLY A C     1 
ATOM   6283  O  O     . GLY A 1  823  ? 4.061   4.394   59.408  1.00 85.91  ? 823  GLY A O     1 
ATOM   6284  N  N     . LEU A 1  824  ? 2.446   6.003   59.284  1.00 86.05  ? 824  LEU A N     1 
ATOM   6285  C  CA    . LEU A 1  824  ? 2.860   6.577   58.013  1.00 86.62  ? 824  LEU A CA    1 
ATOM   6286  C  C     . LEU A 1  824  ? 4.296   7.114   58.038  1.00 87.50  ? 824  LEU A C     1 
ATOM   6287  O  O     . LEU A 1  824  ? 4.964   7.117   56.999  1.00 87.51  ? 824  LEU A O     1 
ATOM   6288  C  CB    . LEU A 1  824  ? 1.861   7.658   57.592  1.00 86.30  ? 824  LEU A CB    1 
ATOM   6289  C  CG    . LEU A 1  824  ? 0.403   7.190   57.482  1.00 85.83  ? 824  LEU A CG    1 
ATOM   6290  C  CD1   . LEU A 1  824  ? -0.569  8.355   57.438  1.00 84.90  ? 824  LEU A CD1   1 
ATOM   6291  C  CD2   . LEU A 1  824  ? 0.192   6.270   56.277  1.00 85.98  ? 824  LEU A CD2   1 
ATOM   6292  N  N     . ILE A 1  825  ? 4.756   7.545   59.225  1.00 88.62  ? 825  ILE A N     1 
ATOM   6293  C  CA    . ILE A 1  825  ? 6.134   8.038   59.456  1.00 89.78  ? 825  ILE A CA    1 
ATOM   6294  C  C     . ILE A 1  825  ? 7.192   6.920   59.327  1.00 90.96  ? 825  ILE A C     1 
ATOM   6295  O  O     . ILE A 1  825  ? 8.261   7.107   58.711  1.00 91.35  ? 825  ILE A O     1 
ATOM   6296  C  CB    . ILE A 1  825  ? 6.312   8.691   60.871  1.00 89.50  ? 825  ILE A CB    1 
ATOM   6297  C  CG1   . ILE A 1  825  ? 5.169   9.640   61.221  1.00 89.48  ? 825  ILE A CG1   1 
ATOM   6298  C  CG2   . ILE A 1  825  ? 7.651   9.399   60.987  1.00 89.37  ? 825  ILE A CG2   1 
ATOM   6299  C  CD1   . ILE A 1  825  ? 5.311   11.045  60.707  1.00 90.04  ? 825  ILE A CD1   1 
ATOM   6300  N  N     . ASP A 1  826  ? 6.899   5.763   59.919  1.00 91.96  ? 826  ASP A N     1 
ATOM   6301  C  CA    . ASP A 1  826  ? 7.841   4.648   59.929  1.00 92.89  ? 826  ASP A CA    1 
ATOM   6302  C  C     . ASP A 1  826  ? 8.022   4.126   58.523  1.00 93.07  ? 826  ASP A C     1 
ATOM   6303  O  O     . ASP A 1  826  ? 9.097   4.251   57.953  1.00 93.05  ? 826  ASP A O     1 
ATOM   6304  C  CB    . ASP A 1  826  ? 7.336   3.528   60.828  1.00 93.18  ? 826  ASP A CB    1 
ATOM   6305  C  CG    . ASP A 1  826  ? 6.698   4.042   62.103  1.00 94.73  ? 826  ASP A CG    1 
ATOM   6306  O  OD1   . ASP A 1  826  ? 6.140   3.201   62.840  1.00 96.81  ? 826  ASP A OD1   1 
ATOM   6307  O  OD2   . ASP A 1  826  ? 6.749   5.270   62.376  1.00 96.19  ? 826  ASP A OD2   1 
ATOM   6308  N  N     . THR A 1  827  ? 6.946   3.581   57.957  1.00 93.53  ? 827  THR A N     1 
ATOM   6309  C  CA    . THR A 1  827  ? 6.965   3.002   56.603  1.00 94.01  ? 827  THR A CA    1 
ATOM   6310  C  C     . THR A 1  827  ? 7.610   3.934   55.541  1.00 94.03  ? 827  THR A C     1 
ATOM   6311  O  O     . THR A 1  827  ? 7.872   3.512   54.405  1.00 94.34  ? 827  THR A O     1 
ATOM   6312  C  CB    . THR A 1  827  ? 5.537   2.450   56.131  1.00 94.12  ? 827  THR A CB    1 
ATOM   6313  O  OG1   . THR A 1  827  ? 4.733   3.506   55.576  1.00 95.05  ? 827  THR A OG1   1 
ATOM   6314  C  CG2   . THR A 1  827  ? 4.765   1.740   57.272  1.00 93.57  ? 827  THR A CG2   1 
ATOM   6315  N  N     . ALA A 1  828  ? 7.867   5.186   55.918  1.00 93.81  ? 828  ALA A N     1 
ATOM   6316  C  CA    . ALA A 1  828  ? 8.606   6.108   55.066  1.00 93.79  ? 828  ALA A CA    1 
ATOM   6317  C  C     . ALA A 1  828  ? 10.112  6.013   55.325  1.00 93.91  ? 828  ALA A C     1 
ATOM   6318  O  O     . ALA A 1  828  ? 10.913  6.055   54.382  1.00 93.96  ? 828  ALA A O     1 
ATOM   6319  C  CB    . ALA A 1  828  ? 8.125   7.514   55.278  1.00 93.77  ? 828  ALA A CB    1 
ATOM   6320  N  N     . VAL A 1  829  ? 10.492  5.884   56.598  1.00 93.91  ? 829  VAL A N     1 
ATOM   6321  C  CA    . VAL A 1  829  ? 11.907  5.780   56.977  1.00 93.80  ? 829  VAL A CA    1 
ATOM   6322  C  C     . VAL A 1  829  ? 12.320  4.385   57.503  1.00 93.92  ? 829  VAL A C     1 
ATOM   6323  O  O     . VAL A 1  829  ? 13.374  3.860   57.119  1.00 93.87  ? 829  VAL A O     1 
ATOM   6324  C  CB    . VAL A 1  829  ? 12.336  6.952   57.898  1.00 93.62  ? 829  VAL A CB    1 
ATOM   6325  C  CG1   . VAL A 1  829  ? 13.493  6.566   58.806  1.00 93.35  ? 829  VAL A CG1   1 
ATOM   6326  C  CG2   . VAL A 1  829  ? 12.708  8.158   57.037  1.00 93.55  ? 829  VAL A CG2   1 
ATOM   6327  N  N     . LYS A 1  830  ? 11.484  3.770   58.341  1.00 94.09  ? 830  LYS A N     1 
ATOM   6328  C  CA    . LYS A 1  830  ? 11.742  2.393   58.815  1.00 93.70  ? 830  LYS A CA    1 
ATOM   6329  C  C     . LYS A 1  830  ? 11.932  1.401   57.661  1.00 92.93  ? 830  LYS A C     1 
ATOM   6330  O  O     . LYS A 1  830  ? 12.139  0.208   57.883  1.00 92.96  ? 830  LYS A O     1 
ATOM   6331  C  CB    . LYS A 1  830  ? 10.651  1.904   59.802  1.00 94.18  ? 830  LYS A CB    1 
ATOM   6332  C  CG    . LYS A 1  830  ? 10.935  0.508   60.456  1.00 94.68  ? 830  LYS A CG    1 
ATOM   6333  C  CD    . LYS A 1  830  ? 10.494  0.415   61.925  1.00 96.00  ? 830  LYS A CD    1 
ATOM   6334  C  CE    . LYS A 1  830  ? 11.573  0.950   62.862  1.00 96.52  ? 830  LYS A CE    1 
ATOM   6335  N  NZ    . LYS A 1  830  ? 11.006  1.460   64.142  1.00 97.48  ? 830  LYS A NZ    1 
ATOM   6336  N  N     . THR A 1  831  ? 11.873  1.892   56.431  1.00 92.00  ? 831  THR A N     1 
ATOM   6337  C  CA    . THR A 1  831  ? 12.148  1.031   55.293  1.00 91.32  ? 831  THR A CA    1 
ATOM   6338  C  C     . THR A 1  831  ? 13.535  1.272   54.681  1.00 90.67  ? 831  THR A C     1 
ATOM   6339  O  O     . THR A 1  831  ? 14.103  0.381   54.046  1.00 90.46  ? 831  THR A O     1 
ATOM   6340  C  CB    . THR A 1  831  ? 11.007  1.059   54.240  1.00 91.40  ? 831  THR A CB    1 
ATOM   6341  O  OG1   . THR A 1  831  ? 11.060  -0.136  53.451  1.00 91.76  ? 831  THR A OG1   1 
ATOM   6342  C  CG2   . THR A 1  831  ? 11.086  2.292   53.342  1.00 91.02  ? 831  THR A CG2   1 
ATOM   6343  N  N     . ALA A 1  832  ? 14.077  2.470   54.885  1.00 89.86  ? 832  ALA A N     1 
ATOM   6344  C  CA    . ALA A 1  832  ? 15.428  2.776   54.422  1.00 88.96  ? 832  ALA A CA    1 
ATOM   6345  C  C     . ALA A 1  832  ? 16.420  2.284   55.443  1.00 88.31  ? 832  ALA A C     1 
ATOM   6346  O  O     . ALA A 1  832  ? 17.518  1.857   55.078  1.00 88.33  ? 832  ALA A O     1 
ATOM   6347  C  CB    . ALA A 1  832  ? 15.615  4.262   54.172  1.00 89.06  ? 832  ALA A CB    1 
ATOM   6348  N  N     . GLU A 1  833  ? 16.034  2.342   56.720  1.00 87.39  ? 833  GLU A N     1 
ATOM   6349  C  CA    . GLU A 1  833  ? 16.856  1.765   57.777  1.00 86.84  ? 833  GLU A CA    1 
ATOM   6350  C  C     . GLU A 1  833  ? 16.992  0.266   57.535  1.00 85.77  ? 833  GLU A C     1 
ATOM   6351  O  O     . GLU A 1  833  ? 18.082  -0.288  57.685  1.00 86.08  ? 833  GLU A O     1 
ATOM   6352  C  CB    . GLU A 1  833  ? 16.325  2.084   59.184  1.00 86.86  ? 833  GLU A CB    1 
ATOM   6353  C  CG    . GLU A 1  833  ? 16.997  3.322   59.820  1.00 87.86  ? 833  GLU A CG    1 
ATOM   6354  C  CD    . GLU A 1  833  ? 16.669  3.514   61.305  1.00 88.13  ? 833  GLU A CD    1 
ATOM   6355  O  OE1   . GLU A 1  833  ? 15.475  3.714   61.642  1.00 89.86  ? 833  GLU A OE1   1 
ATOM   6356  O  OE2   . GLU A 1  833  ? 17.615  3.486   62.133  1.00 89.23  ? 833  GLU A OE2   1 
ATOM   6357  N  N     . THR A 1  834  ? 15.898  -0.374  57.119  1.00 84.31  ? 834  THR A N     1 
ATOM   6358  C  CA    . THR A 1  834  ? 15.930  -1.768  56.697  1.00 82.65  ? 834  THR A CA    1 
ATOM   6359  C  C     . THR A 1  834  ? 16.752  -1.894  55.433  1.00 81.76  ? 834  THR A C     1 
ATOM   6360  O  O     . THR A 1  834  ? 17.600  -2.769  55.319  1.00 81.50  ? 834  THR A O     1 
ATOM   6361  C  CB    . THR A 1  834  ? 14.527  -2.293  56.428  1.00 82.60  ? 834  THR A CB    1 
ATOM   6362  O  OG1   . THR A 1  834  ? 13.838  -2.429  57.671  1.00 82.75  ? 834  THR A OG1   1 
ATOM   6363  C  CG2   . THR A 1  834  ? 14.585  -3.642  55.754  1.00 82.51  ? 834  THR A CG2   1 
ATOM   6364  N  N     . GLY A 1  835  ? 16.505  -0.991  54.495  1.00 80.93  ? 835  GLY A N     1 
ATOM   6365  C  CA    . GLY A 1  835  ? 17.167  -1.022  53.199  1.00 79.98  ? 835  GLY A CA    1 
ATOM   6366  C  C     . GLY A 1  835  ? 18.675  -0.959  53.275  1.00 79.14  ? 835  GLY A C     1 
ATOM   6367  O  O     . GLY A 1  835  ? 19.366  -1.448  52.379  1.00 79.17  ? 835  GLY A O     1 
ATOM   6368  N  N     . TYR A 1  836  ? 19.182  -0.348  54.339  1.00 78.28  ? 836  TYR A N     1 
ATOM   6369  C  CA    . TYR A 1  836  ? 20.607  -0.290  54.567  1.00 77.69  ? 836  TYR A CA    1 
ATOM   6370  C  C     . TYR A 1  836  ? 21.076  -1.526  55.321  1.00 76.70  ? 836  TYR A C     1 
ATOM   6371  O  O     . TYR A 1  836  ? 22.061  -2.159  54.924  1.00 76.94  ? 836  TYR A O     1 
ATOM   6372  C  CB    . TYR A 1  836  ? 20.963  0.968   55.333  1.00 78.58  ? 836  TYR A CB    1 
ATOM   6373  C  CG    . TYR A 1  836  ? 22.440  1.164   55.600  1.00 79.86  ? 836  TYR A CG    1 
ATOM   6374  C  CD1   . TYR A 1  836  ? 23.362  1.277   54.550  1.00 80.30  ? 836  TYR A CD1   1 
ATOM   6375  C  CD2   . TYR A 1  836  ? 22.910  1.279   56.907  1.00 81.39  ? 836  TYR A CD2   1 
ATOM   6376  C  CE1   . TYR A 1  836  ? 24.719  1.485   54.803  1.00 81.02  ? 836  TYR A CE1   1 
ATOM   6377  C  CE2   . TYR A 1  836  ? 24.253  1.496   57.171  1.00 82.13  ? 836  TYR A CE2   1 
ATOM   6378  C  CZ    . TYR A 1  836  ? 25.154  1.595   56.122  1.00 81.57  ? 836  TYR A CZ    1 
ATOM   6379  O  OH    . TYR A 1  836  ? 26.485  1.798   56.427  1.00 82.23  ? 836  TYR A OH    1 
ATOM   6380  N  N     . ILE A 1  837  ? 20.373  -1.875  56.399  1.00 75.12  ? 837  ILE A N     1 
ATOM   6381  C  CA    . ILE A 1  837  ? 20.665  -3.104  57.130  1.00 73.50  ? 837  ILE A CA    1 
ATOM   6382  C  C     . ILE A 1  837  ? 21.043  -4.187  56.124  1.00 72.71  ? 837  ILE A C     1 
ATOM   6383  O  O     . ILE A 1  837  ? 22.183  -4.650  56.119  1.00 72.62  ? 837  ILE A O     1 
ATOM   6384  C  CB    . ILE A 1  837  ? 19.480  -3.538  58.047  1.00 73.38  ? 837  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A 1  837  ? 19.447  -2.709  59.339  1.00 72.95  ? 837  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A 1  837  ? 19.537  -5.016  58.381  1.00 72.96  ? 837  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A 1  837  ? 20.790  -2.136  59.765  1.00 73.28  ? 837  ILE A CD1   1 
ATOM   6388  N  N     . GLN A 1  838  ? 20.102  -4.528  55.241  1.00 71.72  ? 838  GLN A N     1 
ATOM   6389  C  CA    . GLN A 1  838  ? 20.295  -5.560  54.224  1.00 70.68  ? 838  GLN A CA    1 
ATOM   6390  C  C     . GLN A 1  838  ? 21.535  -5.300  53.376  1.00 70.05  ? 838  GLN A C     1 
ATOM   6391  O  O     . GLN A 1  838  ? 22.393  -6.159  53.303  1.00 70.05  ? 838  GLN A O     1 
ATOM   6392  C  CB    . GLN A 1  838  ? 19.034  -5.744  53.362  1.00 70.68  ? 838  GLN A CB    1 
ATOM   6393  C  CG    . GLN A 1  838  ? 18.866  -7.133  52.724  1.00 70.99  ? 838  GLN A CG    1 
ATOM   6394  C  CD    . GLN A 1  838  ? 19.306  -7.201  51.252  1.00 72.17  ? 838  GLN A CD    1 
ATOM   6395  O  OE1   . GLN A 1  838  ? 20.190  -6.456  50.818  1.00 73.26  ? 838  GLN A OE1   1 
ATOM   6396  N  NE2   . GLN A 1  838  ? 18.686  -8.103  50.481  1.00 72.29  ? 838  GLN A NE2   1 
ATOM   6397  N  N     . ARG A 1  839  ? 21.666  -4.124  52.770  1.00 69.53  ? 839  ARG A N     1 
ATOM   6398  C  CA    . ARG A 1  839  ? 22.844  -3.863  51.931  1.00 69.63  ? 839  ARG A CA    1 
ATOM   6399  C  C     . ARG A 1  839  ? 24.155  -4.285  52.589  1.00 68.35  ? 839  ARG A C     1 
ATOM   6400  O  O     . ARG A 1  839  ? 25.003  -4.913  51.950  1.00 68.19  ? 839  ARG A O     1 
ATOM   6401  C  CB    . ARG A 1  839  ? 22.918  -2.419  51.439  1.00 69.61  ? 839  ARG A CB    1 
ATOM   6402  C  CG    . ARG A 1  839  ? 22.728  -2.309  49.914  1.00 71.46  ? 839  ARG A CG    1 
ATOM   6403  C  CD    . ARG A 1  839  ? 23.277  -0.972  49.329  1.00 72.50  ? 839  ARG A CD    1 
ATOM   6404  N  NE    . ARG A 1  839  ? 24.675  -0.635  49.703  1.00 76.82  ? 839  ARG A NE    1 
ATOM   6405  C  CZ    . ARG A 1  839  ? 25.789  -1.107  49.114  1.00 77.08  ? 839  ARG A CZ    1 
ATOM   6406  N  NH1   . ARG A 1  839  ? 25.735  -1.985  48.112  1.00 77.47  ? 839  ARG A NH1   1 
ATOM   6407  N  NH2   . ARG A 1  839  ? 26.980  -0.705  49.542  1.00 76.43  ? 839  ARG A NH2   1 
ATOM   6408  N  N     . ARG A 1  840  ? 24.297  -3.967  53.870  1.00 67.39  ? 840  ARG A N     1 
ATOM   6409  C  CA    . ARG A 1  840  ? 25.446  -4.415  54.654  1.00 66.59  ? 840  ARG A CA    1 
ATOM   6410  C  C     . ARG A 1  840  ? 25.456  -5.943  54.893  1.00 65.93  ? 840  ARG A C     1 
ATOM   6411  O  O     . ARG A 1  840  ? 26.400  -6.634  54.480  1.00 65.82  ? 840  ARG A O     1 
ATOM   6412  C  CB    . ARG A 1  840  ? 25.503  -3.643  55.956  1.00 66.41  ? 840  ARG A CB    1 
ATOM   6413  C  CG    . ARG A 1  840  ? 25.914  -2.213  55.741  1.00 68.34  ? 840  ARG A CG    1 
ATOM   6414  C  CD    . ARG A 1  840  ? 25.420  -1.322  56.857  1.00 72.69  ? 840  ARG A CD    1 
ATOM   6415  N  NE    . ARG A 1  840  ? 25.859  -1.784  58.174  1.00 76.40  ? 840  ARG A NE    1 
ATOM   6416  C  CZ    . ARG A 1  840  ? 25.311  -1.430  59.336  1.00 76.90  ? 840  ARG A CZ    1 
ATOM   6417  N  NH1   . ARG A 1  840  ? 24.280  -0.582  59.372  1.00 77.03  ? 840  ARG A NH1   1 
ATOM   6418  N  NH2   . ARG A 1  840  ? 25.798  -1.943  60.467  1.00 76.61  ? 840  ARG A NH2   1 
ATOM   6419  N  N     . LEU A 1  841  ? 24.404  -6.457  55.543  1.00 64.84  ? 841  LEU A N     1 
ATOM   6420  C  CA    . LEU A 1  841  ? 24.193  -7.886  55.736  1.00 63.46  ? 841  LEU A CA    1 
ATOM   6421  C  C     . LEU A 1  841  ? 24.537  -8.688  54.514  1.00 63.13  ? 841  LEU A C     1 
ATOM   6422  O  O     . LEU A 1  841  ? 25.162  -9.730  54.629  1.00 63.10  ? 841  LEU A O     1 
ATOM   6423  C  CB    . LEU A 1  841  ? 22.743  -8.156  56.045  1.00 63.34  ? 841  LEU A CB    1 
ATOM   6424  C  CG    . LEU A 1  841  ? 22.353  -8.082  57.501  1.00 63.58  ? 841  LEU A CG    1 
ATOM   6425  C  CD1   . LEU A 1  841  ? 20.870  -8.353  57.615  1.00 64.17  ? 841  LEU A CD1   1 
ATOM   6426  C  CD2   . LEU A 1  841  ? 23.134  -9.120  58.256  1.00 64.66  ? 841  LEU A CD2   1 
ATOM   6427  N  N     . VAL A 1  842  ? 24.115  -8.204  53.346  1.00 62.92  ? 842  VAL A N     1 
ATOM   6428  C  CA    . VAL A 1  842  ? 24.433  -8.848  52.071  1.00 62.56  ? 842  VAL A CA    1 
ATOM   6429  C  C     . VAL A 1  842  ? 25.894  -8.701  51.733  1.00 63.01  ? 842  VAL A C     1 
ATOM   6430  O  O     . VAL A 1  842  ? 26.580  -9.706  51.520  1.00 63.23  ? 842  VAL A O     1 
ATOM   6431  C  CB    . VAL A 1  842  ? 23.608  -8.316  50.921  1.00 62.09  ? 842  VAL A CB    1 
ATOM   6432  C  CG1   . VAL A 1  842  ? 24.346  -8.505  49.638  1.00 61.50  ? 842  VAL A CG1   1 
ATOM   6433  C  CG2   . VAL A 1  842  ? 22.311  -9.057  50.862  1.00 62.06  ? 842  VAL A CG2   1 
ATOM   6434  N  N     . LYS A 1  843  ? 26.379  -7.463  51.700  1.00 63.29  ? 843  LYS A N     1 
ATOM   6435  C  CA    . LYS A 1  843  ? 27.789  -7.238  51.401  1.00 63.91  ? 843  LYS A CA    1 
ATOM   6436  C  C     . LYS A 1  843  ? 28.765  -7.841  52.419  1.00 64.82  ? 843  LYS A C     1 
ATOM   6437  O  O     . LYS A 1  843  ? 29.983  -7.915  52.163  1.00 65.08  ? 843  LYS A O     1 
ATOM   6438  C  CB    . LYS A 1  843  ? 28.076  -5.763  51.213  1.00 63.57  ? 843  LYS A CB    1 
ATOM   6439  C  CG    . LYS A 1  843  ? 28.038  -5.337  49.785  1.00 62.78  ? 843  LYS A CG    1 
ATOM   6440  C  CD    . LYS A 1  843  ? 28.972  -6.166  48.925  1.00 61.14  ? 843  LYS A CD    1 
ATOM   6441  C  CE    . LYS A 1  843  ? 29.007  -5.609  47.501  1.00 62.24  ? 843  LYS A CE    1 
ATOM   6442  N  NZ    . LYS A 1  843  ? 27.667  -5.419  46.824  1.00 60.57  ? 843  LYS A NZ    1 
ATOM   6443  N  N     . ALA A 1  844  ? 28.241  -8.279  53.561  1.00 65.59  ? 844  ALA A N     1 
ATOM   6444  C  CA    . ALA A 1  844  ? 29.098  -8.876  54.576  1.00 66.55  ? 844  ALA A CA    1 
ATOM   6445  C  C     . ALA A 1  844  ? 29.155  -10.403 54.508  1.00 67.12  ? 844  ALA A C     1 
ATOM   6446  O  O     . ALA A 1  844  ? 30.122  -11.008 54.988  1.00 67.53  ? 844  ALA A O     1 
ATOM   6447  C  CB    . ALA A 1  844  ? 28.724  -8.389  55.983  1.00 66.49  ? 844  ALA A CB    1 
ATOM   6448  N  N     . LEU A 1  845  ? 28.150  -11.038 53.915  1.00 67.52  ? 845  LEU A N     1 
ATOM   6449  C  CA    . LEU A 1  845  ? 28.192  -12.491 53.856  1.00 68.18  ? 845  LEU A CA    1 
ATOM   6450  C  C     . LEU A 1  845  ? 28.635  -12.983 52.484  1.00 69.31  ? 845  LEU A C     1 
ATOM   6451  O  O     . LEU A 1  845  ? 29.581  -13.758 52.377  1.00 69.27  ? 845  LEU A O     1 
ATOM   6452  C  CB    . LEU A 1  845  ? 26.871  -13.106 54.300  1.00 67.60  ? 845  LEU A CB    1 
ATOM   6453  C  CG    . LEU A 1  845  ? 26.318  -12.680 55.661  1.00 66.40  ? 845  LEU A CG    1 
ATOM   6454  C  CD1   . LEU A 1  845  ? 25.187  -13.610 55.986  1.00 66.65  ? 845  LEU A CD1   1 
ATOM   6455  C  CD2   . LEU A 1  845  ? 27.334  -12.697 56.779  1.00 64.11  ? 845  LEU A CD2   1 
ATOM   6456  N  N     . GLU A 1  846  ? 27.955  -12.515 51.439  1.00 70.80  ? 846  GLU A N     1 
ATOM   6457  C  CA    . GLU A 1  846  ? 28.365  -12.731 50.044  1.00 72.21  ? 846  GLU A CA    1 
ATOM   6458  C  C     . GLU A 1  846  ? 28.992  -14.099 49.740  1.00 72.50  ? 846  GLU A C     1 
ATOM   6459  O  O     . GLU A 1  846  ? 28.299  -15.125 49.671  1.00 72.73  ? 846  GLU A O     1 
ATOM   6460  C  CB    . GLU A 1  846  ? 29.331  -11.628 49.627  1.00 72.45  ? 846  GLU A CB    1 
ATOM   6461  C  CG    . GLU A 1  846  ? 29.669  -11.625 48.158  1.00 75.54  ? 846  GLU A CG    1 
ATOM   6462  C  CD    . GLU A 1  846  ? 29.970  -10.226 47.632  1.00 80.90  ? 846  GLU A CD    1 
ATOM   6463  O  OE1   . GLU A 1  846  ? 30.355  -10.108 46.443  1.00 82.94  ? 846  GLU A OE1   1 
ATOM   6464  O  OE2   . GLU A 1  846  ? 29.822  -9.237  48.398  1.00 83.42  ? 846  GLU A OE2   1 
ATOM   6465  N  N     . ASP A 1  847  ? 30.314  -14.087 49.578  1.00 72.83  ? 847  ASP A N     1 
ATOM   6466  C  CA    . ASP A 1  847  ? 31.093  -15.237 49.112  1.00 73.27  ? 847  ASP A CA    1 
ATOM   6467  C  C     . ASP A 1  847  ? 31.231  -16.406 50.096  1.00 73.26  ? 847  ASP A C     1 
ATOM   6468  O  O     . ASP A 1  847  ? 32.009  -17.328 49.840  1.00 73.36  ? 847  ASP A O     1 
ATOM   6469  C  CB    . ASP A 1  847  ? 32.497  -14.774 48.738  1.00 73.35  ? 847  ASP A CB    1 
ATOM   6470  C  CG    . ASP A 1  847  ? 33.211  -14.142 49.909  1.00 73.78  ? 847  ASP A CG    1 
ATOM   6471  O  OD1   . ASP A 1  847  ? 32.567  -13.356 50.637  1.00 74.55  ? 847  ASP A OD1   1 
ATOM   6472  O  OD2   . ASP A 1  847  ? 34.402  -14.433 50.117  1.00 74.55  ? 847  ASP A OD2   1 
ATOM   6473  N  N     . ILE A 1  848  ? 30.519  -16.363 51.222  1.00 73.21  ? 848  ILE A N     1 
ATOM   6474  C  CA    . ILE A 1  848  ? 30.432  -17.529 52.096  1.00 73.08  ? 848  ILE A CA    1 
ATOM   6475  C  C     . ILE A 1  848  ? 29.695  -18.602 51.283  1.00 73.08  ? 848  ILE A C     1 
ATOM   6476  O  O     . ILE A 1  848  ? 28.491  -18.473 51.045  1.00 73.29  ? 848  ILE A O     1 
ATOM   6477  C  CB    . ILE A 1  848  ? 29.652  -17.233 53.423  1.00 73.08  ? 848  ILE A CB    1 
ATOM   6478  C  CG1   . ILE A 1  848  ? 30.125  -15.943 54.099  1.00 73.40  ? 848  ILE A CG1   1 
ATOM   6479  C  CG2   . ILE A 1  848  ? 29.756  -18.387 54.401  1.00 72.68  ? 848  ILE A CG2   1 
ATOM   6480  C  CD1   . ILE A 1  848  ? 31.416  -16.059 54.885  1.00 73.83  ? 848  ILE A CD1   1 
ATOM   6481  N  N     . MET A 1  849  ? 30.408  -19.629 50.819  1.00 72.71  ? 849  MET A N     1 
ATOM   6482  C  CA    . MET A 1  849  ? 29.759  -20.670 50.009  1.00 72.57  ? 849  MET A CA    1 
ATOM   6483  C  C     . MET A 1  849  ? 30.269  -22.082 50.239  1.00 72.10  ? 849  MET A C     1 
ATOM   6484  O  O     . MET A 1  849  ? 31.402  -22.410 49.898  1.00 72.24  ? 849  MET A O     1 
ATOM   6485  C  CB    . MET A 1  849  ? 29.773  -20.327 48.504  1.00 72.70  ? 849  MET A CB    1 
ATOM   6486  C  CG    . MET A 1  849  ? 31.124  -20.394 47.791  1.00 72.96  ? 849  MET A CG    1 
ATOM   6487  S  SD    . MET A 1  849  ? 31.040  -21.095 46.117  1.00 73.29  ? 849  MET A SD    1 
ATOM   6488  C  CE    . MET A 1  849  ? 31.182  -22.853 46.444  1.00 73.01  ? 849  MET A CE    1 
ATOM   6489  N  N     . VAL A 1  850  ? 29.411  -22.923 50.798  1.00 71.70  ? 850  VAL A N     1 
ATOM   6490  C  CA    . VAL A 1  850  ? 29.755  -24.311 51.058  1.00 71.38  ? 850  VAL A CA    1 
ATOM   6491  C  C     . VAL A 1  850  ? 30.661  -24.841 49.945  1.00 71.52  ? 850  VAL A C     1 
ATOM   6492  O  O     . VAL A 1  850  ? 30.241  -24.908 48.797  1.00 71.82  ? 850  VAL A O     1 
ATOM   6493  C  CB    . VAL A 1  850  ? 28.489  -25.180 51.140  1.00 71.13  ? 850  VAL A CB    1 
ATOM   6494  C  CG1   . VAL A 1  850  ? 28.841  -26.537 51.683  1.00 71.74  ? 850  VAL A CG1   1 
ATOM   6495  C  CG2   . VAL A 1  850  ? 27.438  -24.530 52.020  1.00 70.43  ? 850  VAL A CG2   1 
ATOM   6496  N  N     . HIS A 1  851  ? 31.904  -25.181 50.268  1.00 71.70  ? 851  HIS A N     1 
ATOM   6497  C  CA    . HIS A 1  851  ? 32.795  -25.780 49.277  1.00 72.58  ? 851  HIS A CA    1 
ATOM   6498  C  C     . HIS A 1  851  ? 32.598  -27.283 49.191  1.00 73.17  ? 851  HIS A C     1 
ATOM   6499  O  O     . HIS A 1  851  ? 31.804  -27.859 49.944  1.00 73.59  ? 851  HIS A O     1 
ATOM   6500  C  CB    . HIS A 1  851  ? 34.252  -25.518 49.606  1.00 72.73  ? 851  HIS A CB    1 
ATOM   6501  C  CG    . HIS A 1  851  ? 34.706  -24.138 49.285  1.00 73.82  ? 851  HIS A CG    1 
ATOM   6502  N  ND1   . HIS A 1  851  ? 35.422  -23.841 48.148  1.00 74.83  ? 851  HIS A ND1   1 
ATOM   6503  C  CD2   . HIS A 1  851  ? 34.568  -22.973 49.964  1.00 75.13  ? 851  HIS A CD2   1 
ATOM   6504  C  CE1   . HIS A 1  851  ? 35.693  -22.546 48.132  1.00 76.26  ? 851  HIS A CE1   1 
ATOM   6505  N  NE2   . HIS A 1  851  ? 35.187  -21.996 49.224  1.00 75.64  ? 851  HIS A NE2   1 
ATOM   6506  N  N     . TYR A 1  852  ? 33.353  -27.920 48.293  1.00 73.68  ? 852  TYR A N     1 
ATOM   6507  C  CA    . TYR A 1  852  ? 33.228  -29.361 48.047  1.00 73.91  ? 852  TYR A CA    1 
ATOM   6508  C  C     . TYR A 1  852  ? 33.601  -30.270 49.225  1.00 73.98  ? 852  TYR A C     1 
ATOM   6509  O  O     . TYR A 1  852  ? 33.195  -31.428 49.260  1.00 73.99  ? 852  TYR A O     1 
ATOM   6510  C  CB    . TYR A 1  852  ? 33.967  -29.770 46.765  1.00 74.13  ? 852  TYR A CB    1 
ATOM   6511  C  CG    . TYR A 1  852  ? 33.104  -29.697 45.525  1.00 73.88  ? 852  TYR A CG    1 
ATOM   6512  C  CD1   . TYR A 1  852  ? 33.246  -28.660 44.620  1.00 74.28  ? 852  TYR A CD1   1 
ATOM   6513  C  CD2   . TYR A 1  852  ? 32.143  -30.672 45.266  1.00 73.68  ? 852  TYR A CD2   1 
ATOM   6514  C  CE1   . TYR A 1  852  ? 32.447  -28.595 43.479  1.00 75.45  ? 852  TYR A CE1   1 
ATOM   6515  C  CE2   . TYR A 1  852  ? 31.331  -30.615 44.141  1.00 74.02  ? 852  TYR A CE2   1 
ATOM   6516  C  CZ    . TYR A 1  852  ? 31.483  -29.576 43.245  1.00 74.96  ? 852  TYR A CZ    1 
ATOM   6517  O  OH    . TYR A 1  852  ? 30.678  -29.505 42.116  1.00 74.72  ? 852  TYR A OH    1 
ATOM   6518  N  N     . ASP A 1  853  ? 34.352  -29.751 50.190  1.00 74.19  ? 853  ASP A N     1 
ATOM   6519  C  CA    . ASP A 1  853  ? 34.601  -30.499 51.430  1.00 74.72  ? 853  ASP A CA    1 
ATOM   6520  C  C     . ASP A 1  853  ? 33.447  -30.381 52.447  1.00 74.71  ? 853  ASP A C     1 
ATOM   6521  O  O     . ASP A 1  853  ? 33.507  -30.969 53.543  1.00 74.91  ? 853  ASP A O     1 
ATOM   6522  C  CB    . ASP A 1  853  ? 35.969  -30.132 52.073  1.00 75.06  ? 853  ASP A CB    1 
ATOM   6523  C  CG    . ASP A 1  853  ? 36.028  -28.685 52.636  1.00 75.50  ? 853  ASP A CG    1 
ATOM   6524  O  OD1   . ASP A 1  853  ? 35.035  -27.922 52.569  1.00 75.80  ? 853  ASP A OD1   1 
ATOM   6525  O  OD2   . ASP A 1  853  ? 37.100  -28.307 53.154  1.00 75.34  ? 853  ASP A OD2   1 
ATOM   6526  N  N     . ASN A 1  854  ? 32.414  -29.615 52.080  1.00 74.35  ? 854  ASN A N     1 
ATOM   6527  C  CA    . ASN A 1  854  ? 31.286  -29.315 52.969  1.00 74.03  ? 854  ASN A CA    1 
ATOM   6528  C  C     . ASN A 1  854  ? 31.614  -28.285 54.071  1.00 73.75  ? 854  ASN A C     1 
ATOM   6529  O  O     . ASN A 1  854  ? 30.732  -27.875 54.844  1.00 73.82  ? 854  ASN A O     1 
ATOM   6530  C  CB    . ASN A 1  854  ? 30.736  -30.602 53.583  1.00 74.12  ? 854  ASN A CB    1 
ATOM   6531  C  CG    . ASN A 1  854  ? 29.241  -30.624 53.619  1.00 74.34  ? 854  ASN A CG    1 
ATOM   6532  O  OD1   . ASN A 1  854  ? 28.618  -30.158 54.574  1.00 73.77  ? 854  ASN A OD1   1 
ATOM   6533  N  ND2   . ASN A 1  854  ? 28.645  -31.177 52.568  1.00 75.65  ? 854  ASN A ND2   1 
ATOM   6534  N  N     . THR A 1  855  ? 32.879  -27.873 54.135  1.00 73.07  ? 855  THR A N     1 
ATOM   6535  C  CA    . THR A 1  855  ? 33.297  -26.829 55.041  1.00 72.73  ? 855  THR A CA    1 
ATOM   6536  C  C     . THR A 1  855  ? 32.974  -25.479 54.429  1.00 72.51  ? 855  THR A C     1 
ATOM   6537  O  O     . THR A 1  855  ? 33.302  -25.228 53.275  1.00 72.68  ? 855  THR A O     1 
ATOM   6538  C  CB    . THR A 1  855  ? 34.790  -26.906 55.310  1.00 72.81  ? 855  THR A CB    1 
ATOM   6539  O  OG1   . THR A 1  855  ? 35.031  -26.626 56.691  1.00 74.04  ? 855  THR A OG1   1 
ATOM   6540  C  CG2   . THR A 1  855  ? 35.557  -25.911 54.454  1.00 72.26  ? 855  THR A CG2   1 
ATOM   6541  N  N     . THR A 1  856  ? 32.351  -24.611 55.218  1.00 72.26  ? 856  THR A N     1 
ATOM   6542  C  CA    . THR A 1  856  ? 31.789  -23.348 54.739  1.00 72.10  ? 856  THR A CA    1 
ATOM   6543  C  C     . THR A 1  856  ? 32.795  -22.213 54.825  1.00 72.28  ? 856  THR A C     1 
ATOM   6544  O  O     . THR A 1  856  ? 33.187  -21.842 55.925  1.00 72.65  ? 856  THR A O     1 
ATOM   6545  C  CB    . THR A 1  856  ? 30.595  -22.962 55.625  1.00 71.84  ? 856  THR A CB    1 
ATOM   6546  O  OG1   . THR A 1  856  ? 29.652  -24.035 55.654  1.00 72.37  ? 856  THR A OG1   1 
ATOM   6547  C  CG2   . THR A 1  856  ? 29.922  -21.742 55.110  1.00 71.43  ? 856  THR A CG2   1 
ATOM   6548  N  N     . ARG A 1  857  ? 33.220  -21.638 53.707  1.00 72.32  ? 857  ARG A N     1 
ATOM   6549  C  CA    . ARG A 1  857  ? 34.157  -20.518 53.838  1.00 72.81  ? 857  ARG A CA    1 
ATOM   6550  C  C     . ARG A 1  857  ? 33.943  -19.320 52.941  1.00 73.10  ? 857  ARG A C     1 
ATOM   6551  O  O     . ARG A 1  857  ? 32.836  -19.098 52.444  1.00 73.35  ? 857  ARG A O     1 
ATOM   6552  C  CB    . ARG A 1  857  ? 35.616  -20.960 53.769  1.00 72.87  ? 857  ARG A CB    1 
ATOM   6553  C  CG    . ARG A 1  857  ? 35.876  -22.314 53.183  1.00 73.84  ? 857  ARG A CG    1 
ATOM   6554  C  CD    . ARG A 1  857  ? 37.353  -22.648 53.383  1.00 74.67  ? 857  ARG A CD    1 
ATOM   6555  N  NE    . ARG A 1  857  ? 37.591  -24.075 53.546  1.00 74.59  ? 857  ARG A NE    1 
ATOM   6556  C  CZ    . ARG A 1  857  ? 38.791  -24.635 53.564  1.00 74.27  ? 857  ARG A CZ    1 
ATOM   6557  N  NH1   . ARG A 1  857  ? 39.887  -23.898 53.408  1.00 73.32  ? 857  ARG A NH1   1 
ATOM   6558  N  NH2   . ARG A 1  857  ? 38.886  -25.942 53.724  1.00 75.25  ? 857  ARG A NH2   1 
ATOM   6559  N  N     . ASN A 1  858  ? 35.023  -18.550 52.768  1.00 73.14  ? 858  ASN A N     1 
ATOM   6560  C  CA    . ASN A 1  858  ? 35.030  -17.292 52.008  1.00 72.92  ? 858  ASN A CA    1 
ATOM   6561  C  C     . ASN A 1  858  ? 36.198  -17.215 51.007  1.00 72.67  ? 858  ASN A C     1 
ATOM   6562  O  O     . ASN A 1  858  ? 36.876  -18.215 50.791  1.00 72.60  ? 858  ASN A O     1 
ATOM   6563  C  CB    . ASN A 1  858  ? 35.078  -16.111 52.976  1.00 72.78  ? 858  ASN A CB    1 
ATOM   6564  C  CG    . ASN A 1  858  ? 36.375  -16.047 53.749  1.00 72.88  ? 858  ASN A CG    1 
ATOM   6565  O  OD1   . ASN A 1  858  ? 36.536  -15.212 54.637  1.00 73.72  ? 858  ASN A OD1   1 
ATOM   6566  N  ND2   . ASN A 1  858  ? 37.314  -16.928 53.418  1.00 72.88  ? 858  ASN A ND2   1 
ATOM   6567  N  N     . SER A 1  859  ? 36.440  -16.025 50.439  1.00 72.56  ? 859  SER A N     1 
ATOM   6568  C  CA    . SER A 1  859  ? 37.423  -15.819 49.346  1.00 72.39  ? 859  SER A CA    1 
ATOM   6569  C  C     . SER A 1  859  ? 38.870  -16.090 49.741  1.00 72.47  ? 859  SER A C     1 
ATOM   6570  O  O     . SER A 1  859  ? 39.686  -16.528 48.914  1.00 72.50  ? 859  SER A O     1 
ATOM   6571  C  CB    . SER A 1  859  ? 37.288  -14.428 48.676  1.00 72.38  ? 859  SER A CB    1 
ATOM   6572  O  OG    . SER A 1  859  ? 37.385  -13.331 49.576  1.00 71.64  ? 859  SER A OG    1 
ATOM   6573  N  N     . LEU A 1  860  ? 39.184  -15.826 51.002  1.00 72.39  ? 860  LEU A N     1 
ATOM   6574  C  CA    . LEU A 1  860  ? 40.495  -16.144 51.529  1.00 72.62  ? 860  LEU A CA    1 
ATOM   6575  C  C     . LEU A 1  860  ? 40.640  -17.661 51.681  1.00 72.65  ? 860  LEU A C     1 
ATOM   6576  O  O     . LEU A 1  860  ? 41.739  -18.214 51.577  1.00 72.70  ? 860  LEU A O     1 
ATOM   6577  C  CB    . LEU A 1  860  ? 40.711  -15.462 52.881  1.00 72.63  ? 860  LEU A CB    1 
ATOM   6578  C  CG    . LEU A 1  860  ? 40.370  -13.987 53.108  1.00 73.09  ? 860  LEU A CG    1 
ATOM   6579  C  CD1   . LEU A 1  860  ? 40.395  -13.668 54.609  1.00 73.09  ? 860  LEU A CD1   1 
ATOM   6580  C  CD2   . LEU A 1  860  ? 41.299  -13.056 52.324  1.00 73.52  ? 860  LEU A CD2   1 
ATOM   6581  N  N     . GLY A 1  861  ? 39.516  -18.328 51.907  1.00 72.64  ? 861  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1  861  ? 39.521  -19.744 52.222  1.00 72.62  ? 861  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1  861  ? 39.624  -19.948 53.719  1.00 72.56  ? 861  GLY A C     1 
ATOM   6584  O  O     . GLY A 1  861  ? 40.211  -20.921 54.180  1.00 72.91  ? 861  GLY A O     1 
ATOM   6585  N  N     . ASN A 1  862  ? 39.048  -19.022 54.477  1.00 72.21  ? 862  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1  862  ? 39.040  -19.101 55.927  1.00 72.00  ? 862  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1  862  ? 37.730  -19.705 56.413  1.00 71.33  ? 862  ASN A C     1 
ATOM   6588  O  O     . ASN A 1  862  ? 36.653  -19.234 56.049  1.00 71.51  ? 862  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1  862  ? 39.244  -17.706 56.527  1.00 72.60  ? 862  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1  862  ? 40.472  -17.000 55.960  1.00 74.10  ? 862  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1  862  ? 41.025  -17.436 54.942  1.00 75.57  ? 862  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1  862  ? 40.909  -15.905 56.616  1.00 74.81  ? 862  ASN A ND2   1 
ATOM   6593  N  N     . VAL A 1  863  ? 37.829  -20.748 57.231  1.00 70.36  ? 863  VAL A N     1 
ATOM   6594  C  CA    . VAL A 1  863  ? 36.659  -21.478 57.717  1.00 69.43  ? 863  VAL A CA    1 
ATOM   6595  C  C     . VAL A 1  863  ? 35.740  -20.575 58.518  1.00 68.74  ? 863  VAL A C     1 
ATOM   6596  O  O     . VAL A 1  863  ? 36.195  -19.732 59.261  1.00 68.37  ? 863  VAL A O     1 
ATOM   6597  C  CB    . VAL A 1  863  ? 37.067  -22.707 58.586  1.00 69.59  ? 863  VAL A CB    1 
ATOM   6598  C  CG1   . VAL A 1  863  ? 35.836  -23.392 59.199  1.00 69.58  ? 863  VAL A CG1   1 
ATOM   6599  C  CG2   . VAL A 1  863  ? 37.892  -23.711 57.768  1.00 69.25  ? 863  VAL A CG2   1 
ATOM   6600  N  N     . ILE A 1  864  ? 34.440  -20.747 58.331  1.00 68.57  ? 864  ILE A N     1 
ATOM   6601  C  CA    . ILE A 1  864  ? 33.432  -20.115 59.188  1.00 68.45  ? 864  ILE A CA    1 
ATOM   6602  C  C     . ILE A 1  864  ? 32.627  -21.208 59.914  1.00 68.71  ? 864  ILE A C     1 
ATOM   6603  O  O     . ILE A 1  864  ? 32.341  -21.116 61.122  1.00 69.04  ? 864  ILE A O     1 
ATOM   6604  C  CB    . ILE A 1  864  ? 32.464  -19.220 58.392  1.00 68.03  ? 864  ILE A CB    1 
ATOM   6605  C  CG1   . ILE A 1  864  ? 33.079  -18.784 57.055  1.00 67.82  ? 864  ILE A CG1   1 
ATOM   6606  C  CG2   . ILE A 1  864  ? 32.016  -18.053 59.255  1.00 67.64  ? 864  ILE A CG2   1 
ATOM   6607  C  CD1   . ILE A 1  864  ? 34.271  -17.848 57.173  1.00 68.44  ? 864  ILE A CD1   1 
ATOM   6608  N  N     . GLN A 1  865  ? 32.270  -22.242 59.158  1.00 68.47  ? 865  GLN A N     1 
ATOM   6609  C  CA    . GLN A 1  865  ? 31.636  -23.419 59.695  1.00 68.19  ? 865  GLN A CA    1 
ATOM   6610  C  C     . GLN A 1  865  ? 32.287  -24.633 59.040  1.00 68.06  ? 865  GLN A C     1 
ATOM   6611  O  O     . GLN A 1  865  ? 32.284  -24.748 57.806  1.00 68.03  ? 865  GLN A O     1 
ATOM   6612  C  CB    . GLN A 1  865  ? 30.144  -23.389 59.383  1.00 68.13  ? 865  GLN A CB    1 
ATOM   6613  C  CG    . GLN A 1  865  ? 29.415  -22.228 59.995  1.00 68.43  ? 865  GLN A CG    1 
ATOM   6614  C  CD    . GLN A 1  865  ? 27.919  -22.344 59.859  1.00 69.65  ? 865  GLN A CD    1 
ATOM   6615  O  OE1   . GLN A 1  865  ? 27.414  -23.179 59.108  1.00 70.12  ? 865  GLN A OE1   1 
ATOM   6616  N  NE2   . GLN A 1  865  ? 27.193  -21.501 60.590  1.00 70.55  ? 865  GLN A NE2   1 
ATOM   6617  N  N     . PHE A 1  866  ? 32.846  -25.532 59.857  1.00 67.73  ? 866  PHE A N     1 
ATOM   6618  C  CA    . PHE A 1  866  ? 33.428  -26.784 59.350  1.00 67.19  ? 866  PHE A CA    1 
ATOM   6619  C  C     . PHE A 1  866  ? 32.393  -27.780 58.775  1.00 67.05  ? 866  PHE A C     1 
ATOM   6620  O  O     . PHE A 1  866  ? 32.782  -28.757 58.129  1.00 67.02  ? 866  PHE A O     1 
ATOM   6621  C  CB    . PHE A 1  866  ? 34.266  -27.484 60.417  1.00 67.13  ? 866  PHE A CB    1 
ATOM   6622  C  CG    . PHE A 1  866  ? 35.371  -26.647 60.995  1.00 66.61  ? 866  PHE A CG    1 
ATOM   6623  C  CD1   . PHE A 1  866  ? 35.182  -25.950 62.181  1.00 66.91  ? 866  PHE A CD1   1 
ATOM   6624  C  CD2   . PHE A 1  866  ? 36.616  -26.606 60.392  1.00 66.35  ? 866  PHE A CD2   1 
ATOM   6625  C  CE1   . PHE A 1  866  ? 36.211  -25.194 62.742  1.00 66.68  ? 866  PHE A CE1   1 
ATOM   6626  C  CE2   . PHE A 1  866  ? 37.653  -25.858 60.940  1.00 66.19  ? 866  PHE A CE2   1 
ATOM   6627  C  CZ    . PHE A 1  866  ? 37.447  -25.148 62.116  1.00 66.65  ? 866  PHE A CZ    1 
ATOM   6628  N  N     . ILE A 1  867  ? 31.100  -27.556 59.053  1.00 66.65  ? 867  ILE A N     1 
ATOM   6629  C  CA    . ILE A 1  867  ? 29.988  -28.256 58.381  1.00 66.49  ? 867  ILE A CA    1 
ATOM   6630  C  C     . ILE A 1  867  ? 28.784  -27.335 58.352  1.00 66.11  ? 867  ILE A C     1 
ATOM   6631  O  O     . ILE A 1  867  ? 28.298  -26.948 59.413  1.00 66.09  ? 867  ILE A O     1 
ATOM   6632  C  CB    . ILE A 1  867  ? 29.520  -29.517 59.133  1.00 66.21  ? 867  ILE A CB    1 
ATOM   6633  C  CG1   . ILE A 1  867  ? 30.524  -29.915 60.213  1.00 67.18  ? 867  ILE A CG1   1 
ATOM   6634  C  CG2   . ILE A 1  867  ? 29.236  -30.648 58.147  1.00 65.64  ? 867  ILE A CG2   1 
ATOM   6635  C  CD1   . ILE A 1  867  ? 29.956  -30.841 61.327  1.00 67.87  ? 867  ILE A CD1   1 
ATOM   6636  N  N     . TYR A 1  868  ? 28.280  -26.994 57.166  1.00 65.72  ? 868  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  868  ? 27.190  -26.024 57.101  1.00 65.70  ? 868  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  868  ? 26.077  -26.344 58.081  1.00 66.21  ? 868  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  868  ? 25.621  -27.479 58.176  1.00 65.88  ? 868  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  868  ? 26.608  -25.870 55.698  1.00 65.25  ? 868  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  868  ? 25.399  -24.927 55.623  1.00 64.89  ? 868  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  868  ? 25.553  -23.597 55.310  1.00 64.03  ? 868  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  868  ? 24.096  -25.383 55.867  1.00 65.56  ? 868  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  868  ? 24.455  -22.744 55.247  1.00 63.99  ? 868  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  868  ? 22.990  -24.520 55.796  1.00 64.43  ? 868  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  868  ? 23.184  -23.206 55.482  1.00 63.75  ? 868  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  868  ? 22.124  -22.333 55.405  1.00 63.27  ? 868  TYR A OH    1 
