data_3GTU
# 
_entry.id   3GTU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GTU         
WWPDB D_1000178994 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GTU 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patskovsky, Y.V.' 1 
'Patskovska, L.N.' 2 
'Listowsky, I.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
;
Biochemistry           38  16187 16194 1999 BICHAW US 0006-2960 0033 ? 10587441 10.1021/bi991714t 
1       
'Crystal Structure of Human Class Mu Glutathione Transferase Gstm2-2. Effects of Lattice Packing on Conformational Heterogeneity' 
J.Mol.Biol.            238 815   ?     1994 JMOBAK UK 0022-2836 0070 ? ?        ?                 
2       
'Cloning, Expression, and Characterization of a Class-Mu Glutathione Transferase from Human Muscle, the Product of the Gst4 Locus' 
Proc.Natl.Acad.Sci.USA 88  4443  ?     1991 PNASA6 US 0027-8424 0040 ? ?        ?                 
3       
;A Distinct Human Testis and Brain Mu-Class Glutathione S-Transferase. Molecular Cloning and Characterization of a Form Present Even in Individuals Lacking Hepatic Type Mu Isoenzymes
;
J.Biol.Chem.           265 9188  ?     1990 JBCHA3 US 0021-9258 0071 ? ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Patskovsky, Y.V.' 1  
primary 'Patskovska, L.N.' 2  
primary 'Listowsky, I.'    3  
1       'Raghunathan, S.'  4  
1       'Chandross, R.J.'  5  
1       'Kretsinger, R.H.' 6  
1       'Allison, T.J.'    7  
1       'Penington, C.J.'  8  
1       'Rule, G.S.'       9  
2       'Vorachek, W.R.'   10 
2       'Pearson, W.R.'    11 
2       'Rule, G.S.'       12 
3       'Campbell, E.'     13 
3       'Takahashi, Y.'    14 
3       'Abramovitz, M.'   15 
3       'Peretz, M.'       16 
3       'Listowsky, I.'    17 
# 
_cell.entry_id           3GTU 
_cell.length_a           51.970 
_cell.length_b           102.747 
_cell.length_c           103.977 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3GTU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'GLUTATHIONE S-TRANSFERASE' 25645.457 2  2.5.1.18 ? ? 'LIGAND-FREE, HETERODIMER' 
2 polymer man 'GLUTATHIONE S-TRANSFERASE' 26460.410 2  2.5.1.18 ? ? 'LIGAND-FREE, HETERODIMER' 
3 water   nat water                       18.015    72 ?        ? ? ?                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIA
RKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAY
DVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
;
;PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIA
RKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAY
DVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
;
A,C ? 
2 'polypeptide(L)' no no 
;SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAIL
RYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVD
FLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
;
;SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAIL
RYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVD
FLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   MET n 
1 3   THR n 
1 4   LEU n 
1 5   GLY n 
1 6   TYR n 
1 7   TRP n 
1 8   ASN n 
1 9   ILE n 
1 10  ARG n 
1 11  GLY n 
1 12  LEU n 
1 13  ALA n 
1 14  HIS n 
1 15  SER n 
1 16  ILE n 
1 17  ARG n 
1 18  LEU n 
1 19  LEU n 
1 20  LEU n 
1 21  GLU n 
1 22  TYR n 
1 23  THR n 
1 24  ASP n 
1 25  SER n 
1 26  SER n 
1 27  TYR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  LYS n 
1 32  TYR n 
1 33  THR n 
1 34  MET n 
1 35  GLY n 
1 36  ASP n 
1 37  ALA n 
1 38  PRO n 
1 39  ASP n 
1 40  TYR n 
1 41  ASP n 
1 42  ARG n 
1 43  SER n 
1 44  GLN n 
1 45  TRP n 
1 46  LEU n 
1 47  ASN n 
1 48  GLU n 
1 49  LYS n 
1 50  PHE n 
1 51  LYS n 
1 52  LEU n 
1 53  GLY n 
1 54  LEU n 
1 55  ASP n 
1 56  PHE n 
1 57  PRO n 
1 58  ASN n 
1 59  LEU n 
1 60  PRO n 
1 61  TYR n 
1 62  LEU n 
1 63  ILE n 
1 64  ASP n 
1 65  GLY n 
1 66  THR n 
1 67  HIS n 
1 68  LYS n 
1 69  ILE n 
1 70  THR n 
1 71  GLN n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  ILE n 
1 76  LEU n 
1 77  ARG n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  ARG n 
1 82  LYS n 
1 83  HIS n 
1 84  ASN n 
1 85  LEU n 
1 86  CYS n 
1 87  GLY n 
1 88  GLU n 
1 89  SER n 
1 90  GLU n 
1 91  LYS n 
1 92  GLU n 
1 93  GLN n 
1 94  ILE n 
1 95  ARG n 
1 96  GLU n 
1 97  ASP n 
1 98  ILE n 
1 99  LEU n 
1 100 GLU n 
1 101 ASN n 
1 102 GLN n 
1 103 PHE n 
1 104 MET n 
1 105 ASP n 
1 106 SER n 
1 107 ARG n 
1 108 MET n 
1 109 GLN n 
1 110 LEU n 
1 111 ALA n 
1 112 LYS n 
1 113 LEU n 
1 114 CYS n 
1 115 TYR n 
1 116 ASP n 
1 117 PRO n 
1 118 ASP n 
1 119 PHE n 
1 120 GLU n 
1 121 LYS n 
1 122 LEU n 
1 123 LYS n 
1 124 PRO n 
1 125 GLU n 
1 126 TYR n 
1 127 LEU n 
1 128 GLN n 
1 129 ALA n 
1 130 LEU n 
1 131 PRO n 
1 132 GLU n 
1 133 MET n 
1 134 LEU n 
1 135 LYS n 
1 136 LEU n 
1 137 TYR n 
1 138 SER n 
1 139 GLN n 
1 140 PHE n 
1 141 LEU n 
1 142 GLY n 
1 143 LYS n 
1 144 GLN n 
1 145 PRO n 
1 146 TRP n 
1 147 PHE n 
1 148 LEU n 
1 149 GLY n 
1 150 ASP n 
1 151 LYS n 
1 152 ILE n 
1 153 THR n 
1 154 PHE n 
1 155 VAL n 
1 156 ASP n 
1 157 PHE n 
1 158 ILE n 
1 159 ALA n 
1 160 TYR n 
1 161 ASP n 
1 162 VAL n 
1 163 LEU n 
1 164 GLU n 
1 165 ARG n 
1 166 ASN n 
1 167 GLN n 
1 168 VAL n 
1 169 PHE n 
1 170 GLU n 
1 171 PRO n 
1 172 SER n 
1 173 CYS n 
1 174 LEU n 
1 175 ASP n 
1 176 ALA n 
1 177 PHE n 
1 178 PRO n 
1 179 ASN n 
1 180 LEU n 
1 181 LYS n 
1 182 ASP n 
1 183 PHE n 
1 184 ILE n 
1 185 SER n 
1 186 ARG n 
1 187 PHE n 
1 188 GLU n 
1 189 GLY n 
1 190 LEU n 
1 191 GLU n 
1 192 LYS n 
1 193 ILE n 
1 194 SER n 
1 195 ALA n 
1 196 TYR n 
1 197 MET n 
1 198 LYS n 
1 199 SER n 
1 200 SER n 
1 201 ARG n 
1 202 PHE n 
1 203 LEU n 
1 204 PRO n 
1 205 ARG n 
1 206 PRO n 
1 207 VAL n 
1 208 PHE n 
1 209 THR n 
1 210 LYS n 
1 211 MET n 
1 212 ALA n 
1 213 VAL n 
1 214 TRP n 
1 215 GLY n 
1 216 ASN n 
1 217 LYS n 
2 1   SER n 
2 2   CYS n 
2 3   GLU n 
2 4   SER n 
2 5   SER n 
2 6   MET n 
2 7   VAL n 
2 8   LEU n 
2 9   GLY n 
2 10  TYR n 
2 11  TRP n 
2 12  ASP n 
2 13  ILE n 
2 14  ARG n 
2 15  GLY n 
2 16  LEU n 
2 17  ALA n 
2 18  HIS n 
2 19  ALA n 
2 20  ILE n 
2 21  ARG n 
2 22  LEU n 
2 23  LEU n 
2 24  LEU n 
2 25  GLU n 
2 26  PHE n 
2 27  THR n 
2 28  ASP n 
2 29  THR n 
2 30  SER n 
2 31  TYR n 
2 32  GLU n 
2 33  GLU n 
2 34  LYS n 
2 35  ARG n 
2 36  TYR n 
2 37  THR n 
2 38  CYS n 
2 39  GLY n 
2 40  GLU n 
2 41  ALA n 
2 42  PRO n 
2 43  ASP n 
2 44  TYR n 
2 45  ASP n 
2 46  ARG n 
2 47  SER n 
2 48  GLN n 
2 49  TRP n 
2 50  LEU n 
2 51  ASP n 
2 52  VAL n 
2 53  LYS n 
2 54  PHE n 
2 55  LYS n 
2 56  LEU n 
2 57  ASP n 
2 58  LEU n 
2 59  ASP n 
2 60  PHE n 
2 61  PRO n 
2 62  ASN n 
2 63  LEU n 
2 64  PRO n 
2 65  TYR n 
2 66  LEU n 
2 67  LEU n 
2 68  ASP n 
2 69  GLY n 
2 70  LYS n 
2 71  ASN n 
2 72  LYS n 
2 73  ILE n 
2 74  THR n 
2 75  GLN n 
2 76  SER n 
2 77  ASN n 
2 78  ALA n 
2 79  ILE n 
2 80  LEU n 
2 81  ARG n 
2 82  TYR n 
2 83  ILE n 
2 84  ALA n 
2 85  ARG n 
2 86  LYS n 
2 87  HIS n 
2 88  ASN n 
2 89  MET n 
2 90  CYS n 
2 91  GLY n 
2 92  GLU n 
2 93  THR n 
2 94  GLU n 
2 95  GLU n 
2 96  GLU n 
2 97  LYS n 
2 98  ILE n 
2 99  ARG n 
2 100 VAL n 
2 101 ASP n 
2 102 ILE n 
2 103 ILE n 
2 104 GLU n 
2 105 ASN n 
2 106 GLN n 
2 107 VAL n 
2 108 MET n 
2 109 ASP n 
2 110 PHE n 
2 111 ARG n 
2 112 THR n 
2 113 GLN n 
2 114 LEU n 
2 115 ILE n 
2 116 ARG n 
2 117 LEU n 
2 118 CYS n 
2 119 TYR n 
2 120 SER n 
2 121 SER n 
2 122 ASP n 
2 123 HIS n 
2 124 GLU n 
2 125 LYS n 
2 126 LEU n 
2 127 LYS n 
2 128 PRO n 
2 129 GLN n 
2 130 TYR n 
2 131 LEU n 
2 132 GLU n 
2 133 GLU n 
2 134 LEU n 
2 135 PRO n 
2 136 GLY n 
2 137 GLN n 
2 138 LEU n 
2 139 LYS n 
2 140 GLN n 
2 141 PHE n 
2 142 SER n 
2 143 MET n 
2 144 PHE n 
2 145 LEU n 
2 146 GLY n 
2 147 LYS n 
2 148 PHE n 
2 149 SER n 
2 150 TRP n 
2 151 PHE n 
2 152 ALA n 
2 153 GLY n 
2 154 GLU n 
2 155 LYS n 
2 156 LEU n 
2 157 THR n 
2 158 PHE n 
2 159 VAL n 
2 160 ASP n 
2 161 PHE n 
2 162 LEU n 
2 163 THR n 
2 164 TYR n 
2 165 ASP n 
2 166 ILE n 
2 167 LEU n 
2 168 ASP n 
2 169 GLN n 
2 170 ASN n 
2 171 ARG n 
2 172 ILE n 
2 173 PHE n 
2 174 ASP n 
2 175 PRO n 
2 176 LYS n 
2 177 CYS n 
2 178 LEU n 
2 179 ASP n 
2 180 GLU n 
2 181 PHE n 
2 182 PRO n 
2 183 ASN n 
2 184 LEU n 
2 185 LYS n 
2 186 ALA n 
2 187 PHE n 
2 188 MET n 
2 189 CYS n 
2 190 ARG n 
2 191 PHE n 
2 192 GLU n 
2 193 ALA n 
2 194 LEU n 
2 195 GLU n 
2 196 LYS n 
2 197 ILE n 
2 198 ALA n 
2 199 ALA n 
2 200 TYR n 
2 201 LEU n 
2 202 GLN n 
2 203 SER n 
2 204 ASP n 
2 205 GLN n 
2 206 PHE n 
2 207 CYS n 
2 208 LYS n 
2 209 MET n 
2 210 PRO n 
2 211 ILE n 
2 212 ASN n 
2 213 ASN n 
2 214 LYS n 
2 215 MET n 
2 216 ALA n 
2 217 GLN n 
2 218 TRP n 
2 219 GLY n 
2 220 ASN n 
2 221 LYS n 
2 222 PRO n 
2 223 VAL n 
2 224 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'GSTM2, GSTM3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? CYTOPLASM ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia 'GSTM2, GSTM3' ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? PET3A ? ? PET3A-GSTM2-3 ? 
'THE GSTM2 AND GSTM3 CDNA WERE AMPLIFIED USING RT-PCR AND SUBCLONED INTO A PET3A COEXPRESSION VECTOR. SYNTHETIC GENE.' 
2 1 sample ? ? ? human Homo 'GSTM2, GSTM3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? CYTOPLASM ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia 'GSTM2, GSTM3' ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? PET3A ? ? PET3A-GSTM2-3 ? 
'THE GSTM2 AND GSTM3 CDNA WERE AMPLIFIED USING RT-PCR AND SUBCLONED INTO A PET3A COEXPRESSION VECTOR. SYNTHETIC GENE.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP GSTM2_HUMAN 1 P28161 1 
;PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIA
RKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAY
DVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
;
? 
2 UNP GSTM3_HUMAN 2 P21266 1 
;MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAI
LRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLWKFSWFAGEKLTFV
DFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GTU A 1 ? 217 ? P28161 1 ? 217 ? 1 217 
2 2 3GTU B 1 ? 224 ? P21266 2 ? 225 ? 1 224 
3 1 3GTU C 1 ? 217 ? P28161 1 ? 217 ? 1 217 
4 2 3GTU D 1 ? 224 ? P21266 2 ? 225 ? 1 224 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 3GTU GLY B 146 ? UNP P21266 TRP 147 'SEQUENCING ERROR' 146 1 
4 3GTU GLY D 146 ? UNP P21266 TRP 147 'SEQUENCING ERROR' 146 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3GTU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           289 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS-NICOLET X100' 
_diffrn_detector.pdbx_collection_date   1997-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3GTU 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   25387 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.41 
_reflns.pdbx_Rmerge_I_obs            0.1130000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        3.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.4 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   69.4 
_reflns_shell.Rmerge_I_obs           0.3410000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.71 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3GTU 
_refine.ls_number_reflns_obs                     20086 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    78.14 
_refine.ls_R_factor_obs                          0.2250000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2250000 
_refine.ls_R_factor_R_free                       0.2700000 
_refine.ls_R_factor_R_free_error                 0.01 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.96 
_refine.ls_number_reflns_R_free                  996 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2GTU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3GTU 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           8.00 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7328 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             72 
_refine_hist.number_atoms_total               7400 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.18  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      21.11 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.053 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.77  1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.86  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.67  2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            3.95  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.8 
_refine_ls_shell.d_res_low                        2.92 
_refine_ls_shell.number_reflns_R_work             1205 
_refine_ls_shell.R_factor_R_work                  0.2600000 
_refine_ls_shell.percent_reflns_obs               39.52 
_refine_ls_shell.R_factor_R_free                  0.2700000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            5.04 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPH19.SOLV  'X-RAY DIFFRACTION' 
2 PARAM19.SOLV TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.999976 0.004042 -0.005642 0.001042 0.891131 0.453745 0.006862 0.453728 -0.891114 -23.89890 -62.34320 155.61230 
2 given ? -0.999999 0.001036 -0.000035 0.000905 0.889089 0.457734 0.000505 0.457734 -0.889089 -24.42750 -62.87300 155.42059 
# 
_struct.entry_id                  3GTU 
_struct.title                     
'LIGAND-FREE HETERODIMERIC HUMAN GLUTATHIONE S-TRANSFERASE M2-3 (EC 2.5.1.18), MONOCLINIC CRYSTAL FORM' 
_struct.pdbx_descriptor           'GLUTATHIONE S-TRANSFERASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GTU 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, GLUTATHIONE, CONJUGATION, DETOXIFICATION, CYTOSOLIC, HETERODIMER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 11  ? TYR A 22  ? GLY A 11  TYR A 22  5 ? 12 
HELX_P HELX_P2  2  SER A 43  ? LYS A 51  ? SER A 43  LYS A 51  1 ? 9  
HELX_P HELX_P3  3  SER A 72  ? HIS A 83  ? SER A 72  HIS A 83  1 ? 12 
HELX_P HELX_P4  4  GLU A 90  ? TYR A 115 ? GLU A 90  TYR A 115 1 ? 26 
HELX_P HELX_P5  5  PHE A 119 ? LEU A 141 ? PHE A 119 LEU A 141 1 ? 23 
HELX_P HELX_P6  6  PHE A 154 ? PHE A 169 ? PHE A 154 PHE A 169 1 ? 16 
HELX_P HELX_P7  7  PRO A 171 ? LEU A 174 ? PRO A 171 LEU A 174 5 ? 4  
HELX_P HELX_P8  8  PRO A 178 ? GLU A 188 ? PRO A 178 GLU A 188 1 ? 11 
HELX_P HELX_P9  9  GLU A 191 ? LYS A 198 ? GLU A 191 LYS A 198 1 ? 8  
HELX_P HELX_P10 10 GLY B 15  ? PHE B 26  ? GLY B 15  PHE B 26  5 ? 12 
HELX_P HELX_P11 11 SER B 47  ? LYS B 55  ? SER B 47  LYS B 55  1 ? 9  
HELX_P HELX_P12 12 SER B 76  ? HIS B 87  ? SER B 76  HIS B 87  1 ? 12 
HELX_P HELX_P13 13 GLU B 94  ? TYR B 119 ? GLU B 94  TYR B 119 1 ? 26 
HELX_P HELX_P14 14 SER B 121 ? LEU B 145 ? SER B 121 LEU B 145 5 ? 25 
HELX_P HELX_P15 15 PHE B 158 ? PHE B 173 ? PHE B 158 PHE B 173 1 ? 16 
HELX_P HELX_P16 16 PRO B 175 ? LEU B 178 ? PRO B 175 LEU B 178 5 ? 4  
HELX_P HELX_P17 17 PRO B 182 ? GLU B 192 ? PRO B 182 GLU B 192 1 ? 11 
HELX_P HELX_P18 18 GLU B 195 ? GLN B 202 ? GLU B 195 GLN B 202 1 ? 8  
HELX_P HELX_P19 19 ASP B 204 ? LYS B 208 ? ASP B 204 LYS B 208 1 ? 5  
HELX_P HELX_P20 20 GLY C 11  ? TYR C 22  ? GLY C 11  TYR C 22  5 ? 12 
HELX_P HELX_P21 21 SER C 43  ? LYS C 51  ? SER C 43  LYS C 51  1 ? 9  
HELX_P HELX_P22 22 SER C 72  ? HIS C 83  ? SER C 72  HIS C 83  1 ? 12 
HELX_P HELX_P23 23 GLU C 90  ? TYR C 115 ? GLU C 90  TYR C 115 1 ? 26 
HELX_P HELX_P24 24 PHE C 119 ? LEU C 141 ? PHE C 119 LEU C 141 1 ? 23 
HELX_P HELX_P25 25 PHE C 154 ? PHE C 169 ? PHE C 154 PHE C 169 1 ? 16 
HELX_P HELX_P26 26 PRO C 171 ? LEU C 174 ? PRO C 171 LEU C 174 5 ? 4  
HELX_P HELX_P27 27 PRO C 178 ? GLU C 188 ? PRO C 178 GLU C 188 1 ? 11 
HELX_P HELX_P28 28 GLU C 191 ? LYS C 198 ? GLU C 191 LYS C 198 1 ? 8  
HELX_P HELX_P29 29 GLY D 15  ? PHE D 26  ? GLY D 15  PHE D 26  5 ? 12 
HELX_P HELX_P30 30 SER D 47  ? LYS D 55  ? SER D 47  LYS D 55  1 ? 9  
HELX_P HELX_P31 31 SER D 76  ? HIS D 87  ? SER D 76  HIS D 87  1 ? 12 
HELX_P HELX_P32 32 GLU D 94  ? TYR D 119 ? GLU D 94  TYR D 119 1 ? 26 
HELX_P HELX_P33 33 SER D 121 ? LEU D 145 ? SER D 121 LEU D 145 5 ? 25 
HELX_P HELX_P34 34 PHE D 158 ? PHE D 173 ? PHE D 158 PHE D 173 1 ? 16 
HELX_P HELX_P35 35 PRO D 175 ? LEU D 178 ? PRO D 175 LEU D 178 5 ? 4  
HELX_P HELX_P36 36 PRO D 182 ? GLU D 192 ? PRO D 182 GLU D 192 1 ? 11 
HELX_P HELX_P37 37 GLU D 195 ? GLN D 202 ? GLU D 195 GLN D 202 1 ? 8  
HELX_P HELX_P38 38 ASP D 204 ? LYS D 208 ? ASP D 204 LYS D 208 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 59  A . ? LEU 59  A PRO 60  A ? PRO 60  A 1 -0.63 
2 ARG 205 A . ? ARG 205 A PRO 206 A ? PRO 206 A 1 -4.14 
3 LEU 63  B . ? LEU 63  B PRO 64  B ? PRO 64  B 1 -1.21 
4 LEU 59  C . ? LEU 59  C PRO 60  C ? PRO 60  C 1 -1.61 
5 ARG 205 C . ? ARG 205 C PRO 206 C ? PRO 206 C 1 -0.06 
6 LEU 63  D . ? LEU 63  D PRO 64  D ? PRO 64  D 1 -0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 27 ? TYR A 32 ? TYR A 27 TYR A 32 
A 2 MET A 2  ? TRP A 7  ? MET A 2  TRP A 7  
A 3 TYR A 61 ? ASP A 64 ? TYR A 61 ASP A 64 
A 4 HIS A 67 ? THR A 70 ? HIS A 67 THR A 70 
B 1 TYR B 31 ? TYR B 36 ? TYR B 31 TYR B 36 
B 2 MET B 6  ? TRP B 11 ? MET B 6  TRP B 11 
B 3 TYR B 65 ? ASP B 68 ? TYR B 65 ASP B 68 
B 4 ASN B 71 ? THR B 74 ? ASN B 71 THR B 74 
C 1 TYR C 27 ? TYR C 32 ? TYR C 27 TYR C 32 
C 2 MET C 2  ? TRP C 7  ? MET C 2  TRP C 7  
C 3 TYR C 61 ? ASP C 64 ? TYR C 61 ASP C 64 
C 4 HIS C 67 ? THR C 70 ? HIS C 67 THR C 70 
D 1 TYR D 31 ? TYR D 36 ? TYR D 31 TYR D 36 
D 2 MET D 6  ? TRP D 11 ? MET D 6  TRP D 11 
D 3 TYR D 65 ? ASP D 68 ? TYR D 65 ASP D 68 
D 4 ASN D 71 ? THR D 74 ? ASN D 71 THR D 74 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 28 ? O GLU A 28 N MET A 2  ? N MET A 2  
A 2 3 O THR A 3  ? O THR A 3  N ILE A 63 ? N ILE A 63 
A 3 4 O LEU A 62 ? O LEU A 62 N ILE A 69 ? N ILE A 69 
B 1 2 O GLU B 32 ? O GLU B 32 N MET B 6  ? N MET B 6  
B 2 3 O VAL B 7  ? O VAL B 7  N LEU B 67 ? N LEU B 67 
B 3 4 O LEU B 66 ? O LEU B 66 N ILE B 73 ? N ILE B 73 
C 1 2 O GLU C 28 ? O GLU C 28 N MET C 2  ? N MET C 2  
C 2 3 O THR C 3  ? O THR C 3  N ILE C 63 ? N ILE C 63 
C 3 4 O LEU C 62 ? O LEU C 62 N ILE C 69 ? N ILE C 69 
D 1 2 O GLU D 32 ? O GLU D 32 N MET D 6  ? N MET D 6  
D 2 3 O VAL D 7  ? O VAL D 7  N LEU D 67 ? N LEU D 67 
D 3 4 O LEU D 66 ? O LEU D 66 N ILE D 73 ? N ILE D 73 
# 
_database_PDB_matrix.entry_id          3GTU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GTU 
_atom_sites.fract_transf_matrix[1][1]   0.019242 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001955 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009733 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009667 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? -46.556 -21.566 72.789  1.00 29.56  ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? -45.275 -20.953 72.468  1.00 27.61  ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? -44.633 -21.541 71.193  1.00 25.86  ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? -45.342 -22.118 70.352  1.00 27.05  ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? -44.475 -21.271 73.719  1.00 27.34  ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? -44.990 -22.622 74.102  1.00 26.96  ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? -46.432 -22.508 73.924  1.00 26.70  ? 1   PRO A CD  1 
ATOM   8    N N   . MET A 1 2   ? -43.308 -21.456 71.079  1.00 25.18  ? 2   MET A N   1 
ATOM   9    C CA  . MET A 1 2   ? -42.581 -22.046 69.955  1.00 22.88  ? 2   MET A CA  1 
ATOM   10   C C   . MET A 1 2   ? -42.722 -23.563 69.971  1.00 23.36  ? 2   MET A C   1 
ATOM   11   O O   . MET A 1 2   ? -42.948 -24.162 71.024  1.00 24.12  ? 2   MET A O   1 
ATOM   12   C CB  . MET A 1 2   ? -41.100 -21.689 70.034  1.00 25.06  ? 2   MET A CB  1 
ATOM   13   C CG  . MET A 1 2   ? -40.781 -20.315 69.531  1.00 26.92  ? 2   MET A CG  1 
ATOM   14   S SD  . MET A 1 2   ? -39.021 -20.019 69.490  1.00 25.48  ? 2   MET A SD  1 
ATOM   15   C CE  . MET A 1 2   ? -38.877 -18.827 70.813  1.00 27.63  ? 2   MET A CE  1 
ATOM   16   N N   . THR A 1 3   ? -42.600 -24.182 68.794  1.00 21.07  ? 3   THR A N   1 
ATOM   17   C CA  . THR A 1 3   ? -42.691 -25.628 68.674  1.00 20.28  ? 3   THR A CA  1 
ATOM   18   C C   . THR A 1 3   ? -41.477 -26.125 67.926  1.00 20.46  ? 3   THR A C   1 
ATOM   19   O O   . THR A 1 3   ? -41.158 -25.628 66.879  1.00 21.34  ? 3   THR A O   1 
ATOM   20   C CB  . THR A 1 3   ? -44.003 -26.059 67.957  1.00 21.91  ? 3   THR A CB  1 
ATOM   21   O OG1 . THR A 1 3   ? -45.132 -25.513 68.655  1.00 24.42  ? 3   THR A OG1 1 
ATOM   22   C CG2 . THR A 1 3   ? -44.139 -27.559 67.962  1.00 15.10  ? 3   THR A CG2 1 
ATOM   23   N N   . LEU A 1 4   ? -40.827 -27.136 68.473  1.00 18.52  ? 4   LEU A N   1 
ATOM   24   C CA  . LEU A 1 4   ? -39.652 -27.715 67.865  1.00 18.17  ? 4   LEU A CA  1 
ATOM   25   C C   . LEU A 1 4   ? -40.010 -29.142 67.536  1.00 19.05  ? 4   LEU A C   1 
ATOM   26   O O   . LEU A 1 4   ? -40.303 -29.901 68.445  1.00 18.26  ? 4   LEU A O   1 
ATOM   27   C CB  . LEU A 1 4   ? -38.426 -27.660 68.827  1.00 17.85  ? 4   LEU A CB  1 
ATOM   28   C CG  . LEU A 1 4   ? -37.096 -28.259 68.301  1.00 16.87  ? 4   LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 4   ? -36.523 -27.367 67.197  1.00 15.19  ? 4   LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 4   ? -36.127 -28.421 69.421  1.00 17.30  ? 4   LEU A CD2 1 
ATOM   31   N N   . GLY A 1 5   ? -39.934 -29.505 66.255  1.00 17.39  ? 5   GLY A N   1 
ATOM   32   C CA  . GLY A 1 5   ? -40.273 -30.851 65.833  1.00 16.94  ? 5   GLY A CA  1 
ATOM   33   C C   . GLY A 1 5   ? -39.056 -31.574 65.311  1.00 20.40  ? 5   GLY A C   1 
ATOM   34   O O   . GLY A 1 5   ? -38.378 -31.090 64.432  1.00 24.25  ? 5   GLY A O   1 
ATOM   35   N N   . TYR A 1 6   ? -38.808 -32.751 65.879  1.00 20.50  ? 6   TYR A N   1 
ATOM   36   C CA  . TYR A 1 6   ? -37.696 -33.591 65.468  1.00 20.56  ? 6   TYR A CA  1 
ATOM   37   C C   . TYR A 1 6   ? -37.902 -35.007 65.998  1.00 19.23  ? 6   TYR A C   1 
ATOM   38   O O   . TYR A 1 6   ? -38.811 -35.235 66.800  1.00 18.72  ? 6   TYR A O   1 
ATOM   39   C CB  . TYR A 1 6   ? -36.380 -33.018 65.970  1.00 17.94  ? 6   TYR A CB  1 
ATOM   40   C CG  . TYR A 1 6   ? -35.145 -33.665 65.357  1.00 21.62  ? 6   TYR A CG  1 
ATOM   41   C CD1 . TYR A 1 6   ? -34.909 -33.604 63.989  1.00 20.93  ? 6   TYR A CD1 1 
ATOM   42   C CD2 . TYR A 1 6   ? -34.195 -34.312 66.155  1.00 20.09  ? 6   TYR A CD2 1 
ATOM   43   C CE1 . TYR A 1 6   ? -33.750 -34.167 63.427  1.00 21.37  ? 6   TYR A CE1 1 
ATOM   44   C CE2 . TYR A 1 6   ? -33.053 -34.875 65.602  1.00 17.90  ? 6   TYR A CE2 1 
ATOM   45   C CZ  . TYR A 1 6   ? -32.849 -34.799 64.232  1.00 19.61  ? 6   TYR A CZ  1 
ATOM   46   O OH  . TYR A 1 6   ? -31.723 -35.304 63.652  1.00 18.39  ? 6   TYR A OH  1 
ATOM   47   N N   . TRP A 1 7   ? -37.070 -35.939 65.566  1.00 20.55  ? 7   TRP A N   1 
ATOM   48   C CA  . TRP A 1 7   ? -37.125 -37.303 66.077  1.00 20.81  ? 7   TRP A CA  1 
ATOM   49   C C   . TRP A 1 7   ? -36.823 -37.289 67.582  1.00 20.34  ? 7   TRP A C   1 
ATOM   50   O O   . TRP A 1 7   ? -36.267 -36.326 68.091  1.00 16.78  ? 7   TRP A O   1 
ATOM   51   C CB  . TRP A 1 7   ? -36.127 -38.178 65.335  1.00 17.14  ? 7   TRP A CB  1 
ATOM   52   C CG  . TRP A 1 7   ? -36.360 -38.251 63.866  1.00 20.67  ? 7   TRP A CG  1 
ATOM   53   C CD1 . TRP A 1 7   ? -35.575 -37.689 62.898  1.00 21.03  ? 7   TRP A CD1 1 
ATOM   54   C CD2 . TRP A 1 7   ? -37.400 -38.988 63.181  1.00 22.96  ? 7   TRP A CD2 1 
ATOM   55   N NE1 . TRP A 1 7   ? -36.090 -37.976 61.642  1.00 20.06  ? 7   TRP A NE1 1 
ATOM   56   C CE2 . TRP A 1 7   ? -37.177 -38.778 61.783  1.00 22.38  ? 7   TRP A CE2 1 
ATOM   57   C CE3 . TRP A 1 7   ? -38.473 -39.783 63.600  1.00 17.56  ? 7   TRP A CE3 1 
ATOM   58   C CZ2 . TRP A 1 7   ? -38.021 -39.349 60.808  1.00 20.99  ? 7   TRP A CZ2 1 
ATOM   59   C CZ3 . TRP A 1 7   ? -39.302 -40.337 62.637  1.00 20.82  ? 7   TRP A CZ3 1 
ATOM   60   C CH2 . TRP A 1 7   ? -39.072 -40.112 61.252  1.00 22.98  ? 7   TRP A CH2 1 