ATOM   6648  N  N     . GLY A 1  869  ? 25.653  -25.311 58.805  1.00 67.21  ? 869  GLY A N     1 
ATOM   6649  C  CA    . GLY A 1  869  ? 24.501  -25.382 59.704  1.00 68.24  ? 869  GLY A CA    1 
ATOM   6650  C  C     . GLY A 1  869  ? 24.707  -26.406 60.790  1.00 68.79  ? 869  GLY A C     1 
ATOM   6651  O  O     . GLY A 1  869  ? 23.761  -27.017 61.282  1.00 68.62  ? 869  GLY A O     1 
ATOM   6652  N  N     . GLU A 1  870  ? 25.970  -26.596 61.141  1.00 69.63  ? 870  GLU A N     1 
ATOM   6653  C  CA    . GLU A 1  870  ? 26.382  -27.588 62.128  1.00 70.74  ? 870  GLU A CA    1 
ATOM   6654  C  C     . GLU A 1  870  ? 25.845  -29.003 61.846  1.00 71.00  ? 870  GLU A C     1 
ATOM   6655  O  O     . GLU A 1  870  ? 25.727  -29.793 62.784  1.00 71.50  ? 870  GLU A O     1 
ATOM   6656  C  CB    . GLU A 1  870  ? 26.024  -27.125 63.559  1.00 70.67  ? 870  GLU A CB    1 
ATOM   6657  C  CG    . GLU A 1  870  ? 26.068  -25.596 63.767  1.00 71.27  ? 870  GLU A CG    1 
ATOM   6658  C  CD    . GLU A 1  870  ? 26.343  -25.172 65.210  1.00 71.63  ? 870  GLU A CD    1 
ATOM   6659  O  OE1   . GLU A 1  870  ? 26.873  -25.976 66.004  1.00 72.54  ? 870  GLU A OE1   1 
ATOM   6660  O  OE2   . GLU A 1  870  ? 26.039  -24.011 65.549  1.00 73.35  ? 870  GLU A OE2   1 
ATOM   6661  N  N     . ASP A 1  871  ? 25.533  -29.320 60.579  1.00 71.14  ? 871  ASP A N     1 
ATOM   6662  C  CA    . ASP A 1  871  ? 25.059  -30.666 60.189  1.00 71.43  ? 871  ASP A CA    1 
ATOM   6663  C  C     . ASP A 1  871  ? 25.000  -30.889 58.674  1.00 71.40  ? 871  ASP A C     1 
ATOM   6664  O  O     . ASP A 1  871  ? 24.377  -31.835 58.179  1.00 70.86  ? 871  ASP A O     1 
ATOM   6665  C  CB    . ASP A 1  871  ? 23.684  -30.955 60.795  1.00 71.74  ? 871  ASP A CB    1 
ATOM   6666  C  CG    . ASP A 1  871  ? 22.550  -30.328 59.998  1.00 73.09  ? 871  ASP A CG    1 
ATOM   6667  O  OD1   . ASP A 1  871  ? 22.714  -29.172 59.530  1.00 72.88  ? 871  ASP A OD1   1 
ATOM   6668  O  OD2   . ASP A 1  871  ? 21.498  -31.001 59.851  1.00 75.26  ? 871  ASP A OD2   1 
ATOM   6669  N  N     . GLY A 1  872  ? 25.627  -29.982 57.944  1.00 71.81  ? 872  GLY A N     1 
ATOM   6670  C  CA    . GLY A 1  872  ? 25.737  -30.090 56.498  1.00 71.99  ? 872  GLY A CA    1 
ATOM   6671  C  C     . GLY A 1  872  ? 24.447  -30.454 55.819  1.00 71.99  ? 872  GLY A C     1 
ATOM   6672  O  O     . GLY A 1  872  ? 24.445  -31.282 54.925  1.00 72.18  ? 872  GLY A O     1 
ATOM   6673  N  N     . MET A 1  873  ? 23.353  -29.828 56.231  1.00 72.16  ? 873  MET A N     1 
ATOM   6674  C  CA    . MET A 1  873  ? 22.058  -30.117 55.637  1.00 72.57  ? 873  MET A CA    1 
ATOM   6675  C  C     . MET A 1  873  ? 21.443  -28.873 55.025  1.00 72.62  ? 873  MET A C     1 
ATOM   6676  O  O     . MET A 1  873  ? 21.515  -27.805 55.625  1.00 72.69  ? 873  MET A O     1 
ATOM   6677  C  CB    . MET A 1  873  ? 21.126  -30.649 56.707  1.00 72.66  ? 873  MET A CB    1 
ATOM   6678  C  CG    . MET A 1  873  ? 20.255  -31.774 56.235  1.00 74.03  ? 873  MET A CG    1 
ATOM   6679  S  SD    . MET A 1  873  ? 21.209  -33.279 55.905  1.00 77.80  ? 873  MET A SD    1 
ATOM   6680  C  CE    . MET A 1  873  ? 21.927  -33.574 57.540  1.00 76.91  ? 873  MET A CE    1 
ATOM   6681  N  N     . ASP A 1  874  ? 20.832  -28.999 53.848  1.00 72.87  ? 874  ASP A N     1 
ATOM   6682  C  CA    . ASP A 1  874  ? 20.125  -27.862 53.248  1.00 73.65  ? 874  ASP A CA    1 
ATOM   6683  C  C     . ASP A 1  874  ? 18.816  -27.538 53.965  1.00 73.91  ? 874  ASP A C     1 
ATOM   6684  O  O     . ASP A 1  874  ? 17.967  -28.411 54.181  1.00 73.96  ? 874  ASP A O     1 
ATOM   6685  C  CB    . ASP A 1  874  ? 19.865  -28.055 51.749  1.00 73.93  ? 874  ASP A CB    1 
ATOM   6686  C  CG    . ASP A 1  874  ? 19.160  -26.834 51.088  1.00 75.41  ? 874  ASP A CG    1 
ATOM   6687  O  OD1   . ASP A 1  874  ? 18.701  -25.895 51.793  1.00 75.81  ? 874  ASP A OD1   1 
ATOM   6688  O  OD2   . ASP A 1  874  ? 19.064  -26.820 49.834  1.00 77.49  ? 874  ASP A OD2   1 
ATOM   6689  N  N     . ALA A 1  875  ? 18.661  -26.256 54.286  1.00 74.27  ? 875  ALA A N     1 
ATOM   6690  C  CA    . ALA A 1  875  ? 17.516  -25.729 55.021  1.00 74.66  ? 875  ALA A CA    1 
ATOM   6691  C  C     . ALA A 1  875  ? 16.150  -26.190 54.502  1.00 75.13  ? 875  ALA A C     1 
ATOM   6692  O  O     . ALA A 1  875  ? 15.164  -26.218 55.254  1.00 75.08  ? 875  ALA A O     1 
ATOM   6693  C  CB    . ALA A 1  875  ? 17.592  -24.233 55.039  1.00 74.49  ? 875  ALA A CB    1 
ATOM   6694  N  N     . ALA A 1  876  ? 16.122  -26.567 53.224  1.00 75.85  ? 876  ALA A N     1 
ATOM   6695  C  CA    . ALA A 1  876  ? 14.901  -26.929 52.500  1.00 76.55  ? 876  ALA A CA    1 
ATOM   6696  C  C     . ALA A 1  876  ? 14.280  -28.249 52.936  1.00 77.02  ? 876  ALA A C     1 
ATOM   6697  O  O     . ALA A 1  876  ? 13.064  -28.354 53.123  1.00 77.02  ? 876  ALA A O     1 
ATOM   6698  C  CB    . ALA A 1  876  ? 15.186  -26.973 50.999  1.00 76.56  ? 876  ALA A CB    1 
ATOM   6699  N  N     . HIS A 1  877  ? 15.120  -29.258 53.102  1.00 77.68  ? 877  HIS A N     1 
ATOM   6700  C  CA    . HIS A 1  877  ? 14.631  -30.623 53.160  1.00 78.46  ? 877  HIS A CA    1 
ATOM   6701  C  C     . HIS A 1  877  ? 14.202  -31.054 54.562  1.00 78.78  ? 877  HIS A C     1 
ATOM   6702  O  O     . HIS A 1  877  ? 13.695  -32.157 54.762  1.00 79.26  ? 877  HIS A O     1 
ATOM   6703  C  CB    . HIS A 1  877  ? 15.663  -31.556 52.519  1.00 78.44  ? 877  HIS A CB    1 
ATOM   6704  C  CG    . HIS A 1  877  ? 15.981  -31.189 51.099  1.00 79.06  ? 877  HIS A CG    1 
ATOM   6705  N  ND1   . HIS A 1  877  ? 15.491  -31.888 50.015  1.00 79.01  ? 877  HIS A ND1   1 
ATOM   6706  C  CD2   . HIS A 1  877  ? 16.701  -30.163 50.585  1.00 79.62  ? 877  HIS A CD2   1 
ATOM   6707  C  CE1   . HIS A 1  877  ? 15.918  -31.325 48.898  1.00 78.84  ? 877  HIS A CE1   1 
ATOM   6708  N  NE2   . HIS A 1  877  ? 16.654  -30.275 49.216  1.00 79.26  ? 877  HIS A NE2   1 
ATOM   6709  N  N     . ILE A 1  878  ? 14.337  -30.131 55.502  1.00 78.95  ? 878  ILE A N     1 
ATOM   6710  C  CA    . ILE A 1  878  ? 14.166  -30.372 56.923  1.00 79.14  ? 878  ILE A CA    1 
ATOM   6711  C  C     . ILE A 1  878  ? 12.770  -30.012 57.350  1.00 78.93  ? 878  ILE A C     1 
ATOM   6712  O  O     . ILE A 1  878  ? 12.159  -29.168 56.719  1.00 79.21  ? 878  ILE A O     1 
ATOM   6713  C  CB    . ILE A 1  878  ? 15.085  -29.420 57.641  1.00 79.48  ? 878  ILE A CB    1 
ATOM   6714  C  CG1   . ILE A 1  878  ? 16.445  -29.385 56.918  1.00 80.16  ? 878  ILE A CG1   1 
ATOM   6715  C  CG2   . ILE A 1  878  ? 15.198  -29.793 59.103  1.00 80.29  ? 878  ILE A CG2   1 
ATOM   6716  C  CD1   . ILE A 1  878  ? 17.317  -28.201 57.278  1.00 80.56  ? 878  ILE A CD1   1 
ATOM   6717  N  N     . GLU A 1  879  ? 12.261  -30.636 58.411  1.00 78.90  ? 879  GLU A N     1 
ATOM   6718  C  CA    . GLU A 1  879  ? 10.964  -30.244 59.004  1.00 79.42  ? 879  GLU A CA    1 
ATOM   6719  C  C     . GLU A 1  879  ? 10.816  -30.667 60.449  1.00 79.62  ? 879  GLU A C     1 
ATOM   6720  O  O     . GLU A 1  879  ? 11.358  -31.678 60.862  1.00 79.38  ? 879  GLU A O     1 
ATOM   6721  C  CB    . GLU A 1  879  ? 9.751   -30.719 58.188  1.00 79.27  ? 879  GLU A CB    1 
ATOM   6722  C  CG    . GLU A 1  879  ? 10.007  -31.877 57.227  1.00 79.82  ? 879  GLU A CG    1 
ATOM   6723  C  CD    . GLU A 1  879  ? 8.751   -32.364 56.514  1.00 80.11  ? 879  GLU A CD    1 
ATOM   6724  O  OE1   . GLU A 1  879  ? 8.892   -33.116 55.513  1.00 80.47  ? 879  GLU A OE1   1 
ATOM   6725  O  OE2   . GLU A 1  879  ? 7.630   -32.005 56.956  1.00 81.50  ? 879  GLU A OE2   1 
ATOM   6726  N  N     . LYS A 1  880  ? 10.058  -29.886 61.206  1.00 80.54  ? 880  LYS A N     1 
ATOM   6727  C  CA    . LYS A 1  880  ? 10.009  -30.030 62.665  1.00 81.68  ? 880  LYS A CA    1 
ATOM   6728  C  C     . LYS A 1  880  ? 9.375   -31.326 63.148  1.00 81.76  ? 880  LYS A C     1 
ATOM   6729  O  O     . LYS A 1  880  ? 8.163   -31.504 63.083  1.00 81.82  ? 880  LYS A O     1 
ATOM   6730  C  CB    . LYS A 1  880  ? 9.324   -28.817 63.320  1.00 81.91  ? 880  LYS A CB    1 
ATOM   6731  C  CG    . LYS A 1  880  ? 7.840   -28.571 62.927  1.00 82.56  ? 880  LYS A CG    1 
ATOM   6732  C  CD    . LYS A 1  880  ? 7.222   -27.394 63.713  1.00 82.88  ? 880  LYS A CD    1 
ATOM   6733  C  CE    . LYS A 1  880  ? 7.183   -27.645 65.238  1.00 84.56  ? 880  LYS A CE    1 
ATOM   6734  N  NZ    . LYS A 1  880  ? 7.173   -26.366 66.023  1.00 85.51  ? 880  LYS A NZ    1 
ATOM   6735  N  N     . GLN A 1  881  ? 10.214  -32.230 63.640  1.00 82.23  ? 881  GLN A N     1 
ATOM   6736  C  CA    . GLN A 1  881  ? 9.763   -33.528 64.149  1.00 82.54  ? 881  GLN A CA    1 
ATOM   6737  C  C     . GLN A 1  881  ? 9.954   -33.627 65.666  1.00 82.80  ? 881  GLN A C     1 
ATOM   6738  O  O     . GLN A 1  881  ? 10.831  -32.965 66.227  1.00 83.04  ? 881  GLN A O     1 
ATOM   6739  C  CB    . GLN A 1  881  ? 10.521  -34.647 63.456  1.00 82.42  ? 881  GLN A CB    1 
ATOM   6740  C  CG    . GLN A 1  881  ? 10.665  -34.435 61.979  1.00 82.48  ? 881  GLN A CG    1 
ATOM   6741  C  CD    . GLN A 1  881  ? 11.139  -35.669 61.279  1.00 83.32  ? 881  GLN A CD    1 
ATOM   6742  O  OE1   . GLN A 1  881  ? 10.480  -36.716 61.319  1.00 83.75  ? 881  GLN A OE1   1 
ATOM   6743  N  NE2   . GLN A 1  881  ? 12.289  -35.565 60.621  1.00 83.74  ? 881  GLN A NE2   1 
ATOM   6744  N  N     . SER A 1  882  ? 9.132   -34.442 66.329  1.00 83.00  ? 882  SER A N     1 
ATOM   6745  C  CA    . SER A 1  882  ? 9.191   -34.555 67.785  1.00 83.09  ? 882  SER A CA    1 
ATOM   6746  C  C     . SER A 1  882  ? 10.100  -35.702 68.170  1.00 83.49  ? 882  SER A C     1 
ATOM   6747  O  O     . SER A 1  882  ? 9.915   -36.828 67.692  1.00 83.62  ? 882  SER A O     1 
ATOM   6748  C  CB    . SER A 1  882  ? 7.798   -34.752 68.394  1.00 82.98  ? 882  SER A CB    1 
ATOM   6749  O  OG    . SER A 1  882  ? 7.447   -36.123 68.474  1.00 82.24  ? 882  SER A OG    1 
ATOM   6750  N  N     . LEU A 1  883  ? 11.082  -35.409 69.024  1.00 83.87  ? 883  LEU A N     1 
ATOM   6751  C  CA    . LEU A 1  883  ? 11.994  -36.429 69.552  1.00 84.32  ? 883  LEU A CA    1 
ATOM   6752  C  C     . LEU A 1  883  ? 11.457  -36.985 70.885  1.00 85.04  ? 883  LEU A C     1 
ATOM   6753  O  O     . LEU A 1  883  ? 11.969  -36.643 71.963  1.00 85.46  ? 883  LEU A O     1 
ATOM   6754  C  CB    . LEU A 1  883  ? 13.401  -35.844 69.746  1.00 83.80  ? 883  LEU A CB    1 
ATOM   6755  C  CG    . LEU A 1  883  ? 14.076  -34.991 68.679  1.00 82.24  ? 883  LEU A CG    1 
ATOM   6756  C  CD1   . LEU A 1  883  ? 15.208  -34.285 69.325  1.00 81.63  ? 883  LEU A CD1   1 
ATOM   6757  C  CD2   . LEU A 1  883  ? 14.598  -35.799 67.536  1.00 80.95  ? 883  LEU A CD2   1 
ATOM   6758  N  N     . ASP A 1  884  ? 10.433  -37.838 70.818  1.00 85.51  ? 884  ASP A N     1 
ATOM   6759  C  CA    . ASP A 1  884  ? 9.680   -38.222 72.026  1.00 85.92  ? 884  ASP A CA    1 
ATOM   6760  C  C     . ASP A 1  884  ? 10.417  -39.229 72.899  1.00 86.05  ? 884  ASP A C     1 
ATOM   6761  O  O     . ASP A 1  884  ? 9.800   -39.995 73.657  1.00 86.21  ? 884  ASP A O     1 
ATOM   6762  C  CB    . ASP A 1  884  ? 8.266   -38.708 71.689  1.00 86.09  ? 884  ASP A CB    1 
ATOM   6763  C  CG    . ASP A 1  884  ? 8.257   -39.828 70.665  1.00 86.88  ? 884  ASP A CG    1 
ATOM   6764  O  OD1   . ASP A 1  884  ? 7.177   -40.084 70.076  1.00 87.66  ? 884  ASP A OD1   1 
ATOM   6765  O  OD2   . ASP A 1  884  ? 9.325   -40.443 70.440  1.00 87.97  ? 884  ASP A OD2   1 
ATOM   6766  N  N     . THR A 1  885  ? 11.742  -39.234 72.760  1.00 86.00  ? 885  THR A N     1 
ATOM   6767  C  CA    . THR A 1  885  ? 12.630  -39.803 73.760  1.00 85.74  ? 885  THR A CA    1 
ATOM   6768  C  C     . THR A 1  885  ? 12.665  -38.792 74.926  1.00 85.95  ? 885  THR A C     1 
ATOM   6769  O  O     . THR A 1  885  ? 12.867  -39.181 76.084  1.00 85.93  ? 885  THR A O     1 
ATOM   6770  C  CB    . THR A 1  885  ? 14.051  -40.012 73.184  1.00 85.53  ? 885  THR A CB    1 
ATOM   6771  O  OG1   . THR A 1  885  ? 13.982  -40.097 71.759  1.00 85.54  ? 885  THR A OG1   1 
ATOM   6772  C  CG2   . THR A 1  885  ? 14.688  -41.268 73.723  1.00 84.70  ? 885  THR A CG2   1 
ATOM   6773  N  N     . ILE A 1  886  ? 12.418  -37.511 74.608  1.00 85.94  ? 886  ILE A N     1 
ATOM   6774  C  CA    . ILE A 1  886  ? 12.577  -36.377 75.546  1.00 85.98  ? 886  ILE A CA    1 
ATOM   6775  C  C     . ILE A 1  886  ? 11.507  -36.199 76.624  1.00 86.34  ? 886  ILE A C     1 
ATOM   6776  O  O     . ILE A 1  886  ? 11.839  -35.962 77.784  1.00 86.23  ? 886  ILE A O     1 
ATOM   6777  C  CB    . ILE A 1  886  ? 12.756  -35.038 74.791  1.00 85.79  ? 886  ILE A CB    1 
ATOM   6778  C  CG1   . ILE A 1  886  ? 14.202  -34.891 74.338  1.00 85.37  ? 886  ILE A CG1   1 
ATOM   6779  C  CG2   . ILE A 1  886  ? 12.346  -33.828 75.663  1.00 85.67  ? 886  ILE A CG2   1 
ATOM   6780  C  CD1   . ILE A 1  886  ? 15.171  -34.673 75.470  1.00 84.21  ? 886  ILE A CD1   1 
ATOM   6781  N  N     . GLY A 1  887  ? 10.236  -36.285 76.245  1.00 86.83  ? 887  GLY A N     1 
ATOM   6782  C  CA    . GLY A 1  887  ? 9.159   -36.100 77.211  1.00 87.52  ? 887  GLY A CA    1 
ATOM   6783  C  C     . GLY A 1  887  ? 8.872   -37.370 77.994  1.00 88.03  ? 887  GLY A C     1 
ATOM   6784  O  O     . GLY A 1  887  ? 9.707   -38.281 78.052  1.00 88.00  ? 887  GLY A O     1 
ATOM   6785  N  N     . GLY A 1  888  ? 7.694   -37.410 78.615  1.00 88.48  ? 888  GLY A N     1 
ATOM   6786  C  CA    . GLY A 1  888  ? 7.160   -38.628 79.228  1.00 89.18  ? 888  GLY A CA    1 
ATOM   6787  C  C     . GLY A 1  888  ? 7.782   -39.022 80.553  1.00 89.66  ? 888  GLY A C     1 
ATOM   6788  O  O     . GLY A 1  888  ? 8.937   -38.694 80.837  1.00 89.65  ? 888  GLY A O     1 
ATOM   6789  N  N     . SER A 1  889  ? 7.004   -39.741 81.359  1.00 90.16  ? 889  SER A N     1 
ATOM   6790  C  CA    . SER A 1  889  ? 7.449   -40.230 82.663  1.00 90.62  ? 889  SER A CA    1 
ATOM   6791  C  C     . SER A 1  889  ? 8.579   -41.217 82.457  1.00 90.69  ? 889  SER A C     1 
ATOM   6792  O  O     . SER A 1  889  ? 8.609   -41.906 81.430  1.00 90.84  ? 889  SER A O     1 
ATOM   6793  C  CB    . SER A 1  889  ? 6.307   -40.964 83.370  1.00 90.76  ? 889  SER A CB    1 
ATOM   6794  O  OG    . SER A 1  889  ? 5.096   -40.872 82.633  1.00 91.43  ? 889  SER A OG    1 
ATOM   6795  N  N     . ASP A 1  890  ? 9.501   -41.290 83.420  1.00 90.71  ? 890  ASP A N     1 
ATOM   6796  C  CA    . ASP A 1  890  ? 10.475  -42.386 83.446  1.00 90.70  ? 890  ASP A CA    1 
ATOM   6797  C  C     . ASP A 1  890  ? 9.695   -43.689 83.441  1.00 90.40  ? 890  ASP A C     1 
ATOM   6798  O  O     . ASP A 1  890  ? 10.084  -44.650 82.785  1.00 90.13  ? 890  ASP A O     1 
ATOM   6799  C  CB    . ASP A 1  890  ? 11.417  -42.295 84.656  1.00 90.98  ? 890  ASP A CB    1 
ATOM   6800  C  CG    . ASP A 1  890  ? 12.760  -41.647 84.308  1.00 91.61  ? 890  ASP A CG    1 
ATOM   6801  O  OD1   . ASP A 1  890  ? 13.590  -42.319 83.649  1.00 92.37  ? 890  ASP A OD1   1 
ATOM   6802  O  OD2   . ASP A 1  890  ? 12.987  -40.474 84.688  1.00 92.05  ? 890  ASP A OD2   1 
ATOM   6803  N  N     . ALA A 1  891  ? 8.565   -43.678 84.148  1.00 90.38  ? 891  ALA A N     1 
ATOM   6804  C  CA    . ALA A 1  891  ? 7.582   -44.758 84.123  1.00 90.42  ? 891  ALA A CA    1 
ATOM   6805  C  C     . ALA A 1  891  ? 7.061   -45.050 82.709  1.00 90.28  ? 891  ALA A C     1 
ATOM   6806  O  O     . ALA A 1  891  ? 7.280   -46.143 82.180  1.00 90.17  ? 891  ALA A O     1 
ATOM   6807  C  CB    . ALA A 1  891  ? 6.423   -44.435 85.065  1.00 90.56  ? 891  ALA A CB    1 
ATOM   6808  N  N     . ALA A 1  892  ? 6.387   -44.066 82.107  1.00 90.16  ? 892  ALA A N     1 
ATOM   6809  C  CA    . ALA A 1  892  ? 5.784   -44.206 80.769  1.00 89.84  ? 892  ALA A CA    1 
ATOM   6810  C  C     . ALA A 1  892  ? 6.794   -44.476 79.652  1.00 89.52  ? 892  ALA A C     1 
ATOM   6811  O  O     . ALA A 1  892  ? 6.424   -44.984 78.591  1.00 89.44  ? 892  ALA A O     1 
ATOM   6812  C  CB    . ALA A 1  892  ? 4.919   -42.994 80.430  1.00 89.90  ? 892  ALA A CB    1 
ATOM   6813  N  N     . PHE A 1  893  ? 8.055   -44.120 79.898  1.00 89.07  ? 893  PHE A N     1 
ATOM   6814  C  CA    . PHE A 1  893  ? 9.159   -44.422 78.992  1.00 88.60  ? 893  PHE A CA    1 
ATOM   6815  C  C     . PHE A 1  893  ? 9.449   -45.917 78.984  1.00 89.08  ? 893  PHE A C     1 
ATOM   6816  O  O     . PHE A 1  893  ? 9.602   -46.518 77.924  1.00 89.13  ? 893  PHE A O     1 
ATOM   6817  C  CB    . PHE A 1  893  ? 10.413  -43.660 79.414  1.00 87.83  ? 893  PHE A CB    1 
ATOM   6818  C  CG    . PHE A 1  893  ? 11.637  -43.978 78.594  1.00 86.13  ? 893  PHE A CG    1 
ATOM   6819  C  CD1   . PHE A 1  893  ? 12.308  -42.980 77.925  1.00 84.87  ? 893  PHE A CD1   1 
ATOM   6820  C  CD2   . PHE A 1  893  ? 12.136  -45.261 78.517  1.00 84.78  ? 893  PHE A CD2   1 
ATOM   6821  C  CE1   . PHE A 1  893  ? 13.444  -43.257 77.177  1.00 84.12  ? 893  PHE A CE1   1 
ATOM   6822  C  CE2   . PHE A 1  893  ? 13.263  -45.536 77.768  1.00 84.44  ? 893  PHE A CE2   1 
ATOM   6823  C  CZ    . PHE A 1  893  ? 13.917  -44.532 77.097  1.00 84.18  ? 893  PHE A CZ    1 
ATOM   6824  N  N     . GLU A 1  894  ? 9.547   -46.516 80.165  1.00 89.63  ? 894  GLU A N     1 
ATOM   6825  C  CA    . GLU A 1  894  ? 9.820   -47.942 80.245  1.00 90.33  ? 894  GLU A CA    1 
ATOM   6826  C  C     . GLU A 1  894  ? 8.731   -48.726 79.517  1.00 90.76  ? 894  GLU A C     1 
ATOM   6827  O  O     . GLU A 1  894  ? 9.042   -49.543 78.656  1.00 90.77  ? 894  GLU A O     1 
ATOM   6828  C  CB    . GLU A 1  894  ? 9.944   -48.391 81.697  1.00 90.38  ? 894  GLU A CB    1 
ATOM   6829  C  CG    . GLU A 1  894  ? 10.893  -49.552 81.898  1.00 90.74  ? 894  GLU A CG    1 
ATOM   6830  C  CD    . GLU A 1  894  ? 11.446  -49.608 83.309  1.00 91.53  ? 894  GLU A CD    1 
ATOM   6831  O  OE1   . GLU A 1  894  ? 11.022  -50.508 84.064  1.00 92.34  ? 894  GLU A OE1   1 
ATOM   6832  O  OE2   . GLU A 1  894  ? 12.293  -48.753 83.669  1.00 91.31  ? 894  GLU A OE2   1 
ATOM   6833  N  N     . LYS A 1  895  ? 7.466   -48.438 79.843  1.00 91.44  ? 895  LYS A N     1 
ATOM   6834  C  CA    . LYS A 1  895  ? 6.284   -49.044 79.194  1.00 91.93  ? 895  LYS A CA    1 
ATOM   6835  C  C     . LYS A 1  895  ? 6.411   -49.069 77.681  1.00 91.87  ? 895  LYS A C     1 
ATOM   6836  O  O     . LYS A 1  895  ? 5.709   -49.826 77.013  1.00 91.84  ? 895  LYS A O     1 
ATOM   6837  C  CB    . LYS A 1  895  ? 4.995   -48.271 79.540  1.00 92.14  ? 895  LYS A CB    1 
ATOM   6838  C  CG    . LYS A 1  895  ? 4.223   -48.740 80.789  1.00 93.49  ? 895  LYS A CG    1 
ATOM   6839  C  CD    . LYS A 1  895  ? 4.514   -47.903 82.078  1.00 95.16  ? 895  LYS A CD    1 
ATOM   6840  C  CE    . LYS A 1  895  ? 3.864   -46.493 82.090  1.00 95.15  ? 895  LYS A CE    1 
ATOM   6841  N  NZ    . LYS A 1  895  ? 2.381   -46.440 81.879  1.00 95.37  ? 895  LYS A NZ    1 
ATOM   6842  N  N     . ARG A 1  896  ? 7.328   -48.252 77.164  1.00 92.03  ? 896  ARG A N     1 
ATOM   6843  C  CA    . ARG A 1  896  ? 7.398   -47.894 75.742  1.00 92.34  ? 896  ARG A CA    1 
ATOM   6844  C  C     . ARG A 1  896  ? 8.581   -48.498 74.957  1.00 92.21  ? 896  ARG A C     1 
ATOM   6845  O  O     . ARG A 1  896  ? 8.461   -48.761 73.752  1.00 92.23  ? 896  ARG A O     1 
ATOM   6846  C  CB    . ARG A 1  896  ? 7.423   -46.361 75.614  1.00 92.49  ? 896  ARG A CB    1 
ATOM   6847  C  CG    . ARG A 1  896  ? 6.180   -45.687 75.035  1.00 93.07  ? 896  ARG A CG    1 
ATOM   6848  C  CD    . ARG A 1  896  ? 6.497   -45.136 73.639  1.00 94.49  ? 896  ARG A CD    1 
ATOM   6849  N  NE    . ARG A 1  896  ? 5.778   -43.903 73.299  1.00 95.42  ? 896  ARG A NE    1 
ATOM   6850  C  CZ    . ARG A 1  896  ? 6.126   -42.679 73.706  1.00 96.22  ? 896  ARG A CZ    1 
ATOM   6851  N  NH1   . ARG A 1  896  ? 7.182   -42.496 74.497  1.00 96.01  ? 896  ARG A NH1   1 
ATOM   6852  N  NH2   . ARG A 1  896  ? 5.404   -41.628 73.329  1.00 96.69  ? 896  ARG A NH2   1 
ATOM   6853  N  N     . TYR A 1  897  ? 9.715   -48.700 75.627  1.00 91.98  ? 897  TYR A N     1 
ATOM   6854  C  CA    . TYR A 1  897  ? 10.956  -49.088 74.941  1.00 91.80  ? 897  TYR A CA    1 
ATOM   6855  C  C     . TYR A 1  897  ? 11.655  -50.319 75.547  1.00 91.74  ? 897  TYR A C     1 
ATOM   6856  O  O     . TYR A 1  897  ? 12.560  -50.906 74.935  1.00 91.72  ? 897  TYR A O     1 
ATOM   6857  C  CB    . TYR A 1  897  ? 11.933  -47.905 74.916  1.00 91.78  ? 897  TYR A CB    1 
ATOM   6858  C  CG    . TYR A 1  897  ? 11.605  -46.777 73.953  1.00 91.53  ? 897  TYR A CG    1 
ATOM   6859  C  CD1   . TYR A 1  897  ? 10.369  -46.142 73.977  1.00 91.41  ? 897  TYR A CD1   1 
ATOM   6860  C  CD2   . TYR A 1  897  ? 12.559  -46.317 73.047  1.00 91.35  ? 897  TYR A CD2   1 
ATOM   6861  C  CE1   . TYR A 1  897  ? 10.075  -45.103 73.106  1.00 91.85  ? 897  TYR A CE1   1 
ATOM   6862  C  CE2   . TYR A 1  897  ? 12.280  -45.274 72.171  1.00 91.51  ? 897  TYR A CE2   1 
ATOM   6863  C  CZ    . TYR A 1  897  ? 11.034  -44.669 72.207  1.00 91.78  ? 897  TYR A CZ    1 
ATOM   6864  O  OH    . TYR A 1  897  ? 10.739  -43.634 71.350  1.00 91.61  ? 897  TYR A OH    1 
ATOM   6865  N  N     . ARG A 1  898  ? 11.247  -50.693 76.756  1.00 91.56  ? 898  ARG A N     1 
ATOM   6866  C  CA    . ARG A 1  898  ? 11.787  -51.875 77.404  1.00 91.33  ? 898  ARG A CA    1 
ATOM   6867  C  C     . ARG A 1  898  ? 11.234  -53.113 76.731  1.00 90.89  ? 898  ARG A C     1 
ATOM   6868  O  O     . ARG A 1  898  ? 10.015  -53.312 76.671  1.00 90.69  ? 898  ARG A O     1 
ATOM   6869  C  CB    . ARG A 1  898  ? 11.456  -51.877 78.907  1.00 91.63  ? 898  ARG A CB    1 
ATOM   6870  C  CG    . ARG A 1  898  ? 12.118  -53.002 79.741  1.00 92.74  ? 898  ARG A CG    1 
ATOM   6871  C  CD    . ARG A 1  898  ? 13.641  -52.868 79.788  1.00 94.18  ? 898  ARG A CD    1 
ATOM   6872  N  NE    . ARG A 1  898  ? 14.305  -54.041 80.356  1.00 95.03  ? 898  ARG A NE    1 
ATOM   6873  C  CZ    . ARG A 1  898  ? 15.462  -54.537 79.915  1.00 96.04  ? 898  ARG A CZ    1 
ATOM   6874  N  NH1   . ARG A 1  898  ? 16.094  -53.987 78.881  1.00 96.03  ? 898  ARG A NH1   1 
ATOM   6875  N  NH2   . ARG A 1  898  ? 15.983  -55.606 80.499  1.00 96.96  ? 898  ARG A NH2   1 
ATOM   6876  N  N     . VAL A 1  899  ? 12.130  -53.952 76.221  1.00 90.40  ? 899  VAL A N     1 
ATOM   6877  C  CA    . VAL A 1  899  ? 11.731  -55.182 75.548  1.00 89.97  ? 899  VAL A CA    1 
ATOM   6878  C  C     . VAL A 1  899  ? 12.318  -56.406 76.244  1.00 89.67  ? 899  VAL A C     1 
ATOM   6879  O  O     . VAL A 1  899  ? 13.069  -57.174 75.641  1.00 89.75  ? 899  VAL A O     1 
ATOM   6880  C  CB    . VAL A 1  899  ? 12.167  -55.184 74.071  1.00 89.89  ? 899  VAL A CB    1 
ATOM   6881  C  CG1   . VAL A 1  899  ? 11.972  -56.565 73.463  1.00 90.03  ? 899  VAL A CG1   1 
ATOM   6882  C  CG2   . VAL A 1  899  ? 11.393  -54.135 73.288  1.00 90.07  ? 899  VAL A CG2   1 
ATOM   6883  N  N     . ASP A 1  900  ? 11.972  -56.581 77.515  1.00 89.29  ? 900  ASP A N     1 
ATOM   6884  C  CA    . ASP A 1  900  ? 12.465  -57.710 78.295  1.00 89.01  ? 900  ASP A CA    1 
ATOM   6885  C  C     . ASP A 1  900  ? 12.037  -59.036 77.677  1.00 88.67  ? 900  ASP A C     1 
ATOM   6886  O  O     . ASP A 1  900  ? 10.880  -59.209 77.292  1.00 88.72  ? 900  ASP A O     1 
ATOM   6887  C  CB    . ASP A 1  900  ? 11.970  -57.619 79.740  1.00 89.13  ? 900  ASP A CB    1 
ATOM   6888  C  CG    . ASP A 1  900  ? 13.078  -57.842 80.750  1.00 88.83  ? 900  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A 1  900  ? 13.615  -58.969 80.806  1.00 88.43  ? 900  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A 1  900  ? 13.412  -56.892 81.489  1.00 88.03  ? 900  ASP A OD2   1 
ATOM   6891  N  N     . LEU A 1  901  ? 12.977  -59.971 77.586  1.00 88.10  ? 901  LEU A N     1 
ATOM   6892  C  CA    . LEU A 1  901  ? 12.700  -61.284 77.016  1.00 87.71  ? 901  LEU A CA    1 
ATOM   6893  C  C     . LEU A 1  901  ? 12.600  -62.347 78.104  1.00 87.79  ? 901  LEU A C     1 
ATOM   6894  O  O     . LEU A 1  901  ? 11.690  -63.176 78.094  1.00 87.80  ? 901  LEU A O     1 
ATOM   6895  C  CB    . LEU A 1  901  ? 13.780  -61.668 76.003  1.00 87.37  ? 901  LEU A CB    1 
ATOM   6896  C  CG    . LEU A 1  901  ? 13.582  -61.159 74.574  1.00 86.73  ? 901  LEU A CG    1 
ATOM   6897  C  CD1   . LEU A 1  901  ? 14.676  -61.688 73.659  1.00 85.85  ? 901  LEU A CD1   1 
ATOM   6898  C  CD2   . LEU A 1  901  ? 12.207  -61.545 74.051  1.00 86.30  ? 901  LEU A CD2   1 
ATOM   6899  N  N     . LEU A 1  902  ? 13.541  -62.317 79.042  1.00 87.79  ? 902  LEU A N     1 
ATOM   6900  C  CA    . LEU A 1  902  ? 13.560  -63.277 80.139  1.00 87.77  ? 902  LEU A CA    1 
ATOM   6901  C  C     . LEU A 1  902  ? 12.715  -62.791 81.312  1.00 88.25  ? 902  LEU A C     1 
ATOM   6902  O  O     . LEU A 1  902  ? 13.039  -63.048 82.472  1.00 88.56  ? 902  LEU A O     1 
ATOM   6903  C  CB    . LEU A 1  902  ? 14.997  -63.537 80.598  1.00 87.32  ? 902  LEU A CB    1 
ATOM   6904  C  CG    . LEU A 1  902  ? 16.062  -62.576 80.068  1.00 86.52  ? 902  LEU A CG    1 
ATOM   6905  C  CD1   . LEU A 1  902  ? 16.294  -61.436 81.049  1.00 86.62  ? 902  LEU A CD1   1 
ATOM   6906  C  CD2   . LEU A 1  902  ? 17.360  -63.316 79.783  1.00 85.53  ? 902  LEU A CD2   1 
ATOM   6907  N  N     . ASN A 1  903  ? 11.631  -62.088 81.002  1.00 88.67  ? 903  ASN A N     1 
ATOM   6908  C  CA    . ASN A 1  903  ? 10.738  -61.564 82.029  1.00 89.34  ? 903  ASN A CA    1 
ATOM   6909  C  C     . ASN A 1  903  ? 9.273   -61.640 81.611  1.00 89.92  ? 903  ASN A C     1 
ATOM   6910  O  O     . ASN A 1  903  ? 8.676   -60.635 81.224  1.00 90.01  ? 903  ASN A O     1 
ATOM   6911  C  CB    . ASN A 1  903  ? 11.111  -60.123 82.380  1.00 89.22  ? 903  ASN A CB    1 
ATOM   6912  C  CG    . ASN A 1  903  ? 10.131  -59.486 83.345  1.00 89.28  ? 903  ASN A CG    1 
ATOM   6913  O  OD1   . ASN A 1  903  ? 9.257   -60.157 83.894  1.00 89.73  ? 903  ASN A OD1   1 
ATOM   6914  N  ND2   . ASN A 1  903  ? 10.272  -58.183 83.558  1.00 88.74  ? 903  ASN A ND2   1 
ATOM   6915  N  N     . THR A 1  904  ? 8.700   -62.836 81.692  1.00 90.82  ? 904  THR A N     1 
ATOM   6916  C  CA    . THR A 1  904  ? 7.305   -63.044 81.322  1.00 91.69  ? 904  THR A CA    1 
ATOM   6917  C  C     . THR A 1  904  ? 6.579   -61.716 81.139  1.00 92.27  ? 904  THR A C     1 
ATOM   6918  O  O     . THR A 1  904  ? 6.596   -61.133 80.055  1.00 92.18  ? 904  THR A O     1 
ATOM   6919  C  CB    . THR A 1  904  ? 6.561   -63.884 82.378  1.00 91.71  ? 904  THR A CB    1 
ATOM   6920  O  OG1   . THR A 1  904  ? 7.142   -65.192 82.448  1.00 91.56  ? 904  THR A OG1   1 
ATOM   6921  C  CG2   . THR A 1  904  ? 5.088   -64.007 82.019  1.00 91.83  ? 904  THR A CG2   1 
ATOM   6922  N  N     . ASP A 1  905  ? 5.943   -61.243 82.205  1.00 93.14  ? 905  ASP A N     1 
ATOM   6923  C  CA    . ASP A 1  905  ? 5.209   -59.984 82.164  1.00 94.19  ? 905  ASP A CA    1 
ATOM   6924  C  C     . ASP A 1  905  ? 5.754   -59.064 81.076  1.00 94.76  ? 905  ASP A C     1 
ATOM   6925  O  O     . ASP A 1  905  ? 5.054   -58.739 80.117  1.00 94.85  ? 905  ASP A O     1 
ATOM   6926  C  CB    . ASP A 1  905  ? 5.270   -59.284 83.523  1.00 94.28  ? 905  ASP A CB    1 
ATOM   6927  C  CG    . ASP A 1  905  ? 4.235   -59.811 84.497  1.00 94.87  ? 905  ASP A CG    1 
ATOM   6928  O  OD1   . ASP A 1  905  ? 3.616   -60.855 84.201  1.00 95.50  ? 905  ASP A OD1   1 
ATOM   6929  O  OD2   . ASP A 1  905  ? 4.039   -59.182 85.558  1.00 95.43  ? 905  ASP A OD2   1 
ATOM   6930  N  N     . HIS A 1  906  ? 7.007   -58.649 81.232  1.00 95.40  ? 906  HIS A N     1 
ATOM   6931  C  CA    . HIS A 1  906  ? 7.647   -57.768 80.263  1.00 95.88  ? 906  HIS A CA    1 
ATOM   6932  C  C     . HIS A 1  906  ? 8.331   -58.567 79.159  1.00 95.98  ? 906  HIS A C     1 
ATOM   6933  O  O     . HIS A 1  906  ? 9.507   -58.916 79.269  1.00 95.81  ? 906  HIS A O     1 
ATOM   6934  C  CB    . HIS A 1  906  ? 8.661   -56.856 80.956  1.00 96.10  ? 906  HIS A CB    1 
ATOM   6935  C  CG    . HIS A 1  906  ? 8.039   -55.842 81.866  1.00 97.00  ? 906  HIS A CG    1 
ATOM   6936  N  ND1   . HIS A 1  906  ? 7.931   -56.031 83.227  1.00 97.65  ? 906  HIS A ND1   1 
ATOM   6937  C  CD2   . HIS A 1  906  ? 7.493   -54.630 81.610  1.00 97.82  ? 906  HIS A CD2   1 
ATOM   6938  C  CE1   . HIS A 1  906  ? 7.344   -54.979 83.770  1.00 98.03  ? 906  HIS A CE1   1 
ATOM   6939  N  NE2   . HIS A 1  906  ? 7.068   -54.115 82.810  1.00 98.14  ? 906  HIS A NE2   1 
ATOM   6940  N  N     . THR A 1  907  ? 7.588   -58.855 78.095  1.00 96.40  ? 907  THR A N     1 
ATOM   6941  C  CA    . THR A 1  907  ? 8.121   -59.614 76.971  1.00 97.06  ? 907  THR A CA    1 
ATOM   6942  C  C     . THR A 1  907  ? 7.156   -59.601 75.790  1.00 97.43  ? 907  THR A C     1 
ATOM   6943  O  O     . THR A 1  907  ? 5.962   -59.853 75.949  1.00 97.72  ? 907  THR A O     1 
ATOM   6944  C  CB    . THR A 1  907  ? 8.416   -61.073 77.364  1.00 97.14  ? 907  THR A CB    1 
ATOM   6945  O  OG1   . THR A 1  907  ? 9.502   -61.108 78.299  1.00 97.61  ? 907  THR A OG1   1 
ATOM   6946  C  CG2   . THR A 1  907  ? 8.783   -61.892 76.136  1.00 97.17  ? 907  THR A CG2   1 
ATOM   6947  N  N     . LEU A 1  908  ? 7.683   -59.307 74.605  1.00 97.75  ? 908  LEU A N     1 
ATOM   6948  C  CA    . LEU A 1  908  ? 6.870   -59.263 73.396  1.00 98.00  ? 908  LEU A CA    1 
ATOM   6949  C  C     . LEU A 1  908  ? 5.897   -60.436 73.343  1.00 98.52  ? 908  LEU A C     1 
ATOM   6950  O  O     . LEU A 1  908  ? 6.305   -61.596 73.397  1.00 98.67  ? 908  LEU A O     1 
ATOM   6951  C  CB    . LEU A 1  908  ? 7.760   -59.262 72.152  1.00 97.67  ? 908  LEU A CB    1 
ATOM   6952  C  CG    . LEU A 1  908  ? 9.091   -58.516 72.271  1.00 96.46  ? 908  LEU A CG    1 
ATOM   6953  C  CD1   . LEU A 1  908  ? 10.229  -59.352 71.707  1.00 95.11  ? 908  LEU A CD1   1 
ATOM   6954  C  CD2   . LEU A 1  908  ? 9.015   -57.166 71.573  1.00 95.87  ? 908  LEU A CD2   1 
ATOM   6955  N  N     . ASP A 1  909  ? 4.609   -60.126 73.238  1.00 99.10  ? 909  ASP A N     1 
ATOM   6956  C  CA    . ASP A 1  909  ? 3.569   -61.161 73.181  1.00 99.75  ? 909  ASP A CA    1 
ATOM   6957  C  C     . ASP A 1  909  ? 3.843   -62.115 72.016  1.00 99.66  ? 909  ASP A C     1 
ATOM   6958  O  O     . ASP A 1  909  ? 4.328   -61.693 70.964  1.00 99.64  ? 909  ASP A O     1 
ATOM   6959  C  CB    . ASP A 1  909  ? 2.153   -60.553 73.067  1.00 100.09 ? 909  ASP A CB    1 
ATOM   6960  C  CG    . ASP A 1  909  ? 1.035   -61.536 73.504  1.00 101.29 ? 909  ASP A CG    1 
ATOM   6961  O  OD1   . ASP A 1  909  ? 0.007   -61.644 72.789  1.00 102.09 ? 909  ASP A OD1   1 
ATOM   6962  O  OD2   . ASP A 1  909  ? 1.180   -62.198 74.563  1.00 102.30 ? 909  ASP A OD2   1 
ATOM   6963  N  N     . PRO A 1  910  ? 3.579   -63.413 72.215  1.00 99.67  ? 910  PRO A N     1 
ATOM   6964  C  CA    . PRO A 1  910  ? 3.676   -64.345 71.102  1.00 99.69  ? 910  PRO A CA    1 
ATOM   6965  C  C     . PRO A 1  910  ? 2.900   -63.866 69.875  1.00 99.64  ? 910  PRO A C     1 
ATOM   6966  O  O     . PRO A 1  910  ? 3.276   -64.176 68.747  1.00 99.54  ? 910  PRO A O     1 
ATOM   6967  C  CB    . PRO A 1  910  ? 3.040   -65.614 71.665  1.00 99.83  ? 910  PRO A CB    1 
ATOM   6968  C  CG    . PRO A 1  910  ? 3.302   -65.538 73.123  1.00 99.96  ? 910  PRO A CG    1 
ATOM   6969  C  CD    . PRO A 1  910  ? 3.227   -64.091 73.478  1.00 99.66  ? 910  PRO A CD    1 
ATOM   6970  N  N     . SER A 1  911  ? 1.830   -63.112 70.101  1.00 99.68  ? 911  SER A N     1 
ATOM   6971  C  CA    . SER A 1  911  ? 1.031   -62.577 69.011  1.00 99.90  ? 911  SER A CA    1 
ATOM   6972  C  C     . SER A 1  911  ? 1.850   -61.667 68.090  1.00 100.09 ? 911  SER A C     1 
ATOM   6973  O  O     . SER A 1  911  ? 1.780   -61.795 66.869  1.00 100.14 ? 911  SER A O     1 
ATOM   6974  C  CB    . SER A 1  911  ? -0.199  -61.838 69.552  1.00 99.88  ? 911  SER A CB    1 
ATOM   6975  O  OG    . SER A 1  911  ? 0.168   -60.682 70.286  1.00 99.86  ? 911  SER A OG    1 
ATOM   6976  N  N     . LEU A 1  912  ? 2.638   -60.772 68.683  1.00 100.35 ? 912  LEU A N     1 
ATOM   6977  C  CA    . LEU A 1  912  ? 3.347   -59.718 67.943  1.00 100.48 ? 912  LEU A CA    1 
ATOM   6978  C  C     . LEU A 1  912  ? 4.402   -60.237 66.962  1.00 100.54 ? 912  LEU A C     1 
ATOM   6979  O  O     . LEU A 1  912  ? 4.611   -59.645 65.908  1.00 100.48 ? 912  LEU A O     1 
ATOM   6980  C  CB    . LEU A 1  912  ? 3.977   -58.686 68.901  1.00 100.55 ? 912  LEU A CB    1 
ATOM   6981  C  CG    . LEU A 1  912  ? 3.267   -58.157 70.167  1.00 100.69 ? 912  LEU A CG    1 
ATOM   6982  C  CD1   . LEU A 1  912  ? 4.050   -56.987 70.754  1.00 100.42 ? 912  LEU A CD1   1 
ATOM   6983  C  CD2   . LEU A 1  912  ? 1.802   -57.753 69.944  1.00 100.92 ? 912  LEU A CD2   1 
ATOM   6984  N  N     . LEU A 1  913  ? 5.058   -61.340 67.304  1.00 100.85 ? 913  LEU A N     1 
ATOM   6985  C  CA    . LEU A 1  913  ? 6.107   -61.895 66.447  1.00 101.22 ? 913  LEU A CA    1 
ATOM   6986  C  C     . LEU A 1  913  ? 5.809   -63.331 65.984  1.00 101.46 ? 913  LEU A C     1 
ATOM   6987  O  O     . LEU A 1  913  ? 4.783   -63.913 66.354  1.00 101.59 ? 913  LEU A O     1 
ATOM   6988  C  CB    . LEU A 1  913  ? 7.469   -61.819 67.156  1.00 101.20 ? 913  LEU A CB    1 
ATOM   6989  C  CG    . LEU A 1  913  ? 8.734   -61.776 66.287  1.00 101.30 ? 913  LEU A CG    1 
ATOM   6990  C  CD1   . LEU A 1  913  ? 8.740   -60.528 65.431  1.00 101.78 ? 913  LEU A CD1   1 
ATOM   6991  C  CD2   . LEU A 1  913  ? 10.013  -61.856 67.110  1.00 101.20 ? 913  LEU A CD2   1 
ATOM   6992  N  N     . GLU A 1  914  ? 6.702   -63.878 65.157  1.00 101.60 ? 914  GLU A N     1 
ATOM   6993  C  CA    . GLU A 1  914  ? 6.651   -65.282 64.742  1.00 101.73 ? 914  GLU A CA    1 
ATOM   6994  C  C     . GLU A 1  914  ? 7.578   -66.130 65.630  1.00 101.73 ? 914  GLU A C     1 
ATOM   6995  O  O     . GLU A 1  914  ? 7.363   -67.334 65.822  1.00 101.70 ? 914  GLU A O     1 
ATOM   6996  C  CB    . GLU A 1  914  ? 7.025   -65.408 63.261  1.00 101.72 ? 914  GLU A CB    1 
ATOM   6997  C  CG    . GLU A 1  914  ? 6.241   -66.480 62.506  1.00 102.04 ? 914  GLU A CG    1 
ATOM   6998  C  CD    . GLU A 1  914  ? 5.769   -66.016 61.126  1.00 102.73 ? 914  GLU A CD    1 
ATOM   6999  O  OE1   . GLU A 1  914  ? 6.611   -65.560 60.316  1.00 103.07 ? 914  GLU A OE1   1 
ATOM   7000  O  OE2   . GLU A 1  914  ? 4.550   -66.113 60.846  1.00 102.65 ? 914  GLU A OE2   1 
ATOM   7001  N  N     . SER A 1  915  ? 8.606   -65.479 66.171  1.00 101.66 ? 915  SER A N     1 
ATOM   7002  C  CA    . SER A 1  915  ? 9.503   -66.084 67.148  1.00 101.52 ? 915  SER A CA    1 
ATOM   7003  C  C     . SER A 1  915  ? 8.983   -65.822 68.559  1.00 101.34 ? 915  SER A C     1 
ATOM   7004  O  O     . SER A 1  915  ? 9.457   -66.429 69.520  1.00 101.32 ? 915  SER A O     1 