ATOM   61   N N   . ASN A 1 8   ? -37.184 -38.349 68.294  1.00 22.01  ? 8   ASN A N   1 
ATOM   62   C CA  . ASN A 1 8   ? -36.859 -38.455 69.702  1.00 27.14  ? 8   ASN A CA  1 
ATOM   63   C C   . ASN A 1 8   ? -35.393 -38.928 69.784  1.00 28.44  ? 8   ASN A C   1 
ATOM   64   O O   . ASN A 1 8   ? -35.095 -40.000 70.313  1.00 29.83  ? 8   ASN A O   1 
ATOM   65   C CB  . ASN A 1 8   ? -37.782 -39.465 70.373  1.00 30.62  ? 8   ASN A CB  1 
ATOM   66   C CG  . ASN A 1 8   ? -37.505 -39.610 71.876  1.00 36.17  ? 8   ASN A CG  1 
ATOM   67   O OD1 . ASN A 1 8   ? -37.919 -38.767 72.668  1.00 37.24  ? 8   ASN A OD1 1 
ATOM   68   N ND2 . ASN A 1 8   ? -36.765 -40.654 72.253  1.00 39.21  ? 8   ASN A ND2 1 
ATOM   69   N N   . ILE A 1 9   ? -34.489 -38.103 69.276  1.00 27.06  ? 9   ILE A N   1 
ATOM   70   C CA  . ILE A 1 9   ? -33.083 -38.456 69.134  1.00 24.06  ? 9   ILE A CA  1 
ATOM   71   C C   . ILE A 1 9   ? -32.338 -37.164 69.476  1.00 23.03  ? 9   ILE A C   1 
ATOM   72   O O   . ILE A 1 9   ? -32.922 -36.079 69.422  1.00 21.21  ? 9   ILE A O   1 
ATOM   73   C CB  . ILE A 1 9   ? -32.732 -38.906 67.686  1.00 24.84  ? 9   ILE A CB  1 
ATOM   74   C CG1 . ILE A 1 9   ? -33.505 -40.155 67.318  1.00 26.92  ? 9   ILE A CG1 1 
ATOM   75   C CG2 . ILE A 1 9   ? -31.281 -39.252 67.576  1.00 29.08  ? 9   ILE A CG2 1 
ATOM   76   C CD1 . ILE A 1 9   ? -33.244 -41.365 68.150  1.00 26.43  ? 9   ILE A CD1 1 
ATOM   77   N N   . ARG A 1 10  ? -31.062 -37.290 69.806  1.00 21.91  ? 10  ARG A N   1 
ATOM   78   C CA  . ARG A 1 10  ? -30.189 -36.149 70.019  1.00 19.57  ? 10  ARG A CA  1 
ATOM   79   C C   . ARG A 1 10  ? -30.010 -35.399 68.712  1.00 16.28  ? 10  ARG A C   1 
ATOM   80   O O   . ARG A 1 10  ? -30.439 -34.232 68.587  1.00 17.08  ? 10  ARG A O   1 
ATOM   81   C CB  . ARG A 1 10  ? -28.845 -36.622 70.577  1.00 19.00  ? 10  ARG A CB  1 
ATOM   82   C CG  . ARG A 1 10  ? -27.793 -35.539 70.696  1.00 22.84  ? 10  ARG A CG  1 
ATOM   83   C CD  . ARG A 1 10  ? -26.421 -36.118 70.973  1.00 26.26  ? 10  ARG A CD  1 
ATOM   84   N NE  . ARG A 1 10  ? -25.409 -35.081 71.119  1.00 27.41  ? 10  ARG A NE  1 
ATOM   85   C CZ  . ARG A 1 10  ? -24.338 -35.194 71.897  1.00 27.73  ? 10  ARG A CZ  1 
ATOM   86   N NH1 . ARG A 1 10  ? -24.146 -36.287 72.615  1.00 27.68  ? 10  ARG A NH1 1 
ATOM   87   N NH2 . ARG A 1 10  ? -23.462 -34.209 71.944  1.00 26.63  ? 10  ARG A NH2 1 
ATOM   88   N N   . GLY A 1 11  ? -29.367 -36.098 67.760  1.00 12.98  ? 11  GLY A N   1 
ATOM   89   C CA  . GLY A 1 11  ? -29.098 -35.587 66.423  1.00 9.47   ? 11  GLY A CA  1 
ATOM   90   C C   . GLY A 1 11  ? -28.984 -34.084 66.225  1.00 9.10   ? 11  GLY A C   1 
ATOM   91   O O   . GLY A 1 11  ? -28.454 -33.355 67.047  1.00 11.86  ? 11  GLY A O   1 
ATOM   92   N N   . LEU A 1 12  ? -29.536 -33.619 65.108  1.00 7.91   ? 12  LEU A N   1 
ATOM   93   C CA  . LEU A 1 12  ? -29.499 -32.216 64.744  1.00 9.87   ? 12  LEU A CA  1 
ATOM   94   C C   . LEU A 1 12  ? -30.309 -31.278 65.650  1.00 8.95   ? 12  LEU A C   1 
ATOM   95   O O   . LEU A 1 12  ? -30.236 -30.059 65.459  1.00 10.22  ? 12  LEU A O   1 
ATOM   96   C CB  . LEU A 1 12  ? -29.997 -32.060 63.306  1.00 13.12  ? 12  LEU A CB  1 
ATOM   97   C CG  . LEU A 1 12  ? -29.228 -32.769 62.193  1.00 15.54  ? 12  LEU A CG  1 
ATOM   98   C CD1 . LEU A 1 12  ? -30.075 -32.841 60.955  1.00 12.76  ? 12  LEU A CD1 1 
ATOM   99   C CD2 . LEU A 1 12  ? -27.931 -32.032 61.926  1.00 12.61  ? 12  LEU A CD2 1 
ATOM   100  N N   . ALA A 1 13  ? -31.069 -31.815 66.599  1.00 11.16  ? 13  ALA A N   1 
ATOM   101  C CA  . ALA A 1 13  ? -31.906 -30.985 67.468  1.00 12.65  ? 13  ALA A CA  1 
ATOM   102  C C   . ALA A 1 13  ? -31.142 -30.553 68.734  1.00 11.91  ? 13  ALA A C   1 
ATOM   103  O O   . ALA A 1 13  ? -31.477 -29.508 69.329  1.00 9.47   ? 13  ALA A O   1 
ATOM   104  C CB  . ALA A 1 13  ? -33.138 -31.694 67.847  1.00 10.30  ? 13  ALA A CB  1 
ATOM   105  N N   . HIS A 1 14  ? -30.113 -31.316 69.108  1.00 14.71  ? 14  HIS A N   1 
ATOM   106  C CA  . HIS A 1 14  ? -29.305 -31.016 70.296  1.00 15.75  ? 14  HIS A CA  1 
ATOM   107  C C   . HIS A 1 14  ? -28.908 -29.563 70.487  1.00 13.70  ? 14  HIS A C   1 
ATOM   108  O O   . HIS A 1 14  ? -29.225 -28.956 71.501  1.00 12.31  ? 14  HIS A O   1 
ATOM   109  C CB  . HIS A 1 14  ? -28.068 -31.907 70.358  1.00 17.54  ? 14  HIS A CB  1 
ATOM   110  C CG  . HIS A 1 14  ? -27.565 -32.152 71.744  1.00 19.46  ? 14  HIS A CG  1 
ATOM   111  N ND1 . HIS A 1 14  ? -28.196 -32.976 72.641  1.00 22.55  ? 14  HIS A ND1 1 
ATOM   112  C CD2 . HIS A 1 14  ? -26.467 -31.661 72.391  1.00 18.92  ? 14  HIS A CD2 1 
ATOM   113  C CE1 . HIS A 1 14  ? -27.525 -33.002 73.787  1.00 17.88  ? 14  HIS A CE1 1 
ATOM   114  N NE2 . HIS A 1 14  ? -26.466 -32.197 73.653  1.00 19.52  ? 14  HIS A NE2 1 
ATOM   115  N N   . SER A 1 15  ? -28.216 -28.991 69.493  1.00 11.96  ? 15  SER A N   1 
ATOM   116  C CA  . SER A 1 15  ? -27.756 -27.615 69.585  1.00 12.53  ? 15  SER A CA  1 
ATOM   117  C C   . SER A 1 15  ? -28.914 -26.644 69.756  1.00 14.53  ? 15  SER A C   1 
ATOM   118  O O   . SER A 1 15  ? -28.789 -25.670 70.504  1.00 14.93  ? 15  SER A O   1 
ATOM   119  C CB  . SER A 1 15  ? -26.923 -27.230 68.354  1.00 11.77  ? 15  SER A CB  1 
ATOM   120  O OG  . SER A 1 15  ? -25.763 -28.062 68.253  1.00 17.92  ? 15  SER A OG  1 
ATOM   121  N N   . ILE A 1 16  ? -30.029 -26.934 69.085  1.00 17.94  ? 16  ILE A N   1 
ATOM   122  C CA  . ILE A 1 16  ? -31.220 -26.080 69.103  1.00 16.52  ? 16  ILE A CA  1 
ATOM   123  C C   . ILE A 1 16  ? -31.831 -26.080 70.509  1.00 15.66  ? 16  ILE A C   1 
ATOM   124  O O   . ILE A 1 16  ? -32.035 -25.016 71.094  1.00 15.28  ? 16  ILE A O   1 
ATOM   125  C CB  . ILE A 1 16  ? -32.284 -26.535 68.102  1.00 18.13  ? 16  ILE A CB  1 
ATOM   126  C CG1 . ILE A 1 16  ? -31.687 -26.606 66.699  1.00 19.33  ? 16  ILE A CG1 1 
ATOM   127  C CG2 . ILE A 1 16  ? -33.398 -25.546 68.091  1.00 19.91  ? 16  ILE A CG2 1 
ATOM   128  C CD1 . ILE A 1 16  ? -32.579 -27.213 65.685  1.00 16.37  ? 16  ILE A CD1 1 
ATOM   129  N N   . ARG A 1 17  ? -32.084 -27.275 71.049  1.00 12.90  ? 17  ARG A N   1 
ATOM   130  C CA  . ARG A 1 17  ? -32.658 -27.401 72.374  1.00 9.48   ? 17  ARG A CA  1 
ATOM   131  C C   . ARG A 1 17  ? -31.818 -26.614 73.390  1.00 11.48  ? 17  ARG A C   1 
ATOM   132  O O   . ARG A 1 17  ? -32.357 -25.817 74.171  1.00 12.08  ? 17  ARG A O   1 
ATOM   133  C CB  . ARG A 1 17  ? -32.731 -28.873 72.752  1.00 7.58   ? 17  ARG A CB  1 
ATOM   134  C CG  . ARG A 1 17  ? -33.632 -29.685 71.872  1.00 2.96   ? 17  ARG A CG  1 
ATOM   135  C CD  . ARG A 1 17  ? -33.500 -31.183 72.137  1.00 2.00   ? 17  ARG A CD  1 
ATOM   136  N NE  . ARG A 1 17  ? -34.397 -32.001 71.311  1.00 2.00   ? 17  ARG A NE  1 
ATOM   137  C CZ  . ARG A 1 17  ? -34.107 -33.225 70.857  1.00 5.08   ? 17  ARG A CZ  1 
ATOM   138  N NH1 . ARG A 1 17  ? -32.920 -33.781 71.061  1.00 9.98   ? 17  ARG A NH1 1 
ATOM   139  N NH2 . ARG A 1 17  ? -35.020 -33.911 70.206  1.00 8.41   ? 17  ARG A NH2 1 
ATOM   140  N N   . LEU A 1 18  ? -30.497 -26.827 73.362  1.00 10.41  ? 18  LEU A N   1 
ATOM   141  C CA  . LEU A 1 18  ? -29.575 -26.149 74.266  1.00 10.79  ? 18  LEU A CA  1 
ATOM   142  C C   . LEU A 1 18  ? -29.730 -24.651 74.151  1.00 10.85  ? 18  LEU A C   1 
ATOM   143  O O   . LEU A 1 18  ? -29.828 -23.969 75.163  1.00 11.03  ? 18  LEU A O   1 
ATOM   144  C CB  . LEU A 1 18  ? -28.113 -26.567 73.999  1.00 9.17   ? 18  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 18  ? -27.653 -27.980 74.399  1.00 6.07   ? 18  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 18  ? -26.321 -28.247 73.788  1.00 4.35   ? 18  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 18  ? -27.615 -28.112 75.924  1.00 2.46   ? 18  LEU A CD2 1 
ATOM   148  N N   . LEU A 1 19  ? -29.762 -24.155 72.915  1.00 12.53  ? 19  LEU A N   1 
ATOM   149  C CA  . LEU A 1 19  ? -29.870 -22.726 72.677  1.00 14.43  ? 19  LEU A CA  1 
ATOM   150  C C   . LEU A 1 19  ? -31.162 -22.169 73.222  1.00 15.48  ? 19  LEU A C   1 
ATOM   151  O O   . LEU A 1 19  ? -31.179 -21.123 73.853  1.00 17.59  ? 19  LEU A O   1 
ATOM   152  C CB  . LEU A 1 19  ? -29.736 -22.400 71.196  1.00 13.68  ? 19  LEU A CB  1 
ATOM   153  C CG  . LEU A 1 19  ? -29.701 -20.916 70.835  1.00 16.12  ? 19  LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 19  ? -28.600 -20.202 71.633  1.00 19.63  ? 19  LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 19  ? -29.471 -20.764 69.329  1.00 16.95  ? 19  LEU A CD2 1 
ATOM   156  N N   . LEU A 1 20  ? -32.247 -22.912 73.002  1.00 15.31  ? 20  LEU A N   1 
ATOM   157  C CA  . LEU A 1 20  ? -33.566 -22.524 73.488  1.00 12.92  ? 20  LEU A CA  1 
ATOM   158  C C   . LEU A 1 20  ? -33.601 -22.369 74.999  1.00 11.42  ? 20  LEU A C   1 
ATOM   159  O O   . LEU A 1 20  ? -34.109 -21.363 75.495  1.00 8.18   ? 20  LEU A O   1 
ATOM   160  C CB  . LEU A 1 20  ? -34.611 -23.559 73.043  1.00 11.05  ? 20  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 20  ? -35.016 -23.586 71.565  1.00 2.00   ? 20  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 20  ? -35.867 -24.795 71.303  1.00 2.00   ? 20  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 20  ? -35.723 -22.303 71.222  1.00 3.19   ? 20  LEU A CD2 1 
ATOM   164  N N   . GLU A 1 21  ? -33.033 -23.354 75.708  1.00 13.22  ? 21  GLU A N   1 
ATOM   165  C CA  . GLU A 1 21  ? -32.926 -23.345 77.169  1.00 16.50  ? 21  GLU A CA  1 
ATOM   166  C C   . GLU A 1 21  ? -32.090 -22.180 77.665  1.00 18.93  ? 21  GLU A C   1 
ATOM   167  O O   . GLU A 1 21  ? -32.529 -21.410 78.490  1.00 19.75  ? 21  GLU A O   1 
ATOM   168  C CB  . GLU A 1 21  ? -32.319 -24.649 77.666  1.00 14.40  ? 21  GLU A CB  1 
ATOM   169  C CG  . GLU A 1 21  ? -33.200 -25.861 77.383  1.00 14.82  ? 21  GLU A CG  1 
ATOM   170  C CD  . GLU A 1 21  ? -34.359 -26.036 78.364  1.00 14.61  ? 21  GLU A CD  1 
ATOM   171  O OE1 . GLU A 1 21  ? -34.358 -25.373 79.422  1.00 12.79  ? 21  GLU A OE1 1 
ATOM   172  O OE2 . GLU A 1 21  ? -35.284 -26.834 78.068  1.00 14.58  ? 21  GLU A OE2 1 
ATOM   173  N N   . TYR A 1 22  ? -30.893 -22.037 77.112  1.00 21.46  ? 22  TYR A N   1 
ATOM   174  C CA  . TYR A 1 22  ? -29.983 -20.962 77.485  1.00 25.27  ? 22  TYR A CA  1 
ATOM   175  C C   . TYR A 1 22  ? -30.672 -19.606 77.383  1.00 26.00  ? 22  TYR A C   1 
ATOM   176  O O   . TYR A 1 22  ? -30.416 -18.715 78.175  1.00 27.03  ? 22  TYR A O   1 
ATOM   177  C CB  . TYR A 1 22  ? -28.726 -21.018 76.598  1.00 26.87  ? 22  TYR A CB  1 
ATOM   178  C CG  . TYR A 1 22  ? -27.698 -19.951 76.917  1.00 26.91  ? 22  TYR A CG  1 
ATOM   179  C CD1 . TYR A 1 22  ? -26.771 -20.137 77.954  1.00 26.18  ? 22  TYR A CD1 1 
ATOM   180  C CD2 . TYR A 1 22  ? -27.692 -18.739 76.219  1.00 25.55  ? 22  TYR A CD2 1 
ATOM   181  C CE1 . TYR A 1 22  ? -25.842 -19.127 78.295  1.00 25.59  ? 22  TYR A CE1 1 
ATOM   182  C CE2 . TYR A 1 22  ? -26.775 -17.720 76.546  1.00 24.33  ? 22  TYR A CE2 1 
ATOM   183  C CZ  . TYR A 1 22  ? -25.858 -17.923 77.583  1.00 26.31  ? 22  TYR A CZ  1 
ATOM   184  O OH  . TYR A 1 22  ? -25.004 -16.900 77.915  1.00 24.73  ? 22  TYR A OH  1 
ATOM   185  N N   . THR A 1 23  ? -31.522 -19.435 76.383  1.00 29.54  ? 23  THR A N   1 
ATOM   186  C CA  . THR A 1 23  ? -32.178 -18.157 76.164  1.00 29.53  ? 23  THR A CA  1 
ATOM   187  C C   . THR A 1 23  ? -33.524 -18.033 76.883  1.00 29.46  ? 23  THR A C   1 
ATOM   188  O O   . THR A 1 23  ? -34.213 -17.018 76.770  1.00 28.92  ? 23  THR A O   1 
ATOM   189  C CB  . THR A 1 23  ? -32.389 -17.902 74.646  1.00 28.44  ? 23  THR A CB  1 
ATOM   190  O OG1 . THR A 1 23  ? -33.113 -18.992 74.043  1.00 29.82  ? 23  THR A OG1 1 
ATOM   191  C CG2 . THR A 1 23  ? -31.055 -17.726 73.949  1.00 26.85  ? 23  THR A CG2 1 
ATOM   192  N N   . ASP A 1 24  ? -33.891 -19.095 77.606  1.00 28.42  ? 24  ASP A N   1 
ATOM   193  C CA  . ASP A 1 24  ? -35.157 -19.150 78.320  1.00 30.42  ? 24  ASP A CA  1 
ATOM   194  C C   . ASP A 1 24  ? -36.352 -18.896 77.411  1.00 28.51  ? 24  ASP A C   1 
ATOM   195  O O   . ASP A 1 24  ? -37.319 -18.249 77.820  1.00 29.52  ? 24  ASP A O   1 
ATOM   196  C CB  . ASP A 1 24  ? -35.145 -18.182 79.506  1.00 31.68  ? 24  ASP A CB  1 
ATOM   197  C CG  . ASP A 1 24  ? -34.300 -18.691 80.666  1.00 32.86  ? 24  ASP A CG  1 
ATOM   198  O OD1 . ASP A 1 24  ? -34.235 -19.920 80.907  1.00 35.40  ? 24  ASP A OD1 1 
ATOM   199  O OD2 . ASP A 1 24  ? -33.680 -17.850 81.333  1.00 31.80  ? 24  ASP A OD2 1 
ATOM   200  N N   . SER A 1 25  ? -36.289 -19.419 76.197  1.00 28.75  ? 25  SER A N   1 
ATOM   201  C CA  . SER A 1 25  ? -37.365 -19.251 75.234  1.00 26.95  ? 25  SER A CA  1 
ATOM   202  C C   . SER A 1 25  ? -38.421 -20.284 75.616  1.00 26.26  ? 25  SER A C   1 
ATOM   203  O O   . SER A 1 25  ? -38.122 -21.470 75.774  1.00 27.11  ? 25  SER A O   1 
ATOM   204  C CB  . SER A 1 25  ? -36.814 -19.468 73.813  1.00 23.16  ? 25  SER A CB  1 
ATOM   205  O OG  . SER A 1 25  ? -35.801 -18.515 73.477  1.00 27.02  ? 25  SER A OG  1 
ATOM   206  N N   . SER A 1 26  ? -39.669 -19.845 75.733  1.00 25.59  ? 26  SER A N   1 
ATOM   207  C CA  . SER A 1 26  ? -40.758 -20.761 76.017  1.00 25.69  ? 26  SER A CA  1 
ATOM   208  C C   . SER A 1 26  ? -41.057 -21.560 74.762  1.00 24.62  ? 26  SER A C   1 
ATOM   209  O O   . SER A 1 26  ? -41.360 -20.987 73.707  1.00 22.01  ? 26  SER A O   1 
ATOM   210  C CB  . SER A 1 26  ? -42.007 -19.987 76.445  1.00 25.34  ? 26  SER A CB  1 
ATOM   211  O OG  . SER A 1 26  ? -42.990 -20.865 76.968  1.00 25.80  ? 26  SER A OG  1 
ATOM   212  N N   . TYR A 1 27  ? -40.974 -22.889 74.876  1.00 25.52  ? 27  TYR A N   1 
ATOM   213  C CA  . TYR A 1 27  ? -41.184 -23.745 73.720  1.00 24.80  ? 27  TYR A CA  1 
ATOM   214  C C   . TYR A 1 27  ? -41.755 -25.104 74.114  1.00 24.19  ? 27  TYR A C   1 
ATOM   215  O O   . TYR A 1 27  ? -41.709 -25.498 75.262  1.00 22.84  ? 27  TYR A O   1 
ATOM   216  C CB  . TYR A 1 27  ? -39.873 -23.921 72.925  1.00 26.24  ? 27  TYR A CB  1 
ATOM   217  C CG  . TYR A 1 27  ? -38.833 -24.803 73.571  1.00 26.68  ? 27  TYR A CG  1 
ATOM   218  C CD1 . TYR A 1 27  ? -38.061 -24.329 74.641  1.00 24.86  ? 27  TYR A CD1 1 
ATOM   219  C CD2 . TYR A 1 27  ? -38.646 -26.116 73.139  1.00 26.10  ? 27  TYR A CD2 1 
ATOM   220  C CE1 . TYR A 1 27  ? -37.115 -25.148 75.280  1.00 24.52  ? 27  TYR A CE1 1 
ATOM   221  C CE2 . TYR A 1 27  ? -37.702 -26.951 73.765  1.00 25.40  ? 27  TYR A CE2 1 
ATOM   222  C CZ  . TYR A 1 27  ? -36.938 -26.459 74.834  1.00 24.79  ? 27  TYR A CZ  1 
ATOM   223  O OH  . TYR A 1 27  ? -36.021 -27.296 75.442  1.00 25.24  ? 27  TYR A OH  1 
ATOM   224  N N   . GLU A 1 28  ? -42.267 -25.823 73.117  1.00 25.64  ? 28  GLU A N   1 
ATOM   225  C CA  . GLU A 1 28  ? -42.805 -27.165 73.292  1.00 27.39  ? 28  GLU A CA  1 
ATOM   226  C C   . GLU A 1 28  ? -42.158 -28.006 72.217  1.00 24.83  ? 28  GLU A C   1 
ATOM   227  O O   . GLU A 1 28  ? -41.843 -27.514 71.145  1.00 24.96  ? 28  GLU A O   1 
ATOM   228  C CB  . GLU A 1 28  ? -44.329 -27.165 73.113  1.00 30.38  ? 28  GLU A CB  1 
ATOM   229  C CG  . GLU A 1 28  ? -45.067 -26.320 74.156  1.00 37.99  ? 28  GLU A CG  1 
ATOM   230  C CD  . GLU A 1 28  ? -46.587 -26.299 73.964  1.00 43.44  ? 28  GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 28  ? -47.066 -26.027 72.829  1.00 42.27  ? 28  GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 28  ? -47.301 -26.579 74.961  1.00 44.83  ? 28  GLU A OE2 1 
ATOM   233  N N   . GLU A 1 29  ? -41.962 -29.287 72.499  1.00 21.10  ? 29  GLU A N   1 
ATOM   234  C CA  . GLU A 1 29  ? -41.343 -30.173 71.521  1.00 20.46  ? 29  GLU A CA  1 
ATOM   235  C C   . GLU A 1 29  ? -42.346 -31.178 70.955  1.00 22.03  ? 29  GLU A C   1 
ATOM   236  O O   . GLU A 1 29  ? -43.195 -31.702 71.682  1.00 23.88  ? 29  GLU A O   1 
ATOM   237  C CB  . GLU A 1 29  ? -40.160 -30.916 72.145  1.00 16.73  ? 29  GLU A CB  1 
ATOM   238  C CG  . GLU A 1 29  ? -38.872 -30.083 72.226  1.00 12.77  ? 29  GLU A CG  1 
ATOM   239  C CD  . GLU A 1 29  ? -37.710 -30.875 72.822  1.00 11.32  ? 29  GLU A CD  1 
ATOM   240  O OE1 . GLU A 1 29  ? -37.371 -31.943 72.265  1.00 12.66  ? 29  GLU A OE1 1 
ATOM   241  O OE2 . GLU A 1 29  ? -37.126 -30.453 73.848  1.00 20.16  ? 29  GLU A OE2 1 
ATOM   242  N N   . LYS A 1 30  ? -42.205 -31.460 69.661  1.00 22.67  ? 30  LYS A N   1 
ATOM   243  C CA  . LYS A 1 30  ? -43.019 -32.434 68.970  1.00 23.86  ? 30  LYS A CA  1 
ATOM   244  C C   . LYS A 1 30  ? -42.050 -33.487 68.521  1.00 23.85  ? 30  LYS A C   1 
ATOM   245  O O   . LYS A 1 30  ? -41.458 -33.397 67.463  1.00 24.90  ? 30  LYS A O   1 
ATOM   246  C CB  . LYS A 1 30  ? -43.708 -31.763 67.784  1.00 25.59  ? 30  LYS A CB  1 
ATOM   247  C CG  . LYS A 1 30  ? -44.637 -32.663 66.988  1.00 27.17  ? 30  LYS A CG  1 
ATOM   248  C CD  . LYS A 1 30  ? -45.908 -32.959 67.748  1.00 27.79  ? 30  LYS A CD  1 
ATOM   249  C CE  . LYS A 1 30  ? -46.803 -33.936 67.003  1.00 31.73  ? 30  LYS A CE  1 
ATOM   250  N NZ  . LYS A 1 30  ? -46.175 -35.291 66.876  1.00 33.56  ? 30  LYS A NZ  1 
ATOM   251  N N   . LYS A 1 31  ? -41.910 -34.530 69.332  1.00 24.24  ? 31  LYS A N   1 
ATOM   252  C CA  . LYS A 1 31  ? -40.958 -35.600 69.045  1.00 24.78  ? 31  LYS A CA  1 
ATOM   253  C C   . LYS A 1 31  ? -41.604 -36.680 68.197  1.00 24.70  ? 31  LYS A C   1 
ATOM   254  O O   . LYS A 1 31  ? -42.733 -37.058 68.425  1.00 30.30  ? 31  LYS A O   1 
ATOM   255  C CB  . LYS A 1 31  ? -40.401 -36.223 70.342  1.00 25.06  ? 31  LYS A CB  1 
ATOM   256  C CG  . LYS A 1 31  ? -39.489 -35.312 71.172  1.00 26.43  ? 31  LYS A CG  1 
ATOM   257  C CD  . LYS A 1 31  ? -39.074 -36.032 72.405  1.00 27.27  ? 31  LYS A CD  1 
ATOM   258  C CE  . LYS A 1 31  ? -38.362 -35.131 73.384  1.00 31.22  ? 31  LYS A CE  1 
ATOM   259  N NZ  . LYS A 1 31  ? -38.002 -35.855 74.657  1.00 33.12  ? 31  LYS A NZ  1 
ATOM   260  N N   . TYR A 1 32  ? -40.881 -37.166 67.198  1.00 23.39  ? 32  TYR A N   1 
ATOM   261  C CA  . TYR A 1 32  ? -41.412 -38.203 66.330  1.00 23.28  ? 32  TYR A CA  1 
ATOM   262  C C   . TYR A 1 32  ? -40.660 -39.494 66.633  1.00 20.96  ? 32  TYR A C   1 
ATOM   263  O O   . TYR A 1 32  ? -39.443 -39.491 66.787  1.00 19.84  ? 32  TYR A O   1 
ATOM   264  C CB  . TYR A 1 32  ? -41.247 -37.805 64.857  1.00 22.85  ? 32  TYR A CB  1 
ATOM   265  C CG  . TYR A 1 32  ? -42.050 -36.598 64.480  1.00 23.33  ? 32  TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 32  ? -43.387 -36.718 64.130  1.00 24.09  ? 32  TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 32  ? -41.481 -35.332 64.487  1.00 20.79  ? 32  TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 32  ? -44.161 -35.577 63.790  1.00 25.79  ? 32  TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 32  ? -42.248 -34.179 64.152  1.00 22.22  ? 32  TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 32  ? -43.579 -34.320 63.814  1.00 23.14  ? 32  TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 32  ? -44.317 -33.211 63.495  1.00 21.55  ? 32  TYR A OH  1 
ATOM   272  N N   . THR A 1 33  ? -41.390 -40.608 66.681  1.00 21.07  ? 33  THR A N   1 
ATOM   273  C CA  . THR A 1 33  ? -40.786 -41.914 66.931  1.00 21.19  ? 33  THR A CA  1 
ATOM   274  C C   . THR A 1 33  ? -40.648 -42.700 65.627  1.00 23.16  ? 33  THR A C   1 
ATOM   275  O O   . THR A 1 33  ? -41.526 -42.660 64.759  1.00 28.06  ? 33  THR A O   1 
ATOM   276  C CB  . THR A 1 33  ? -41.649 -42.724 67.931  1.00 21.09  ? 33  THR A CB  1 
ATOM   277  O OG1 . THR A 1 33  ? -41.916 -41.924 69.090  1.00 21.89  ? 33  THR A OG1 1 
ATOM   278  C CG2 . THR A 1 33  ? -40.936 -43.982 68.381  1.00 21.34  ? 33  THR A CG2 1 
ATOM   279  N N   . MET A 1 34  ? -39.532 -43.419 65.507  1.00 24.45  ? 34  MET A N   1 
ATOM   280  C CA  . MET A 1 34  ? -39.235 -44.205 64.320  1.00 26.77  ? 34  MET A CA  1 
ATOM   281  C C   . MET A 1 34  ? -39.378 -45.694 64.634  1.00 30.69  ? 34  MET A C   1 
ATOM   282  O O   . MET A 1 34  ? -39.125 -46.136 65.745  1.00 32.58  ? 34  MET A O   1 
ATOM   283  C CB  . MET A 1 34  ? -37.811 -43.904 63.817  1.00 24.36  ? 34  MET A CB  1 
ATOM   284  C CG  . MET A 1 34  ? -37.462 -44.548 62.467  1.00 24.32  ? 34  MET A CG  1 
ATOM   285  S SD  . MET A 1 34  ? -35.883 -44.112 61.857  1.00 21.29  ? 34  MET A SD  1 
ATOM   286  C CE  . MET A 1 34  ? -36.145 -42.502 61.261  1.00 21.47  ? 34  MET A CE  1 
ATOM   287  N N   . GLY A 1 35  ? -39.796 -46.462 63.629  1.00 32.56  ? 35  GLY A N   1 
ATOM   288  C CA  . GLY A 1 35  ? -39.945 -47.898 63.795  1.00 36.32  ? 35  GLY A CA  1 
ATOM   289  C C   . GLY A 1 35  ? -38.647 -48.635 63.997  1.00 39.33  ? 35  GLY A C   1 
ATOM   290  O O   . GLY A 1 35  ? -37.593 -48.232 63.519  1.00 39.24  ? 35  GLY A O   1 
ATOM   291  N N   . ASP A 1 36  ? -38.730 -49.723 64.754  1.00 43.34  ? 36  ASP A N   1 
ATOM   292  C CA  . ASP A 1 36  ? -37.569 -50.524 65.087  1.00 46.81  ? 36  ASP A CA  1 
ATOM   293  C C   . ASP A 1 36  ? -37.475 -51.737 64.179  1.00 46.78  ? 36  ASP A C   1 
ATOM   294  O O   . ASP A 1 36  ? -36.405 -52.273 63.930  1.00 49.44  ? 36  ASP A O   1 
ATOM   295  C CB  . ASP A 1 36  ? -37.657 -50.953 66.562  1.00 48.74  ? 36  ASP A CB  1 
ATOM   296  C CG  . ASP A 1 36  ? -36.572 -51.953 66.968  1.00 51.72  ? 36  ASP A CG  1 
ATOM   297  O OD1 . ASP A 1 36  ? -35.360 -51.616 66.827  1.00 51.75  ? 36  ASP A OD1 1 
ATOM   298  O OD2 . ASP A 1 36  ? -36.947 -53.083 67.390  1.00 53.32  ? 36  ASP A OD2 1 
ATOM   299  N N   . ALA A 1 37  ? -38.620 -52.190 63.699  1.00 47.31  ? 37  ALA A N   1 
ATOM   300  C CA  . ALA A 1 37  ? -38.709 -53.383 62.857  1.00 47.07  ? 37  ALA A CA  1 
ATOM   301  C C   . ALA A 1 37  ? -37.893 -53.169 61.572  1.00 44.42  ? 37  ALA A C   1 
ATOM   302  O O   . ALA A 1 37  ? -37.438 -52.045 61.334  1.00 46.98  ? 37  ALA A O   1 
ATOM   303  C CB  . ALA A 1 37  ? -40.236 -53.653 62.515  1.00 46.98  ? 37  ALA A CB  1 
ATOM   304  N N   . PRO A 1 38  ? -37.758 -54.210 60.698  1.00 40.80  ? 38  PRO A N   1 
ATOM   305  C CA  . PRO A 1 38  ? -37.035 -54.023 59.446  1.00 39.03  ? 38  PRO A CA  1 
ATOM   306  C C   . PRO A 1 38  ? -37.448 -52.781 58.703  1.00 36.61  ? 38  PRO A C   1 
ATOM   307  O O   . PRO A 1 38  ? -36.634 -52.066 58.127  1.00 35.68  ? 38  PRO A O   1 
ATOM   308  C CB  . PRO A 1 38  ? -37.403 -55.280 58.676  1.00 38.83  ? 38  PRO A CB  1 
ATOM   309  C CG  . PRO A 1 38  ? -37.650 -56.270 59.703  1.00 40.65  ? 38  PRO A CG  1 
ATOM   310  C CD  . PRO A 1 38  ? -38.315 -55.570 60.797  1.00 39.98  ? 38  PRO A CD  1 
ATOM   311  N N   . ASP A 1 39  ? -38.730 -52.489 58.785  1.00 33.27  ? 39  ASP A N   1 
ATOM   312  C CA  . ASP A 1 39  ? -39.290 -51.307 58.187  1.00 34.70  ? 39  ASP A CA  1 
ATOM   313  C C   . ASP A 1 39  ? -39.196 -50.294 59.295  1.00 34.67  ? 39  ASP A C   1 
ATOM   314  O O   . ASP A 1 39  ? -40.009 -50.296 60.217  1.00 38.53  ? 39  ASP A O   1 
ATOM   315  C CB  . ASP A 1 39  ? -40.757 -51.558 57.788  1.00 33.60  ? 39  ASP A CB  1 
ATOM   316  C CG  . ASP A 1 39  ? -40.976 -52.963 57.219  1.00 33.14  ? 39  ASP A CG  1 
ATOM   317  O OD1 . ASP A 1 39  ? -40.687 -53.199 56.015  1.00 33.02  ? 39  ASP A OD1 1 
ATOM   318  O OD2 . ASP A 1 39  ? -41.425 -53.833 58.000  1.00 31.51  ? 39  ASP A OD2 1 
ATOM   319  N N   . TYR A 1 40  ? -38.239 -49.378 59.177  1.00 33.48  ? 40  TYR A N   1 
ATOM   320  C CA  . TYR A 1 40  ? -38.115 -48.322 60.170  1.00 30.71  ? 40  TYR A CA  1 
ATOM   321  C C   . TYR A 1 40  ? -39.246 -47.320 59.953  1.00 31.00  ? 40  TYR A C   1 
ATOM   322  O O   . TYR A 1 40  ? -39.026 -46.242 59.397  1.00 31.98  ? 40  TYR A O   1 
ATOM   323  C CB  . TYR A 1 40  ? -36.751 -47.640 60.076  1.00 28.65  ? 40  TYR A CB  1 