ATOM   7005  C  CB    . SER A 1  915  ? 10.909  -65.488 67.025  1.00 101.58 ? 915  SER A CB    1 
ATOM   7006  O  OG    . SER A 1  915  ? 11.190  -65.061 65.704  1.00 102.05 ? 915  SER A OG    1 
ATOM   7007  N  N     . GLY A 1  916  ? 8.007   -64.914 68.659  1.00 101.13 ? 916  GLY A N     1 
ATOM   7008  C  CA    . GLY A 1  916  ? 7.461   -64.398 69.926  1.00 100.67 ? 916  GLY A CA    1 
ATOM   7009  C  C     . GLY A 1  916  ? 7.658   -65.261 71.155  1.00 100.27 ? 916  GLY A C     1 
ATOM   7010  O  O     . GLY A 1  916  ? 8.117   -64.785 72.200  1.00 100.17 ? 916  GLY A O     1 
ATOM   7011  N  N     . SER A 1  917  ? 7.312   -66.535 71.018  1.00 99.87  ? 917  SER A N     1 
ATOM   7012  C  CA    . SER A 1  917  ? 7.473   -67.498 72.094  1.00 99.64  ? 917  SER A CA    1 
ATOM   7013  C  C     . SER A 1  917  ? 8.817   -68.220 72.035  1.00 99.12  ? 917  SER A C     1 
ATOM   7014  O  O     . SER A 1  917  ? 9.449   -68.427 73.070  1.00 99.10  ? 917  SER A O     1 
ATOM   7015  C  CB    . SER A 1  917  ? 6.320   -68.509 72.094  1.00 99.86  ? 917  SER A CB    1 
ATOM   7016  O  OG    . SER A 1  917  ? 6.185   -69.141 70.829  1.00 100.66 ? 917  SER A OG    1 
ATOM   7017  N  N     . GLU A 1  918  ? 9.257   -68.592 70.836  1.00 98.54  ? 918  GLU A N     1 
ATOM   7018  C  CA    . GLU A 1  918  ? 10.500  -69.354 70.685  1.00 98.13  ? 918  GLU A CA    1 
ATOM   7019  C  C     . GLU A 1  918  ? 11.730  -68.493 70.987  1.00 97.42  ? 918  GLU A C     1 
ATOM   7020  O  O     . GLU A 1  918  ? 12.853  -68.828 70.615  1.00 97.25  ? 918  GLU A O     1 
ATOM   7021  C  CB    . GLU A 1  918  ? 10.574  -70.027 69.304  1.00 98.44  ? 918  GLU A CB    1 
ATOM   7022  C  CG    . GLU A 1  918  ? 11.059  -69.151 68.136  1.00 99.66  ? 918  GLU A CG    1 
ATOM   7023  C  CD    . GLU A 1  918  ? 12.467  -69.507 67.655  1.00 100.73 ? 918  GLU A CD    1 
ATOM   7024  O  OE1   . GLU A 1  918  ? 12.795  -70.718 67.589  1.00 100.88 ? 918  GLU A OE1   1 
ATOM   7025  O  OE2   . GLU A 1  918  ? 13.238  -68.572 67.330  1.00 101.07 ? 918  GLU A OE2   1 
ATOM   7026  N  N     . ILE A 1  919  ? 11.497  -67.389 71.687  1.00 96.76  ? 919  ILE A N     1 
ATOM   7027  C  CA    . ILE A 1  919  ? 12.559  -66.476 72.092  1.00 96.17  ? 919  ILE A CA    1 
ATOM   7028  C  C     . ILE A 1  919  ? 12.442  -66.108 73.582  1.00 95.45  ? 919  ILE A C     1 
ATOM   7029  O  O     . ILE A 1  919  ? 13.430  -65.699 74.190  1.00 95.32  ? 919  ILE A O     1 
ATOM   7030  C  CB    . ILE A 1  919  ? 12.610  -65.211 71.157  1.00 96.40  ? 919  ILE A CB    1 
ATOM   7031  C  CG1   . ILE A 1  919  ? 13.103  -65.575 69.740  1.00 96.77  ? 919  ILE A CG1   1 
ATOM   7032  C  CG2   . ILE A 1  919  ? 13.474  -64.105 71.736  1.00 96.42  ? 919  ILE A CG2   1 
ATOM   7033  C  CD1   . ILE A 1  919  ? 14.504  -66.238 69.648  1.00 97.01  ? 919  ILE A CD1   1 
ATOM   7034  N  N     . LEU A 1  920  ? 11.249  -66.272 74.164  1.00 94.67  ? 920  LEU A N     1 
ATOM   7035  C  CA    . LEU A 1  920  ? 11.043  -66.057 75.608  1.00 93.89  ? 920  LEU A CA    1 
ATOM   7036  C  C     . LEU A 1  920  ? 12.132  -66.800 76.343  1.00 93.11  ? 920  LEU A C     1 
ATOM   7037  O  O     . LEU A 1  920  ? 12.332  -67.992 76.121  1.00 93.01  ? 920  LEU A O     1 
ATOM   7038  C  CB    . LEU A 1  920  ? 9.683   -66.588 76.083  1.00 94.12  ? 920  LEU A CB    1 
ATOM   7039  C  CG    . LEU A 1  920  ? 8.912   -65.966 77.270  1.00 94.25  ? 920  LEU A CG    1 
ATOM   7040  C  CD1   . LEU A 1  920  ? 7.756   -66.890 77.666  1.00 94.68  ? 920  LEU A CD1   1 
ATOM   7041  C  CD2   . LEU A 1  920  ? 9.755   -65.636 78.496  1.00 93.48  ? 920  LEU A CD2   1 
ATOM   7042  N  N     . GLY A 1  921  ? 12.829  -66.084 77.216  1.00 92.33  ? 921  GLY A N     1 
ATOM   7043  C  CA    . GLY A 1  921  ? 14.062  -66.578 77.818  1.00 91.24  ? 921  GLY A CA    1 
ATOM   7044  C  C     . GLY A 1  921  ? 15.203  -66.023 76.995  1.00 90.40  ? 921  GLY A C     1 
ATOM   7045  O  O     . GLY A 1  921  ? 15.310  -64.803 76.833  1.00 90.53  ? 921  GLY A O     1 
ATOM   7046  N  N     . ASP A 1  922  ? 16.036  -66.921 76.467  1.00 89.41  ? 922  ASP A N     1 
ATOM   7047  C  CA    . ASP A 1  922  ? 17.122  -66.591 75.533  1.00 88.52  ? 922  ASP A CA    1 
ATOM   7048  C  C     . ASP A 1  922  ? 18.117  -65.574 76.095  1.00 87.99  ? 922  ASP A C     1 
ATOM   7049  O  O     . ASP A 1  922  ? 17.730  -64.624 76.781  1.00 88.13  ? 922  ASP A O     1 
ATOM   7050  C  CB    . ASP A 1  922  ? 16.556  -66.115 74.191  1.00 88.49  ? 922  ASP A CB    1 
ATOM   7051  C  CG    . ASP A 1  922  ? 17.541  -66.266 73.051  1.00 88.63  ? 922  ASP A CG    1 
ATOM   7052  O  OD1   . ASP A 1  922  ? 18.708  -65.836 73.204  1.00 88.67  ? 922  ASP A OD1   1 
ATOM   7053  O  OD2   . ASP A 1  922  ? 17.145  -66.810 71.992  1.00 88.75  ? 922  ASP A OD2   1 
ATOM   7054  N  N     . LEU A 1  923  ? 19.401  -65.759 75.800  1.00 87.11  ? 923  LEU A N     1 
ATOM   7055  C  CA    . LEU A 1  923  ? 20.428  -64.919 76.434  1.00 86.11  ? 923  LEU A CA    1 
ATOM   7056  C  C     . LEU A 1  923  ? 21.437  -64.236 75.511  1.00 85.35  ? 923  LEU A C     1 
ATOM   7057  O  O     . LEU A 1  923  ? 22.458  -63.725 75.974  1.00 85.25  ? 923  LEU A O     1 
ATOM   7058  C  CB    . LEU A 1  923  ? 21.141  -65.694 77.551  1.00 86.06  ? 923  LEU A CB    1 
ATOM   7059  C  CG    . LEU A 1  923  ? 20.422  -65.620 78.900  1.00 85.69  ? 923  LEU A CG    1 
ATOM   7060  C  CD1   . LEU A 1  923  ? 20.738  -66.842 79.737  1.00 85.29  ? 923  LEU A CD1   1 
ATOM   7061  C  CD2   . LEU A 1  923  ? 20.771  -64.330 79.634  1.00 85.56  ? 923  LEU A CD2   1 
ATOM   7062  N  N     . LYS A 1  924  ? 21.149  -64.206 74.218  1.00 84.26  ? 924  LYS A N     1 
ATOM   7063  C  CA    . LYS A 1  924  ? 21.964  -63.416 73.322  1.00 83.33  ? 924  LYS A CA    1 
ATOM   7064  C  C     . LYS A 1  924  ? 21.148  -62.265 72.748  1.00 82.80  ? 924  LYS A C     1 
ATOM   7065  O  O     . LYS A 1  924  ? 21.698  -61.256 72.299  1.00 83.01  ? 924  LYS A O     1 
ATOM   7066  C  CB    . LYS A 1  924  ? 22.612  -64.291 72.246  1.00 83.40  ? 924  LYS A CB    1 
ATOM   7067  C  CG    . LYS A 1  924  ? 23.913  -64.936 72.731  1.00 83.19  ? 924  LYS A CG    1 
ATOM   7068  C  CD    . LYS A 1  924  ? 24.647  -65.705 71.643  1.00 83.23  ? 924  LYS A CD    1 
ATOM   7069  C  CE    . LYS A 1  924  ? 24.428  -67.204 71.765  1.00 83.38  ? 924  LYS A CE    1 
ATOM   7070  N  NZ    . LYS A 1  924  ? 23.019  -67.604 71.488  1.00 83.88  ? 924  LYS A NZ    1 
ATOM   7071  N  N     . LEU A 1  925  ? 19.828  -62.406 72.803  1.00 81.84  ? 925  LEU A N     1 
ATOM   7072  C  CA    . LEU A 1  925  ? 18.928  -61.376 72.289  1.00 80.79  ? 925  LEU A CA    1 
ATOM   7073  C  C     . LEU A 1  925  ? 18.278  -60.589 73.425  1.00 79.88  ? 925  LEU A C     1 
ATOM   7074  O  O     . LEU A 1  925  ? 17.213  -60.001 73.263  1.00 79.95  ? 925  LEU A O     1 
ATOM   7075  C  CB    . LEU A 1  925  ? 17.895  -61.986 71.329  1.00 80.82  ? 925  LEU A CB    1 
ATOM   7076  C  CG    . LEU A 1  925  ? 18.529  -62.873 70.243  1.00 81.30  ? 925  LEU A CG    1 
ATOM   7077  C  CD1   . LEU A 1  925  ? 17.499  -63.715 69.494  1.00 82.25  ? 925  LEU A CD1   1 
ATOM   7078  C  CD2   . LEU A 1  925  ? 19.374  -62.065 69.260  1.00 81.91  ? 925  LEU A CD2   1 
ATOM   7079  N  N     . GLN A 1  926  ? 18.923  -60.623 74.583  1.00 78.56  ? 926  GLN A N     1 
ATOM   7080  C  CA    . GLN A 1  926  ? 18.697  -59.651 75.621  1.00 77.36  ? 926  GLN A CA    1 
ATOM   7081  C  C     . GLN A 1  926  ? 20.031  -58.969 75.825  1.00 77.37  ? 926  GLN A C     1 
ATOM   7082  O  O     . GLN A 1  926  ? 20.225  -58.259 76.808  1.00 77.46  ? 926  GLN A O     1 
ATOM   7083  C  CB    . GLN A 1  926  ? 18.240  -60.319 76.909  1.00 77.00  ? 926  GLN A CB    1 
ATOM   7084  C  CG    . GLN A 1  926  ? 16.746  -60.363 77.082  1.00 75.08  ? 926  GLN A CG    1 
ATOM   7085  C  CD    . GLN A 1  926  ? 16.150  -59.045 77.536  1.00 72.25  ? 926  GLN A CD    1 
ATOM   7086  O  OE1   . GLN A 1  926  ? 16.736  -58.306 78.326  1.00 70.95  ? 926  GLN A OE1   1 
ATOM   7087  N  NE2   . GLN A 1  926  ? 14.972  -58.754 77.041  1.00 71.11  ? 926  GLN A NE2   1 
ATOM   7088  N  N     . VAL A 1  927  ? 20.957  -59.219 74.892  1.00 77.12  ? 927  VAL A N     1 
ATOM   7089  C  CA    . VAL A 1  927  ? 22.298  -58.614 74.898  1.00 76.89  ? 927  VAL A CA    1 
ATOM   7090  C  C     . VAL A 1  927  ? 22.318  -57.504 73.869  1.00 76.82  ? 927  VAL A C     1 
ATOM   7091  O  O     . VAL A 1  927  ? 22.809  -56.401 74.138  1.00 76.99  ? 927  VAL A O     1 
ATOM   7092  C  CB    . VAL A 1  927  ? 23.411  -59.655 74.611  1.00 76.79  ? 927  VAL A CB    1 
ATOM   7093  C  CG1   . VAL A 1  927  ? 24.666  -59.007 74.031  1.00 76.38  ? 927  VAL A CG1   1 
ATOM   7094  C  CG2   . VAL A 1  927  ? 23.746  -60.408 75.877  1.00 77.17  ? 927  VAL A CG2   1 
ATOM   7095  N  N     . LEU A 1  928  ? 21.774  -57.807 72.691  1.00 76.49  ? 928  LEU A N     1 
ATOM   7096  C  CA    . LEU A 1  928  ? 21.488  -56.788 71.697  1.00 76.24  ? 928  LEU A CA    1 
ATOM   7097  C  C     . LEU A 1  928  ? 20.373  -55.903 72.241  1.00 76.15  ? 928  LEU A C     1 
ATOM   7098  O  O     . LEU A 1  928  ? 20.543  -54.708 72.395  1.00 75.94  ? 928  LEU A O     1 
ATOM   7099  C  CB    . LEU A 1  928  ? 21.081  -57.432 70.370  1.00 76.18  ? 928  LEU A CB    1 
ATOM   7100  C  CG    . LEU A 1  928  ? 22.169  -58.108 69.526  1.00 75.89  ? 928  LEU A CG    1 
ATOM   7101  C  CD1   . LEU A 1  928  ? 21.548  -59.071 68.527  1.00 74.87  ? 928  LEU A CD1   1 
ATOM   7102  C  CD2   . LEU A 1  928  ? 23.074  -57.089 68.813  1.00 75.80  ? 928  LEU A CD2   1 
ATOM   7103  N  N     . LEU A 1  929  ? 19.240  -56.520 72.549  1.00 76.36  ? 929  LEU A N     1 
ATOM   7104  C  CA    . LEU A 1  929  ? 18.128  -55.877 73.237  1.00 76.65  ? 929  LEU A CA    1 
ATOM   7105  C  C     . LEU A 1  929  ? 18.483  -55.024 74.463  1.00 77.29  ? 929  LEU A C     1 
ATOM   7106  O  O     . LEU A 1  929  ? 17.976  -53.911 74.599  1.00 77.43  ? 929  LEU A O     1 
ATOM   7107  C  CB    . LEU A 1  929  ? 17.125  -56.945 73.647  1.00 76.50  ? 929  LEU A CB    1 
ATOM   7108  C  CG    . LEU A 1  929  ? 15.758  -56.911 73.003  1.00 75.87  ? 929  LEU A CG    1 
ATOM   7109  C  CD1   . LEU A 1  929  ? 15.033  -55.791 73.664  1.00 76.04  ? 929  LEU A CD1   1 
ATOM   7110  C  CD2   . LEU A 1  929  ? 15.881  -56.683 71.524  1.00 75.66  ? 929  LEU A CD2   1 
ATOM   7111  N  N     . ASP A 1  930  ? 19.307  -55.557 75.367  1.00 78.05  ? 930  ASP A N     1 
ATOM   7112  C  CA    . ASP A 1  930  ? 19.843  -54.764 76.465  1.00 78.94  ? 930  ASP A CA    1 
ATOM   7113  C  C     . ASP A 1  930  ? 20.662  -53.650 75.848  1.00 79.28  ? 930  ASP A C     1 
ATOM   7114  O  O     . ASP A 1  930  ? 20.469  -52.485 76.181  1.00 79.72  ? 930  ASP A O     1 
ATOM   7115  C  CB    . ASP A 1  930  ? 20.717  -55.598 77.409  1.00 79.32  ? 930  ASP A CB    1 
ATOM   7116  C  CG    . ASP A 1  930  ? 20.027  -55.920 78.743  1.00 80.78  ? 930  ASP A CG    1 
ATOM   7117  O  OD1   . ASP A 1  930  ? 19.147  -55.130 79.171  1.00 82.65  ? 930  ASP A OD1   1 
ATOM   7118  O  OD2   . ASP A 1  930  ? 20.386  -56.954 79.373  1.00 81.22  ? 930  ASP A OD2   1 
ATOM   7119  N  N     . GLU A 1  931  ? 21.550  -54.012 74.922  1.00 79.56  ? 931  GLU A N     1 
ATOM   7120  C  CA    . GLU A 1  931  ? 22.361  -53.043 74.176  1.00 79.98  ? 931  GLU A CA    1 
ATOM   7121  C  C     . GLU A 1  931  ? 21.550  -51.832 73.662  1.00 79.53  ? 931  GLU A C     1 
ATOM   7122  O  O     . GLU A 1  931  ? 21.977  -50.683 73.804  1.00 79.55  ? 931  GLU A O     1 
ATOM   7123  C  CB    . GLU A 1  931  ? 23.078  -53.748 73.014  1.00 80.41  ? 931  GLU A CB    1 
ATOM   7124  C  CG    . GLU A 1  931  ? 23.820  -52.827 72.056  1.00 82.30  ? 931  GLU A CG    1 
ATOM   7125  C  CD    . GLU A 1  931  ? 24.936  -52.085 72.754  1.00 84.69  ? 931  GLU A CD    1 
ATOM   7126  O  OE1   . GLU A 1  931  ? 25.737  -52.751 73.468  1.00 85.24  ? 931  GLU A OE1   1 
ATOM   7127  O  OE2   . GLU A 1  931  ? 24.990  -50.840 72.599  1.00 85.30  ? 931  GLU A OE2   1 
ATOM   7128  N  N     . GLU A 1  932  ? 20.388  -52.110 73.074  1.00 79.04  ? 932  GLU A N     1 
ATOM   7129  C  CA    . GLU A 1  932  ? 19.469  -51.085 72.599  1.00 78.63  ? 932  GLU A CA    1 
ATOM   7130  C  C     . GLU A 1  932  ? 18.997  -50.178 73.725  1.00 78.29  ? 932  GLU A C     1 
ATOM   7131  O  O     . GLU A 1  932  ? 19.245  -48.976 73.688  1.00 78.65  ? 932  GLU A O     1 
ATOM   7132  C  CB    . GLU A 1  932  ? 18.258  -51.728 71.924  1.00 78.61  ? 932  GLU A CB    1 
ATOM   7133  C  CG    . GLU A 1  932  ? 17.166  -50.750 71.525  1.00 78.94  ? 932  GLU A CG    1 
ATOM   7134  C  CD    . GLU A 1  932  ? 15.913  -51.436 70.993  1.00 79.00  ? 932  GLU A CD    1 
ATOM   7135  O  OE1   . GLU A 1  932  ? 15.721  -51.458 69.757  1.00 79.80  ? 932  GLU A OE1   1 
ATOM   7136  O  OE2   . GLU A 1  932  ? 15.118  -51.941 71.813  1.00 78.98  ? 932  GLU A OE2   1 
ATOM   7137  N  N     . TYR A 1  933  ? 18.321  -50.748 74.719  1.00 77.66  ? 933  TYR A N     1 
ATOM   7138  C  CA    . TYR A 1  933  ? 17.707  -49.951 75.773  1.00 77.09  ? 933  TYR A CA    1 
ATOM   7139  C  C     . TYR A 1  933  ? 18.714  -49.065 76.472  1.00 76.82  ? 933  TYR A C     1 
ATOM   7140  O  O     . TYR A 1  933  ? 18.370  -47.970 76.891  1.00 76.53  ? 933  TYR A O     1 
ATOM   7141  C  CB    . TYR A 1  933  ? 17.017  -50.843 76.785  1.00 77.15  ? 933  TYR A CB    1 
ATOM   7142  C  CG    . TYR A 1  933  ? 16.102  -50.120 77.749  1.00 77.24  ? 933  TYR A CG    1 
ATOM   7143  C  CD1   . TYR A 1  933  ? 14.762  -49.899 77.438  1.00 77.52  ? 933  TYR A CD1   1 
ATOM   7144  C  CD2   . TYR A 1  933  ? 16.562  -49.695 78.991  1.00 77.49  ? 933  TYR A CD2   1 
ATOM   7145  C  CE1   . TYR A 1  933  ? 13.910  -49.253 78.339  1.00 77.66  ? 933  TYR A CE1   1 
ATOM   7146  C  CE2   . TYR A 1  933  ? 15.720  -49.045 79.898  1.00 77.68  ? 933  TYR A CE2   1 
ATOM   7147  C  CZ    . TYR A 1  933  ? 14.397  -48.828 79.566  1.00 77.58  ? 933  TYR A CZ    1 
ATOM   7148  O  OH    . TYR A 1  933  ? 13.562  -48.190 80.457  1.00 77.64  ? 933  TYR A OH    1 
ATOM   7149  N  N     . LYS A 1  934  ? 19.956  -49.534 76.588  1.00 76.90  ? 934  LYS A N     1 
ATOM   7150  C  CA    . LYS A 1  934  ? 21.018  -48.751 77.230  1.00 77.21  ? 934  LYS A CA    1 
ATOM   7151  C  C     . LYS A 1  934  ? 21.198  -47.480 76.443  1.00 77.14  ? 934  LYS A C     1 
ATOM   7152  O  O     . LYS A 1  934  ? 21.010  -46.382 76.965  1.00 77.23  ? 934  LYS A O     1 
ATOM   7153  C  CB    . LYS A 1  934  ? 22.350  -49.512 77.291  1.00 77.08  ? 934  LYS A CB    1 
ATOM   7154  C  CG    . LYS A 1  934  ? 23.450  -48.765 78.065  1.00 77.41  ? 934  LYS A CG    1 
ATOM   7155  C  CD    . LYS A 1  934  ? 24.602  -49.679 78.505  1.00 77.82  ? 934  LYS A CD    1 
ATOM   7156  C  CE    . LYS A 1  934  ? 24.250  -50.526 79.737  1.00 79.10  ? 934  LYS A CE    1 
ATOM   7157  N  NZ    . LYS A 1  934  ? 23.243  -51.622 79.475  1.00 79.58  ? 934  LYS A NZ    1 
ATOM   7158  N  N     . GLN A 1  935  ? 21.544  -47.670 75.173  1.00 77.10  ? 935  GLN A N     1 
ATOM   7159  C  CA    . GLN A 1  935  ? 21.739  -46.610 74.198  1.00 77.01  ? 935  GLN A CA    1 
ATOM   7160  C  C     . GLN A 1  935  ? 20.595  -45.591 74.134  1.00 77.24  ? 935  GLN A C     1 
ATOM   7161  O  O     . GLN A 1  935  ? 20.846  -44.405 73.920  1.00 77.31  ? 935  GLN A O     1 
ATOM   7162  C  CB    . GLN A 1  935  ? 21.963  -47.251 72.834  1.00 76.84  ? 935  GLN A CB    1 
ATOM   7163  C  CG    . GLN A 1  935  ? 22.119  -46.289 71.702  1.00 76.52  ? 935  GLN A CG    1 
ATOM   7164  C  CD    . GLN A 1  935  ? 23.287  -45.364 71.883  1.00 75.85  ? 935  GLN A CD    1 
ATOM   7165  O  OE1   . GLN A 1  935  ? 24.409  -45.795 72.172  1.00 75.24  ? 935  GLN A OE1   1 
ATOM   7166  N  NE2   . GLN A 1  935  ? 23.038  -44.077 71.696  1.00 75.74  ? 935  GLN A NE2   1 
ATOM   7167  N  N     . LEU A 1  936  ? 19.354  -46.053 74.325  1.00 77.48  ? 936  LEU A N     1 
ATOM   7168  C  CA    . LEU A 1  936  ? 18.163  -45.172 74.367  1.00 77.63  ? 936  LEU A CA    1 
ATOM   7169  C  C     . LEU A 1  936  ? 17.941  -44.485 75.724  1.00 77.85  ? 936  LEU A C     1 
ATOM   7170  O  O     . LEU A 1  936  ? 16.925  -43.806 75.924  1.00 77.68  ? 936  LEU A O     1 
ATOM   7171  C  CB    . LEU A 1  936  ? 16.887  -45.936 74.006  1.00 77.38  ? 936  LEU A CB    1 
ATOM   7172  C  CG    . LEU A 1  936  ? 16.824  -46.852 72.795  1.00 77.43  ? 936  LEU A CG    1 
ATOM   7173  C  CD1   . LEU A 1  936  ? 15.496  -47.566 72.835  1.00 77.62  ? 936  LEU A CD1   1 
ATOM   7174  C  CD2   . LEU A 1  936  ? 16.991  -46.087 71.491  1.00 77.73  ? 936  LEU A CD2   1 
ATOM   7175  N  N     . VAL A 1  937  ? 18.863  -44.711 76.657  1.00 78.12  ? 937  VAL A N     1 
ATOM   7176  C  CA    . VAL A 1  937  ? 18.885  -44.008 77.929  1.00 78.47  ? 937  VAL A CA    1 
ATOM   7177  C  C     . VAL A 1  937  ? 20.087  -43.080 77.887  1.00 78.70  ? 937  VAL A C     1 
ATOM   7178  O  O     . VAL A 1  937  ? 20.024  -41.941 78.372  1.00 78.97  ? 937  VAL A O     1 
ATOM   7179  C  CB    . VAL A 1  937  ? 18.945  -44.986 79.135  1.00 78.48  ? 937  VAL A CB    1 
ATOM   7180  C  CG1   . VAL A 1  937  ? 19.788  -44.413 80.294  1.00 79.01  ? 937  VAL A CG1   1 
ATOM   7181  C  CG2   . VAL A 1  937  ? 17.531  -45.346 79.604  1.00 78.25  ? 937  VAL A CG2   1 
ATOM   7182  N  N     . LYS A 1  938  ? 21.173  -43.570 77.287  1.00 78.85  ? 938  LYS A N     1 
ATOM   7183  C  CA    . LYS A 1  938  ? 22.330  -42.738 76.994  1.00 78.89  ? 938  LYS A CA    1 
ATOM   7184  C  C     . LYS A 1  938  ? 21.812  -41.549 76.212  1.00 78.69  ? 938  LYS A C     1 
ATOM   7185  O  O     . LYS A 1  938  ? 22.347  -40.444 76.319  1.00 78.96  ? 938  LYS A O     1 
ATOM   7186  C  CB    . LYS A 1  938  ? 23.374  -43.497 76.173  1.00 78.96  ? 938  LYS A CB    1 
ATOM   7187  C  CG    . LYS A 1  938  ? 24.750  -42.841 76.157  1.00 79.66  ? 938  LYS A CG    1 
ATOM   7188  C  CD    . LYS A 1  938  ? 25.832  -43.872 75.851  1.00 81.92  ? 938  LYS A CD    1 
ATOM   7189  C  CE    . LYS A 1  938  ? 27.186  -43.508 76.478  1.00 82.59  ? 938  LYS A CE    1 
ATOM   7190  N  NZ    . LYS A 1  938  ? 28.067  -44.717 76.627  1.00 82.88  ? 938  LYS A NZ    1 
ATOM   7191  N  N     . ASP A 1  939  ? 20.742  -41.784 75.458  1.00 78.17  ? 939  ASP A N     1 
ATOM   7192  C  CA    . ASP A 1  939  ? 20.123  -40.744 74.664  1.00 77.93  ? 939  ASP A CA    1 
ATOM   7193  C  C     . ASP A 1  939  ? 19.191  -39.848 75.473  1.00 77.32  ? 939  ASP A C     1 
ATOM   7194  O  O     . ASP A 1  939  ? 19.373  -38.633 75.508  1.00 77.23  ? 939  ASP A O     1 
ATOM   7195  C  CB    . ASP A 1  939  ? 19.393  -41.348 73.464  1.00 78.42  ? 939  ASP A CB    1 
ATOM   7196  C  CG    . ASP A 1  939  ? 20.298  -41.500 72.241  1.00 79.86  ? 939  ASP A CG    1 
ATOM   7197  O  OD1   . ASP A 1  939  ? 21.465  -41.024 72.293  1.00 80.67  ? 939  ASP A OD1   1 
ATOM   7198  O  OD2   . ASP A 1  939  ? 19.834  -42.088 71.227  1.00 81.37  ? 939  ASP A OD2   1 
ATOM   7199  N  N     . ARG A 1  940  ? 18.199  -40.439 76.129  1.00 76.71  ? 940  ARG A N     1 
ATOM   7200  C  CA    . ARG A 1  940  ? 17.204  -39.644 76.831  1.00 75.92  ? 940  ARG A CA    1 
ATOM   7201  C  C     . ARG A 1  940  ? 17.863  -38.611 77.703  1.00 75.92  ? 940  ARG A C     1 
ATOM   7202  O  O     . ARG A 1  940  ? 17.345  -37.513 77.835  1.00 76.07  ? 940  ARG A O     1 
ATOM   7203  C  CB    . ARG A 1  940  ? 16.282  -40.492 77.683  1.00 75.74  ? 940  ARG A CB    1 
ATOM   7204  C  CG    . ARG A 1  940  ? 14.948  -39.837 77.891  1.00 74.70  ? 940  ARG A CG    1 
ATOM   7205  C  CD    . ARG A 1  940  ? 14.342  -40.195 79.227  1.00 74.35  ? 940  ARG A CD    1 
ATOM   7206  N  NE    . ARG A 1  940  ? 12.898  -39.960 79.233  1.00 73.13  ? 940  ARG A NE    1 
ATOM   7207  C  CZ    . ARG A 1  940  ? 12.135  -39.952 80.324  1.00 71.94  ? 940  ARG A CZ    1 
ATOM   7208  N  NH1   . ARG A 1  940  ? 12.670  -40.146 81.526  1.00 71.49  ? 940  ARG A NH1   1 
ATOM   7209  N  NH2   . ARG A 1  940  ? 10.835  -39.731 80.211  1.00 70.40  ? 940  ARG A NH2   1 
ATOM   7210  N  N     . LYS A 1  941  ? 19.003  -38.931 78.301  1.00 75.84  ? 941  LYS A N     1 
ATOM   7211  C  CA    . LYS A 1  941  ? 19.657  -37.877 79.046  1.00 76.02  ? 941  LYS A CA    1 
ATOM   7212  C  C     . LYS A 1  941  ? 20.665  -37.054 78.249  1.00 75.67  ? 941  LYS A C     1 
ATOM   7213  O  O     . LYS A 1  941  ? 20.904  -35.902 78.600  1.00 75.99  ? 941  LYS A O     1 
ATOM   7214  C  CB    . LYS A 1  941  ? 20.161  -38.303 80.432  1.00 76.16  ? 941  LYS A CB    1 
ATOM   7215  C  CG    . LYS A 1  941  ? 19.747  -37.257 81.513  1.00 76.42  ? 941  LYS A CG    1 
ATOM   7216  C  CD    . LYS A 1  941  ? 20.497  -37.394 82.835  1.00 76.71  ? 941  LYS A CD    1 
ATOM   7217  C  CE    . LYS A 1  941  ? 19.868  -38.445 83.747  1.00 77.79  ? 941  LYS A CE    1 
ATOM   7218  N  NZ    . LYS A 1  941  ? 20.532  -38.511 85.083  1.00 77.93  ? 941  LYS A NZ    1 
ATOM   7219  N  N     . PHE A 1  942  ? 21.213  -37.585 77.160  1.00 75.19  ? 942  PHE A N     1 
ATOM   7220  C  CA    . PHE A 1  942  ? 21.984  -36.714 76.259  1.00 74.86  ? 942  PHE A CA    1 
ATOM   7221  C  C     . PHE A 1  942  ? 21.131  -35.590 75.692  1.00 74.69  ? 942  PHE A C     1 
ATOM   7222  O  O     . PHE A 1  942  ? 21.622  -34.500 75.447  1.00 74.40  ? 942  PHE A O     1 
ATOM   7223  C  CB    . PHE A 1  942  ? 22.613  -37.467 75.087  1.00 74.79  ? 942  PHE A CB    1 
ATOM   7224  C  CG    . PHE A 1  942  ? 23.082  -36.558 73.974  1.00 74.27  ? 942  PHE A CG    1 
ATOM   7225  C  CD1   . PHE A 1  942  ? 24.416  -36.186 73.880  1.00 74.82  ? 942  PHE A CD1   1 
ATOM   7226  C  CD2   . PHE A 1  942  ? 22.189  -36.058 73.042  1.00 72.48  ? 942  PHE A CD2   1 
ATOM   7227  C  CE1   . PHE A 1  942  ? 24.851  -35.337 72.865  1.00 74.01  ? 942  PHE A CE1   1 
ATOM   7228  C  CE2   . PHE A 1  942  ? 22.620  -35.222 72.041  1.00 72.56  ? 942  PHE A CE2   1 
ATOM   7229  C  CZ    . PHE A 1  942  ? 23.951  -34.861 71.949  1.00 73.14  ? 942  PHE A CZ    1 
ATOM   7230  N  N     . LEU A 1  943  ? 19.863  -35.879 75.443  1.00 74.99  ? 943  LEU A N     1 
ATOM   7231  C  CA    . LEU A 1  943  ? 18.954  -34.866 74.933  1.00 75.38  ? 943  LEU A CA    1 
ATOM   7232  C  C     . LEU A 1  943  ? 18.510  -33.927 76.051  1.00 75.94  ? 943  LEU A C     1 
ATOM   7233  O  O     . LEU A 1  943  ? 18.659  -32.710 75.929  1.00 76.34  ? 943  LEU A O     1 
ATOM   7234  C  CB    . LEU A 1  943  ? 17.745  -35.487 74.222  1.00 74.97  ? 943  LEU A CB    1 
ATOM   7235  C  CG    . LEU A 1  943  ? 17.955  -36.274 72.935  1.00 73.99  ? 943  LEU A CG    1 
ATOM   7236  C  CD1   . LEU A 1  943  ? 16.631  -36.715 72.371  1.00 72.83  ? 943  LEU A CD1   1 
ATOM   7237  C  CD2   . LEU A 1  943  ? 18.670  -35.427 71.935  1.00 73.88  ? 943  LEU A CD2   1 
ATOM   7238  N  N     . ARG A 1  944  ? 17.986  -34.473 77.145  1.00 76.29  ? 944  ARG A N     1 
ATOM   7239  C  CA    . ARG A 1  944  ? 17.546  -33.618 78.234  1.00 76.80  ? 944  ARG A CA    1 
ATOM   7240  C  C     . ARG A 1  944  ? 18.686  -32.659 78.622  1.00 77.51  ? 944  ARG A C     1 
ATOM   7241  O  O     . ARG A 1  944  ? 18.449  -31.552 79.113  1.00 77.69  ? 944  ARG A O     1 
ATOM   7242  C  CB    . ARG A 1  944  ? 17.022  -34.443 79.410  1.00 76.65  ? 944  ARG A CB    1 
ATOM   7243  C  CG    . ARG A 1  944  ? 15.619  -35.021 79.190  1.00 75.97  ? 944  ARG A CG    1 
ATOM   7244  C  CD    . ARG A 1  944  ? 14.948  -35.403 80.507  1.00 75.66  ? 944  ARG A CD    1 
ATOM   7245  N  NE    . ARG A 1  944  ? 13.689  -36.133 80.331  1.00 75.76  ? 944  ARG A NE    1 
ATOM   7246  C  CZ    . ARG A 1  944  ? 12.833  -36.436 81.315  1.00 76.44  ? 944  ARG A CZ    1 
ATOM   7247  N  NH1   . ARG A 1  944  ? 13.069  -36.078 82.569  1.00 77.09  ? 944  ARG A NH1   1 
ATOM   7248  N  NH2   . ARG A 1  944  ? 11.721  -37.103 81.051  1.00 76.85  ? 944  ARG A NH2   1 
ATOM   7249  N  N     . GLU A 1  945  ? 19.916  -33.078 78.339  1.00 78.24  ? 945  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  945  ? 21.085  -32.221 78.465  1.00 79.22  ? 945  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  945  ? 21.034  -31.062 77.474  1.00 79.31  ? 945  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  945  ? 21.127  -29.908 77.880  1.00 79.66  ? 945  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  945  ? 22.360  -33.038 78.246  1.00 79.55  ? 945  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  945  ? 23.662  -32.315 78.576  1.00 82.11  ? 945  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  945  ? 24.816  -33.278 78.880  1.00 86.23  ? 945  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  945  ? 25.906  -33.099 78.285  1.00 88.63  ? 945  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  945  ? 24.640  -34.210 79.711  1.00 87.45  ? 945  GLU A OE2   1 
ATOM   7258  N  N     . VAL A 1  946  ? 20.890  -31.375 76.184  1.00 79.47  ? 946  VAL A N     1 
ATOM   7259  C  CA    . VAL A 1  946  ? 20.949  -30.383 75.105  1.00 79.57  ? 946  VAL A CA    1 
ATOM   7260  C  C     . VAL A 1  946  ? 19.704  -29.512 75.056  1.00 80.25  ? 946  VAL A C     1 
ATOM   7261  O  O     . VAL A 1  946  ? 19.803  -28.290 74.995  1.00 80.70  ? 946  VAL A O     1 
ATOM   7262  C  CB    . VAL A 1  946  ? 21.183  -31.040 73.729  1.00 79.18  ? 946  VAL A CB    1 
ATOM   7263  C  CG1   . VAL A 1  946  ? 20.888  -30.089 72.617  1.00 79.00  ? 946  VAL A CG1   1 
ATOM   7264  C  CG2   . VAL A 1  946  ? 22.602  -31.459 73.607  1.00 79.39  ? 946  VAL A CG2   1 
ATOM   7265  N  N     . PHE A 1  947  ? 18.531  -30.125 75.092  1.00 80.94  ? 947  PHE A N     1 
ATOM   7266  C  CA    . PHE A 1  947  ? 17.301  -29.351 75.005  1.00 81.74  ? 947  PHE A CA    1 
ATOM   7267  C  C     . PHE A 1  947  ? 16.636  -29.175 76.361  1.00 82.30  ? 947  PHE A C     1 
ATOM   7268  O  O     . PHE A 1  947  ? 15.481  -29.569 76.541  1.00 82.51  ? 947  PHE A O     1 
ATOM   7269  C  CB    . PHE A 1  947  ? 16.350  -29.978 73.989  1.00 81.78  ? 947  PHE A CB    1 
ATOM   7270  C  CG    . PHE A 1  947  ? 16.895  -29.995 72.585  1.00 82.34  ? 947  PHE A CG    1 
ATOM   7271  C  CD1   . PHE A 1  947  ? 17.708  -31.027 72.148  1.00 82.88  ? 947  PHE A CD1   1 
ATOM   7272  C  CD2   . PHE A 1  947  ? 16.604  -28.970 71.702  1.00 82.52  ? 947  PHE A CD2   1 
ATOM   7273  C  CE1   . PHE A 1  947  ? 18.205  -31.034 70.848  1.00 82.85  ? 947  PHE A CE1   1 
ATOM   7274  C  CE2   . PHE A 1  947  ? 17.101  -28.974 70.410  1.00 82.08  ? 947  PHE A CE2   1 
ATOM   7275  C  CZ    . PHE A 1  947  ? 17.894  -30.005 69.984  1.00 82.25  ? 947  PHE A CZ    1 
ATOM   7276  N  N     . VAL A 1  948  ? 17.384  -28.566 77.291  1.00 82.89  ? 948  VAL A N     1 
ATOM   7277  C  CA    . VAL A 1  948  ? 16.972  -28.287 78.681  1.00 83.49  ? 948  VAL A CA    1 
ATOM   7278  C  C     . VAL A 1  948  ? 15.511  -27.855 78.825  1.00 84.24  ? 948  VAL A C     1 
ATOM   7279  O  O     . VAL A 1  948  ? 14.880  -28.122 79.858  1.00 84.13  ? 948  VAL A O     1 
ATOM   7280  C  CB    . VAL A 1  948  ? 17.834  -27.162 79.291  1.00 83.33  ? 948  VAL A CB    1 
ATOM   7281  C  CG1   . VAL A 1  948  ? 17.695  -27.128 80.811  1.00 83.43  ? 948  VAL A CG1   1 
ATOM   7282  C  CG2   . VAL A 1  948  ? 19.281  -27.321 78.896  1.00 83.43  ? 948  VAL A CG2   1 
ATOM   7283  N  N     . ASP A 1  949  ? 15.005  -27.180 77.784  1.00 85.12  ? 949  ASP A N     1 
ATOM   7284  C  CA    . ASP A 1  949  ? 13.620  -26.682 77.685  1.00 85.90  ? 949  ASP A CA    1 
ATOM   7285  C  C     . ASP A 1  949  ? 12.561  -27.715 78.086  1.00 85.98  ? 949  ASP A C     1 
ATOM   7286  O  O     . ASP A 1  949  ? 11.545  -27.374 78.694  1.00 86.16  ? 949  ASP A O     1 
ATOM   7287  C  CB    . ASP A 1  949  ? 13.303  -26.216 76.248  1.00 86.15  ? 949  ASP A CB    1 
ATOM   7288  C  CG    . ASP A 1  949  ? 14.395  -25.338 75.637  1.00 87.74  ? 949  ASP A CG    1 
ATOM   7289  O  OD1   . ASP A 1  949  ? 15.598  -25.645 75.827  1.00 89.26  ? 949  ASP A OD1   1 
ATOM   7290  O  OD2   . ASP A 1  949  ? 14.040  -24.354 74.935  1.00 89.35  ? 949  ASP A OD2   1 
ATOM   7291  N  N     . GLY A 1  950  ? 12.814  -28.975 77.737  1.00 86.07  ? 950  GLY A N     1 
ATOM   7292  C  CA    . GLY A 1  950  ? 11.792  -30.008 77.757  1.00 86.09  ? 950  GLY A CA    1 
ATOM   7293  C  C     . GLY A 1  950  ? 11.115  -30.055 76.397  1.00 86.27  ? 950  GLY A C     1 
ATOM   7294  O  O     . GLY A 1  950  ? 10.201  -30.848 76.185  1.00 86.36  ? 950  GLY A O     1 
ATOM   7295  N  N     . GLU A 1  951  ? 11.574  -29.212 75.470  1.00 86.36  ? 951  GLU A N     1 
ATOM   7296  C  CA    . GLU A 1  951  ? 10.959  -29.110 74.146  1.00 86.40  ? 951  GLU A CA    1 
ATOM   7297  C  C     . GLU A 1  951  ? 11.432  -30.204 73.211  1.00 85.93  ? 951  GLU A C     1 
ATOM   7298  O  O     . GLU A 1  951  ? 12.627  -30.353 72.935  1.00 85.61  ? 951  GLU A O     1 
ATOM   7299  C  CB    . GLU A 1  951  ? 11.168  -27.722 73.516  1.00 86.87  ? 951  GLU A CB    1 
ATOM   7300  C  CG    . GLU A 1  951  ? 10.248  -27.404 72.299  1.00 88.22  ? 951  GLU A CG    1 
ATOM   7301  C  CD    . GLU A 1  951  ? 8.776   -27.109 72.670  1.00 89.50  ? 951  GLU A CD    1 
ATOM   7302  O  OE1   . GLU A 1  951  ? 8.243   -26.067 72.214  1.00 89.80  ? 951  GLU A OE1   1 
ATOM   7303  O  OE2   . GLU A 1  951  ? 8.150   -27.916 73.401  1.00 89.65  ? 951  GLU A OE2   1 
ATOM   7304  N  N     . ALA A 1  952  ? 10.453  -30.955 72.727  1.00 85.71  ? 952  ALA A N     1 
ATOM   7305  C  CA    . ALA A 1  952  ? 10.694  -32.119 71.902  1.00 85.59  ? 952  ALA A CA    1 
ATOM   7306  C  C     . ALA A 1  952  ? 10.850  -31.707 70.456  1.00 85.29  ? 952  ALA A C     1 
ATOM   7307  O  O     . ALA A 1  952  ? 11.770  -32.143 69.768  1.00 85.57  ? 952  ALA A O     1 
ATOM   7308  C  CB    . ALA A 1  952  ? 9.538   -33.106 72.042  1.00 85.64  ? 952  ALA A CB    1 
ATOM   7309  N  N     . ASN A 1  953  ? 9.944   -30.855 70.003  1.00 84.61  ? 953  ASN A N     1 
ATOM   7310  C  CA    . ASN A 1  953  ? 9.780   -30.614 68.586  1.00 84.04  ? 953  ASN A CA    1 
ATOM   7311  C  C     . ASN A 1  953  ? 10.957  -29.819 68.039  1.00 83.43  ? 953  ASN A C     1 
ATOM   7312  O  O     . ASN A 1  953  ? 11.179  -28.693 68.457  1.00 83.54  ? 953  ASN A O     1 
ATOM   7313  C  CB    . ASN A 1  953  ? 8.441   -29.904 68.356  1.00 84.22  ? 953  ASN A CB    1 
ATOM   7314  C  CG    . ASN A 1  953  ? 7.379   -30.317 69.384  1.00 84.12  ? 953  ASN A CG    1 
ATOM   7315  O  OD1   . ASN A 1  953  ? 6.807   -31.412 69.318  1.00 83.40  ? 953  ASN A OD1   1 
ATOM   7316  N  ND2   . ASN A 1  953  ? 7.128   -29.438 70.346  1.00 84.13  ? 953  ASN A ND2   1 
ATOM   7317  N  N     . TRP A 1  954  ? 11.724  -30.424 67.133  1.00 82.73  ? 954  TRP A N     1 
ATOM   7318  C  CA    . TRP A 1  954  ? 12.918  -29.788 66.569  1.00 82.35  ? 954  TRP A CA    1 
ATOM   7319  C  C     . TRP A 1  954  ? 13.219  -30.197 65.125  1.00 82.03  ? 954  TRP A C     1 
ATOM   7320  O  O     . TRP A 1  954  ? 13.273  -31.386 64.813  1.00 82.04  ? 954  TRP A O     1 
ATOM   7321  C  CB    . TRP A 1  954  ? 14.125  -30.080 67.446  1.00 82.54  ? 954  TRP A CB    1 
ATOM   7322  C  CG    . TRP A 1  954  ? 14.078  -29.367 68.756  1.00 83.03  ? 954  TRP A CG    1 
ATOM   7323  C  CD1   . TRP A 1  954  ? 13.743  -29.896 69.975  1.00 82.91  ? 954  TRP A CD1   1 
ATOM   7324  C  CD2   . TRP A 1  954  ? 14.368  -27.981 68.983  1.00 83.44  ? 954  TRP A CD2   1 
ATOM   7325  N  NE1   . TRP A 1  954  ? 13.810  -28.927 70.944  1.00 83.12  ? 954  TRP A NE1   1 
ATOM   7326  C  CE2   . TRP A 1  954  ? 14.190  -27.740 70.366  1.00 83.53  ? 954  TRP A CE2   1 
ATOM   7327  C  CE3   . TRP A 1  954  ? 14.762  -26.917 68.150  1.00 82.93  ? 954  TRP A CE3   1 
ATOM   7328  C  CZ2   . TRP A 1  954  ? 14.400  -26.474 70.940  1.00 83.60  ? 954  TRP A CZ2   1 
ATOM   7329  C  CZ3   . TRP A 1  954  ? 14.959  -25.668 68.712  1.00 82.92  ? 954  TRP A CZ3   1 
ATOM   7330  C  CH2   . TRP A 1  954  ? 14.781  -25.455 70.099  1.00 83.51  ? 954  TRP A CH2   1 
ATOM   7331  N  N     . PRO A 1  955  ? 13.472  -29.212 64.248  1.00 81.66  ? 955  PRO A N     1 
ATOM   7332  C  CA    . PRO A 1  955  ? 13.582  -29.445 62.815  1.00 81.40  ? 955  PRO A CA    1 
ATOM   7333  C  C     . PRO A 1  955  ? 14.617  -30.509 62.487  1.00 81.21  ? 955  PRO A C     1 
ATOM   7334  O  O     . PRO A 1  955  ? 15.757  -30.404 62.929  1.00 81.33  ? 955  PRO A O     1 
ATOM   7335  C  CB    . PRO A 1  955  ? 14.059  -28.088 62.271  1.00 81.35  ? 955  PRO A CB    1 
ATOM   7336  C  CG    . PRO A 1  955  ? 14.608  -27.370 63.432  1.00 81.84  ? 955  PRO A CG    1 
ATOM   7337  C  CD    . PRO A 1  955  ? 13.743  -27.808 64.578  1.00 81.85  ? 955  PRO A CD    1 
ATOM   7338  N  N     . LEU A 1  956  ? 14.218  -31.523 61.718  1.00 81.02  ? 956  LEU A N     1 
ATOM   7339  C  CA    . LEU A 1  956  ? 15.141  -32.571 61.261  1.00 80.54  ? 956  LEU A CA    1 
ATOM   7340  C  C     . LEU A 1  956  ? 14.853  -33.135 59.869  1.00 80.26  ? 956  LEU A C     1 
ATOM   7341  O  O     . LEU A 1  956  ? 13.689  -33.276 59.506  1.00 80.38  ? 956  LEU A O     1 
ATOM   7342  C  CB    . LEU A 1  956  ? 15.157  -33.694 62.265  1.00 80.38  ? 956  LEU A CB    1 
ATOM   7343  C  CG    . LEU A 1  956  ? 16.151  -33.236 63.307  1.00 80.83  ? 956  LEU A CG    1 
ATOM   7344  C  CD1   . LEU A 1  956  ? 15.660  -33.636 64.676  1.00 82.40  ? 956  LEU A CD1   1 
ATOM   7345  C  CD2   . LEU A 1  956  ? 17.563  -33.741 62.985  1.00 81.26  ? 956  LEU A CD2   1 
ATOM   7346  N  N     . PRO A 1  957  ? 15.917  -33.446 59.081  1.00 79.84  ? 957  PRO A N     1 
ATOM   7347  C  CA    . PRO A 1  957  ? 15.769  -34.131 57.789  1.00 79.43  ? 957  PRO A CA    1 
ATOM   7348  C  C     . PRO A 1  957  ? 14.805  -35.311 57.853  1.00 79.26  ? 957  PRO A C     1 
ATOM   7349  O  O     . PRO A 1  957  ? 14.555  -35.848 58.932  1.00 79.08  ? 957  PRO A O     1 
ATOM   7350  C  CB    . PRO A 1  957  ? 17.177  -34.660 57.494  1.00 79.07  ? 957  PRO A CB    1 
ATOM   7351  C  CG    . PRO A 1  957  ? 18.090  -33.864 58.310  1.00 79.46  ? 957  PRO A CG    1 
ATOM   7352  C  CD    . PRO A 1  957  ? 17.328  -33.114 59.362  1.00 79.85  ? 957  PRO A CD    1 
ATOM   7353  N  N     . VAL A 1  958  ? 14.272  -35.694 56.694  1.00 79.34  ? 958  VAL A N     1 
ATOM   7354  C  CA    . VAL A 1  958  ? 13.505  -36.930 56.520  1.00 79.50  ? 958  VAL A CA    1 
ATOM   7355  C  C     . VAL A 1  958  ? 12.395  -37.140 57.533  1.00 79.65  ? 958  VAL A C     1 
ATOM   7356  O  O     . VAL A 1  958  ? 12.595  -37.862 58.512  1.00 79.81  ? 958  VAL A O     1 
ATOM   7357  C  CB    . VAL A 1  958  ? 14.385  -38.204 56.650  1.00 79.40  ? 958  VAL A CB    1 
ATOM   7358  C  CG1   . VAL A 1  958  ? 13.832  -39.286 55.760  1.00 79.80  ? 958  VAL A CG1   1 
ATOM   7359  C  CG2   . VAL A 1  958  ? 15.849  -37.939 56.334  1.00 79.65  ? 958  VAL A CG2   1 
ATOM   7360  N  N     . ASN A 1  959  ? 11.226  -36.552 57.307  1.00 79.86  ? 959  ASN A N     1 
ATOM   7361  C  CA    . ASN A 1  959  ? 10.078  -36.898 58.134  1.00 80.19  ? 959  ASN A CA    1 
ATOM   7362  C  C     . ASN A 1  959  ? 9.996   -38.424 58.196  1.00 80.23  ? 959  ASN A C     1 
ATOM   7363  O  O     . ASN A 1  959  ? 9.857   -39.079 57.160  1.00 80.16  ? 959  ASN A O     1 
ATOM   7364  C  CB    . ASN A 1  959  ? 8.777   -36.295 57.575  1.00 80.35  ? 959  ASN A CB    1 
ATOM   7365  C  CG    . ASN A 1  959  ? 7.613   -36.283 58.604  1.00 81.06  ? 959  ASN A CG    1 
ATOM   7366  O  OD1   . ASN A 1  959  ? 7.495   -37.173 59.471  1.00 81.87  ? 959  ASN A OD1   1 
ATOM   7367  N  ND2   . ASN A 1  959  ? 6.738   -35.270 58.487  1.00 80.30  ? 959  ASN A ND2   1 
ATOM   7368  N  N     . ILE A 1  960  ? 10.138  -38.979 59.399  1.00 80.47  ? 960  ILE A N     1 
ATOM   7369  C  CA    . ILE A 1  960  ? 9.944   -40.415 59.607  1.00 80.82  ? 960  ILE A CA    1 
ATOM   7370  C  C     . ILE A 1  960  ? 8.460   -40.778 59.759  1.00 81.41  ? 960  ILE A C     1 
ATOM   7371  O  O     . ILE A 1  960  ? 7.987   -41.751 59.159  1.00 81.23  ? 960  ILE A O     1 
ATOM   7372  C  CB    . ILE A 1  960  ? 10.817  -40.983 60.776  1.00 80.61  ? 960  ILE A CB    1 
ATOM   7373  C  CG1   . ILE A 1  960  ? 12.069  -41.652 60.213  1.00 80.44  ? 960  ILE A CG1   1 
ATOM   7374  C  CG2   . ILE A 1  960  ? 10.080  -42.049 61.574  1.00 79.81  ? 960  ILE A CG2   1 
ATOM   7375  C  CD1   . ILE A 1  960  ? 13.148  -40.694 59.762  1.00 80.70  ? 960  ILE A CD1   1 
ATOM   7376  N  N     . ARG A 1  961  ? 7.712   -39.987 60.522  1.00 82.09  ? 961  ARG A N     1 
ATOM   7377  C  CA    . ARG A 1  961  ? 6.368   -40.414 60.845  1.00 82.86  ? 961  ARG A CA    1 
ATOM   7378  C  C     . ARG A 1  961  ? 5.518   -40.466 59.611  1.00 83.33  ? 961  ARG A C     1 
ATOM   7379  O  O     . ARG A 1  961  ? 4.427   -41.020 59.645  1.00 83.77  ? 961  ARG A O     1 
ATOM   7380  C  CB    . ARG A 1  961  ? 5.709   -39.569 61.922  1.00 82.98  ? 961  ARG A CB    1 
ATOM   7381  C  CG    . ARG A 1  961  ? 4.885   -40.431 62.881  1.00 83.58  ? 961  ARG A CG    1 
ATOM   7382  C  CD    . ARG A 1  961  ? 3.677   -39.691 63.415  1.00 84.64  ? 961  ARG A CD    1 
ATOM   7383  N  NE    . ARG A 1  961  ? 2.651   -39.501 62.388  1.00 84.85  ? 961  ARG A NE    1 
ATOM   7384  C  CZ    . ARG A 1  961  ? 2.425   -38.361 61.738  1.00 85.23  ? 961  ARG A CZ    1 
ATOM   7385  N  NH1   . ARG A 1  961  ? 3.145   -37.273 61.986  1.00 85.14  ? 961  ARG A NH1   1 
ATOM   7386  N  NH2   . ARG A 1  961  ? 1.462   -38.311 60.831  1.00 86.56  ? 961  ARG A NH2   1 
ATOM   7387  N  N     . ARG A 1  962  ? 6.017   -39.915 58.512  1.00 83.98  ? 962  ARG A N     1 
ATOM   7388  C  CA    . ARG A 1  962  ? 5.388   -40.198 57.227  1.00 84.86  ? 962  ARG A CA    1 
ATOM   7389  C  C     . ARG A 1  962  ? 5.914   -41.487 56.605  1.00 85.28  ? 962  ARG A C     1 
ATOM   7390  O  O     . ARG A 1  962  ? 5.122   -42.297 56.134  1.00 85.46  ? 962  ARG A O     1 
ATOM   7391  C  CB    . ARG A 1  962  ? 5.423   -39.012 56.253  1.00 84.70  ? 962  ARG A CB    1 
ATOM   7392  C  CG    . ARG A 1  962  ? 4.135   -38.188 56.308  1.00 84.80  ? 962  ARG A CG    1 
ATOM   7393  C  CD    . ARG A 1  962  ? 4.055   -37.118 55.235  1.00 85.37  ? 962  ARG A CD    1 
ATOM   7394  N  NE    . ARG A 1  962  ? 4.887   -35.950 55.531  1.00 87.62  ? 962  ARG A NE    1 
ATOM   7395  C  CZ    . ARG A 1  962  ? 6.075   -35.704 54.974  1.00 88.54  ? 962  ARG A CZ    1 
ATOM   7396  N  NH1   . ARG A 1  962  ? 6.586   -36.545 54.076  1.00 89.36  ? 962  ARG A NH1   1 
ATOM   7397  N  NH2   . ARG A 1  962  ? 6.762   -34.617 55.313  1.00 87.92  ? 962  ARG A NH2   1 
ATOM   7398  N  N     . ILE A 1  963  ? 7.230   -41.691 56.625  1.00 85.89  ? 963  ILE A N     1 
ATOM   7399  C  CA    . ILE A 1  963  ? 7.812   -42.927 56.096  1.00 86.77  ? 963  ILE A CA    1 
ATOM   7400  C  C     . ILE A 1  963  ? 7.198   -44.180 56.767  1.00 87.90  ? 963  ILE A C     1 
ATOM   7401  O  O     . ILE A 1  963  ? 7.176   -45.272 56.185  1.00 88.10  ? 963  ILE A O     1 
ATOM   7402  C  CB    . ILE A 1  963  ? 9.358   -42.925 56.182  1.00 86.41  ? 963  ILE A CB    1 
ATOM   7403  C  CG1   . ILE A 1  963  ? 9.954   -41.901 55.222  1.00 85.72  ? 963  ILE A CG1   1 
ATOM   7404  C  CG2   . ILE A 1  963  ? 9.926   -44.285 55.828  1.00 86.60  ? 963  ILE A CG2   1 
ATOM   7405  C  CD1   . ILE A 1  963  ? 11.423  -42.158 54.886  1.00 84.21  ? 963  ILE A CD1   1 
ATOM   7406  N  N     . ILE A 1  964  ? 6.688   -44.015 57.984  1.00 89.17  ? 964  ILE A N     1 
ATOM   7407  C  CA    . ILE A 1  964  ? 5.891   -45.059 58.638  1.00 90.22  ? 964  ILE A CA    1 
ATOM   7408  C  C     . ILE A 1  964  ? 4.548   -45.193 57.920  1.00 90.81  ? 964  ILE A C     1 
ATOM   7409  O  O     . ILE A 1  964  ? 4.202   -46.270 57.440  1.00 90.67  ? 964  ILE A O     1 
ATOM   7410  C  CB    . ILE A 1  964  ? 5.701   -44.768 60.175  1.00 90.46  ? 964  ILE A CB    1 
ATOM   7411  C  CG1   . ILE A 1  964  ? 6.973   -45.112 60.992  1.00 90.43  ? 964  ILE A CG1   1 
ATOM   7412  C  CG2   . ILE A 1  964  ? 4.397   -45.391 60.745  1.00 90.32  ? 964  ILE A CG2   1 
ATOM   7413  C  CD1   . ILE A 1  964  ? 7.847   -46.240 60.443  1.00 89.51  ? 964  ILE A CD1   1 
ATOM   7414  N  N     . GLN A 1  965  ? 3.816   -44.084 57.829  1.00 91.79  ? 965  GLN A N     1 
ATOM   7415  C  CA    . GLN A 1  965  ? 2.541   -44.048 57.126  1.00 92.97  ? 965  GLN A CA    1 
ATOM   7416  C  C     . GLN A 1  965  ? 2.673   -44.655 55.729  1.00 93.51  ? 965  GLN A C     1 
ATOM   7417  O  O     . GLN A 1  965  ? 1.867   -45.503 55.338  1.00 93.46  ? 965  GLN A O     1 
ATOM   7418  C  CB    . GLN A 1  965  ? 2.010   -42.613 57.055  1.00 93.07  ? 965  GLN A CB    1 
ATOM   7419  C  CG    . GLN A 1  965  ? 1.522   -42.061 58.395  1.00 94.00  ? 965  GLN A CG    1 
ATOM   7420  C  CD    . GLN A 1  965  ? 0.663   -40.822 58.232  1.00 95.36  ? 965  GLN A CD    1 
ATOM   7421  O  OE1   . GLN A 1  965  ? -0.566  -40.893 58.307  1.00 96.83  ? 965  GLN A OE1   1 
ATOM   7422  N  NE2   . GLN A 1  965  ? 1.301   -39.684 57.981  1.00 95.17  ? 965  GLN A NE2   1 
ATOM   7423  N  N     . ASN A 1  966  ? 3.719   -44.241 55.011  1.00 94.38  ? 966  ASN A N     1 
ATOM   7424  C  CA    . ASN A 1  966  ? 4.019   -44.723 53.658  1.00 95.24  ? 966  ASN A CA    1 
ATOM   7425  C  C     . ASN A 1  966  ? 4.541   -46.145 53.578  1.00 95.99  ? 966  ASN A C     1 
ATOM   7426  O  O     . ASN A 1  966  ? 4.871   -46.619 52.493  1.00 96.02  ? 966  ASN A O     1 
ATOM   7427  C  CB    . ASN A 1  966  ? 5.037   -43.815 52.978  1.00 95.13  ? 966  ASN A CB    1 
ATOM   7428  C  CG    . ASN A 1  966  ? 4.446   -42.513 52.541  1.00 95.21  ? 966  ASN A CG    1 
ATOM   7429  O  OD1   . ASN A 1  966  ? 3.453   -42.475 51.811  1.00 95.93  ? 966  ASN A OD1   1 
ATOM   7430  N  ND2   . ASN A 1  966  ? 5.062   -41.425 52.974  1.00 95.34  ? 966  ASN A ND2   1 
ATOM   7431  N  N     . ALA A 1  967  ? 4.648   -46.816 54.718  1.00 97.02  ? 967  ALA A N     1 
ATOM   7432  C  CA    . ALA A 1  967  ? 4.978   -48.232 54.722  1.00 98.04  ? 967  ALA A CA    1 
ATOM   7433  C  C     . ALA A 1  967  ? 3.725   -49.031 55.055  1.00 98.88  ? 967  ALA A C     1 
ATOM   7434  O  O     . ALA A 1  967  ? 3.397   -49.999 54.367  1.00 98.81  ? 967  ALA A O     1 
ATOM   7435  C  CB    . ALA A 1  967  ? 6.080   -48.517 55.706  1.00 98.03  ? 967  ALA A CB    1 
ATOM   7436  N  N     . GLN A 1  968  ? 3.019   -48.608 56.103  1.00 100.08 ? 968  GLN A N     1 
ATOM   7437  C  CA    . GLN A 1  968  ? 1.723   -49.194 56.431  1.00 101.29 ? 968  GLN A CA    1 
ATOM   7438  C  C     . GLN A 1  968  ? 0.630   -48.599 55.532  1.00 101.83 ? 968  GLN A C     1 
ATOM   7439  O  O     . GLN A 1  968  ? -0.409  -48.120 56.007  1.00 102.11 ? 968  GLN A O     1 
ATOM   7440  C  CB    . GLN A 1  968  ? 1.399   -49.082 57.936  1.00 101.28 ? 968  GLN A CB    1 
ATOM   7441  C  CG    . GLN A 1  968  ? 1.299   -47.666 58.528  1.00 101.58 ? 968  GLN A CG    1 
ATOM   7442  C  CD    . GLN A 1  968  ? 1.106   -47.680 60.048  1.00 101.90 ? 968  GLN A CD    1 
ATOM   7443  O  OE1   . GLN A 1  968  ? 0.932   -46.628 60.678  1.00 102.41 ? 968  GLN A OE1   1 
ATOM   7444  N  NE2   . GLN A 1  968  ? 1.144   -48.880 60.643  1.00 102.73 ? 968  GLN A NE2   1 
ATOM   7445  N  N     . GLN A 1  969  ? 0.905   -48.628 54.224  1.00 102.46 ? 969  GLN A N     1 
ATOM   7446  C  CA    . GLN A 1  969  ? -0.047  -48.242 53.175  1.00 102.93 ? 969  GLN A CA    1 
ATOM   7447  C  C     . GLN A 1  969  ? 0.475   -48.659 51.790  1.00 103.19 ? 969  GLN A C     1 
ATOM   7448  O  O     . GLN A 1  969  ? -0.305  -49.068 50.940  1.00 103.15 ? 969  GLN A O     1 
ATOM   7449  C  CB    . GLN A 1  969  ? -0.382  -46.742 53.246  1.00 102.91 ? 969  GLN A CB    1 
ATOM   7450  C  CG    . GLN A 1  969  ? 0.052   -45.896 52.064  1.00 102.99 ? 969  GLN A CG    1 
ATOM   7451  C  CD    . GLN A 1  969  ? -1.092  -45.596 51.124  1.00 102.97 ? 969  GLN A CD    1 
ATOM   7452  O  OE1   . GLN A 1  969  ? -2.252  -45.888 51.428  1.00 102.98 ? 969  GLN A OE1   1 
ATOM   7453  N  NE2   . GLN A 1  969  ? -0.774  -44.997 49.978  1.00 102.83 ? 969  GLN A NE2   1 
ATOM   7454  N  N     . THR A 1  970  ? 1.791   -48.567 51.582  1.00 103.71 ? 970  THR A N     1 
ATOM   7455  C  CA    . THR A 1  970  ? 2.433   -49.021 50.342  1.00 104.24 ? 970  THR A CA    1 
ATOM   7456  C  C     . THR A 1  970  ? 2.532   -50.540 50.291  1.00 104.96 ? 970  THR A C     1 
ATOM   7457  O  O     . THR A 1  970  ? 2.743   -51.106 49.217  1.00 105.17 ? 970  THR A O     1 
ATOM   7458  C  CB    . THR A 1  970  ? 3.852   -48.426 50.166  1.00 104.09 ? 970  THR A CB    1 
ATOM   7459  O  OG1   . THR A 1  970  ? 3.777   -46.998 50.130  1.00 104.34 ? 970  THR A OG1   1 
ATOM   7460  C  CG2   . THR A 1  970  ? 4.503   -48.910 48.878  1.00 103.74 ? 970  THR A CG2   1 
ATOM   7461  N  N     . PHE A 1  971  ? 2.375   -51.192 51.447  1.00 105.82 ? 971  PHE A N     1 
ATOM   7462  C  CA    . PHE A 1  971  ? 2.479   -52.656 51.557  1.00 106.60 ? 971  PHE A CA    1 
ATOM   7463  C  C     . PHE A 1  971  ? 1.247   -53.363 52.144  1.00 107.35 ? 971  PHE A C     1 
ATOM   7464  O  O     . PHE A 1  971  ? 1.246   -54.586 52.278  1.00 107.10 ? 971  PHE A O     1 
ATOM   7465  C  CB    . PHE A 1  971  ? 3.703   -53.034 52.387  1.00 106.50 ? 971  PHE A CB    1 
ATOM   7466  C  CG    . PHE A 1  971  ? 5.013   -52.759 51.710  1.00 106.46 ? 971  PHE A CG    1 
ATOM   7467  C  CD1   . PHE A 1  971  ? 5.742   -51.621 52.020  1.00 106.53 ? 971  PHE A CD1   1 
ATOM   7468  C  CD2   . PHE A 1  971  ? 5.533   -53.651 50.780  1.00 106.44 ? 971  PHE A CD2   1 
ATOM   7469  C  CE1   . PHE A 1  971  ? 6.961   -51.372 51.407  1.00 106.62 ? 971  PHE A CE1   1 
ATOM   7470  C  CE2   . PHE A 1  971  ? 6.753   -53.409 50.162  1.00 106.35 ? 971  PHE A CE2   1 
ATOM   7471  C  CZ    . PHE A 1  971  ? 7.467   -52.269 50.476  1.00 106.50 ? 971  PHE A CZ    1 
ATOM   7472  N  N     . HIS A 1  972  ? 0.213   -52.589 52.478  1.00 108.67 ? 972  HIS A N     1 
ATOM   7473  C  CA    . HIS A 1  972  ? -1.006  -53.068 53.177  1.00 109.92 ? 972  HIS A CA    1 
ATOM   7474  C  C     . HIS A 1  972  ? -0.775  -54.170 54.226  1.00 110.18 ? 972  HIS A C     1 
ATOM   7475  O  O     . HIS A 1  972  ? -0.478  -55.321 53.892  1.00 110.08 ? 972  HIS A O     1 
ATOM   7476  C  CB    . HIS A 1  972  ? -2.143  -53.429 52.193  1.00 110.26 ? 972  HIS A CB    1 
ATOM   7477  C  CG    . HIS A 1  972  ? -3.033  -52.269 51.833  1.00 111.76 ? 972  HIS A CG    1 
ATOM   7478  N  ND1   . HIS A 1  972  ? -3.722  -51.533 52.777  1.00 112.81 ? 972  HIS A ND1   1 
ATOM   7479  C  CD2   . HIS A 1  972  ? -3.356  -51.732 50.630  1.00 112.76 ? 972  HIS A CD2   1 
ATOM   7480  C  CE1   . HIS A 1  972  ? -4.422  -50.588 52.172  1.00 113.41 ? 972  HIS A CE1   1 
ATOM   7481  N  NE2   . HIS A 1  972  ? -4.220  -50.688 50.869  1.00 113.39 ? 972  HIS A NE2   1 
ATOM   7482  N  N     . ILE A 1  973  ? -0.921  -53.796 55.496  1.00 110.77 ? 973  ILE A N     1 
ATOM   7483  C  CA    . ILE A 1  973  ? -0.588  -54.686 56.611  1.00 111.24 ? 973  ILE A CA    1 
ATOM   7484  C  C     . ILE A 1  973  ? -1.618  -54.692 57.754  1.00 111.60 ? 973  ILE A C     1 
ATOM   7485  O  O     . ILE A 1  973  ? -1.978  -53.641 58.309  1.00 111.63 ? 973  ILE A O     1 
ATOM   7486  C  CB    . ILE A 1  973  ? 0.866   -54.436 57.144  1.00 111.26 ? 973  ILE A CB    1 
ATOM   7487  C  CG1   . ILE A 1  973  ? 1.247   -55.453 58.234  1.00 111.36 ? 973  ILE A CG1   1 
ATOM   7488  C  CG2   . ILE A 1  973  ? 1.064   -52.972 57.609  1.00 111.02 ? 973  ILE A CG2   1 
ATOM   7489  C  CD1   . ILE A 1  973  ? 1.238   -56.912 57.784  1.00 111.36 ? 973  ILE A CD1   1 
ATOM   7490  N  N     . ASP A 1  974  ? -2.070  -55.899 58.093  1.00 111.93 ? 974  ASP A N     1 
ATOM   7491  C  CA    . ASP A 1  974  ? -3.080  -56.099 59.128  1.00 112.26 ? 974  ASP A CA    1 
ATOM   7492  C  C     . ASP A 1  974  ? -2.543  -55.958 60.557  1.00 112.21 ? 974  ASP A C     1 
ATOM   7493  O  O     . ASP A 1  974  ? -1.456  -56.449 60.892  1.00 112.18 ? 974  ASP A O     1 
ATOM   7494  C  CB    . ASP A 1  974  ? -3.813  -57.442 58.936  1.00 112.45 ? 974  ASP A CB    1 
ATOM   7495  C  CG    . ASP A 1  974  ? -2.865  -58.617 58.677  1.00 113.03 ? 974  ASP A CG    1 
ATOM   7496  O  OD1   . ASP A 1  974  ? -1.744  -58.639 59.234  1.00 113.73 ? 974  ASP A OD1   1 
ATOM   7497  O  OD2   . ASP A 1  974  ? -3.262  -59.538 57.923  1.00 113.25 ? 974  ASP A OD2   1 
ATOM   7498  N  N     . HIS A 1  975  ? -3.326  -55.276 61.389  1.00 112.16 ? 975  HIS A N     1 
ATOM   7499  C  CA    . HIS A 1  975  ? -2.989  -55.085 62.793  1.00 112.03 ? 975  HIS A CA    1 
ATOM   7500  C  C     . HIS A 1  975  ? -3.614  -56.197 63.654  1.00 111.63 ? 975  HIS A C     1 
ATOM   7501  O  O     . HIS A 1  975  ? -4.128  -55.928 64.746  1.00 111.71 ? 975  HIS A O     1 
ATOM   7502  C  CB    . HIS A 1  975  ? -3.415  -53.679 63.261  1.00 112.28 ? 975  HIS A CB    1 
ATOM   7503  C  CG    . HIS A 1  975  ? -2.719  -52.555 62.541  1.00 112.87 ? 975  HIS A CG    1 
ATOM   7504  N  ND1   . HIS A 1  975  ? -1.754  -51.769 63.137  1.00 113.20 ? 975  HIS A ND1   1 
ATOM   7505  C  CD2   . HIS A 1  975  ? -2.853  -52.085 61.275  1.00 112.93 ? 975  HIS A CD2   1 
ATOM   7506  C  CE1   . HIS A 1  975  ? -1.324  -50.867 62.271  1.00 112.85 ? 975  HIS A CE1   1 
ATOM   7507  N  NE2   . HIS A 1  975  ? -1.974  -51.038 61.133  1.00 112.62 ? 975  HIS A NE2   1 
ATOM   7508  N  N     . THR A 1  976  ? -3.577  -57.435 63.135  1.00 111.01 ? 976  THR A N     1 
ATOM   7509  C  CA    . THR A 1  976  ? -3.988  -58.661 63.869  1.00 110.24 ? 976  THR A CA    1 
ATOM   7510  C  C     . THR A 1  976  ? -3.131  -59.910 63.560  1.00 109.46 ? 976  THR A C     1 
ATOM   7511  O  O     . THR A 1  976  ? -3.267  -60.929 64.247  1.00 109.42 ? 976  THR A O     1 
ATOM   7512  C  CB    . THR A 1  976  ? -5.486  -59.060 63.647  1.00 110.35 ? 976  THR A CB    1 
ATOM   7513  O  OG1   . THR A 1  976  ? -5.654  -59.604 62.330  1.00 110.45 ? 976  THR A OG1   1 
ATOM   7514  C  CG2   . THR A 1  976  ? -6.462  -57.883 63.882  1.00 110.40 ? 976  THR A CG2   1 
ATOM   7515  N  N     . LYS A 1  977  ? -2.280  -59.842 62.528  1.00 108.46 ? 977  LYS A N     1 
ATOM   7516  C  CA    . LYS A 1  977  ? -1.360  -60.952 62.170  1.00 107.24 ? 977  LYS A CA    1 
ATOM   7517  C  C     . LYS A 1  977  ? 0.149   -60.604 62.288  1.00 106.83 ? 977  LYS A C     1 
ATOM   7518  O  O     . LYS A 1  977  ? 0.559   -59.507 61.874  1.00 106.85 ? 977  LYS A O     1 
ATOM   7519  C  CB    . LYS A 1  977  ? -1.685  -61.521 60.779  1.00 107.48 ? 977  LYS A CB    1 
ATOM   7520  C  CG    . LYS A 1  977  ? -2.417  -62.877 60.792  1.00 107.69 ? 977  LYS A CG    1 
ATOM   7521  C  CD    . LYS A 1  977  ? -3.946  -62.744 60.812  1.00 108.00 ? 977  LYS A CD    1 
ATOM   7522  C  CE    . LYS A 1  977  ? -4.625  -64.115 60.791  1.00 107.50 ? 977  LYS A CE    1 
ATOM   7523  N  NZ    . LYS A 1  977  ? -6.111  -64.026 60.717  1.00 107.07 ? 977  LYS A NZ    1 
ATOM   7524  N  N     . PRO A 1  978  ? 0.970   -61.545 62.846  1.00 105.95 ? 978  PRO A N     1 
ATOM   7525  C  CA    . PRO A 1  978  ? 2.387   -61.345 63.247  1.00 105.27 ? 978  PRO A CA    1 
ATOM   7526  C  C     . PRO A 1  978  ? 3.423   -61.076 62.138  1.00 103.82 ? 978  PRO A C     1 
ATOM   7527  O  O     . PRO A 1  978  ? 3.219   -61.431 60.968  1.00 103.82 ? 978  PRO A O     1 
ATOM   7528  C  CB    . PRO A 1  978  ? 2.735   -62.657 63.966  1.00 105.00 ? 978  PRO A CB    1 
ATOM   7529  C  CG    . PRO A 1  978  ? 1.829   -63.652 63.376  1.00 105.42 ? 978  PRO A CG    1 
ATOM   7530  C  CD    . PRO A 1  978  ? 0.535   -62.924 63.149  1.00 105.91 ? 978  PRO A CD    1 
ATOM   7531  N  N     . SER A 1  979  ? 4.534   -60.459 62.542  1.00 102.10 ? 979  SER A N     1 
ATOM   7532  C  CA    . SER A 1  979  ? 5.618   -60.089 61.643  1.00 100.33 ? 979  SER A CA    1 
ATOM   7533  C  C     . SER A 1  979  ? 6.506   -61.280 61.361  1.00 99.17  ? 979  SER A C     1 
ATOM   7534  O  O     . SER A 1  979  ? 6.332   -62.339 61.951  1.00 99.09  ? 979  SER A O     1 
ATOM   7535  C  CB    . SER A 1  979  ? 6.448   -58.968 62.269  1.00 100.38 ? 979  SER A CB    1 
ATOM   7536  O  OG    . SER A 1  979  ? 7.668   -58.789 61.576  1.00 100.02 ? 979  SER A OG    1 
ATOM   7537  N  N     . ASP A 1  980  ? 7.463   -61.096 60.460  1.00 97.79  ? 980  ASP A N     1 
ATOM   7538  C  CA    . ASP A 1  980  ? 8.452   -62.125 60.156  1.00 96.69  ? 980  ASP A CA    1 
ATOM   7539  C  C     . ASP A 1  980  ? 9.887   -61.619 60.330  1.00 95.71  ? 980  ASP A C     1 
ATOM   7540  O  O     . ASP A 1  980  ? 10.788  -61.999 59.577  1.00 95.53  ? 980  ASP A O     1 
ATOM   7541  C  CB    . ASP A 1  980  ? 8.236   -62.702 58.751  1.00 96.92  ? 980  ASP A CB    1 
ATOM   7542  C  CG    . ASP A 1  980  ? 7.912   -61.635 57.714  1.00 97.47  ? 980  ASP A CG    1 
ATOM   7543  O  OD1   . ASP A 1  980  ? 6.932   -60.890 57.921  1.00 98.62  ? 980  ASP A OD1   1 
ATOM   7544  O  OD2   . ASP A 1  980  ? 8.620   -61.552 56.682  1.00 97.74  ? 980  ASP A OD2   1 
ATOM   7545  N  N     . LEU A 1  981  ? 10.086  -60.777 61.345  1.00 94.46  ? 981  LEU A N     1 
ATOM   7546  C  CA    . LEU A 1  981  ? 11.396  -60.197 61.670  1.00 93.04  ? 981  LEU A CA    1 
ATOM   7547  C  C     . LEU A 1  981  ? 12.031  -60.869 62.895  1.00 92.14  ? 981  LEU A C     1 
ATOM   7548  O  O     . LEU A 1  981  ? 11.326  -61.319 63.796  1.00 92.12  ? 981  LEU A O     1 
ATOM   7549  C  CB    . LEU A 1  981  ? 11.248  -58.692 61.917  1.00 92.95  ? 981  LEU A CB    1 
ATOM   7550  C  CG    . LEU A 1  981  ? 10.757  -57.821 60.756  1.00 92.51  ? 981  LEU A CG    1 
ATOM   7551  C  CD1   . LEU A 1  981  ? 9.962   -56.658 61.272  1.00 92.02  ? 981  LEU A CD1   1 
ATOM   7552  C  CD2   . LEU A 1  981  ? 11.924  -57.326 59.947  1.00 92.78  ? 981  LEU A CD2   1 
ATOM   7553  N  N     . THR A 1  982  ? 13.359  -60.948 62.927  1.00 90.92  ? 982  THR A N     1 
ATOM   7554  C  CA    . THR A 1  982  ? 14.052  -61.432 64.122  1.00 89.90  ? 982  THR A CA    1 
ATOM   7555  C  C     . THR A 1  982  ? 14.488  -60.236 64.918  1.00 88.92  ? 982  THR A C     1 
ATOM   7556  O  O     . THR A 1  982  ? 14.886  -59.224 64.348  1.00 88.81  ? 982  THR A O     1 
ATOM   7557  C  CB    . THR A 1  982  ? 15.334  -62.221 63.801  1.00 90.06  ? 982  THR A CB    1 
ATOM   7558  O  OG1   . THR A 1  982  ? 15.227  -62.821 62.508  1.00 90.79  ? 982  THR A OG1   1 
ATOM   7559  C  CG2   . THR A 1  982  ? 15.607  -63.300 64.872  1.00 90.01  ? 982  THR A CG2   1 
ATOM   7560  N  N     . ILE A 1  983  ? 14.450  -60.360 66.238  1.00 87.87  ? 983  ILE A N     1 
ATOM   7561  C  CA    . ILE A 1  983  ? 14.976  -59.318 67.103  1.00 86.81  ? 983  ILE A CA    1 
ATOM   7562  C  C     . ILE A 1  983  ? 16.370  -58.906 66.640  1.00 86.33  ? 983  ILE A C     1 
ATOM   7563  O  O     . ILE A 1  983  ? 16.925  -57.944 67.147  1.00 86.62  ? 983  ILE A O     1 
ATOM   7564  C  CB    . ILE A 1  983  ? 14.994  -59.753 68.585  1.00 86.66  ? 983  ILE A CB    1 
ATOM   7565  C  CG1   . ILE A 1  983  ? 13.575  -60.024 69.080  1.00 86.74  ? 983  ILE A CG1   1 
ATOM   7566  C  CG2   . ILE A 1  983  ? 15.605  -58.691 69.455  1.00 86.15  ? 983  ILE A CG2   1 
ATOM   7567  C  CD1   . ILE A 1  983  ? 12.676  -58.805 69.111  1.00 86.38  ? 983  ILE A CD1   1 
ATOM   7568  N  N     . LYS A 1  984  ? 16.916  -59.623 65.661  1.00 85.55  ? 984  LYS A N     1 
ATOM   7569  C  CA    . LYS A 1  984  ? 18.207  -59.287 65.072  1.00 84.84  ? 984  LYS A CA    1 
ATOM   7570  C  C     . LYS A 1  984  ? 18.046  -58.384 63.843  1.00 84.49  ? 984  LYS A C     1 
ATOM   7571  O  O     . LYS A 1  984  ? 18.740  -57.375 63.716  1.00 84.52  ? 984  LYS A O     1 
ATOM   7572  C  CB    . LYS A 1  984  ? 18.961  -60.558 64.711  1.00 84.82  ? 984  LYS A CB    1 
ATOM   7573  C  CG    . LYS A 1  984  ? 20.464  -60.491 64.863  1.00 84.39  ? 984  LYS A CG    1 
ATOM   7574  C  CD    . LYS A 1  984  ? 21.016  -61.871 64.556  1.00 84.59  ? 984  LYS A CD    1 
ATOM   7575  C  CE    . LYS A 1  984  ? 22.491  -62.009 64.842  1.00 84.05  ? 984  LYS A CE    1 
ATOM   7576  N  NZ    . LYS A 1  984  ? 22.872  -63.399 64.483  1.00 83.97  ? 984  LYS A NZ    1 
ATOM   7577  N  N     . ASP A 1  985  ? 17.123  -58.740 62.950  1.00 84.01  ? 985  ASP A N     1 
ATOM   7578  C  CA    . ASP A 1  985  ? 16.856  -57.956 61.730  1.00 83.49  ? 985  ASP A CA    1 
ATOM   7579  C  C     . ASP A 1  985  ? 16.755  -56.471 62.007  1.00 83.08  ? 985  ASP A C     1 
ATOM   7580  O  O     . ASP A 1  985  ? 17.394  -55.664 61.330  1.00 83.21  ? 985  ASP A O     1 
ATOM   7581  C  CB    . ASP A 1  985  ? 15.565  -58.412 61.061  1.00 83.35  ? 985  ASP A CB    1 
ATOM   7582  C  CG    . ASP A 1  985  ? 15.602  -59.857 60.679  1.00 83.59  ? 985  ASP A CG    1 
ATOM   7583  O  OD1   . ASP A 1  985  ? 16.508  -60.575 61.164  1.00 83.80  ? 985  ASP A OD1   1 
ATOM   7584  O  OD2   . ASP A 1  985  ? 14.727  -60.273 59.891  1.00 83.94  ? 985  ASP A OD2   1 
ATOM   7585  N  N     . ILE A 1  986  ? 15.932  -56.128 62.995  1.00 82.44  ? 986  ILE A N     1 
ATOM   7586  C  CA    . ILE A 1  986  ? 15.792  -54.764 63.465  1.00 81.70  ? 986  ILE A CA    1 
ATOM   7587  C  C     . ILE A 1  986  ? 17.135  -54.338 64.029  1.00 81.47  ? 986  ILE A C     1 
ATOM   7588  O  O     . ILE A 1  986  ? 17.899  -53.623 63.384  1.00 81.18  ? 986  ILE A O     1 
ATOM   7589  C  CB    . ILE A 1  986  ? 14.677  -54.658 64.544  1.00 81.53  ? 986  ILE A CB    1 
ATOM   7590  C  CG1   . ILE A 1  986  ? 13.328  -55.066 63.949  1.00 81.50  ? 986  ILE A CG1   1 
ATOM   7591  C  CG2   . ILE A 1  986  ? 14.599  -53.257 65.135  1.00 80.79  ? 986  ILE A CG2   1 
ATOM   7592  C  CD1   . ILE A 1  986  ? 12.209  -55.199 64.967  1.00 81.81  ? 986  ILE A CD1   1 
ATOM   7593  N  N     . VAL A 1  987  ? 17.441  -54.839 65.215  1.00 81.41  ? 987  VAL A N     1 
ATOM   7594  C  CA    . VAL A 1  987  ? 18.537  -54.317 66.010  1.00 81.41  ? 987  VAL A CA    1 
ATOM   7595  C  C     . VAL A 1  987  ? 19.805  -54.130 65.195  1.00 81.74  ? 987  VAL A C     1 
ATOM   7596  O  O     . VAL A 1  987  ? 20.565  -53.197 65.431  1.00 81.95  ? 987  VAL A O     1 
ATOM   7597  C  CB    . VAL A 1  987  ? 18.782  -55.180 67.255  1.00 81.13  ? 987  VAL A CB    1 
ATOM   7598  C  CG1   . VAL A 1  987  ? 20.152  -54.926 67.828  1.00 81.18  ? 987  VAL A CG1   1 
ATOM   7599  C  CG2   . VAL A 1  987  ? 17.707  -54.910 68.291  1.00 80.67  ? 987  VAL A CG2   1 
ATOM   7600  N  N     . LEU A 1  988  ? 20.025  -54.981 64.210  1.00 82.21  ? 988  LEU A N     1 
ATOM   7601  C  CA    . LEU A 1  988  ? 21.241  -54.830 63.451  1.00 82.90  ? 988  LEU A CA    1 
ATOM   7602  C  C     . LEU A 1  988  ? 21.087  -53.917 62.244  1.00 83.25  ? 988  LEU A C     1 
ATOM   7603  O  O     . LEU A 1  988  ? 21.969  -53.119 61.963  1.00 83.44  ? 988  LEU A O     1 
ATOM   7604  C  CB    . LEU A 1  988  ? 21.848  -56.171 63.076  1.00 83.00  ? 988  LEU A CB    1 
ATOM   7605  C  CG    . LEU A 1  988  ? 23.359  -55.994 62.996  1.00 83.21  ? 988  LEU A CG    1 
ATOM   7606  C  CD1   . LEU A 1  988  ? 24.050  -56.947 63.954  1.00 84.33  ? 988  LEU A CD1   1 
ATOM   7607  C  CD2   . LEU A 1  988  ? 23.847  -56.148 61.553  1.00 83.57  ? 988  LEU A CD2   1 
ATOM   7608  N  N     . GLY A 1  989  ? 19.975  -54.026 61.533  1.00 83.71  ? 989  GLY A N     1 
ATOM   7609  C  CA    . GLY A 1  989  ? 19.730  -53.132 60.393  1.00 84.30  ? 989  GLY A CA    1 
ATOM   7610  C  C     . GLY A 1  989  ? 19.908  -51.663 60.755  1.00 84.47  ? 989  GLY A C     1 
ATOM   7611  O  O     . GLY A 1  989  ? 20.787  -50.985 60.217  1.00 84.28  ? 989  GLY A O     1 
ATOM   7612  N  N     . VAL A 1  990  ? 19.061  -51.195 61.674  1.00 84.84  ? 990  VAL A N     1 
ATOM   7613  C  CA    . VAL A 1  990  ? 19.142  -49.870 62.290  1.00 85.20  ? 990  VAL A CA    1 
ATOM   7614  C  C     . VAL A 1  990  ? 20.590  -49.407 62.487  1.00 85.94  ? 990  VAL A C     1 
ATOM   7615  O  O     . VAL A 1  990  ? 20.960  -48.290 62.101  1.00 85.99  ? 990  VAL A O     1 
ATOM   7616  C  CB    . VAL A 1  990  ? 18.323  -49.855 63.627  1.00 84.99  ? 990  VAL A CB    1 
ATOM   7617  C  CG1   . VAL A 1  990  ? 19.119  -49.311 64.823  1.00 85.07  ? 990  VAL A CG1   1 
ATOM   7618  C  CG2   . VAL A 1  990  ? 17.035  -49.108 63.447  1.00 84.24  ? 990  VAL A CG2   1 
ATOM   7619  N  N     . LYS A 1  991  ? 21.406  -50.292 63.059  1.00 86.72  ? 991  LYS A N     1 
ATOM   7620  C  CA    . LYS A 1  991  ? 22.792  -49.988 63.389  1.00 87.40  ? 991  LYS A CA    1 
ATOM   7621  C  C     . LYS A 1  991  ? 23.646  -49.782 62.134  1.00 87.78  ? 991  LYS A C     1 
ATOM   7622  O  O     . LYS A 1  991  ? 24.531  -48.935 62.133  1.00 88.13  ? 991  LYS A O     1 
ATOM   7623  C  CB    . LYS A 1  991  ? 23.368  -51.092 64.280  1.00 87.36  ? 991  LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1  991  ? 24.731  -50.806 64.883  1.00 87.86  ? 991  LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1  991  ? 25.111  -51.933 65.839  1.00 88.86  ? 991  LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1  991  ? 26.288  -51.571 66.733  1.00 88.85  ? 991  LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1  991  ? 26.266  -52.410 67.964  1.00 88.97  ? 991  LYS A NZ    1 
ATOM   7628  N  N     . ASP A 1  992  ? 23.371  -50.534 61.069  1.00 88.13  ? 992  ASP A N     1 
ATOM   7629  C  CA    . ASP A 1  992  ? 24.177  -50.442 59.847  1.00 88.62  ? 992  ASP A CA    1 
ATOM   7630  C  C     . ASP A 1  992  ? 23.553  -49.597 58.757  1.00 88.35  ? 992  ASP A C     1 
ATOM   7631  O  O     . ASP A 1  992  ? 24.033  -49.584 57.623  1.00 88.49  ? 992  ASP A O     1 
ATOM   7632  C  CB    . ASP A 1  992  ? 24.552  -51.819 59.308  1.00 89.09  ? 992  ASP A CB    1 
ATOM   7633  C  CG    . ASP A 1  992  ? 25.868  -52.338 59.893  1.00 91.48  ? 992  ASP A CG    1 
ATOM   7634  O  OD1   . ASP A 1  992  ? 26.399  -51.729 60.872  1.00 92.67  ? 992  ASP A OD1   1 
ATOM   7635  O  OD2   . ASP A 1  992  ? 26.367  -53.368 59.366  1.00 94.15  ? 992  ASP A OD2   1 
ATOM   7636  N  N     . LEU A 1  993  ? 22.466  -48.920 59.109  1.00 88.11  ? 993  LEU A N     1 
ATOM   7637  C  CA    . LEU A 1  993  ? 21.920  -47.831 58.313  1.00 87.54  ? 993  LEU A CA    1 
ATOM   7638  C  C     . LEU A 1  993  ? 22.746  -46.636 58.722  1.00 87.61  ? 993  LEU A C     1 
ATOM   7639  O  O     . LEU A 1  993  ? 23.294  -45.913 57.891  1.00 87.49  ? 993  LEU A O     1 
ATOM   7640  C  CB    . LEU A 1  993  ? 20.451  -47.604 58.686  1.00 87.53  ? 993  LEU A CB    1 
ATOM   7641  C  CG    . LEU A 1  993  ? 19.812  -46.219 58.591  1.00 86.81  ? 993  LEU A CG    1 
ATOM   7642  C  CD1   . LEU A 1  993  ? 19.592  -45.871 57.146  1.00 87.54  ? 993  LEU A CD1   1 
ATOM   7643  C  CD2   . LEU A 1  993  ? 18.500  -46.177 59.354  1.00 86.65  ? 993  LEU A CD2   1 
ATOM   7644  N  N     . GLN A 1  994  ? 22.845  -46.484 60.038  1.00 87.60  ? 994  GLN A N     1 
ATOM   7645  C  CA    . GLN A 1  994  ? 23.606  -45.448 60.687  1.00 87.71  ? 994  GLN A CA    1 
ATOM   7646  C  C     . GLN A 1  994  ? 24.990  -45.360 60.079  1.00 87.36  ? 994  GLN A C     1 
ATOM   7647  O  O     . GLN A 1  994  ? 25.591  -44.293 60.042  1.00 87.22  ? 994  GLN A O     1 
ATOM   7648  C  CB    . GLN A 1  994  ? 23.726  -45.812 62.155  1.00 87.99  ? 994  GLN A CB    1 
ATOM   7649  C  CG    . GLN A 1  994  ? 23.166  -44.785 63.112  1.00 89.79  ? 994  GLN A CG    1 
ATOM   7650  C  CD    . GLN A 1  994  ? 22.649  -45.425 64.395  1.00 91.97  ? 994  GLN A CD    1 
ATOM   7651  O  OE1   . GLN A 1  994  ? 22.883  -44.920 65.503  1.00 92.96  ? 994  GLN A OE1   1 
ATOM   7652  N  NE2   . GLN A 1  994  ? 21.945  -46.550 64.249  1.00 92.13  ? 994  GLN A NE2   1 
ATOM   7653  N  N     . GLU A 1  995  ? 25.481  -46.497 59.595  1.00 87.22  ? 995  GLU A N     1 
ATOM   7654  C  CA    . GLU A 1  995  ? 26.832  -46.599 59.051  1.00 87.18  ? 995  GLU A CA    1 
ATOM   7655  C  C     . GLU A 1  995  ? 27.029  -45.885 57.717  1.00 86.84  ? 995  GLU A C     1 
ATOM   7656  O  O     . GLU A 1  995  ? 28.169  -45.600 57.334  1.00 86.98  ? 995  GLU A O     1 
ATOM   7657  C  CB    . GLU A 1  995  ? 27.281  -48.068 58.935  1.00 87.43  ? 995  GLU A CB    1 
ATOM   7658  C  CG    . GLU A 1  995  ? 28.105  -48.570 60.111  1.00 87.99  ? 995  GLU A CG    1 
ATOM   7659  C  CD    . GLU A 1  995  ? 29.260  -47.638 60.459  1.00 89.54  ? 995  GLU A CD    1 
ATOM   7660  O  OE1   . GLU A 1  995  ? 30.301  -47.692 59.765  1.00 90.18  ? 995  GLU A OE1   1 
ATOM   7661  O  OE2   . GLU A 1  995  ? 29.123  -46.856 61.432  1.00 90.18  ? 995  GLU A OE2   1 
ATOM   7662  N  N     . ASN A 1  996  ? 25.942  -45.604 57.004  1.00 86.29  ? 996  ASN A N     1 
ATOM   7663  C  CA    . ASN A 1  996  ? 26.073  -44.873 55.739  1.00 85.88  ? 996  ASN A CA    1 
ATOM   7664  C  C     . ASN A 1  996  ? 25.136  -43.668 55.504  1.00 85.37  ? 996  ASN A C     1 
ATOM   7665  O  O     . ASN A 1  996  ? 24.751  -43.378 54.359  1.00 85.21  ? 996  ASN A O     1 
ATOM   7666  C  CB    . ASN A 1  996  ? 26.119  -45.825 54.536  1.00 85.93  ? 996  ASN A CB    1 
ATOM   7667  C  CG    . ASN A 1  996  ? 25.473  -47.153 54.822  1.00 86.57  ? 996  ASN A CG    1 
ATOM   7668  O  OD1   . ASN A 1  996  ? 26.159  -48.172 54.912  1.00 87.76  ? 996  ASN A OD1   1 
ATOM   7669  N  ND2   . ASN A 1  996  ? 24.148  -47.156 54.979  1.00 86.90  ? 996  ASN A ND2   1 
ATOM   7670  N  N     . LEU A 1  997  ? 24.808  -42.957 56.585  1.00 84.69  ? 997  LEU A N     1 
ATOM   7671  C  CA    . LEU A 1  997  ? 24.051  -41.713 56.478  1.00 84.09  ? 997  LEU A CA    1 
ATOM   7672  C  C     . LEU A 1  997  ? 24.952  -40.573 56.041  1.00 84.17  ? 997  LEU A C     1 
ATOM   7673  O  O     . LEU A 1  997  ? 24.483  -39.481 55.730  1.00 84.14  ? 997  LEU A O     1 
ATOM   7674  C  CB    . LEU A 1  997  ? 23.326  -41.367 57.771  1.00 83.79  ? 997  LEU A CB    1 
ATOM   7675  C  CG    . LEU A 1  997  ? 22.167  -42.245 58.228  1.00 82.69  ? 997  LEU A CG    1 
ATOM   7676  C  CD1   . LEU A 1  997  ? 21.125  -41.323 58.761  1.00 81.82  ? 997  LEU A CD1   1 
ATOM   7677  C  CD2   . LEU A 1  997  ? 21.582  -43.069 57.113  1.00 82.05  ? 997  LEU A CD2   1 
ATOM   7678  N  N     . LEU A 1  998  ? 26.250  -40.837 56.038  1.00 84.24  ? 998  LEU A N     1 
ATOM   7679  C  CA    . LEU A 1  998  ? 27.176  -40.139 55.150  1.00 84.69  ? 998  LEU A CA    1 
ATOM   7680  C  C     . LEU A 1  998  ? 26.900  -38.650 54.842  1.00 84.95  ? 998  LEU A C     1 
ATOM   7681  O  O     . LEU A 1  998  ? 26.218  -38.305 53.866  1.00 84.87  ? 998  LEU A O     1 
ATOM   7682  C  CB    . LEU A 1  998  ? 27.316  -40.927 53.833  1.00 84.56  ? 998  LEU A CB    1 
ATOM   7683  C  CG    . LEU A 1  998  ? 28.576  -41.770 53.662  1.00 84.32  ? 998  LEU A CG    1 
ATOM   7684  C  CD1   . LEU A 1  998  ? 29.788  -40.915 53.965  1.00 84.51  ? 998  LEU A CD1   1 
ATOM   7685  C  CD2   . LEU A 1  998  ? 28.579  -43.005 54.544  1.00 84.12  ? 998  LEU A CD2   1 
ATOM   7686  N  N     . VAL A 1  999  ? 27.454  -37.784 55.685  1.00 85.30  ? 999  VAL A N     1 
ATOM   7687  C  CA    . VAL A 1  999  ? 27.509  -36.359 55.410  1.00 85.56  ? 999  VAL A CA    1 
ATOM   7688  C  C     . VAL A 1  999  ? 28.876  -36.027 54.835  1.00 85.73  ? 999  VAL A C     1 
ATOM   7689  O  O     . VAL A 1  999  ? 28.963  -35.587 53.690  1.00 85.99  ? 999  VAL A O     1 
ATOM   7690  C  CB    . VAL A 1  999  ? 27.156  -35.520 56.658  1.00 85.58  ? 999  VAL A CB    1 
ATOM   7691  C  CG1   . VAL A 1  999  ? 27.917  -34.194 56.696  1.00 85.88  ? 999  VAL A CG1   1 
ATOM   7692  C  CG2   . VAL A 1  999  ? 25.654  -35.282 56.699  1.00 85.93  ? 999  VAL A CG2   1 
ATOM   7693  N  N     . LEU A 1  1000 ? 29.936  -36.247 55.610  1.00 85.94  ? 1000 LEU A N     1 
ATOM   7694  C  CA    . LEU A 1  1000 ? 31.277  -36.115 55.071  1.00 86.39  ? 1000 LEU A CA    1 
ATOM   7695  C  C     . LEU A 1  1000 ? 31.878  -37.499 54.895  1.00 86.92  ? 1000 LEU A C     1 
ATOM   7696  O  O     . LEU A 1  1000 ? 31.654  -38.400 55.712  1.00 86.79  ? 1000 LEU A O     1 
ATOM   7697  C  CB    . LEU A 1  1000 ? 32.158  -35.215 55.936  1.00 86.31  ? 1000 LEU A CB    1 
ATOM   7698  C  CG    . LEU A 1  1000 ? 33.031  -34.210 55.161  1.00 86.50  ? 1000 LEU A CG    1 
ATOM   7699  C  CD1   . LEU A 1  1000 ? 33.801  -33.258 56.109  1.00 85.83  ? 1000 LEU A CD1   1 
ATOM   7700  C  CD2   . LEU A 1  1000 ? 33.988  -34.876 54.138  1.00 86.35  ? 1000 LEU A CD2   1 
ATOM   7701  N  N     . ARG A 1  1001 ? 32.649  -37.647 53.821  1.00 87.72  ? 1001 ARG A N     1 
ATOM   7702  C  CA    . ARG A 1  1001 ? 32.995  -38.959 53.274  1.00 88.51  ? 1001 ARG A CA    1 
ATOM   7703  C  C     . ARG A 1  1001 ? 34.435  -39.395 53.570  1.00 88.86  ? 1001 ARG A C     1 
ATOM   7704  O  O     . ARG A 1  1001 ? 34.790  -40.558 53.375  1.00 88.42  ? 1001 ARG A O     1 
ATOM   7705  C  CB    . ARG A 1  1001 ? 32.701  -38.966 51.758  1.00 88.55  ? 1001 ARG A CB    1 
ATOM   7706  C  CG    . ARG A 1  1001 ? 31.976  -40.224 51.251  1.00 89.09  ? 1001 ARG A CG    1 
ATOM   7707  C  CD    . ARG A 1  1001 ? 31.085  -39.967 50.036  1.00 89.53  ? 1001 ARG A CD    1 
ATOM   7708  N  NE    . ARG A 1  1001 ? 29.992  -39.012 50.286  1.00 90.62  ? 1001 ARG A NE    1 
ATOM   7709  C  CZ    . ARG A 1  1001 ? 28.704  -39.338 50.457  1.00 90.53  ? 1001 ARG A CZ    1 
ATOM   7710  N  NH1   . ARG A 1  1001 ? 28.323  -40.616 50.421  1.00 90.43  ? 1001 ARG A NH1   1 
ATOM   7711  N  NH2   . ARG A 1  1001 ? 27.792  -38.382 50.664  1.00 88.61  ? 1001 ARG A NH2   1 
ATOM   7712  N  N     . GLY A 1  1002 ? 35.242  -38.457 54.062  1.00 89.78  ? 1002 GLY A N     1 
ATOM   7713  C  CA    . GLY A 1  1002 ? 36.672  -38.671 54.315  1.00 91.12  ? 1002 GLY A CA    1 
ATOM   7714  C  C     . GLY A 1  1002 ? 36.989  -39.925 55.107  1.00 92.09  ? 1002 GLY A C     1 
ATOM   7715  O  O     . GLY A 1  1002 ? 36.178  -40.358 55.932  1.00 92.20  ? 1002 GLY A O     1 
ATOM   7716  N  N     . LYS A 1  1003 ? 38.182  -40.484 54.869  1.00 92.97  ? 1003 LYS A N     1 
ATOM   7717  C  CA    . LYS A 1  1003 ? 38.556  -41.837 55.327  1.00 93.61  ? 1003 LYS A CA    1 
ATOM   7718  C  C     . LYS A 1  1003 ? 39.571  -41.872 56.482  1.00 93.76  ? 1003 LYS A C     1 
ATOM   7719  O  O     . LYS A 1  1003 ? 40.132  -42.925 56.796  1.00 93.65  ? 1003 LYS A O     1 
ATOM   7720  C  CB    . LYS A 1  1003 ? 39.084  -42.640 54.133  1.00 93.55  ? 1003 LYS A CB    1 
ATOM   7721  C  CG    . LYS A 1  1003 ? 38.601  -44.090 54.071  1.00 94.30  ? 1003 LYS A CG    1 
ATOM   7722  C  CD    . LYS A 1  1003 ? 39.072  -44.778 52.776  1.00 94.19  ? 1003 LYS A CD    1 
ATOM   7723  C  CE    . LYS A 1  1003 ? 38.969  -46.296 52.858  1.00 93.96  ? 1003 LYS A CE    1 
ATOM   7724  N  NZ    . LYS A 1  1003 ? 40.156  -46.920 52.221  1.00 93.63  ? 1003 LYS A NZ    1 
ATOM   7725  N  N     . ASN A 1  1004 ? 39.780  -40.720 57.116  1.00 94.28  ? 1004 ASN A N     1 
ATOM   7726  C  CA    . ASN A 1  1004 ? 40.745  -40.573 58.205  1.00 94.82  ? 1004 ASN A CA    1 
ATOM   7727  C  C     . ASN A 1  1004 ? 40.098  -40.345 59.574  1.00 95.14  ? 1004 ASN A C     1 
ATOM   7728  O  O     . ASN A 1  1004 ? 38.874  -40.232 59.688  1.00 95.05  ? 1004 ASN A O     1 