ATOM   324  C CG  . TYR A 1 40  ? -35.600 -48.620 60.244  1.00 26.35  ? 40  TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 40  ? -35.305 -49.168 61.515  1.00 23.31  ? 40  TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 40  ? -34.824 -49.025 59.136  1.00 26.43  ? 40  TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 40  ? -34.262 -50.107 61.673  1.00 21.78  ? 40  TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 40  ? -33.772 -49.966 59.286  1.00 23.39  ? 40  TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 40  ? -33.515 -50.508 60.553  1.00 23.27  ? 40  TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 40  ? -32.505 -51.437 60.685  1.00 27.04  ? 40  TYR A OH  1 
ATOM   331  N N   . ASP A 1 41  ? -40.430 -47.689 60.408  1.00 30.23  ? 41  ASP A N   1 
ATOM   332  C CA  . ASP A 1 41  ? -41.663 -46.953 60.168  1.00 32.37  ? 41  ASP A CA  1 
ATOM   333  C C   . ASP A 1 41  ? -41.608 -45.491 60.557  1.00 33.66  ? 41  ASP A C   1 
ATOM   334  O O   . ASP A 1 41  ? -41.492 -45.153 61.737  1.00 35.69  ? 41  ASP A O   1 
ATOM   335  C CB  . ASP A 1 41  ? -42.794 -47.646 60.910  1.00 31.70  ? 41  ASP A CB  1 
ATOM   336  C CG  . ASP A 1 41  ? -44.146 -47.089 60.553  1.00 31.56  ? 41  ASP A CG  1 
ATOM   337  O OD1 . ASP A 1 41  ? -44.361 -46.772 59.361  1.00 33.69  ? 41  ASP A OD1 1 
ATOM   338  O OD2 . ASP A 1 41  ? -44.990 -46.968 61.474  1.00 27.58  ? 41  ASP A OD2 1 
ATOM   339  N N   . ARG A 1 42  ? -41.641 -44.623 59.551  1.00 33.46  ? 42  ARG A N   1 
ATOM   340  C CA  . ARG A 1 42  ? -41.561 -43.188 59.768  1.00 34.39  ? 42  ARG A CA  1 
ATOM   341  C C   . ARG A 1 42  ? -42.921 -42.502 59.529  1.00 32.86  ? 42  ARG A C   1 
ATOM   342  O O   . ARG A 1 42  ? -42.990 -41.270 59.349  1.00 32.94  ? 42  ARG A O   1 
ATOM   343  C CB  . ARG A 1 42  ? -40.494 -42.576 58.858  1.00 34.81  ? 42  ARG A CB  1 
ATOM   344  C CG  . ARG A 1 42  ? -39.136 -43.193 59.002  1.00 36.37  ? 42  ARG A CG  1 
ATOM   345  C CD  . ARG A 1 42  ? -38.185 -42.705 57.943  1.00 41.14  ? 42  ARG A CD  1 
ATOM   346  N NE  . ARG A 1 42  ? -37.893 -41.276 58.080  1.00 41.10  ? 42  ARG A NE  1 
ATOM   347  C CZ  . ARG A 1 42  ? -36.852 -40.657 57.514  1.00 41.72  ? 42  ARG A CZ  1 
ATOM   348  N NH1 . ARG A 1 42  ? -35.985 -41.333 56.750  1.00 39.69  ? 42  ARG A NH1 1 
ATOM   349  N NH2 . ARG A 1 42  ? -36.678 -39.349 57.711  1.00 41.20  ? 42  ARG A NH2 1 
ATOM   350  N N   . SER A 1 43  ? -43.985 -43.306 59.539  1.00 30.73  ? 43  SER A N   1 
ATOM   351  C CA  . SER A 1 43  ? -45.332 -42.822 59.244  1.00 29.75  ? 43  SER A CA  1 
ATOM   352  C C   . SER A 1 43  ? -45.753 -41.693 60.171  1.00 30.29  ? 43  SER A C   1 
ATOM   353  O O   . SER A 1 43  ? -46.402 -40.761 59.739  1.00 31.41  ? 43  SER A O   1 
ATOM   354  C CB  . SER A 1 43  ? -46.339 -43.948 59.362  1.00 27.56  ? 43  SER A CB  1 
ATOM   355  O OG  . SER A 1 43  ? -46.205 -44.564 60.618  1.00 23.23  ? 43  SER A OG  1 
ATOM   356  N N   . GLN A 1 44  ? -45.350 -41.765 61.436  1.00 29.68  ? 44  GLN A N   1 
ATOM   357  C CA  . GLN A 1 44  ? -45.654 -40.729 62.435  1.00 26.88  ? 44  GLN A CA  1 
ATOM   358  C C   . GLN A 1 44  ? -45.289 -39.320 61.948  1.00 25.45  ? 44  GLN A C   1 
ATOM   359  O O   . GLN A 1 44  ? -46.003 -38.368 62.224  1.00 25.87  ? 44  GLN A O   1 
ATOM   360  C CB  . GLN A 1 44  ? -44.898 -41.026 63.729  1.00 28.37  ? 44  GLN A CB  1 
ATOM   361  C CG  . GLN A 1 44  ? -45.446 -40.307 64.941  1.00 33.08  ? 44  GLN A CG  1 
ATOM   362  C CD  . GLN A 1 44  ? -44.802 -40.797 66.247  1.00 36.65  ? 44  GLN A CD  1 
ATOM   363  O OE1 . GLN A 1 44  ? -44.134 -40.031 66.957  1.00 37.44  ? 44  GLN A OE1 1 
ATOM   364  N NE2 . GLN A 1 44  ? -45.008 -42.076 66.558  1.00 37.13  ? 44  GLN A NE2 1 
ATOM   365  N N   . TRP A 1 45  ? -44.202 -39.215 61.198  1.00 23.50  ? 45  TRP A N   1 
ATOM   366  C CA  . TRP A 1 45  ? -43.747 -37.958 60.626  1.00 18.48  ? 45  TRP A CA  1 
ATOM   367  C C   . TRP A 1 45  ? -44.435 -37.774 59.297  1.00 19.91  ? 45  TRP A C   1 
ATOM   368  O O   . TRP A 1 45  ? -45.040 -36.749 59.093  1.00 20.54  ? 45  TRP A O   1 
ATOM   369  C CB  . TRP A 1 45  ? -42.217 -37.967 60.480  1.00 14.64  ? 45  TRP A CB  1 
ATOM   370  C CG  . TRP A 1 45  ? -41.631 -36.980 59.486  1.00 8.46   ? 45  TRP A CG  1 
ATOM   371  C CD1 . TRP A 1 45  ? -40.836 -37.271 58.435  1.00 2.87   ? 45  TRP A CD1 1 
ATOM   372  C CD2 . TRP A 1 45  ? -41.766 -35.543 59.509  1.00 4.26   ? 45  TRP A CD2 1 
ATOM   373  N NE1 . TRP A 1 45  ? -40.493 -36.134 57.781  1.00 2.00   ? 45  TRP A NE1 1 
ATOM   374  C CE2 . TRP A 1 45  ? -41.015 -35.064 58.428  1.00 2.00   ? 45  TRP A CE2 1 
ATOM   375  C CE3 . TRP A 1 45  ? -42.445 -34.653 60.320  1.00 5.37   ? 45  TRP A CE3 1 
ATOM   376  C CZ2 . TRP A 1 45  ? -40.955 -33.685 58.134  1.00 2.12   ? 45  TRP A CZ2 1 
ATOM   377  C CZ3 . TRP A 1 45  ? -42.374 -33.286 60.023  1.00 2.05   ? 45  TRP A CZ3 1 
ATOM   378  C CH2 . TRP A 1 45  ? -41.647 -32.818 58.928  1.00 3.24   ? 45  TRP A CH2 1 
ATOM   379  N N   . LEU A 1 46  ? -44.290 -38.740 58.393  1.00 21.66  ? 46  LEU A N   1 
ATOM   380  C CA  . LEU A 1 46  ? -44.802 -38.647 57.025  1.00 21.25  ? 46  LEU A CA  1 
ATOM   381  C C   . LEU A 1 46  ? -46.265 -38.227 56.940  1.00 23.03  ? 46  LEU A C   1 
ATOM   382  O O   . LEU A 1 46  ? -46.642 -37.388 56.137  1.00 27.56  ? 46  LEU A O   1 
ATOM   383  C CB  . LEU A 1 46  ? -44.602 -39.977 56.308  1.00 18.46  ? 46  LEU A CB  1 
ATOM   384  C CG  . LEU A 1 46  ? -43.137 -40.410 56.188  1.00 15.11  ? 46  LEU A CG  1 
ATOM   385  C CD1 . LEU A 1 46  ? -43.089 -41.825 55.572  1.00 10.80  ? 46  LEU A CD1 1 
ATOM   386  C CD2 . LEU A 1 46  ? -42.328 -39.410 55.335  1.00 9.64   ? 46  LEU A CD2 1 
ATOM   387  N N   . ASN A 1 47  ? -47.095 -38.809 57.805  1.00 21.86  ? 47  ASN A N   1 
ATOM   388  C CA  . ASN A 1 47  ? -48.527 -38.506 57.832  1.00 21.26  ? 47  ASN A CA  1 
ATOM   389  C C   . ASN A 1 47  ? -48.833 -37.053 58.204  1.00 21.80  ? 47  ASN A C   1 
ATOM   390  O O   . ASN A 1 47  ? -49.912 -36.531 57.913  1.00 23.48  ? 47  ASN A O   1 
ATOM   391  C CB  . ASN A 1 47  ? -49.266 -39.455 58.790  1.00 21.69  ? 47  ASN A CB  1 
ATOM   392  C CG  . ASN A 1 47  ? -49.083 -40.940 58.425  1.00 23.95  ? 47  ASN A CG  1 
ATOM   393  O OD1 . ASN A 1 47  ? -48.290 -41.300 57.552  1.00 27.35  ? 47  ASN A OD1 1 
ATOM   394  N ND2 . ASN A 1 47  ? -49.820 -41.779 59.097  1.00 24.26  ? 47  ASN A ND2 1 
ATOM   395  N N   . GLU A 1 48  ? -47.865 -36.408 58.854  1.00 21.92  ? 48  GLU A N   1 
ATOM   396  C CA  . GLU A 1 48  ? -48.019 -35.039 59.314  1.00 21.97  ? 48  GLU A CA  1 
ATOM   397  C C   . GLU A 1 48  ? -47.115 -34.099 58.501  1.00 18.95  ? 48  GLU A C   1 
ATOM   398  O O   . GLU A 1 48  ? -47.281 -32.892 58.545  1.00 18.73  ? 48  GLU A O   1 
ATOM   399  C CB  . GLU A 1 48  ? -47.680 -34.997 60.808  1.00 22.73  ? 48  GLU A CB  1 
ATOM   400  C CG  . GLU A 1 48  ? -48.065 -33.736 61.522  1.00 31.14  ? 48  GLU A CG  1 
ATOM   401  C CD  . GLU A 1 48  ? -47.766 -33.801 63.011  1.00 34.57  ? 48  GLU A CD  1 
ATOM   402  O OE1 . GLU A 1 48  ? -47.733 -34.926 63.574  1.00 37.85  ? 48  GLU A OE1 1 
ATOM   403  O OE2 . GLU A 1 48  ? -47.566 -32.724 63.627  1.00 37.09  ? 48  GLU A OE2 1 
ATOM   404  N N   . LYS A 1 49  ? -46.142 -34.685 57.803  1.00 15.59  ? 49  LYS A N   1 
ATOM   405  C CA  . LYS A 1 49  ? -45.102 -33.966 57.063  1.00 15.58  ? 49  LYS A CA  1 
ATOM   406  C C   . LYS A 1 49  ? -45.582 -32.812 56.190  1.00 15.33  ? 49  LYS A C   1 
ATOM   407  O O   . LYS A 1 49  ? -45.081 -31.687 56.276  1.00 15.53  ? 49  LYS A O   1 
ATOM   408  C CB  . LYS A 1 49  ? -44.336 -34.963 56.198  1.00 14.41  ? 49  LYS A CB  1 
ATOM   409  C CG  . LYS A 1 49  ? -43.229 -34.366 55.374  1.00 12.84  ? 49  LYS A CG  1 
ATOM   410  C CD  . LYS A 1 49  ? -42.474 -35.456 54.668  1.00 8.48   ? 49  LYS A CD  1 
ATOM   411  C CE  . LYS A 1 49  ? -41.400 -34.888 53.757  1.00 9.18   ? 49  LYS A CE  1 
ATOM   412  N NZ  . LYS A 1 49  ? -40.940 -35.968 52.817  1.00 7.89   ? 49  LYS A NZ  1 
ATOM   413  N N   . PHE A 1 50  ? -46.575 -33.080 55.357  1.00 16.98  ? 50  PHE A N   1 
ATOM   414  C CA  . PHE A 1 50  ? -47.075 -32.069 54.439  1.00 14.71  ? 50  PHE A CA  1 
ATOM   415  C C   . PHE A 1 50  ? -48.223 -31.231 54.965  1.00 14.83  ? 50  PHE A C   1 
ATOM   416  O O   . PHE A 1 50  ? -48.648 -30.308 54.305  1.00 16.86  ? 50  PHE A O   1 
ATOM   417  C CB  . PHE A 1 50  ? -47.424 -32.696 53.089  1.00 10.07  ? 50  PHE A CB  1 
ATOM   418  C CG  . PHE A 1 50  ? -46.255 -33.341 52.417  1.00 7.10   ? 50  PHE A CG  1 
ATOM   419  C CD1 . PHE A 1 50  ? -45.397 -32.593 51.592  1.00 4.19   ? 50  PHE A CD1 1 
ATOM   420  C CD2 . PHE A 1 50  ? -45.977 -34.691 52.634  1.00 6.45   ? 50  PHE A CD2 1 
ATOM   421  C CE1 . PHE A 1 50  ? -44.279 -33.194 50.978  1.00 4.55   ? 50  PHE A CE1 1 
ATOM   422  C CE2 . PHE A 1 50  ? -44.852 -35.305 52.018  1.00 3.81   ? 50  PHE A CE2 1 
ATOM   423  C CZ  . PHE A 1 50  ? -44.007 -34.553 51.196  1.00 2.00   ? 50  PHE A CZ  1 
ATOM   424  N N   . LYS A 1 51  ? -48.708 -31.543 56.161  1.00 15.14  ? 51  LYS A N   1 
ATOM   425  C CA  . LYS A 1 51  ? -49.825 -30.812 56.737  1.00 17.83  ? 51  LYS A CA  1 
ATOM   426  C C   . LYS A 1 51  ? -49.376 -29.651 57.614  1.00 18.65  ? 51  LYS A C   1 
ATOM   427  O O   . LYS A 1 51  ? -50.216 -28.954 58.190  1.00 19.11  ? 51  LYS A O   1 
ATOM   428  C CB  . LYS A 1 51  ? -50.721 -31.755 57.545  1.00 17.99  ? 51  LYS A CB  1 
ATOM   429  C CG  . LYS A 1 51  ? -51.319 -32.898 56.736  1.00 15.73  ? 51  LYS A CG  1 
ATOM   430  C CD  . LYS A 1 51  ? -52.075 -33.848 57.630  1.00 14.37  ? 51  LYS A CD  1 
ATOM   431  C CE  . LYS A 1 51  ? -52.593 -35.023 56.830  1.00 13.06  ? 51  LYS A CE  1 
ATOM   432  N NZ  . LYS A 1 51  ? -53.249 -36.053 57.696  1.00 14.93  ? 51  LYS A NZ  1 
ATOM   433  N N   . LEU A 1 52  ? -48.069 -29.451 57.731  1.00 19.75  ? 52  LEU A N   1 
ATOM   434  C CA  . LEU A 1 52  ? -47.523 -28.393 58.590  1.00 19.33  ? 52  LEU A CA  1 
ATOM   435  C C   . LEU A 1 52  ? -47.377 -27.027 57.908  1.00 17.31  ? 52  LEU A C   1 
ATOM   436  O O   . LEU A 1 52  ? -47.268 -26.005 58.574  1.00 16.76  ? 52  LEU A O   1 
ATOM   437  C CB  . LEU A 1 52  ? -46.174 -28.838 59.171  1.00 22.21  ? 52  LEU A CB  1 
ATOM   438  C CG  . LEU A 1 52  ? -46.220 -30.167 59.934  1.00 24.73  ? 52  LEU A CG  1 
ATOM   439  C CD1 . LEU A 1 52  ? -44.831 -30.601 60.311  1.00 25.67  ? 52  LEU A CD1 1 
ATOM   440  C CD2 . LEU A 1 52  ? -47.095 -30.016 61.152  1.00 19.03  ? 52  LEU A CD2 1 
ATOM   441  N N   . GLY A 1 53  ? -47.398 -27.015 56.582  1.00 16.66  ? 53  GLY A N   1 
ATOM   442  C CA  . GLY A 1 53  ? -47.302 -25.766 55.841  1.00 16.50  ? 53  GLY A CA  1 
ATOM   443  C C   . GLY A 1 53  ? -45.909 -25.172 55.729  1.00 15.19  ? 53  GLY A C   1 
ATOM   444  O O   . GLY A 1 53  ? -45.731 -23.969 55.532  1.00 17.92  ? 53  GLY A O   1 
ATOM   445  N N   . LEU A 1 54  ? -44.907 -26.035 55.818  1.00 13.12  ? 54  LEU A N   1 
ATOM   446  C CA  . LEU A 1 54  ? -43.515 -25.606 55.699  1.00 12.91  ? 54  LEU A CA  1 
ATOM   447  C C   . LEU A 1 54  ? -43.194 -25.512 54.213  1.00 10.15  ? 54  LEU A C   1 
ATOM   448  O O   . LEU A 1 54  ? -43.649 -26.351 53.443  1.00 7.30   ? 54  LEU A O   1 
ATOM   449  C CB  . LEU A 1 54  ? -42.576 -26.626 56.396  1.00 12.70  ? 54  LEU A CB  1 
ATOM   450  C CG  . LEU A 1 54  ? -42.946 -27.119 57.796  1.00 12.61  ? 54  LEU A CG  1 
ATOM   451  C CD1 . LEU A 1 54  ? -42.126 -28.329 58.107  1.00 10.91  ? 54  LEU A CD1 1 
ATOM   452  C CD2 . LEU A 1 54  ? -42.725 -26.027 58.812  1.00 7.12   ? 54  LEU A CD2 1 
ATOM   453  N N   . ASP A 1 55  ? -42.366 -24.535 53.817  1.00 9.54   ? 55  ASP A N   1 
ATOM   454  C CA  . ASP A 1 55  ? -41.952 -24.398 52.422  1.00 11.07  ? 55  ASP A CA  1 
ATOM   455  C C   . ASP A 1 55  ? -41.081 -25.573 51.972  1.00 14.03  ? 55  ASP A C   1 
ATOM   456  O O   . ASP A 1 55  ? -41.235 -26.078 50.853  1.00 14.72  ? 55  ASP A O   1 
ATOM   457  C CB  . ASP A 1 55  ? -41.153 -23.119 52.203  1.00 10.44  ? 55  ASP A CB  1 
ATOM   458  C CG  . ASP A 1 55  ? -41.830 -21.887 52.764  1.00 14.54  ? 55  ASP A CG  1 
ATOM   459  O OD1 . ASP A 1 55  ? -42.796 -21.408 52.104  1.00 16.65  ? 55  ASP A OD1 1 
ATOM   460  O OD2 . ASP A 1 55  ? -41.411 -21.424 53.870  1.00 18.07  ? 55  ASP A OD2 1 
ATOM   461  N N   . PHE A 1 56  ? -40.193 -26.028 52.847  1.00 14.81  ? 56  PHE A N   1 
ATOM   462  C CA  . PHE A 1 56  ? -39.365 -27.187 52.549  1.00 16.71  ? 56  PHE A CA  1 
ATOM   463  C C   . PHE A 1 56  ? -39.495 -28.175 53.706  1.00 17.42  ? 56  PHE A C   1 
ATOM   464  O O   . PHE A 1 56  ? -38.686 -28.154 54.628  1.00 20.58  ? 56  PHE A O   1 
ATOM   465  C CB  . PHE A 1 56  ? -37.899 -26.766 52.401  1.00 12.51  ? 56  PHE A CB  1 
ATOM   466  C CG  . PHE A 1 56  ? -37.655 -25.822 51.245  1.00 7.62   ? 56  PHE A CG  1 
ATOM   467  C CD1 . PHE A 1 56  ? -37.470 -26.320 49.958  1.00 7.93   ? 56  PHE A CD1 1 
ATOM   468  C CD2 . PHE A 1 56  ? -37.594 -24.439 51.456  1.00 4.54   ? 56  PHE A CD2 1 
ATOM   469  C CE1 . PHE A 1 56  ? -37.240 -25.453 48.890  1.00 4.90   ? 56  PHE A CE1 1 
ATOM   470  C CE2 . PHE A 1 56  ? -37.361 -23.557 50.399  1.00 4.21   ? 56  PHE A CE2 1 
ATOM   471  C CZ  . PHE A 1 56  ? -37.185 -24.061 49.116  1.00 5.00   ? 56  PHE A CZ  1 
ATOM   472  N N   . PRO A 1 57  ? -40.528 -29.055 53.665  1.00 17.30  ? 57  PRO A N   1 
ATOM   473  C CA  . PRO A 1 57  ? -40.794 -30.035 54.721  1.00 18.28  ? 57  PRO A CA  1 
ATOM   474  C C   . PRO A 1 57  ? -39.559 -30.831 55.099  1.00 16.25  ? 57  PRO A C   1 
ATOM   475  O O   . PRO A 1 57  ? -38.946 -31.464 54.250  1.00 14.56  ? 57  PRO A O   1 
ATOM   476  C CB  . PRO A 1 57  ? -41.869 -30.929 54.085  1.00 15.73  ? 57  PRO A CB  1 
ATOM   477  C CG  . PRO A 1 57  ? -42.588 -30.020 53.198  1.00 15.58  ? 57  PRO A CG  1 
ATOM   478  C CD  . PRO A 1 57  ? -41.540 -29.118 52.605  1.00 14.72  ? 57  PRO A CD  1 
ATOM   479  N N   . ASN A 1 58  ? -39.175 -30.774 56.386  1.00 17.76  ? 58  ASN A N   1 
ATOM   480  C CA  . ASN A 1 58  ? -37.963 -31.464 56.853  1.00 18.18  ? 58  ASN A CA  1 
ATOM   481  C C   . ASN A 1 58  ? -37.849 -31.405 58.362  1.00 17.57  ? 58  ASN A C   1 
ATOM   482  O O   . ASN A 1 58  ? -38.441 -30.560 58.997  1.00 18.93  ? 58  ASN A O   1 
ATOM   483  C CB  . ASN A 1 58  ? -36.708 -30.850 56.212  1.00 18.87  ? 58  ASN A CB  1 
ATOM   484  C CG  . ASN A 1 58  ? -35.516 -31.743 56.276  1.00 15.95  ? 58  ASN A CG  1 
ATOM   485  O OD1 . ASN A 1 58  ? -35.614 -32.949 56.102  1.00 16.34  ? 58  ASN A OD1 1 
ATOM   486  N ND2 . ASN A 1 58  ? -34.387 -31.158 56.566  1.00 17.77  ? 58  ASN A ND2 1 
ATOM   487  N N   . LEU A 1 59  ? -37.052 -32.322 58.917  1.00 16.68  ? 59  LEU A N   1 
ATOM   488  C CA  . LEU A 1 59  ? -36.773 -32.352 60.351  1.00 17.58  ? 59  LEU A CA  1 
ATOM   489  C C   . LEU A 1 59  ? -35.304 -31.942 60.598  1.00 18.16  ? 59  LEU A C   1 
ATOM   490  O O   . LEU A 1 59  ? -34.397 -32.426 59.908  1.00 20.41  ? 59  LEU A O   1 
ATOM   491  C CB  . LEU A 1 59  ? -36.998 -33.770 60.892  1.00 15.87  ? 59  LEU A CB  1 
ATOM   492  C CG  . LEU A 1 59  ? -38.451 -34.212 61.071  1.00 15.42  ? 59  LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 59  ? -38.494 -35.587 61.621  1.00 12.09  ? 59  LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 59  ? -39.196 -33.263 61.977  1.00 14.16  ? 59  LEU A CD2 1 
ATOM   495  N N   . PRO A 1 60  ? -35.045 -31.051 61.594  1.00 17.49  ? 60  PRO A N   1 
ATOM   496  C CA  . PRO A 1 60  ? -36.010 -30.405 62.477  1.00 16.52  ? 60  PRO A CA  1 
ATOM   497  C C   . PRO A 1 60  ? -36.650 -29.181 61.857  1.00 16.91  ? 60  PRO A C   1 
ATOM   498  O O   . PRO A 1 60  ? -36.158 -28.666 60.828  1.00 14.67  ? 60  PRO A O   1 
ATOM   499  C CB  . PRO A 1 60  ? -35.128 -30.015 63.639  1.00 19.02  ? 60  PRO A CB  1 
ATOM   500  C CG  . PRO A 1 60  ? -33.858 -29.649 62.974  1.00 14.85  ? 60  PRO A CG  1 
ATOM   501  C CD  . PRO A 1 60  ? -33.669 -30.642 61.910  1.00 15.42  ? 60  PRO A CD  1 
ATOM   502  N N   . TYR A 1 61  ? -37.720 -28.698 62.503  1.00 15.97  ? 61  TYR A N   1 
ATOM   503  C CA  . TYR A 1 61  ? -38.395 -27.478 62.077  1.00 14.37  ? 61  TYR A CA  1 
ATOM   504  C C   . TYR A 1 61  ? -38.732 -26.694 63.344  1.00 15.55  ? 61  TYR A C   1 
ATOM   505  O O   . TYR A 1 61  ? -38.974 -27.292 64.397  1.00 14.36  ? 61  TYR A O   1 
ATOM   506  C CB  . TYR A 1 61  ? -39.646 -27.809 61.217  1.00 11.00  ? 61  TYR A CB  1 
ATOM   507  C CG  . TYR A 1 61  ? -40.782 -28.546 61.924  1.00 6.79   ? 61  TYR A CG  1 
ATOM   508  C CD1 . TYR A 1 61  ? -41.655 -27.862 62.798  1.00 6.49   ? 61  TYR A CD1 1 
ATOM   509  C CD2 . TYR A 1 61  ? -40.909 -29.933 61.790  1.00 6.83   ? 61  TYR A CD2 1 
ATOM   510  C CE1 . TYR A 1 61  ? -42.646 -28.550 63.518  1.00 2.73   ? 61  TYR A CE1 1 
ATOM   511  C CE2 . TYR A 1 61  ? -41.919 -30.647 62.505  1.00 5.00   ? 61  TYR A CE2 1 
ATOM   512  C CZ  . TYR A 1 61  ? -42.779 -29.937 63.339  1.00 6.61   ? 61  TYR A CZ  1 
ATOM   513  O OH  . TYR A 1 61  ? -43.717 -30.611 64.057  1.00 9.57   ? 61  TYR A OH  1 
ATOM   514  N N   . LEU A 1 62  ? -38.818 -25.369 63.206  1.00 14.98  ? 62  LEU A N   1 
ATOM   515  C CA  . LEU A 1 62  ? -39.212 -24.505 64.295  1.00 15.63  ? 62  LEU A CA  1 
ATOM   516  C C   . LEU A 1 62  ? -40.332 -23.600 63.815  1.00 15.81  ? 62  LEU A C   1 
ATOM   517  O O   . LEU A 1 62  ? -40.208 -22.927 62.808  1.00 16.57  ? 62  LEU A O   1 
ATOM   518  C CB  . LEU A 1 62  ? -38.023 -23.668 64.755  1.00 18.37  ? 62  LEU A CB  1 
ATOM   519  C CG  . LEU A 1 62  ? -38.273 -22.718 65.927  1.00 20.09  ? 62  LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 62  ? -38.298 -23.522 67.226  1.00 22.11  ? 62  LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 62  ? -37.184 -21.641 65.969  1.00 22.30  ? 62  LEU A CD2 1 
ATOM   522  N N   . ILE A 1 63  ? -41.432 -23.589 64.559  1.00 17.12  ? 63  ILE A N   1 
ATOM   523  C CA  . ILE A 1 63  ? -42.561 -22.733 64.246  1.00 15.09  ? 63  ILE A CA  1 
ATOM   524  C C   . ILE A 1 63  ? -42.654 -21.656 65.340  1.00 15.38  ? 63  ILE A C   1 
ATOM   525  O O   . ILE A 1 63  ? -42.930 -21.938 66.488  1.00 18.04  ? 63  ILE A O   1 
ATOM   526  C CB  . ILE A 1 63  ? -43.855 -23.571 64.169  1.00 12.46  ? 63  ILE A CB  1 
ATOM   527  C CG1 . ILE A 1 63  ? -43.661 -24.695 63.150  1.00 10.07  ? 63  ILE A CG1 1 
ATOM   528  C CG2 . ILE A 1 63  ? -45.019 -22.674 63.755  1.00 11.66  ? 63  ILE A CG2 1 
ATOM   529  C CD1 . ILE A 1 63  ? -44.845 -25.597 62.977  1.00 4.84   ? 63  ILE A CD1 1 
ATOM   530  N N   . ASP A 1 64  ? -42.450 -20.409 64.947  1.00 16.52  ? 64  ASP A N   1 
ATOM   531  C CA  . ASP A 1 64  ? -42.556 -19.295 65.854  1.00 20.22  ? 64  ASP A CA  1 
ATOM   532  C C   . ASP A 1 64  ? -43.591 -18.304 65.290  1.00 21.62  ? 64  ASP A C   1 
ATOM   533  O O   . ASP A 1 64  ? -43.262 -17.396 64.499  1.00 22.60  ? 64  ASP A O   1 
ATOM   534  C CB  . ASP A 1 64  ? -41.193 -18.617 66.011  1.00 22.51  ? 64  ASP A CB  1 
ATOM   535  C CG  . ASP A 1 64  ? -41.171 -17.591 67.176  1.00 22.81  ? 64  ASP A CG  1 
ATOM   536  O OD1 . ASP A 1 64  ? -42.147 -17.482 67.958  1.00 24.67  ? 64  ASP A OD1 1 
ATOM   537  O OD2 . ASP A 1 64  ? -40.163 -16.870 67.311  1.00 26.97  ? 64  ASP A OD2 1 
ATOM   538  N N   . GLY A 1 65  ? -44.841 -18.467 65.730  1.00 22.20  ? 65  GLY A N   1 
ATOM   539  C CA  . GLY A 1 65  ? -45.918 -17.605 65.267  1.00 23.18  ? 65  GLY A CA  1 
ATOM   540  C C   . GLY A 1 65  ? -46.161 -17.834 63.793  1.00 25.24  ? 65  GLY A C   1 
ATOM   541  O O   . GLY A 1 65  ? -46.595 -18.927 63.378  1.00 24.57  ? 65  GLY A O   1 
ATOM   542  N N   . THR A 1 66  ? -45.887 -16.806 62.991  1.00 24.55  ? 66  THR A N   1 
ATOM   543  C CA  . THR A 1 66  ? -46.049 -16.901 61.549  1.00 25.48  ? 66  THR A CA  1 
ATOM   544  C C   . THR A 1 66  ? -44.790 -17.446 60.853  1.00 23.51  ? 66  THR A C   1 
ATOM   545  O O   . THR A 1 66  ? -44.820 -17.776 59.664  1.00 25.38  ? 66  THR A O   1 
ATOM   546  C CB  . THR A 1 66  ? -46.375 -15.523 60.945  1.00 27.53  ? 66  THR A CB  1 
ATOM   547  O OG1 . THR A 1 66  ? -45.433 -14.549 61.430  1.00 30.12  ? 66  THR A OG1 1 
ATOM   548  C CG2 . THR A 1 66  ? -47.800 -15.111 61.334  1.00 28.64  ? 66  THR A CG2 1 
ATOM   549  N N   . HIS A 1 67  ? -43.694 -17.534 61.595  1.00 22.66  ? 67  HIS A N   1 
ATOM   550  C CA  . HIS A 1 67  ? -42.428 -18.006 61.044  1.00 20.71  ? 67  HIS A CA  1 
ATOM   551  C C   . HIS A 1 67  ? -42.374 -19.511 61.163  1.00 19.99  ? 67  HIS A C   1 
ATOM   552  O O   . HIS A 1 67  ? -42.588 -20.072 62.216  1.00 19.93  ? 67  HIS A O   1 
ATOM   553  C CB  . HIS A 1 67  ? -41.248 -17.369 61.776  1.00 20.15  ? 67  HIS A CB  1 
ATOM   554  C CG  . HIS A 1 67  ? -41.217 -15.891 61.665  1.00 19.93  ? 67  HIS A CG  1 
ATOM   555  N ND1 . HIS A 1 67  ? -41.221 -15.039 62.784  1.00 21.62  ? 67  HIS A ND1 1 
ATOM   556  C CD2 . HIS A 1 67  ? -41.194 -15.047 60.610  1.00 21.50  ? 67  HIS A CD2 1 
ATOM   557  C CE1 . HIS A 1 67  ? -41.187 -13.806 62.402  1.00 20.54  ? 67  HIS A CE1 1 
ATOM   558  N NE2 . HIS A 1 67  ? -41.171 -13.765 61.061  1.00 20.69  ? 67  HIS A NE2 1 
ATOM   559  N N   . LYS A 1 68  ? -42.091 -20.159 60.049  1.00 20.25  ? 68  LYS A N   1 
ATOM   560  C CA  . LYS A 1 68  ? -41.933 -21.591 60.007  1.00 22.37  ? 68  LYS A CA  1 
ATOM   561  C C   . LYS A 1 68  ? -40.571 -21.833 59.327  1.00 23.68  ? 68  LYS A C   1 
ATOM   562  O O   . LYS A 1 68  ? -40.459 -21.760 58.084  1.00 25.61  ? 68  LYS A O   1 
ATOM   563  C CB  . LYS A 1 68  ? -43.073 -22.209 59.192  1.00 23.27  ? 68  LYS A CB  1 
ATOM   564  C CG  . LYS A 1 68  ? -44.439 -21.991 59.750  1.00 25.80  ? 68  LYS A CG  1 
ATOM   565  C CD  . LYS A 1 68  ? -45.502 -22.633 58.888  1.00 31.52  ? 68  LYS A CD  1 
ATOM   566  C CE  . LYS A 1 68  ? -46.889 -22.391 59.429  1.00 32.10  ? 68  LYS A CE  1 
ATOM   567  N NZ  . LYS A 1 68  ? -47.217 -20.931 59.559  1.00 38.72  ? 68  LYS A NZ  1 
ATOM   568  N N   . ILE A 1 69  ? -39.551 -22.119 60.135  1.00 20.92  ? 69  ILE A N   1 
ATOM   569  C CA  . ILE A 1 69  ? -38.195 -22.269 59.632  1.00 20.42  ? 69  ILE A CA  1 
ATOM   570  C C   . ILE A 1 69  ? -37.776 -23.734 59.712  1.00 19.70  ? 69  ILE A C   1 
ATOM   571  O O   . ILE A 1 69  ? -38.129 -24.442 60.648  1.00 21.81  ? 69  ILE A O   1 
ATOM   572  C CB  . ILE A 1 69  ? -37.183 -21.386 60.403  1.00 20.70  ? 69  ILE A CB  1 
ATOM   573  C CG1 . ILE A 1 69  ? -37.675 -19.939 60.465  1.00 18.59  ? 69  ILE A CG1 1 
ATOM   574  C CG2 . ILE A 1 69  ? -35.838 -21.400 59.667  1.00 20.33  ? 69  ILE A CG2 1 
ATOM   575  C CD1 . ILE A 1 69  ? -38.287 -19.591 61.748  1.00 16.97  ? 69  ILE A CD1 1 
ATOM   576  N N   . THR A 1 70  ? -36.991 -24.168 58.725  1.00 17.59  ? 70  THR A N   1 
ATOM   577  C CA  . THR A 1 70  ? -36.395 -25.501 58.692  1.00 16.21  ? 70  THR A CA  1 
ATOM   578  C C   . THR A 1 70  ? -34.905 -25.308 58.466  1.00 16.12  ? 70  THR A C   1 
ATOM   579  O O   . THR A 1 70  ? -34.446 -24.195 58.280  1.00 14.42  ? 70  THR A O   1 
ATOM   580  C CB  . THR A 1 70  ? -36.995 -26.364 57.534  1.00 16.30  ? 70  THR A CB  1 
ATOM   581  O OG1 . THR A 1 70  ? -37.154 -25.585 56.341  1.00 18.27  ? 70  THR A OG1 1 
ATOM   582  C CG2 . THR A 1 70  ? -38.341 -26.899 57.933  1.00 13.23  ? 70  THR A CG2 1 
ATOM   583  N N   . GLN A 1 71  ? -34.157 -26.418 58.498  1.00 16.41  ? 71  GLN A N   1 
ATOM   584  C CA  . GLN A 1 71  ? -32.705 -26.398 58.380  1.00 14.66  ? 71  GLN A CA  1 
ATOM   585  C C   . GLN A 1 71  ? -32.045 -25.928 59.678  1.00 10.54  ? 71  GLN A C   1 
ATOM   586  O O   . GLN A 1 71  ? -32.237 -24.769 60.076  1.00 6.16   ? 71  GLN A O   1 
ATOM   587  C CB  . GLN A 1 71  ? -32.229 -25.522 57.213  1.00 15.02  ? 71  GLN A CB  1 
ATOM   588  C CG  . GLN A 1 71  ? -32.595 -26.029 55.827  1.00 16.45  ? 71  GLN A CG  1 
ATOM   589  C CD  . GLN A 1 71  ? -31.854 -27.301 55.458  1.00 15.69  ? 71  GLN A CD  1 
ATOM   590  O OE1 . GLN A 1 71  ? -30.802 -27.601 56.004  1.00 14.77  ? 71  GLN A OE1 1 
ATOM   591  N NE2 . GLN A 1 71  ? -32.424 -28.051 54.534  1.00 15.72  ? 71  GLN A NE2 1 
ATOM   592  N N   . SER A 1 72  ? -31.285 -26.833 60.314  1.00 14.08  ? 72  SER A N   1 