ATOM   7729  C  CB    . ASN A 1  1004 ? 41.698  -39.417 57.903  1.00 94.83  ? 1004 ASN A CB    1 
ATOM   7730  C  CG    . ASN A 1  1004 ? 41.051  -38.055 58.124  1.00 95.28  ? 1004 ASN A CG    1 
ATOM   7731  O  OD1   . ASN A 1  1004 ? 40.418  -37.805 59.158  1.00 95.02  ? 1004 ASN A OD1   1 
ATOM   7732  N  ND2   . ASN A 1  1004 ? 41.207  -37.165 57.148  1.00 96.07  ? 1004 ASN A ND2   1 
ATOM   7733  N  N     . GLU A 1  1005 ? 40.952  -40.233 60.592  1.00 95.60  ? 1005 GLU A N     1 
ATOM   7734  C  CA    . GLU A 1  1005 ? 40.544  -40.089 61.988  1.00 96.12  ? 1005 GLU A CA    1 
ATOM   7735  C  C     . GLU A 1  1005 ? 39.475  -39.016 62.228  1.00 96.05  ? 1005 GLU A C     1 
ATOM   7736  O  O     . GLU A 1  1005 ? 38.324  -39.346 62.513  1.00 96.20  ? 1005 GLU A O     1 
ATOM   7737  C  CB    . GLU A 1  1005 ? 41.771  -39.828 62.871  1.00 96.37  ? 1005 GLU A CB    1 
ATOM   7738  C  CG    . GLU A 1  1005 ? 41.580  -40.127 64.364  1.00 98.04  ? 1005 GLU A CG    1 
ATOM   7739  C  CD    . GLU A 1  1005 ? 41.640  -41.621 64.681  1.00 100.20 ? 1005 GLU A CD    1 
ATOM   7740  O  OE1   . GLU A 1  1005 ? 40.773  -42.375 64.160  1.00 101.60 ? 1005 GLU A OE1   1 
ATOM   7741  O  OE2   . GLU A 1  1005 ? 42.549  -42.040 65.450  1.00 99.85  ? 1005 GLU A OE2   1 
ATOM   7742  N  N     . ILE A 1  1006 ? 39.850  -37.742 62.108  1.00 95.91  ? 1006 ILE A N     1 
ATOM   7743  C  CA    . ILE A 1  1006 ? 38.954  -36.648 62.511  1.00 95.62  ? 1006 ILE A CA    1 
ATOM   7744  C  C     . ILE A 1  1006 ? 37.677  -36.544 61.685  1.00 95.44  ? 1006 ILE A C     1 
ATOM   7745  O  O     . ILE A 1  1006 ? 36.605  -36.345 62.247  1.00 95.65  ? 1006 ILE A O     1 
ATOM   7746  C  CB    . ILE A 1  1006 ? 39.649  -35.250 62.616  1.00 95.55  ? 1006 ILE A CB    1 
ATOM   7747  C  CG1   . ILE A 1  1006 ? 40.424  -34.889 61.335  1.00 95.18  ? 1006 ILE A CG1   1 
ATOM   7748  C  CG2   . ILE A 1  1006 ? 40.499  -35.171 63.899  1.00 95.92  ? 1006 ILE A CG2   1 
ATOM   7749  C  CD1   . ILE A 1  1006 ? 41.921  -35.153 61.384  1.00 95.04  ? 1006 ILE A CD1   1 
ATOM   7750  N  N     . ILE A 1  1007 ? 37.791  -36.687 60.365  1.00 95.03  ? 1007 ILE A N     1 
ATOM   7751  C  CA    . ILE A 1  1007 ? 36.635  -36.565 59.469  1.00 94.45  ? 1007 ILE A CA    1 
ATOM   7752  C  C     . ILE A 1  1007 ? 35.460  -37.437 59.937  1.00 94.24  ? 1007 ILE A C     1 
ATOM   7753  O  O     . ILE A 1  1007 ? 34.365  -36.924 60.177  1.00 94.08  ? 1007 ILE A O     1 
ATOM   7754  C  CB    . ILE A 1  1007 ? 37.006  -36.922 58.002  1.00 94.45  ? 1007 ILE A CB    1 
ATOM   7755  C  CG1   . ILE A 1  1007 ? 38.128  -36.014 57.464  1.00 93.99  ? 1007 ILE A CG1   1 
ATOM   7756  C  CG2   . ILE A 1  1007 ? 35.765  -36.923 57.112  1.00 94.29  ? 1007 ILE A CG2   1 
ATOM   7757  C  CD1   . ILE A 1  1007 ? 37.748  -34.573 57.220  1.00 93.78  ? 1007 ILE A CD1   1 
ATOM   7758  N  N     . GLN A 1  1008 ? 35.709  -38.741 60.083  1.00 93.91  ? 1008 GLN A N     1 
ATOM   7759  C  CA    . GLN A 1  1008 ? 34.688  -39.718 60.491  1.00 93.57  ? 1008 GLN A CA    1 
ATOM   7760  C  C     . GLN A 1  1008 ? 34.307  -39.539 61.956  1.00 93.18  ? 1008 GLN A C     1 
ATOM   7761  O  O     . GLN A 1  1008 ? 33.418  -40.236 62.461  1.00 93.00  ? 1008 GLN A O     1 
ATOM   7762  C  CB    . GLN A 1  1008 ? 35.186  -41.156 60.279  1.00 93.80  ? 1008 GLN A CB    1 
ATOM   7763  C  CG    . GLN A 1  1008 ? 35.666  -41.501 58.866  1.00 94.20  ? 1008 GLN A CG    1 
ATOM   7764  C  CD    . GLN A 1  1008 ? 34.737  -42.454 58.120  1.00 94.62  ? 1008 GLN A CD    1 
ATOM   7765  O  OE1   . GLN A 1  1008 ? 33.508  -42.319 58.163  1.00 94.49  ? 1008 GLN A OE1   1 
ATOM   7766  N  NE2   . GLN A 1  1008 ? 35.329  -43.424 57.423  1.00 94.81  ? 1008 GLN A NE2   1 
ATOM   7767  N  N     . ASN A 1  1009 ? 35.009  -38.624 62.628  1.00 92.81  ? 1009 ASN A N     1 
ATOM   7768  C  CA    . ASN A 1  1009 ? 34.748  -38.266 64.022  1.00 92.60  ? 1009 ASN A CA    1 
ATOM   7769  C  C     . ASN A 1  1009 ? 34.035  -36.910 64.126  1.00 92.36  ? 1009 ASN A C     1 
ATOM   7770  O  O     . ASN A 1  1009 ? 33.752  -36.412 65.226  1.00 92.32  ? 1009 ASN A O     1 
ATOM   7771  C  CB    . ASN A 1  1009 ? 36.053  -38.254 64.815  1.00 92.61  ? 1009 ASN A CB    1 
ATOM   7772  C  CG    . ASN A 1  1009 ? 35.894  -38.849 66.187  1.00 93.06  ? 1009 ASN A CG    1 
ATOM   7773  O  OD1   . ASN A 1  1009 ? 34.834  -38.739 66.807  1.00 93.24  ? 1009 ASN A OD1   1 
ATOM   7774  N  ND2   . ASN A 1  1009 ? 36.948  -39.498 66.674  1.00 94.35  ? 1009 ASN A ND2   1 
ATOM   7775  N  N     . ALA A 1  1010 ? 33.785  -36.314 62.961  1.00 92.00  ? 1010 ALA A N     1 
ATOM   7776  C  CA    . ALA A 1  1010 ? 32.874  -35.187 62.816  1.00 91.65  ? 1010 ALA A CA    1 
ATOM   7777  C  C     . ALA A 1  1010 ? 31.585  -35.781 62.309  1.00 91.39  ? 1010 ALA A C     1 
ATOM   7778  O  O     . ALA A 1  1010 ? 30.518  -35.536 62.864  1.00 91.45  ? 1010 ALA A O     1 
ATOM   7779  C  CB    . ALA A 1  1010 ? 33.412  -34.181 61.810  1.00 91.73  ? 1010 ALA A CB    1 
ATOM   7780  N  N     . GLN A 1  1011 ? 31.718  -36.577 61.247  1.00 90.96  ? 1011 GLN A N     1 
ATOM   7781  C  CA    . GLN A 1  1011 ? 30.633  -37.344 60.652  1.00 90.37  ? 1011 GLN A CA    1 
ATOM   7782  C  C     . GLN A 1  1011 ? 29.795  -38.040 61.709  1.00 90.09  ? 1011 GLN A C     1 
ATOM   7783  O  O     . GLN A 1  1011 ? 28.580  -38.076 61.601  1.00 90.05  ? 1011 GLN A O     1 
ATOM   7784  C  CB    . GLN A 1  1011 ? 31.205  -38.360 59.659  1.00 90.30  ? 1011 GLN A CB    1 
ATOM   7785  C  CG    . GLN A 1  1011 ? 30.307  -39.546 59.365  1.00 90.80  ? 1011 GLN A CG    1 
ATOM   7786  C  CD    . GLN A 1  1011 ? 28.945  -39.126 58.873  1.00 91.43  ? 1011 GLN A CD    1 
ATOM   7787  O  OE1   . GLN A 1  1011 ? 28.824  -38.197 58.080  1.00 91.73  ? 1011 GLN A OE1   1 
ATOM   7788  N  NE2   . GLN A 1  1011 ? 27.906  -39.800 59.351  1.00 92.21  ? 1011 GLN A NE2   1 
ATOM   7789  N  N     . ARG A 1  1012 ? 30.450  -38.583 62.728  1.00 89.97  ? 1012 ARG A N     1 
ATOM   7790  C  CA    . ARG A 1  1012 ? 29.754  -39.237 63.824  1.00 90.17  ? 1012 ARG A CA    1 
ATOM   7791  C  C     . ARG A 1  1012 ? 29.009  -38.211 64.662  1.00 89.50  ? 1012 ARG A C     1 
ATOM   7792  O  O     . ARG A 1  1012 ? 27.897  -38.469 65.122  1.00 89.72  ? 1012 ARG A O     1 
ATOM   7793  C  CB    . ARG A 1  1012 ? 30.723  -40.040 64.697  1.00 90.23  ? 1012 ARG A CB    1 
ATOM   7794  C  CG    . ARG A 1  1012 ? 30.047  -41.053 65.638  1.00 91.28  ? 1012 ARG A CG    1 
ATOM   7795  C  CD    . ARG A 1  1012 ? 31.053  -41.826 66.498  1.00 91.95  ? 1012 ARG A CD    1 
ATOM   7796  N  NE    . ARG A 1  1012 ? 32.102  -42.462 65.693  1.00 96.09  ? 1012 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A 1  1012 ? 33.391  -42.115 65.714  1.00 97.80  ? 1012 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A 1  1012 ? 33.820  -41.138 66.518  1.00 97.75  ? 1012 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A 1  1012 ? 34.261  -42.758 64.936  1.00 98.84  ? 1012 ARG A NH2   1 
ATOM   7800  N  N     . ASP A 1  1013 ? 29.607  -37.046 64.861  1.00 88.82  ? 1013 ASP A N     1 
ATOM   7801  C  CA    . ASP A 1  1013 ? 28.905  -36.005 65.593  1.00 88.41  ? 1013 ASP A CA    1 
ATOM   7802  C  C     . ASP A 1  1013 ? 27.809  -35.350 64.729  1.00 87.51  ? 1013 ASP A C     1 
ATOM   7803  O  O     . ASP A 1  1013 ? 26.692  -35.119 65.205  1.00 87.45  ? 1013 ASP A O     1 
ATOM   7804  C  CB    . ASP A 1  1013 ? 29.887  -34.988 66.193  1.00 88.86  ? 1013 ASP A CB    1 
ATOM   7805  C  CG    . ASP A 1  1013 ? 30.501  -35.468 67.522  1.00 90.81  ? 1013 ASP A CG    1 
ATOM   7806  O  OD1   . ASP A 1  1013 ? 29.975  -36.444 68.127  1.00 92.22  ? 1013 ASP A OD1   1 
ATOM   7807  O  OD2   . ASP A 1  1013 ? 31.510  -34.864 67.971  1.00 93.11  ? 1013 ASP A OD2   1 
ATOM   7808  N  N     . ALA A 1  1014 ? 28.120  -35.110 63.452  1.00 86.31  ? 1014 ALA A N     1 
ATOM   7809  C  CA    . ALA A 1  1014 ? 27.227  -34.408 62.514  1.00 85.00  ? 1014 ALA A CA    1 
ATOM   7810  C  C     . ALA A 1  1014 ? 25.913  -35.147 62.211  1.00 84.11  ? 1014 ALA A C     1 
ATOM   7811  O  O     . ALA A 1  1014 ? 25.129  -34.742 61.347  1.00 83.87  ? 1014 ALA A O     1 
ATOM   7812  C  CB    . ALA A 1  1014 ? 27.972  -34.090 61.221  1.00 84.98  ? 1014 ALA A CB    1 
ATOM   7813  N  N     . VAL A 1  1015 ? 25.675  -36.228 62.937  1.00 83.02  ? 1015 VAL A N     1 
ATOM   7814  C  CA    . VAL A 1  1015 ? 24.503  -37.047 62.719  1.00 81.99  ? 1015 VAL A CA    1 
ATOM   7815  C  C     . VAL A 1  1015 ? 23.874  -37.348 64.083  1.00 81.42  ? 1015 VAL A C     1 
ATOM   7816  O  O     . VAL A 1  1015 ? 22.694  -37.713 64.161  1.00 81.37  ? 1015 VAL A O     1 
ATOM   7817  C  CB    . VAL A 1  1015 ? 24.873  -38.334 61.912  1.00 81.96  ? 1015 VAL A CB    1 
ATOM   7818  C  CG1   . VAL A 1  1015 ? 23.705  -39.283 61.804  1.00 81.98  ? 1015 VAL A CG1   1 
ATOM   7819  C  CG2   . VAL A 1  1015 ? 25.357  -37.971 60.509  1.00 81.25  ? 1015 VAL A CG2   1 
ATOM   7820  N  N     . THR A 1  1016 ? 24.658  -37.136 65.148  1.00 80.51  ? 1016 THR A N     1 
ATOM   7821  C  CA    . THR A 1  1016 ? 24.234  -37.390 66.540  1.00 79.87  ? 1016 THR A CA    1 
ATOM   7822  C  C     . THR A 1  1016 ? 22.772  -37.102 66.832  1.00 79.50  ? 1016 THR A C     1 
ATOM   7823  O  O     . THR A 1  1016 ? 22.073  -37.959 67.375  1.00 79.48  ? 1016 THR A O     1 
ATOM   7824  C  CB    . THR A 1  1016 ? 25.053  -36.590 67.566  1.00 79.80  ? 1016 THR A CB    1 
ATOM   7825  O  OG1   . THR A 1  1016 ? 26.440  -36.928 67.444  1.00 80.05  ? 1016 THR A OG1   1 
ATOM   7826  C  CG2   . THR A 1  1016 ? 24.565  -36.893 68.993  1.00 79.28  ? 1016 THR A CG2   1 
ATOM   7827  N  N     . LEU A 1  1017 ? 22.322  -35.893 66.490  1.00 79.11  ? 1017 LEU A N     1 
ATOM   7828  C  CA    . LEU A 1  1017 ? 20.946  -35.509 66.765  1.00 78.50  ? 1017 LEU A CA    1 
ATOM   7829  C  C     . LEU A 1  1017 ? 19.986  -36.353 65.951  1.00 78.29  ? 1017 LEU A C     1 
ATOM   7830  O  O     . LEU A 1  1017 ? 19.170  -37.070 66.538  1.00 78.42  ? 1017 LEU A O     1 
ATOM   7831  C  CB    . LEU A 1  1017 ? 20.686  -34.025 66.548  1.00 78.16  ? 1017 LEU A CB    1 
ATOM   7832  C  CG    . LEU A 1  1017 ? 19.636  -33.530 67.551  1.00 78.09  ? 1017 LEU A CG    1 
ATOM   7833  C  CD1   . LEU A 1  1017 ? 19.665  -32.044 67.625  1.00 79.22  ? 1017 LEU A CD1   1 
ATOM   7834  C  CD2   . LEU A 1  1017 ? 18.217  -33.987 67.249  1.00 77.49  ? 1017 LEU A CD2   1 
ATOM   7835  N  N     . PHE A 1  1018 ? 20.099  -36.303 64.619  1.00 77.78  ? 1018 PHE A N     1 
ATOM   7836  C  CA    . PHE A 1  1018 ? 19.215  -37.102 63.756  1.00 77.29  ? 1018 PHE A CA    1 
ATOM   7837  C  C     . PHE A 1  1018 ? 19.004  -38.532 64.287  1.00 77.08  ? 1018 PHE A C     1 
ATOM   7838  O  O     . PHE A 1  1018 ? 17.905  -39.087 64.219  1.00 76.84  ? 1018 PHE A O     1 
ATOM   7839  C  CB    . PHE A 1  1018 ? 19.712  -37.122 62.305  1.00 77.14  ? 1018 PHE A CB    1 
ATOM   7840  C  CG    . PHE A 1  1018 ? 18.821  -37.901 61.371  1.00 76.64  ? 1018 PHE A CG    1 
ATOM   7841  C  CD1   . PHE A 1  1018 ? 17.446  -37.691 61.357  1.00 76.90  ? 1018 PHE A CD1   1 
ATOM   7842  C  CD2   . PHE A 1  1018 ? 19.353  -38.844 60.508  1.00 76.19  ? 1018 PHE A CD2   1 
ATOM   7843  C  CE1   . PHE A 1  1018 ? 16.616  -38.423 60.495  1.00 77.53  ? 1018 PHE A CE1   1 
ATOM   7844  C  CE2   . PHE A 1  1018 ? 18.533  -39.579 59.649  1.00 76.26  ? 1018 PHE A CE2   1 
ATOM   7845  C  CZ    . PHE A 1  1018 ? 17.168  -39.368 59.639  1.00 77.01  ? 1018 PHE A CZ    1 
ATOM   7846  N  N     . CYS A 1  1019 ? 20.056  -39.101 64.857  1.00 76.83  ? 1019 CYS A N     1 
ATOM   7847  C  CA    . CYS A 1  1019 ? 19.988  -40.457 65.344  1.00 76.75  ? 1019 CYS A CA    1 
ATOM   7848  C  C     . CYS A 1  1019 ? 19.085  -40.653 66.544  1.00 76.69  ? 1019 CYS A C     1 
ATOM   7849  O  O     . CYS A 1  1019 ? 18.211  -41.508 66.488  1.00 76.81  ? 1019 CYS A O     1 
ATOM   7850  C  CB    . CYS A 1  1019 ? 21.379  -40.998 65.591  1.00 76.72  ? 1019 CYS A CB    1 
ATOM   7851  S  SG    . CYS A 1  1019 ? 22.209  -41.171 64.025  1.00 77.26  ? 1019 CYS A SG    1 
ATOM   7852  N  N     . CYS A 1  1020 ? 19.269  -39.862 67.606  1.00 76.63  ? 1020 CYS A N     1 
ATOM   7853  C  CA    . CYS A 1  1020 ? 18.431  -39.983 68.818  1.00 76.57  ? 1020 CYS A CA    1 
ATOM   7854  C  C     . CYS A 1  1020 ? 16.974  -40.221 68.464  1.00 76.30  ? 1020 CYS A C     1 
ATOM   7855  O  O     . CYS A 1  1020 ? 16.293  -40.967 69.169  1.00 76.57  ? 1020 CYS A O     1 
ATOM   7856  C  CB    . CYS A 1  1020 ? 18.509  -38.748 69.708  1.00 76.49  ? 1020 CYS A CB    1 
ATOM   7857  S  SG    . CYS A 1  1020 ? 20.160  -38.266 70.179  1.00 78.13  ? 1020 CYS A SG    1 
ATOM   7858  N  N     . LEU A 1  1021 ? 16.514  -39.577 67.382  1.00 75.66  ? 1021 LEU A N     1 
ATOM   7859  C  CA    . LEU A 1  1021 ? 15.201  -39.835 66.789  1.00 75.23  ? 1021 LEU A CA    1 
ATOM   7860  C  C     . LEU A 1  1021 ? 15.210  -41.240 66.203  1.00 75.02  ? 1021 LEU A C     1 
ATOM   7861  O  O     . LEU A 1  1021 ? 14.663  -42.173 66.792  1.00 75.28  ? 1021 LEU A O     1 
ATOM   7862  C  CB    . LEU A 1  1021 ? 14.877  -38.806 65.690  1.00 75.19  ? 1021 LEU A CB    1 
ATOM   7863  C  CG    . LEU A 1  1021 ? 13.514  -38.858 64.973  1.00 75.33  ? 1021 LEU A CG    1 
ATOM   7864  C  CD1   . LEU A 1  1021 ? 12.473  -38.028 65.697  1.00 75.22  ? 1021 LEU A CD1   1 
ATOM   7865  C  CD2   . LEU A 1  1021 ? 13.623  -38.393 63.521  1.00 75.21  ? 1021 LEU A CD2   1 
ATOM   7866  N  N     . LEU A 1  1022 ? 15.860  -41.380 65.050  1.00 74.47  ? 1022 LEU A N     1 
ATOM   7867  C  CA    . LEU A 1  1022 ? 16.005  -42.648 64.348  1.00 73.84  ? 1022 LEU A CA    1 
ATOM   7868  C  C     . LEU A 1  1022 ? 15.995  -43.873 65.277  1.00 73.43  ? 1022 LEU A C     1 
ATOM   7869  O  O     . LEU A 1  1022 ? 15.220  -44.805 65.086  1.00 73.22  ? 1022 LEU A O     1 
ATOM   7870  C  CB    . LEU A 1  1022 ? 17.298  -42.591 63.555  1.00 73.85  ? 1022 LEU A CB    1 
ATOM   7871  C  CG    . LEU A 1  1022 ? 17.651  -43.743 62.643  1.00 74.18  ? 1022 LEU A CG    1 
ATOM   7872  C  CD1   . LEU A 1  1022 ? 16.593  -43.890 61.582  1.00 75.32  ? 1022 LEU A CD1   1 
ATOM   7873  C  CD2   . LEU A 1  1022 ? 18.986  -43.447 62.024  1.00 74.95  ? 1022 LEU A CD2   1 
ATOM   7874  N  N     . ARG A 1  1023 ? 16.847  -43.851 66.292  1.00 73.07  ? 1023 ARG A N     1 
ATOM   7875  C  CA    . ARG A 1  1023 ? 16.893  -44.922 67.263  1.00 73.04  ? 1023 ARG A CA    1 
ATOM   7876  C  C     . ARG A 1  1023 ? 15.588  -45.034 68.045  1.00 73.05  ? 1023 ARG A C     1 
ATOM   7877  O  O     . ARG A 1  1023 ? 15.148  -46.135 68.348  1.00 73.27  ? 1023 ARG A O     1 
ATOM   7878  C  CB    . ARG A 1  1023 ? 18.054  -44.729 68.238  1.00 73.13  ? 1023 ARG A CB    1 
ATOM   7879  C  CG    . ARG A 1  1023 ? 19.455  -44.747 67.641  1.00 73.13  ? 1023 ARG A CG    1 
ATOM   7880  C  CD    . ARG A 1  1023 ? 20.442  -44.601 68.780  1.00 74.11  ? 1023 ARG A CD    1 
ATOM   7881  N  NE    . ARG A 1  1023 ? 21.765  -44.111 68.396  1.00 75.10  ? 1023 ARG A NE    1 
ATOM   7882  C  CZ    . ARG A 1  1023 ? 22.177  -42.852 68.539  1.00 75.92  ? 1023 ARG A CZ    1 
ATOM   7883  N  NH1   . ARG A 1  1023 ? 21.358  -41.926 69.029  1.00 75.68  ? 1023 ARG A NH1   1 
ATOM   7884  N  NH2   . ARG A 1  1023 ? 23.411  -42.510 68.172  1.00 76.24  ? 1023 ARG A NH2   1 
ATOM   7885  N  N     . SER A 1  1024 ? 14.976  -43.905 68.383  1.00 73.07  ? 1024 SER A N     1 
ATOM   7886  C  CA    . SER A 1  1024 ? 13.750  -43.924 69.184  1.00 73.43  ? 1024 SER A CA    1 
ATOM   7887  C  C     . SER A 1  1024 ? 12.523  -44.343 68.385  1.00 73.57  ? 1024 SER A C     1 
ATOM   7888  O  O     . SER A 1  1024 ? 11.595  -44.938 68.943  1.00 73.96  ? 1024 SER A O     1 
ATOM   7889  C  CB    . SER A 1  1024 ? 13.479  -42.563 69.814  1.00 73.58  ? 1024 SER A CB    1 
ATOM   7890  O  OG    . SER A 1  1024 ? 12.689  -41.744 68.957  1.00 74.13  ? 1024 SER A OG    1 
ATOM   7891  N  N     . ARG A 1  1025 ? 12.511  -44.008 67.094  1.00 73.43  ? 1025 ARG A N     1 
ATOM   7892  C  CA    . ARG A 1  1025 ? 11.419  -44.377 66.189  1.00 73.34  ? 1025 ARG A CA    1 
ATOM   7893  C  C     . ARG A 1  1025 ? 11.541  -45.790 65.583  1.00 73.11  ? 1025 ARG A C     1 
ATOM   7894  O  O     . ARG A 1  1025 ? 10.536  -46.385 65.175  1.00 72.93  ? 1025 ARG A O     1 
ATOM   7895  C  CB    . ARG A 1  1025 ? 11.296  -43.341 65.084  1.00 73.41  ? 1025 ARG A CB    1 
ATOM   7896  C  CG    . ARG A 1  1025 ? 10.124  -42.413 65.244  1.00 74.88  ? 1025 ARG A CG    1 
ATOM   7897  C  CD    . ARG A 1  1025 ? 10.367  -41.293 66.252  1.00 77.46  ? 1025 ARG A CD    1 
ATOM   7898  N  NE    . ARG A 1  1025 ? 10.084  -39.988 65.652  1.00 79.46  ? 1025 ARG A NE    1 
ATOM   7899  C  CZ    . ARG A 1  1025 ? 8.901   -39.612 65.166  1.00 81.21  ? 1025 ARG A CZ    1 
ATOM   7900  N  NH1   . ARG A 1  1025 ? 7.858   -40.445 65.204  1.00 81.79  ? 1025 ARG A NH1   1 
ATOM   7901  N  NH2   . ARG A 1  1025 ? 8.758   -38.401 64.629  1.00 81.99  ? 1025 ARG A NH2   1 
ATOM   7902  N  N     . LEU A 1  1026 ? 12.771  -46.309 65.520  1.00 72.85  ? 1026 LEU A N     1 
ATOM   7903  C  CA    . LEU A 1  1026 ? 13.027  -47.685 65.082  1.00 72.35  ? 1026 LEU A CA    1 
ATOM   7904  C  C     . LEU A 1  1026 ? 13.511  -48.508 66.257  1.00 72.50  ? 1026 LEU A C     1 
ATOM   7905  O  O     . LEU A 1  1026 ? 14.594  -49.101 66.236  1.00 72.21  ? 1026 LEU A O     1 
ATOM   7906  C  CB    . LEU A 1  1026 ? 14.035  -47.727 63.939  1.00 71.99  ? 1026 LEU A CB    1 
ATOM   7907  C  CG    . LEU A 1  1026 ? 13.728  -46.864 62.714  1.00 71.51  ? 1026 LEU A CG    1 
ATOM   7908  C  CD1   . LEU A 1  1026 ? 14.746  -47.136 61.625  1.00 70.98  ? 1026 LEU A CD1   1 
ATOM   7909  C  CD2   . LEU A 1  1026 ? 12.294  -47.061 62.181  1.00 71.16  ? 1026 LEU A CD2   1 
ATOM   7910  N  N     . ALA A 1  1027 ? 12.685  -48.515 67.293  1.00 72.98  ? 1027 ALA A N     1 
ATOM   7911  C  CA    . ALA A 1  1027 ? 12.967  -49.256 68.505  1.00 73.59  ? 1027 ALA A CA    1 
ATOM   7912  C  C     . ALA A 1  1027 ? 12.253  -50.603 68.461  1.00 73.91  ? 1027 ALA A C     1 
ATOM   7913  O  O     . ALA A 1  1027 ? 11.159  -50.732 67.903  1.00 74.24  ? 1027 ALA A O     1 
ATOM   7914  C  CB    . ALA A 1  1027 ? 12.538  -48.458 69.717  1.00 73.79  ? 1027 ALA A CB    1 
ATOM   7915  N  N     . THR A 1  1028 ? 12.879  -51.602 69.063  1.00 74.03  ? 1028 THR A N     1 
ATOM   7916  C  CA    . THR A 1  1028 ? 12.438  -52.976 68.931  1.00 73.95  ? 1028 THR A CA    1 
ATOM   7917  C  C     . THR A 1  1028 ? 10.979  -53.158 69.310  1.00 73.98  ? 1028 THR A C     1 
ATOM   7918  O  O     . THR A 1  1028 ? 10.236  -53.784 68.575  1.00 73.82  ? 1028 THR A O     1 
ATOM   7919  C  CB    . THR A 1  1028 ? 13.341  -53.899 69.743  1.00 73.94  ? 1028 THR A CB    1 
ATOM   7920  O  OG1   . THR A 1  1028 ? 14.620  -53.983 69.098  1.00 73.74  ? 1028 THR A OG1   1 
ATOM   7921  C  CG2   . THR A 1  1028 ? 12.740  -55.274 69.849  1.00 74.17  ? 1028 THR A CG2   1 
ATOM   7922  N  N     . ARG A 1  1029 ? 10.566  -52.590 70.436  1.00 74.39  ? 1029 ARG A N     1 
ATOM   7923  C  CA    . ARG A 1  1029 ? 9.188   -52.745 70.884  1.00 75.02  ? 1029 ARG A CA    1 
ATOM   7924  C  C     . ARG A 1  1029 ? 8.248   -51.886 70.066  1.00 74.87  ? 1029 ARG A C     1 
ATOM   7925  O  O     . ARG A 1  1029 ? 7.103   -52.259 69.839  1.00 74.93  ? 1029 ARG A O     1 
ATOM   7926  C  CB    . ARG A 1  1029 ? 9.044   -52.413 72.367  1.00 75.53  ? 1029 ARG A CB    1 
ATOM   7927  C  CG    . ARG A 1  1029 ? 8.314   -53.497 73.172  1.00 77.11  ? 1029 ARG A CG    1 
ATOM   7928  C  CD    . ARG A 1  1029 ? 7.025   -52.997 73.803  1.00 80.16  ? 1029 ARG A CD    1 
ATOM   7929  N  NE    . ARG A 1  1029 ? 6.404   -54.027 74.645  1.00 81.98  ? 1029 ARG A NE    1 
ATOM   7930  C  CZ    . ARG A 1  1029 ? 6.690   -54.252 75.930  1.00 81.94  ? 1029 ARG A CZ    1 
ATOM   7931  N  NH1   . ARG A 1  1029 ? 7.610   -53.528 76.569  1.00 81.01  ? 1029 ARG A NH1   1 
ATOM   7932  N  NH2   . ARG A 1  1029 ? 6.046   -55.214 76.581  1.00 81.88  ? 1029 ARG A NH2   1 
ATOM   7933  N  N     . ARG A 1  1030 ? 8.737   -50.739 69.618  1.00 74.83  ? 1030 ARG A N     1 
ATOM   7934  C  CA    . ARG A 1  1030 ? 7.939   -49.867 68.771  1.00 74.95  ? 1030 ARG A CA    1 
ATOM   7935  C  C     . ARG A 1  1030 ? 7.649   -50.453 67.398  1.00 74.81  ? 1030 ARG A C     1 
ATOM   7936  O  O     . ARG A 1  1030 ? 6.487   -50.671 67.060  1.00 75.12  ? 1030 ARG A O     1 
ATOM   7937  C  CB    . ARG A 1  1030 ? 8.579   -48.501 68.618  1.00 75.01  ? 1030 ARG A CB    1 
ATOM   7938  C  CG    . ARG A 1  1030 ? 7.905   -47.453 69.447  1.00 75.93  ? 1030 ARG A CG    1 
ATOM   7939  C  CD    . ARG A 1  1030 ? 7.469   -46.320 68.557  1.00 77.35  ? 1030 ARG A CD    1 
ATOM   7940  N  NE    . ARG A 1  1030 ? 7.704   -45.025 69.176  1.00 77.95  ? 1030 ARG A NE    1 
ATOM   7941  C  CZ    . ARG A 1  1030 ? 7.903   -43.910 68.487  1.00 79.10  ? 1030 ARG A CZ    1 
ATOM   7942  N  NH1   . ARG A 1  1030 ? 7.893   -43.932 67.155  1.00 79.54  ? 1030 ARG A NH1   1 
ATOM   7943  N  NH2   . ARG A 1  1030 ? 8.117   -42.774 69.128  1.00 79.91  ? 1030 ARG A NH2   1 
ATOM   7944  N  N     . VAL A 1  1031 ? 8.688   -50.700 66.604  1.00 74.61  ? 1031 VAL A N     1 
ATOM   7945  C  CA    . VAL A 1  1031 ? 8.480   -51.239 65.264  1.00 74.40  ? 1031 VAL A CA    1 
ATOM   7946  C  C     . VAL A 1  1031 ? 7.365   -52.276 65.355  1.00 74.55  ? 1031 VAL A C     1 
ATOM   7947  O  O     . VAL A 1  1031 ? 6.325   -52.117 64.720  1.00 74.71  ? 1031 VAL A O     1 
ATOM   7948  C  CB    . VAL A 1  1031 ? 9.769   -51.837 64.624  1.00 74.19  ? 1031 VAL A CB    1 
ATOM   7949  C  CG1   . VAL A 1  1031 ? 9.532   -52.192 63.171  1.00 73.60  ? 1031 VAL A CG1   1 
ATOM   7950  C  CG2   . VAL A 1  1031 ? 10.901  -50.851 64.693  1.00 74.07  ? 1031 VAL A CG2   1 
ATOM   7951  N  N     . LEU A 1  1032 ? 7.551   -53.281 66.206  1.00 74.68  ? 1032 LEU A N     1 
ATOM   7952  C  CA    . LEU A 1  1032 ? 6.635   -54.421 66.256  1.00 75.01  ? 1032 LEU A CA    1 
ATOM   7953  C  C     . LEU A 1  1032 ? 5.289   -54.145 66.915  1.00 75.55  ? 1032 LEU A C     1 
ATOM   7954  O  O     . LEU A 1  1032 ? 4.251   -54.507 66.360  1.00 75.54  ? 1032 LEU A O     1 
ATOM   7955  C  CB    . LEU A 1  1032 ? 7.301   -55.646 66.888  1.00 74.68  ? 1032 LEU A CB    1 
ATOM   7956  C  CG    . LEU A 1  1032 ? 8.651   -56.070 66.302  1.00 73.90  ? 1032 LEU A CG    1 
ATOM   7957  C  CD1   . LEU A 1  1032 ? 9.208   -57.184 67.141  1.00 73.97  ? 1032 LEU A CD1   1 
ATOM   7958  C  CD2   . LEU A 1  1032 ? 8.561   -56.502 64.847  1.00 72.95  ? 1032 LEU A CD2   1 
ATOM   7959  N  N     . GLN A 1  1033 ? 5.295   -53.510 68.081  1.00 76.23  ? 1033 GLN A N     1 
ATOM   7960  C  CA    . GLN A 1  1033 ? 4.043   -53.292 68.791  1.00 77.25  ? 1033 GLN A CA    1 
ATOM   7961  C  C     . GLN A 1  1033 ? 3.168   -52.195 68.147  1.00 77.61  ? 1033 GLN A C     1 
ATOM   7962  O  O     . GLN A 1  1033 ? 2.029   -52.460 67.747  1.00 77.75  ? 1033 GLN A O     1 
ATOM   7963  C  CB    . GLN A 1  1033 ? 4.291   -53.026 70.280  1.00 77.35  ? 1033 GLN A CB    1 
ATOM   7964  C  CG    . GLN A 1  1033 ? 3.184   -53.538 71.209  1.00 79.11  ? 1033 GLN A CG    1 
ATOM   7965  C  CD    . GLN A 1  1033 ? 1.850   -52.814 71.012  1.00 81.47  ? 1033 GLN A CD    1 
ATOM   7966  O  OE1   . GLN A 1  1033 ? 1.718   -51.617 71.317  1.00 82.14  ? 1033 GLN A OE1   1 
ATOM   7967  N  NE2   . GLN A 1  1033 ? 0.854   -53.542 70.492  1.00 81.88  ? 1033 GLN A NE2   1 
ATOM   7968  N  N     . GLU A 1  1034 ? 3.707   -50.984 68.024  1.00 78.10  ? 1034 GLU A N     1 
ATOM   7969  C  CA    . GLU A 1  1034 ? 2.917   -49.811 67.634  1.00 78.65  ? 1034 GLU A CA    1 
ATOM   7970  C  C     . GLU A 1  1034 ? 2.531   -49.738 66.166  1.00 78.65  ? 1034 GLU A C     1 
ATOM   7971  O  O     . GLU A 1  1034 ? 1.379   -49.437 65.851  1.00 78.63  ? 1034 GLU A O     1 
ATOM   7972  C  CB    . GLU A 1  1034 ? 3.615   -48.516 68.053  1.00 78.73  ? 1034 GLU A CB    1 
ATOM   7973  C  CG    . GLU A 1  1034 ? 3.279   -48.061 69.471  1.00 79.42  ? 1034 GLU A CG    1 
ATOM   7974  C  CD    . GLU A 1  1034 ? 4.207   -46.964 69.980  1.00 79.47  ? 1034 GLU A CD    1 
ATOM   7975  O  OE1   . GLU A 1  1034 ? 4.373   -45.932 69.290  1.00 80.78  ? 1034 GLU A OE1   1 
ATOM   7976  O  OE2   . GLU A 1  1034 ? 4.766   -47.137 71.083  1.00 80.55  ? 1034 GLU A OE2   1 
ATOM   7977  N  N     . TYR A 1  1035 ? 3.478   -49.976 65.264  1.00 78.95  ? 1035 TYR A N     1 
ATOM   7978  C  CA    . TYR A 1  1035 ? 3.120   -49.982 63.844  1.00 79.63  ? 1035 TYR A CA    1 
ATOM   7979  C  C     . TYR A 1  1035 ? 3.521   -51.228 63.048  1.00 79.75  ? 1035 TYR A C     1 
ATOM   7980  O  O     . TYR A 1  1035 ? 4.322   -51.145 62.111  1.00 79.99  ? 1035 TYR A O     1 
ATOM   7981  C  CB    . TYR A 1  1035 ? 3.549   -48.704 63.126  1.00 79.98  ? 1035 TYR A CB    1 
ATOM   7982  C  CG    . TYR A 1  1035 ? 4.852   -48.037 63.540  1.00 80.73  ? 1035 TYR A CG    1 
ATOM   7983  C  CD1   . TYR A 1  1035 ? 6.096   -48.619 63.280  1.00 80.78  ? 1035 TYR A CD1   1 
ATOM   7984  C  CD2   . TYR A 1  1035 ? 4.832   -46.754 64.117  1.00 82.33  ? 1035 TYR A CD2   1 
ATOM   7985  C  CE1   . TYR A 1  1035 ? 7.293   -47.941 63.631  1.00 81.75  ? 1035 TYR A CE1   1 
ATOM   7986  C  CE2   . TYR A 1  1035 ? 6.011   -46.075 64.474  1.00 81.68  ? 1035 TYR A CE2   1 
ATOM   7987  C  CZ    . TYR A 1  1035 ? 7.231   -46.665 64.229  1.00 81.33  ? 1035 TYR A CZ    1 
ATOM   7988  O  OH    . TYR A 1  1035 ? 8.363   -45.967 64.593  1.00 80.54  ? 1035 TYR A OH    1 
ATOM   7989  N  N     . ARG A 1  1036 ? 2.887   -52.350 63.397  1.00 79.51  ? 1036 ARG A N     1 
ATOM   7990  C  CA    . ARG A 1  1036 ? 3.292   -53.707 63.014  1.00 79.34  ? 1036 ARG A CA    1 
ATOM   7991  C  C     . ARG A 1  1036 ? 3.934   -53.890 61.637  1.00 78.41  ? 1036 ARG A C     1 
ATOM   7992  O  O     . ARG A 1  1036 ? 3.313   -54.426 60.732  1.00 78.31  ? 1036 ARG A O     1 
ATOM   7993  C  CB    . ARG A 1  1036 ? 2.102   -54.660 63.174  1.00 79.39  ? 1036 ARG A CB    1 
ATOM   7994  C  CG    . ARG A 1  1036 ? 1.828   -55.071 64.616  1.00 80.62  ? 1036 ARG A CG    1 
ATOM   7995  C  CD    . ARG A 1  1036 ? 0.673   -56.077 64.725  1.00 81.30  ? 1036 ARG A CD    1 
ATOM   7996  N  NE    . ARG A 1  1036 ? 0.289   -56.309 66.122  1.00 85.16  ? 1036 ARG A NE    1 
ATOM   7997  C  CZ    . ARG A 1  1036 ? -0.456  -55.477 66.856  1.00 86.84  ? 1036 ARG A CZ    1 
ATOM   7998  N  NH1   . ARG A 1  1036 ? -0.918  -54.336 66.336  1.00 87.55  ? 1036 ARG A NH1   1 
ATOM   7999  N  NH2   . ARG A 1  1036 ? -0.742  -55.790 68.120  1.00 87.40  ? 1036 ARG A NH2   1 
ATOM   8000  N  N     . LEU A 1  1037 ? 5.190   -53.473 61.500  1.00 77.79  ? 1037 LEU A N     1 
ATOM   8001  C  CA    . LEU A 1  1037 ? 5.917   -53.612 60.246  1.00 77.45  ? 1037 LEU A CA    1 
ATOM   8002  C  C     . LEU A 1  1037 ? 6.222   -55.066 59.940  1.00 77.62  ? 1037 LEU A C     1 
ATOM   8003  O  O     . LEU A 1  1037 ? 6.220   -55.896 60.854  1.00 77.83  ? 1037 LEU A O     1 
ATOM   8004  C  CB    . LEU A 1  1037 ? 7.229   -52.837 60.295  1.00 77.22  ? 1037 LEU A CB    1 
ATOM   8005  C  CG    . LEU A 1  1037 ? 7.264   -51.384 59.829  1.00 77.12  ? 1037 LEU A CG    1 
ATOM   8006  C  CD1   . LEU A 1  1037 ? 8.496   -51.196 58.973  1.00 76.69  ? 1037 LEU A CD1   1 
ATOM   8007  C  CD2   . LEU A 1  1037 ? 6.033   -50.996 59.030  1.00 76.95  ? 1037 LEU A CD2   1 
ATOM   8008  N  N     . THR A 1  1038 ? 6.477   -55.370 58.661  1.00 77.58  ? 1038 THR A N     1 
ATOM   8009  C  CA    . THR A 1  1038 ? 6.978   -56.693 58.237  1.00 77.41  ? 1038 THR A CA    1 
ATOM   8010  C  C     . THR A 1  1038 ? 8.452   -56.614 57.855  1.00 77.48  ? 1038 THR A C     1 
ATOM   8011  O  O     . THR A 1  1038 ? 9.101   -55.611 58.121  1.00 77.88  ? 1038 THR A O     1 
ATOM   8012  C  CB    . THR A 1  1038 ? 6.199   -57.255 57.057  1.00 77.26  ? 1038 THR A CB    1 
ATOM   8013  O  OG1   . THR A 1  1038 ? 6.225   -56.311 55.983  1.00 77.42  ? 1038 THR A OG1   1 
ATOM   8014  C  CG2   . THR A 1  1038 ? 4.763   -57.536 57.455  1.00 77.37  ? 1038 THR A CG2   1 
ATOM   8015  N  N     . LYS A 1  1039 ? 8.986   -57.664 57.244  1.00 77.45  ? 1039 LYS A N     1 
ATOM   8016  C  CA    . LYS A 1  1039 ? 10.396  -57.668 56.870  1.00 77.51  ? 1039 LYS A CA    1 
ATOM   8017  C  C     . LYS A 1  1039 ? 10.618  -56.912 55.573  1.00 77.25  ? 1039 LYS A C     1 
ATOM   8018  O  O     . LYS A 1  1039 ? 11.556  -56.123 55.464  1.00 77.47  ? 1039 LYS A O     1 
ATOM   8019  C  CB    . LYS A 1  1039 ? 10.942  -59.094 56.776  1.00 77.77  ? 1039 LYS A CB    1 
ATOM   8020  C  CG    . LYS A 1  1039 ? 12.311  -59.232 56.103  1.00 78.83  ? 1039 LYS A CG    1 
ATOM   8021  C  CD    . LYS A 1  1039 ? 13.419  -58.449 56.814  1.00 80.03  ? 1039 LYS A CD    1 
ATOM   8022  C  CE    . LYS A 1  1039 ? 14.805  -58.884 56.328  1.00 81.15  ? 1039 LYS A CE    1 
ATOM   8023  N  NZ    . LYS A 1  1039 ? 15.820  -57.792 56.443  1.00 81.34  ? 1039 LYS A NZ    1 
ATOM   8024  N  N     . GLN A 1  1040 ? 9.758   -57.159 54.592  1.00 76.83  ? 1040 GLN A N     1 
ATOM   8025  C  CA    . GLN A 1  1040 ? 9.815   -56.447 53.319  1.00 76.42  ? 1040 GLN A CA    1 
ATOM   8026  C  C     . GLN A 1  1040 ? 9.761   -54.943 53.577  1.00 75.96  ? 1040 GLN A C     1 
ATOM   8027  O  O     . GLN A 1  1040 ? 10.728  -54.214 53.325  1.00 75.55  ? 1040 GLN A O     1 
ATOM   8028  C  CB    . GLN A 1  1040 ? 8.645   -56.886 52.439  1.00 76.44  ? 1040 GLN A CB    1 
ATOM   8029  C  CG    . GLN A 1  1040 ? 8.773   -56.521 50.986  1.00 76.46  ? 1040 GLN A CG    1 
ATOM   8030  C  CD    . GLN A 1  1040 ? 7.742   -57.234 50.156  1.00 76.53  ? 1040 GLN A CD    1 
ATOM   8031  O  OE1   . GLN A 1  1040 ? 6.602   -56.785 50.031  1.00 76.30  ? 1040 GLN A OE1   1 
ATOM   8032  N  NE2   . GLN A 1  1040 ? 8.131   -58.364 49.588  1.00 76.69  ? 1040 GLN A NE2   1 
ATOM   8033  N  N     . ALA A 1  1041 ? 8.618   -54.515 54.105  1.00 75.70  ? 1041 ALA A N     1 
ATOM   8034  C  CA    . ALA A 1  1041 ? 8.386   -53.145 54.536  1.00 75.44  ? 1041 ALA A CA    1 
ATOM   8035  C  C     . ALA A 1  1041 ? 9.611   -52.567 55.235  1.00 74.97  ? 1041 ALA A C     1 
ATOM   8036  O  O     . ALA A 1  1041 ? 10.214  -51.614 54.755  1.00 75.18  ? 1041 ALA A O     1 
ATOM   8037  C  CB    . ALA A 1  1041 ? 7.158   -53.076 55.455  1.00 75.61  ? 1041 ALA A CB    1 
ATOM   8038  N  N     . PHE A 1  1042 ? 9.996   -53.151 56.358  1.00 74.19  ? 1042 PHE A N     1 
ATOM   8039  C  CA    . PHE A 1  1042 ? 11.150  -52.648 57.078  1.00 73.39  ? 1042 PHE A CA    1 
ATOM   8040  C  C     . PHE A 1  1042 ? 12.334  -52.378 56.144  1.00 73.28  ? 1042 PHE A C     1 
ATOM   8041  O  O     . PHE A 1  1042 ? 12.827  -51.256 56.094  1.00 73.57  ? 1042 PHE A O     1 
ATOM   8042  C  CB    . PHE A 1  1042 ? 11.551  -53.586 58.216  1.00 72.90  ? 1042 PHE A CB    1 
ATOM   8043  C  CG    . PHE A 1  1042 ? 12.691  -53.088 59.006  1.00 71.45  ? 1042 PHE A CG    1 
ATOM   8044  C  CD1   . PHE A 1  1042 ? 12.496  -52.141 59.994  1.00 70.85  ? 1042 PHE A CD1   1 
ATOM   8045  C  CD2   . PHE A 1  1042 ? 13.968  -53.536 58.747  1.00 70.89  ? 1042 PHE A CD2   1 
ATOM   8046  C  CE1   . PHE A 1  1042 ? 13.553  -51.656 60.722  1.00 70.53  ? 1042 PHE A CE1   1 
ATOM   8047  C  CE2   . PHE A 1  1042 ? 15.035  -53.063 59.474  1.00 71.31  ? 1042 PHE A CE2   1 
ATOM   8048  C  CZ    . PHE A 1  1042 ? 14.827  -52.117 60.466  1.00 71.28  ? 1042 PHE A CZ    1 
ATOM   8049  N  N     . ASP A 1  1043 ? 12.765  -53.386 55.388  1.00 72.89  ? 1043 ASP A N     1 
ATOM   8050  C  CA    . ASP A 1  1043 ? 13.945  -53.246 54.530  1.00 72.57  ? 1043 ASP A CA    1 
ATOM   8051  C  C     . ASP A 1  1043 ? 13.828  -52.056 53.614  1.00 71.67  ? 1043 ASP A C     1 
ATOM   8052  O  O     . ASP A 1  1043 ? 14.827  -51.422 53.269  1.00 71.67  ? 1043 ASP A O     1 
ATOM   8053  C  CB    . ASP A 1  1043 ? 14.173  -54.502 53.695  1.00 73.19  ? 1043 ASP A CB    1 
ATOM   8054  C  CG    . ASP A 1  1043 ? 15.244  -55.404 54.285  1.00 75.02  ? 1043 ASP A CG    1 
ATOM   8055  O  OD1   . ASP A 1  1043 ? 16.158  -54.877 54.970  1.00 77.07  ? 1043 ASP A OD1   1 
ATOM   8056  O  OD2   . ASP A 1  1043 ? 15.174  -56.636 54.059  1.00 76.43  ? 1043 ASP A OD2   1 
ATOM   8057  N  N     . TRP A 1  1044 ? 12.589  -51.780 53.220  1.00 70.51  ? 1044 TRP A N     1 
ATOM   8058  C  CA    . TRP A 1  1044 ? 12.239  -50.614 52.417  1.00 69.18  ? 1044 TRP A CA    1 
ATOM   8059  C  C     . TRP A 1  1044 ? 12.370  -49.359 53.283  1.00 68.14  ? 1044 TRP A C     1 
ATOM   8060  O  O     . TRP A 1  1044 ? 13.099  -48.441 52.920  1.00 68.09  ? 1044 TRP A O     1 
ATOM   8061  C  CB    . TRP A 1  1044 ? 10.823  -50.799 51.840  1.00 69.08  ? 1044 TRP A CB    1 
ATOM   8062  C  CG    . TRP A 1  1044 ? 10.275  -49.696 50.986  1.00 68.65  ? 1044 TRP A CG    1 
ATOM   8063  C  CD1   . TRP A 1  1044 ? 10.408  -49.562 49.634  1.00 68.24  ? 1044 TRP A CD1   1 
ATOM   8064  C  CD2   . TRP A 1  1044 ? 9.448   -48.608 51.419  1.00 68.91  ? 1044 TRP A CD2   1 
ATOM   8065  N  NE1   . TRP A 1  1044 ? 9.733   -48.447 49.200  1.00 68.56  ? 1044 TRP A NE1   1 
ATOM   8066  C  CE2   . TRP A 1  1044 ? 9.135   -47.842 50.275  1.00 68.78  ? 1044 TRP A CE2   1 
ATOM   8067  C  CE3   . TRP A 1  1044 ? 8.943   -48.202 52.665  1.00 68.97  ? 1044 TRP A CE3   1 
ATOM   8068  C  CZ2   . TRP A 1  1044 ? 8.347   -46.687 50.338  1.00 68.53  ? 1044 TRP A CZ2   1 
ATOM   8069  C  CZ3   . TRP A 1  1044 ? 8.157   -47.050 52.724  1.00 68.76  ? 1044 TRP A CZ3   1 
ATOM   8070  C  CH2   . TRP A 1  1044 ? 7.875   -46.306 51.568  1.00 68.46  ? 1044 TRP A CH2   1 
ATOM   8071  N  N     . VAL A 1  1045 ? 11.713  -49.348 54.444  1.00 66.75  ? 1045 VAL A N     1 
ATOM   8072  C  CA    . VAL A 1  1045 ? 11.750  -48.200 55.343  1.00 65.39  ? 1045 VAL A CA    1 
ATOM   8073  C  C     . VAL A 1  1045 ? 13.176  -47.736 55.527  1.00 64.79  ? 1045 VAL A C     1 
ATOM   8074  O  O     . VAL A 1  1045 ? 13.433  -46.548 55.543  1.00 64.35  ? 1045 VAL A O     1 
ATOM   8075  C  CB    . VAL A 1  1045 ? 11.108  -48.503 56.688  1.00 65.18  ? 1045 VAL A CB    1 
ATOM   8076  C  CG1   . VAL A 1  1045 ? 11.136  -47.286 57.554  1.00 65.15  ? 1045 VAL A CG1   1 
ATOM   8077  C  CG2   . VAL A 1  1045 ? 9.688   -48.918 56.484  1.00 64.99  ? 1045 VAL A CG2   1 
ATOM   8078  N  N     . LEU A 1  1046 ? 14.100  -48.684 55.628  1.00 64.71  ? 1046 LEU A N     1 
ATOM   8079  C  CA    . LEU A 1  1046 ? 15.538  -48.385 55.609  1.00 64.85  ? 1046 LEU A CA    1 
ATOM   8080  C  C     . LEU A 1  1046 ? 15.981  -47.846 54.259  1.00 65.27  ? 1046 LEU A C     1 
ATOM   8081  O  O     . LEU A 1  1046 ? 16.265  -46.651 54.114  1.00 65.34  ? 1046 LEU A O     1 
ATOM   8082  C  CB    . LEU A 1  1046 ? 16.367  -49.624 55.937  1.00 64.46  ? 1046 LEU A CB    1 
ATOM   8083  C  CG    . LEU A 1  1046 ? 16.931  -49.694 57.340  1.00 63.58  ? 1046 LEU A CG    1 
ATOM   8084  C  CD1   . LEU A 1  1046 ? 15.815  -49.921 58.330  1.00 62.49  ? 1046 LEU A CD1   1 
ATOM   8085  C  CD2   . LEU A 1  1046 ? 17.947  -50.809 57.414  1.00 64.03  ? 1046 LEU A CD2   1 
ATOM   8086  N  N     . SER A 1  1047 ? 16.036  -48.743 53.275  1.00 65.66  ? 1047 SER A N     1 
ATOM   8087  C  CA    . SER A 1  1047 ? 16.362  -48.401 51.898  1.00 65.95  ? 1047 SER A CA    1 
ATOM   8088  C  C     . SER A 1  1047 ? 15.928  -46.956 51.566  1.00 66.20  ? 1047 SER A C     1 
ATOM   8089  O  O     . SER A 1  1047 ? 16.700  -46.181 50.988  1.00 66.36  ? 1047 SER A O     1 
ATOM   8090  C  CB    . SER A 1  1047 ? 15.710  -49.426 50.968  1.00 65.78  ? 1047 SER A CB    1 
ATOM   8091  O  OG    . SER A 1  1047 ? 15.933  -49.119 49.610  1.00 66.40  ? 1047 SER A OG    1 
ATOM   8092  N  N     . ASN A 1  1048 ? 14.709  -46.604 51.988  1.00 66.38  ? 1048 ASN A N     1 
ATOM   8093  C  CA    . ASN A 1  1048 ? 14.108  -45.279 51.805  1.00 66.31  ? 1048 ASN A CA    1 
ATOM   8094  C  C     . ASN A 1  1048 ? 14.884  -44.180 52.519  1.00 65.88  ? 1048 ASN A C     1 
ATOM   8095  O  O     . ASN A 1  1048 ? 15.450  -43.301 51.863  1.00 65.87  ? 1048 ASN A O     1 
ATOM   8096  C  CB    . ASN A 1  1048 ? 12.669  -45.297 52.336  1.00 66.73  ? 1048 ASN A CB    1 
ATOM   8097  C  CG    . ASN A 1  1048 ? 11.682  -44.584 51.420  1.00 67.80  ? 1048 ASN A CG    1 
ATOM   8098  O  OD1   . ASN A 1  1048 ? 11.167  -43.517 51.756  1.00 69.23  ? 1048 ASN A OD1   1 
ATOM   8099  N  ND2   . ASN A 1  1048 ? 11.393  -45.188 50.268  1.00 68.84  ? 1048 ASN A ND2   1 
ATOM   8100  N  N     . ILE A 1  1049 ? 14.892  -44.247 53.857  1.00 65.31  ? 1049 ILE A N     1 
ATOM   8101  C  CA    . ILE A 1  1049 ? 15.547  -43.266 54.724  1.00 64.65  ? 1049 ILE A CA    1 
ATOM   8102  C  C     . ILE A 1  1049 ? 16.924  -42.918 54.202  1.00 65.15  ? 1049 ILE A C     1 
ATOM   8103  O  O     . ILE A 1  1049 ? 17.153  -41.785 53.788  1.00 64.99  ? 1049 ILE A O     1 
ATOM   8104  C  CB    . ILE A 1  1049 ? 15.648  -43.764 56.174  1.00 64.11  ? 1049 ILE A CB    1 
ATOM   8105  C  CG1   . ILE A 1  1049 ? 14.433  -43.306 56.977  1.00 63.04  ? 1049 ILE A CG1   1 
ATOM   8106  C  CG2   . ILE A 1  1049 ? 16.902  -43.249 56.825  1.00 63.76  ? 1049 ILE A CG2   1 
ATOM   8107  C  CD1   . ILE A 1  1049 ? 14.257  -44.005 58.314  1.00 60.90  ? 1049 ILE A CD1   1 
ATOM   8108  N  N     . GLU A 1  1050 ? 17.816  -43.906 54.196  1.00 65.80  ? 1050 GLU A N     1 
ATOM   8109  C  CA    . GLU A 1  1050 ? 19.173  -43.766 53.666  1.00 66.78  ? 1050 GLU A CA    1 
ATOM   8110  C  C     . GLU A 1  1050 ? 19.273  -42.855 52.432  1.00 66.68  ? 1050 GLU A C     1 
ATOM   8111  O  O     . GLU A 1  1050 ? 20.130  -41.971 52.377  1.00 66.72  ? 1050 GLU A O     1 
ATOM   8112  C  CB    . GLU A 1  1050 ? 19.758  -45.148 53.373  1.00 67.35  ? 1050 GLU A CB    1 
ATOM   8113  C  CG    . GLU A 1  1050 ? 20.601  -45.261 52.099  1.00 70.40  ? 1050 GLU A CG    1 
ATOM   8114  C  CD    . GLU A 1  1050 ? 21.883  -46.069 52.308  1.00 74.88  ? 1050 GLU A CD    1 
ATOM   8115  O  OE1   . GLU A 1  1050 ? 21.810  -47.291 52.644  1.00 75.43  ? 1050 GLU A OE1   1 
ATOM   8116  O  OE2   . GLU A 1  1050 ? 22.971  -45.457 52.134  1.00 76.94  ? 1050 GLU A OE2   1 
ATOM   8117  N  N     . ALA A 1  1051 ? 18.394  -43.066 51.453  1.00 66.59  ? 1051 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1  1051 ? 18.385  -42.235 50.256  1.00 66.38  ? 1051 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1  1051 ? 17.800  -40.869 50.556  1.00 66.27  ? 1051 ALA A C     1 
ATOM   8120  O  O     . ALA A 1  1051 ? 18.442  -39.850 50.298  1.00 66.17  ? 1051 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1  1051 ? 17.615  -42.907 49.139  1.00 66.44  ? 1051 ALA A CB    1 
ATOM   8122  N  N     . GLN A 1  1052 ? 16.591  -40.865 51.123  1.00 66.23  ? 1052 GLN A N     1 
ATOM   8123  C  CA    . GLN A 1  1052 ? 15.828  -39.641 51.353  1.00 66.34  ? 1052 GLN A CA    1 
ATOM   8124  C  C     . GLN A 1  1052 ? 16.594  -38.713 52.271  1.00 66.14  ? 1052 GLN A C     1 
ATOM   8125  O  O     . GLN A 1  1052 ? 16.431  -37.483 52.233  1.00 65.68  ? 1052 GLN A O     1 
ATOM   8126  C  CB    . GLN A 1  1052 ? 14.451  -39.951 51.939  1.00 66.61  ? 1052 GLN A CB    1 
ATOM   8127  C  CG    . GLN A 1  1052 ? 13.347  -39.041 51.378  1.00 68.40  ? 1052 GLN A CG    1 
ATOM   8128  C  CD    . GLN A 1  1052 ? 12.189  -38.817 52.349  1.00 70.23  ? 1052 GLN A CD    1 
ATOM   8129  O  OE1   . GLN A 1  1052 ? 12.102  -37.769 53.011  1.00 71.75  ? 1052 GLN A OE1   1 
ATOM   8130  N  NE2   . GLN A 1  1052 ? 11.285  -39.791 52.425  1.00 70.34  ? 1052 GLN A NE2   1 
ATOM   8131  N  N     . PHE A 1  1053 ? 17.436  -39.327 53.098  1.00 66.43  ? 1053 PHE A N     1 
ATOM   8132  C  CA    . PHE A 1  1053 ? 18.409  -38.594 53.885  1.00 66.57  ? 1053 PHE A CA    1 
ATOM   8133  C  C     . PHE A 1  1053 ? 19.447  -38.021 52.934  1.00 66.88  ? 1053 PHE A C     1 
ATOM   8134  O  O     . PHE A 1  1053 ? 19.473  -36.813 52.708  1.00 67.06  ? 1053 PHE A O     1 
ATOM   8135  C  CB    . PHE A 1  1053 ? 19.077  -39.486 54.916  1.00 66.21  ? 1053 PHE A CB    1 
ATOM   8136  C  CG    . PHE A 1  1053 ? 20.105  -38.781 55.715  1.00 66.20  ? 1053 PHE A CG    1 
ATOM   8137  C  CD1   . PHE A 1  1053 ? 19.837  -38.419 57.036  1.00 66.98  ? 1053 PHE A CD1   1 
ATOM   8138  C  CD2   . PHE A 1  1053 ? 21.336  -38.447 55.152  1.00 65.88  ? 1053 PHE A CD2   1 
ATOM   8139  C  CE1   . PHE A 1  1053 ? 20.783  -37.739 57.804  1.00 66.63  ? 1053 PHE A CE1   1 
ATOM   8140  C  CE2   . PHE A 1  1053 ? 22.289  -37.759 55.899  1.00 66.95  ? 1053 PHE A CE2   1 
ATOM   8141  C  CZ    . PHE A 1  1053 ? 22.013  -37.405 57.235  1.00 66.88  ? 1053 PHE A CZ    1 
ATOM   8142  N  N     . LEU A 1  1054 ? 20.276  -38.895 52.364  1.00 66.93  ? 1054 LEU A N     1 
ATOM   8143  C  CA    . LEU A 1  1054 ? 21.276  -38.506 51.374  1.00 67.05  ? 1054 LEU A CA    1 
ATOM   8144  C  C     . LEU A 1  1054 ? 20.897  -37.360 50.412  1.00 67.26  ? 1054 LEU A C     1 
ATOM   8145  O  O     . LEU A 1  1054 ? 21.792  -36.630 49.952  1.00 67.35  ? 1054 LEU A O     1 
ATOM   8146  C  CB    . LEU A 1  1054 ? 21.718  -39.725 50.587  1.00 66.95  ? 1054 LEU A CB    1 
ATOM   8147  C  CG    . LEU A 1  1054 ? 23.030  -40.285 51.110  1.00 67.15  ? 1054 LEU A CG    1 
ATOM   8148  C  CD1   . LEU A 1  1054 ? 23.131  -41.802 50.947  1.00 67.09  ? 1054 LEU A CD1   1 
ATOM   8149  C  CD2   . LEU A 1  1054 ? 24.174  -39.575 50.412  1.00 68.09  ? 1054 LEU A CD2   1 
ATOM   8150  N  N     . ARG A 1  1055 ? 19.599  -37.206 50.121  1.00 67.26  ? 1055 ARG A N     1 
ATOM   8151  C  CA    . ARG A 1  1055 ? 19.095  -36.055 49.347  1.00 67.73  ? 1055 ARG A CA    1 
ATOM   8152  C  C     . ARG A 1  1055 ? 19.010  -34.746 50.128  1.00 67.45  ? 1055 ARG A C     1 
ATOM   8153  O  O     . ARG A 1  1055 ? 18.715  -33.698 49.541  1.00 67.65  ? 1055 ARG A O     1 
ATOM   8154  C  CB    . ARG A 1  1055 ? 17.712  -36.322 48.758  1.00 68.02  ? 1055 ARG A CB    1 
ATOM   8155  C  CG    . ARG A 1  1055 ? 17.701  -37.191 47.513  1.00 70.51  ? 1055 ARG A CG    1 
ATOM   8156  C  CD    . ARG A 1  1055 ? 16.374  -37.040 46.755  1.00 73.60  ? 1055 ARG A CD    1 
ATOM   8157  N  NE    . ARG A 1  1055 ? 15.749  -38.326 46.414  1.00 75.63  ? 1055 ARG A NE    1 
ATOM   8158  C  CZ    . ARG A 1  1055 ? 14.756  -38.890 47.109  1.00 77.36  ? 1055 ARG A CZ    1 
ATOM   8159  N  NH1   . ARG A 1  1055 ? 14.261  -38.286 48.192  1.00 78.32  ? 1055 ARG A NH1   1 
ATOM   8160  N  NH2   . ARG A 1  1055 ? 14.246  -40.056 46.720  1.00 78.17  ? 1055 ARG A NH2   1 
ATOM   8161  N  N     . SER A 1  1056 ? 19.251  -34.797 51.436  1.00 67.02  ? 1056 SER A N     1 
ATOM   8162  C  CA    . SER A 1  1056 ? 19.118  -33.606 52.281  1.00 66.54  ? 1056 SER A CA    1 
ATOM   8163  C  C     . SER A 1  1056 ? 20.454  -32.896 52.557  1.00 65.88  ? 1056 SER A C     1 
ATOM   8164  O  O     . SER A 1  1056 ? 20.465  -31.783 53.076  1.00 66.33  ? 1056 SER A O     1 
ATOM   8165  C  CB    . SER A 1  1056 ? 18.375  -33.938 53.590  1.00 66.90  ? 1056 SER A CB    1 
ATOM   8166  O  OG    . SER A 1  1056 ? 17.005  -34.287 53.365  1.00 67.58  ? 1056 SER A OG    1 
ATOM   8167  N  N     . VAL A 1  1057 ? 21.573  -33.525 52.210  1.00 64.80  ? 1057 VAL A N     1 
ATOM   8168  C  CA    . VAL A 1  1057 ? 22.884  -32.863 52.269  1.00 63.79  ? 1057 VAL A CA    1 
ATOM   8169  C  C     . VAL A 1  1057 ? 22.941  -31.591 51.387  1.00 63.59  ? 1057 VAL A C     1 
ATOM   8170  O  O     . VAL A 1  1057 ? 22.382  -31.575 50.276  1.00 63.54  ? 1057 VAL A O     1 
ATOM   8171  C  CB    . VAL A 1  1057 ? 24.002  -33.864 51.898  1.00 63.58  ? 1057 VAL A CB    1 
ATOM   8172  C  CG1   . VAL A 1  1057 ? 25.247  -33.177 51.356  1.00 63.45  ? 1057 VAL A CG1   1 
ATOM   8173  C  CG2   . VAL A 1  1057 ? 24.363  -34.666 53.097  1.00 63.49  ? 1057 VAL A CG2   1 
ATOM   8174  N  N     . VAL A 1  1058 ? 23.596  -30.534 51.897  1.00 63.06  ? 1058 VAL A N     1 
ATOM   8175  C  CA    . VAL A 1  1058 ? 23.825  -29.268 51.151  1.00 62.32  ? 1058 VAL A CA    1 
ATOM   8176  C  C     . VAL A 1  1058 ? 24.614  -29.539 49.893  1.00 62.10  ? 1058 VAL A C     1 
ATOM   8177  O  O     . VAL A 1  1058 ? 25.443  -30.438 49.882  1.00 62.44  ? 1058 VAL A O     1 
ATOM   8178  C  CB    . VAL A 1  1058 ? 24.706  -28.280 51.926  1.00 61.92  ? 1058 VAL A CB    1 
ATOM   8179  C  CG1   . VAL A 1  1058 ? 24.298  -26.873 51.606  1.00 61.80  ? 1058 VAL A CG1   1 
ATOM   8180  C  CG2   . VAL A 1  1058 ? 24.620  -28.513 53.396  1.00 61.63  ? 1058 VAL A CG2   1 
ATOM   8181  N  N     . HIS A 1  1059 ? 24.404  -28.753 48.849  1.00 61.73  ? 1059 HIS A N     1 
ATOM   8182  C  CA    . HIS A 1  1059 ? 25.195  -28.942 47.643  1.00 61.78  ? 1059 HIS A CA    1 
ATOM   8183  C  C     . HIS A 1  1059 ? 26.456  -28.085 47.582  1.00 61.53  ? 1059 HIS A C     1 
ATOM   8184  O  O     . HIS A 1  1059 ? 26.390  -26.869 47.764  1.00 61.25  ? 1059 HIS A O     1 
ATOM   8185  C  CB    . HIS A 1  1059 ? 24.340  -28.718 46.413  1.00 62.18  ? 1059 HIS A CB    1 
ATOM   8186  C  CG    . HIS A 1  1059 ? 23.494  -29.894 46.050  1.00 63.53  ? 1059 HIS A CG    1 
ATOM   8187  N  ND1   . HIS A 1  1059 ? 23.152  -30.192 44.748  1.00 64.51  ? 1059 HIS A ND1   1 
ATOM   8188  C  CD2   . HIS A 1  1059 ? 22.928  -30.853 46.819  1.00 65.27  ? 1059 HIS A CD2   1 
ATOM   8189  C  CE1   . HIS A 1  1059 ? 22.409  -31.282 44.729  1.00 65.93  ? 1059 HIS A CE1   1 
ATOM   8190  N  NE2   . HIS A 1  1059 ? 22.260  -31.706 45.973  1.00 66.93  ? 1059 HIS A NE2   1 
ATOM   8191  N  N     . PRO A 1  1060 ? 27.629  -28.725 47.388  1.00 61.64  ? 1060 PRO A N     1 
ATOM   8192  C  CA    . PRO A 1  1060 ? 28.801  -27.953 46.967  1.00 61.71  ? 1060 PRO A CA    1 
ATOM   8193  C  C     . PRO A 1  1060 ? 28.552  -27.108 45.699  1.00 61.64  ? 1060 PRO A C     1 
ATOM   8194  O  O     . PRO A 1  1060 ? 28.208  -27.637 44.615  1.00 61.08  ? 1060 PRO A O     1 
ATOM   8195  C  CB    . PRO A 1  1060 ? 29.875  -29.028 46.783  1.00 61.64  ? 1060 PRO A CB    1 
ATOM   8196  C  CG    . PRO A 1  1060 ? 29.488  -30.082 47.792  1.00 61.36  ? 1060 PRO A CG    1 
ATOM   8197  C  CD    . PRO A 1  1060 ? 27.989  -30.135 47.647  1.00 61.58  ? 1060 PRO A CD    1 
ATOM   8198  N  N     . GLY A 1  1061 ? 28.736  -25.798 45.886  1.00 61.50  ? 1061 GLY A N     1 
ATOM   8199  C  CA    . GLY A 1  1061 ? 28.246  -24.782 44.982  1.00 61.85  ? 1061 GLY A CA    1 
ATOM   8200  C  C     . GLY A 1  1061 ? 27.475  -23.736 45.771  1.00 62.19  ? 1061 GLY A C     1 
ATOM   8201  O  O     . GLY A 1  1061 ? 27.953  -22.609 45.929  1.00 62.60  ? 1061 GLY A O     1 
ATOM   8202  N  N     . GLU A 1  1062 ? 26.288  -24.115 46.261  1.00 62.20  ? 1062 GLU A N     1 
ATOM   8203  C  CA    . GLU A 1  1062 ? 25.402  -23.277 47.103  1.00 62.29  ? 1062 GLU A CA    1 
ATOM   8204  C  C     . GLU A 1  1062 ? 26.022  -22.031 47.713  1.00 61.84  ? 1062 GLU A C     1 
ATOM   8205  O  O     . GLU A 1  1062 ? 26.883  -22.122 48.584  1.00 62.09  ? 1062 GLU A O     1 
ATOM   8206  C  CB    . GLU A 1  1062 ? 24.861  -24.111 48.249  1.00 62.47  ? 1062 GLU A CB    1 
ATOM   8207  C  CG    . GLU A 1  1062 ? 23.646  -24.929 47.896  1.00 65.18  ? 1062 GLU A CG    1 
ATOM   8208  C  CD    . GLU A 1  1062 ? 22.359  -24.207 48.207  1.00 67.97  ? 1062 GLU A CD    1 
ATOM   8209  O  OE1   . GLU A 1  1062 ? 22.394  -23.345 49.124  1.00 68.41  ? 1062 GLU A OE1   1 
ATOM   8210  O  OE2   . GLU A 1  1062 ? 21.330  -24.505 47.540  1.00 69.26  ? 1062 GLU A OE2   1 
ATOM   8211  N  N     . MET A 1  1063 ? 25.559  -20.868 47.293  1.00 61.22  ? 1063 MET A N     1 
ATOM   8212  C  CA    . MET A 1  1063 ? 26.188  -19.651 47.731  1.00 61.04  ? 1063 MET A CA    1 
ATOM   8213  C  C     . MET A 1  1063 ? 25.666  -19.165 49.068  1.00 61.30  ? 1063 MET A C     1 
ATOM   8214  O  O     . MET A 1  1063 ? 25.104  -18.087 49.170  1.00 61.26  ? 1063 MET A O     1 
ATOM   8215  C  CB    . MET A 1  1063 ? 26.019  -18.596 46.664  1.00 60.93  ? 1063 MET A CB    1 
ATOM   8216  C  CG    . MET A 1  1063 ? 26.818  -18.897 45.411  1.00 60.99  ? 1063 MET A CG    1 
ATOM   8217  S  SD    . MET A 1  1063 ? 28.614  -18.773 45.568  1.00 59.10  ? 1063 MET A SD    1 
ATOM   8218  C  CE    . MET A 1  1063 ? 28.787  -17.255 46.535  1.00 59.79  ? 1063 MET A CE    1 
ATOM   8219  N  N     . VAL A 1  1064 ? 25.900  -19.940 50.115  1.00 61.99  ? 1064 VAL A N     1 
ATOM   8220  C  CA    . VAL A 1  1064 ? 25.181  -19.719 51.370  1.00 63.02  ? 1064 VAL A CA    1 
ATOM   8221  C  C     . VAL A 1  1064 ? 25.585  -18.488 52.203  1.00 63.62  ? 1064 VAL A C     1 
ATOM   8222  O  O     . VAL A 1  1064 ? 25.311  -18.412 53.419  1.00 63.87  ? 1064 VAL A O     1 
ATOM   8223  C  CB    . VAL A 1  1064 ? 25.136  -20.990 52.228  1.00 62.90  ? 1064 VAL A CB    1 
ATOM   8224  C  CG1   . VAL A 1  1064 ? 24.286  -20.748 53.458  1.00 63.11  ? 1064 VAL A CG1   1 
ATOM   8225  C  CG2   . VAL A 1  1064 ? 24.529  -22.124 51.418  1.00 63.26  ? 1064 VAL A CG2   1 
ATOM   8226  N  N     . GLY A 1  1065 ? 26.216  -17.516 51.546  1.00 63.95  ? 1065 GLY A N     1 
ATOM   8227  C  CA    . GLY A 1  1065 ? 26.417  -16.211 52.158  1.00 64.10  ? 1065 GLY A CA    1 
ATOM   8228  C  C     . GLY A 1  1065 ? 25.139  -15.452 51.893  1.00 64.09  ? 1065 GLY A C     1 
ATOM   8229  O  O     . GLY A 1  1065 ? 24.224  -15.407 52.727  1.00 64.07  ? 1065 GLY A O     1 
ATOM   8230  N  N     . VAL A 1  1066 ? 25.083  -14.891 50.695  1.00 63.91  ? 1066 VAL A N     1 
ATOM   8231  C  CA    . VAL A 1  1066 ? 23.926  -14.196 50.202  1.00 63.99  ? 1066 VAL A CA    1 
ATOM   8232  C  C     . VAL A 1  1066 ? 22.650  -14.787 50.753  1.00 64.71  ? 1066 VAL A C     1 
ATOM   8233  O  O     . VAL A 1  1066 ? 21.758  -14.054 51.170  1.00 64.82  ? 1066 VAL A O     1 
ATOM   8234  C  CB    . VAL A 1  1066 ? 23.885  -14.306 48.700  1.00 63.79  ? 1066 VAL A CB    1 
ATOM   8235  C  CG1   . VAL A 1  1066 ? 22.761  -13.462 48.141  1.00 63.24  ? 1066 VAL A CG1   1 
ATOM   8236  C  CG2   . VAL A 1  1066 ? 25.233  -13.906 48.139  1.00 63.54  ? 1066 VAL A CG2   1 
ATOM   8237  N  N     . LEU A 1  1067 ? 22.573  -16.117 50.761  1.00 65.52  ? 1067 LEU A N     1 
ATOM   8238  C  CA    . LEU A 1  1067 ? 21.386  -16.805 51.238  1.00 66.30  ? 1067 LEU A CA    1 
ATOM   8239  C  C     . LEU A 1  1067 ? 21.080  -16.341 52.647  1.00 66.79  ? 1067 LEU A C     1 
ATOM   8240  O  O     . LEU A 1  1067 ? 19.988  -15.853 52.910  1.00 67.23  ? 1067 LEU A O     1 
ATOM   8241  C  CB    . LEU A 1  1067 ? 21.582  -18.322 51.228  1.00 66.43  ? 1067 LEU A CB    1 
ATOM   8242  C  CG    . LEU A 1  1067 ? 20.368  -19.280 51.231  1.00 66.97  ? 1067 LEU A CG    1 
ATOM   8243  C  CD1   . LEU A 1  1067 ? 18.982  -18.588 51.413  1.00 66.40  ? 1067 LEU A CD1   1 
ATOM   8244  C  CD2   . LEU A 1  1067 ? 20.377  -20.163 49.975  1.00 67.17  ? 1067 LEU A CD2   1 
ATOM   8245  N  N     . ALA A 1  1068 ? 22.057  -16.468 53.540  1.00 67.24  ? 1068 ALA A N     1 
ATOM   8246  C  CA    . ALA A 1  1068 ? 21.847  -16.175 54.960  1.00 67.70  ? 1068 ALA A CA    1 
ATOM   8247  C  C     . ALA A 1  1068 ? 21.666  -14.692 55.272  1.00 67.68  ? 1068 ALA A C     1 
ATOM   8248  O  O     . ALA A 1  1068 ? 21.195  -14.328 56.348  1.00 67.72  ? 1068 ALA A O     1 
ATOM   8249  C  CB    . ALA A 1  1068 ? 22.977  -16.757 55.788  1.00 67.99  ? 1068 ALA A CB    1 
ATOM   8250  N  N     . ALA A 1  1069 ? 22.039  -13.840 54.332  1.00 67.84  ? 1069 ALA A N     1 
ATOM   8251  C  CA    . ALA A 1  1069 ? 21.830  -12.414 54.509  1.00 68.56  ? 1069 ALA A CA    1 
ATOM   8252  C  C     . ALA A 1  1069 ? 20.352  -12.061 54.322  1.00 68.87  ? 1069 ALA A C     1 
ATOM   8253  O  O     . ALA A 1  1069 ? 19.712  -11.482 55.221  1.00 69.02  ? 1069 ALA A O     1 
ATOM   8254  C  CB    . ALA A 1  1069 ? 22.703  -11.624 53.533  1.00 68.62  ? 1069 ALA A CB    1 
ATOM   8255  N  N     . GLN A 1  1070 ? 19.842  -12.415 53.137  1.00 68.93  ? 1070 GLN A N     1 
ATOM   8256  C  CA    . GLN A 1  1070 ? 18.459  -12.215 52.739  1.00 68.65  ? 1070 GLN A CA    1 
ATOM   8257  C  C     . GLN A 1  1070 ? 17.591  -12.868 53.775  1.00 68.86  ? 1070 GLN A C     1 
ATOM   8258  O  O     . GLN A 1  1070 ? 16.650  -12.280 54.280  1.00 68.97  ? 1070 GLN A O     1 
ATOM   8259  C  CB    . GLN A 1  1070 ? 18.188  -12.909 51.403  1.00 68.65  ? 1070 GLN A CB    1 
ATOM   8260  C  CG    . GLN A 1  1070 ? 19.188  -12.635 50.289  1.00 68.15  ? 1070 GLN A CG    1 
ATOM   8261  C  CD    . GLN A 1  1070 ? 18.687  -13.114 48.939  1.00 68.29  ? 1070 GLN A CD    1 
ATOM   8262  O  OE1   . GLN A 1  1070 ? 18.178  -14.230 48.803  1.00 67.28  ? 1070 GLN A OE1   1 
ATOM   8263  N  NE2   . GLN A 1  1070 ? 18.816  -12.259 47.931  1.00 68.77  ? 1070 GLN A NE2   1 
ATOM   8264  N  N     . SER A 1  1071 ? 17.939  -14.098 54.104  1.00 69.21  ? 1071 SER A N     1 
ATOM   8265  C  CA    . SER A 1  1071 ? 17.156  -14.881 55.011  1.00 69.72  ? 1071 SER A CA    1 
ATOM   8266  C  C     . SER A 1  1071 ? 16.970  -14.192 56.354  1.00 70.02  ? 1071 SER A C     1 
ATOM   8267  O  O     . SER A 1  1071 ? 15.906  -14.309 56.947  1.00 70.25  ? 1071 SER A O     1 
ATOM   8268  C  CB    . SER A 1  1071 ? 17.744  -16.282 55.120  1.00 69.82  ? 1071 SER A CB    1 
ATOM   8269  O  OG    . SER A 1  1071 ? 17.611  -16.928 53.852  1.00 70.11  ? 1071 SER A OG    1 
ATOM   8270  N  N     . ILE A 1  1072 ? 17.952  -13.419 56.804  1.00 70.48  ? 1072 ILE A N     1 
ATOM   8271  C  CA    . ILE A 1  1072 ? 17.713  -12.537 57.958  1.00 71.28  ? 1072 ILE A CA    1 
ATOM   8272  C  C     . ILE A 1  1072 ? 17.156  -11.142 57.573  1.00 72.10  ? 1072 ILE A C     1 
ATOM   8273  O  O     . ILE A 1  1072 ? 16.522  -10.469 58.398  1.00 72.22  ? 1072 ILE A O     1 
ATOM   8274  C  CB    . ILE A 1  1072 ? 18.945  -12.431 58.882  1.00 71.14  ? 1072 ILE A CB    1 
ATOM   8275  C  CG1   . ILE A 1  1072 ? 19.430  -13.842 59.239  1.00 71.67  ? 1072 ILE A CG1   1 
ATOM   8276  C  CG2   . ILE A 1  1072 ? 18.595  -11.660 60.152  1.00 70.33  ? 1072 ILE A CG2   1 
ATOM   8277  C  CD1   . ILE A 1  1072 ? 20.876  -13.943 59.665  1.00 71.63  ? 1072 ILE A CD1   1 
ATOM   8278  N  N     . GLY A 1  1073 ? 17.372  -10.730 56.321  1.00 72.92  ? 1073 GLY A N     1 
ATOM   8279  C  CA    . GLY A 1  1073 ? 16.918  -9.422  55.809  1.00 73.81  ? 1073 GLY A CA    1 
ATOM   8280  C  C     . GLY A 1  1073 ? 15.414  -9.226  55.684  1.00 74.50  ? 1073 GLY A C     1 
ATOM   8281  O  O     . GLY A 1  1073 ? 14.839  -8.387  56.375  1.00 74.26  ? 1073 GLY A O     1 
ATOM   8282  N  N     . GLU A 1  1074 ? 14.785  -9.995  54.794  1.00 75.42  ? 1074 GLU A N     1 
ATOM   8283  C  CA    . GLU A 1  1074 ? 13.327  -10.003 54.625  1.00 76.53  ? 1074 GLU A CA    1 
ATOM   8284  C  C     . GLU A 1  1074 ? 12.493  -9.786  55.896  1.00 77.53  ? 1074 GLU A C     1 
ATOM   8285  O  O     . GLU A 1  1074 ? 11.801  -8.787  55.966  1.00 77.55  ? 1074 GLU A O     1 
ATOM   8286  C  CB    . GLU A 1  1074 ? 12.844  -11.265 53.911  1.00 76.27  ? 1074 GLU A CB    1 
ATOM   8287  C  CG    . GLU A 1  1074 ? 11.417  -11.148 53.352  1.00 78.01  ? 1074 GLU A CG    1 
ATOM   8288  C  CD    . GLU A 1  1074 ? 10.259  -11.413 54.362  1.00 79.97  ? 1074 GLU A CD    1 
ATOM   8289  O  OE1   . GLU A 1  1074 ? 10.515  -11.709 55.549  1.00 80.41  ? 1074 GLU A OE1   1 
ATOM   8290  O  OE2   . GLU A 1  1074 ? 9.067   -11.324 53.955  1.00 79.98  ? 1074 GLU A OE2   1 
ATOM   8291  N  N     . PRO A 1  1075 ? 12.531  -10.714 56.894  1.00 78.81  ? 1075 PRO A N     1 
ATOM   8292  C  CA    . PRO A 1  1075 ? 11.549  -10.528 57.969  1.00 79.83  ? 1075 PRO A CA    1 
ATOM   8293  C  C     . PRO A 1  1075 ? 11.800  -9.266  58.785  1.00 81.29  ? 1075 PRO A C     1 
ATOM   8294  O  O     . PRO A 1  1075 ? 10.874  -8.769  59.426  1.00 81.69  ? 1075 PRO A O     1 
ATOM   8295  C  CB    . PRO A 1  1075 ? 11.708  -11.784 58.824  1.00 79.46  ? 1075 PRO A CB    1 
ATOM   8296  C  CG    . PRO A 1  1075 ? 13.088  -12.225 58.588  1.00 78.91  ? 1075 PRO A CG    1 
ATOM   8297  C  CD    . PRO A 1  1075 ? 13.384  -11.893 57.154  1.00 78.90  ? 1075 PRO A CD    1 
ATOM   8298  N  N     . ALA A 1  1076 ? 13.024  -8.741  58.739  1.00 82.76  ? 1076 ALA A N     1 
ATOM   8299  C  CA    . ALA A 1  1076 ? 13.304  -7.425  59.296  1.00 84.32  ? 1076 ALA A CA    1 
ATOM   8300  C  C     . ALA A 1  1076 ? 12.440  -6.366  58.604  1.00 85.42  ? 1076 ALA A C     1 
ATOM   8301  O  O     . ALA A 1  1076 ? 11.907  -5.472  59.246  1.00 85.53  ? 1076 ALA A O     1 
ATOM   8302  C  CB    . ALA A 1  1076 ? 14.780  -7.092  59.170  1.00 84.37  ? 1076 ALA A CB    1 
ATOM   8303  N  N     . THR A 1  1077 ? 12.281  -6.496  57.295  1.00 87.00  ? 1077 THR A N     1 
ATOM   8304  C  CA    . THR A 1  1077 ? 11.425  -5.606  56.523  1.00 88.89  ? 1077 THR A CA    1 
ATOM   8305  C  C     . THR A 1  1077 ? 9.933   -5.787  56.857  1.00 90.10  ? 1077 THR A C     1 
ATOM   8306  O  O     . THR A 1  1077 ? 9.072   -5.120  56.284  1.00 90.30  ? 1077 THR A O     1 
ATOM   8307  C  CB    . THR A 1  1077 ? 11.638  -5.836  55.009  1.00 88.89  ? 1077 THR A CB    1 
ATOM   8308  O  OG1   . THR A 1  1077 ? 12.991  -6.253  54.769  1.00 88.92  ? 1077 THR A OG1   1 
ATOM   8309  C  CG2   . THR A 1  1077 ? 11.342  -4.566  54.220  1.00 89.70  ? 1077 THR A CG2   1 
ATOM   8310  N  N     . GLN A 1  1078 ? 9.621   -6.694  57.773  1.00 91.74  ? 1078 GLN A N     1 
ATOM   8311  C  CA    . GLN A 1  1078 ? 8.237   -6.906  58.163  1.00 93.74  ? 1078 GLN A CA    1 
ATOM   8312  C  C     . GLN A 1  1078 ? 8.063   -6.496  59.615  1.00 94.79  ? 1078 GLN A C     1 
ATOM   8313  O  O     . GLN A 1  1078 ? 7.374   -7.169  60.386  1.00 95.24  ? 1078 GLN A O     1 
ATOM   8314  C  CB    . GLN A 1  1078 ? 7.836   -8.371  57.982  1.00 94.00  ? 1078 GLN A CB    1 
ATOM   8315  C  CG    . GLN A 1  1078 ? 8.337   -9.020  56.690  1.00 96.08  ? 1078 GLN A CG    1 
ATOM   8316  C  CD    . GLN A 1  1078 ? 7.425   -8.782  55.489  1.00 97.98  ? 1078 GLN A CD    1 
ATOM   8317  O  OE1   . GLN A 1  1078 ? 6.494   -9.559  55.235  1.00 98.16  ? 1078 GLN A OE1   1 
ATOM   8318  N  NE2   . GLN A 1  1078 ? 7.710   -7.722  54.724  1.00 98.52  ? 1078 GLN A NE2   1 
ATOM   8319  N  N     . MET A 1  1079 ? 8.712   -5.402  59.997  1.00 96.06  ? 1079 MET A N     1 
ATOM   8320  C  CA    . MET A 1  1079 ? 8.618   -4.908  61.364  1.00 97.19  ? 1079 MET A CA    1 
ATOM   8321  C  C     . MET A 1  1079 ? 8.207   -3.448  61.375  1.00 98.54  ? 1079 MET A C     1 
ATOM   8322  O  O     . MET A 1  1079 ? 8.931   -2.575  60.866  1.00 98.84  ? 1079 MET A O     1 
ATOM   8323  C  CB    . MET A 1  1079 ? 9.934   -5.083  62.126  1.00 97.00  ? 1079 MET A CB    1 
ATOM   8324  C  CG    . MET A 1  1079 ? 10.437  -6.502  62.200  1.00 96.77  ? 1079 MET A CG    1 
ATOM   8325  S  SD    . MET A 1  1079 ? 11.898  -6.649  63.230  1.00 96.45  ? 1079 MET A SD    1 
ATOM   8326  C  CE    . MET A 1  1079 ? 12.537  -8.218  62.653  1.00 95.83  ? 1079 MET A CE    1 
ATOM   8327  N  N     . THR A 1  1080 ? 7.027   -3.211  61.951  1.00 99.90  ? 1080 THR A N     1 
ATOM   8328  C  CA    . THR A 1  1080 ? 6.484   -1.870  62.216  1.00 100.90 ? 1080 THR A CA    1 
ATOM   8329  C  C     . THR A 1  1080 ? 5.791   -1.913  63.612  1.00 101.59 ? 1080 THR A C     1 
ATOM   8330  O  O     . THR A 1  1080 ? 5.368   -2.992  64.068  1.00 101.72 ? 1080 THR A O     1 
ATOM   8331  C  CB    . THR A 1  1080 ? 5.488   -1.407  61.059  1.00 100.84 ? 1080 THR A CB    1 
ATOM   8332  O  OG1   . THR A 1  1080 ? 5.969   -1.833  59.772  1.00 100.38 ? 1080 THR A OG1   1 
ATOM   8333  C  CG2   . THR A 1  1080 ? 5.288   0.120   61.042  1.00 100.58 ? 1080 THR A CG2   1 
ATOM   8334  N  N     . LEU A 1  1081 ? 5.710   -0.769  64.302  1.00 102.24 ? 1081 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1  1081 ? 4.799   -0.624  65.464  1.00 102.83 ? 1081 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1  1081 ? 4.067   0.728   65.501  1.00 103.06 ? 1081 LEU A C     1 
ATOM   8337  O  O     . LEU A 1  1081 ? 2.991   0.891   64.904  1.00 103.34 ? 1081 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1  1081 ? 5.507   -0.892  66.807  1.00 102.94 ? 1081 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1  1081 ? 5.419   -2.301  67.425  1.00 103.60 ? 1081 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1  1081 ? 6.069   -2.363  68.823  1.00 103.28 ? 1081 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1  1081 ? 3.965   -2.824  67.474  1.00 104.61 ? 1081 LEU A CD2   1 
ATOM   8342  N  N     . LYS A 1  1092 ? 6.866   -4.245  80.145  1.00 111.15 ? 1092 LYS A N     1 
ATOM   8343  C  CA    . LYS A 1  1092 ? 6.901   -4.101  78.683  1.00 111.25 ? 1092 LYS A CA    1 
ATOM   8344  C  C     . LYS A 1  1092 ? 7.705   -2.877  78.212  1.00 110.96 ? 1092 LYS A C     1 
ATOM   8345  O  O     . LYS A 1  1092 ? 7.136   -1.908  77.667  1.00 111.13 ? 1092 LYS A O     1 
ATOM   8346  C  CB    . LYS A 1  1092 ? 5.478   -4.084  78.072  1.00 111.40 ? 1092 LYS A CB    1 
ATOM   8347  C  CG    . LYS A 1  1092 ? 4.663   -5.364  78.270  1.00 111.64 ? 1092 LYS A CG    1 
ATOM   8348  C  CD    . LYS A 1  1092 ? 5.363   -6.605  77.711  1.00 111.52 ? 1092 LYS A CD    1 
ATOM   8349  C  CE    . LYS A 1  1092 ? 4.698   -7.872  78.218  1.00 111.24 ? 1092 LYS A CE    1 
ATOM   8350  N  NZ    . LYS A 1  1092 ? 3.277   -7.941  77.773  1.00 111.52 ? 1092 LYS A NZ    1 
ATOM   8351  N  N     . LYS A 1  1093 ? 9.020   -2.929  78.444  1.00 110.25 ? 1093 LYS A N     1 
ATOM   8352  C  CA    . LYS A 1  1093 ? 9.969   -1.962  77.875  1.00 109.43 ? 1093 LYS A CA    1 
ATOM   8353  C  C     . LYS A 1  1093 ? 11.313  -2.667  77.602  1.00 108.42 ? 1093 LYS A C     1 
ATOM   8354  O  O     . LYS A 1  1093 ? 11.875  -3.311  78.489  1.00 108.40 ? 1093 LYS A O     1 
ATOM   8355  C  CB    . LYS A 1  1093 ? 10.163  -0.721  78.784  1.00 109.83 ? 1093 LYS A CB    1 
ATOM   8356  C  CG    . LYS A 1  1093 ? 8.933   0.218   79.000  1.00 110.14 ? 1093 LYS A CG    1 
ATOM   8357  C  CD    . LYS A 1  1093 ? 8.173   -0.111  80.311  1.00 110.72 ? 1093 LYS A CD    1 
ATOM   8358  C  CE    . LYS A 1  1093 ? 7.277   1.040   80.800  1.00 110.51 ? 1093 LYS A CE    1 
ATOM   8359  N  NZ    . LYS A 1  1093 ? 8.026   2.073   81.588  1.00 110.26 ? 1093 LYS A NZ    1 
ATOM   8360  N  N     . VAL A 1  1094 ? 11.784  -2.571  76.359  1.00 107.06 ? 1094 VAL A N     1 
ATOM   8361  C  CA    . VAL A 1  1094 ? 13.083  -3.089  75.915  1.00 105.67 ? 1094 VAL A CA    1 
ATOM   8362  C  C     . VAL A 1  1094 ? 13.273  -2.709  74.450  1.00 104.84 ? 1094 VAL A C     1 
ATOM   8363  O  O     . VAL A 1  1094 ? 12.319  -2.779  73.667  1.00 104.80 ? 1094 VAL A O     1 
ATOM   8364  C  CB    . VAL A 1  1094 ? 13.208  -4.634  76.038  1.00 105.64 ? 1094 VAL A CB    1 
ATOM   8365  C  CG1   . VAL A 1  1094 ? 13.787  -5.035  77.394  1.00 105.37 ? 1094 VAL A CG1   1 
ATOM   8366  C  CG2   . VAL A 1  1094 ? 11.876  -5.331  75.756  1.00 105.50 ? 1094 VAL A CG2   1 
ATOM   8367  N  N     . THR A 1  1095 ? 14.489  -2.296  74.081  1.00 103.66 ? 1095 THR A N     1 
ATOM   8368  C  CA    . THR A 1  1095 ? 14.803  -1.992  72.677  1.00 102.35 ? 1095 THR A CA    1 
ATOM   8369  C  C     . THR A 1  1095 ? 14.601  -3.235  71.815  1.00 101.59 ? 1095 THR A C     1 
ATOM   8370  O  O     . THR A 1  1095 ? 15.420  -4.149  71.830  1.00 101.64 ? 1095 THR A O     1 
ATOM   8371  C  CB    . THR A 1  1095 ? 16.233  -1.416  72.477  1.00 102.34 ? 1095 THR A CB    1 
ATOM   8372  O  OG1   . THR A 1  1095 ? 17.066  -1.749  73.600  1.00 101.96 ? 1095 THR A OG1   1 
ATOM   8373  C  CG2   . THR A 1  1095 ? 16.174  0.091   72.319  1.00 102.00 ? 1095 THR A CG2   1 
ATOM   8374  N  N     . SER A 1  1096 ? 13.475  -3.274  71.105  1.00 100.50 ? 1096 SER A N     1 
ATOM   8375  C  CA    . SER A 1  1096 ? 13.128  -4.386  70.211  1.00 99.23  ? 1096 SER A CA    1 
ATOM   8376  C  C     . SER A 1  1096 ? 12.763  -3.834  68.835  1.00 98.30  ? 1096 SER A C     1 
ATOM   8377  O  O     . SER A 1  1096 ? 12.646  -2.617  68.658  1.00 98.38  ? 1096 SER A O     1 
ATOM   8378  C  CB    . SER A 1  1096 ? 11.965  -5.212  70.781  1.00 99.23  ? 1096 SER A CB    1 
ATOM   8379  O  OG    . SER A 1  1096 ? 10.721  -4.545  70.621  1.00 99.31  ? 1096 SER A OG    1 
ATOM   8380  N  N     . GLY A 1  1097 ? 12.576  -4.729  67.867  1.00 97.09  ? 1097 GLY A N     1 
ATOM   8381  C  CA    . GLY A 1  1097 ? 12.245  -4.327  66.494  1.00 95.37  ? 1097 GLY A CA    1 
ATOM   8382  C  C     . GLY A 1  1097 ? 13.457  -3.822  65.733  1.00 94.06  ? 1097 GLY A C     1 
ATOM   8383  O  O     . GLY A 1  1097 ? 14.595  -3.947  66.207  1.00 94.36  ? 1097 GLY A O     1 
ATOM   8384  N  N     . VAL A 1  1098 ? 13.218  -3.235  64.564  1.00 92.39  ? 1098 VAL A N     1 
ATOM   8385  C  CA    . VAL A 1  1098 ? 14.307  -2.783  63.692  1.00 90.88  ? 1098 VAL A CA    1 
ATOM   8386  C  C     . VAL A 1  1098 ? 15.395  -1.922  64.367  1.00 89.86  ? 1098 VAL A C     1 
ATOM   8387  O  O     . VAL A 1  1098 ? 16.565  -2.057  64.001  1.00 89.97  ? 1098 VAL A O     1 
ATOM   8388  C  CB    . VAL A 1  1098 ? 13.770  -2.165  62.371  1.00 91.02  ? 1098 VAL A CB    1 
ATOM   8389  C  CG1   . VAL A 1  1098 ? 14.680  -1.053  61.830  1.00 91.05  ? 1098 VAL A CG1   1 
ATOM   8390  C  CG2   . VAL A 1  1098 ? 13.579  -3.261  61.337  1.00 90.63  ? 1098 VAL A CG2   1 
ATOM   8391  N  N     . PRO A 1  1099 ? 15.028  -1.051  65.348  1.00 88.67  ? 1099 PRO A N     1 
ATOM   8392  C  CA    . PRO A 1  1099 ? 16.072  -0.300  66.060  1.00 87.55  ? 1099 PRO A CA    1 
ATOM   8393  C  C     . PRO A 1  1099 ? 17.058  -1.185  66.819  1.00 86.50  ? 1099 PRO A C     1 
ATOM   8394  O  O     . PRO A 1  1099 ? 18.248  -0.861  66.858  1.00 86.72  ? 1099 PRO A O     1 
ATOM   8395  C  CB    . PRO A 1  1099 ? 15.281  0.578   67.042  1.00 87.53  ? 1099 PRO A CB    1 
ATOM   8396  C  CG    . PRO A 1  1099 ? 13.973  -0.082  67.188  1.00 88.06  ? 1099 PRO A CG    1 
ATOM   8397  C  CD    . PRO A 1  1099 ? 13.686  -0.679  65.837  1.00 88.63  ? 1099 PRO A CD    1 
ATOM   8398  N  N     . ARG A 1  1100 ? 16.581  -2.283  67.412  1.00 85.03  ? 1100 ARG A N     1 
ATOM   8399  C  CA    . ARG A 1  1100 ? 17.478  -3.198  68.115  1.00 83.65  ? 1100 ARG A CA    1 
ATOM   8400  C  C     . ARG A 1  1100 ? 18.395  -3.887  67.134  1.00 83.07  ? 1100 ARG A C     1 
ATOM   8401  O  O     . ARG A 1  1100 ? 19.601  -3.941  67.347  1.00 83.15  ? 1100 ARG A O     1 
ATOM   8402  C  CB    . ARG A 1  1100 ? 16.723  -4.240  68.935  1.00 83.47  ? 1100 ARG A CB    1 
ATOM   8403  C  CG    . ARG A 1  1100 ? 17.624  -5.300  69.629  1.00 82.16  ? 1100 ARG A CG    1 
ATOM   8404  C  CD    . ARG A 1  1100 ? 18.604  -4.729  70.688  1.00 79.20  ? 1100 ARG A CD    1 
ATOM   8405  N  NE    . ARG A 1  1100 ? 19.064  -5.768  71.619  1.00 76.80  ? 1100 ARG A NE    1 
ATOM   8406  C  CZ    . ARG A 1  1100 ? 20.219  -5.754  72.281  1.00 75.25  ? 1100 ARG A CZ    1 
ATOM   8407  N  NH1   . ARG A 1  1100 ? 21.068  -4.754  72.132  1.00 75.16  ? 1100 ARG A NH1   1 
ATOM   8408  N  NH2   . ARG A 1  1100 ? 20.531  -6.751  73.094  1.00 73.92  ? 1100 ARG A NH2   1 
ATOM   8409  N  N     . LEU A 1  1101 ? 17.830  -4.404  66.051  1.00 82.19  ? 1101 LEU A N     1 
ATOM   8410  C  CA    . LEU A 1  1101 ? 18.647  -5.042  65.038  1.00 81.42  ? 1101 LEU A CA    1 
ATOM   8411  C  C     . LEU A 1  1101 ? 19.807  -4.152  64.600  1.00 81.31  ? 1101 LEU A C     1 
ATOM   8412  O  O     . LEU A 1  1101 ? 20.914  -4.641  64.456  1.00 81.41  ? 1101 LEU A O     1 
ATOM   8413  C  CB    . LEU A 1  1101 ? 17.813  -5.473  63.842  1.00 81.15  ? 1101 LEU A CB    1 
ATOM   8414  C  CG    . LEU A 1  1101 ? 18.441  -6.611  63.043  1.00 80.35  ? 1101 LEU A CG    1 
ATOM   8415  C  CD1   . LEU A 1  1101 ? 18.521  -7.877  63.870  1.00 79.67  ? 1101 LEU A CD1   1 
ATOM   8416  C  CD2   . LEU A 1  1101 ? 17.653  -6.864  61.778  1.00 80.44  ? 1101 LEU A CD2   1 
ATOM   8417  N  N     . LYS A 1  1102 ? 19.563  -2.852  64.421  1.00 81.28  ? 1102 LYS A N     1 
ATOM   8418  C  CA    . LYS A 1  1102 ? 20.619  -1.894  64.027  1.00 81.32  ? 1102 LYS A CA    1 
ATOM   8419  C  C     . LYS A 1  1102 ? 21.719  -1.792  65.080  1.00 81.27  ? 1102 LYS A C     1 
ATOM   8420  O  O     . LYS A 1  1102 ? 22.908  -1.845  64.752  1.00 81.21  ? 1102 LYS A O     1 
ATOM   8421  C  CB    . LYS A 1  1102 ? 20.038  -0.502  63.725  1.00 81.38  ? 1102 LYS A CB    1 
ATOM   8422  C  CG    . LYS A 1  1102 ? 21.060  0.513   63.195  1.00 81.62  ? 1102 LYS A CG    1 
ATOM   8423  C  CD    . LYS A 1  1102 ? 20.383  1.647   62.431  1.00 82.64  ? 1102 LYS A CD    1 
ATOM   8424  C  CE    . LYS A 1  1102 ? 21.392  2.674   61.909  1.00 83.49  ? 1102 LYS A CE    1 
ATOM   8425  N  NZ    . LYS A 1  1102 ? 21.784  3.692   62.944  1.00 83.90  ? 1102 LYS A NZ    1 
ATOM   8426  N  N     . GLU A 1  1103 ? 21.290  -1.637  66.332  1.00 81.21  ? 1103 GLU A N     1 
ATOM   8427  C  CA    . GLU A 1  1103 ? 22.141  -1.673  67.511  1.00 81.27  ? 1103 GLU A CA    1 
ATOM   8428  C  C     . GLU A 1  1103 ? 23.072  -2.909  67.486  1.00 81.33  ? 1103 GLU A C     1 
ATOM   8429  O  O     . GLU A 1  1103 ? 24.305  -2.769  67.454  1.00 81.51  ? 1103 GLU A O     1 
ATOM   8430  C  CB    . GLU A 1  1103 ? 21.233  -1.719  68.737  1.00 81.18  ? 1103 GLU A CB    1 
ATOM   8431  C  CG    . GLU A 1  1103 ? 21.579  -0.773  69.854  1.00 82.07  ? 1103 GLU A CG    1 
ATOM   8432  C  CD    . GLU A 1  1103 ? 20.439  -0.629  70.858  1.00 83.46  ? 1103 GLU A CD    1 
ATOM   8433  O  OE1   . GLU A 1  1103 ? 20.096  -1.623  71.544  1.00 83.66  ? 1103 GLU A OE1   1 
ATOM   8434  O  OE2   . GLU A 1  1103 ? 19.884  0.488   70.963  1.00 84.54  ? 1103 GLU A OE2   1 
ATOM   8435  N  N     . ILE A 1  1104 ? 22.469  -4.104  67.476  1.00 81.20  ? 1104 ILE A N     1 
ATOM   8436  C  CA    . ILE A 1  1104 ? 23.189  -5.380  67.449  1.00 80.86  ? 1104 ILE A CA    1 
ATOM   8437  C  C     . ILE A 1  1104 ? 24.254  -5.414  66.378  1.00 81.56  ? 1104 ILE A C     1 
ATOM   8438  O  O     . ILE A 1  1104 ? 25.367  -5.837  66.636  1.00 81.62  ? 1104 ILE A O     1 
ATOM   8439  C  CB    . ILE A 1  1104 ? 22.244  -6.555  67.190  1.00 80.54  ? 1104 ILE A CB    1 
ATOM   8440  C  CG1   . ILE A 1  1104 ? 21.557  -6.981  68.485  1.00 80.28  ? 1104 ILE A CG1   1 
ATOM   8441  C  CG2   . ILE A 1  1104 ? 23.000  -7.722  66.576  1.00 79.78  ? 1104 ILE A CG2   1 
ATOM   8442  C  CD1   . ILE A 1  1104 ? 20.495  -8.070  68.297  1.00 80.50  ? 1104 ILE A CD1   1 
ATOM   8443  N  N     . LEU A 1  1105 ? 23.911  -4.960  65.179  1.00 82.61  ? 1105 LEU A N     1 
ATOM   8444  C  CA    . LEU A 1  1105 ? 24.793  -5.104  64.020  1.00 83.72  ? 1105 LEU A CA    1 
ATOM   8445  C  C     . LEU A 1  1105 ? 25.978  -4.113  63.962  1.00 84.90  ? 1105 LEU A C     1 
ATOM   8446  O  O     . LEU A 1  1105 ? 27.018  -4.404  63.357  1.00 85.10  ? 1105 LEU A O     1 
ATOM   8447  C  CB    . LEU A 1  1105 ? 23.980  -5.130  62.716  1.00 83.30  ? 1105 LEU A CB    1 
ATOM   8448  C  CG    . LEU A 1  1105 ? 23.409  -6.508  62.364  1.00 81.84  ? 1105 LEU A CG    1 
ATOM   8449  C  CD1   . LEU A 1  1105 ? 22.000  -6.663  62.822  1.00 80.94  ? 1105 LEU A CD1   1 
ATOM   8450  C  CD2   . LEU A 1  1105 ? 23.439  -6.706  60.894  1.00 81.37  ? 1105 LEU A CD2   1 
ATOM   8451  N  N     . ASN A 1  1106 ? 25.830  -2.962  64.606  1.00 86.17  ? 1106 ASN A N     1 