ATOM   593  C CA  . SER A 1 72  ? -30.592 -26.601 61.604  1.00 14.93  ? 72  SER A CA  1 
ATOM   594  C C   . SER A 1 72  ? -29.930 -25.213 61.703  1.00 14.85  ? 72  SER A C   1 
ATOM   595  O O   . SER A 1 72  ? -30.261 -24.427 62.601  1.00 11.65  ? 72  SER A O   1 
ATOM   596  C CB  . SER A 1 72  ? -29.527 -27.670 61.816  1.00 16.61  ? 72  SER A CB  1 
ATOM   597  O OG  . SER A 1 72  ? -30.130 -28.943 61.815  1.00 19.79  ? 72  SER A OG  1 
ATOM   598  N N   . ASN A 1 73  ? -29.057 -24.890 60.745  1.00 11.23  ? 73  ASN A N   1 
ATOM   599  C CA  . ASN A 1 73  ? -28.331 -23.640 60.783  1.00 8.50   ? 73  ASN A CA  1 
ATOM   600  C C   . ASN A 1 73  ? -29.234 -22.456 60.663  1.00 8.21   ? 73  ASN A C   1 
ATOM   601  O O   . ASN A 1 73  ? -28.995 -21.466 61.286  1.00 10.35  ? 73  ASN A O   1 
ATOM   602  C CB  . ASN A 1 73  ? -27.302 -23.591 59.668  1.00 8.91   ? 73  ASN A CB  1 
ATOM   603  C CG  . ASN A 1 73  ? -26.155 -24.597 59.903  1.00 6.56   ? 73  ASN A CG  1 
ATOM   604  O OD1 . ASN A 1 73  ? -25.802 -24.899 61.022  1.00 7.60   ? 73  ASN A OD1 1 
ATOM   605  N ND2 . ASN A 1 73  ? -25.578 -25.091 58.824  1.00 2.00   ? 73  ASN A ND2 1 
ATOM   606  N N   . ALA A 1 74  ? -30.311 -22.576 59.898  1.00 9.45   ? 74  ALA A N   1 
ATOM   607  C CA  . ALA A 1 74  ? -31.297 -21.481 59.785  1.00 7.16   ? 74  ALA A CA  1 
ATOM   608  C C   . ALA A 1 74  ? -32.110 -21.273 61.105  1.00 5.69   ? 74  ALA A C   1 
ATOM   609  O O   . ALA A 1 74  ? -32.394 -20.123 61.525  1.00 7.42   ? 74  ALA A O   1 
ATOM   610  C CB  . ALA A 1 74  ? -32.234 -21.768 58.670  1.00 5.56   ? 74  ALA A CB  1 
ATOM   611  N N   . ILE A 1 75  ? -32.440 -22.387 61.768  1.00 5.51   ? 75  ILE A N   1 
ATOM   612  C CA  . ILE A 1 75  ? -33.130 -22.324 63.045  1.00 8.10   ? 75  ILE A CA  1 
ATOM   613  C C   . ILE A 1 75  ? -32.232 -21.683 64.119  1.00 9.71   ? 75  ILE A C   1 
ATOM   614  O O   . ILE A 1 75  ? -32.699 -20.844 64.910  1.00 11.56  ? 75  ILE A O   1 
ATOM   615  C CB  . ILE A 1 75  ? -33.542 -23.723 63.508  1.00 7.24   ? 75  ILE A CB  1 
ATOM   616  C CG1 . ILE A 1 75  ? -34.451 -24.366 62.470  1.00 3.56   ? 75  ILE A CG1 1 
ATOM   617  C CG2 . ILE A 1 75  ? -34.243 -23.633 64.837  1.00 3.95   ? 75  ILE A CG2 1 
ATOM   618  C CD1 . ILE A 1 75  ? -34.929 -25.732 62.826  1.00 2.00   ? 75  ILE A CD1 1 
ATOM   619  N N   . LEU A 1 76  ? -30.959 -22.086 64.157  1.00 9.58   ? 76  LEU A N   1 
ATOM   620  C CA  . LEU A 1 76  ? -30.015 -21.548 65.134  1.00 9.10   ? 76  LEU A CA  1 
ATOM   621  C C   . LEU A 1 76  ? -29.770 -20.070 64.889  1.00 7.54   ? 76  LEU A C   1 
ATOM   622  O O   . LEU A 1 76  ? -29.774 -19.295 65.804  1.00 8.26   ? 76  LEU A O   1 
ATOM   623  C CB  . LEU A 1 76  ? -28.695 -22.324 65.120  1.00 7.64   ? 76  LEU A CB  1 
ATOM   624  C CG  . LEU A 1 76  ? -28.701 -23.732 65.706  1.00 5.25   ? 76  LEU A CG  1 
ATOM   625  C CD1 . LEU A 1 76  ? -27.404 -24.400 65.376  1.00 10.79  ? 76  LEU A CD1 1 
ATOM   626  C CD2 . LEU A 1 76  ? -28.906 -23.697 67.181  1.00 4.15   ? 76  LEU A CD2 1 
ATOM   627  N N   . ARG A 1 77  ? -29.559 -19.685 63.633  1.00 7.40   ? 77  ARG A N   1 
ATOM   628  C CA  . ARG A 1 77  ? -29.330 -18.289 63.304  1.00 10.23  ? 77  ARG A CA  1 
ATOM   629  C C   . ARG A 1 77  ? -30.532 -17.412 63.587  1.00 9.99   ? 77  ARG A C   1 
ATOM   630  O O   . ARG A 1 77  ? -30.381 -16.244 63.898  1.00 9.41   ? 77  ARG A O   1 
ATOM   631  C CB  . ARG A 1 77  ? -28.973 -18.158 61.829  1.00 12.43  ? 77  ARG A CB  1 
ATOM   632  C CG  . ARG A 1 77  ? -27.551 -18.568 61.474  1.00 16.17  ? 77  ARG A CG  1 
ATOM   633  C CD  . ARG A 1 77  ? -27.320 -18.500 59.983  1.00 17.62  ? 77  ARG A CD  1 
ATOM   634  N NE  . ARG A 1 77  ? -25.907 -18.595 59.628  1.00 15.10  ? 77  ARG A NE  1 
ATOM   635  C CZ  . ARG A 1 77  ? -25.017 -17.617 59.755  1.00 17.26  ? 77  ARG A CZ  1 
ATOM   636  N NH1 . ARG A 1 77  ? -25.365 -16.434 60.231  1.00 14.87  ? 77  ARG A NH1 1 
ATOM   637  N NH2 . ARG A 1 77  ? -23.758 -17.827 59.402  1.00 18.39  ? 77  ARG A NH2 1 
ATOM   638  N N   . TYR A 1 78  ? -31.726 -17.988 63.502  1.00 11.73  ? 78  TYR A N   1 
ATOM   639  C CA  . TYR A 1 78  ? -32.961 -17.271 63.819  1.00 15.52  ? 78  TYR A CA  1 
ATOM   640  C C   . TYR A 1 78  ? -33.069 -16.929 65.314  1.00 15.15  ? 78  TYR A C   1 
ATOM   641  O O   . TYR A 1 78  ? -33.256 -15.765 65.704  1.00 17.36  ? 78  TYR A O   1 
ATOM   642  C CB  . TYR A 1 78  ? -34.187 -18.089 63.366  1.00 15.84  ? 78  TYR A CB  1 
ATOM   643  C CG  . TYR A 1 78  ? -35.494 -17.492 63.817  1.00 16.12  ? 78  TYR A CG  1 
ATOM   644  C CD1 . TYR A 1 78  ? -35.871 -16.205 63.364  1.00 15.57  ? 78  TYR A CD1 1 
ATOM   645  C CD2 . TYR A 1 78  ? -36.348 -18.186 64.716  1.00 15.79  ? 78  TYR A CD2 1 
ATOM   646  C CE1 . TYR A 1 78  ? -37.081 -15.595 63.802  1.00 17.43  ? 78  TYR A CE1 1 
ATOM   647  C CE2 . TYR A 1 78  ? -37.571 -17.603 65.163  1.00 17.63  ? 78  TYR A CE2 1 
ATOM   648  C CZ  . TYR A 1 78  ? -37.923 -16.299 64.700  1.00 16.57  ? 78  TYR A CZ  1 
ATOM   649  O OH  . TYR A 1 78  ? -39.108 -15.697 65.089  1.00 14.42  ? 78  TYR A OH  1 
ATOM   650  N N   . ILE A 1 79  ? -32.944 -17.965 66.147  1.00 15.65  ? 79  ILE A N   1 
ATOM   651  C CA  . ILE A 1 79  ? -32.992 -17.802 67.589  1.00 18.68  ? 79  ILE A CA  1 
ATOM   652  C C   . ILE A 1 79  ? -31.833 -16.939 68.091  1.00 17.81  ? 79  ILE A C   1 
ATOM   653  O O   . ILE A 1 79  ? -32.006 -16.149 68.996  1.00 16.40  ? 79  ILE A O   1 
ATOM   654  C CB  . ILE A 1 79  ? -32.941 -19.164 68.300  1.00 20.63  ? 79  ILE A CB  1 
ATOM   655  C CG1 . ILE A 1 79  ? -34.041 -20.082 67.762  1.00 22.04  ? 79  ILE A CG1 1 
ATOM   656  C CG2 . ILE A 1 79  ? -33.131 -18.975 69.784  1.00 21.43  ? 79  ILE A CG2 1 
ATOM   657  C CD1 . ILE A 1 79  ? -33.969 -21.507 68.281  1.00 24.65  ? 79  ILE A CD1 1 
ATOM   658  N N   . ALA A 1 80  ? -30.663 -17.103 67.473  1.00 18.20  ? 80  ALA A N   1 
ATOM   659  C CA  . ALA A 1 80  ? -29.474 -16.342 67.812  1.00 18.63  ? 80  ALA A CA  1 
ATOM   660  C C   . ALA A 1 80  ? -29.710 -14.856 67.591  1.00 18.21  ? 80  ALA A C   1 
ATOM   661  O O   . ALA A 1 80  ? -29.460 -14.041 68.451  1.00 18.85  ? 80  ALA A O   1 
ATOM   662  C CB  . ALA A 1 80  ? -28.323 -16.823 66.982  1.00 12.75  ? 80  ALA A CB  1 
ATOM   663  N N   . ARG A 1 81  ? -30.214 -14.508 66.411  1.00 21.22  ? 81  ARG A N   1 
ATOM   664  C CA  . ARG A 1 81  ? -30.502 -13.119 66.088  1.00 19.45  ? 81  ARG A CA  1 
ATOM   665  C C   . ARG A 1 81  ? -31.565 -12.607 67.033  1.00 20.64  ? 81  ARG A C   1 
ATOM   666  O O   . ARG A 1 81  ? -31.474 -11.500 67.534  1.00 17.65  ? 81  ARG A O   1 
ATOM   667  C CB  . ARG A 1 81  ? -30.939 -13.003 64.614  1.00 15.62  ? 81  ARG A CB  1 
ATOM   668  C CG  . ARG A 1 81  ? -29.808 -12.737 63.656  1.00 12.50  ? 81  ARG A CG  1 
ATOM   669  C CD  . ARG A 1 81  ? -30.301 -12.685 62.246  1.00 14.55  ? 81  ARG A CD  1 
ATOM   670  N NE  . ARG A 1 81  ? -30.620 -14.020 61.734  1.00 14.53  ? 81  ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 81  ? -31.753 -14.344 61.115  1.00 13.68  ? 81  ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 81  ? -32.666 -13.427 60.870  1.00 11.93  ? 81  ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 81  ? -31.976 -15.594 60.749  1.00 11.05  ? 81  ARG A NH2 1 
ATOM   674  N N   . LYS A 1 82  ? -32.566 -13.434 67.301  1.00 23.04  ? 82  LYS A N   1 
ATOM   675  C CA  . LYS A 1 82  ? -33.658 -13.064 68.189  1.00 26.24  ? 82  LYS A CA  1 
ATOM   676  C C   . LYS A 1 82  ? -33.191 -12.722 69.589  1.00 29.17  ? 82  LYS A C   1 
ATOM   677  O O   . LYS A 1 82  ? -33.902 -12.057 70.318  1.00 33.15  ? 82  LYS A O   1 
ATOM   678  C CB  . LYS A 1 82  ? -34.709 -14.183 68.242  1.00 27.11  ? 82  LYS A CB  1 
ATOM   679  C CG  . LYS A 1 82  ? -35.937 -13.910 69.091  1.00 29.78  ? 82  LYS A CG  1 
ATOM   680  C CD  . LYS A 1 82  ? -37.086 -14.866 68.803  1.00 29.40  ? 82  LYS A CD  1 
ATOM   681  C CE  . LYS A 1 82  ? -36.659 -16.331 68.912  1.00 33.27  ? 82  LYS A CE  1 
ATOM   682  N NZ  . LYS A 1 82  ? -36.094 -16.695 70.271  1.00 37.04  ? 82  LYS A NZ  1 
ATOM   683  N N   . HIS A 1 83  ? -32.011 -13.207 69.950  1.00 31.55  ? 83  HIS A N   1 
ATOM   684  C CA  . HIS A 1 83  ? -31.464 -12.975 71.280  1.00 29.50  ? 83  HIS A CA  1 
ATOM   685  C C   . HIS A 1 83  ? -30.087 -12.335 71.228  1.00 30.68  ? 83  HIS A C   1 
ATOM   686  O O   . HIS A 1 83  ? -29.376 -12.306 72.209  1.00 33.60  ? 83  HIS A O   1 
ATOM   687  C CB  . HIS A 1 83  ? -31.396 -14.299 72.054  1.00 31.04  ? 83  HIS A CB  1 
ATOM   688  C CG  . HIS A 1 83  ? -32.728 -14.931 72.306  1.00 33.87  ? 83  HIS A CG  1 
ATOM   689  N ND1 . HIS A 1 83  ? -33.694 -14.361 73.137  1.00 34.34  ? 83  HIS A ND1 1 
ATOM   690  C CD2 . HIS A 1 83  ? -33.278 -16.080 71.849  1.00 35.70  ? 83  HIS A CD2 1 
ATOM   691  C CE1 . HIS A 1 83  ? -34.748 -15.141 73.170  1.00 33.44  ? 83  HIS A CE1 1 
ATOM   692  N NE2 . HIS A 1 83  ? -34.534 -16.189 72.404  1.00 33.20  ? 83  HIS A NE2 1 
ATOM   693  N N   . ASN A 1 84  ? -29.739 -11.803 70.060  1.00 32.56  ? 84  ASN A N   1 
ATOM   694  C CA  . ASN A 1 84  ? -28.450 -11.127 69.862  1.00 33.56  ? 84  ASN A CA  1 
ATOM   695  C C   . ASN A 1 84  ? -27.177 -11.990 70.085  1.00 30.68  ? 84  ASN A C   1 
ATOM   696  O O   . ASN A 1 84  ? -26.089 -11.476 70.358  1.00 30.08  ? 84  ASN A O   1 
ATOM   697  C CB  . ASN A 1 84  ? -28.407 -9.824  70.673  1.00 37.62  ? 84  ASN A CB  1 
ATOM   698  C CG  . ASN A 1 84  ? -27.283 -8.864  70.227  1.00 44.08  ? 84  ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 84  ? -26.736 -8.115  71.048  1.00 48.99  ? 84  ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 84  ? -26.915 -8.920  68.935  1.00 47.33  ? 84  ASN A ND2 1 
ATOM   701  N N   . LEU A 1 85  ? -27.310 -13.292 69.967  1.00 26.08  ? 85  LEU A N   1 
ATOM   702  C CA  . LEU A 1 85  ? -26.187 -14.206 70.150  1.00 22.84  ? 85  LEU A CA  1 
ATOM   703  C C   . LEU A 1 85  ? -25.411 -14.490 68.851  1.00 23.16  ? 85  LEU A C   1 
ATOM   704  O O   . LEU A 1 85  ? -25.095 -15.636 68.532  1.00 21.26  ? 85  LEU A O   1 
ATOM   705  C CB  . LEU A 1 85  ? -26.683 -15.512 70.793  1.00 19.06  ? 85  LEU A CB  1 
ATOM   706  C CG  . LEU A 1 85  ? -27.389 -15.407 72.147  1.00 12.33  ? 85  LEU A CG  1 
ATOM   707  C CD1 . LEU A 1 85  ? -27.832 -16.735 72.601  1.00 10.22  ? 85  LEU A CD1 1 
ATOM   708  C CD2 . LEU A 1 85  ? -26.484 -14.799 73.103  1.00 11.82  ? 85  LEU A CD2 1 
ATOM   709  N N   . CYS A 1 86  ? -25.080 -13.423 68.128  1.00 24.83  ? 86  CYS A N   1 
ATOM   710  C CA  . CYS A 1 86  ? -24.367 -13.551 66.861  1.00 26.46  ? 86  CYS A CA  1 
ATOM   711  C C   . CYS A 1 86  ? -23.154 -12.638 66.866  1.00 26.54  ? 86  CYS A C   1 
ATOM   712  O O   . CYS A 1 86  ? -23.045 -11.774 67.730  1.00 30.56  ? 86  CYS A O   1 
ATOM   713  C CB  . CYS A 1 86  ? -25.262 -13.143 65.696  1.00 26.53  ? 86  CYS A CB  1 
ATOM   714  S SG  . CYS A 1 86  ? -26.675 -14.148 65.442  1.00 30.95  ? 86  CYS A SG  1 
ATOM   715  N N   . GLY A 1 87  ? -22.260 -12.814 65.888  1.00 24.10  ? 87  GLY A N   1 
ATOM   716  C CA  . GLY A 1 87  ? -21.091 -11.956 65.779  1.00 26.29  ? 87  GLY A CA  1 
ATOM   717  C C   . GLY A 1 87  ? -21.500 -10.610 65.235  1.00 28.26  ? 87  GLY A C   1 
ATOM   718  O O   . GLY A 1 87  ? -22.380 -10.548 64.361  1.00 31.23  ? 87  GLY A O   1 
ATOM   719  N N   . GLU A 1 88  ? -20.879 -9.537  65.730  1.00 29.56  ? 88  GLU A N   1 
ATOM   720  C CA  . GLU A 1 88  ? -21.210 -8.191  65.278  1.00 30.82  ? 88  GLU A CA  1 
ATOM   721  C C   . GLU A 1 88  ? -20.218 -7.659  64.280  1.00 29.33  ? 88  GLU A C   1 
ATOM   722  O O   . GLU A 1 88  ? -20.575 -7.300  63.174  1.00 29.77  ? 88  GLU A O   1 
ATOM   723  C CB  . GLU A 1 88  ? -21.330 -7.220  66.449  1.00 31.68  ? 88  GLU A CB  1 
ATOM   724  C CG  . GLU A 1 88  ? -22.458 -7.593  67.423  1.00 35.31  ? 88  GLU A CG  1 
ATOM   725  C CD  . GLU A 1 88  ? -22.539 -6.670  68.636  1.00 39.86  ? 88  GLU A CD  1 
ATOM   726  O OE1 . GLU A 1 88  ? -21.519 -6.497  69.358  1.00 42.45  ? 88  GLU A OE1 1 
ATOM   727  O OE2 . GLU A 1 88  ? -23.632 -6.095  68.847  1.00 40.89  ? 88  GLU A OE2 1 
ATOM   728  N N   . SER A 1 89  ? -18.946 -7.618  64.657  1.00 28.56  ? 89  SER A N   1 
ATOM   729  C CA  . SER A 1 89  ? -17.916 -7.112  63.747  1.00 27.26  ? 89  SER A CA  1 
ATOM   730  C C   . SER A 1 89  ? -17.604 -8.107  62.606  1.00 25.40  ? 89  SER A C   1 
ATOM   731  O O   . SER A 1 89  ? -17.701 -9.326  62.788  1.00 22.90  ? 89  SER A O   1 
ATOM   732  C CB  . SER A 1 89  ? -16.629 -6.800  64.534  1.00 25.88  ? 89  SER A CB  1 
ATOM   733  O OG  . SER A 1 89  ? -16.054 -7.970  65.108  1.00 26.98  ? 89  SER A OG  1 
ATOM   734  N N   . GLU A 1 90  ? -17.216 -7.579  61.445  1.00 25.85  ? 90  GLU A N   1 
ATOM   735  C CA  . GLU A 1 90  ? -16.873 -8.387  60.284  1.00 28.54  ? 90  GLU A CA  1 
ATOM   736  C C   . GLU A 1 90  ? -15.962 -9.571  60.633  1.00 28.56  ? 90  GLU A C   1 
ATOM   737  O O   . GLU A 1 90  ? -16.119 -10.667 60.106  1.00 28.19  ? 90  GLU A O   1 
ATOM   738  C CB  . GLU A 1 90  ? -16.217 -7.507  59.224  1.00 30.40  ? 90  GLU A CB  1 
ATOM   739  C CG  . GLU A 1 90  ? -15.797 -8.261  57.971  1.00 32.57  ? 90  GLU A CG  1 
ATOM   740  C CD  . GLU A 1 90  ? -15.087 -7.360  56.977  1.00 35.31  ? 90  GLU A CD  1 
ATOM   741  O OE1 . GLU A 1 90  ? -13.948 -6.886  57.293  1.00 32.76  ? 90  GLU A OE1 1 
ATOM   742  O OE2 . GLU A 1 90  ? -15.686 -7.136  55.883  1.00 43.43  ? 90  GLU A OE2 1 
ATOM   743  N N   . LYS A 1 91  ? -15.030 -9.350  61.549  1.00 28.37  ? 91  LYS A N   1 
ATOM   744  C CA  . LYS A 1 91  ? -14.088 -10.383 61.952  1.00 25.87  ? 91  LYS A CA  1 
ATOM   745  C C   . LYS A 1 91  ? -14.843 -11.520 62.639  1.00 24.01  ? 91  LYS A C   1 
ATOM   746  O O   . LYS A 1 91  ? -14.657 -12.691 62.299  1.00 21.10  ? 91  LYS A O   1 
ATOM   747  C CB  . LYS A 1 91  ? -13.033 -9.792  62.890  1.00 29.58  ? 91  LYS A CB  1 
ATOM   748  C CG  . LYS A 1 91  ? -11.980 -8.925  62.177  1.00 33.72  ? 91  LYS A CG  1 
ATOM   749  C CD  . LYS A 1 91  ? -12.579 -7.646  61.568  1.00 36.44  ? 91  LYS A CD  1 
ATOM   750  C CE  . LYS A 1 91  ? -11.606 -6.964  60.626  1.00 39.14  ? 91  LYS A CE  1 
ATOM   751  N NZ  . LYS A 1 91  ? -12.263 -5.822  59.892  1.00 39.88  ? 91  LYS A NZ  1 
ATOM   752  N N   . GLU A 1 92  ? -15.713 -11.167 63.581  1.00 21.06  ? 92  GLU A N   1 
ATOM   753  C CA  . GLU A 1 92  ? -16.500 -12.158 64.283  1.00 19.07  ? 92  GLU A CA  1 
ATOM   754  C C   . GLU A 1 92  ? -17.379 -12.902 63.299  1.00 17.67  ? 92  GLU A C   1 
ATOM   755  O O   . GLU A 1 92  ? -17.494 -14.119 63.378  1.00 17.31  ? 92  GLU A O   1 
ATOM   756  C CB  . GLU A 1 92  ? -17.354 -11.499 65.348  1.00 20.98  ? 92  GLU A CB  1 
ATOM   757  C CG  . GLU A 1 92  ? -16.545 -10.824 66.425  1.00 22.60  ? 92  GLU A CG  1 
ATOM   758  C CD  . GLU A 1 92  ? -17.421 -10.130 67.460  1.00 24.01  ? 92  GLU A CD  1 
ATOM   759  O OE1 . GLU A 1 92  ? -18.195 -9.215  67.077  1.00 24.84  ? 92  GLU A OE1 1 
ATOM   760  O OE2 . GLU A 1 92  ? -17.342 -10.499 68.660  1.00 28.44  ? 92  GLU A OE2 1 
ATOM   761  N N   . GLN A 1 93  ? -17.974 -12.165 62.366  1.00 18.26  ? 93  GLN A N   1 
ATOM   762  C CA  . GLN A 1 93  ? -18.850 -12.732 61.342  1.00 14.51  ? 93  GLN A CA  1 
ATOM   763  C C   . GLN A 1 93  ? -18.126 -13.729 60.443  1.00 12.99  ? 93  GLN A C   1 
ATOM   764  O O   . GLN A 1 93  ? -18.645 -14.795 60.152  1.00 10.16  ? 93  GLN A O   1 
ATOM   765  C CB  . GLN A 1 93  ? -19.465 -11.616 60.510  1.00 11.34  ? 93  GLN A CB  1 
ATOM   766  C CG  . GLN A 1 93  ? -20.400 -10.736 61.320  1.00 16.08  ? 93  GLN A CG  1 
ATOM   767  C CD  . GLN A 1 93  ? -20.853 -9.491  60.598  1.00 19.48  ? 93  GLN A CD  1 
ATOM   768  O OE1 . GLN A 1 93  ? -20.068 -8.804  59.941  1.00 21.53  ? 93  GLN A OE1 1 
ATOM   769  N NE2 . GLN A 1 93  ? -22.139 -9.188  60.724  1.00 17.23  ? 93  GLN A NE2 1 
ATOM   770  N N   . ILE A 1 94  ? -16.889 -13.413 60.067  1.00 11.78  ? 94  ILE A N   1 
ATOM   771  C CA  . ILE A 1 94  ? -16.080 -14.335 59.284  1.00 11.60  ? 94  ILE A CA  1 
ATOM   772  C C   . ILE A 1 94  ? -15.834 -15.637 60.044  1.00 13.34  ? 94  ILE A C   1 
ATOM   773  O O   . ILE A 1 94  ? -15.975 -16.709 59.466  1.00 16.07  ? 94  ILE A O   1 
ATOM   774  C CB  . ILE A 1 94  ? -14.716 -13.712 58.835  1.00 9.38   ? 94  ILE A CB  1 
ATOM   775  C CG1 . ILE A 1 94  ? -14.960 -12.500 57.927  1.00 11.87  ? 94  ILE A CG1 1 
ATOM   776  C CG2 . ILE A 1 94  ? -13.905 -14.740 58.069  1.00 6.91   ? 94  ILE A CG2 1 
ATOM   777  C CD1 . ILE A 1 94  ? -13.721 -11.792 57.492  1.00 13.45  ? 94  ILE A CD1 1 
ATOM   778  N N   . ARG A 1 95  ? -15.463 -15.522 61.329  1.00 13.37  ? 95  ARG A N   1 
ATOM   779  C CA  . ARG A 1 95  ? -15.223 -16.690 62.163  1.00 12.36  ? 95  ARG A CA  1 
ATOM   780  C C   . ARG A 1 95  ? -16.491 -17.515 62.253  1.00 10.56  ? 95  ARG A C   1 
ATOM   781  O O   . ARG A 1 95  ? -16.479 -18.725 62.088  1.00 6.71   ? 95  ARG A O   1 
ATOM   782  C CB  . ARG A 1 95  ? -14.835 -16.249 63.558  1.00 18.12  ? 95  ARG A CB  1 
ATOM   783  C CG  . ARG A 1 95  ? -13.399 -15.834 63.711  1.00 22.55  ? 95  ARG A CG  1 
ATOM   784  C CD  . ARG A 1 95  ? -13.086 -15.557 65.185  1.00 24.52  ? 95  ARG A CD  1 
ATOM   785  N NE  . ARG A 1 95  ? -11.662 -15.697 65.482  1.00 26.70  ? 95  ARG A NE  1 
ATOM   786  C CZ  . ARG A 1 95  ? -11.123 -16.661 66.232  1.00 27.72  ? 95  ARG A CZ  1 
ATOM   787  N NH1 . ARG A 1 95  ? -11.901 -17.582 66.804  1.00 25.95  ? 95  ARG A NH1 1 
ATOM   788  N NH2 . ARG A 1 95  ? -9.804  -16.696 66.406  1.00 31.56  ? 95  ARG A NH2 1 
ATOM   789  N N   . GLU A 1 96  ? -17.604 -16.819 62.481  1.00 9.98   ? 96  GLU A N   1 
ATOM   790  C CA  . GLU A 1 96  ? -18.931 -17.416 62.613  1.00 12.13  ? 96  GLU A CA  1 
ATOM   791  C C   . GLU A 1 96  ? -19.325 -18.247 61.381  1.00 13.18  ? 96  GLU A C   1 
ATOM   792  O O   . GLU A 1 96  ? -19.846 -19.351 61.534  1.00 12.47  ? 96  GLU A O   1 
ATOM   793  C CB  . GLU A 1 96  ? -19.934 -16.283 62.839  1.00 13.24  ? 96  GLU A CB  1 
ATOM   794  C CG  . GLU A 1 96  ? -21.338 -16.698 63.009  1.00 17.30  ? 96  GLU A CG  1 
ATOM   795  C CD  . GLU A 1 96  ? -22.177 -15.553 63.493  1.00 17.81  ? 96  GLU A CD  1 
ATOM   796  O OE1 . GLU A 1 96  ? -22.635 -14.774 62.621  1.00 14.62  ? 96  GLU A OE1 1 
ATOM   797  O OE2 . GLU A 1 96  ? -22.405 -15.461 64.730  1.00 23.78  ? 96  GLU A OE2 1 
ATOM   798  N N   . ASP A 1 97  ? -19.077 -17.699 60.195  1.00 13.48  ? 97  ASP A N   1 
ATOM   799  C CA  . ASP A 1 97  ? -19.405 -18.337 58.932  1.00 11.89  ? 97  ASP A CA  1 
ATOM   800  C C   . ASP A 1 97  ? -18.515 -19.533 58.659  1.00 11.72  ? 97  ASP A C   1 
ATOM   801  O O   . ASP A 1 97  ? -19.008 -20.620 58.422  1.00 14.46  ? 97  ASP A O   1 
ATOM   802  C CB  . ASP A 1 97  ? -19.261 -17.353 57.786  1.00 11.00  ? 97  ASP A CB  1 
ATOM   803  C CG  . ASP A 1 97  ? -20.301 -16.275 57.825  1.00 6.48   ? 97  ASP A CG  1 
ATOM   804  O OD1 . ASP A 1 97  ? -21.253 -16.376 58.603  1.00 8.76   ? 97  ASP A OD1 1 
ATOM   805  O OD2 . ASP A 1 97  ? -20.152 -15.301 57.058  1.00 4.87   ? 97  ASP A OD2 1 
ATOM   806  N N   . ILE A 1 98  ? -17.197 -19.341 58.739  1.00 11.69  ? 98  ILE A N   1 
ATOM   807  C CA  . ILE A 1 98  ? -16.262 -20.445 58.508  1.00 14.47  ? 98  ILE A CA  1 
ATOM   808  C C   . ILE A 1 98  ? -16.545 -21.603 59.485  1.00 12.90  ? 98  ILE A C   1 
ATOM   809  O O   . ILE A 1 98  ? -16.597 -22.764 59.086  1.00 10.71  ? 98  ILE A O   1 
ATOM   810  C CB  . ILE A 1 98  ? -14.780 -19.983 58.674  1.00 16.52  ? 98  ILE A CB  1 
ATOM   811  C CG1 . ILE A 1 98  ? -14.490 -18.842 57.710  1.00 19.41  ? 98  ILE A CG1 1 
ATOM   812  C CG2 . ILE A 1 98  ? -13.825 -21.147 58.407  1.00 13.28  ? 98  ILE A CG2 1 
ATOM   813  C CD1 . ILE A 1 98  ? -13.099 -18.244 57.870  1.00 22.62  ? 98  ILE A CD1 1 
ATOM   814  N N   . LEU A 1 99  ? -16.712 -21.278 60.769  1.00 12.26  ? 99  LEU A N   1 
ATOM   815  C CA  . LEU A 1 99  ? -16.945 -22.278 61.799  1.00 11.80  ? 99  LEU A CA  1 
ATOM   816  C C   . LEU A 1 99  ? -18.241 -23.023 61.584  1.00 12.34  ? 99  LEU A C   1 
ATOM   817  O O   . LEU A 1 99  ? -18.238 -24.244 61.663  1.00 11.86  ? 99  LEU A O   1 
ATOM   818  C CB  . LEU A 1 99  ? -16.935 -21.642 63.190  1.00 13.50  ? 99  LEU A CB  1 
ATOM   819  C CG  . LEU A 1 99  ? -15.564 -21.404 63.835  1.00 12.36  ? 99  LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 99  ? -15.743 -20.661 65.128  1.00 11.20  ? 99  LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 99  ? -14.851 -22.698 64.049  1.00 10.52  ? 99  LEU A CD2 1 
ATOM   822  N N   . GLU A 1 100 ? -19.327 -22.294 61.310  1.00 12.86  ? 100 GLU A N   1 
ATOM   823  C CA  . GLU A 1 100 ? -20.640 -22.903 61.070  1.00 15.92  ? 100 GLU A CA  1 
ATOM   824  C C   . GLU A 1 100 ? -20.534 -23.996 60.009  1.00 15.45  ? 100 GLU A C   1 
ATOM   825  O O   . GLU A 1 100 ? -20.987 -25.119 60.220  1.00 15.85  ? 100 GLU A O   1 
ATOM   826  C CB  . GLU A 1 100 ? -21.658 -21.834 60.647  1.00 17.83  ? 100 GLU A CB  1 
ATOM   827  C CG  . GLU A 1 100 ? -23.044 -22.362 60.397  1.00 20.71  ? 100 GLU A CG  1 
ATOM   828  C CD  . GLU A 1 100 ? -23.987 -21.318 59.875  1.00 26.04  ? 100 GLU A CD  1 
ATOM   829  O OE1 . GLU A 1 100 ? -23.743 -20.729 58.809  1.00 24.86  ? 100 GLU A OE1 1 
ATOM   830  O OE2 . GLU A 1 100 ? -24.993 -21.080 60.549  1.00 29.18  ? 100 GLU A OE2 1 
ATOM   831  N N   . ASN A 1 101 ? -19.915 -23.659 58.885  1.00 13.06  ? 101 ASN A N   1 
ATOM   832  C CA  . ASN A 1 101 ? -19.718 -24.609 57.809  1.00 14.19  ? 101 ASN A CA  1 
ATOM   833  C C   . ASN A 1 101 ? -18.723 -25.733 58.209  1.00 12.62  ? 101 ASN A C   1 
ATOM   834  O O   . ASN A 1 101 ? -19.008 -26.928 58.061  1.00 9.23   ? 101 ASN A O   1 
ATOM   835  C CB  . ASN A 1 101 ? -19.192 -23.869 56.581  1.00 17.55  ? 101 ASN A CB  1 
ATOM   836  C CG  . ASN A 1 101 ? -20.248 -23.032 55.907  1.00 20.41  ? 101 ASN A CG  1 
ATOM   837  O OD1 . ASN A 1 101 ? -20.979 -23.500 55.038  1.00 25.02  ? 101 ASN A OD1 1 
ATOM   838  N ND2 . ASN A 1 101 ? -20.324 -21.781 56.296  1.00 17.22  ? 101 ASN A ND2 1 
ATOM   839  N N   . GLN A 1 102 ? -17.577 -25.330 58.738  1.00 12.20  ? 102 GLN A N   1 
ATOM   840  C CA  . GLN A 1 102 ? -16.539 -26.251 59.173  1.00 11.99  ? 102 GLN A CA  1 
ATOM   841  C C   . GLN A 1 102 ? -17.052 -27.290 60.148  1.00 12.92  ? 102 GLN A C   1 
ATOM   842  O O   . GLN A 1 102 ? -16.677 -28.450 60.057  1.00 13.29  ? 102 GLN A O   1 
ATOM   843  C CB  . GLN A 1 102 ? -15.380 -25.468 59.793  1.00 12.52  ? 102 GLN A CB  1 
ATOM   844  C CG  . GLN A 1 102 ? -14.121 -26.288 60.022  1.00 4.22   ? 102 GLN A CG  1 
ATOM   845  C CD  . GLN A 1 102 ? -13.524 -26.847 58.729  1.00 3.72   ? 102 GLN A CD  1 
ATOM   846  O OE1 . GLN A 1 102 ? -13.460 -26.171 57.709  1.00 6.37   ? 102 GLN A OE1 1 
ATOM   847  N NE2 . GLN A 1 102 ? -13.087 -28.089 58.788  1.00 6.48   ? 102 GLN A NE2 1 
ATOM   848  N N   . PHE A 1 103 ? -17.914 -26.871 61.073  1.00 15.63  ? 103 PHE A N   1 
ATOM   849  C CA  . PHE A 1 103 ? -18.467 -27.767 62.084  1.00 14.70  ? 103 PHE A CA  1 
ATOM   850  C C   . PHE A 1 103 ? -19.536 -28.708 61.506  1.00 14.40  ? 103 PHE A C   1 
ATOM   851  O O   . PHE A 1 103 ? -19.656 -29.870 61.932  1.00 16.38  ? 103 PHE A O   1 
ATOM   852  C CB  . PHE A 1 103 ? -19.070 -26.965 63.233  1.00 17.26  ? 103 PHE A CB  1 
ATOM   853  C CG  . PHE A 1 103 ? -18.072 -26.553 64.269  1.00 23.00  ? 103 PHE A CG  1 
ATOM   854  C CD1 . PHE A 1 103 ? -17.174 -27.479 64.805  1.00 25.82  ? 103 PHE A CD1 1 
ATOM   855  C CD2 . PHE A 1 103 ? -18.023 -25.230 64.702  1.00 24.09  ? 103 PHE A CD2 1 
ATOM   856  C CE1 . PHE A 1 103 ? -16.233 -27.089 65.767  1.00 24.38  ? 103 PHE A CE1 1 
ATOM   857  C CE2 . PHE A 1 103 ? -17.090 -24.827 65.651  1.00 25.08  ? 103 PHE A CE2 1 
ATOM   858  C CZ  . PHE A 1 103 ? -16.192 -25.761 66.187  1.00 24.77  ? 103 PHE A CZ  1 
ATOM   859  N N   . MET A 1 104 ? -20.267 -28.219 60.505  1.00 12.79  ? 104 MET A N   1 