ATOM   8452  C  CA    . ASN A 1  1106 ? 26.943  -2.031  64.745  1.00 87.71  ? 1106 ASN A CA    1 
ATOM   8453  C  C     . ASN A 1  1106 ? 27.870  -2.424  65.885  1.00 88.44  ? 1106 ASN A C     1 
ATOM   8454  O  O     . ASN A 1  1106 ? 28.915  -1.790  66.095  1.00 88.71  ? 1106 ASN A O     1 
ATOM   8455  C  CB    . ASN A 1  1106 ? 26.420  -0.625  65.006  1.00 88.05  ? 1106 ASN A CB    1 
ATOM   8456  C  CG    . ASN A 1  1106 ? 25.347  -0.223  64.034  1.00 89.47  ? 1106 ASN A CG    1 
ATOM   8457  O  OD1   . ASN A 1  1106 ? 25.468  -0.461  62.829  1.00 91.06  ? 1106 ASN A OD1   1 
ATOM   8458  N  ND2   . ASN A 1  1106 ? 24.275  0.381   64.548  1.00 90.71  ? 1106 ASN A ND2   1 
ATOM   8459  N  N     . VAL A 1  1107 ? 27.488  -3.482  66.604  1.00 89.27  ? 1107 VAL A N     1 
ATOM   8460  C  CA    . VAL A 1  1107 ? 28.071  -3.814  67.907  1.00 89.79  ? 1107 VAL A CA    1 
ATOM   8461  C  C     . VAL A 1  1107 ? 28.040  -2.512  68.702  1.00 90.16  ? 1107 VAL A C     1 
ATOM   8462  O  O     . VAL A 1  1107 ? 29.067  -1.850  68.898  1.00 90.26  ? 1107 VAL A O     1 
ATOM   8463  C  CB    . VAL A 1  1107 ? 29.508  -4.430  67.818  1.00 89.75  ? 1107 VAL A CB    1 
ATOM   8464  C  CG1   . VAL A 1  1107 ? 29.895  -5.040  69.150  1.00 89.55  ? 1107 VAL A CG1   1 
ATOM   8465  C  CG2   . VAL A 1  1107 ? 29.597  -5.486  66.710  1.00 89.58  ? 1107 VAL A CG2   1 
ATOM   8466  N  N     . ALA A 1  1108 ? 26.832  -2.133  69.104  1.00 90.59  ? 1108 ALA A N     1 
ATOM   8467  C  CA    . ALA A 1  1108 ? 26.609  -0.856  69.752  1.00 91.47  ? 1108 ALA A CA    1 
ATOM   8468  C  C     . ALA A 1  1108 ? 27.104  -0.867  71.202  1.00 92.16  ? 1108 ALA A C     1 
ATOM   8469  O  O     . ALA A 1  1108 ? 26.689  -1.730  71.992  1.00 92.55  ? 1108 ALA A O     1 
ATOM   8470  C  CB    . ALA A 1  1108 ? 25.144  -0.497  69.688  1.00 91.45  ? 1108 ALA A CB    1 
ATOM   8471  N  N     . LYS A 1  1109 ? 27.996  0.079   71.531  1.00 92.63  ? 1109 LYS A N     1 
ATOM   8472  C  CA    . LYS A 1  1109 ? 28.549  0.232   72.886  1.00 93.03  ? 1109 LYS A CA    1 
ATOM   8473  C  C     . LYS A 1  1109 ? 27.616  1.052   73.774  1.00 93.41  ? 1109 LYS A C     1 
ATOM   8474  O  O     . LYS A 1  1109 ? 27.697  1.005   75.006  1.00 93.66  ? 1109 LYS A O     1 
ATOM   8475  C  CB    . LYS A 1  1109 ? 29.932  0.897   72.833  1.00 92.92  ? 1109 LYS A CB    1 
ATOM   8476  C  CG    . LYS A 1  1109 ? 31.111  -0.076  72.724  1.00 93.18  ? 1109 LYS A CG    1 
ATOM   8477  C  CD    . LYS A 1  1109 ? 31.603  -0.615  74.099  1.00 92.80  ? 1109 LYS A CD    1 
ATOM   8478  C  CE    . LYS A 1  1109 ? 32.647  0.308   74.746  1.00 92.23  ? 1109 LYS A CE    1 
ATOM   8479  N  NZ    . LYS A 1  1109 ? 33.581  -0.415  75.649  1.00 90.79  ? 1109 LYS A NZ    1 
ATOM   8480  N  N     . ASN A 1  1110 ? 26.714  1.775   73.122  1.00 93.81  ? 1110 ASN A N     1 
ATOM   8481  C  CA    . ASN A 1  1110 ? 25.898  2.803   73.749  1.00 94.25  ? 1110 ASN A CA    1 
ATOM   8482  C  C     . ASN A 1  1110 ? 24.430  2.389   73.708  1.00 94.10  ? 1110 ASN A C     1 
ATOM   8483  O  O     . ASN A 1  1110 ? 23.567  3.153   73.248  1.00 94.13  ? 1110 ASN A O     1 
ATOM   8484  C  CB    . ASN A 1  1110 ? 26.093  4.125   72.987  1.00 94.66  ? 1110 ASN A CB    1 
ATOM   8485  C  CG    . ASN A 1  1110 ? 27.291  4.082   72.029  1.00 95.55  ? 1110 ASN A CG    1 
ATOM   8486  O  OD1   . ASN A 1  1110 ? 28.430  3.853   72.454  1.00 97.16  ? 1110 ASN A OD1   1 
ATOM   8487  N  ND2   . ASN A 1  1110 ? 27.033  4.288   70.730  1.00 95.17  ? 1110 ASN A ND2   1 
ATOM   8488  N  N     . MET A 1  1111 ? 24.151  1.178   74.181  1.00 93.87  ? 1111 MET A N     1 
ATOM   8489  C  CA    . MET A 1  1111 ? 22.820  0.595   74.016  1.00 93.93  ? 1111 MET A CA    1 
ATOM   8490  C  C     . MET A 1  1111 ? 21.754  1.224   74.904  1.00 93.74  ? 1111 MET A C     1 
ATOM   8491  O  O     . MET A 1  1111 ? 22.006  1.557   76.058  1.00 93.58  ? 1111 MET A O     1 
ATOM   8492  C  CB    . MET A 1  1111 ? 22.848  -0.932  74.160  1.00 94.04  ? 1111 MET A CB    1 
ATOM   8493  C  CG    . MET A 1  1111 ? 23.269  -1.478  75.521  1.00 94.29  ? 1111 MET A CG    1 
ATOM   8494  S  SD    . MET A 1  1111 ? 23.260  -3.287  75.562  1.00 94.29  ? 1111 MET A SD    1 
ATOM   8495  C  CE    . MET A 1  1111 ? 21.541  -3.650  75.222  1.00 93.95  ? 1111 MET A CE    1 
ATOM   8496  N  N     . LYS A 1  1112 ? 20.562  1.382   74.340  1.00 93.88  ? 1112 LYS A N     1 
ATOM   8497  C  CA    . LYS A 1  1112 ? 19.471  2.075   75.020  1.00 94.07  ? 1112 LYS A CA    1 
ATOM   8498  C  C     . LYS A 1  1112 ? 18.919  1.310   76.219  1.00 94.16  ? 1112 LYS A C     1 
ATOM   8499  O  O     . LYS A 1  1112 ? 18.719  1.896   77.281  1.00 94.31  ? 1112 LYS A O     1 
ATOM   8500  C  CB    . LYS A 1  1112 ? 18.338  2.458   74.051  1.00 94.08  ? 1112 LYS A CB    1 
ATOM   8501  C  CG    . LYS A 1  1112 ? 18.507  3.818   73.370  1.00 94.07  ? 1112 LYS A CG    1 
ATOM   8502  C  CD    . LYS A 1  1112 ? 18.701  3.686   71.871  1.00 94.77  ? 1112 LYS A CD    1 
ATOM   8503  C  CE    . LYS A 1  1112 ? 17.370  3.380   71.175  1.00 95.72  ? 1112 LYS A CE    1 
ATOM   8504  N  NZ    . LYS A 1  1112 ? 17.454  3.392   69.682  1.00 96.06  ? 1112 LYS A NZ    1 
ATOM   8505  N  N     . THR A 1  1113 ? 18.674  0.011   76.061  1.00 94.26  ? 1113 THR A N     1 
ATOM   8506  C  CA    . THR A 1  1113 ? 18.154  -0.781  77.182  1.00 94.40  ? 1113 THR A CA    1 
ATOM   8507  C  C     . THR A 1  1113 ? 19.076  -1.946  77.590  1.00 94.23  ? 1113 THR A C     1 
ATOM   8508  O  O     . THR A 1  1113 ? 18.809  -3.107  77.249  1.00 94.44  ? 1113 THR A O     1 
ATOM   8509  C  CB    . THR A 1  1113 ? 16.689  -1.277  76.936  1.00 94.46  ? 1113 THR A CB    1 
ATOM   8510  O  OG1   . THR A 1  1113 ? 15.917  -0.241  76.318  1.00 94.37  ? 1113 THR A OG1   1 
ATOM   8511  C  CG2   . THR A 1  1113 ? 16.015  -1.690  78.260  1.00 94.78  ? 1113 THR A CG2   1 
ATOM   8512  N  N     . PRO A 1  1114 ? 20.169  -1.643  78.317  1.00 93.81  ? 1114 PRO A N     1 
ATOM   8513  C  CA    . PRO A 1  1114 ? 20.899  -2.748  78.907  1.00 93.68  ? 1114 PRO A CA    1 
ATOM   8514  C  C     . PRO A 1  1114 ? 20.127  -3.280  80.131  1.00 93.70  ? 1114 PRO A C     1 
ATOM   8515  O  O     . PRO A 1  1114 ? 19.261  -2.560  80.663  1.00 93.85  ? 1114 PRO A O     1 
ATOM   8516  C  CB    . PRO A 1  1114 ? 22.241  -2.111  79.302  1.00 93.53  ? 1114 PRO A CB    1 
ATOM   8517  C  CG    . PRO A 1  1114 ? 22.234  -0.739  78.712  1.00 93.45  ? 1114 PRO A CG    1 
ATOM   8518  C  CD    . PRO A 1  1114 ? 20.807  -0.357  78.626  1.00 93.62  ? 1114 PRO A CD    1 
ATOM   8519  N  N     . SER A 1  1115 ? 20.423  -4.524  80.540  1.00 93.45  ? 1115 SER A N     1 
ATOM   8520  C  CA    . SER A 1  1115 ? 19.737  -5.212  81.644  1.00 93.14  ? 1115 SER A CA    1 
ATOM   8521  C  C     . SER A 1  1115 ? 20.350  -6.563  81.995  1.00 93.16  ? 1115 SER A C     1 
ATOM   8522  O  O     . SER A 1  1115 ? 20.582  -7.388  81.114  1.00 92.99  ? 1115 SER A O     1 
ATOM   8523  C  CB    . SER A 1  1115 ? 18.263  -5.438  81.301  1.00 93.12  ? 1115 SER A CB    1 
ATOM   8524  O  OG    . SER A 1  1115 ? 17.665  -6.366  82.191  1.00 92.98  ? 1115 SER A OG    1 
ATOM   8525  N  N     . LEU A 1  1116 ? 20.595  -6.774  83.291  1.00 93.44  ? 1116 LEU A N     1 
ATOM   8526  C  CA    . LEU A 1  1116 ? 20.846  -8.103  83.862  1.00 93.55  ? 1116 LEU A CA    1 
ATOM   8527  C  C     . LEU A 1  1116 ? 19.516  -8.818  84.043  1.00 94.11  ? 1116 LEU A C     1 
ATOM   8528  O  O     . LEU A 1  1116 ? 18.447  -8.206  84.016  1.00 94.19  ? 1116 LEU A O     1 
ATOM   8529  C  CB    . LEU A 1  1116 ? 21.511  -8.016  85.243  1.00 93.13  ? 1116 LEU A CB    1 
ATOM   8530  C  CG    . LEU A 1  1116 ? 22.921  -7.531  85.584  1.00 92.49  ? 1116 LEU A CG    1 
ATOM   8531  C  CD1   . LEU A 1  1116 ? 23.958  -8.591  85.306  1.00 92.00  ? 1116 LEU A CD1   1 
ATOM   8532  C  CD2   . LEU A 1  1116 ? 23.284  -6.235  84.908  1.00 92.27  ? 1116 LEU A CD2   1 
ATOM   8533  N  N     . THR A 1  1117 ? 19.587  -10.123 84.241  1.00 94.79  ? 1117 THR A N     1 
ATOM   8534  C  CA    . THR A 1  1117 ? 18.422  -10.908 84.571  1.00 95.55  ? 1117 THR A CA    1 
ATOM   8535  C  C     . THR A 1  1117 ? 18.959  -11.923 85.551  1.00 96.13  ? 1117 THR A C     1 
ATOM   8536  O  O     . THR A 1  1117 ? 19.559  -12.909 85.155  1.00 96.40  ? 1117 THR A O     1 
ATOM   8537  C  CB    . THR A 1  1117 ? 17.809  -11.551 83.307  1.00 95.45  ? 1117 THR A CB    1 
ATOM   8538  O  OG1   . THR A 1  1117 ? 17.406  -10.513 82.405  1.00 95.61  ? 1117 THR A OG1   1 
ATOM   8539  C  CG2   . THR A 1  1117 ? 16.584  -12.366 83.647  1.00 95.72  ? 1117 THR A CG2   1 
ATOM   8540  N  N     . VAL A 1  1118 ? 18.786  -11.641 86.836  1.00 97.01  ? 1118 VAL A N     1 
ATOM   8541  C  CA    . VAL A 1  1118 ? 19.457  -12.392 87.884  1.00 98.04  ? 1118 VAL A CA    1 
ATOM   8542  C  C     . VAL A 1  1118 ? 18.708  -13.682 88.176  1.00 98.86  ? 1118 VAL A C     1 
ATOM   8543  O  O     . VAL A 1  1118 ? 17.475  -13.682 88.213  1.00 99.08  ? 1118 VAL A O     1 
ATOM   8544  C  CB    . VAL A 1  1118 ? 19.566  -11.562 89.170  1.00 98.02  ? 1118 VAL A CB    1 
ATOM   8545  C  CG1   . VAL A 1  1118 ? 20.715  -12.058 90.033  1.00 98.18  ? 1118 VAL A CG1   1 
ATOM   8546  C  CG2   . VAL A 1  1118 ? 19.763  -10.089 88.842  1.00 98.38  ? 1118 VAL A CG2   1 
ATOM   8547  N  N     . TYR A 1  1119 ? 19.449  -14.774 88.379  1.00 99.82  ? 1119 TYR A N     1 
ATOM   8548  C  CA    . TYR A 1  1119 ? 18.842  -16.057 88.700  1.00 100.89 ? 1119 TYR A CA    1 
ATOM   8549  C  C     . TYR A 1  1119 ? 19.163  -16.513 90.104  1.00 102.40 ? 1119 TYR A C     1 
ATOM   8550  O  O     . TYR A 1  1119 ? 20.312  -16.436 90.535  1.00 102.48 ? 1119 TYR A O     1 
ATOM   8551  C  CB    . TYR A 1  1119 ? 19.289  -17.122 87.710  1.00 100.32 ? 1119 TYR A CB    1 
ATOM   8552  C  CG    . TYR A 1  1119 ? 18.516  -17.119 86.415  1.00 99.48  ? 1119 TYR A CG    1 
ATOM   8553  C  CD1   . TYR A 1  1119 ? 19.169  -16.984 85.200  1.00 98.79  ? 1119 TYR A CD1   1 
ATOM   8554  C  CD2   . TYR A 1  1119 ? 17.129  -17.253 86.404  1.00 98.67  ? 1119 TYR A CD2   1 
ATOM   8555  C  CE1   . TYR A 1  1119 ? 18.468  -16.982 84.008  1.00 98.83  ? 1119 TYR A CE1   1 
ATOM   8556  C  CE2   . TYR A 1  1119 ? 16.417  -17.246 85.219  1.00 98.28  ? 1119 TYR A CE2   1 
ATOM   8557  C  CZ    . TYR A 1  1119 ? 17.092  -17.110 84.026  1.00 98.82  ? 1119 TYR A CZ    1 
ATOM   8558  O  OH    . TYR A 1  1119 ? 16.396  -17.103 82.846  1.00 98.87  ? 1119 TYR A OH    1 
ATOM   8559  N  N     . LEU A 1  1120 ? 18.141  -17.001 90.801  1.00 104.42 ? 1120 LEU A N     1 
ATOM   8560  C  CA    . LEU A 1  1120 ? 18.288  -17.508 92.166  1.00 106.68 ? 1120 LEU A CA    1 
ATOM   8561  C  C     . LEU A 1  1120 ? 19.226  -18.720 92.307  1.00 108.43 ? 1120 LEU A C     1 
ATOM   8562  O  O     . LEU A 1  1120 ? 19.400  -19.496 91.361  1.00 108.59 ? 1120 LEU A O     1 
ATOM   8563  C  CB    . LEU A 1  1120 ? 16.911  -17.818 92.769  1.00 106.47 ? 1120 LEU A CB    1 
ATOM   8564  C  CG    . LEU A 1  1120 ? 16.436  -16.859 93.865  1.00 106.48 ? 1120 LEU A CG    1 
ATOM   8565  C  CD1   . LEU A 1  1120 ? 16.038  -15.502 93.298  1.00 106.52 ? 1120 LEU A CD1   1 
ATOM   8566  C  CD2   . LEU A 1  1120 ? 15.291  -17.466 94.659  1.00 106.24 ? 1120 LEU A CD2   1 
ATOM   8567  N  N     . GLU A 1  1121 ? 19.820  -18.857 93.497  1.00 110.66 ? 1121 GLU A N     1 
ATOM   8568  C  CA    . GLU A 1  1121 ? 20.706  -19.969 93.872  1.00 112.92 ? 1121 GLU A CA    1 
ATOM   8569  C  C     . GLU A 1  1121 ? 20.022  -21.308 93.585  1.00 114.30 ? 1121 GLU A C     1 
ATOM   8570  O  O     . GLU A 1  1121 ? 18.862  -21.485 93.963  1.00 114.27 ? 1121 GLU A O     1 
ATOM   8571  C  CB    . GLU A 1  1121 ? 21.052  -19.862 95.364  1.00 112.79 ? 1121 GLU A CB    1 
ATOM   8572  C  CG    . GLU A 1  1121 ? 22.390  -20.471 95.784  1.00 113.47 ? 1121 GLU A CG    1 
ATOM   8573  C  CD    . GLU A 1  1121 ? 22.886  -19.948 97.139  1.00 113.85 ? 1121 GLU A CD    1 
ATOM   8574  O  OE1   . GLU A 1  1121 ? 23.936  -20.437 97.617  1.00 115.30 ? 1121 GLU A OE1   1 
ATOM   8575  O  OE2   . GLU A 1  1121 ? 22.232  -19.051 97.730  1.00 114.33 ? 1121 GLU A OE2   1 
ATOM   8576  N  N     . PRO A 1  1122 ? 20.734  -22.253 92.918  1.00 115.91 ? 1122 PRO A N     1 
ATOM   8577  C  CA    . PRO A 1  1122 ? 20.124  -23.523 92.452  1.00 117.04 ? 1122 PRO A CA    1 
ATOM   8578  C  C     . PRO A 1  1122 ? 19.172  -24.174 93.473  1.00 118.19 ? 1122 PRO A C     1 
ATOM   8579  O  O     . PRO A 1  1122 ? 18.090  -24.637 93.097  1.00 118.20 ? 1122 PRO A O     1 
ATOM   8580  C  CB    . PRO A 1  1122 ? 21.338  -24.427 92.187  1.00 117.00 ? 1122 PRO A CB    1 
ATOM   8581  C  CG    . PRO A 1  1122 ? 22.461  -23.489 91.880  1.00 116.60 ? 1122 PRO A CG    1 
ATOM   8582  C  CD    . PRO A 1  1122 ? 22.172  -22.174 92.579  1.00 116.03 ? 1122 PRO A CD    1 
ATOM   8583  N  N     . GLY A 1  1123 ? 19.582  -24.191 94.746  1.00 119.47 ? 1123 GLY A N     1 
ATOM   8584  C  CA    . GLY A 1  1123 ? 18.764  -24.702 95.850  1.00 120.89 ? 1123 GLY A CA    1 
ATOM   8585  C  C     . GLY A 1  1123 ? 17.558  -23.825 96.145  1.00 121.91 ? 1123 GLY A C     1 
ATOM   8586  O  O     . GLY A 1  1123 ? 16.433  -24.330 96.247  1.00 122.13 ? 1123 GLY A O     1 
ATOM   8587  N  N     . HIS A 1  1124 ? 17.795  -22.516 96.275  1.00 122.68 ? 1124 HIS A N     1 
ATOM   8588  C  CA    . HIS A 1  1124 ? 16.734  -21.540 96.555  1.00 123.48 ? 1124 HIS A CA    1 
ATOM   8589  C  C     . HIS A 1  1124 ? 15.949  -21.156 95.292  1.00 123.70 ? 1124 HIS A C     1 
ATOM   8590  O  O     . HIS A 1  1124 ? 16.535  -20.774 94.276  1.00 123.71 ? 1124 HIS A O     1 
ATOM   8591  C  CB    . HIS A 1  1124 ? 17.314  -20.308 97.256  1.00 123.62 ? 1124 HIS A CB    1 
ATOM   8592  C  CG    . HIS A 1  1124 ? 17.920  -20.613 98.590  1.00 124.71 ? 1124 HIS A CG    1 
ATOM   8593  N  ND1   . HIS A 1  1124 ? 17.205  -20.541 99.767  1.00 125.81 ? 1124 HIS A ND1   1 
ATOM   8594  C  CD2   . HIS A 1  1124 ? 19.168  -21.016 98.932  1.00 125.71 ? 1124 HIS A CD2   1 
ATOM   8595  C  CE1   . HIS A 1  1124 ? 17.988  -20.874 100.778 1.00 126.13 ? 1124 HIS A CE1   1 
ATOM   8596  N  NE2   . HIS A 1  1124 ? 19.185  -21.166 100.299 1.00 126.17 ? 1124 HIS A NE2   1 
ATOM   8597  N  N     . ALA A 1  1125 ? 14.621  -21.265 95.366  1.00 124.02 ? 1125 ALA A N     1 
ATOM   8598  C  CA    . ALA A 1  1125 ? 13.767  -21.080 94.190  1.00 124.27 ? 1125 ALA A CA    1 
ATOM   8599  C  C     . ALA A 1  1125 ? 12.558  -20.165 94.428  1.00 124.33 ? 1125 ALA A C     1 
ATOM   8600  O  O     . ALA A 1  1125 ? 12.555  -19.009 93.992  1.00 124.30 ? 1125 ALA A O     1 
ATOM   8601  C  CB    . ALA A 1  1125 ? 13.324  -22.452 93.621  1.00 124.33 ? 1125 ALA A CB    1 
ATOM   8602  N  N     . ALA A 1  1126 ? 11.541  -20.692 95.113  1.00 124.38 ? 1126 ALA A N     1 
ATOM   8603  C  CA    . ALA A 1  1126 ? 10.279  -19.980 95.328  1.00 124.34 ? 1126 ALA A CA    1 
ATOM   8604  C  C     . ALA A 1  1126 ? 10.289  -19.086 96.582  1.00 124.35 ? 1126 ALA A C     1 
ATOM   8605  O  O     . ALA A 1  1126 ? 9.326   -18.344 96.828  1.00 124.44 ? 1126 ALA A O     1 
ATOM   8606  C  CB    . ALA A 1  1126 ? 9.108   -20.974 95.369  1.00 124.21 ? 1126 ALA A CB    1 
ATOM   8607  N  N     . ASP A 1  1127 ? 11.383  -19.147 97.348  1.00 124.21 ? 1127 ASP A N     1 
ATOM   8608  C  CA    . ASP A 1  1127 ? 11.513  -18.417 98.616  1.00 123.97 ? 1127 ASP A CA    1 
ATOM   8609  C  C     . ASP A 1  1127 ? 11.533  -16.895 98.405  1.00 123.68 ? 1127 ASP A C     1 
ATOM   8610  O  O     . ASP A 1  1127 ? 12.584  -16.288 98.184  1.00 123.55 ? 1127 ASP A O     1 
ATOM   8611  C  CB    . ASP A 1  1127 ? 12.744  -18.910 99.390  1.00 124.07 ? 1127 ASP A CB    1 
ATOM   8612  C  CG    . ASP A 1  1127 ? 12.533  -18.901 100.897 1.00 124.24 ? 1127 ASP A CG    1 
ATOM   8613  O  OD1   . ASP A 1  1127 ? 12.016  -17.892 101.427 1.00 124.76 ? 1127 ASP A OD1   1 
ATOM   8614  O  OD2   . ASP A 1  1127 ? 12.889  -19.904 101.554 1.00 124.01 ? 1127 ASP A OD2   1 
ATOM   8615  N  N     . GLN A 1  1128 ? 10.348  -16.294 98.469  1.00 123.37 ? 1128 GLN A N     1 
ATOM   8616  C  CA    . GLN A 1  1128 ? 10.159  -14.901 98.075  1.00 123.05 ? 1128 GLN A CA    1 
ATOM   8617  C  C     . GLN A 1  1128 ? 10.625  -13.919 99.146  1.00 122.61 ? 1128 GLN A C     1 
ATOM   8618  O  O     . GLN A 1  1128 ? 10.934  -12.767 98.841  1.00 122.69 ? 1128 GLN A O     1 
ATOM   8619  C  CB    . GLN A 1  1128 ? 8.706   -14.646 97.630  1.00 123.14 ? 1128 GLN A CB    1 
ATOM   8620  C  CG    . GLN A 1  1128 ? 7.705   -14.319 98.737  1.00 123.57 ? 1128 GLN A CG    1 
ATOM   8621  C  CD    . GLN A 1  1128 ? 7.460   -12.822 98.891  1.00 124.19 ? 1128 GLN A CD    1 
ATOM   8622  O  OE1   . GLN A 1  1128 ? 7.263   -12.101 97.903  1.00 123.98 ? 1128 GLN A OE1   1 
ATOM   8623  N  NE2   . GLN A 1  1128 ? 7.463   -12.352 100.136 1.00 124.58 ? 1128 GLN A NE2   1 
ATOM   8624  N  N     . GLU A 1  1129 ? 10.679  -14.373 100.395 1.00 121.99 ? 1129 GLU A N     1 
ATOM   8625  C  CA    . GLU A 1  1129 ? 11.304  -13.578 101.439 1.00 121.47 ? 1129 GLU A CA    1 
ATOM   8626  C  C     . GLU A 1  1129 ? 12.790  -13.494 101.104 1.00 120.98 ? 1129 GLU A C     1 
ATOM   8627  O  O     . GLU A 1  1129 ? 13.419  -12.443 101.250 1.00 121.08 ? 1129 GLU A O     1 
ATOM   8628  C  CB    . GLU A 1  1129 ? 11.101  -14.210 102.817 1.00 121.56 ? 1129 GLU A CB    1 
ATOM   8629  C  CG    . GLU A 1  1129 ? 11.368  -13.251 103.976 1.00 121.58 ? 1129 GLU A CG    1 
ATOM   8630  C  CD    . GLU A 1  1129 ? 12.106  -13.903 105.133 1.00 121.60 ? 1129 GLU A CD    1 
ATOM   8631  O  OE1   . GLU A 1  1129 ? 12.934  -14.808 104.889 1.00 121.31 ? 1129 GLU A OE1   1 
ATOM   8632  O  OE2   . GLU A 1  1129 ? 11.869  -13.495 106.290 1.00 121.90 ? 1129 GLU A OE2   1 
ATOM   8633  N  N     . GLN A 1  1130 ? 13.324  -14.616 100.629 1.00 120.15 ? 1130 GLN A N     1 
ATOM   8634  C  CA    . GLN A 1  1130 ? 14.712  -14.723 100.213 1.00 119.35 ? 1130 GLN A CA    1 
ATOM   8635  C  C     . GLN A 1  1130 ? 15.023  -13.739 99.088  1.00 118.56 ? 1130 GLN A C     1 
ATOM   8636  O  O     . GLN A 1  1130 ? 16.086  -13.122 99.086  1.00 118.58 ? 1130 GLN A O     1 
ATOM   8637  C  CB    . GLN A 1  1130 ? 14.996  -16.168 99.778  1.00 119.55 ? 1130 GLN A CB    1 
ATOM   8638  C  CG    . GLN A 1  1130 ? 16.326  -16.424 99.089  1.00 119.83 ? 1130 GLN A CG    1 
ATOM   8639  C  CD    . GLN A 1  1130 ? 17.490  -16.394 100.046 1.00 120.19 ? 1130 GLN A CD    1 
ATOM   8640  O  OE1   . GLN A 1  1130 ? 17.353  -16.731 101.225 1.00 120.01 ? 1130 GLN A OE1   1 
ATOM   8641  N  NE2   . GLN A 1  1130 ? 18.651  -15.989 99.544  1.00 120.77 ? 1130 GLN A NE2   1 
ATOM   8642  N  N     . ALA A 1  1131 ? 14.077  -13.576 98.161  1.00 117.54 ? 1131 ALA A N     1 
ATOM   8643  C  CA    . ALA A 1  1131 ? 14.288  -12.797 96.926  1.00 116.60 ? 1131 ALA A CA    1 
ATOM   8644  C  C     . ALA A 1  1131 ? 14.540  -11.302 97.130  1.00 115.85 ? 1131 ALA A C     1 
ATOM   8645  O  O     . ALA A 1  1131 ? 15.112  -10.640 96.258  1.00 115.64 ? 1131 ALA A O     1 
ATOM   8646  C  CB    . ALA A 1  1131 ? 13.130  -13.011 95.957  1.00 116.61 ? 1131 ALA A CB    1 
ATOM   8647  N  N     . LYS A 1  1132 ? 14.111  -10.783 98.278  1.00 114.96 ? 1132 LYS A N     1 
ATOM   8648  C  CA    . LYS A 1  1132 ? 14.289  -9.371  98.611  1.00 114.04 ? 1132 LYS A CA    1 
ATOM   8649  C  C     . LYS A 1  1132 ? 15.718  -9.055  99.032  1.00 113.08 ? 1132 LYS A C     1 
ATOM   8650  O  O     . LYS A 1  1132 ? 16.289  -8.067  98.572  1.00 113.01 ? 1132 LYS A O     1 
ATOM   8651  C  CB    . LYS A 1  1132 ? 13.281  -8.925  99.677  1.00 114.16 ? 1132 LYS A CB    1 
ATOM   8652  C  CG    . LYS A 1  1132 ? 11.868  -8.780  99.125  1.00 114.40 ? 1132 LYS A CG    1 
ATOM   8653  C  CD    . LYS A 1  1132 ? 10.892  -8.180  100.130 1.00 114.50 ? 1132 LYS A CD    1 
ATOM   8654  C  CE    . LYS A 1  1132 ? 9.578   -7.827  99.428  1.00 114.94 ? 1132 LYS A CE    1 
ATOM   8655  N  NZ    . LYS A 1  1132 ? 8.517   -7.352  100.374 1.00 115.20 ? 1132 LYS A NZ    1 
ATOM   8656  N  N     . LEU A 1  1133 ? 16.296  -9.899  99.888  1.00 111.93 ? 1133 LEU A N     1 
ATOM   8657  C  CA    . LEU A 1  1133 ? 17.702  -9.755  100.271 1.00 110.88 ? 1133 LEU A CA    1 
ATOM   8658  C  C     . LEU A 1  1133 ? 18.569  -9.618  99.026  1.00 110.10 ? 1133 LEU A C     1 
ATOM   8659  O  O     . LEU A 1  1133 ? 19.556  -8.879  99.017  1.00 110.22 ? 1133 LEU A O     1 
ATOM   8660  C  CB    . LEU A 1  1133 ? 18.196  -10.949 101.098 1.00 110.79 ? 1133 LEU A CB    1 
ATOM   8661  C  CG    . LEU A 1  1133 ? 17.512  -11.435 102.379 1.00 110.71 ? 1133 LEU A CG    1 
ATOM   8662  C  CD1   . LEU A 1  1133 ? 18.505  -12.292 103.139 1.00 111.08 ? 1133 LEU A CD1   1 
ATOM   8663  C  CD2   . LEU A 1  1133 ? 17.006  -10.313 103.276 1.00 110.63 ? 1133 LEU A CD2   1 
ATOM   8664  N  N     . ILE A 1  1134 ? 18.175  -10.325 97.973  1.00 108.93 ? 1134 ILE A N     1 
ATOM   8665  C  CA    . ILE A 1  1134 ? 18.941  -10.366 96.745  1.00 107.78 ? 1134 ILE A CA    1 
ATOM   8666  C  C     . ILE A 1  1134 ? 18.711  -9.109  95.927  1.00 107.10 ? 1134 ILE A C     1 
ATOM   8667  O  O     . ILE A 1  1134 ? 19.584  -8.696  95.176  1.00 107.04 ? 1134 ILE A O     1 
ATOM   8668  C  CB    . ILE A 1  1134 ? 18.612  -11.612 95.916  1.00 107.79 ? 1134 ILE A CB    1 
ATOM   8669  C  CG1   . ILE A 1  1134 ? 18.750  -12.872 96.782  1.00 107.98 ? 1134 ILE A CG1   1 
ATOM   8670  C  CG2   . ILE A 1  1134 ? 19.547  -11.699 94.731  1.00 107.53 ? 1134 ILE A CG2   1 
ATOM   8671  C  CD1   . ILE A 1  1134 ? 17.952  -14.077 96.300  1.00 108.29 ? 1134 ILE A CD1   1 
ATOM   8672  N  N     . ARG A 1  1135 ? 17.543  -8.495  96.077  1.00 106.23 ? 1135 ARG A N     1 
ATOM   8673  C  CA    . ARG A 1  1135 ? 17.259  -7.248  95.368  1.00 105.26 ? 1135 ARG A CA    1 
ATOM   8674  C  C     . ARG A 1  1135 ? 18.080  -6.097  95.935  1.00 104.71 ? 1135 ARG A C     1 
ATOM   8675  O  O     . ARG A 1  1135 ? 18.668  -5.325  95.173  1.00 104.67 ? 1135 ARG A O     1 
ATOM   8676  C  CB    . ARG A 1  1135 ? 15.765  -6.910  95.413  1.00 105.20 ? 1135 ARG A CB    1 
ATOM   8677  C  CG    . ARG A 1  1135 ? 15.360  -5.744  94.523  1.00 104.62 ? 1135 ARG A CG    1 
ATOM   8678  C  CD    . ARG A 1  1135 ? 13.867  -5.751  94.238  1.00 104.40 ? 1135 ARG A CD    1 
ATOM   8679  N  NE    . ARG A 1  1135 ? 13.104  -4.910  95.159  1.00 104.48 ? 1135 ARG A NE    1 
ATOM   8680  C  CZ    . ARG A 1  1135 ? 12.562  -5.325  96.302  1.00 104.55 ? 1135 ARG A CZ    1 
ATOM   8681  N  NH1   . ARG A 1  1135 ? 12.694  -6.581  96.705  1.00 104.43 ? 1135 ARG A NH1   1 
ATOM   8682  N  NH2   . ARG A 1  1135 ? 11.888  -4.472  97.054  1.00 104.98 ? 1135 ARG A NH2   1 
ATOM   8683  N  N     . SER A 1  1136 ? 18.132  -6.009  97.267  1.00 103.86 ? 1136 SER A N     1 
ATOM   8684  C  CA    . SER A 1  1136 ? 18.683  -4.840  97.953  1.00 102.94 ? 1136 SER A CA    1 
ATOM   8685  C  C     . SER A 1  1136 ? 20.205  -4.840  98.077  1.00 102.48 ? 1136 SER A C     1 
ATOM   8686  O  O     . SER A 1  1136 ? 20.798  -3.797  98.342  1.00 102.65 ? 1136 SER A O     1 
ATOM   8687  C  CB    . SER A 1  1136 ? 18.025  -4.654  99.323  1.00 102.80 ? 1136 SER A CB    1 
ATOM   8688  O  OG    . SER A 1  1136 ? 18.445  -5.659  100.220 1.00 102.41 ? 1136 SER A OG    1 
ATOM   8689  N  N     . ALA A 1  1137 ? 20.836  -5.993  97.881  1.00 101.73 ? 1137 ALA A N     1 
ATOM   8690  C  CA    . ALA A 1  1137 ? 22.296  -6.043  97.844  1.00 100.96 ? 1137 ALA A CA    1 
ATOM   8691  C  C     . ALA A 1  1137 ? 22.822  -5.849  96.422  1.00 100.36 ? 1137 ALA A C     1 
ATOM   8692  O  O     . ALA A 1  1137 ? 24.027  -5.920  96.196  1.00 100.25 ? 1137 ALA A O     1 
ATOM   8693  C  CB    . ALA A 1  1137 ? 22.807  -7.341  98.444  1.00 101.17 ? 1137 ALA A CB    1 
ATOM   8694  N  N     . ILE A 1  1138 ? 21.905  -5.585  95.485  1.00 99.74  ? 1138 ILE A N     1 
ATOM   8695  C  CA    . ILE A 1  1138 ? 22.210  -5.377  94.054  1.00 99.12  ? 1138 ILE A CA    1 
ATOM   8696  C  C     . ILE A 1  1138 ? 21.965  -3.936  93.586  1.00 98.64  ? 1138 ILE A C     1 
ATOM   8697  O  O     . ILE A 1  1138 ? 22.855  -3.287  93.019  1.00 98.67  ? 1138 ILE A O     1 
ATOM   8698  C  CB    . ILE A 1  1138 ? 21.348  -6.290  93.159  1.00 99.02  ? 1138 ILE A CB    1 
ATOM   8699  C  CG1   . ILE A 1  1138 ? 21.324  -7.714  93.697  1.00 99.40  ? 1138 ILE A CG1   1 
ATOM   8700  C  CG2   . ILE A 1  1138 ? 21.870  -6.287  91.733  1.00 99.21  ? 1138 ILE A CG2   1 
ATOM   8701  C  CD1   . ILE A 1  1138 ? 22.686  -8.398  93.744  1.00 100.56 ? 1138 ILE A CD1   1 
ATOM   8702  N  N     . GLU A 1  1139 ? 20.736  -3.470  93.808  1.00 97.88  ? 1139 GLU A N     1 
ATOM   8703  C  CA    . GLU A 1  1139 ? 20.298  -2.121  93.482  1.00 97.03  ? 1139 GLU A CA    1 
ATOM   8704  C  C     . GLU A 1  1139 ? 21.339  -1.107  93.903  1.00 96.33  ? 1139 GLU A C     1 
ATOM   8705  O  O     . GLU A 1  1139 ? 21.923  -1.225  94.980  1.00 96.31  ? 1139 GLU A O     1 
ATOM   8706  C  CB    . GLU A 1  1139 ? 18.987  -1.841  94.208  1.00 97.01  ? 1139 GLU A CB    1 
ATOM   8707  C  CG    . GLU A 1  1139 ? 18.188  -0.696  93.637  1.00 98.10  ? 1139 GLU A CG    1 
ATOM   8708  C  CD    . GLU A 1  1139 ? 16.684  -0.969  93.635  1.00 99.96  ? 1139 GLU A CD    1 
ATOM   8709  O  OE1   . GLU A 1  1139 ? 16.284  -2.122  93.355  1.00 100.67 ? 1139 GLU A OE1   1 
ATOM   8710  O  OE2   . GLU A 1  1139 ? 15.895  -0.028  93.896  1.00 100.94 ? 1139 GLU A OE2   1 
ATOM   8711  N  N     . HIS A 1  1140 ? 21.591  -0.121  93.055  1.00 95.49  ? 1140 HIS A N     1 
ATOM   8712  C  CA    . HIS A 1  1140 ? 22.478  0.958   93.455  1.00 94.88  ? 1140 HIS A CA    1 
ATOM   8713  C  C     . HIS A 1  1140 ? 21.700  1.997   94.246  1.00 94.25  ? 1140 HIS A C     1 
ATOM   8714  O  O     . HIS A 1  1140 ? 20.564  2.328   93.904  1.00 94.33  ? 1140 HIS A O     1 
ATOM   8715  C  CB    . HIS A 1  1140 ? 23.163  1.598   92.252  1.00 95.00  ? 1140 HIS A CB    1 
ATOM   8716  C  CG    . HIS A 1  1140 ? 24.209  2.603   92.618  1.00 95.59  ? 1140 HIS A CG    1 
ATOM   8717  N  ND1   . HIS A 1  1140 ? 24.945  2.523   93.782  1.00 96.12  ? 1140 HIS A ND1   1 
ATOM   8718  C  CD2   . HIS A 1  1140 ? 24.655  3.704   91.967  1.00 96.55  ? 1140 HIS A CD2   1 
ATOM   8719  C  CE1   . HIS A 1  1140 ? 25.793  3.535   93.837  1.00 96.74  ? 1140 HIS A CE1   1 
ATOM   8720  N  NE2   . HIS A 1  1140 ? 25.637  4.267   92.748  1.00 97.37  ? 1140 HIS A NE2   1 
ATOM   8721  N  N     . THR A 1  1141 ? 22.304  2.493   95.316  1.00 93.31  ? 1141 THR A N     1 
ATOM   8722  C  CA    . THR A 1  1141 ? 21.679  3.533   96.108  1.00 92.49  ? 1141 THR A CA    1 
ATOM   8723  C  C     . THR A 1  1141 ? 22.723  4.584   96.480  1.00 92.39  ? 1141 THR A C     1 
ATOM   8724  O  O     . THR A 1  1141 ? 23.638  4.299   97.253  1.00 92.62  ? 1141 THR A O     1 
ATOM   8725  C  CB    . THR A 1  1141 ? 21.028  2.958   97.376  1.00 92.23  ? 1141 THR A CB    1 
ATOM   8726  O  OG1   . THR A 1  1141 ? 20.197  1.848   97.033  1.00 91.28  ? 1141 THR A OG1   1 
ATOM   8727  C  CG2   . THR A 1  1141 ? 20.182  4.001   98.046  1.00 92.19  ? 1141 THR A CG2   1 
ATOM   8728  N  N     . THR A 1  1142 ? 22.598  5.786   95.908  1.00 91.94  ? 1142 THR A N     1 
ATOM   8729  C  CA    . THR A 1  1142 ? 23.473  6.914   96.262  1.00 91.41  ? 1142 THR A CA    1 
ATOM   8730  C  C     . THR A 1  1142 ? 22.915  7.634   97.476  1.00 90.93  ? 1142 THR A C     1 
ATOM   8731  O  O     . THR A 1  1142 ? 21.728  7.519   97.784  1.00 90.99  ? 1142 THR A O     1 
ATOM   8732  C  CB    . THR A 1  1142 ? 23.647  7.942   95.101  1.00 91.57  ? 1142 THR A CB    1 
ATOM   8733  O  OG1   . THR A 1  1142 ? 22.424  8.050   94.351  1.00 91.38  ? 1142 THR A OG1   1 
ATOM   8734  C  CG2   . THR A 1  1142 ? 24.828  7.557   94.174  1.00 91.29  ? 1142 THR A CG2   1 
ATOM   8735  N  N     . LEU A 1  1143 ? 23.762  8.377   98.170  1.00 90.26  ? 1143 LEU A N     1 
ATOM   8736  C  CA    . LEU A 1  1143 ? 23.271  9.164   99.276  1.00 89.82  ? 1143 LEU A CA    1 
ATOM   8737  C  C     . LEU A 1  1143 ? 22.264  10.201  98.768  1.00 89.65  ? 1143 LEU A C     1 
ATOM   8738  O  O     . LEU A 1  1143 ? 21.235  10.422  99.398  1.00 89.64  ? 1143 LEU A O     1 
ATOM   8739  C  CB    . LEU A 1  1143 ? 24.430  9.807   100.039 1.00 89.91  ? 1143 LEU A CB    1 
ATOM   8740  C  CG    . LEU A 1  1143 ? 24.180  10.593  101.334 1.00 89.54  ? 1143 LEU A CG    1 
ATOM   8741  C  CD1   . LEU A 1  1143 ? 23.116  9.968   102.244 1.00 88.79  ? 1143 LEU A CD1   1 
ATOM   8742  C  CD2   . LEU A 1  1143 ? 25.497  10.762  102.071 1.00 89.56  ? 1143 LEU A CD2   1 
ATOM   8743  N  N     . LYS A 1  1144 ? 22.544  10.801  97.611  1.00 89.35  ? 1144 LYS A N     1 
ATOM   8744  C  CA    . LYS A 1  1144 ? 21.658  11.811  97.016  1.00 89.14  ? 1144 LYS A CA    1 
ATOM   8745  C  C     . LYS A 1  1144 ? 20.207  11.352  97.014  1.00 88.75  ? 1144 LYS A C     1 
ATOM   8746  O  O     . LYS A 1  1144 ? 19.304  12.135  97.296  1.00 88.78  ? 1144 LYS A O     1 
ATOM   8747  C  CB    . LYS A 1  1144 ? 22.111  12.166  95.586  1.00 89.32  ? 1144 LYS A CB    1 
ATOM   8748  C  CG    . LYS A 1  1144 ? 21.120  13.024  94.751  1.00 89.49  ? 1144 LYS A CG    1 
ATOM   8749  C  CD    . LYS A 1  1144 ? 21.622  13.256  93.308  1.00 89.59  ? 1144 LYS A CD    1 
ATOM   8750  C  CE    . LYS A 1  1144 ? 20.486  13.566  92.319  1.00 89.72  ? 1144 LYS A CE    1 
ATOM   8751  N  NZ    . LYS A 1  1144 ? 19.896  12.339  91.695  1.00 89.47  ? 1144 LYS A NZ    1 
ATOM   8752  N  N     . SER A 1  1145 ? 19.998  10.071  96.718  1.00 88.37  ? 1145 SER A N     1 
ATOM   8753  C  CA    . SER A 1  1145 ? 18.662  9.510   96.556  1.00 87.85  ? 1145 SER A CA    1 
ATOM   8754  C  C     . SER A 1  1145 ? 17.899  9.343   97.877  1.00 87.53  ? 1145 SER A C     1 
ATOM   8755  O  O     . SER A 1  1145 ? 16.785  8.819   97.886  1.00 87.61  ? 1145 SER A O     1 
ATOM   8756  C  CB    . SER A 1  1145 ? 18.753  8.174   95.823  1.00 87.83  ? 1145 SER A CB    1 
ATOM   8757  O  OG    . SER A 1  1145 ? 19.443  7.224   96.612  1.00 87.45  ? 1145 SER A OG    1 
ATOM   8758  N  N     . VAL A 1  1146 ? 18.491  9.801   98.980  1.00 86.97  ? 1146 VAL A N     1 
ATOM   8759  C  CA    . VAL A 1  1146 ? 17.862  9.697   100.303 1.00 86.37  ? 1146 VAL A CA    1 
ATOM   8760  C  C     . VAL A 1  1146 ? 17.835  10.973  101.132 1.00 85.84  ? 1146 VAL A C     1 
ATOM   8761  O  O     . VAL A 1  1146 ? 17.164  11.031  102.161 1.00 85.85  ? 1146 VAL A O     1 
ATOM   8762  C  CB    . VAL A 1  1146 ? 18.491  8.583   101.161 1.00 86.47  ? 1146 VAL A CB    1 
ATOM   8763  C  CG1   . VAL A 1  1146 ? 17.521  7.430   101.296 1.00 86.93  ? 1146 VAL A CG1   1 
ATOM   8764  C  CG2   . VAL A 1  1146 ? 19.836  8.123   100.593 1.00 86.40  ? 1146 VAL A CG2   1 
ATOM   8765  N  N     . THR A 1  1147 ? 18.560  11.988  100.678 1.00 85.20  ? 1147 THR A N     1 
ATOM   8766  C  CA    . THR A 1  1147 ? 18.624  13.275  101.353 1.00 84.73  ? 1147 THR A CA    1 
ATOM   8767  C  C     . THR A 1  1147 ? 17.440  14.150  100.992 1.00 84.40  ? 1147 THR A C     1 
ATOM   8768  O  O     . THR A 1  1147 ? 17.081  14.253  99.828  1.00 84.68  ? 1147 THR A O     1 
ATOM   8769  C  CB    . THR A 1  1147 ? 19.847  14.075  100.893 1.00 84.77  ? 1147 THR A CB    1 
ATOM   8770  O  OG1   . THR A 1  1147 ? 20.813  13.212  100.277 1.00 84.85  ? 1147 THR A OG1   1 
ATOM   8771  C  CG2   . THR A 1  1147 ? 20.461  14.795  102.061 1.00 85.30  ? 1147 THR A CG2   1 
ATOM   8772  N  N     . ILE A 1  1148 ? 16.842  14.808  101.972 1.00 83.97  ? 1148 ILE A N     1 
ATOM   8773  C  CA    . ILE A 1  1148 ? 15.931  15.897  101.662 1.00 83.67  ? 1148 ILE A CA    1 
ATOM   8774  C  C     . ILE A 1  1148 ? 16.788  17.081  101.221 1.00 83.67  ? 1148 ILE A C     1 
ATOM   8775  O  O     . ILE A 1  1148 ? 16.826  17.405  100.036 1.00 83.74  ? 1148 ILE A O     1 
ATOM   8776  C  CB    . ILE A 1  1148 ? 15.053  16.296  102.872 1.00 83.68  ? 1148 ILE A CB    1 
ATOM   8777  C  CG1   . ILE A 1  1148 ? 14.151  15.144  103.302 1.00 83.65  ? 1148 ILE A CG1   1 
ATOM   8778  C  CG2   . ILE A 1  1148 ? 14.206  17.530  102.563 1.00 83.67  ? 1148 ILE A CG2   1 
ATOM   8779  C  CD1   . ILE A 1  1148 ? 12.940  14.946  102.420 1.00 84.88  ? 1148 ILE A CD1   1 
ATOM   8780  N  N     . ALA A 1  1149 ? 17.503  17.676  102.181 1.00 83.57  ? 1149 ALA A N     1 
ATOM   8781  C  CA    . ALA A 1  1149 ? 18.249  18.924  102.009 1.00 83.47  ? 1149 ALA A CA    1 
ATOM   8782  C  C     . ALA A 1  1149 ? 19.626  18.824  102.645 1.00 83.50  ? 1149 ALA A C     1 
ATOM   8783  O  O     . ALA A 1  1149 ? 19.784  18.169  103.675 1.00 83.49  ? 1149 ALA A O     1 
ATOM   8784  C  CB    . ALA A 1  1149 ? 17.483  20.063  102.646 1.00 83.43  ? 1149 ALA A CB    1 
ATOM   8785  N  N     . SER A 1  1150 ? 20.614  19.479  102.042 1.00 83.61  ? 1150 SER A N     1 
ATOM   8786  C  CA    . SER A 1  1150 ? 21.958  19.520  102.603 1.00 83.92  ? 1150 SER A CA    1 
ATOM   8787  C  C     . SER A 1  1150 ? 22.373  20.962  102.881 1.00 84.68  ? 1150 SER A C     1 
ATOM   8788  O  O     . SER A 1  1150 ? 22.477  21.756  101.946 1.00 84.97  ? 1150 SER A O     1 
ATOM   8789  C  CB    . SER A 1  1150 ? 22.941  18.871  101.648 1.00 83.41  ? 1150 SER A CB    1 
ATOM   8790  O  OG    . SER A 1  1150 ? 23.087  19.676  100.511 1.00 82.83  ? 1150 SER A OG    1 
ATOM   8791  N  N     . GLU A 1  1151 ? 22.619  21.283  104.160 1.00 85.49  ? 1151 GLU A N     1 
ATOM   8792  C  CA    . GLU A 1  1151 ? 22.856  22.661  104.634 1.00 86.18  ? 1151 GLU A CA    1 
ATOM   8793  C  C     . GLU A 1  1151 ? 24.145  22.820  105.415 1.00 86.94  ? 1151 GLU A C     1 
ATOM   8794  O  O     . GLU A 1  1151 ? 24.555  21.908  106.124 1.00 87.12  ? 1151 GLU A O     1 
ATOM   8795  C  CB    . GLU A 1  1151 ? 21.736  23.105  105.564 1.00 85.96  ? 1151 GLU A CB    1 
ATOM   8796  C  CG    . GLU A 1  1151 ? 20.365  22.626  105.190 1.00 86.15  ? 1151 GLU A CG    1 
ATOM   8797  C  CD    . GLU A 1  1151 ? 19.477  22.474  106.396 1.00 86.59  ? 1151 GLU A CD    1 
ATOM   8798  O  OE1   . GLU A 1  1151 ? 19.761  21.597  107.243 1.00 86.34  ? 1151 GLU A OE1   1 
ATOM   8799  O  OE2   . GLU A 1  1151 ? 18.489  23.234  106.496 1.00 87.38  ? 1151 GLU A OE2   1 
ATOM   8800  N  N     . ILE A 1  1152 ? 24.756  23.999  105.297 1.00 88.12  ? 1152 ILE A N     1 
ATOM   8801  C  CA    . ILE A 1  1152 ? 25.916  24.399  106.103 1.00 89.18  ? 1152 ILE A CA    1 
ATOM   8802  C  C     . ILE A 1  1152 ? 25.506  25.491  107.089 1.00 90.44  ? 1152 ILE A C     1 
ATOM   8803  O  O     . ILE A 1  1152 ? 24.785  26.420  106.736 1.00 90.61  ? 1152 ILE A O     1 
ATOM   8804  C  CB    . ILE A 1  1152 ? 27.108  24.883  105.226 1.00 88.77  ? 1152 ILE A CB    1 
ATOM   8805  C  CG1   . ILE A 1  1152 ? 27.924  23.706  104.711 1.00 87.68  ? 1152 ILE A CG1   1 
ATOM   8806  C  CG2   . ILE A 1  1152 ? 28.044  25.781  106.001 1.00 88.85  ? 1152 ILE A CG2   1 
ATOM   8807  C  CD1   . ILE A 1  1152 ? 27.599  23.321  103.324 1.00 85.92  ? 1152 ILE A CD1   1 
ATOM   8808  N  N     . TYR A 1  1153 ? 25.976  25.363  108.323 1.00 92.15  ? 1153 TYR A N     1 
ATOM   8809  C  CA    . TYR A 1  1153 ? 25.645  26.282  109.396 1.00 94.04  ? 1153 TYR A CA    1 
ATOM   8810  C  C     . TYR A 1  1153 ? 26.915  26.779  110.081 1.00 95.57  ? 1153 TYR A C     1 
ATOM   8811  O  O     . TYR A 1  1153 ? 27.983  26.197  109.899 1.00 95.80  ? 1153 TYR A O     1 
ATOM   8812  C  CB    . TYR A 1  1153 ? 24.810  25.536  110.421 1.00 93.82  ? 1153 TYR A CB    1 
ATOM   8813  C  CG    . TYR A 1  1153 ? 23.368  25.329  110.058 1.00 93.75  ? 1153 TYR A CG    1 