ATOM   860  C CA  . MET A 1 104 ? -21.216 -29.059 59.784  1.00 10.54  ? 104 MET A CA  1 
ATOM   861  C C   . MET A 1 104 ? -20.422 -30.165 59.067  1.00 10.16  ? 104 MET A C   1 
ATOM   862  O O   . MET A 1 104 ? -20.852 -31.316 58.984  1.00 9.86   ? 104 MET A O   1 
ATOM   863  C CB  . MET A 1 104 ? -22.046 -28.211 58.802  1.00 9.04   ? 104 MET A CB  1 
ATOM   864  C CG  . MET A 1 104 ? -23.065 -29.005 57.995  1.00 9.76   ? 104 MET A CG  1 
ATOM   865  S SD  . MET A 1 104 ? -24.223 -29.959 59.051  1.00 12.20  ? 104 MET A SD  1 
ATOM   866  C CE  . MET A 1 104 ? -25.300 -28.602 59.501  1.00 14.72  ? 104 MET A CE  1 
ATOM   867  N N   . ASP A 1 105 ? -19.248 -29.798 58.559  1.00 11.91  ? 105 ASP A N   1 
ATOM   868  C CA  . ASP A 1 105 ? -18.382 -30.734 57.886  1.00 11.96  ? 105 ASP A CA  1 
ATOM   869  C C   . ASP A 1 105 ? -18.063 -31.901 58.788  1.00 10.26  ? 105 ASP A C   1 
ATOM   870  O O   . ASP A 1 105 ? -18.292 -33.045 58.416  1.00 9.39   ? 105 ASP A O   1 
ATOM   871  C CB  . ASP A 1 105 ? -17.106 -30.015 57.480  1.00 13.08  ? 105 ASP A CB  1 
ATOM   872  C CG  . ASP A 1 105 ? -16.728 -30.270 56.021  1.00 16.66  ? 105 ASP A CG  1 
ATOM   873  O OD1 . ASP A 1 105 ? -16.473 -31.455 55.660  1.00 20.58  ? 105 ASP A OD1 1 
ATOM   874  O OD2 . ASP A 1 105 ? -16.696 -29.272 55.244  1.00 19.01  ? 105 ASP A OD2 1 
ATOM   875  N N   . SER A 1 106 ? -17.542 -31.608 59.978  1.00 12.40  ? 106 SER A N   1 
ATOM   876  C CA  . SER A 1 106 ? -17.189 -32.636 60.944  1.00 12.67  ? 106 SER A CA  1 
ATOM   877  C C   . SER A 1 106 ? -18.368 -33.511 61.339  1.00 15.06  ? 106 SER A C   1 
ATOM   878  O O   . SER A 1 106 ? -18.214 -34.730 61.448  1.00 15.11  ? 106 SER A O   1 
ATOM   879  C CB  . SER A 1 106 ? -16.572 -31.988 62.181  1.00 11.69  ? 106 SER A CB  1 
ATOM   880  O OG  . SER A 1 106 ? -15.399 -31.285 61.818  1.00 5.52   ? 106 SER A OG  1 
ATOM   881  N N   . ARG A 1 107 ? -19.524 -32.876 61.529  1.00 18.45  ? 107 ARG A N   1 
ATOM   882  C CA  . ARG A 1 107 ? -20.758 -33.571 61.883  1.00 20.90  ? 107 ARG A CA  1 
ATOM   883  C C   . ARG A 1 107 ? -21.132 -34.639 60.852  1.00 21.86  ? 107 ARG A C   1 
ATOM   884  O O   . ARG A 1 107 ? -21.416 -35.803 61.183  1.00 20.62  ? 107 ARG A O   1 
ATOM   885  C CB  . ARG A 1 107 ? -21.903 -32.571 62.028  1.00 22.62  ? 107 ARG A CB  1 
ATOM   886  C CG  . ARG A 1 107 ? -23.259 -33.233 62.347  1.00 25.23  ? 107 ARG A CG  1 
ATOM   887  C CD  . ARG A 1 107 ? -24.347 -32.209 62.558  1.00 24.45  ? 107 ARG A CD  1 
ATOM   888  N NE  . ARG A 1 107 ? -24.261 -31.557 63.859  1.00 25.92  ? 107 ARG A NE  1 
ATOM   889  C CZ  . ARG A 1 107 ? -24.226 -30.237 64.029  1.00 29.62  ? 107 ARG A CZ  1 
ATOM   890  N NH1 . ARG A 1 107 ? -24.250 -29.405 62.986  1.00 31.04  ? 107 ARG A NH1 1 
ATOM   891  N NH2 . ARG A 1 107 ? -24.156 -29.747 65.255  1.00 29.99  ? 107 ARG A NH2 1 
ATOM   892  N N   . MET A 1 108 ? -21.109 -34.233 59.584  1.00 23.04  ? 108 MET A N   1 
ATOM   893  C CA  . MET A 1 108 ? -21.426 -35.135 58.487  1.00 23.71  ? 108 MET A CA  1 
ATOM   894  C C   . MET A 1 108 ? -20.400 -36.253 58.335  1.00 22.39  ? 108 MET A C   1 
ATOM   895  O O   . MET A 1 108 ? -20.736 -37.358 57.941  1.00 22.73  ? 108 MET A O   1 
ATOM   896  C CB  . MET A 1 108 ? -21.550 -34.352 57.179  1.00 24.80  ? 108 MET A CB  1 
ATOM   897  C CG  . MET A 1 108 ? -22.745 -33.401 57.130  1.00 29.09  ? 108 MET A CG  1 
ATOM   898  S SD  . MET A 1 108 ? -24.292 -34.232 57.554  1.00 33.03  ? 108 MET A SD  1 
ATOM   899  C CE  . MET A 1 108 ? -24.744 -33.422 59.049  1.00 33.64  ? 108 MET A CE  1 
ATOM   900  N N   . GLN A 1 109 ? -19.151 -35.944 58.672  1.00 22.73  ? 109 GLN A N   1 
ATOM   901  C CA  . GLN A 1 109 ? -18.074 -36.916 58.622  1.00 23.75  ? 109 GLN A CA  1 
ATOM   902  C C   . GLN A 1 109 ? -18.326 -38.061 59.588  1.00 23.08  ? 109 GLN A C   1 
ATOM   903  O O   . GLN A 1 109 ? -18.192 -39.221 59.215  1.00 22.09  ? 109 GLN A O   1 
ATOM   904  C CB  . GLN A 1 109 ? -16.763 -36.230 58.965  1.00 28.31  ? 109 GLN A CB  1 
ATOM   905  C CG  . GLN A 1 109 ? -15.518 -36.994 58.526  1.00 33.45  ? 109 GLN A CG  1 
ATOM   906  C CD  . GLN A 1 109 ? -14.232 -36.250 58.876  1.00 34.98  ? 109 GLN A CD  1 
ATOM   907  O OE1 . GLN A 1 109 ? -13.356 -36.785 59.576  1.00 35.37  ? 109 GLN A OE1 1 
ATOM   908  N NE2 . GLN A 1 109 ? -14.111 -35.008 58.393  1.00 38.02  ? 109 GLN A NE2 1 
ATOM   909  N N   . LEU A 1 110 ? -18.715 -37.735 60.818  1.00 22.11  ? 110 LEU A N   1 
ATOM   910  C CA  . LEU A 1 110 ? -19.019 -38.750 61.815  1.00 20.77  ? 110 LEU A CA  1 
ATOM   911  C C   . LEU A 1 110 ? -20.316 -39.470 61.451  1.00 22.11  ? 110 LEU A C   1 
ATOM   912  O O   . LEU A 1 110 ? -20.375 -40.709 61.535  1.00 23.62  ? 110 LEU A O   1 
ATOM   913  C CB  . LEU A 1 110 ? -19.115 -38.133 63.230  1.00 16.82  ? 110 LEU A CB  1 
ATOM   914  C CG  . LEU A 1 110 ? -19.428 -39.059 64.433  1.00 15.99  ? 110 LEU A CG  1 
ATOM   915  C CD1 . LEU A 1 110 ? -18.322 -40.076 64.617  1.00 15.88  ? 110 LEU A CD1 1 
ATOM   916  C CD2 . LEU A 1 110 ? -19.609 -38.267 65.676  1.00 10.29  ? 110 LEU A CD2 1 
ATOM   917  N N   . ALA A 1 111 ? -21.336 -38.699 61.066  1.00 21.78  ? 111 ALA A N   1 
ATOM   918  C CA  . ALA A 1 111 ? -22.633 -39.251 60.708  1.00 20.81  ? 111 ALA A CA  1 
ATOM   919  C C   . ALA A 1 111 ? -22.520 -40.372 59.676  1.00 20.49  ? 111 ALA A C   1 
ATOM   920  O O   . ALA A 1 111 ? -22.919 -41.494 59.936  1.00 21.23  ? 111 ALA A O   1 
ATOM   921  C CB  . ALA A 1 111 ? -23.527 -38.164 60.203  1.00 17.71  ? 111 ALA A CB  1 
ATOM   922  N N   . LYS A 1 112 ? -21.947 -40.056 58.512  1.00 20.66  ? 112 LYS A N   1 
ATOM   923  C CA  . LYS A 1 112 ? -21.793 -41.014 57.421  1.00 22.61  ? 112 LYS A CA  1 
ATOM   924  C C   . LYS A 1 112 ? -21.094 -42.285 57.896  1.00 22.43  ? 112 LYS A C   1 
ATOM   925  O O   . LYS A 1 112 ? -21.526 -43.397 57.567  1.00 23.61  ? 112 LYS A O   1 
ATOM   926  C CB  . LYS A 1 112 ? -21.000 -40.376 56.275  1.00 25.33  ? 112 LYS A CB  1 
ATOM   927  C CG  . LYS A 1 112 ? -20.821 -41.293 55.049  1.00 26.80  ? 112 LYS A CG  1 
ATOM   928  C CD  . LYS A 1 112 ? -20.151 -40.546 53.900  1.00 31.68  ? 112 LYS A CD  1 
ATOM   929  C CE  . LYS A 1 112 ? -18.726 -40.076 54.280  1.00 34.77  ? 112 LYS A CE  1 
ATOM   930  N NZ  . LYS A 1 112 ? -18.031 -39.439 53.128  1.00 37.00  ? 112 LYS A NZ  1 
ATOM   931  N N   . LEU A 1 113 ? -20.042 -42.108 58.699  1.00 22.08  ? 113 LEU A N   1 
ATOM   932  C CA  . LEU A 1 113 ? -19.283 -43.219 59.272  1.00 20.16  ? 113 LEU A CA  1 
ATOM   933  C C   . LEU A 1 113 ? -20.219 -44.109 60.075  1.00 20.94  ? 113 LEU A C   1 
ATOM   934  O O   . LEU A 1 113 ? -20.272 -45.312 59.868  1.00 21.14  ? 113 LEU A O   1 
ATOM   935  C CB  . LEU A 1 113 ? -18.143 -42.658 60.147  1.00 19.92  ? 113 LEU A CB  1 
ATOM   936  C CG  . LEU A 1 113 ? -17.130 -43.492 60.953  1.00 18.11  ? 113 LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 113 ? -17.689 -43.707 62.339  1.00 14.81  ? 113 LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 113 ? -16.843 -44.830 60.282  1.00 19.12  ? 113 LEU A CD2 1 
ATOM   939  N N   . CYS A 1 114 ? -20.942 -43.512 61.011  1.00 22.94  ? 114 CYS A N   1 
ATOM   940  C CA  . CYS A 1 114 ? -21.813 -44.258 61.894  1.00 24.26  ? 114 CYS A CA  1 
ATOM   941  C C   . CYS A 1 114 ? -22.991 -44.943 61.208  1.00 23.44  ? 114 CYS A C   1 
ATOM   942  O O   . CYS A 1 114 ? -23.591 -45.862 61.767  1.00 25.63  ? 114 CYS A O   1 
ATOM   943  C CB  . CYS A 1 114 ? -22.319 -43.346 63.000  1.00 23.47  ? 114 CYS A CB  1 
ATOM   944  S SG  . CYS A 1 114 ? -21.007 -42.693 64.021  1.00 19.74  ? 114 CYS A SG  1 
ATOM   945  N N   . TYR A 1 115 ? -23.331 -44.495 60.001  1.00 22.44  ? 115 TYR A N   1 
ATOM   946  C CA  . TYR A 1 115 ? -24.436 -45.097 59.272  1.00 20.36  ? 115 TYR A CA  1 
ATOM   947  C C   . TYR A 1 115 ? -23.939 -46.110 58.226  1.00 22.23  ? 115 TYR A C   1 
ATOM   948  O O   . TYR A 1 115 ? -24.708 -47.004 57.812  1.00 23.67  ? 115 TYR A O   1 
ATOM   949  C CB  . TYR A 1 115 ? -25.243 -44.018 58.574  1.00 11.40  ? 115 TYR A CB  1 
ATOM   950  C CG  . TYR A 1 115 ? -26.229 -43.313 59.465  1.00 8.73   ? 115 TYR A CG  1 
ATOM   951  C CD1 . TYR A 1 115 ? -27.525 -43.831 59.661  1.00 8.62   ? 115 TYR A CD1 1 
ATOM   952  C CD2 . TYR A 1 115 ? -25.869 -42.132 60.131  1.00 4.63   ? 115 TYR A CD2 1 
ATOM   953  C CE1 . TYR A 1 115 ? -28.485 -43.149 60.519  1.00 3.12   ? 115 TYR A CE1 1 
ATOM   954  C CE2 . TYR A 1 115 ? -26.807 -41.454 60.977  1.00 5.97   ? 115 TYR A CE2 1 
ATOM   955  C CZ  . TYR A 1 115 ? -28.105 -41.972 61.136  1.00 2.00   ? 115 TYR A CZ  1 
ATOM   956  O OH  . TYR A 1 115 ? -29.025 -41.336 61.911  1.00 5.45   ? 115 TYR A OH  1 
ATOM   957  N N   . ASP A 1 116 ? -22.661 -45.997 57.851  1.00 24.95  ? 116 ASP A N   1 
ATOM   958  C CA  . ASP A 1 116 ? -22.068 -46.907 56.872  1.00 28.07  ? 116 ASP A CA  1 
ATOM   959  C C   . ASP A 1 116 ? -21.882 -48.321 57.443  1.00 30.49  ? 116 ASP A C   1 
ATOM   960  O O   . ASP A 1 116 ? -21.265 -48.504 58.510  1.00 30.44  ? 116 ASP A O   1 
ATOM   961  C CB  . ASP A 1 116 ? -20.724 -46.363 56.389  1.00 27.85  ? 116 ASP A CB  1 
ATOM   962  C CG  . ASP A 1 116 ? -20.263 -47.009 55.076  1.00 28.23  ? 116 ASP A CG  1 
ATOM   963  O OD1 . ASP A 1 116 ? -20.023 -48.239 55.028  1.00 25.40  ? 116 ASP A OD1 1 
ATOM   964  O OD2 . ASP A 1 116 ? -20.149 -46.270 54.078  1.00 28.72  ? 116 ASP A OD2 1 
ATOM   965  N N   . PRO A 1 117 ? -22.420 -49.343 56.735  1.00 33.04  ? 117 PRO A N   1 
ATOM   966  C CA  . PRO A 1 117 ? -22.331 -50.745 57.135  1.00 34.61  ? 117 PRO A CA  1 
ATOM   967  C C   . PRO A 1 117 ? -20.940 -51.212 57.506  1.00 36.18  ? 117 PRO A C   1 
ATOM   968  O O   . PRO A 1 117 ? -20.774 -51.994 58.460  1.00 36.39  ? 117 PRO A O   1 
ATOM   969  C CB  . PRO A 1 117 ? -22.871 -51.470 55.911  1.00 34.40  ? 117 PRO A CB  1 
ATOM   970  C CG  . PRO A 1 117 ? -23.850 -50.509 55.353  1.00 34.19  ? 117 PRO A CG  1 
ATOM   971  C CD  . PRO A 1 117 ? -23.181 -49.194 55.487  1.00 34.60  ? 117 PRO A CD  1 
ATOM   972  N N   . ASP A 1 118 ? -19.939 -50.733 56.783  1.00 35.92  ? 118 ASP A N   1 
ATOM   973  C CA  . ASP A 1 118 ? -18.549 -51.101 57.049  1.00 35.09  ? 118 ASP A CA  1 
ATOM   974  C C   . ASP A 1 118 ? -17.918 -50.362 58.241  1.00 35.24  ? 118 ASP A C   1 
ATOM   975  O O   . ASP A 1 118 ? -16.691 -50.177 58.266  1.00 33.49  ? 118 ASP A O   1 
ATOM   976  C CB  . ASP A 1 118 ? -17.709 -50.886 55.792  1.00 36.83  ? 118 ASP A CB  1 
ATOM   977  C CG  . ASP A 1 118 ? -18.145 -51.784 54.641  1.00 37.56  ? 118 ASP A CG  1 
ATOM   978  O OD1 . ASP A 1 118 ? -17.782 -52.986 54.631  1.00 38.14  ? 118 ASP A OD1 1 
ATOM   979  O OD2 . ASP A 1 118 ? -18.860 -51.284 53.747  1.00 40.37  ? 118 ASP A OD2 1 
ATOM   980  N N   . PHE A 1 119 ? -18.762 -49.951 59.191  1.00 34.82  ? 119 PHE A N   1 
ATOM   981  C CA  . PHE A 1 119 ? -18.359 -49.245 60.414  1.00 34.90  ? 119 PHE A CA  1 
ATOM   982  C C   . PHE A 1 119 ? -17.093 -49.818 61.082  1.00 36.84  ? 119 PHE A C   1 
ATOM   983  O O   . PHE A 1 119 ? -16.184 -49.068 61.411  1.00 37.10  ? 119 PHE A O   1 
ATOM   984  C CB  . PHE A 1 119 ? -19.519 -49.239 61.412  1.00 33.49  ? 119 PHE A CB  1 
ATOM   985  C CG  . PHE A 1 119 ? -19.209 -48.531 62.691  1.00 30.39  ? 119 PHE A CG  1 
ATOM   986  C CD1 . PHE A 1 119 ? -19.253 -47.143 62.762  1.00 29.32  ? 119 PHE A CD1 1 
ATOM   987  C CD2 . PHE A 1 119 ? -18.851 -49.251 63.829  1.00 29.67  ? 119 PHE A CD2 1 
ATOM   988  C CE1 . PHE A 1 119 ? -18.946 -46.483 63.973  1.00 31.32  ? 119 PHE A CE1 1 
ATOM   989  C CE2 . PHE A 1 119 ? -18.545 -48.597 65.034  1.00 29.18  ? 119 PHE A CE2 1 
ATOM   990  C CZ  . PHE A 1 119 ? -18.595 -47.220 65.104  1.00 30.03  ? 119 PHE A CZ  1 
ATOM   991  N N   . GLU A 1 120 ? -17.039 -51.141 61.255  1.00 37.38  ? 120 GLU A N   1 
ATOM   992  C CA  . GLU A 1 120 ? -15.900 -51.823 61.881  1.00 37.83  ? 120 GLU A CA  1 
ATOM   993  C C   . GLU A 1 120 ? -14.565 -51.438 61.259  1.00 38.77  ? 120 GLU A C   1 
ATOM   994  O O   . GLU A 1 120 ? -13.647 -51.033 61.974  1.00 40.77  ? 120 GLU A O   1 
ATOM   995  C CB  . GLU A 1 120 ? -16.057 -53.334 61.774  1.00 37.81  ? 120 GLU A CB  1 
ATOM   996  C CG  . GLU A 1 120 ? -17.320 -53.882 62.395  1.00 37.27  ? 120 GLU A CG  1 
ATOM   997  C CD  . GLU A 1 120 ? -17.481 -55.384 62.145  1.00 37.83  ? 120 GLU A CD  1 
ATOM   998  O OE1 . GLU A 1 120 ? -17.387 -55.823 60.972  1.00 38.13  ? 120 GLU A OE1 1 
ATOM   999  O OE2 . GLU A 1 120 ? -17.704 -56.132 63.124  1.00 36.75  ? 120 GLU A OE2 1 
ATOM   1000 N N   . LYS A 1 121 ? -14.458 -51.535 59.934  1.00 38.35  ? 121 LYS A N   1 
ATOM   1001 C CA  . LYS A 1 121 ? -13.203 -51.255 59.247  1.00 37.65  ? 121 LYS A CA  1 
ATOM   1002 C C   . LYS A 1 121 ? -12.983 -49.754 59.012  1.00 37.39  ? 121 LYS A C   1 
ATOM   1003 O O   . LYS A 1 121 ? -11.832 -49.295 58.914  1.00 37.14  ? 121 LYS A O   1 
ATOM   1004 C CB  . LYS A 1 121 ? -13.125 -51.992 57.911  1.00 39.41  ? 121 LYS A CB  1 
ATOM   1005 C CG  . LYS A 1 121 ? -14.306 -51.777 56.997  1.00 42.31  ? 121 LYS A CG  1 
ATOM   1006 C CD  . LYS A 1 121 ? -14.865 -53.093 56.465  1.00 44.45  ? 121 LYS A CD  1 
ATOM   1007 C CE  . LYS A 1 121 ? -15.489 -53.951 57.578  1.00 46.16  ? 121 LYS A CE  1 
ATOM   1008 N NZ  . LYS A 1 121 ? -16.107 -55.199 57.045  1.00 46.73  ? 121 LYS A NZ  1 
ATOM   1009 N N   . LEU A 1 122 ? -14.073 -48.993 58.925  1.00 35.58  ? 122 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 122 ? -13.977 -47.558 58.692  1.00 32.36  ? 122 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 122 ? -13.632 -46.775 59.965  1.00 31.62  ? 122 LEU A C   1 
ATOM   1012 O O   . LEU A 1 122 ? -12.993 -45.733 59.897  1.00 31.28  ? 122 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 122 ? -15.278 -47.048 58.072  1.00 33.01  ? 122 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 122 ? -15.400 -47.080 56.544  1.00 31.60  ? 122 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 122 ? -15.162 -48.443 56.021  1.00 32.10  ? 122 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 122 ? -16.763 -46.628 56.144  1.00 31.32  ? 122 LEU A CD2 1 
ATOM   1017 N N   . LYS A 1 123 ? -14.032 -47.302 61.118  1.00 31.98  ? 123 LYS A N   1 
ATOM   1018 C CA  . LYS A 1 123 ? -13.762 -46.648 62.388  1.00 29.96  ? 123 LYS A CA  1 
ATOM   1019 C C   . LYS A 1 123 ? -12.287 -46.265 62.553  1.00 29.92  ? 123 LYS A C   1 
ATOM   1020 O O   . LYS A 1 123 ? -11.995 -45.104 62.841  1.00 31.19  ? 123 LYS A O   1 
ATOM   1021 C CB  . LYS A 1 123 ? -14.223 -47.528 63.554  1.00 30.47  ? 123 LYS A CB  1 
ATOM   1022 C CG  . LYS A 1 123 ? -14.052 -46.897 64.935  1.00 33.79  ? 123 LYS A CG  1 
ATOM   1023 C CD  . LYS A 1 123 ? -14.521 -47.816 66.054  1.00 35.56  ? 123 LYS A CD  1 
ATOM   1024 C CE  . LYS A 1 123 ? -14.313 -47.142 67.407  1.00 37.88  ? 123 LYS A CE  1 
ATOM   1025 N NZ  . LYS A 1 123 ? -14.715 -48.032 68.519  1.00 37.68  ? 123 LYS A NZ  1 
ATOM   1026 N N   . PRO A 1 124 ? -11.335 -47.242 62.375  1.00 28.39  ? 124 PRO A N   1 
ATOM   1027 C CA  . PRO A 1 124 ? -9.919  -46.904 62.497  1.00 26.34  ? 124 PRO A CA  1 
ATOM   1028 C C   . PRO A 1 124 ? -9.471  -45.771 61.594  1.00 26.74  ? 124 PRO A C   1 
ATOM   1029 O O   . PRO A 1 124 ? -8.755  -44.848 62.023  1.00 29.67  ? 124 PRO A O   1 
ATOM   1030 C CB  . PRO A 1 124 ? -9.233  -48.224 62.133  1.00 26.27  ? 124 PRO A CB  1 
ATOM   1031 C CG  . PRO A 1 124 ? -10.223 -49.253 62.511  1.00 25.81  ? 124 PRO A CG  1 
ATOM   1032 C CD  . PRO A 1 124 ? -11.515 -48.677 62.101  1.00 26.46  ? 124 PRO A CD  1 
ATOM   1033 N N   . GLU A 1 125 ? -9.942  -45.820 60.352  1.00 26.12  ? 125 GLU A N   1 
ATOM   1034 C CA  . GLU A 1 125 ? -9.665  -44.782 59.373  1.00 27.07  ? 125 GLU A CA  1 
ATOM   1035 C C   . GLU A 1 125 ? -10.015 -43.403 59.927  1.00 25.87  ? 125 GLU A C   1 
ATOM   1036 O O   . GLU A 1 125 ? -9.232  -42.457 59.799  1.00 26.03  ? 125 GLU A O   1 
ATOM   1037 C CB  . GLU A 1 125 ? -10.449 -45.063 58.091  1.00 27.86  ? 125 GLU A CB  1 
ATOM   1038 C CG  . GLU A 1 125 ? -10.159 -44.118 56.934  1.00 32.94  ? 125 GLU A CG  1 
ATOM   1039 C CD  . GLU A 1 125 ? -11.036 -44.430 55.701  1.00 36.37  ? 125 GLU A CD  1 
ATOM   1040 O OE1 . GLU A 1 125 ? -10.877 -45.534 55.113  1.00 37.00  ? 125 GLU A OE1 1 
ATOM   1041 O OE2 . GLU A 1 125 ? -11.884 -43.578 55.319  1.00 38.59  ? 125 GLU A OE2 1 
ATOM   1042 N N   . TYR A 1 126 ? -11.185 -43.313 60.561  1.00 26.01  ? 126 TYR A N   1 
ATOM   1043 C CA  . TYR A 1 126 ? -11.665 -42.086 61.177  1.00 24.85  ? 126 TYR A CA  1 
ATOM   1044 C C   . TYR A 1 126 ? -10.802 -41.697 62.386  1.00 23.78  ? 126 TYR A C   1 
ATOM   1045 O O   . TYR A 1 126 ? -10.334 -40.544 62.477  1.00 24.45  ? 126 TYR A O   1 
ATOM   1046 C CB  . TYR A 1 126 ? -13.127 -42.248 61.589  1.00 24.06  ? 126 TYR A CB  1 
ATOM   1047 C CG  . TYR A 1 126 ? -13.720 -41.014 62.222  1.00 24.48  ? 126 TYR A CG  1 
ATOM   1048 C CD1 . TYR A 1 126 ? -14.095 -39.911 61.431  1.00 25.23  ? 126 TYR A CD1 1 
ATOM   1049 C CD2 . TYR A 1 126 ? -13.923 -40.940 63.614  1.00 23.93  ? 126 TYR A CD2 1 
ATOM   1050 C CE1 . TYR A 1 126 ? -14.663 -38.757 62.015  1.00 23.43  ? 126 TYR A CE1 1 
ATOM   1051 C CE2 . TYR A 1 126 ? -14.484 -39.789 64.197  1.00 22.72  ? 126 TYR A CE2 1 
ATOM   1052 C CZ  . TYR A 1 126 ? -14.844 -38.727 63.384  1.00 21.94  ? 126 TYR A CZ  1 
ATOM   1053 O OH  . TYR A 1 126 ? -15.407 -37.638 63.954  1.00 21.86  ? 126 TYR A OH  1 
ATOM   1054 N N   . LEU A 1 127 ? -10.610 -42.645 63.311  1.00 23.85  ? 127 LEU A N   1 
ATOM   1055 C CA  . LEU A 1 127 ? -9.895  -42.377 64.557  1.00 26.79  ? 127 LEU A CA  1 
ATOM   1056 C C   . LEU A 1 127 ? -8.512  -41.760 64.337  1.00 26.07  ? 127 LEU A C   1 
ATOM   1057 O O   . LEU A 1 127 ? -8.172  -40.728 64.927  1.00 24.08  ? 127 LEU A O   1 
ATOM   1058 C CB  . LEU A 1 127 ? -9.778  -43.657 65.371  1.00 25.24  ? 127 LEU A CB  1 
ATOM   1059 C CG  . LEU A 1 127 ? -11.100 -44.144 65.978  1.00 28.07  ? 127 LEU A CG  1 
ATOM   1060 C CD1 . LEU A 1 127 ? -10.884 -45.508 66.629  1.00 29.20  ? 127 LEU A CD1 1 
ATOM   1061 C CD2 . LEU A 1 127 ? -11.613 -43.149 67.001  1.00 28.03  ? 127 LEU A CD2 1 
ATOM   1062 N N   . GLN A 1 128 ? -7.711  -42.351 63.454  1.00 26.75  ? 128 GLN A N   1 
ATOM   1063 C CA  . GLN A 1 128 ? -6.371  -41.816 63.209  1.00 30.90  ? 128 GLN A CA  1 
ATOM   1064 C C   . GLN A 1 128 ? -6.367  -40.413 62.551  1.00 29.92  ? 128 GLN A C   1 
ATOM   1065 O O   . GLN A 1 128 ? -5.390  -39.645 62.702  1.00 32.58  ? 128 GLN A O   1 
ATOM   1066 C CB  . GLN A 1 128 ? -5.511  -42.799 62.390  1.00 32.87  ? 128 GLN A CB  1 
ATOM   1067 C CG  . GLN A 1 128 ? -6.124  -43.274 61.079  1.00 39.24  ? 128 GLN A CG  1 
ATOM   1068 C CD  . GLN A 1 128 ? -5.450  -44.532 60.536  1.00 43.02  ? 128 GLN A CD  1 
ATOM   1069 O OE1 . GLN A 1 128 ? -4.482  -45.032 61.109  1.00 45.31  ? 128 GLN A OE1 1 
ATOM   1070 N NE2 . GLN A 1 128 ? -5.961  -45.035 59.422  1.00 45.16  ? 128 GLN A NE2 1 
ATOM   1071 N N   . ALA A 1 129 ? -7.446  -40.088 61.840  1.00 28.48  ? 129 ALA A N   1 
ATOM   1072 C CA  . ALA A 1 129 ? -7.559  -38.799 61.191  1.00 25.67  ? 129 ALA A CA  1 
ATOM   1073 C C   . ALA A 1 129 ? -8.090  -37.740 62.168  1.00 23.55  ? 129 ALA A C   1 
ATOM   1074 O O   . ALA A 1 129 ? -7.832  -36.536 62.012  1.00 23.86  ? 129 ALA A O   1 
ATOM   1075 C CB  . ALA A 1 129 ? -8.447  -38.915 59.970  1.00 22.88  ? 129 ALA A CB  1 
ATOM   1076 N N   . LEU A 1 130 ? -8.838  -38.201 63.165  1.00 21.48  ? 130 LEU A N   1 
ATOM   1077 C CA  . LEU A 1 130 ? -9.460  -37.314 64.138  1.00 21.85  ? 130 LEU A CA  1 
ATOM   1078 C C   . LEU A 1 130 ? -8.540  -36.233 64.763  1.00 23.19  ? 130 LEU A C   1 
ATOM   1079 O O   . LEU A 1 130 ? -8.901  -35.052 64.777  1.00 24.74  ? 130 LEU A O   1 
ATOM   1080 C CB  . LEU A 1 130 ? -10.138 -38.137 65.232  1.00 19.82  ? 130 LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 130 ? -11.064 -37.400 66.201  1.00 21.27  ? 130 LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 130 ? -12.245 -36.815 65.459  1.00 21.83  ? 130 LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 130 ? -11.546 -38.357 67.264  1.00 21.40  ? 130 LEU A CD2 1 
ATOM   1084 N N   . PRO A 1 131 ? -7.345  -36.628 65.290  1.00 22.21  ? 131 PRO A N   1 
ATOM   1085 C CA  . PRO A 1 131 ? -6.455  -35.663 65.927  1.00 21.91  ? 131 PRO A CA  1 
ATOM   1086 C C   . PRO A 1 131 ? -6.173  -34.371 65.153  1.00 24.16  ? 131 PRO A C   1 
ATOM   1087 O O   . PRO A 1 131 ? -6.268  -33.273 65.734  1.00 23.19  ? 131 PRO A O   1 
ATOM   1088 C CB  . PRO A 1 131 ? -5.198  -36.496 66.148  1.00 19.60  ? 131 PRO A CB  1 
ATOM   1089 C CG  . PRO A 1 131 ? -5.703  -37.830 66.390  1.00 21.37  ? 131 PRO A CG  1 
ATOM   1090 C CD  . PRO A 1 131 ? -6.782  -37.981 65.394  1.00 24.86  ? 131 PRO A CD  1 
ATOM   1091 N N   . GLU A 1 132 ? -5.876  -34.484 63.867  1.00 24.97  ? 132 GLU A N   1 
ATOM   1092 C CA  . GLU A 1 132 ? -5.591  -33.311 63.057  1.00 28.05  ? 132 GLU A CA  1 
ATOM   1093 C C   . GLU A 1 132 ? -6.802  -32.394 63.001  1.00 28.90  ? 132 GLU A C   1 
ATOM   1094 O O   . GLU A 1 132 ? -6.656  -31.174 62.967  1.00 30.28  ? 132 GLU A O   1 
ATOM   1095 C CB  . GLU A 1 132 ? -5.168  -33.712 61.653  1.00 30.56  ? 132 GLU A CB  1 
ATOM   1096 C CG  . GLU A 1 132 ? -4.828  -32.524 60.731  1.00 38.36  ? 132 GLU A CG  1 
ATOM   1097 C CD  . GLU A 1 132 ? -3.809  -31.540 61.315  1.00 40.14  ? 132 GLU A CD  1 
ATOM   1098 O OE1 . GLU A 1 132 ? -2.613  -31.907 61.409  1.00 41.27  ? 132 GLU A OE1 1 
ATOM   1099 O OE2 . GLU A 1 132 ? -4.211  -30.412 61.696  1.00 42.50  ? 132 GLU A OE2 1 
ATOM   1100 N N   . MET A 1 133 ? -8.002  -32.984 63.032  1.00 26.43  ? 133 MET A N   1 
ATOM   1101 C CA  . MET A 1 133 ? -9.238  -32.210 63.054  1.00 23.49  ? 133 MET A CA  1 
ATOM   1102 C C   . MET A 1 133 ? -9.312  -31.372 64.324  1.00 21.50  ? 133 MET A C   1 
ATOM   1103 O O   . MET A 1 133 ? -9.467  -30.141 64.270  1.00 21.61  ? 133 MET A O   1 
ATOM   1104 C CB  . MET A 1 133 ? -10.456 -33.137 62.939  1.00 25.55  ? 133 MET A CB  1 
ATOM   1105 C CG  . MET A 1 133 ? -11.803 -32.435 62.807  1.00 29.39  ? 133 MET A CG  1 
ATOM   1106 S SD  . MET A 1 133 ? -13.134 -33.646 62.553  1.00 37.12  ? 133 MET A SD  1 
ATOM   1107 C CE  . MET A 1 133 ? -13.763 -33.750 64.255  1.00 34.24  ? 133 MET A CE  1 
ATOM   1108 N N   . LEU A 1 134 ? -9.185  -32.054 65.466  1.00 18.37  ? 134 LEU A N   1 
ATOM   1109 C CA  . LEU A 1 134 ? -9.234  -31.386 66.750  1.00 18.92  ? 134 LEU A CA  1 
ATOM   1110 C C   . LEU A 1 134 ? -8.125  -30.356 66.926  1.00 20.33  ? 134 LEU A C   1 
ATOM   1111 O O   . LEU A 1 134 ? -8.316  -29.346 67.582  1.00 22.03  ? 134 LEU A O   1 
ATOM   1112 C CB  . LEU A 1 134 ? -9.145  -32.410 67.873  1.00 16.38  ? 134 LEU A CB  1 
ATOM   1113 C CG  . LEU A 1 134 ? -10.366 -33.253 68.232  1.00 15.53  ? 134 LEU A CG  1 
ATOM   1114 C CD1 . LEU A 1 134 ? -11.550 -32.345 68.570  1.00 17.19  ? 134 LEU A CD1 1 
ATOM   1115 C CD2 . LEU A 1 134 ? -10.715 -34.141 67.082  1.00 15.98  ? 134 LEU A CD2 1 
ATOM   1116 N N   . LYS A 1 135 ? -6.969  -30.616 66.319  1.00 22.60  ? 135 LYS A N   1 
ATOM   1117 C CA  . LYS A 1 135 ? -5.831  -29.710 66.398  1.00 22.31  ? 135 LYS A CA  1 
ATOM   1118 C C   . LYS A 1 135 ? -6.220  -28.347 65.863  1.00 20.49  ? 135 LYS A C   1 
ATOM   1119 O O   . LYS A 1 135 ? -5.957  -27.340 66.511  1.00 20.07  ? 135 LYS A O   1 
ATOM   1120 C CB  . LYS A 1 135 ? -4.659  -30.265 65.591  1.00 25.75  ? 135 LYS A CB  1 
ATOM   1121 C CG  . LYS A 1 135 ? -3.407  -29.415 65.667  1.00 29.86  ? 135 LYS A CG  1 
ATOM   1122 C CD  . LYS A 1 135 ? -2.287  -29.976 64.777  1.00 35.82  ? 135 LYS A CD  1 
ATOM   1123 C CE  . LYS A 1 135 ? -1.798  -31.356 65.272  1.00 39.78  ? 135 LYS A CE  1 
ATOM   1124 N NZ  . LYS A 1 135 ? -1.240  -31.300 66.670  1.00 42.90  ? 135 LYS A NZ  1 
ATOM   1125 N N   . LEU A 1 136 ? -6.854  -28.334 64.689  1.00 19.16  ? 136 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 136 ? -7.278  -27.098 64.031  1.00 16.90  ? 136 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 136 ? -8.277  -26.286 64.858  1.00 15.99  ? 136 LEU A C   1 
ATOM   1128 O O   . LEU A 1 136 ? -8.170  -25.042 64.932  1.00 15.33  ? 136 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 136 ? -7.870  -27.415 62.660  1.00 17.40  ? 136 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 136 ? -6.876  -27.962 61.627  1.00 15.41  ? 136 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 136 ? -7.630  -28.326 60.357  1.00 13.28  ? 136 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 136 ? -5.820  -26.945 61.341  1.00 14.84  ? 136 LEU A CD2 1 
ATOM   1133 N N   . TYR A 1 137 ? -9.213  -26.988 65.501  1.00 12.26  ? 137 TYR A N   1 
ATOM   1134 C CA  . TYR A 1 137 ? -10.194 -26.342 66.363  1.00 10.76  ? 137 TYR A CA  1 
ATOM   1135 C C   . TYR A 1 137 ? -9.554  -25.804 67.652  1.00 11.90  ? 137 TYR A C   1 
ATOM   1136 O O   . TYR A 1 137 ? -9.890  -24.710 68.090  1.00 14.52  ? 137 TYR A O   1 
ATOM   1137 C CB  . TYR A 1 137 ? -11.301 -27.312 66.725  1.00 9.73   ? 137 TYR A CB  1 
ATOM   1138 C CG  . TYR A 1 137 ? -12.193 -27.694 65.575  1.00 7.89   ? 137 TYR A CG  1 
ATOM   1139 C CD1 . TYR A 1 137 ? -12.694 -26.716 64.698  1.00 8.76   ? 137 TYR A CD1 1 
ATOM   1140 C CD2 . TYR A 1 137 ? -12.516 -29.053 65.341  1.00 8.13   ? 137 TYR A CD2 1 
ATOM   1141 C CE1 . TYR A 1 137 ? -13.516 -27.082 63.588  1.00 9.06   ? 137 TYR A CE1 1 
ATOM   1142 C CE2 . TYR A 1 137 ? -13.328 -29.428 64.251  1.00 9.73   ? 137 TYR A CE2 1 
ATOM   1143 C CZ  . TYR A 1 137 ? -13.824 -28.427 63.393  1.00 9.74   ? 137 TYR A CZ  1 
ATOM   1144 O OH  . TYR A 1 137 ? -14.609 -28.764 62.330  1.00 12.29  ? 137 TYR A OH  1 
ATOM   1145 N N   . SER A 1 138 ? -8.616  -26.556 68.217  1.00 14.29  ? 138 SER A N   1 
ATOM   1146 C CA  . SER A 1 138 ? -7.880  -26.122 69.398  1.00 15.27  ? 138 SER A CA  1 
ATOM   1147 C C   . SER A 1 138 ? -7.090  -24.865 69.101  1.00 14.06  ? 138 SER A C   1 
ATOM   1148 O O   . SER A 1 138 ? -7.170  -23.889 69.839  1.00 11.58  ? 138 SER A O   1 
ATOM   1149 C CB  . SER A 1 138 ? -6.950  -27.227 69.886  1.00 16.83  ? 138 SER A CB  1 
ATOM   1150 O OG  . SER A 1 138 ? -6.529  -26.982 71.226  1.00 21.88  ? 138 SER A OG  1 
ATOM   1151 N N   . GLN A 1 139 ? -6.344  -24.893 68.003  1.00 13.84  ? 139 GLN A N   1 
ATOM   1152 C CA  . GLN A 1 139 ? -5.564  -23.745 67.608  1.00 14.71  ? 139 GLN A CA  1 
ATOM   1153 C C   . GLN A 1 139 ? -6.449  -22.554 67.400  1.00 13.67  ? 139 GLN A C   1 
ATOM   1154 O O   . GLN A 1 139 ? -6.134  -21.484 67.850  1.00 14.99  ? 139 GLN A O   1 
ATOM   1155 C CB  . GLN A 1 139 ? -4.783  -24.034 66.339  1.00 17.83  ? 139 GLN A CB  1 
ATOM   1156 C CG  . GLN A 1 139 ? -3.693  -25.067 66.476  1.00 20.54  ? 139 GLN A CG  1 
ATOM   1157 C CD  . GLN A 1 139 ? -2.961  -25.312 65.156  1.00 23.08  ? 139 GLN A CD  1 
ATOM   1158 O OE1 . GLN A 1 139 ? -1.969  -24.652 64.852  1.00 25.67  ? 139 GLN A OE1 1 
ATOM   1159 N NE2 . GLN A 1 139 ? -3.449  -26.266 64.375  1.00 25.10  ? 139 GLN A NE2 1 
ATOM   1160 N N   . PHE A 1 140 ? -7.570  -22.746 66.717  1.00 17.07  ? 140 PHE A N   1 
ATOM   1161 C CA  . PHE A 1 140 ? -8.491  -21.654 66.436  1.00 18.65  ? 140 PHE A CA  1 
ATOM   1162 C C   . PHE A 1 140 ? -9.043  -21.029 67.715  1.00 18.63  ? 140 PHE A C   1 
ATOM   1163 O O   . PHE A 1 140 ? -9.096  -19.796 67.833  1.00 19.18  ? 140 PHE A O   1 
ATOM   1164 C CB  . PHE A 1 140 ? -9.642  -22.159 65.557  1.00 20.02  ? 140 PHE A CB  1 
ATOM   1165 C CG  . PHE A 1 140 ? -10.425 -21.068 64.883  1.00 19.14  ? 140 PHE A CG  1 
ATOM   1166 C CD1 . PHE A 1 140 ? -9.866  -20.342 63.812  1.00 17.49  ? 140 PHE A CD1 1 
ATOM   1167 C CD2 . PHE A 1 140 ? -11.726 -20.760 65.306  1.00 20.68  ? 140 PHE A CD2 1 
ATOM   1168 C CE1 . PHE A 1 140 ? -10.592 -19.320 63.170  1.00 19.25  ? 140 PHE A CE1 1 
ATOM   1169 C CE2 . PHE A 1 140 ? -12.463 -19.731 64.662  1.00 22.34  ? 140 PHE A CE2 1 
ATOM   1170 C CZ  . PHE A 1 140 ? -11.887 -19.016 63.591  1.00 23.71  ? 140 PHE A CZ  1 
ATOM   1171 N N   . LEU A 1 141 ? -9.427  -21.887 68.662  1.00 17.40  ? 141 LEU A N   1 
ATOM   1172 C CA  . LEU A 1 141 ? -9.944  -21.449 69.951  1.00 17.14  ? 141 LEU A CA  1 
ATOM   1173 C C   . LEU A 1 141 ? -8.878  -20.664 70.714  1.00 18.87  ? 141 LEU A C   1 
ATOM   1174 O O   . LEU A 1 141 ? -9.143  -19.592 71.261  1.00 19.16  ? 141 LEU A O   1 
ATOM   1175 C CB  . LEU A 1 141 ? -10.420 -22.641 70.780  1.00 11.44  ? 141 LEU A CB  1 
ATOM   1176 C CG  . LEU A 1 141 ? -10.995 -22.355 72.165  1.00 10.89  ? 141 LEU A CG  1 
ATOM   1177 C CD1 . LEU A 1 141 ? -12.161 -21.395 72.082  1.00 11.44  ? 141 LEU A CD1 1 
ATOM   1178 C CD2 . LEU A 1 141 ? -11.424 -23.642 72.759  1.00 8.90   ? 141 LEU A CD2 1 
ATOM   1179 N N   . GLY A 1 142 ? -7.658  -21.218 70.745  1.00 21.47  ? 142 GLY A N   1 
ATOM   1180 C CA  . GLY A 1 142 ? -6.566  -20.567 71.442  1.00 22.20  ? 142 GLY A CA  1 
ATOM   1181 C C   . GLY A 1 142 ? -6.830  -20.501 72.914  1.00 21.59  ? 142 GLY A C   1 
ATOM   1182 O O   . GLY A 1 142 ? -7.290  -21.474 73.473  1.00 19.24  ? 142 GLY A O   1 
ATOM   1183 N N   . LYS A 1 143 ? -6.563  -19.362 73.542  1.00 22.48  ? 143 LYS A N   1 
ATOM   1184 C CA  . LYS A 1 143 ? -6.811  -19.153 74.971  1.00 23.64  ? 143 LYS A CA  1 
ATOM   1185 C C   . LYS A 1 143 ? -8.113  -18.373 75.215  1.00 23.99  ? 143 LYS A C   1 
ATOM   1186 O O   . LYS A 1 143 ? -8.312  -17.842 76.307  1.00 24.49  ? 143 LYS A O   1 
ATOM   1187 C CB  . LYS A 1 143 ? -5.618  -18.416 75.622  1.00 23.93  ? 143 LYS A CB  1 
ATOM   1188 C CG  . LYS A 1 143 ? -4.269  -19.141 75.459  1.00 24.14  ? 143 LYS A CG  1 
ATOM   1189 C CD  . LYS A 1 143 ? -4.052  -20.225 76.524  1.00 27.19  ? 143 LYS A CD  1 
ATOM   1190 C CE  . LYS A 1 143 ? -4.830  -21.542 76.236  1.00 26.75  ? 143 LYS A CE  1 
ATOM   1191 N NZ  . LYS A 1 143 ? -4.333  -22.307 75.060  1.00 27.44  ? 143 LYS A NZ  1 
ATOM   1192 N N   . GLN A 1 144 ? -8.983  -18.327 74.212  1.00 23.99  ? 144 GLN A N   1 
ATOM   1193 C CA  . GLN A 1 144 ? -10.246 -17.593 74.305  1.00 22.21  ? 144 GLN A CA  1 
ATOM   1194 C C   . GLN A 1 144 ? -11.224 -18.458 75.080  1.00 18.48  ? 144 GLN A C   1 
ATOM   1195 O O   . GLN A 1 144 ? -11.134 -19.686 75.045  1.00 20.94  ? 144 GLN A O   1 
ATOM   1196 C CB  . GLN A 1 144 ? -10.815 -17.329 72.913  1.00 25.01  ? 144 GLN A CB  1 
ATOM   1197 C CG  . GLN A 1 144 ? -9.938  -16.555 71.996  1.00 30.32  ? 144 GLN A CG  1 
ATOM   1198 C CD  . GLN A 1 144 ? -10.558 -16.411 70.622  1.00 34.18  ? 144 GLN A CD  1 
ATOM   1199 O OE1 . GLN A 1 144 ? -10.879 -15.318 70.201  1.00 36.98  ? 144 GLN A OE1 1 
ATOM   1200 N NE2 . GLN A 1 144 ? -10.686 -17.510 69.909  1.00 34.28  ? 144 GLN A NE2 1 
ATOM   1201 N N   . PRO A 1 145 ? -12.163 -17.833 75.829  1.00 13.47  ? 145 PRO A N   1 
ATOM   1202 C CA  . PRO A 1 145 ? -13.199 -18.603 76.513  1.00 11.88  ? 145 PRO A CA  1 
ATOM   1203 C C   . PRO A 1 145 ? -14.217 -19.235 75.557  1.00 14.32  ? 145 PRO A C   1 
ATOM   1204 O O   . PRO A 1 145 ? -14.736 -20.349 75.806  1.00 12.05  ? 145 PRO A O   1 
ATOM   1205 C CB  . PRO A 1 145 ? -13.850 -17.549 77.426  1.00 4.64   ? 145 PRO A CB  1 
ATOM   1206 C CG  . PRO A 1 145 ? -13.641 -16.260 76.716  1.00 7.55   ? 145 PRO A CG  1 
ATOM   1207 C CD  . PRO A 1 145 ? -12.299 -16.387 76.051  1.00 10.17  ? 145 PRO A CD  1 
ATOM   1208 N N   . TRP A 1 146 ? -14.534 -18.498 74.504  1.00 15.55  ? 146 TRP A N   1 
ATOM   1209 C CA  . TRP A 1 146 ? -15.514 -18.932 73.522  1.00 16.09  ? 146 TRP A CA  1 
ATOM   1210 C C   . TRP A 1 146 ? -14.962 -18.668 72.143  1.00 16.99  ? 146 TRP A C   1 
ATOM   1211 O O   . TRP A 1 146 ? -14.117 -17.791 71.985  1.00 18.43  ? 146 TRP A O   1 
ATOM   1212 C CB  . TRP A 1 146 ? -16.844 -18.182 73.690  1.00 16.01  ? 146 TRP A CB  1 
ATOM   1213 C CG  . TRP A 1 146 ? -17.448 -18.254 75.077  1.00 16.53  ? 146 TRP A CG  1 
ATOM   1214 C CD1 . TRP A 1 146 ? -17.565 -17.224 75.975  1.00 15.75  ? 146 TRP A CD1 1 
ATOM   1215 C CD2 . TRP A 1 146 ? -18.021 -19.415 75.716  1.00 15.91  ? 146 TRP A CD2 1 
ATOM   1216 N NE1 . TRP A 1 146 ? -18.175 -17.671 77.128  1.00 15.98  ? 146 TRP A NE1 1 
ATOM   1217 C CE2 . TRP A 1 146 ? -18.467 -18.993 76.995  1.00 15.44  ? 146 TRP A CE2 1 
ATOM   1218 C CE3 . TRP A 1 146 ? -18.215 -20.746 75.326  1.00 15.55  ? 146 TRP A CE3 1 
ATOM   1219 C CZ2 . TRP A 1 146 ? -19.104 -19.887 77.885  1.00 15.21  ? 146 TRP A CZ2 1 
ATOM   1220 C CZ3 . TRP A 1 146 ? -18.842 -21.631 76.223  1.00 16.98  ? 146 TRP A CZ3 1 
ATOM   1221 C CH2 . TRP A 1 146 ? -19.274 -21.194 77.483  1.00 15.34  ? 146 TRP A CH2 1 
ATOM   1222 N N   . PHE A 1 147 ? -15.417 -19.434 71.160  1.00 16.66  ? 147 PHE A N   1 
ATOM   1223 C CA  . PHE A 1 147 ? -14.908 -19.359 69.789  1.00 15.87  ? 147 PHE A CA  1 
ATOM   1224 C C   . PHE A 1 147 ? -14.962 -17.997 69.129  1.00 15.58  ? 147 PHE A C   1 
ATOM   1225 O O   . PHE A 1 147 ? -14.092 -17.671 68.336  1.00 15.50  ? 147 PHE A O   1 
ATOM   1226 C CB  . PHE A 1 147 ? -15.595 -20.386 68.896  1.00 17.80  ? 147 PHE A CB  1 
ATOM   1227 C CG  . PHE A 1 147 ? -15.066 -21.776 69.067  1.00 14.88  ? 147 PHE A CG  1 
ATOM   1228 C CD1 . PHE A 1 147 ? -15.627 -22.637 70.020  1.00 13.72  ? 147 PHE A CD1 1 
ATOM   1229 C CD2 . PHE A 1 147 ? -13.998 -22.233 68.286  1.00 12.40  ? 147 PHE A CD2 1 
ATOM   1230 C CE1 . PHE A 1 147 ? -15.132 -23.947 70.190  1.00 11.57  ? 147 PHE A CE1 1 
ATOM   1231 C CE2 . PHE A 1 147 ? -13.498 -23.550 68.446  1.00 10.90  ? 147 PHE A CE2 1 
ATOM   1232 C CZ  . PHE A 1 147 ? -14.060 -24.406 69.397  1.00 7.81   ? 147 PHE A CZ  1 
ATOM   1233 N N   . LEU A 1 148 ? -15.960 -17.187 69.470  1.00 15.40  ? 148 LEU A N   1 
ATOM   1234 C CA  . LEU A 1 148 ? -16.072 -15.847 68.888  1.00 17.59  ? 148 LEU A CA  1 
ATOM   1235 C C   . LEU A 1 148 ? -15.485 -14.764 69.819  1.00 18.89  ? 148 LEU A C   1 
ATOM   1236 O O   . LEU A 1 148 ? -15.818 -13.579 69.716  1.00 21.75  ? 148 LEU A O   1 
ATOM   1237 C CB  . LEU A 1 148 ? -17.541 -15.512 68.569  1.00 17.26  ? 148 LEU A CB  1 
ATOM   1238 C CG  . LEU A 1 148 ? -18.187 -15.971 67.256  1.00 13.47  ? 148 LEU A CG  1 
ATOM   1239 C CD1 . LEU A 1 148 ? -17.641 -15.160 66.168  1.00 9.26   ? 148 LEU A CD1 1 
ATOM   1240 C CD2 . LEU A 1 148 ? -17.899 -17.432 67.013  1.00 15.48  ? 148 LEU A CD2 1 
ATOM   1241 N N   . GLY A 1 149 ? -14.613 -15.186 70.731  1.00 21.59  ? 149 GLY A N   1 
ATOM   1242 C CA  . GLY A 1 149 ? -14.026 -14.254 71.678  1.00 21.68  ? 149 GLY A CA  1 
ATOM   1243 C C   . GLY A 1 149 ? -14.564 -14.448 73.081  1.00 23.46  ? 149 GLY A C   1 
ATOM   1244 O O   . GLY A 1 149 ? -14.685 -15.577 73.577  1.00 22.60  ? 149 GLY A O   1 
ATOM   1245 N N   . ASP A 1 150 ? -14.867 -13.331 73.737  1.00 23.99  ? 150 ASP A N   1 
ATOM   1246 C CA  . ASP A 1 150 ? -15.332 -13.356 75.122  1.00 26.21  ? 150 ASP A CA  1 
ATOM   1247 C C   . ASP A 1 150 ? -16.805 -13.645 75.226  1.00 23.74  ? 150 ASP A C   1 
ATOM   1248 O O   . ASP A 1 150 ? -17.275 -14.180 76.232  1.00 21.18  ? 150 ASP A O   1 
ATOM   1249 C CB  . ASP A 1 150 ? -15.037 -12.034 75.815  1.00 29.84  ? 150 ASP A CB  1 
ATOM   1250 C CG  . ASP A 1 150 ? -13.641 -11.516 75.507  1.00 32.05  ? 150 ASP A CG  1 
ATOM   1251 O OD1 . ASP A 1 150 ? -12.653 -11.992 76.126  1.00 30.71  ? 150 ASP A OD1 1 
ATOM   1252 O OD2 . ASP A 1 150 ? -13.543 -10.637 74.626  1.00 36.60  ? 150 ASP A OD2 1 
ATOM   1253 N N   . LYS A 1 151 ? -17.532 -13.311 74.164  1.00 23.52  ? 151 LYS A N   1 
ATOM   1254 C CA  . LYS A 1 151 ? -18.986 -13.469 74.126  1.00 23.73  ? 151 LYS A CA  1 
ATOM   1255 C C   . LYS A 1 151 ? -19.336 -14.825 73.542  1.00 21.27  ? 151 LYS A C   1 
ATOM   1256 O O   . LYS A 1 151 ? -18.789 -15.229 72.519  1.00 22.62  ? 151 LYS A O   1 
ATOM   1257 C CB  . LYS A 1 151 ? -19.654 -12.314 73.329  1.00 24.85  ? 151 LYS A CB  1 
ATOM   1258 C CG  . LYS A 1 151 ? -19.255 -12.191 71.833  1.00 30.62  ? 151 LYS A CG  1 
ATOM   1259 C CD  . LYS A 1 151 ? -17.802 -11.740 71.602  1.00 33.52  ? 151 LYS A CD  1 
ATOM   1260 C CE  . LYS A 1 151 ? -17.479 -10.408 72.320  1.00 36.40  ? 151 LYS A CE  1 
ATOM   1261 N NZ  . LYS A 1 151 ? -16.010 -10.108 72.315  1.00 39.48  ? 151 LYS A NZ  1 
ATOM   1262 N N   . ILE A 1 152 ? -20.274 -15.518 74.196  1.00 19.93  ? 152 ILE A N   1 
ATOM   1263 C CA  . ILE A 1 152 ? -20.744 -16.806 73.728  1.00 20.82  ? 152 ILE A CA  1 
ATOM   1264 C C   . ILE A 1 152 ? -21.801 -16.580 72.652  1.00 22.52  ? 152 ILE A C   1 
ATOM   1265 O O   . ILE A 1 152 ? -22.783 -15.867 72.872  1.00 24.57  ? 152 ILE A O   1 
ATOM   1266 C CB  . ILE A 1 152 ? -21.322 -17.688 74.902  1.00 20.17  ? 152 ILE A CB  1 
ATOM   1267 C CG1 . ILE A 1 152 ? -21.829 -19.017 74.361  1.00 20.59  ? 152 ILE A CG1 1 
ATOM   1268 C CG2 . ILE A 1 152 ? -22.425 -16.979 75.648  1.00 18.94  ? 152 ILE A CG2 1 
ATOM   1269 C CD1 . ILE A 1 152 ? -22.164 -20.018 75.434  1.00 20.37  ? 152 ILE A CD1 1 
ATOM   1270 N N   . THR A 1 153 ? -21.601 -17.184 71.487  1.00 21.50  ? 153 THR A N   1 
ATOM   1271 C CA  . THR A 1 153 ? -22.529 -17.014 70.391  1.00 18.53  ? 153 THR A CA  1 
ATOM   1272 C C   . THR A 1 153 ? -23.122 -18.381 70.029  1.00 16.71  ? 153 THR A C   1 
ATOM   1273 O O   . THR A 1 153 ? -22.743 -19.394 70.624  1.00 17.65  ? 153 THR A O   1 
ATOM   1274 C CB  . THR A 1 153 ? -21.809 -16.394 69.174  1.00 17.98  ? 153 THR A CB  1 
ATOM   1275 O OG1 . THR A 1 153 ? -20.662 -17.183 68.808  1.00 15.04  ? 153 THR A OG1 1 
ATOM   1276 C CG2 . THR A 1 153 ? -21.379 -14.954 69.470  1.00 14.02  ? 153 THR A CG2 1 
ATOM   1277 N N   . PHE A 1 154 ? -24.038 -18.417 69.069  1.00 15.65  ? 154 PHE A N   1 
ATOM   1278 C CA  . PHE A 1 154 ? -24.657 -19.673 68.670  1.00 17.01  ? 154 PHE A CA  1 
ATOM   1279 C C   . PHE A 1 154 ? -23.687 -20.735 68.178  1.00 16.87  ? 154 PHE A C   1 
ATOM   1280 O O   . PHE A 1 154 ? -23.946 -21.925 68.282  1.00 14.44  ? 154 PHE A O   1 
ATOM   1281 C CB  . PHE A 1 154 ? -25.790 -19.416 67.669  1.00 13.89  ? 154 PHE A CB  1 
ATOM   1282 C CG  . PHE A 1 154 ? -25.325 -19.172 66.262  1.00 12.26  ? 154 PHE A CG  1 
ATOM   1283 C CD1 . PHE A 1 154 ? -25.011 -17.887 65.847  1.00 12.60  ? 154 PHE A CD1 1 
ATOM   1284 C CD2 . PHE A 1 154 ? -25.276 -20.216 65.334  1.00 10.15  ? 154 PHE A CD2 1 
ATOM   1285 C CE1 . PHE A 1 154 ? -24.632 -17.641 64.522  1.00 10.90  ? 154 PHE A CE1 1 
ATOM   1286 C CE2 . PHE A 1 154 ? -24.879 -19.978 64.019  1.00 10.81  ? 154 PHE A CE2 1 
ATOM   1287 C CZ  . PHE A 1 154 ? -24.564 -18.685 63.613  1.00 10.68  ? 154 PHE A CZ  1 
ATOM   1288 N N   . VAL A 1 155 ? -22.556 -20.285 67.641  1.00 19.46  ? 155 VAL A N   1 
ATOM   1289 C CA  . VAL A 1 155 ? -21.530 -21.177 67.089  1.00 20.42  ? 155 VAL A CA  1 
ATOM   1290 C C   . VAL A 1 155 ? -21.008 -22.135 68.170  1.00 19.42  ? 155 VAL A C   1 
ATOM   1291 O O   . VAL A 1 155 ? -20.747 -23.301 67.892  1.00 17.73  ? 155 VAL A O   1 
ATOM   1292 C CB  . VAL A 1 155 ? -20.329 -20.394 66.496  1.00 22.82  ? 155 VAL A CB  1 
ATOM   1293 C CG1 . VAL A 1 155 ? -19.443 -21.317 65.733  1.00 25.00  ? 155 VAL A CG1 1 
ATOM   1294 C CG2 . VAL A 1 155 ? -20.816 -19.317 65.586  1.00 22.79  ? 155 VAL A CG2 1 
ATOM   1295 N N   . ASP A 1 156 ? -20.903 -21.651 69.406  1.00 17.84  ? 156 ASP A N   1 
ATOM   1296 C CA  . ASP A 1 156 ? -20.453 -22.479 70.524  1.00 17.95  ? 156 ASP A CA  1 
ATOM   1297 C C   . ASP A 1 156 ? -21.369 -23.670 70.814  1.00 17.31  ? 156 ASP A C   1 
ATOM   1298 O O   . ASP A 1 156 ? -20.911 -24.718 71.242  1.00 18.19  ? 156 ASP A O   1 
ATOM   1299 C CB  . ASP A 1 156 ? -20.323 -21.626 71.782  1.00 15.80  ? 156 ASP A CB  1 
ATOM   1300 C CG  . ASP A 1 156 ? -19.237 -20.566 71.662  1.00 17.06  ? 156 ASP A CG  1 
ATOM   1301 O OD1 . ASP A 1 156 ? -18.041 -20.907 71.555  1.00 16.76  ? 156 ASP A OD1 1 
ATOM   1302 O OD2 . ASP A 1 156 ? -19.589 -19.377 71.671  1.00 10.00  ? 156 ASP A OD2 1 
ATOM   1303 N N   . PHE A 1 157 ? -22.658 -23.519 70.527  1.00 17.51  ? 157 PHE A N   1 
ATOM   1304 C CA  . PHE A 1 157 ? -23.622 -24.595 70.737  1.00 14.42  ? 157 PHE A CA  1 
ATOM   1305 C C   . PHE A 1 157 ? -23.463 -25.697 69.684  1.00 12.16  ? 157 PHE A C   1 
ATOM   1306 O O   . PHE A 1 157 ? -23.752 -26.865 69.936  1.00 11.90  ? 157 PHE A O   1 
ATOM   1307 C CB  . PHE A 1 157 ? -25.039 -24.034 70.710  1.00 10.80  ? 157 PHE A CB  1 
ATOM   1308 C CG  . PHE A 1 157 ? -25.311 -23.053 71.787  1.00 7.07   ? 157 PHE A CG  1 
ATOM   1309 C CD1 . PHE A 1 157 ? -24.764 -21.766 71.723  1.00 9.20   ? 157 PHE A CD1 1 
ATOM   1310 C CD2 . PHE A 1 157 ? -26.081 -23.419 72.883  1.00 6.96   ? 157 PHE A CD2 1 
ATOM   1311 C CE1 . PHE A 1 157 ? -24.991 -20.831 72.746  1.00 7.53   ? 157 PHE A CE1 1 
ATOM   1312 C CE2 . PHE A 1 157 ? -26.320 -22.499 73.931  1.00 6.03   ? 157 PHE A CE2 1 
ATOM   1313 C CZ  . PHE A 1 157 ? -25.768 -21.193 73.858  1.00 9.72   ? 157 PHE A CZ  1 
ATOM   1314 N N   . ILE A 1 158 ? -22.977 -25.319 68.498  1.00 9.89   ? 158 ILE A N   1 
ATOM   1315 C CA  . ILE A 1 158 ? -22.694 -26.286 67.442  1.00 11.81  ? 158 ILE A CA  1 
ATOM   1316 C C   . ILE A 1 158 ? -21.413 -27.010 67.855  1.00 12.42  ? 158 ILE A C   1 
ATOM   1317 O O   . ILE A 1 158 ? -21.327 -28.245 67.732  1.00 14.21  ? 158 ILE A O   1 
ATOM   1318 C CB  . ILE A 1 158 ? -22.475 -25.579 66.078  1.00 9.99   ? 158 ILE A CB  1 
ATOM   1319 C CG1 . ILE A 1 158 ? -23.688 -24.709 65.734  1.00 9.30   ? 158 ILE A CG1 1 
ATOM   1320 C CG2 . ILE A 1 158 ? -22.293 -26.577 65.038  1.00 8.08   ? 158 ILE A CG2 1 
ATOM   1321 C CD1 . ILE A 1 158 ? -23.477 -23.767 64.590  1.00 5.26   ? 158 ILE A CD1 1 
ATOM   1322 N N   . ALA A 1 159 ? -20.436 -26.223 68.312  1.00 16.52  ? 159 ALA A N   1 
ATOM   1323 C CA  . ALA A 1 159 ? -19.135 -26.710 68.767  1.00 18.26  ? 159 ALA A CA  1 
ATOM   1324 C C   . ALA A 1 159 ? -19.287 -27.770 69.846  1.00 19.29  ? 159 ALA A C   1 
ATOM   1325 O O   . ALA A 1 159 ? -18.820 -28.881 69.696  1.00 18.26  ? 159 ALA A O   1 
ATOM   1326 C CB  . ALA A 1 159 ? -18.310 -25.564 69.264  1.00 17.66  ? 159 ALA A CB  1 
ATOM   1327 N N   . TYR A 1 160 ? -19.981 -27.422 70.923  1.00 21.18  ? 160 TYR A N   1 
ATOM   1328 C CA  . TYR A 1 160 ? -20.200 -28.331 72.028  1.00 21.60  ? 160 TYR A CA  1 
ATOM   1329 C C   . TYR A 1 160 ? -20.757 -29.658 71.534  1.00 21.37  ? 160 TYR A C   1 
ATOM   1330 O O   . TYR A 1 160 ? -20.272 -30.697 71.914  1.00 25.58  ? 160 TYR A O   1 
ATOM   1331 C CB  . TYR A 1 160 ? -21.119 -27.695 73.083  1.00 24.25  ? 160 TYR A CB  1 
ATOM   1332 C CG  . TYR A 1 160 ? -21.652 -28.696 74.094  1.00 29.51  ? 160 TYR A CG  1 
ATOM   1333 C CD1 . TYR A 1 160 ? -20.871 -29.089 75.194  1.00 33.33  ? 160 TYR A CD1 1 
ATOM   1334 C CD2 . TYR A 1 160 ? -22.906 -29.300 73.915  1.00 30.85  ? 160 TYR A CD2 1 
ATOM   1335 C CE1 . TYR A 1 160 ? -21.330 -30.074 76.095  1.00 33.57  ? 160 TYR A CE1 1 
ATOM   1336 C CE2 . TYR A 1 160 ? -23.366 -30.279 74.796  1.00 32.93  ? 160 TYR A CE2 1 
ATOM   1337 C CZ  . TYR A 1 160 ? -22.568 -30.665 75.875  1.00 33.44  ? 160 TYR A CZ  1 
ATOM   1338 O OH  . TYR A 1 160 ? -23.032 -31.653 76.707  1.00 34.06  ? 160 TYR A OH  1 
ATOM   1339 N N   . ASP A 1 161 ? -21.789 -29.603 70.692  1.00 18.76  ? 161 ASP A N   1 
ATOM   1340 C CA  . ASP A 1 161 ? -22.454 -30.791 70.213  1.00 13.81  ? 161 ASP A CA  1 
ATOM   1341 C C   . ASP A 1 161 ? -21.454 -31.702 69.517  1.00 12.29  ? 161 ASP A C   1 
ATOM   1342 O O   . ASP A 1 161 ? -21.350 -32.859 69.884  1.00 5.84   ? 161 ASP A O   1 
ATOM   1343 C CB  . ASP A 1 161 ? -23.621 -30.398 69.286  1.00 10.16  ? 161 ASP A CB  1 
ATOM   1344 C CG  . ASP A 1 161 ? -24.411 -31.604 68.763  1.00 9.00   ? 161 ASP A CG  1 
ATOM   1345 O OD1 . ASP A 1 161 ? -24.588 -32.569 69.547  1.00 2.78   ? 161 ASP A OD1 1 
ATOM   1346 O OD2 . ASP A 1 161 ? -24.833 -31.606 67.573  1.00 9.19   ? 161 ASP A OD2 1 
ATOM   1347 N N   . VAL A 1 162 ? -20.739 -31.204 68.506  1.00 13.92  ? 162 VAL A N   1 
ATOM   1348 C CA  . VAL A 1 162 ? -19.833 -32.043 67.716  1.00 15.79  ? 162 VAL A CA  1 
ATOM   1349 C C   . VAL A 1 162 ? -18.628 -32.534 68.525  1.00 15.20  ? 162 VAL A C   1 
ATOM   1350 O O   . VAL A 1 162 ? -18.294 -33.698 68.437  1.00 10.69  ? 162 VAL A O   1 
ATOM   1351 C CB  . VAL A 1 162 ? -19.346 -31.327 66.405  1.00 18.50  ? 162 VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 162 ? -20.551 -30.928 65.578  1.00 17.12  ? 162 VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 162 ? -18.550 -30.093 66.708  1.00 20.77  ? 162 VAL A CG2 1 
ATOM   1354 N N   . LEU A 1 163 ? -18.005 -31.655 69.313  1.00 14.65  ? 163 LEU A N   1 
ATOM   1355 C CA  . LEU A 1 163 ? -16.838 -32.010 70.143  1.00 12.87  ? 163 LEU A CA  1 
ATOM   1356 C C   . LEU A 1 163 ? -17.232 -33.032 71.221  1.00 11.74  ? 163 LEU A C   1 
ATOM   1357 O O   . LEU A 1 163 ? -16.612 -34.102 71.298  1.00 13.14  ? 163 LEU A O   1 
ATOM   1358 C CB  . LEU A 1 163 ? -16.241 -30.772 70.811  1.00 11.28  ? 163 LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 163 ? -15.709 -29.703 69.864  1.00 15.43  ? 163 LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 163 ? -15.321 -28.475 70.655  1.00 17.08  ? 163 LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 163 ? -14.531 -30.245 69.055  1.00 15.66  ? 163 LEU A CD2 1 
ATOM   1362 N N   . GLU A 1 164 ? -18.272 -32.720 72.000  1.00 8.66   ? 164 GLU A N   1 
ATOM   1363 C CA  . GLU A 1 164 ? -18.739 -33.604 73.059  1.00 9.24   ? 164 GLU A CA  1 
ATOM   1364 C C   . GLU A 1 164 ? -19.127 -34.951 72.456  1.00 12.00  ? 164 GLU A C   1 
ATOM   1365 O O   . GLU A 1 164 ? -18.838 -35.976 73.057  1.00 11.72  ? 164 GLU A O   1 
ATOM   1366 C CB  . GLU A 1 164 ? -19.916 -32.968 73.784  1.00 6.50   ? 164 GLU A CB  1 
ATOM   1367 C CG  . GLU A 1 164 ? -20.212 -33.532 75.144  1.00 6.87   ? 164 GLU A CG  1 
ATOM   1368 C CD  . GLU A 1 164 ? -21.007 -34.849 75.115  1.00 7.55   ? 164 GLU A CD  1 
ATOM   1369 O OE1 . GLU A 1 164 ? -21.724 -35.130 74.132  1.00 8.89   ? 164 GLU A OE1 1 
ATOM   1370 O OE2 . GLU A 1 164 ? -20.909 -35.633 76.086  1.00 4.77   ? 164 GLU A OE2 1 
ATOM   1371 N N   . ARG A 1 165 ? -19.781 -34.940 71.286  1.00 16.11  ? 165 ARG A N   1 
ATOM   1372 C CA  . ARG A 1 165 ? -20.208 -36.164 70.609  1.00 17.05  ? 165 ARG A CA  1 
ATOM   1373 C C   . ARG A 1 165 ? -19.016 -37.012 70.202  1.00 17.51  ? 165 ARG A C   1 
ATOM   1374 O O   . ARG A 1 165 ? -19.059 -38.214 70.319  1.00 13.46  ? 165 ARG A O   1 
ATOM   1375 C CB  . ARG A 1 165 ? -20.992 -35.804 69.373  1.00 18.22  ? 165 ARG A CB  1 
ATOM   1376 C CG  . ARG A 1 165 ? -21.576 -36.971 68.645  1.00 19.93  ? 165 ARG A CG  1 
ATOM   1377 C CD  . ARG A 1 165 ? -22.350 -36.482 67.375  1.00 25.00  ? 165 ARG A CD  1 
ATOM   1378 N NE  . ARG A 1 165 ? -23.474 -35.611 67.725  1.00 26.83  ? 165 ARG A NE  1 
ATOM   1379 C CZ  . ARG A 1 165 ? -24.450 -35.269 66.891  1.00 25.49  ? 165 ARG A CZ  1 
ATOM   1380 N NH1 . ARG A 1 165 ? -24.457 -35.761 65.668  1.00 25.92  ? 165 ARG A NH1 1 
ATOM   1381 N NH2 . ARG A 1 165 ? -25.390 -34.437 67.305  1.00 24.80  ? 165 ARG A NH2 1 
ATOM   1382 N N   . ASN A 1 166 ? -17.935 -36.377 69.760  1.00 20.91  ? 166 ASN A N   1 
ATOM   1383 C CA  . ASN A 1 166 ? -16.716 -37.103 69.400  1.00 23.30  ? 166 ASN A CA  1 
ATOM   1384 C C   . ASN A 1 166 ? -16.105 -37.724 70.639  1.00 24.68  ? 166 ASN A C   1 
ATOM   1385 O O   . ASN A 1 166 ? -15.612 -38.836 70.601  1.00 25.30  ? 166 ASN A O   1 
ATOM   1386 C CB  . ASN A 1 166 ? -15.709 -36.172 68.719  1.00 24.95  ? 166 ASN A CB  1 
ATOM   1387 C CG  . ASN A 1 166 ? -15.811 -36.208 67.204  1.00 25.56  ? 166 ASN A CG  1 
ATOM   1388 O OD1 . ASN A 1 166 ? -15.977 -35.194 66.559  1.00 25.23  ? 166 ASN A OD1 1 
ATOM   1389 N ND2 . ASN A 1 166 ? -15.723 -37.385 66.642  1.00 25.34  ? 166 ASN A ND2 1 
ATOM   1390 N N   . GLN A 1 167 ? -16.173 -37.003 71.748  1.00 24.32  ? 167 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 167 ? -15.667 -37.511 73.012  1.00 25.53  ? 167 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 167 ? -16.425 -38.741 73.492  1.00 24.57  ? 167 GLN A C   1 