ATOM   8814  C  CD1   . TYR A 1  1153 ? 22.996  24.613  108.925 1.00 93.59  ? 1153 TYR A CD1   1 
ATOM   8815  C  CD2   . TYR A 1  1153 ? 22.365  25.821  110.883 1.00 94.08  ? 1153 TYR A CD2   1 
ATOM   8816  C  CE1   . TYR A 1  1153 ? 21.653  24.416  108.616 1.00 94.11  ? 1153 TYR A CE1   1 
ATOM   8817  C  CE2   . TYR A 1  1153 ? 21.025  25.630  110.588 1.00 94.25  ? 1153 TYR A CE2   1 
ATOM   8818  C  CZ    . TYR A 1  1153 ? 20.670  24.933  109.457 1.00 94.25  ? 1153 TYR A CZ    1 
ATOM   8819  O  OH    . TYR A 1  1153 ? 19.330  24.759  109.188 1.00 94.34  ? 1153 TYR A OH    1 
ATOM   8820  N  N     . TYR A 1  1154 ? 26.810  27.841  110.876 1.00 97.44  ? 1154 TYR A N     1 
ATOM   8821  C  CA    . TYR A 1  1154 ? 27.867  28.129  111.841 1.00 99.57  ? 1154 TYR A CA    1 
ATOM   8822  C  C     . TYR A 1  1154 ? 27.436  27.662  113.226 1.00 101.11 ? 1154 TYR A C     1 
ATOM   8823  O  O     . TYR A 1  1154 ? 26.569  28.273  113.859 1.00 101.26 ? 1154 TYR A O     1 
ATOM   8824  C  CB    . TYR A 1  1154 ? 28.245  29.611  111.869 1.00 99.49  ? 1154 TYR A CB    1 
ATOM   8825  C  CG    . TYR A 1  1154 ? 29.522  29.941  112.651 1.00 99.76  ? 1154 TYR A CG    1 
ATOM   8826  C  CD1   . TYR A 1  1154 ? 30.780  29.835  112.052 1.00 99.94  ? 1154 TYR A CD1   1 
ATOM   8827  C  CD2   . TYR A 1  1154 ? 29.469  30.381  113.980 1.00 99.65  ? 1154 TYR A CD2   1 
ATOM   8828  C  CE1   . TYR A 1  1154 ? 31.950  30.149  112.752 1.00 99.51  ? 1154 TYR A CE1   1 
ATOM   8829  C  CE2   . TYR A 1  1154 ? 30.641  30.700  114.684 1.00 99.13  ? 1154 TYR A CE2   1 
ATOM   8830  C  CZ    . TYR A 1  1154 ? 31.872  30.577  114.060 1.00 99.02  ? 1154 TYR A CZ    1 
ATOM   8831  O  OH    . TYR A 1  1154 ? 33.030  30.883  114.730 1.00 98.87  ? 1154 TYR A OH    1 
ATOM   8832  N  N     . ASP A 1  1155 ? 28.031  26.559  113.672 1.00 103.10 ? 1155 ASP A N     1 
ATOM   8833  C  CA    . ASP A 1  1155 ? 27.851  26.066  115.033 1.00 105.10 ? 1155 ASP A CA    1 
ATOM   8834  C  C     . ASP A 1  1155 ? 29.247  25.785  115.599 1.00 106.95 ? 1155 ASP A C     1 
ATOM   8835  O  O     . ASP A 1  1155 ? 29.835  24.727  115.315 1.00 106.84 ? 1155 ASP A O     1 
ATOM   8836  C  CB    . ASP A 1  1155 ? 26.961  24.816  115.058 1.00 104.83 ? 1155 ASP A CB    1 
ATOM   8837  C  CG    . ASP A 1  1155 ? 26.064  24.744  116.291 1.00 104.22 ? 1155 ASP A CG    1 
ATOM   8838  O  OD1   . ASP A 1  1155 ? 25.463  25.772  116.664 1.00 103.20 ? 1155 ASP A OD1   1 
ATOM   8839  O  OD2   . ASP A 1  1155 ? 25.940  23.642  116.873 1.00 103.59 ? 1155 ASP A OD2   1 
ATOM   8840  N  N     . PRO A 1  1156 ? 29.787  26.751  116.383 1.00 108.85 ? 1156 PRO A N     1 
ATOM   8841  C  CA    . PRO A 1  1156 ? 31.163  26.759  116.900 1.00 110.30 ? 1156 PRO A CA    1 
ATOM   8842  C  C     . PRO A 1  1156 ? 31.308  26.067  118.249 1.00 111.78 ? 1156 PRO A C     1 
ATOM   8843  O  O     . PRO A 1  1156 ? 32.393  25.596  118.591 1.00 111.70 ? 1156 PRO A O     1 
ATOM   8844  C  CB    . PRO A 1  1156 ? 31.448  28.250  117.065 1.00 110.28 ? 1156 PRO A CB    1 
ATOM   8845  C  CG    . PRO A 1  1156 ? 30.100  28.857  117.392 1.00 109.63 ? 1156 PRO A CG    1 
ATOM   8846  C  CD    . PRO A 1  1156 ? 29.037  27.948  116.823 1.00 108.94 ? 1156 PRO A CD    1 
ATOM   8847  N  N     . ASP A 1  1157 ? 30.209  26.032  118.995 1.00 113.72 ? 1157 ASP A N     1 
ATOM   8848  C  CA    . ASP A 1  1157 ? 30.144  25.449  120.316 1.00 115.81 ? 1157 ASP A CA    1 
ATOM   8849  C  C     . ASP A 1  1157 ? 29.783  23.975  120.157 1.00 117.32 ? 1157 ASP A C     1 
ATOM   8850  O  O     . ASP A 1  1157 ? 28.600  23.639  120.078 1.00 117.36 ? 1157 ASP A O     1 
ATOM   8851  C  CB    . ASP A 1  1157 ? 29.075  26.190  121.127 1.00 115.83 ? 1157 ASP A CB    1 
ATOM   8852  C  CG    . ASP A 1  1157 ? 28.891  25.631  122.529 1.00 116.08 ? 1157 ASP A CG    1 
ATOM   8853  O  OD1   . ASP A 1  1157 ? 29.858  25.082  123.105 1.00 116.40 ? 1157 ASP A OD1   1 
ATOM   8854  O  OD2   . ASP A 1  1157 ? 27.767  25.758  123.061 1.00 116.07 ? 1157 ASP A OD2   1 
ATOM   8855  N  N     . PRO A 1  1158 ? 30.797  23.088  120.101 1.00 118.94 ? 1158 PRO A N     1 
ATOM   8856  C  CA    . PRO A 1  1158 ? 30.521  21.689  119.775 1.00 120.26 ? 1158 PRO A CA    1 
ATOM   8857  C  C     . PRO A 1  1158 ? 29.615  21.004  120.791 1.00 121.67 ? 1158 PRO A C     1 
ATOM   8858  O  O     . PRO A 1  1158 ? 28.787  20.177  120.414 1.00 121.68 ? 1158 PRO A O     1 
ATOM   8859  C  CB    . PRO A 1  1158 ? 31.914  21.051  119.772 1.00 120.17 ? 1158 PRO A CB    1 
ATOM   8860  C  CG    . PRO A 1  1158 ? 32.852  22.198  119.542 1.00 119.67 ? 1158 PRO A CG    1 
ATOM   8861  C  CD    . PRO A 1  1158 ? 32.235  23.305  120.330 1.00 119.10 ? 1158 PRO A CD    1 
ATOM   8862  N  N     . ARG A 1  1159 ? 29.753  21.378  122.058 1.00 123.55 ? 1159 ARG A N     1 
ATOM   8863  C  CA    . ARG A 1  1159 ? 29.019  20.742  123.152 1.00 125.58 ? 1159 ARG A CA    1 
ATOM   8864  C  C     . ARG A 1  1159 ? 27.520  21.075  123.182 1.00 126.88 ? 1159 ARG A C     1 
ATOM   8865  O  O     . ARG A 1  1159 ? 26.720  20.312  123.726 1.00 126.77 ? 1159 ARG A O     1 
ATOM   8866  C  CB    . ARG A 1  1159 ? 29.671  21.089  124.504 1.00 125.64 ? 1159 ARG A CB    1 
ATOM   8867  C  CG    . ARG A 1  1159 ? 31.182  20.806  124.586 1.00 126.27 ? 1159 ARG A CG    1 
ATOM   8868  C  CD    . ARG A 1  1159 ? 31.500  19.331  124.858 1.00 126.98 ? 1159 ARG A CD    1 
ATOM   8869  N  NE    . ARG A 1  1159 ? 31.972  19.096  126.223 1.00 127.47 ? 1159 ARG A NE    1 
ATOM   8870  C  CZ    . ARG A 1  1159 ? 31.191  18.843  127.272 1.00 127.97 ? 1159 ARG A CZ    1 
ATOM   8871  N  NH1   . ARG A 1  1159 ? 29.870  18.792  127.142 1.00 128.04 ? 1159 ARG A NH1   1 
ATOM   8872  N  NH2   . ARG A 1  1159 ? 31.738  18.642  128.463 1.00 128.40 ? 1159 ARG A NH2   1 
ATOM   8873  N  N     . SER A 1  1160 ? 27.143  22.216  122.609 1.00 128.81 ? 1160 SER A N     1 
ATOM   8874  C  CA    . SER A 1  1160 ? 25.747  22.669  122.627 1.00 130.66 ? 1160 SER A CA    1 
ATOM   8875  C  C     . SER A 1  1160 ? 25.364  23.455  121.364 1.00 131.93 ? 1160 SER A C     1 
ATOM   8876  O  O     . SER A 1  1160 ? 26.024  24.435  120.996 1.00 132.08 ? 1160 SER A O     1 
ATOM   8877  C  CB    . SER A 1  1160 ? 25.450  23.493  123.891 1.00 130.64 ? 1160 SER A CB    1 
ATOM   8878  O  OG    . SER A 1  1160 ? 25.653  22.732  125.075 1.00 130.67 ? 1160 SER A OG    1 
ATOM   8879  N  N     . THR A 1  1161 ? 24.278  23.017  120.729 1.00 133.46 ? 1161 THR A N     1 
ATOM   8880  C  CA    . THR A 1  1161 ? 23.823  23.540  119.439 1.00 134.92 ? 1161 THR A CA    1 
ATOM   8881  C  C     . THR A 1  1161 ? 23.298  24.974  119.518 1.00 136.03 ? 1161 THR A C     1 
ATOM   8882  O  O     . THR A 1  1161 ? 23.209  25.565  120.601 1.00 136.14 ? 1161 THR A O     1 
ATOM   8883  C  CB    . THR A 1  1161 ? 22.680  22.671  118.871 1.00 134.81 ? 1161 THR A CB    1 
ATOM   8884  O  OG1   . THR A 1  1161 ? 22.516  21.495  119.669 1.00 134.84 ? 1161 THR A OG1   1 
ATOM   8885  C  CG2   . THR A 1  1161 ? 22.961  22.282  117.433 1.00 134.84 ? 1161 THR A CG2   1 
ATOM   8886  N  N     . VAL A 1  1162 ? 22.966  25.529  118.355 1.00 137.37 ? 1162 VAL A N     1 
ATOM   8887  C  CA    . VAL A 1  1162 ? 22.158  26.741  118.278 1.00 138.70 ? 1162 VAL A CA    1 
ATOM   8888  C  C     . VAL A 1  1162 ? 20.803  26.368  117.645 1.00 139.55 ? 1162 VAL A C     1 
ATOM   8889  O  O     . VAL A 1  1162 ? 19.940  27.221  117.435 1.00 139.73 ? 1162 VAL A O     1 
ATOM   8890  C  CB    . VAL A 1  1162 ? 22.908  27.897  117.539 1.00 138.72 ? 1162 VAL A CB    1 
ATOM   8891  C  CG1   . VAL A 1  1162 ? 22.008  29.111  117.308 1.00 138.84 ? 1162 VAL A CG1   1 
ATOM   8892  C  CG2   . VAL A 1  1162 ? 24.140  28.326  118.334 1.00 138.91 ? 1162 VAL A CG2   1 
ATOM   8893  N  N     . ILE A 1  1163 ? 20.618  25.075  117.383 1.00 140.62 ? 1163 ILE A N     1 
ATOM   8894  C  CA    . ILE A 1  1163 ? 19.373  24.549  116.816 1.00 141.67 ? 1163 ILE A CA    1 
ATOM   8895  C  C     . ILE A 1  1163 ? 18.527  23.863  117.904 1.00 142.71 ? 1163 ILE A C     1 
ATOM   8896  O  O     . ILE A 1  1163 ? 19.070  23.132  118.735 1.00 142.74 ? 1163 ILE A O     1 
ATOM   8897  C  CB    . ILE A 1  1163 ? 19.677  23.602  115.633 1.00 141.50 ? 1163 ILE A CB    1 
ATOM   8898  C  CG1   . ILE A 1  1163 ? 20.252  24.411  114.470 1.00 141.32 ? 1163 ILE A CG1   1 
ATOM   8899  C  CG2   . ILE A 1  1163 ? 18.431  22.851  115.176 1.00 141.31 ? 1163 ILE A CG2   1 
ATOM   8900  C  CD1   . ILE A 1  1163 ? 21.282  23.675  113.661 1.00 141.14 ? 1163 ILE A CD1   1 
ATOM   8901  N  N     . PRO A 1  1164 ? 17.198  24.119  117.916 1.00 143.76 ? 1164 PRO A N     1 
ATOM   8902  C  CA    . PRO A 1  1164 ? 16.289  23.564  118.937 1.00 144.61 ? 1164 PRO A CA    1 
ATOM   8903  C  C     . PRO A 1  1164 ? 15.880  22.095  118.757 1.00 145.51 ? 1164 PRO A C     1 
ATOM   8904  O  O     . PRO A 1  1164 ? 15.732  21.382  119.750 1.00 145.49 ? 1164 PRO A O     1 
ATOM   8905  C  CB    . PRO A 1  1164 ? 15.059  24.469  118.837 1.00 144.58 ? 1164 PRO A CB    1 
ATOM   8906  C  CG    . PRO A 1  1164 ? 15.054  24.945  117.425 1.00 144.30 ? 1164 PRO A CG    1 
ATOM   8907  C  CD    . PRO A 1  1164 ? 16.486  24.994  116.963 1.00 143.81 ? 1164 PRO A CD    1 
ATOM   8908  N  N     . GLU A 1  1165 ? 15.696  21.656  117.510 1.00 146.70 ? 1165 GLU A N     1 
ATOM   8909  C  CA    . GLU A 1  1165 ? 15.281  20.276  117.189 1.00 147.80 ? 1165 GLU A CA    1 
ATOM   8910  C  C     . GLU A 1  1165 ? 16.454  19.286  117.254 1.00 148.38 ? 1165 GLU A C     1 
ATOM   8911  O  O     . GLU A 1  1165 ? 16.284  18.088  117.011 1.00 148.33 ? 1165 GLU A O     1 
ATOM   8912  C  CB    . GLU A 1  1165 ? 14.637  20.221  115.792 1.00 147.90 ? 1165 GLU A CB    1 
ATOM   8913  C  CG    . GLU A 1  1165 ? 13.474  21.203  115.566 1.00 148.47 ? 1165 GLU A CG    1 
ATOM   8914  C  CD    . GLU A 1  1165 ? 13.426  21.776  114.145 1.00 148.93 ? 1165 GLU A CD    1 
ATOM   8915  O  OE1   . GLU A 1  1165 ? 12.869  22.885  113.974 1.00 149.07 ? 1165 GLU A OE1   1 
ATOM   8916  O  OE2   . GLU A 1  1165 ? 13.941  21.127  113.204 1.00 149.00 ? 1165 GLU A OE2   1 
ATOM   8917  N  N     . ASP A 1  1166 ? 17.638  19.807  117.572 1.00 149.26 ? 1166 ASP A N     1 
ATOM   8918  C  CA    . ASP A 1  1166 ? 18.868  19.022  117.662 1.00 150.08 ? 1166 ASP A CA    1 
ATOM   8919  C  C     . ASP A 1  1166 ? 19.397  18.950  119.091 1.00 150.81 ? 1166 ASP A C     1 
ATOM   8920  O  O     . ASP A 1  1166 ? 20.491  18.429  119.324 1.00 150.94 ? 1166 ASP A O     1 
ATOM   8921  C  CB    . ASP A 1  1166 ? 19.948  19.619  116.755 1.00 149.94 ? 1166 ASP A CB    1 
ATOM   8922  C  CG    . ASP A 1  1166 ? 19.801  19.197  115.310 1.00 149.75 ? 1166 ASP A CG    1 
ATOM   8923  O  OD1   . ASP A 1  1166 ? 18.661  18.939  114.868 1.00 149.60 ? 1166 ASP A OD1   1 
ATOM   8924  O  OD2   . ASP A 1  1166 ? 20.832  19.129  114.613 1.00 149.24 ? 1166 ASP A OD2   1 
ATOM   8925  N  N     . GLU A 1  1167 ? 18.622  19.478  120.039 1.00 151.66 ? 1167 GLU A N     1 
ATOM   8926  C  CA    . GLU A 1  1167 ? 19.010  19.507  121.448 1.00 152.44 ? 1167 GLU A CA    1 
ATOM   8927  C  C     . GLU A 1  1167 ? 19.424  18.116  121.935 1.00 153.05 ? 1167 GLU A C     1 
ATOM   8928  O  O     . GLU A 1  1167 ? 20.581  17.893  122.295 1.00 153.12 ? 1167 GLU A O     1 
ATOM   8929  C  CB    . GLU A 1  1167 ? 17.863  20.056  122.304 1.00 152.35 ? 1167 GLU A CB    1 
ATOM   8930  C  CG    . GLU A 1  1167 ? 18.206  20.246  123.777 1.00 152.36 ? 1167 GLU A CG    1 
ATOM   8931  C  CD    . GLU A 1  1167 ? 16.997  20.125  124.695 1.00 152.34 ? 1167 GLU A CD    1 
ATOM   8932  O  OE1   . GLU A 1  1167 ? 17.193  19.842  125.897 1.00 152.27 ? 1167 GLU A OE1   1 
ATOM   8933  O  OE2   . GLU A 1  1167 ? 15.853  20.309  124.222 1.00 152.27 ? 1167 GLU A OE2   1 
ATOM   8934  N  N     . GLU A 1  1168 ? 18.473  17.187  121.907 1.00 153.81 ? 1168 GLU A N     1 
ATOM   8935  C  CA    . GLU A 1  1168 ? 18.653  15.842  122.443 1.00 154.61 ? 1168 GLU A CA    1 
ATOM   8936  C  C     . GLU A 1  1168 ? 19.902  15.131  121.919 1.00 155.19 ? 1168 GLU A C     1 
ATOM   8937  O  O     . GLU A 1  1168 ? 20.707  14.626  122.700 1.00 155.27 ? 1168 GLU A O     1 
ATOM   8938  C  CB    . GLU A 1  1168 ? 17.408  15.001  122.150 1.00 154.55 ? 1168 GLU A CB    1 
ATOM   8939  C  CG    . GLU A 1  1168 ? 17.297  13.725  122.974 1.00 154.65 ? 1168 GLU A CG    1 
ATOM   8940  C  CD    . GLU A 1  1168 ? 16.081  12.893  122.610 1.00 154.62 ? 1168 GLU A CD    1 
ATOM   8941  O  OE1   . GLU A 1  1168 ? 15.834  12.685  121.401 1.00 154.46 ? 1168 GLU A OE1   1 
ATOM   8942  O  OE2   . GLU A 1  1168 ? 15.376  12.438  123.537 1.00 154.47 ? 1168 GLU A OE2   1 
ATOM   8943  N  N     . ILE A 1  1169 ? 20.063  15.123  120.600 1.00 155.99 ? 1169 ILE A N     1 
ATOM   8944  C  CA    . ILE A 1  1169 ? 21.057  14.286  119.921 1.00 156.80 ? 1169 ILE A CA    1 
ATOM   8945  C  C     . ILE A 1  1169 ? 22.522  14.618  120.244 1.00 157.58 ? 1169 ILE A C     1 
ATOM   8946  O  O     . ILE A 1  1169 ? 23.403  13.770  120.074 1.00 157.63 ? 1169 ILE A O     1 
ATOM   8947  C  CB    . ILE A 1  1169 ? 20.769  14.220  118.391 1.00 156.65 ? 1169 ILE A CB    1 
ATOM   8948  C  CG1   . ILE A 1  1169 ? 19.779  13.092  118.092 1.00 156.60 ? 1169 ILE A CG1   1 
ATOM   8949  C  CG2   . ILE A 1  1169 ? 22.033  13.998  117.576 1.00 156.44 ? 1169 ILE A CG2   1 
ATOM   8950  C  CD1   . ILE A 1  1169 ? 18.357  13.330  118.587 1.00 156.53 ? 1169 ILE A CD1   1 
ATOM   8951  N  N     . ILE A 1  1170 ? 22.774  15.832  120.733 1.00 158.57 ? 1170 ILE A N     1 
ATOM   8952  C  CA    . ILE A 1  1170 ? 24.118  16.220  121.173 1.00 159.55 ? 1170 ILE A CA    1 
ATOM   8953  C  C     . ILE A 1  1170 ? 24.474  15.555  122.512 1.00 160.23 ? 1170 ILE A C     1 
ATOM   8954  O  O     . ILE A 1  1170 ? 25.556  14.973  122.653 1.00 160.28 ? 1170 ILE A O     1 
ATOM   8955  C  CB    . ILE A 1  1170 ? 24.285  17.764  121.278 1.00 159.50 ? 1170 ILE A CB    1 
ATOM   8956  C  CG1   . ILE A 1  1170 ? 23.738  18.474  120.032 1.00 159.52 ? 1170 ILE A CG1   1 
ATOM   8957  C  CG2   . ILE A 1  1170 ? 25.749  18.140  121.527 1.00 159.64 ? 1170 ILE A CG2   1 
ATOM   8958  C  CD1   . ILE A 1  1170 ? 24.664  18.464  118.818 1.00 159.67 ? 1170 ILE A CD1   1 
ATOM   8959  N  N     . GLN A 1  1171 ? 23.553  15.636  123.478 1.00 161.08 ? 1171 GLN A N     1 
ATOM   8960  C  CA    . GLN A 1  1171 ? 23.737  15.058  124.815 1.00 161.89 ? 1171 GLN A CA    1 
ATOM   8961  C  C     . GLN A 1  1171 ? 24.416  13.703  124.757 1.00 162.51 ? 1171 GLN A C     1 
ATOM   8962  O  O     . GLN A 1  1171 ? 25.421  13.459  125.429 1.00 162.52 ? 1171 GLN A O     1 
ATOM   8963  C  CB    . GLN A 1  1171 ? 22.389  14.887  125.521 1.00 161.85 ? 1171 GLN A CB    1 
ATOM   8964  C  CG    . GLN A 1  1171 ? 21.875  16.115  126.254 1.00 161.85 ? 1171 GLN A CG    1 
ATOM   8965  C  CD    . GLN A 1  1171 ? 20.683  15.809  127.150 1.00 161.74 ? 1171 GLN A CD    1 
ATOM   8966  O  OE1   . GLN A 1  1171 ? 19.934  16.708  127.530 1.00 161.39 ? 1171 GLN A OE1   1 
ATOM   8967  N  NE2   . GLN A 1  1171 ? 20.508  14.536  127.495 1.00 161.41 ? 1171 GLN A NE2   1 
ATOM   8968  N  N     . LEU A 1  1172 ? 23.853  12.831  123.931 1.00 163.33 ? 1172 LEU A N     1 
ATOM   8969  C  CA    . LEU A 1  1172 ? 24.287  11.455  123.858 1.00 164.18 ? 1172 LEU A CA    1 
ATOM   8970  C  C     . LEU A 1  1172 ? 25.060  11.141  122.581 1.00 164.81 ? 1172 LEU A C     1 
ATOM   8971  O  O     . LEU A 1  1172 ? 24.485  10.701  121.584 1.00 164.88 ? 1172 LEU A O     1 
ATOM   8972  C  CB    . LEU A 1  1172 ? 23.099  10.491  124.044 1.00 164.12 ? 1172 LEU A CB    1 
ATOM   8973  C  CG    . LEU A 1  1172 ? 21.732  10.783  123.405 1.00 163.99 ? 1172 LEU A CG    1 
ATOM   8974  C  CD1   . LEU A 1  1172 ? 21.036  9.490   123.010 1.00 163.79 ? 1172 LEU A CD1   1 
ATOM   8975  C  CD2   . LEU A 1  1172 ? 20.841  11.613  124.325 1.00 163.75 ? 1172 LEU A CD2   1 
ATOM   8976  N  N     . HIS A 1  1173 ? 26.362  11.415  122.615 1.00 165.62 ? 1173 HIS A N     1 
ATOM   8977  C  CA    . HIS A 1  1173 ? 27.323  10.713  121.756 1.00 166.45 ? 1173 HIS A CA    1 
ATOM   8978  C  C     . HIS A 1  1173 ? 28.731  10.699  122.358 1.00 167.02 ? 1173 HIS A C     1 
ATOM   8979  O  O     . HIS A 1  1173 ? 29.711  11.107  121.723 1.00 167.06 ? 1173 HIS A O     1 
ATOM   8980  C  CB    . HIS A 1  1173 ? 27.317  11.196  120.299 1.00 166.39 ? 1173 HIS A CB    1 
ATOM   8981  C  CG    . HIS A 1  1173 ? 27.476  10.083  119.303 1.00 166.41 ? 1173 HIS A CG    1 
ATOM   8982  N  ND1   . HIS A 1  1173 ? 28.644  9.361   119.171 1.00 166.34 ? 1173 HIS A ND1   1 
ATOM   8983  C  CD2   . HIS A 1  1173 ? 26.610  9.560   118.402 1.00 166.16 ? 1173 HIS A CD2   1 
ATOM   8984  C  CE1   . HIS A 1  1173 ? 28.492  8.448   118.229 1.00 166.10 ? 1173 HIS A CE1   1 
ATOM   8985  N  NE2   . HIS A 1  1173 ? 27.268  8.548   117.745 1.00 165.95 ? 1173 HIS A NE2   1 
ATOM   8986  N  N     . PHE A 1  1174 ? 28.793  10.244  123.609 1.00 167.73 ? 1174 PHE A N     1 
ATOM   8987  C  CA    . PHE A 1  1174 ? 30.030  9.825   124.265 1.00 168.32 ? 1174 PHE A CA    1 
ATOM   8988  C  C     . PHE A 1  1174 ? 29.812  8.411   124.824 1.00 168.73 ? 1174 PHE A C     1 
ATOM   8989  O  O     . PHE A 1  1174 ? 30.508  7.967   125.742 1.00 168.79 ? 1174 PHE A O     1 
ATOM   8990  C  CB    . PHE A 1  1174 ? 30.473  10.839  125.345 1.00 168.28 ? 1174 PHE A CB    1 
ATOM   8991  C  CG    . PHE A 1  1174 ? 29.597  10.873  126.587 1.00 168.22 ? 1174 PHE A CG    1 
ATOM   8992  C  CD1   . PHE A 1  1174 ? 30.101  10.446  127.815 1.00 167.97 ? 1174 PHE A CD1   1 
ATOM   8993  C  CD2   . PHE A 1  1174 ? 28.292  11.360  126.536 1.00 168.13 ? 1174 PHE A CD2   1 
ATOM   8994  C  CE1   . PHE A 1  1174 ? 29.314  10.483  128.965 1.00 167.81 ? 1174 PHE A CE1   1 
ATOM   8995  C  CE2   . PHE A 1  1174 ? 27.497  11.397  127.682 1.00 168.00 ? 1174 PHE A CE2   1 
ATOM   8996  C  CZ    . PHE A 1  1174 ? 28.011  10.959  128.897 1.00 167.94 ? 1174 PHE A CZ    1 
ATOM   8997  N  N     . SER A 1  1175 ? 28.856  7.706   124.217 1.00 169.20 ? 1175 SER A N     1 
ATOM   8998  C  CA    . SER A 1  1175 ? 28.323  6.452   124.749 1.00 169.65 ? 1175 SER A CA    1 
ATOM   8999  C  C     . SER A 1  1175 ? 28.586  5.229   123.857 1.00 169.87 ? 1175 SER A C     1 
ATOM   9000  O  O     . SER A 1  1175 ? 28.544  5.322   122.625 1.00 169.88 ? 1175 SER A O     1 
ATOM   9001  C  CB    . SER A 1  1175 ? 26.820  6.606   125.002 1.00 169.66 ? 1175 SER A CB    1 
ATOM   9002  O  OG    . SER A 1  1175 ? 26.326  5.559   125.815 1.00 169.80 ? 1175 SER A OG    1 
ATOM   9003  N  N     . LEU A 1  1176 ? 28.847  4.090   124.507 1.00 170.14 ? 1176 LEU A N     1 
ATOM   9004  C  CA    . LEU A 1  1176 ? 29.109  2.801   123.848 1.00 170.29 ? 1176 LEU A CA    1 
ATOM   9005  C  C     . LEU A 1  1176 ? 27.880  1.890   123.933 1.00 170.35 ? 1176 LEU A C     1 
ATOM   9006  O  O     . LEU A 1  1176 ? 27.656  1.038   123.069 1.00 170.36 ? 1176 LEU A O     1 
ATOM   9007  C  CB    . LEU A 1  1176 ? 30.329  2.106   124.487 1.00 170.29 ? 1176 LEU A CB    1 
ATOM   9008  C  CG    . LEU A 1  1176 ? 31.091  0.956   123.797 1.00 170.17 ? 1176 LEU A CG    1 
ATOM   9009  C  CD1   . LEU A 1  1176 ? 32.531  0.891   124.296 1.00 169.89 ? 1176 LEU A CD1   1 
ATOM   9010  C  CD2   . LEU A 1  1176 ? 30.419  -0.407  123.964 1.00 169.84 ? 1176 LEU A CD2   1 
ATOM   9011  N  N     . GLN A 1  1187 ? 39.211  21.389  118.581 1.00 104.32 ? 1187 GLN A N     1 
ATOM   9012  C  CA    . GLN A 1  1187 ? 40.068  20.444  117.851 1.00 104.48 ? 1187 GLN A CA    1 
ATOM   9013  C  C     . GLN A 1  1187 ? 39.417  19.864  116.586 1.00 104.15 ? 1187 GLN A C     1 
ATOM   9014  O  O     . GLN A 1  1187 ? 40.073  19.167  115.802 1.00 104.13 ? 1187 GLN A O     1 
ATOM   9015  C  CB    . GLN A 1  1187 ? 40.611  19.326  118.777 1.00 104.75 ? 1187 GLN A CB    1 
ATOM   9016  C  CG    . GLN A 1  1187 ? 39.746  18.959  119.990 1.00 105.02 ? 1187 GLN A CG    1 
ATOM   9017  C  CD    . GLN A 1  1187 ? 38.486  18.207  119.605 1.00 105.44 ? 1187 GLN A CD    1 
ATOM   9018  O  OE1   . GLN A 1  1187 ? 38.545  17.079  119.106 1.00 105.23 ? 1187 GLN A OE1   1 
ATOM   9019  N  NE2   . GLN A 1  1187 ? 37.333  18.829  119.839 1.00 105.43 ? 1187 GLN A NE2   1 
ATOM   9020  N  N     . GLN A 1  1188 ? 38.130  20.159  116.402 1.00 103.76 ? 1188 GLN A N     1 
ATOM   9021  C  CA    . GLN A 1  1188 ? 37.390  19.782  115.191 1.00 103.34 ? 1188 GLN A CA    1 
ATOM   9022  C  C     . GLN A 1  1188 ? 37.321  20.984  114.243 1.00 102.81 ? 1188 GLN A C     1 
ATOM   9023  O  O     . GLN A 1  1188 ? 38.354  21.463  113.770 1.00 102.95 ? 1188 GLN A O     1 
ATOM   9024  C  CB    . GLN A 1  1188 ? 35.967  19.318  115.531 1.00 103.49 ? 1188 GLN A CB    1 
ATOM   9025  C  CG    . GLN A 1  1188 ? 35.789  18.705  116.911 1.00 103.56 ? 1188 GLN A CG    1 
ATOM   9026  C  CD    . GLN A 1  1188 ? 34.339  18.678  117.339 1.00 103.53 ? 1188 GLN A CD    1 
ATOM   9027  O  OE1   . GLN A 1  1188 ? 33.643  19.695  117.293 1.00 103.26 ? 1188 GLN A OE1   1 
ATOM   9028  N  NE2   . GLN A 1  1188 ? 33.872  17.509  117.757 1.00 103.60 ? 1188 GLN A NE2   1 
ATOM   9029  N  N     . SER A 1  1189 ? 36.105  21.461  113.971 1.00 101.86 ? 1189 SER A N     1 
ATOM   9030  C  CA    . SER A 1  1189 ? 35.890  22.688  113.205 1.00 100.89 ? 1189 SER A CA    1 
ATOM   9031  C  C     . SER A 1  1189 ? 34.504  23.256  113.490 1.00 100.17 ? 1189 SER A C     1 
ATOM   9032  O  O     . SER A 1  1189 ? 33.581  22.506  113.801 1.00 99.96  ? 1189 SER A O     1 
ATOM   9033  C  CB    . SER A 1  1189 ? 36.067  22.445  111.704 1.00 101.01 ? 1189 SER A CB    1 
ATOM   9034  O  OG    . SER A 1  1189 ? 36.339  23.661  111.031 1.00 100.73 ? 1189 SER A OG    1 
ATOM   9035  N  N     . PRO A 1  1190 ? 34.353  24.590  113.386 1.00 99.46  ? 1190 PRO A N     1 
ATOM   9036  C  CA    . PRO A 1  1190 ? 33.097  25.245  113.741 1.00 98.86  ? 1190 PRO A CA    1 
ATOM   9037  C  C     . PRO A 1  1190 ? 32.030  25.068  112.683 1.00 98.22  ? 1190 PRO A C     1 
ATOM   9038  O  O     . PRO A 1  1190 ? 30.858  25.357  112.925 1.00 98.26  ? 1190 PRO A O     1 
ATOM   9039  C  CB    . PRO A 1  1190 ? 33.494  26.717  113.809 1.00 98.93  ? 1190 PRO A CB    1 
ATOM   9040  C  CG    . PRO A 1  1190 ? 34.605  26.842  112.837 1.00 99.17  ? 1190 PRO A CG    1 
ATOM   9041  C  CD    . PRO A 1  1190 ? 35.368  25.565  112.939 1.00 99.46  ? 1190 PRO A CD    1 
ATOM   9042  N  N     . TRP A 1  1191 ? 32.446  24.601  111.513 1.00 97.37  ? 1191 TRP A N     1 
ATOM   9043  C  CA    . TRP A 1  1191 ? 31.565  24.497  110.368 1.00 96.34  ? 1191 TRP A CA    1 
ATOM   9044  C  C     . TRP A 1  1191 ? 30.814  23.174  110.336 1.00 95.52  ? 1191 TRP A C     1 
ATOM   9045  O  O     . TRP A 1  1191 ? 31.378  22.130  109.991 1.00 95.67  ? 1191 TRP A O     1 
ATOM   9046  C  CB    . TRP A 1  1191 ? 32.358  24.722  109.081 1.00 96.48  ? 1191 TRP A CB    1 
ATOM   9047  C  CG    . TRP A 1  1191 ? 32.772  26.143  108.912 1.00 96.68  ? 1191 TRP A CG    1 
ATOM   9048  C  CD1   . TRP A 1  1191 ? 34.043  26.619  108.752 1.00 96.88  ? 1191 TRP A CD1   1 
ATOM   9049  C  CD2   . TRP A 1  1191 ? 31.912  27.287  108.910 1.00 96.82  ? 1191 TRP A CD2   1 
ATOM   9050  N  NE1   . TRP A 1  1191 ? 34.023  27.990  108.638 1.00 96.85  ? 1191 TRP A NE1   1 
ATOM   9051  C  CE2   . TRP A 1  1191 ? 32.728  28.424  108.732 1.00 96.70  ? 1191 TRP A CE2   1 
ATOM   9052  C  CE3   . TRP A 1  1191 ? 30.527  27.461  109.033 1.00 96.88  ? 1191 TRP A CE3   1 
ATOM   9053  C  CZ2   . TRP A 1  1191 ? 32.205  29.717  108.680 1.00 96.48  ? 1191 TRP A CZ2   1 
ATOM   9054  C  CZ3   . TRP A 1  1191 ? 30.008  28.744  108.971 1.00 96.71  ? 1191 TRP A CZ3   1 
ATOM   9055  C  CH2   . TRP A 1  1191 ? 30.846  29.855  108.794 1.00 96.61  ? 1191 TRP A CH2   1 
ATOM   9056  N  N     . LEU A 1  1192 ? 29.541  23.230  110.718 1.00 94.11  ? 1192 LEU A N     1 
ATOM   9057  C  CA    . LEU A 1  1192 ? 28.658  22.082  110.657 1.00 92.69  ? 1192 LEU A CA    1 
ATOM   9058  C  C     . LEU A 1  1192 ? 28.149  21.911  109.236 1.00 92.34  ? 1192 LEU A C     1 
ATOM   9059  O  O     . LEU A 1  1192 ? 27.958  22.889  108.526 1.00 92.52  ? 1192 LEU A O     1 
ATOM   9060  C  CB    . LEU A 1  1192 ? 27.480  22.304  111.592 1.00 92.21  ? 1192 LEU A CB    1 
ATOM   9061  C  CG    . LEU A 1  1192 ? 26.284  21.380  111.446 1.00 90.93  ? 1192 LEU A CG    1 
ATOM   9062  C  CD1   . LEU A 1  1192 ? 26.545  20.121  112.195 1.00 90.16  ? 1192 LEU A CD1   1 
ATOM   9063  C  CD2   . LEU A 1  1192 ? 25.064  22.056  111.981 1.00 90.30  ? 1192 LEU A CD2   1 
ATOM   9064  N  N     . LEU A 1  1193 ? 27.957  20.666  108.818 1.00 91.70  ? 1193 LEU A N     1 
ATOM   9065  C  CA    . LEU A 1  1193 ? 27.167  20.347  107.630 1.00 90.95  ? 1193 LEU A CA    1 
ATOM   9066  C  C     . LEU A 1  1193 ? 26.049  19.423  108.085 1.00 90.87  ? 1193 LEU A C     1 
ATOM   9067  O  O     . LEU A 1  1193 ? 26.315  18.428  108.750 1.00 91.14  ? 1193 LEU A O     1 
ATOM   9068  C  CB    . LEU A 1  1193 ? 28.034  19.675  106.564 1.00 90.85  ? 1193 LEU A CB    1 
ATOM   9069  C  CG    . LEU A 1  1193 ? 27.423  18.843  105.431 1.00 89.75  ? 1193 LEU A CG    1 
ATOM   9070  C  CD1   . LEU A 1  1193 ? 26.154  19.428  104.875 1.00 88.85  ? 1193 LEU A CD1   1 
ATOM   9071  C  CD2   . LEU A 1  1193 ? 28.439  18.708  104.330 1.00 90.23  ? 1193 LEU A CD2   1 
ATOM   9072  N  N     . ARG A 1  1194 ? 24.807  19.743  107.741 1.00 90.43  ? 1194 ARG A N     1 
ATOM   9073  C  CA    . ARG A 1  1194 ? 23.682  19.024  108.317 1.00 90.31  ? 1194 ARG A CA    1 
ATOM   9074  C  C     . ARG A 1  1194 ? 22.653  18.506  107.311 1.00 90.72  ? 1194 ARG A C     1 
ATOM   9075  O  O     . ARG A 1  1194 ? 21.721  19.226  106.968 1.00 91.06  ? 1194 ARG A O     1 
ATOM   9076  C  CB    . ARG A 1  1194 ? 23.000  19.908  109.348 1.00 89.88  ? 1194 ARG A CB    1 
ATOM   9077  C  CG    . ARG A 1  1194 ? 21.810  19.269  110.020 1.00 89.32  ? 1194 ARG A CG    1 
ATOM   9078  C  CD    . ARG A 1  1194 ? 21.266  20.195  111.080 1.00 89.02  ? 1194 ARG A CD    1 
ATOM   9079  N  NE    . ARG A 1  1194 ? 20.174  19.636  111.877 1.00 87.79  ? 1194 ARG A NE    1 
ATOM   9080  C  CZ    . ARG A 1  1194 ? 18.891  19.711  111.542 1.00 87.23  ? 1194 ARG A CZ    1 
ATOM   9081  N  NH1   . ARG A 1  1194 ? 18.532  20.300  110.406 1.00 87.12  ? 1194 ARG A NH1   1 
ATOM   9082  N  NH2   . ARG A 1  1194 ? 17.966  19.190  112.337 1.00 86.60  ? 1194 ARG A NH2   1 
ATOM   9083  N  N     . LEU A 1  1195 ? 22.805  17.255  106.868 1.00 91.02  ? 1195 LEU A N     1 
ATOM   9084  C  CA    . LEU A 1  1195 ? 21.843  16.625  105.959 1.00 91.21  ? 1195 LEU A CA    1 
ATOM   9085  C  C     . LEU A 1  1195 ? 20.665  16.083  106.720 1.00 92.33  ? 1195 LEU A C     1 
ATOM   9086  O  O     . LEU A 1  1195 ? 20.821  15.388  107.722 1.00 92.20  ? 1195 LEU A O     1 
ATOM   9087  C  CB    . LEU A 1  1195 ? 22.458  15.464  105.206 1.00 90.49  ? 1195 LEU A CB    1 
ATOM   9088  C  CG    . LEU A 1  1195 ? 23.940  15.492  104.917 1.00 89.05  ? 1195 LEU A CG    1 
ATOM   9089  C  CD1   . LEU A 1  1195 ? 24.397  14.097  104.619 1.00 88.17  ? 1195 LEU A CD1   1 
ATOM   9090  C  CD2   . LEU A 1  1195 ? 24.192  16.386  103.763 1.00 88.14  ? 1195 LEU A CD2   1 
ATOM   9091  N  N     . GLU A 1  1196 ? 19.484  16.408  106.221 1.00 93.91  ? 1196 GLU A N     1 
ATOM   9092  C  CA    . GLU A 1  1196 ? 18.234  15.888  106.731 1.00 95.85  ? 1196 GLU A CA    1 
ATOM   9093  C  C     . GLU A 1  1196 ? 17.879  14.775  105.772 1.00 96.89  ? 1196 GLU A C     1 
ATOM   9094  O  O     . GLU A 1  1196 ? 18.170  14.888  104.583 1.00 97.31  ? 1196 GLU A O     1 
ATOM   9095  C  CB    . GLU A 1  1196 ? 17.194  16.999  106.688 1.00 95.63  ? 1196 GLU A CB    1 
ATOM   9096  C  CG    . GLU A 1  1196 ? 15.754  16.599  106.946 1.00 96.46  ? 1196 GLU A CG    1 
ATOM   9097  C  CD    . GLU A 1  1196 ? 14.792  17.796  106.876 1.00 97.09  ? 1196 GLU A CD    1 
ATOM   9098  O  OE1   . GLU A 1  1196 ? 15.081  18.793  106.159 1.00 98.23  ? 1196 GLU A OE1   1 
ATOM   9099  O  OE2   . GLU A 1  1196 ? 13.733  17.735  107.543 1.00 98.92  ? 1196 GLU A OE2   1 
ATOM   9100  N  N     . LEU A 1  1197 ? 17.282  13.694  106.269 1.00 98.36  ? 1197 LEU A N     1 
ATOM   9101  C  CA    . LEU A 1  1197 ? 16.955  12.543  105.413 1.00 99.69  ? 1197 LEU A CA    1 
ATOM   9102  C  C     . LEU A 1  1197 ? 15.458  12.267  105.373 1.00 100.92 ? 1197 LEU A C     1 
ATOM   9103  O  O     . LEU A 1  1197 ? 14.762  12.464  106.377 1.00 101.10 ? 1197 LEU A O     1 
ATOM   9104  C  CB    . LEU A 1  1197 ? 17.705  11.281  105.857 1.00 99.39  ? 1197 LEU A CB    1 
ATOM   9105  C  CG    . LEU A 1  1197 ? 19.225  11.212  105.679 1.00 98.78  ? 1197 LEU A CG    1 
ATOM   9106  C  CD1   . LEU A 1  1197 ? 19.797  10.139  106.584 1.00 98.35  ? 1197 LEU A CD1   1 
ATOM   9107  C  CD2   . LEU A 1  1197 ? 19.637  10.972  104.232 1.00 97.89  ? 1197 LEU A CD2   1 
ATOM   9108  N  N     . ASP A 1  1198 ? 14.975  11.811  104.213 1.00 102.33 ? 1198 ASP A N     1 
ATOM   9109  C  CA    . ASP A 1  1198 ? 13.559  11.477  104.026 1.00 103.74 ? 1198 ASP A CA    1 
ATOM   9110  C  C     . ASP A 1  1198 ? 13.185  10.301  104.917 1.00 104.53 ? 1198 ASP A C     1 
ATOM   9111  O  O     . ASP A 1  1198 ? 13.904  9.306   104.941 1.00 104.85 ? 1198 ASP A O     1 
ATOM   9112  C  CB    . ASP A 1  1198 ? 13.263  11.138  102.558 1.00 103.78 ? 1198 ASP A CB    1 
ATOM   9113  C  CG    . ASP A 1  1198 ? 11.760  11.138  102.239 1.00 104.58 ? 1198 ASP A CG    1 
ATOM   9114  O  OD1   . ASP A 1  1198 ? 11.000  10.376  102.879 1.00 105.01 ? 1198 ASP A OD1   1 
ATOM   9115  O  OD2   . ASP A 1  1198 ? 11.334  11.898  101.336 1.00 105.37 ? 1198 ASP A OD2   1 
ATOM   9116  N  N     . ARG A 1  1199 ? 12.072  10.419  105.645 1.00 105.42 ? 1199 ARG A N     1 
ATOM   9117  C  CA    . ARG A 1  1199 ? 11.603  9.346   106.540 1.00 106.22 ? 1199 ARG A CA    1 
ATOM   9118  C  C     . ARG A 1  1199 ? 11.207  8.083   105.756 1.00 106.87 ? 1199 ARG A C     1 
ATOM   9119  O  O     . ARG A 1  1199 ? 11.484  6.960   106.193 1.00 106.84 ? 1199 ARG A O     1 
ATOM   9120  C  CB    . ARG A 1  1199 ? 10.437  9.842   107.422 1.00 106.12 ? 1199 ARG A CB    1 
ATOM   9121  C  CG    . ARG A 1  1199 ? 9.782   8.786   108.336 1.00 105.43 ? 1199 ARG A CG    1 
ATOM   9122  C  CD    . ARG A 1  1199 ? 10.037  9.017   109.825 1.00 104.03 ? 1199 ARG A CD    1 
ATOM   9123  N  NE    . ARG A 1  1199 ? 9.131   8.207   110.652 1.00 103.21 ? 1199 ARG A NE    1 
ATOM   9124  C  CZ    . ARG A 1  1199 ? 7.985   8.635   111.191 1.00 102.25 ? 1199 ARG A CZ    1 
ATOM   9125  N  NH1   . ARG A 1  1199 ? 7.576   9.883   111.016 1.00 102.22 ? 1199 ARG A NH1   1 
ATOM   9126  N  NH2   . ARG A 1  1199 ? 7.242   7.811   111.916 1.00 101.07 ? 1199 ARG A NH2   1 
ATOM   9127  N  N     . ALA A 1  1200 ? 10.599  8.290   104.586 1.00 107.66 ? 1200 ALA A N     1 
ATOM   9128  C  CA    . ALA A 1  1200 ? 9.967   7.219   103.805 1.00 108.35 ? 1200 ALA A CA    1 
ATOM   9129  C  C     . ALA A 1  1200 ? 10.889  6.427   102.872 1.00 108.82 ? 1200 ALA A C     1 
ATOM   9130  O  O     . ALA A 1  1200 ? 10.776  5.207   102.806 1.00 108.96 ? 1200 ALA A O     1 
ATOM   9131  C  CB    . ALA A 1  1200 ? 8.766   7.763   103.032 1.00 108.34 ? 1200 ALA A CB    1 
ATOM   9132  N  N     . ALA A 1  1201 ? 11.784  7.105   102.151 1.00 109.36 ? 1201 ALA A N     1 
ATOM   9133  C  CA    . ALA A 1  1201 ? 12.712  6.423   101.237 1.00 109.91 ? 1201 ALA A CA    1 
ATOM   9134  C  C     . ALA A 1  1201 ? 13.732  5.548   101.980 1.00 110.37 ? 1201 ALA A C     1 
ATOM   9135  O  O     . ALA A 1  1201 ? 14.648  4.994   101.364 1.00 110.40 ? 1201 ALA A O     1 
ATOM   9136  C  CB    . ALA A 1  1201 ? 13.410  7.422   100.318 1.00 109.86 ? 1201 ALA A CB    1 
ATOM   9137  N  N     . MET A 1  1202 ? 13.555  5.439   103.299 1.00 110.91 ? 1202 MET A N     1 
ATOM   9138  C  CA    . MET A 1  1202 ? 14.311  4.511   104.142 1.00 111.45 ? 1202 MET A CA    1 
ATOM   9139  C  C     . MET A 1  1202 ? 13.488  3.250   104.397 1.00 111.74 ? 1202 MET A C     1 
ATOM   9140  O  O     . MET A 1  1202 ? 13.991  2.274   104.952 1.00 111.96 ? 1202 MET A O     1 
ATOM   9141  C  CB    . MET A 1  1202 ? 14.702  5.157   105.479 1.00 111.46 ? 1202 MET A CB    1 
ATOM   9142  C  CG    . MET A 1  1202 ? 15.457  6.480   105.365 1.00 111.79 ? 1202 MET A CG    1 
ATOM   9143  S  SD    . MET A 1  1202 ? 17.118  6.381   104.661 1.00 111.65 ? 1202 MET A SD    1 
ATOM   9144  C  CE    . MET A 1  1202 ? 18.098  6.141   106.140 1.00 111.98 ? 1202 MET A CE    1 
ATOM   9145  N  N     . ASN A 1  1203 ? 12.219  3.283   103.997 1.00 112.04 ? 1203 ASN A N     1 
ATOM   9146  C  CA    . ASN A 1  1203 ? 11.341  2.116   104.068 1.00 112.35 ? 1203 ASN A CA    1 
ATOM   9147  C  C     . ASN A 1  1203 ? 11.222  1.465   102.692 1.00 112.57 ? 1203 ASN A C     1 
ATOM   9148  O  O     . ASN A 1  1203 ? 10.934  0.273   102.583 1.00 112.55 ? 1203 ASN A O     1 
ATOM   9149  C  CB    . ASN A 1  1203 ? 9.952   2.492   104.611 1.00 112.39 ? 1203 ASN A CB    1 
ATOM   9150  C  CG    . ASN A 1  1203 ? 10.011  3.200   105.966 1.00 112.30 ? 1203 ASN A CG    1 
ATOM   9151  O  OD1   . ASN A 1  1203 ? 9.664   2.622   106.998 1.00 111.83 ? 1203 ASN A OD1   1 
ATOM   9152  N  ND2   . ASN A 1  1203 ? 10.444  4.457   105.962 1.00 112.39 ? 1203 ASN A ND2   1 
ATOM   9153  N  N     . ASP A 1  1204 ? 11.435  2.275   101.652 1.00 112.90 ? 1204 ASP A N     1 
ATOM   9154  C  CA    . ASP A 1  1204 ? 11.541  1.824   100.263 1.00 113.25 ? 1204 ASP A CA    1 
ATOM   9155  C  C     . ASP A 1  1204 ? 12.735  0.882   100.176 1.00 113.52 ? 1204 ASP A C     1 
ATOM   9156  O  O     . ASP A 1  1204 ? 12.572  -0.341  100.143 1.00 113.53 ? 1204 ASP A O     1 
ATOM   9157  C  CB    . ASP A 1  1204 ? 11.753  3.037   99.334  1.00 113.30 ? 1204 ASP A CB    1 
ATOM   9158  C  CG    . ASP A 1  1204 ? 11.499  2.722   97.858  1.00 113.15 ? 1204 ASP A CG    1 
ATOM   9159  O  OD1   . ASP A 1  1204 ? 12.447  2.797   97.041  1.00 112.62 ? 1204 ASP A OD1   1 
ATOM   9160  O  OD2   . ASP A 1  1204 ? 10.342  2.419   97.508  1.00 113.22 ? 1204 ASP A OD2   1 
ATOM   9161  N  N     . LYS A 1  1205 ? 13.933  1.464   100.152 1.00 113.80 ? 1205 LYS A N     1 
ATOM   9162  C  CA    . LYS A 1  1205 ? 15.177  0.718   100.298 1.00 114.07 ? 1205 LYS A CA    1 
ATOM   9163  C  C     . LYS A 1  1205 ? 15.247  0.366   101.772 1.00 114.39 ? 1205 LYS A C     1 
ATOM   9164  O  O     . LYS A 1  1205 ? 14.590  1.008   102.583 1.00 114.48 ? 1205 LYS A O     1 
ATOM   9165  C  CB    . LYS A 1  1205 ? 16.375  1.579   99.883  1.00 113.92 ? 1205 LYS A CB    1 
ATOM   9166  C  CG    . LYS A 1  1205 ? 15.989  2.822   99.084  1.00 113.72 ? 1205 LYS A CG    1 
ATOM   9167  C  CD    . LYS A 1  1205 ? 16.802  2.977   97.811  1.00 113.43 ? 1205 LYS A CD    1 
ATOM   9168  C  CE    . LYS A 1  1205 ? 16.217  4.069   96.919  1.00 113.11 ? 1205 LYS A CE    1 
ATOM   9169  N  NZ    . LYS A 1  1205 ? 16.954  4.204   95.633  1.00 112.71 ? 1205 LYS A NZ    1 
ATOM   9170  N  N     . ASP A 1  1206 ? 16.009  -0.658  102.128 1.00 114.76 ? 1206 ASP A N     1 
ATOM   9171  C  CA    . ASP A 1  1206 ? 16.051  -1.089  103.521 1.00 115.17 ? 1206 ASP A CA    1 
ATOM   9172  C  C     . ASP A 1  1206 ? 17.245  -0.470  104.223 1.00 115.36 ? 1206 ASP A C     1 
ATOM   9173  O  O     . ASP A 1  1206 ? 18.345  -1.015  104.190 1.00 115.45 ? 1206 ASP A O     1 
ATOM   9174  C  CB    . ASP A 1  1206 ? 16.080  -2.616  103.616 1.00 115.27 ? 1206 ASP A CB    1 
ATOM   9175  C  CG    . ASP A 1  1206 ? 14.927  -3.274  102.869 1.00 115.76 ? 1206 ASP A CG    1 
ATOM   9176  O  OD1   . ASP A 1