ATOM   1393 O O   . GLN A 1 167 ? -15.838 -39.644 74.041  1.00 26.66  ? 167 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 167 ? -15.724 -36.420 74.082  1.00 28.58  ? 167 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 167 ? -14.957 -36.768 75.361  1.00 31.71  ? 167 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 167 ? -14.996 -35.661 76.361  1.00 33.73  ? 167 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 167 ? -13.978 -35.040 76.644  1.00 35.04  ? 167 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 167 ? -16.174 -35.400 76.911  1.00 31.70  ? 167 GLN A NE2 1 
ATOM   1399 N N   . VAL A 1 168 ? -17.731 -38.800 73.271  1.00 23.93  ? 168 VAL A N   1 
ATOM   1400 C CA  . VAL A 1 168 ? -18.474 -39.995 73.659  1.00 22.49  ? 168 VAL A CA  1 
ATOM   1401 C C   . VAL A 1 168 ? -18.114 -41.136 72.741  1.00 23.19  ? 168 VAL A C   1 
ATOM   1402 O O   . VAL A 1 168 ? -18.186 -42.293 73.155  1.00 23.96  ? 168 VAL A O   1 
ATOM   1403 C CB  . VAL A 1 168 ? -20.060 -39.771 73.694  1.00 22.26  ? 168 VAL A CB  1 
ATOM   1404 C CG1 . VAL A 1 168 ? -20.394 -38.459 74.421  1.00 22.49  ? 168 VAL A CG1 1 
ATOM   1405 C CG2 . VAL A 1 168 ? -20.664 -39.753 72.329  1.00 21.61  ? 168 VAL A CG2 1 
ATOM   1406 N N   . PHE A 1 169 ? -17.739 -40.808 71.506  1.00 23.03  ? 169 PHE A N   1 
ATOM   1407 C CA  . PHE A 1 169 ? -17.349 -41.809 70.525  1.00 23.38  ? 169 PHE A CA  1 
ATOM   1408 C C   . PHE A 1 169 ? -15.985 -42.385 70.891  1.00 26.01  ? 169 PHE A C   1 
ATOM   1409 O O   . PHE A 1 169 ? -15.726 -43.570 70.676  1.00 27.08  ? 169 PHE A O   1 
ATOM   1410 C CB  . PHE A 1 169 ? -17.317 -41.180 69.130  1.00 20.79  ? 169 PHE A CB  1 
ATOM   1411 C CG  . PHE A 1 169 ? -17.047 -42.155 68.022  1.00 18.69  ? 169 PHE A CG  1 
ATOM   1412 C CD1 . PHE A 1 169 ? -18.063 -43.003 67.564  1.00 16.08  ? 169 PHE A CD1 1 
ATOM   1413 C CD2 . PHE A 1 169 ? -15.775 -42.236 67.431  1.00 16.90  ? 169 PHE A CD2 1 
ATOM   1414 C CE1 . PHE A 1 169 ? -17.817 -43.923 66.539  1.00 13.35  ? 169 PHE A CE1 1 
ATOM   1415 C CE2 . PHE A 1 169 ? -15.521 -43.158 66.395  1.00 16.35  ? 169 PHE A CE2 1 
ATOM   1416 C CZ  . PHE A 1 169 ? -16.544 -44.001 65.950  1.00 13.58  ? 169 PHE A CZ  1 
ATOM   1417 N N   . GLU A 1 170 ? -15.130 -41.521 71.444  1.00 26.10  ? 170 GLU A N   1 
ATOM   1418 C CA  . GLU A 1 170 ? -13.796 -41.897 71.900  1.00 25.17  ? 170 GLU A CA  1 
ATOM   1419 C C   . GLU A 1 170 ? -13.346 -40.954 73.015  1.00 26.52  ? 170 GLU A C   1 
ATOM   1420 O O   . GLU A 1 170 ? -12.819 -39.869 72.743  1.00 27.91  ? 170 GLU A O   1 
ATOM   1421 C CB  . GLU A 1 170 ? -12.794 -41.824 70.739  1.00 26.93  ? 170 GLU A CB  1 
ATOM   1422 C CG  . GLU A 1 170 ? -11.366 -42.220 71.101  1.00 27.46  ? 170 GLU A CG  1 
ATOM   1423 C CD  . GLU A 1 170 ? -11.280 -43.623 71.736  1.00 29.21  ? 170 GLU A CD  1 
ATOM   1424 O OE1 . GLU A 1 170 ? -11.416 -44.627 70.989  1.00 32.46  ? 170 GLU A OE1 1 
ATOM   1425 O OE2 . GLU A 1 170 ? -11.081 -43.724 72.978  1.00 31.69  ? 170 GLU A OE2 1 
ATOM   1426 N N   . PRO A 1 171 ? -13.549 -41.364 74.289  1.00 24.84  ? 171 PRO A N   1 
ATOM   1427 C CA  . PRO A 1 171 ? -13.300 -40.566 75.483  1.00 25.56  ? 171 PRO A CA  1 
ATOM   1428 C C   . PRO A 1 171 ? -11.959 -39.848 75.522  1.00 25.93  ? 171 PRO A C   1 
ATOM   1429 O O   . PRO A 1 171 ? -11.886 -38.683 75.947  1.00 27.80  ? 171 PRO A O   1 
ATOM   1430 C CB  . PRO A 1 171 ? -13.466 -41.584 76.605  1.00 25.47  ? 171 PRO A CB  1 
ATOM   1431 C CG  . PRO A 1 171 ? -14.513 -42.482 76.082  1.00 24.67  ? 171 PRO A CG  1 
ATOM   1432 C CD  . PRO A 1 171 ? -14.167 -42.655 74.625  1.00 24.60  ? 171 PRO A CD  1 
ATOM   1433 N N   . SER A 1 172 ? -10.903 -40.515 75.098  1.00 25.55  ? 172 SER A N   1 
ATOM   1434 C CA  . SER A 1 172 ? -9.577  -39.930 75.193  1.00 26.79  ? 172 SER A CA  1 
ATOM   1435 C C   . SER A 1 172 ? -9.220  -38.914 74.088  1.00 28.61  ? 172 SER A C   1 
ATOM   1436 O O   . SER A 1 172 ? -8.130  -38.309 74.147  1.00 29.16  ? 172 SER A O   1 
ATOM   1437 C CB  . SER A 1 172 ? -8.520  -41.024 75.245  1.00 27.21  ? 172 SER A CB  1 
ATOM   1438 O OG  . SER A 1 172 ? -8.691  -41.903 74.148  1.00 30.78  ? 172 SER A OG  1 
ATOM   1439 N N   . CYS A 1 173 ? -10.096 -38.721 73.099  1.00 26.88  ? 173 CYS A N   1 
ATOM   1440 C CA  . CYS A 1 173 ? -9.770  -37.857 71.958  1.00 25.03  ? 173 CYS A CA  1 
ATOM   1441 C C   . CYS A 1 173 ? -9.404  -36.423 72.400  1.00 27.12  ? 173 CYS A C   1 
ATOM   1442 O O   . CYS A 1 173 ? -8.458  -35.815 71.878  1.00 29.78  ? 173 CYS A O   1 
ATOM   1443 C CB  . CYS A 1 173 ? -10.907 -37.853 70.919  1.00 21.00  ? 173 CYS A CB  1 
ATOM   1444 S SG  . CYS A 1 173 ? -12.436 -37.042 71.397  1.00 12.94  ? 173 CYS A SG  1 
ATOM   1445 N N   . LEU A 1 174 ? -10.140 -35.875 73.367  1.00 26.14  ? 174 LEU A N   1 
ATOM   1446 C CA  . LEU A 1 174 ? -9.890  -34.504 73.773  1.00 29.15  ? 174 LEU A CA  1 
ATOM   1447 C C   . LEU A 1 174 ? -8.810  -34.344 74.865  1.00 32.54  ? 174 LEU A C   1 
ATOM   1448 O O   . LEU A 1 174 ? -8.518  -33.215 75.289  1.00 31.48  ? 174 LEU A O   1 
ATOM   1449 C CB  . LEU A 1 174 ? -11.195 -33.848 74.209  1.00 28.76  ? 174 LEU A CB  1 
ATOM   1450 C CG  . LEU A 1 174 ? -11.951 -33.057 73.138  1.00 29.43  ? 174 LEU A CG  1 
ATOM   1451 C CD1 . LEU A 1 174 ? -12.352 -33.970 72.001  1.00 29.25  ? 174 LEU A CD1 1 
ATOM   1452 C CD2 . LEU A 1 174 ? -13.178 -32.430 73.756  1.00 25.74  ? 174 LEU A CD2 1 
ATOM   1453 N N   . ASP A 1 175 ? -8.225  -35.449 75.317  1.00 33.88  ? 175 ASP A N   1 
ATOM   1454 C CA  . ASP A 1 175 ? -7.201  -35.408 76.368  1.00 31.00  ? 175 ASP A CA  1 
ATOM   1455 C C   . ASP A 1 175 ? -5.969  -34.636 75.918  1.00 29.43  ? 175 ASP A C   1 
ATOM   1456 O O   . ASP A 1 175 ? -5.476  -33.761 76.628  1.00 31.47  ? 175 ASP A O   1 
ATOM   1457 C CB  . ASP A 1 175 ? -6.807  -36.826 76.796  1.00 32.66  ? 175 ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 175 ? -7.911  -37.538 77.592  1.00 33.83  ? 175 ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 175 ? -8.992  -36.960 77.878  1.00 35.90  ? 175 ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 175 ? -7.673  -38.712 77.934  1.00 36.79  ? 175 ASP A OD2 1 
ATOM   1461 N N   . ALA A 1 176 ? -5.510  -34.950 74.713  1.00 27.73  ? 176 ALA A N   1 
ATOM   1462 C CA  . ALA A 1 176 ? -4.337  -34.310 74.142  1.00 23.91  ? 176 ALA A CA  1 
ATOM   1463 C C   . ALA A 1 176 ? -4.607  -32.837 73.827  1.00 24.43  ? 176 ALA A C   1 
ATOM   1464 O O   . ALA A 1 176 ? -3.678  -32.107 73.435  1.00 23.04  ? 176 ALA A O   1 
ATOM   1465 C CB  . ALA A 1 176 ? -3.926  -35.024 72.883  1.00 23.22  ? 176 ALA A CB  1 
ATOM   1466 N N   . PHE A 1 177 ? -5.853  -32.411 74.001  1.00 23.72  ? 177 PHE A N   1 
ATOM   1467 C CA  . PHE A 1 177 ? -6.241  -31.033 73.694  1.00 23.76  ? 177 PHE A CA  1 
ATOM   1468 C C   . PHE A 1 177 ? -7.024  -30.494 74.883  1.00 25.37  ? 177 PHE A C   1 
ATOM   1469 O O   . PHE A 1 177 ? -8.232  -30.272 74.790  1.00 24.74  ? 177 PHE A O   1 
ATOM   1470 C CB  . PHE A 1 177 ? -7.109  -30.942 72.422  1.00 18.96  ? 177 PHE A CB  1 
ATOM   1471 C CG  . PHE A 1 177 ? -6.547  -31.681 71.251  1.00 14.16  ? 177 PHE A CG  1 
ATOM   1472 C CD1 . PHE A 1 177 ? -5.650  -31.053 70.400  1.00 13.61  ? 177 PHE A CD1 1 
ATOM   1473 C CD2 . PHE A 1 177 ? -6.915  -33.009 70.997  1.00 9.32   ? 177 PHE A CD2 1 
ATOM   1474 C CE1 . PHE A 1 177 ? -5.106  -31.737 69.300  1.00 14.05  ? 177 PHE A CE1 1 
ATOM   1475 C CE2 . PHE A 1 177 ? -6.382  -33.718 69.905  1.00 14.28  ? 177 PHE A CE2 1 
ATOM   1476 C CZ  . PHE A 1 177 ? -5.473  -33.076 69.049  1.00 13.96  ? 177 PHE A CZ  1 
ATOM   1477 N N   . PRO A 1 178 ? -6.322  -30.211 76.004  1.00 24.86  ? 178 PRO A N   1 
ATOM   1478 C CA  . PRO A 1 178 ? -6.962  -29.693 77.218  1.00 25.24  ? 178 PRO A CA  1 
ATOM   1479 C C   . PRO A 1 178 ? -7.790  -28.439 76.967  1.00 25.06  ? 178 PRO A C   1 
ATOM   1480 O O   . PRO A 1 178 ? -8.810  -28.193 77.623  1.00 23.68  ? 178 PRO A O   1 
ATOM   1481 C CB  . PRO A 1 178 ? -5.755  -29.349 78.105  1.00 26.20  ? 178 PRO A CB  1 
ATOM   1482 C CG  . PRO A 1 178 ? -4.649  -29.157 77.137  1.00 21.74  ? 178 PRO A CG  1 
ATOM   1483 C CD  . PRO A 1 178 ? -4.863  -30.221 76.122  1.00 21.61  ? 178 PRO A CD  1 
ATOM   1484 N N   . ASN A 1 179 ? -7.347  -27.652 75.999  1.00 25.43  ? 179 ASN A N   1 
ATOM   1485 C CA  . ASN A 1 179 ? -8.051  -26.458 75.524  1.00 24.43  ? 179 ASN A CA  1 
ATOM   1486 C C   . ASN A 1 179 ? -9.552  -26.751 75.250  1.00 25.58  ? 179 ASN A C   1 
ATOM   1487 O O   . ASN A 1 179 ? -10.455 -26.112 75.793  1.00 24.60  ? 179 ASN A O   1 
ATOM   1488 C CB  . ASN A 1 179 ? -7.371  -25.967 74.228  1.00 23.00  ? 179 ASN A CB  1 
ATOM   1489 C CG  . ASN A 1 179 ? -7.851  -24.606 73.811  1.00 21.21  ? 179 ASN A CG  1 
ATOM   1490 O OD1 . ASN A 1 179 ? -8.626  -23.930 74.536  1.00 22.70  ? 179 ASN A OD1 1 
ATOM   1491 N ND2 . ASN A 1 179 ? -7.418  -24.174 72.634  1.00 18.92  ? 179 ASN A ND2 1 
ATOM   1492 N N   . LEU A 1 180 ? -9.784  -27.749 74.422  1.00 24.83  ? 180 LEU A N   1 
ATOM   1493 C CA  . LEU A 1 180 ? -11.110 -28.159 74.016  1.00 22.22  ? 180 LEU A CA  1 
ATOM   1494 C C   . LEU A 1 180 ? -11.846 -28.855 75.145  1.00 23.68  ? 180 LEU A C   1 
ATOM   1495 O O   . LEU A 1 180 ? -13.066 -28.654 75.308  1.00 24.92  ? 180 LEU A O   1 
ATOM   1496 C CB  . LEU A 1 180 ? -11.032 -29.063 72.788  1.00 19.33  ? 180 LEU A CB  1 
ATOM   1497 C CG  . LEU A 1 180 ? -10.287 -28.494 71.588  1.00 15.14  ? 180 LEU A CG  1 
ATOM   1498 C CD1 . LEU A 1 180 ? -10.196 -29.541 70.495  1.00 15.35  ? 180 LEU A CD1 1 
ATOM   1499 C CD2 . LEU A 1 180 ? -11.001 -27.223 71.127  1.00 15.13  ? 180 LEU A CD2 1 
ATOM   1500 N N   . LYS A 1 181 ? -11.116 -29.660 75.931  1.00 25.06  ? 181 LYS A N   1 
ATOM   1501 C CA  . LYS A 1 181 ? -11.714 -30.334 77.084  1.00 27.05  ? 181 LYS A CA  1 
ATOM   1502 C C   . LYS A 1 181 ? -12.293 -29.350 78.135  1.00 25.75  ? 181 LYS A C   1 
ATOM   1503 O O   . LYS A 1 181 ? -13.375 -29.566 78.709  1.00 24.72  ? 181 LYS A O   1 
ATOM   1504 C CB  . LYS A 1 181 ? -10.705 -31.266 77.748  1.00 28.68  ? 181 LYS A CB  1 
ATOM   1505 C CG  . LYS A 1 181 ? -11.383 -32.282 78.657  1.00 35.34  ? 181 LYS A CG  1 
ATOM   1506 C CD  . LYS A 1 181 ? -10.372 -32.953 79.587  1.00 39.40  ? 181 LYS A CD  1 
ATOM   1507 C CE  . LYS A 1 181 ? -9.369  -33.808 78.807  1.00 41.04  ? 181 LYS A CE  1 
ATOM   1508 N NZ  . LYS A 1 181 ? -8.441  -34.526 79.736  1.00 40.36  ? 181 LYS A NZ  1 
ATOM   1509 N N   . ASP A 1 182 ? -11.581 -28.245 78.339  1.00 22.29  ? 182 ASP A N   1 
ATOM   1510 C CA  . ASP A 1 182 ? -12.037 -27.202 79.240  1.00 22.53  ? 182 ASP A CA  1 
ATOM   1511 C C   . ASP A 1 182 ? -13.247 -26.453 78.728  1.00 22.12  ? 182 ASP A C   1 
ATOM   1512 O O   . ASP A 1 182 ? -14.071 -25.994 79.521  1.00 22.71  ? 182 ASP A O   1 
ATOM   1513 C CB  . ASP A 1 182 ? -10.919 -26.209 79.523  1.00 22.79  ? 182 ASP A CB  1 
ATOM   1514 C CG  . ASP A 1 182 ? -9.806  -26.806 80.374  1.00 22.64  ? 182 ASP A CG  1 
ATOM   1515 O OD1 . ASP A 1 182 ? -10.058 -27.770 81.159  1.00 18.09  ? 182 ASP A OD1 1 
ATOM   1516 O OD2 . ASP A 1 182 ? -8.667  -26.299 80.233  1.00 25.13  ? 182 ASP A OD2 1 
ATOM   1517 N N   . PHE A 1 183 ? -13.349 -26.364 77.406  1.00 23.51  ? 183 PHE A N   1 
ATOM   1518 C CA  . PHE A 1 183 ? -14.493 -25.754 76.741  1.00 20.48  ? 183 PHE A CA  1 
ATOM   1519 C C   . PHE A 1 183 ? -15.777 -26.474 77.152  1.00 20.67  ? 183 PHE A C   1 
ATOM   1520 O O   . PHE A 1 183 ? -16.703 -25.858 77.682  1.00 18.53  ? 183 PHE A O   1 
ATOM   1521 C CB  . PHE A 1 183 ? -14.299 -25.806 75.221  1.00 17.38  ? 183 PHE A CB  1 
ATOM   1522 C CG  . PHE A 1 183 ? -15.426 -25.205 74.444  1.00 14.68  ? 183 PHE A CG  1 
ATOM   1523 C CD1 . PHE A 1 183 ? -15.566 -23.810 74.368  1.00 18.05  ? 183 PHE A CD1 1 
ATOM   1524 C CD2 . PHE A 1 183 ? -16.364 -26.030 73.796  1.00 11.69  ? 183 PHE A CD2 1 
ATOM   1525 C CE1 . PHE A 1 183 ? -16.636 -23.244 73.637  1.00 16.50  ? 183 PHE A CE1 1 
ATOM   1526 C CE2 . PHE A 1 183 ? -17.426 -25.483 73.086  1.00 8.40   ? 183 PHE A CE2 1 
ATOM   1527 C CZ  . PHE A 1 183 ? -17.568 -24.087 72.997  1.00 13.33  ? 183 PHE A CZ  1 
ATOM   1528 N N   . ILE A 1 184 ? -15.823 -27.784 76.913  1.00 20.68  ? 184 ILE A N   1 
ATOM   1529 C CA  . ILE A 1 184 ? -16.990 -28.593 77.243  1.00 21.85  ? 184 ILE A CA  1 
ATOM   1530 C C   . ILE A 1 184 ? -17.405 -28.334 78.679  1.00 23.01  ? 184 ILE A C   1 
ATOM   1531 O O   . ILE A 1 184 ? -18.574 -28.105 78.949  1.00 27.37  ? 184 ILE A O   1 
ATOM   1532 C CB  . ILE A 1 184 ? -16.703 -30.092 77.018  1.00 21.32  ? 184 ILE A CB  1 
ATOM   1533 C CG1 . ILE A 1 184 ? -16.511 -30.347 75.525  1.00 20.97  ? 184 ILE A CG1 1 
ATOM   1534 C CG2 . ILE A 1 184 ? -17.812 -30.951 77.564  1.00 21.17  ? 184 ILE A CG2 1 
ATOM   1535 C CD1 . ILE A 1 184 ? -16.184 -31.796 75.213  1.00 15.50  ? 184 ILE A CD1 1 
ATOM   1536 N N   . SER A 1 185 ? -16.433 -28.373 79.603  1.00 23.04  ? 185 SER A N   1 
ATOM   1537 C CA  . SER A 1 185 ? -16.677 -28.151 81.026  1.00 19.94  ? 185 SER A CA  1 
ATOM   1538 C C   . SER A 1 185 ? -17.317 -26.803 81.272  1.00 18.96  ? 185 SER A C   1 
ATOM   1539 O O   . SER A 1 185 ? -18.331 -26.697 81.918  1.00 17.59  ? 185 SER A O   1 
ATOM   1540 C CB  . SER A 1 185 ? -15.354 -28.275 81.815  1.00 17.19  ? 185 SER A CB  1 
ATOM   1541 O OG  . SER A 1 185 ? -14.669 -29.513 81.551  1.00 15.24  ? 185 SER A OG  1 
ATOM   1542 N N   . ARG A 1 186 ? -16.698 -25.767 80.719  1.00 20.20  ? 186 ARG A N   1 
ATOM   1543 C CA  . ARG A 1 186 ? -17.166 -24.406 80.881  1.00 21.94  ? 186 ARG A CA  1 
ATOM   1544 C C   . ARG A 1 186 ? -18.601 -24.277 80.373  1.00 24.62  ? 186 ARG A C   1 
ATOM   1545 O O   . ARG A 1 186 ? -19.413 -23.574 80.988  1.00 24.19  ? 186 ARG A O   1 
ATOM   1546 C CB  . ARG A 1 186 ? -16.224 -23.459 80.116  1.00 21.97  ? 186 ARG A CB  1 
ATOM   1547 C CG  . ARG A 1 186 ? -16.656 -22.009 80.056  1.00 26.99  ? 186 ARG A CG  1 
ATOM   1548 C CD  . ARG A 1 186 ? -15.591 -21.118 79.454  1.00 30.05  ? 186 ARG A CD  1 
ATOM   1549 N NE  . ARG A 1 186 ? -14.959 -21.728 78.298  1.00 35.09  ? 186 ARG A NE  1 
ATOM   1550 C CZ  . ARG A 1 186 ? -13.699 -22.140 78.276  1.00 34.51  ? 186 ARG A CZ  1 
ATOM   1551 N NH1 . ARG A 1 186 ? -12.937 -21.993 79.338  1.00 34.40  ? 186 ARG A NH1 1 
ATOM   1552 N NH2 . ARG A 1 186 ? -13.206 -22.694 77.187  1.00 34.87  ? 186 ARG A NH2 1 
ATOM   1553 N N   . PHE A 1 187 ? -18.893 -24.938 79.255  1.00 25.56  ? 187 PHE A N   1 
ATOM   1554 C CA  . PHE A 1 187 ? -20.204 -24.869 78.628  1.00 22.36  ? 187 PHE A CA  1 
ATOM   1555 C C   . PHE A 1 187 ? -21.238 -25.534 79.521  1.00 20.21  ? 187 PHE A C   1 
ATOM   1556 O O   . PHE A 1 187 ? -22.271 -24.932 79.835  1.00 19.72  ? 187 PHE A O   1 
ATOM   1557 C CB  . PHE A 1 187 ? -20.199 -25.499 77.231  1.00 22.46  ? 187 PHE A CB  1 
ATOM   1558 C CG  . PHE A 1 187 ? -21.470 -25.304 76.471  1.00 22.09  ? 187 PHE A CG  1 
ATOM   1559 C CD1 . PHE A 1 187 ? -21.673 -24.146 75.723  1.00 21.28  ? 187 PHE A CD1 1 
ATOM   1560 C CD2 . PHE A 1 187 ? -22.491 -26.255 76.539  1.00 22.70  ? 187 PHE A CD2 1 
ATOM   1561 C CE1 . PHE A 1 187 ? -22.875 -23.945 75.039  1.00 21.03  ? 187 PHE A CE1 1 
ATOM   1562 C CE2 . PHE A 1 187 ? -23.709 -26.061 75.853  1.00 21.73  ? 187 PHE A CE2 1 
ATOM   1563 C CZ  . PHE A 1 187 ? -23.894 -24.906 75.107  1.00 20.50  ? 187 PHE A CZ  1 
ATOM   1564 N N   . GLU A 1 188 ? -20.944 -26.762 79.943  1.00 16.93  ? 188 GLU A N   1 
ATOM   1565 C CA  . GLU A 1 188 ? -21.856 -27.492 80.805  1.00 18.21  ? 188 GLU A CA  1 
ATOM   1566 C C   . GLU A 1 188 ? -21.994 -26.797 82.162  1.00 19.69  ? 188 GLU A C   1 
ATOM   1567 O O   . GLU A 1 188 ? -22.937 -27.033 82.916  1.00 18.54  ? 188 GLU A O   1 
ATOM   1568 C CB  . GLU A 1 188 ? -21.381 -28.931 80.974  1.00 17.88  ? 188 GLU A CB  1 
ATOM   1569 C CG  . GLU A 1 188 ? -21.304 -29.716 79.659  1.00 19.03  ? 188 GLU A CG  1 
ATOM   1570 C CD  . GLU A 1 188 ? -20.780 -31.131 79.830  1.00 19.47  ? 188 GLU A CD  1 
ATOM   1571 O OE1 . GLU A 1 188 ? -19.846 -31.356 80.628  1.00 22.08  ? 188 GLU A OE1 1 
ATOM   1572 O OE2 . GLU A 1 188 ? -21.316 -32.048 79.174  1.00 24.16  ? 188 GLU A OE2 1 
ATOM   1573 N N   . GLY A 1 189 ? -21.023 -25.939 82.447  1.00 20.28  ? 189 GLY A N   1 
ATOM   1574 C CA  . GLY A 1 189 ? -21.019 -25.193 83.683  1.00 20.01  ? 189 GLY A CA  1 
ATOM   1575 C C   . GLY A 1 189 ? -21.921 -23.995 83.686  1.00 20.43  ? 189 GLY A C   1 
ATOM   1576 O O   . GLY A 1 189 ? -22.127 -23.404 84.718  1.00 21.27  ? 189 GLY A O   1 
ATOM   1577 N N   . LEU A 1 190 ? -22.478 -23.645 82.534  1.00 22.64  ? 190 LEU A N   1 
ATOM   1578 C CA  . LEU A 1 190 ? -23.389 -22.510 82.479  1.00 24.62  ? 190 LEU A CA  1 
ATOM   1579 C C   . LEU A 1 190 ? -24.663 -22.859 83.234  1.00 26.06  ? 190 LEU A C   1 
ATOM   1580 O O   . LEU A 1 190 ? -25.227 -23.925 83.040  1.00 24.48  ? 190 LEU A O   1 
ATOM   1581 C CB  . LEU A 1 190 ? -23.721 -22.161 81.018  1.00 25.97  ? 190 LEU A CB  1 
ATOM   1582 C CG  . LEU A 1 190 ? -22.565 -21.729 80.097  1.00 25.04  ? 190 LEU A CG  1 
ATOM   1583 C CD1 . LEU A 1 190 ? -23.044 -21.650 78.671  1.00 26.37  ? 190 LEU A CD1 1 
ATOM   1584 C CD2 . LEU A 1 190 ? -22.036 -20.383 80.546  1.00 25.06  ? 190 LEU A CD2 1 
ATOM   1585 N N   . GLU A 1 191 ? -25.090 -21.972 84.117  1.00 28.29  ? 191 GLU A N   1 
ATOM   1586 C CA  . GLU A 1 191 ? -26.242 -22.209 84.978  1.00 31.43  ? 191 GLU A CA  1 
ATOM   1587 C C   . GLU A 1 191 ? -27.442 -22.854 84.258  1.00 32.84  ? 191 GLU A C   1 
ATOM   1588 O O   . GLU A 1 191 ? -27.918 -23.912 84.683  1.00 32.08  ? 191 GLU A O   1 
ATOM   1589 C CB  . GLU A 1 191 ? -26.666 -20.894 85.646  1.00 34.59  ? 191 GLU A CB  1 
ATOM   1590 C CG  . GLU A 1 191 ? -27.712 -21.081 86.752  1.00 41.46  ? 191 GLU A CG  1 
ATOM   1591 C CD  . GLU A 1 191 ? -27.225 -21.987 87.905  1.00 44.75  ? 191 GLU A CD  1 
ATOM   1592 O OE1 . GLU A 1 191 ? -26.599 -21.450 88.862  1.00 45.86  ? 191 GLU A OE1 1 
ATOM   1593 O OE2 . GLU A 1 191 ? -27.466 -23.226 87.838  1.00 46.81  ? 191 GLU A OE2 1 
ATOM   1594 N N   . LYS A 1 192 ? -27.899 -22.225 83.177  1.00 33.48  ? 192 LYS A N   1 
ATOM   1595 C CA  . LYS A 1 192 ? -29.052 -22.685 82.399  1.00 30.62  ? 192 LYS A CA  1 
ATOM   1596 C C   . LYS A 1 192 ? -28.795 -24.049 81.747  1.00 30.58  ? 192 LYS A C   1 
ATOM   1597 O O   . LYS A 1 192 ? -29.694 -24.880 81.668  1.00 30.63  ? 192 LYS A O   1 
ATOM   1598 C CB  . LYS A 1 192 ? -29.410 -21.669 81.321  1.00 30.41  ? 192 LYS A CB  1 
ATOM   1599 C CG  . LYS A 1 192 ? -29.710 -20.286 81.834  1.00 30.66  ? 192 LYS A CG  1 
ATOM   1600 C CD  . LYS A 1 192 ? -29.119 -19.233 80.925  1.00 31.45  ? 192 LYS A CD  1 
ATOM   1601 C CE  . LYS A 1 192 ? -29.474 -17.819 81.370  1.00 34.68  ? 192 LYS A CE  1 
ATOM   1602 N NZ  . LYS A 1 192 ? -30.952 -17.565 81.382  1.00 32.42  ? 192 LYS A NZ  1 
ATOM   1603 N N   . ILE A 1 193 ? -27.555 -24.298 81.328  1.00 31.55  ? 193 ILE A N   1 
ATOM   1604 C CA  . ILE A 1 193 ? -27.205 -25.551 80.682  1.00 31.12  ? 193 ILE A CA  1 
ATOM   1605 C C   . ILE A 1 193 ? -27.220 -26.648 81.728  1.00 31.00  ? 193 ILE A C   1 
ATOM   1606 O O   . ILE A 1 193 ? -27.825 -27.679 81.518  1.00 30.41  ? 193 ILE A O   1 
ATOM   1607 C CB  . ILE A 1 193 ? -25.812 -25.469 79.999  1.00 30.60  ? 193 ILE A CB  1 
ATOM   1608 C CG1 . ILE A 1 193 ? -25.801 -24.328 78.977  1.00 28.06  ? 193 ILE A CG1 1 
ATOM   1609 C CG2 . ILE A 1 193 ? -25.450 -26.792 79.345  1.00 28.97  ? 193 ILE A CG2 1 
ATOM   1610 C CD1 . ILE A 1 193 ? -26.814 -24.450 77.892  1.00 31.05  ? 193 ILE A CD1 1 
ATOM   1611 N N   . SER A 1 194 ? -26.528 -26.431 82.853  1.00 30.64  ? 194 SER A N   1 
ATOM   1612 C CA  . SER A 1 194 ? -26.439 -27.425 83.929  1.00 31.55  ? 194 SER A CA  1 
ATOM   1613 C C   . SER A 1 194 ? -27.820 -27.786 84.465  1.00 26.46  ? 194 SER A C   1 
ATOM   1614 O O   . SER A 1 194 ? -28.150 -28.949 84.658  1.00 25.54  ? 194 SER A O   1 
ATOM   1615 C CB  . SER A 1 194 ? -25.551 -26.904 85.075  1.00 35.44  ? 194 SER A CB  1 
ATOM   1616 O OG  . SER A 1 194 ? -25.885 -25.560 85.423  1.00 41.62  ? 194 SER A OG  1 
ATOM   1617 N N   . ALA A 1 195 ? -28.641 -26.764 84.667  1.00 22.37  ? 195 ALA A N   1 
ATOM   1618 C CA  . ALA A 1 195 ? -30.015 -26.955 85.086  1.00 22.06  ? 195 ALA A CA  1 
ATOM   1619 C C   . ALA A 1 195 ? -30.773 -27.842 84.090  1.00 22.21  ? 195 ALA A C   1 
ATOM   1620 O O   . ALA A 1 195 ? -31.377 -28.820 84.488  1.00 21.85  ? 195 ALA A O   1 
ATOM   1621 C CB  . ALA A 1 195 ? -30.703 -25.592 85.255  1.00 19.76  ? 195 ALA A CB  1 
ATOM   1622 N N   . TYR A 1 196 ? -30.708 -27.500 82.810  1.00 22.06  ? 196 TYR A N   1 
ATOM   1623 C CA  . TYR A 1 196 ? -31.336 -28.279 81.760  1.00 20.38  ? 196 TYR A CA  1 
ATOM   1624 C C   . TYR A 1 196 ? -30.825 -29.715 81.748  1.00 22.46  ? 196 TYR A C   1 
ATOM   1625 O O   . TYR A 1 196 ? -31.573 -30.629 81.497  1.00 22.44  ? 196 TYR A O   1 
ATOM   1626 C CB  . TYR A 1 196 ? -31.110 -27.585 80.409  1.00 21.71  ? 196 TYR A CB  1 
ATOM   1627 C CG  . TYR A 1 196 ? -31.513 -28.421 79.195  1.00 23.57  ? 196 TYR A CG  1 
ATOM   1628 C CD1 . TYR A 1 196 ? -32.803 -28.968 79.081  1.00 24.92  ? 196 TYR A CD1 1 
ATOM   1629 C CD2 . TYR A 1 196 ? -30.587 -28.691 78.171  1.00 22.31  ? 196 TYR A CD2 1 
ATOM   1630 C CE1 . TYR A 1 196 ? -33.151 -29.752 77.974  1.00 25.65  ? 196 TYR A CE1 1 
ATOM   1631 C CE2 . TYR A 1 196 ? -30.932 -29.473 77.072  1.00 25.00  ? 196 TYR A CE2 1 
ATOM   1632 C CZ  . TYR A 1 196 ? -32.196 -29.981 76.973  1.00 26.71  ? 196 TYR A CZ  1 
ATOM   1633 O OH  . TYR A 1 196 ? -32.487 -30.719 75.858  1.00 27.44  ? 196 TYR A OH  1 
ATOM   1634 N N   . MET A 1 197 ? -29.535 -29.906 82.015  1.00 25.00  ? 197 MET A N   1 
ATOM   1635 C CA  . MET A 1 197 ? -28.939 -31.229 81.994  1.00 26.24  ? 197 MET A CA  1 
ATOM   1636 C C   . MET A 1 197 ? -29.407 -32.079 83.160  1.00 29.22  ? 197 MET A C   1 
ATOM   1637 O O   . MET A 1 197 ? -29.283 -33.303 83.131  1.00 27.10  ? 197 MET A O   1 
ATOM   1638 C CB  . MET A 1 197 ? -27.410 -31.109 82.013  1.00 27.91  ? 197 MET A CB  1 
ATOM   1639 C CG  . MET A 1 197 ? -26.833 -30.476 80.761  1.00 32.04  ? 197 MET A CG  1 
ATOM   1640 S SD  . MET A 1 197 ? -25.107 -30.208 80.743  1.00 36.14  ? 197 MET A SD  1 
ATOM   1641 C CE  . MET A 1 197 ? -24.555 -31.746 80.086  1.00 35.05  ? 197 MET A CE  1 
ATOM   1642 N N   . LYS A 1 198 ? -29.969 -31.428 84.177  1.00 30.51  ? 198 LYS A N   1 
ATOM   1643 C CA  . LYS A 1 198 ? -30.541 -32.134 85.317  1.00 32.75  ? 198 LYS A CA  1 
ATOM   1644 C C   . LYS A 1 198 ? -31.993 -32.455 85.029  1.00 33.94  ? 198 LYS A C   1 
ATOM   1645 O O   . LYS A 1 198 ? -32.570 -33.331 85.637  1.00 34.82  ? 198 LYS A O   1 
ATOM   1646 C CB  . LYS A 1 198 ? -30.451 -31.276 86.594  1.00 33.32  ? 198 LYS A CB  1 
ATOM   1647 C CG  . LYS A 1 198 ? -29.051 -30.855 87.008  1.00 34.58  ? 198 LYS A CG  1 
ATOM   1648 C CD  . LYS A 1 198 ? -29.109 -29.829 88.129  1.00 35.94  ? 198 LYS A CD  1 
ATOM   1649 C CE  . LYS A 1 198 ? -27.711 -29.310 88.505  1.00 36.79  ? 198 LYS A CE  1 
ATOM   1650 N NZ  . LYS A 1 198 ? -27.770 -28.300 89.603  1.00 38.42  ? 198 LYS A NZ  1 
ATOM   1651 N N   . SER A 1 199 ? -32.570 -31.712 84.092  1.00 33.88  ? 199 SER A N   1 
ATOM   1652 C CA  . SER A 1 199 ? -33.967 -31.860 83.707  1.00 34.31  ? 199 SER A CA  1 
ATOM   1653 C C   . SER A 1 199 ? -34.197 -33.157 82.925  1.00 34.30  ? 199 SER A C   1 
ATOM   1654 O O   . SER A 1 199 ? -33.285 -33.696 82.281  1.00 34.72  ? 199 SER A O   1 
ATOM   1655 C CB  . SER A 1 199 ? -34.392 -30.677 82.833  1.00 34.13  ? 199 SER A CB  1 
ATOM   1656 O OG  . SER A 1 199 ? -35.682 -30.870 82.291  1.00 37.25  ? 199 SER A OG  1 
ATOM   1657 N N   . SER A 1 200 ? -35.430 -33.646 82.975  1.00 34.09  ? 200 SER A N   1 
ATOM   1658 C CA  . SER A 1 200 ? -35.804 -34.879 82.288  1.00 34.80  ? 200 SER A CA  1 
ATOM   1659 C C   . SER A 1 200 ? -35.885 -34.627 80.787  1.00 32.70  ? 200 SER A C   1 
ATOM   1660 O O   . SER A 1 200 ? -35.848 -35.559 79.984  1.00 35.01  ? 200 SER A O   1 
ATOM   1661 C CB  . SER A 1 200 ? -37.149 -35.382 82.816  1.00 35.66  ? 200 SER A CB  1 
ATOM   1662 O OG  . SER A 1 200 ? -38.058 -34.297 82.988  1.00 39.71  ? 200 SER A OG  1 
ATOM   1663 N N   . ARG A 1 201 ? -35.977 -33.357 80.409  1.00 31.18  ? 201 ARG A N   1 
ATOM   1664 C CA  . ARG A 1 201 ? -36.063 -32.978 79.004  1.00 29.37  ? 201 ARG A CA  1 
ATOM   1665 C C   . ARG A 1 201 ? -34.709 -32.995 78.288  1.00 28.28  ? 201 ARG A C   1 
ATOM   1666 O O   . ARG A 1 201 ? -34.621 -32.472 77.177  1.00 28.65  ? 201 ARG A O   1 
ATOM   1667 C CB  . ARG A 1 201 ? -36.689 -31.573 78.867  1.00 26.18  ? 201 ARG A CB  1 
ATOM   1668 C CG  . ARG A 1 201 ? -37.891 -31.309 79.760  1.00 28.24  ? 201 ARG A CG  1 
ATOM   1669 C CD  . ARG A 1 201 ? -38.372 -29.902 79.597  1.00 26.46  ? 201 ARG A CD  1 
ATOM   1670 N NE  . ARG A 1 201 ? -37.312 -28.928 79.863  1.00 27.09  ? 201 ARG A NE  1 
ATOM   1671 C CZ  . ARG A 1 201 ? -37.094 -28.356 81.049  1.00 28.27  ? 201 ARG A CZ  1 
ATOM   1672 N NH1 . ARG A 1 201 ? -37.909 -28.602 82.085  1.00 28.24  ? 201 ARG A NH1 1 
ATOM   1673 N NH2 . ARG A 1 201 ? -36.058 -27.525 81.221  1.00 28.66  ? 201 ARG A NH2 1 
ATOM   1674 N N   . PHE A 1 202 ? -33.679 -33.551 78.917  1.00 26.39  ? 202 PHE A N   1 
ATOM   1675 C CA  . PHE A 1 202 ? -32.338 -33.493 78.361  1.00 24.59  ? 202 PHE A CA  1 
ATOM   1676 C C   . PHE A 1 202 ? -32.141 -34.300 77.076  1.00 24.51  ? 202 PHE A C   1 
ATOM   1677 O O   . PHE A 1 202 ? -31.806 -33.740 76.004  1.00 23.88  ? 202 PHE A O   1 
ATOM   1678 C CB  . PHE A 1 202 ? -31.286 -33.880 79.384  1.00 22.78  ? 202 PHE A CB  1 
ATOM   1679 C CG  . PHE A 1 202 ? -29.884 -33.585 78.935  1.00 22.17  ? 202 PHE A CG  1 
ATOM   1680 C CD1 . PHE A 1 202 ? -29.589 -32.377 78.290  1.00 22.40  ? 202 PHE A CD1 1 
ATOM   1681 C CD2 . PHE A 1 202 ? -28.870 -34.525 79.108  1.00 20.54  ? 202 PHE A CD2 1 
ATOM   1682 C CE1 . PHE A 1 202 ? -28.289 -32.117 77.820  1.00 22.28  ? 202 PHE A CE1 1 
ATOM   1683 C CE2 . PHE A 1 202 ? -27.565 -34.271 78.648  1.00 20.40  ? 202 PHE A CE2 1 
ATOM   1684 C CZ  . PHE A 1 202 ? -27.278 -33.070 78.002  1.00 20.86  ? 202 PHE A CZ  1 
ATOM   1685 N N   . LEU A 1 203 ? -32.363 -35.620 77.164  1.00 23.81  ? 203 LEU A N   1 
ATOM   1686 C CA  . LEU A 1 203 ? -32.196 -36.478 75.969  1.00 25.27  ? 203 LEU A CA  1 
ATOM   1687 C C   . LEU A 1 203 ? -30.787 -36.325 75.303  1.00 25.42  ? 203 LEU A C   1 
ATOM   1688 O O   . LEU A 1 203 ? -30.634 -35.737 74.235  1.00 26.67  ? 203 LEU A O   1 
ATOM   1689 C CB  . LEU A 1 203 ? -33.334 -36.193 74.959  1.00 21.13  ? 203 LEU A CB  1 
ATOM   1690 C CG  . LEU A 1 203 ? -33.497 -37.108 73.749  1.00 22.22  ? 203 LEU A CG  1 
ATOM   1691 C CD1 . LEU A 1 203 ? -33.775 -38.524 74.172  1.00 20.30  ? 203 LEU A CD1 1 
ATOM   1692 C CD2 . LEU A 1 203 ? -34.612 -36.565 72.892  1.00 26.31  ? 203 LEU A CD2 1 
ATOM   1693 N N   . PRO A 1 204 ? -29.725 -36.831 75.966  1.00 24.84  ? 204 PRO A N   1 
ATOM   1694 C CA  . PRO A 1 204 ? -28.375 -36.755 75.407  1.00 23.90  ? 204 PRO A CA  1 
ATOM   1695 C C   . PRO A 1 204 ? -28.109 -37.842 74.396  1.00 23.17  ? 204 PRO A C   1 
ATOM   1696 O O   . PRO A 1 204 ? -27.231 -37.715 73.553  1.00 21.60  ? 204 PRO A O   1 
ATOM   1697 C CB  . PRO A 1 204 ? -27.509 -36.977 76.648  1.00 21.01  ? 204 PRO A CB  1 
ATOM   1698 C CG  . PRO A 1 204 ? -28.297 -37.924 77.461  1.00 23.37  ? 204 PRO A CG  1 
ATOM   1699 C CD  . PRO A 1 204 ? -29.746 -37.464 77.279  1.00 24.47  ? 204 PRO A CD  1 
ATOM   1700 N N   . ARG A 1 205 ? -28.862 -38.925 74.512  1.00 24.28  ? 205 ARG A N   1 
ATOM   1701 C CA  . ARG A 1 205 ? -28.722 -40.077 73.640  1.00 24.52  ? 205 ARG A CA  1 
ATOM   1702 C C   . ARG A 1 205 ? -30.132 -40.629 73.448  1.00 22.31  ? 205 ARG A C   1 
ATOM   1703 O O   . ARG A 1 205 ? -31.024 -40.292 74.236  1.00 23.74  ? 205 ARG A O   1 
ATOM   1704 C CB  . ARG A 1 205 ? -27.792 -41.117 74.261  1.00 27.98  ? 205 ARG A CB  1 
ATOM   1705 C CG  . ARG A 1 205 ? -26.356 -40.669 74.361  1.00 35.08  ? 205 ARG A CG  1 
ATOM   1706 C CD  . ARG A 1 205 ? -25.475 -41.771 74.925  1.00 39.37  ? 205 ARG A CD  1 
ATOM   1707 N NE  . ARG A 1 205 ? -24.103 -41.315 75.162  1.00 44.53  ? 205 ARG A NE  1 
ATOM   1708 C CZ  . ARG A 1 205 ? -23.187 -42.009 75.844  1.00 47.51  ? 205 ARG A CZ  1 
ATOM   1709 N NH1 . ARG A 1 205 ? -23.489 -43.206 76.357  1.00 49.70  ? 205 ARG A NH1 1 
ATOM   1710 N NH2 . ARG A 1 205 ? -21.963 -41.513 76.018  1.00 47.81  ? 205 ARG A NH2 1 
ATOM   1711 N N   . PRO A 1 206 ? -30.356 -41.501 72.413  1.00 19.08  ? 206 PRO A N   1 
ATOM   1712 C CA  . PRO A 1 206 ? -29.415 -41.925 71.388  1.00 18.80  ? 206 PRO A CA  1 
ATOM   1713 C C   . PRO A 1 206 ? -28.906 -40.805 70.524  1.00 19.90  ? 206 PRO A C   1 
ATOM   1714 O O   . PRO A 1 206 ? -29.538 -39.740 70.431  1.00 18.08  ? 206 PRO A O   1 
ATOM   1715 C CB  . PRO A 1 206 ? -30.226 -42.941 70.594  1.00 13.87  ? 206 PRO A CB  1 
ATOM   1716 C CG  . PRO A 1 206 ? -31.590 -42.627 70.883  1.00 14.44  ? 206 PRO A CG  1 
ATOM   1717 C CD  . PRO A 1 206 ? -31.643 -42.185 72.260  1.00 14.68  ? 206 PRO A CD  1 
ATOM   1718 N N   . VAL A 1 207 ? -27.742 -41.038 69.903  1.00 21.98  ? 207 VAL A N   1 
ATOM   1719 C CA  . VAL A 1 207 ? -27.071 -40.035 69.081  1.00 20.92  ? 207 VAL A CA  1 
ATOM   1720 C C   . VAL A 1 207 ? -27.724 -39.942 67.711  1.00 19.59  ? 207 VAL A C   1 
ATOM   1721 O O   . VAL A 1 207 ? -28.033 -38.849 67.246  1.00 19.24  ? 207 VAL A O   1 
ATOM   1722 C CB  . VAL A 1 207 ? -25.564 -40.347 68.902  1.00 22.19  ? 207 VAL A CB  1 
ATOM   1723 C CG1 . VAL A 1 207 ? -24.884 -39.229 68.143  1.00 22.79  ? 207 VAL A CG1 1 
ATOM   1724 C CG2 . VAL A 1 207 ? -24.922 -40.525 70.254  1.00 21.46  ? 207 VAL A CG2 1 
ATOM   1725 N N   . PHE A 1 208 ? -27.941 -41.103 67.064  1.00 20.18  ? 208 PHE A N   1 
ATOM   1726 C CA  . PHE A 1 208 ? -28.491 -41.158 65.710  1.00 21.77  ? 208 PHE A CA  1 
ATOM   1727 C C   . PHE A 1 208 ? -29.817 -41.922 65.693  1.00 23.57  ? 208 PHE A C   1 
ATOM   1728 O O   . PHE A 1 208 ? -30.291 -42.400 66.738  1.00 24.64  ? 208 PHE A O   1 
ATOM   1729 C CB  . PHE A 1 208 ? -27.491 -41.805 64.740  1.00 18.74  ? 208 PHE A CB  1 
ATOM   1730 C CG  . PHE A 1 208 ? -26.215 -41.038 64.580  1.00 14.24  ? 208 PHE A CG  1 
ATOM   1731 C CD1 . PHE A 1 208 ? -26.233 -39.706 64.154  1.00 11.37  ? 208 PHE A CD1 1 
ATOM   1732 C CD2 . PHE A 1 208 ? -24.992 -41.633 64.883  1.00 13.01  ? 208 PHE A CD2 1 
ATOM   1733 C CE1 . PHE A 1 208 ? -25.045 -38.977 64.036  1.00 12.62  ? 208 PHE A CE1 1 
ATOM   1734 C CE2 . PHE A 1 208 ? -23.806 -40.914 64.774  1.00 11.66  ? 208 PHE A CE2 1 
ATOM   1735 C CZ  . PHE A 1 208 ? -23.831 -39.582 64.348  1.00 12.10  ? 208 PHE A CZ  1 
ATOM   1736 N N   . THR A 1 209 ? -30.414 -42.043 64.508  1.00 25.33  ? 209 THR A N   1 
ATOM   1737 C CA  . THR A 1 209 ? -31.679 -42.761 64.368  1.00 28.08  ? 209 THR A CA  1 
ATOM   1738 C C   . THR A 1 209 ? -31.443 -44.279 64.462  1.00 29.78  ? 209 THR A C   1 
ATOM   1739 O O   . THR A 1 209 ? -30.332 -44.767 64.217  1.00 31.29  ? 209 THR A O   1 
ATOM   1740 C CB  . THR A 1 209 ? -32.365 -42.450 63.006  1.00 26.85  ? 209 THR A CB  1 
ATOM   1741 O OG1 . THR A 1 209 ? -31.489 -42.832 61.932  1.00 28.61  ? 209 THR A OG1 1 
ATOM   1742 C CG2 . THR A 1 209 ? -32.692 -40.985 62.881  1.00 25.11  ? 209 THR A CG2 1 
ATOM   1743 N N   . LYS A 1 210 ? -32.490 -45.011 64.829  1.00 29.99  ? 210 LYS A N   1 
ATOM   1744 C CA  . LYS A 1 210 ? -32.436 -46.459 64.973  1.00 31.71  ? 210 LYS A CA  1 
ATOM   1745 C C   . LYS A 1 210 ? -31.726 -47.221 63.844  1.00 31.65  ? 210 LYS A C   1 
ATOM   1746 O O   . LYS A 1 210 ? -31.213 -48.329 64.058  1.00 32.36  ? 210 LYS A O   1 
ATOM   1747 C CB  . LYS A 1 210 ? -33.848 -47.017 65.165  1.00 30.40  ? 210 LYS A CB  1 
ATOM   1748 C CG  . LYS A 1 210 ? -34.552 -46.541 66.414  1.00 32.84  ? 210 LYS A CG  1 
ATOM   1749 C CD  . LYS A 1 210 ? -35.842 -47.287 66.654  1.00 36.46  ? 210 LYS A CD  1 
ATOM   1750 C CE  . LYS A 1 210 ? -36.569 -46.782 67.876  1.00 37.36  ? 210 LYS A CE  1 
ATOM   1751 N NZ  . LYS A 1 210 ? -37.854 -47.519 68.091  1.00 37.99  ? 210 LYS A NZ  1 
ATOM   1752 N N   . MET A 1 211 ? -31.666 -46.632 62.656  1.00 31.96  ? 211 MET A N   1 
ATOM   1753 C CA  . MET A 1 211 ? -31.045 -47.312 61.526  1.00 32.54  ? 211 MET A CA  1 
ATOM   1754 C C   . MET A 1 211 ? -29.527 -47.037 61.358  1.00 32.28  ? 211 MET A C   1 
ATOM   1755 O O   . MET A 1 211 ? -28.950 -47.366 60.310  1.00 32.31  ? 211 MET A O   1 
ATOM   1756 C CB  . MET A 1 211 ? -31.802 -46.993 60.227  1.00 33.00  ? 211 MET A CB  1 
ATOM   1757 C CG  . MET A 1 211 ? -32.010 -45.537 59.925  1.00 36.08  ? 211 MET A CG  1 
ATOM   1758 S SD  . MET A 1 211 ? -33.357 -45.334 58.760  1.00 39.83  ? 211 MET A SD  1 
ATOM   1759 C CE  . MET A 1 211 ? -32.535 -45.638 57.219  1.00 39.87  ? 211 MET A CE  1 
ATOM   1760 N N   . ALA A 1 212 ? -28.892 -46.460 62.378  1.00 31.94  ? 212 ALA A N   1 
ATOM   1761 C CA  . ALA A 1 212 ? -27.456 -46.208 62.347  1.00 29.96  ? 212 ALA A CA  1 
ATOM   1762 C C   . ALA A 1 212 ? -26.742 -47.415 62.898  1.00 29.86  ? 212 ALA A C   1 
ATOM   1763 O O   . ALA A 1 212 ? -27.255 -48.085 63.787  1.00 29.37  ? 212 ALA A O   1 
ATOM   1764 C CB  . ALA A 1 212 ? -27.127 -45.002 63.165  1.00 31.80  ? 212 ALA A CB  1 
ATOM   1765 N N   . VAL A 1 213 ? -25.547 -47.689 62.383  1.00 27.85  ? 213 VAL A N   1 
ATOM   1766 C CA  . VAL A 1 213 ? -24.760 -48.827 62.861  1.00 27.59  ? 213 VAL A CA  1 
ATOM   1767 C C   . VAL A 1 213 ? -24.199 -48.531 64.276  1.00 27.78  ? 213 VAL A C   1 
ATOM   1768 O O   . VAL A 1 213 ? -24.114 -49.433 65.115  1.00 26.96  ? 213 VAL A O   1 
ATOM   1769 C CB  . VAL A 1 213 ? -23.565 -49.143 61.902  1.00 29.77  ? 213 VAL A CB  1 
ATOM   1770 C CG1 . VAL A 1 213 ? -22.843 -50.411 62.356  1.00 28.88  ? 213 VAL A CG1 1 
ATOM   1771 C CG2 . VAL A 1 213 ? -24.061 -49.310 60.487  1.00 30.16  ? 213 VAL A CG2 1 
ATOM   1772 N N   . TRP A 1 214 ? -23.843 -47.270 64.529  1.00 25.75  ? 214 TRP A N   1 
ATOM   1773 C CA  . TRP A 1 214 ? -23.359 -46.846 65.830  1.00 23.72  ? 214 TRP A CA  1 
ATOM   1774 C C   . TRP A 1 214 ? -24.279 -45.774 66.383  1.00 23.94  ? 214 TRP A C   1 
ATOM   1775 O O   . TRP A 1 214 ? -24.802 -44.954 65.633  1.00 23.13  ? 214 TRP A O   1 
ATOM   1776 C CB  . TRP A 1 214 ? -21.921 -46.330 65.723  1.00 23.84  ? 214 TRP A CB  1 
ATOM   1777 C CG  . TRP A 1 214 ? -21.347 -45.927 67.074  1.00 19.23  ? 214 TRP A CG  1 
ATOM   1778 C CD1 . TRP A 1 214 ? -20.770 -46.755 68.004  1.00 18.13  ? 214 TRP A CD1 1 
ATOM   1779 C CD2 . TRP A 1 214 ? -21.395 -44.603 67.676  1.00 16.73  ? 214 TRP A CD2 1 
ATOM   1780 N NE1 . TRP A 1 214 ? -20.429 -46.032 69.135  1.00 16.61  ? 214 TRP A NE1 1 
ATOM   1781 C CE2 . TRP A 1 214 ? -20.806 -44.747 68.976  1.00 15.61  ? 214 TRP A CE2 1 
ATOM   1782 C CE3 . TRP A 1 214 ? -21.876 -43.366 67.253  1.00 14.84  ? 214 TRP A CE3 1 
ATOM   1783 C CZ2 . TRP A 1 214 ? -20.706 -43.629 69.848  1.00 15.48  ? 214 TRP A CZ2 1 
ATOM   1784 C CZ3 . TRP A 1 214 ? -21.774 -42.270 68.124  1.00 15.23  ? 214 TRP A CZ3 1 
ATOM   1785 C CH2 . TRP A 1 214 ? -21.183 -42.414 69.412  1.00 14.89  ? 214 TRP A CH2 1 
ATOM   1786 N N   . GLY A 1 215 ? -24.425 -45.765 67.705  1.00 23.71  ? 215 GLY A N   1 
ATOM   1787 C CA  . GLY A 1 215 ? -25.174 -44.732 68.392  1.00 25.77  ? 215 GLY A CA  1 
ATOM   1788 C C   . GLY A 1 215 ? -26.617 -44.678 67.974  1.00 27.27  ? 215 GLY A C   1 
ATOM   1789 O O   . GLY A 1 215 ? -27.223 -43.615 68.029  1.00 27.98  ? 215 GLY A O   1 
ATOM   1790 N N   . ASN A 1 216 ? -27.167 -45.825 67.567  1.00 28.95  ? 216 ASN A N   1 
ATOM   1791 C CA  . ASN A 1 216 ? -28.538 -45.924 67.094  1.00 31.57  ? 216 ASN A CA  1 
ATOM   1792 C C   . ASN A 1 216 ? -29.453 -45.978 68.293  1.00 35.11  ? 216 ASN A C   1 
ATOM   1793 O O   . ASN A 1 216 ? -29.105 -45.444 69.343  1.00 35.58  ? 216 ASN A O   1 
ATOM   1794 C CB  . ASN A 1 216 ? -28.723 -47.178 66.226  1.00 31.80  ? 216 ASN A CB  1 
ATOM   1795 C CG  . ASN A 1 216 ? -28.319 -48.476 66.944  1.00 29.66  ? 216 ASN A CG  1 
ATOM   1796 O OD1 . ASN A 1 216 ? -28.286 -48.564 68.154  1.00 27.69  ? 216 ASN A OD1 1 
ATOM   1797 N ND2 . ASN A 1 216 ? -27.995 -49.477 66.155  1.00 28.18  ? 216 ASN A ND2 1 
ATOM   1798 N N   . LYS A 1 217 ? -30.627 -46.597 68.099  1.00 37.75  ? 217 LYS A N   1 
ATOM   1799 C CA  . LYS A 1 217 ? -31.696 -46.744 69.095  1.00 39.24  ? 217 LYS A CA  1 
ATOM   1800 C C   . LYS A 1 217 ? -32.632 -45.523 69.037  1.00 41.55  ? 217 LYS A C   1 
ATOM   1801 O O   . LYS A 1 217 ? -33.660 -45.535 69.779  1.00 44.78  ? 217 LYS A O   1 
ATOM   1802 C CB  . LYS A 1 217 ? -31.167 -46.946 70.526  1.00 36.44  ? 217 LYS A CB  1 
ATOM   1803 C CG  . LYS A 1 217 ? -30.244 -48.161 70.712  1.00 34.54  ? 217 LYS A CG  1 
ATOM   1804 C CD  . LYS A 1 217 ? -29.571 -48.169 72.077  1.00 30.76  ? 217 LYS A CD  1 
ATOM   1805 C CE  . LYS A 1 217 ? -28.525 -47.067 72.196  1.00 29.06  ? 217 LYS A CE  1 
ATOM   1806 N NZ  . LYS A 1 217 ? -29.085 -45.689 72.342  1.00 27.14  ? 217 LYS A NZ  1 
ATOM   1807 O OXT . LYS A 1 217 ? -32.339 -44.583 68.235  1.00 38.67  ? 217 LYS A OXT 1 
ATOM   1808 N N   . SER B 2 1   ? -9.121  3.367   41.938  1.00 39.75  ? 1   SER B N   1 
ATOM   1809 C CA  . SER B 2 1   ? -10.096 2.227   41.886  1.00 42.09  ? 1   SER B CA  1 
ATOM   1810 C C   . SER B 2 1   ? -9.949  1.375   43.135  1.00 44.04  ? 1   SER B C   1 
ATOM   1811 O O   . SER B 2 1   ? -9.075  1.657   43.956  1.00 44.66  ? 1   SER B O   1 
ATOM   1812 C CB  . SER B 2 1   ? -9.863  1.385   40.624  1.00 40.51  ? 1   SER B CB  1 
ATOM   1813 O OG  . SER B 2 1   ? -9.681  2.256   39.523  1.00 40.31  ? 1   SER B OG  1 
ATOM   1814 N N   . CYS B 2 2   ? -10.791 0.344   43.284  1.00 45.69  ? 2   CYS B N   1 
ATOM   1815 C CA  . CYS B 2 2   ? -10.739 -0.553  44.432  1.00 47.72  ? 2   CYS B CA  1 
ATOM   1816 C C   . CYS B 2 2   ? -9.409  -1.283  44.463  1.00 48.46  ? 2   CYS B C   1 
ATOM   1817 O O   . CYS B 2 2   ? -8.766  -1.322  45.505  1.00 49.21  ? 2   CYS B O   1 
ATOM   1818 C CB  . CYS B 2 2   ? -11.893 -1.559  44.386  1.00 49.33  ? 2   CYS B CB  1 
ATOM   1819 S SG  . CYS B 2 2   ? -12.035 -2.483  42.826  1.00 54.48  ? 2   CYS B SG  1 
ATOM   1820 N N   . GLU B 2 3   ? -9.015  -1.836  43.315  1.00 48.25  ? 3   GLU B N   1 
ATOM   1821 C CA  . GLU B 2 3   ? -7.757  -2.578  43.141  1.00 46.83  ? 3   GLU B CA  1 
ATOM   1822 C C   . GLU B 2 3   ? -7.389  -3.544  44.290  1.00 46.80  ? 3   GLU B C   1 
ATOM   1823 O O   . GLU B 2 3   ? -6.226  -3.577  44.766  1.00 44.33  ? 3   GLU B O   1 
ATOM   1824 C CB  . GLU B 2 3   ? -6.611  -1.599  42.859  1.00 45.98  ? 3   GLU B CB  1 
ATOM   1825 C CG  . GLU B 2 3   ? -5.729  -2.021  41.683  1.00 44.95  ? 3   GLU B CG  1 
ATOM   1826 C CD  . GLU B 2 3   ? -5.316  -3.495  41.750  1.00 44.64  ? 3   GLU B CD  1 
ATOM   1827 O OE1 . GLU B 2 3   ? -4.371  -3.811  42.513  1.00 44.28  ? 3   GLU B OE1 1 
ATOM   1828 O OE2 . GLU B 2 3   ? -5.940  -4.327  41.047  1.00 41.62  ? 3   GLU B OE2 1 
ATOM   1829 N N   . SER B 2 4   ? -8.365  -4.308  44.753  1.00 46.28  ? 4   SER B N   1 
ATOM   1830 C CA  . SER B 2 4   ? -8.168  -5.231  45.859  1.00 44.57  ? 4   SER B CA  1 
ATOM   1831 C C   . SER B 2 4   ? -7.331  -6.434  45.415  1.00 43.51  ? 4   SER B C   1 
ATOM   1832 O O   . SER B 2 4   ? -6.497  -6.936  46.164  1.00 43.79  ? 4   SER B O   1 
ATOM   1833 C CB  . SER B 2 4   ? -9.525  -5.696  46.413  1.00 44.00  ? 4   SER B CB  1 
ATOM   1834 O OG  . SER B 2 4   ? -10.479 -5.904  45.366  1.00 39.68  ? 4   SER B OG  1 
ATOM   1835 N N   . SER B 2 5   ? -7.589  -6.903  44.192  1.00 42.22  ? 5   SER B N   1 
ATOM   1836 C CA  . SER B 2 5   ? -6.913  -8.071  43.627  1.00 41.35  ? 5   SER B CA  1 
ATOM   1837 C C   . SER B 2 5   ? -6.894  -9.276  44.573  1.00 40.50  ? 5   SER B C   1 
ATOM   1838 O O   . SER B 2 5   ? -5.944  -10.085 44.543  1.00 43.51  ? 5   SER B O   1 
ATOM   1839 C CB  . SER B 2 5   ? -5.494  -7.694  43.196  1.00 39.71  ? 5   SER B CB  1 
ATOM   1840 O OG  . SER B 2 5   ? -5.542  -6.896  42.023  1.00 35.45  ? 5   SER B OG  1 
ATOM   1841 N N   . MET B 2 6   ? -7.944  -9.413  45.372  1.00 37.47  ? 6   MET B N   1 
ATOM   1842 C CA  . MET B 2 6   ? -8.065  -10.545 46.273  1.00 33.26  ? 6   MET B CA  1 
ATOM   1843 C C   . MET B 2 6   ? -7.940  -11.832 45.477  1.00 32.27  ? 6   MET B C   1 
ATOM   1844 O O   . MET B 2 6   ? -8.542  -11.957 44.422  1.00 34.74  ? 6   MET B O   1 
ATOM   1845 C CB  . MET B 2 6   ? -9.395  -10.487 47.034  1.00 32.45  ? 6   MET B CB  1 
ATOM   1846 C CG  . MET B 2 6   ? -10.634 -10.310 46.200  1.00 28.59  ? 6   MET B CG  1 
ATOM   1847 S SD  . MET B 2 6   ? -12.105 -10.459 47.130  1.00 29.84  ? 6   MET B SD  1 
ATOM   1848 C CE  . MET B 2 6   ? -12.284 -8.826  47.738  1.00 23.35  ? 6   MET B CE  1 
ATOM   1849 N N   . VAL B 2 7   ? -7.150  -12.781 45.951  1.00 30.37  ? 7   VAL B N   1 
ATOM   1850 C CA  . VAL B 2 7   ? -6.933  -13.991 45.189  1.00 26.96  ? 7   VAL B CA  1 
ATOM   1851 C C   . VAL B 2 7   ? -7.940  -15.071 45.580  1.00 24.10  ? 7   VAL B C   1 
ATOM   1852 O O   . VAL B 2 7   ? -8.123  -15.380 46.766  1.00 21.14  ? 7   VAL B O   1 
ATOM   1853 C CB  . VAL B 2 7   ? -5.467  -14.497 45.281  1.00 24.43  ? 7   VAL B CB  1 
ATOM   1854 C CG1 . VAL B 2 7   ? -4.546  -13.468 44.706  1.00 25.66  ? 7   VAL B CG1 1 
ATOM   1855 C CG2 . VAL B 2 7   ? -5.093  -14.806 46.656  1.00 23.34  ? 7   VAL B CG2 1 
ATOM   1856 N N   . LEU B 2 8   ? -8.564  -15.648 44.557  1.00 20.53  ? 8   LEU B N   1 
ATOM   1857 C CA  . LEU B 2 8   ? -9.499  -16.758 44.697  1.00 17.34  ? 8   LEU B CA  1 
ATOM   1858 C C   . LEU B 2 8   ? -8.763  -18.017 44.270  1.00 14.65  ? 8   LEU B C   1 
ATOM   1859 O O   . LEU B 2 8   ? -8.328  -18.125 43.138  1.00 15.18  ? 8   LEU B O   1 
ATOM   1860 C CB  . LEU B 2 8   ? -10.749 -16.518 43.814  1.00 19.12  ? 8   LEU B CB  1 
ATOM   1861 C CG  . LEU B 2 8   ? -11.833 -17.601 43.821  1.00 16.93  ? 8   LEU B CG  1 
ATOM   1862 C CD1 . LEU B 2 8   ? -12.463 -17.653 45.183  1.00 20.32  ? 8   LEU B CD1 1 
ATOM   1863 C CD2 . LEU B 2 8   ? -12.865 -17.307 42.800  1.00 19.15  ? 8   LEU B CD2 1 
ATOM   1864 N N   . GLY B 2 9   ? -8.656  -18.986 45.173  1.00 12.75  ? 9   GLY B N   1 
ATOM   1865 C CA  . GLY B 2 9   ? -7.963  -20.207 44.833  1.00 12.51  ? 9   GLY B CA  1 
ATOM   1866 C C   . GLY B 2 9   ? -8.919  -21.365 44.825  1.00 11.52  ? 9   GLY B C   1 
ATOM   1867 O O   . GLY B 2 9   ? -9.718  -21.496 45.750  1.00 10.61  ? 9   GLY B O   1 
ATOM   1868 N N   . TYR B 2 10  ? -8.830  -22.185 43.771  1.00 11.97  ? 10  TYR B N   1 
ATOM   1869 C CA  . TYR B 2 10  ? -9.697  -23.363 43.595  1.00 14.25  ? 10  TYR B CA  1 
ATOM   1870 C C   . TYR B 2 10  ? -9.163  -24.164 42.413  1.00 15.03  ? 10  TYR B C   1 
ATOM   1871 O O   . TYR B 2 10  ? -8.221  -23.709 41.745  1.00 11.32  ? 10  TYR B O   1 
ATOM   1872 C CB  . TYR B 2 10  ? -11.146 -22.937 43.327  1.00 15.30  ? 10  TYR B CB  1 
ATOM   1873 C CG  . TYR B 2 10  ? -12.158 -24.034 43.429  1.00 21.61  ? 10  TYR B CG  1 
ATOM   1874 C CD1 . TYR B 2 10  ? -12.276 -24.786 44.603  1.00 21.90  ? 10  TYR B CD1 1 
ATOM   1875 C CD2 . TYR B 2 10  ? -13.015 -24.311 42.358  1.00 23.65  ? 10  TYR B CD2 1 
ATOM   1876 C CE1 . TYR B 2 10  ? -13.247 -25.812 44.714  1.00 23.46  ? 10  TYR B CE1 1 
ATOM   1877 C CE2 . TYR B 2 10  ? -13.996 -25.338 42.455  1.00 23.90  ? 10  TYR B CE2 1 
ATOM   1878 C CZ  . TYR B 2 10  ? -14.095 -26.080 43.640  1.00 23.25  ? 10  TYR B CZ  1 
ATOM   1879 O OH  . TYR B 2 10  ? -15.045 -27.068 43.765  1.00 22.50  ? 10  TYR B OH  1 
ATOM   1880 N N   . TRP B 2 11  ? -9.765  -25.322 42.161  1.00 16.71  ? 11  TRP B N   1 
ATOM   1881 C CA  . TRP B 2 11  ? -9.383  -26.142 41.029  1.00 22.47  ? 11  TRP B CA  1 
ATOM   1882 C C   . TRP B 2 11  ? -9.746  -25.423 39.732  1.00 24.03  ? 11  TRP B C   1 
ATOM   1883 O O   . TRP B 2 11  ? -10.487 -24.424 39.738  1.00 20.31  ? 11  TRP B O   1 
ATOM   1884 C CB  . TRP B 2 11  ? -10.111 -27.475 41.077  1.00 24.54  ? 11  TRP B CB  1 
ATOM   1885 C CG  . TRP B 2 11  ? -9.880  -28.276 42.300  1.00 28.19  ? 11  TRP B CG  1 
ATOM   1886 C CD1 . TRP B 2 11  ? -10.782 -28.513 43.289  1.00 30.29  ? 11  TRP B CD1 1 
ATOM   1887 C CD2 . TRP B 2 11  ? -8.688  -28.994 42.640  1.00 29.49  ? 11  TRP B CD2 1 
ATOM   1888 N NE1 . TRP B 2 11  ? -10.219 -29.286 44.265  1.00 32.43  ? 11  TRP B NE1 1 
ATOM   1889 C CE2 . TRP B 2 11  ? -8.950  -29.625 43.890  1.00 31.86  ? 11  TRP B CE2 1 
ATOM   1890 C CE3 . TRP B 2 11  ? -7.437  -29.148 42.038  1.00 29.56  ? 11  TRP B CE3 1 
ATOM   1891 C CZ2 . TRP B 2 11  ? -7.959  -30.403 44.559  1.00 33.47  ? 11  TRP B CZ2 1 
ATOM   1892 C CZ3 . TRP B 2 11  ? -6.453  -29.924 42.698  1.00 31.70  ? 11  TRP B CZ3 1 
ATOM   1893 C CH2 . TRP B 2 11  ? -6.725  -30.538 43.954  1.00 32.12  ? 11  TRP B CH2 1 
ATOM   1894 N N   . ASP B 2 12  ? -9.227  -25.943 38.621  1.00 27.89  ? 12  ASP B N   1 
ATOM   1895 C CA  . ASP B 2 12  ? -9.521  -25.404 37.301  1.00 33.47  ? 12  ASP B CA  1 
ATOM   1896 C C   . ASP B 2 12  ? -10.876 -25.997 36.859  1.00 34.41  ? 12  ASP B C   1 
ATOM   1897 O O   . ASP B 2 12  ? -11.014 -26.516 35.753  1.00 36.90  ? 12  ASP B O   1 
ATOM   1898 C CB  . ASP B 2 12  ? -8.389  -25.758 36.320  1.00 37.98  ? 12  ASP B CB  1 
ATOM   1899 C CG  . ASP B 2 12  ? -8.569  -25.139 34.945  1.00 42.19  ? 12  ASP B CG  1 
ATOM   1900 O OD1 . ASP B 2 12  ? -9.143  -24.025 34.824  1.00 47.50  ? 12  ASP B OD1 1 
ATOM   1901 O OD2 . ASP B 2 12  ? -8.164  -25.800 33.973  1.00 45.86  ? 12  ASP B OD2 1 
ATOM   1902 N N   . ILE B 2 13  ? -11.871 -25.878 37.733  1.00 34.91  ? 13  ILE B N   1 
ATOM   1903 C CA  . ILE B 2 13  ? -13.174 -26.504 37.555  1.00 32.60  ? 13  ILE B CA  1 
ATOM   1904 C C   . ILE B 2 13  ? -14.192 -25.451 37.958  1.00 29.53  ? 13  ILE B C   1 
ATOM   1905 O O   . ILE B 2 13  ? -13.902 -24.593 38.788  1.00 28.75  ? 13  ILE B O   1 
ATOM   1906 C CB  . ILE B 2 13  ? -13.338 -27.760 38.453  1.00 36.32  ? 13  ILE B CB  1 
ATOM   1907 C CG1 . ILE B 2 13  ? -12.350 -28.842 38.019  1.00 40.18  ? 13  ILE B CG1 1 
ATOM   1908 C CG2 . ILE B 2 13  ? -14.722 -28.308 38.346  1.00 39.88  ? 13  ILE B CG2 1 
ATOM   1909 C CD1 . ILE B 2 13  ? -12.465 -29.294 36.575  1.00 41.85  ? 13  ILE B CD1 1 
ATOM   1910 N N   . ARG B 2 14  ? -15.388 -25.553 37.390  1.00 25.14  ? 14  ARG B N   1 
ATOM   1911 C CA  . ARG B 2 14  ? -16.522 -24.704 37.740  1.00 17.54  ? 14  ARG B CA  1 
ATOM   1912 C C   . ARG B 2 14  ? -16.913 -24.960 39.171  1.00 13.89  ? 14  ARG B C   1 
ATOM   1913 O O   . ARG B 2 14  ? -16.782 -24.076 40.000  1.00 13.07  ? 14  ARG B O   1 
ATOM   1914 C CB  . ARG B 2 14  ? -17.691 -24.984 36.793  1.00 18.97  ? 14  ARG B CB  1 
ATOM   1915 C CG  . ARG B 2 14  ? -18.975 -24.298 37.127  1.00 17.25  ? 14  ARG B CG  1 
ATOM   1916 C CD  . ARG B 2 14  ? -20.094 -24.713 36.185  1.00 17.26  ? 14  ARG B CD  1 
ATOM   1917 N NE  . ARG B 2 14  ? -21.412 -24.414 36.750  1.00 19.56  ? 14  ARG B NE  1 
ATOM   1918 C CZ  . ARG B 2 14  ? -22.538 -24.293 36.048  1.00 17.38  ? 14  ARG B CZ  1 
ATOM   1919 N NH1 . ARG B 2 14  ? -22.529 -24.462 34.740  1.00 17.22  ? 14  ARG B NH1 1 
ATOM   1920 N NH2 . ARG B 2 14  ? -23.663 -23.978 36.668  1.00 25.00  ? 14  ARG B NH2 1 
ATOM   1921 N N   . GLY B 2 15  ? -17.375 -26.188 39.431  1.00 11.85  ? 15  GLY B N   1 
ATOM   1922 C CA  . GLY B 2 15  ? -17.723 -26.637 40.771  1.00 8.87   ? 15  GLY B CA  1 
ATOM   1923 C C   . GLY B 2 15  ? -18.223 -25.616 41.775  1.00 9.84   ? 15  GLY B C   1 
ATOM   1924 O O   . GLY B 2 15  ? -19.112 -24.824 41.437  1.00 11.99  ? 15  GLY B O   1 
ATOM   1925 N N   . LEU B 2 16  ? -17.656 -25.628 42.986  1.00 8.92   ? 16  LEU B N   1 
ATOM   1926 C CA  . LEU B 2 16  ? -18.073 -24.720 44.052  1.00 10.21  ? 16  LEU B CA  1 
ATOM   1927 C C   . LEU B 2 16  ? -17.769 -23.256 43.818  1.00 9.30   ? 16  LEU B C   1 
ATOM   1928 O O   . LEU B 2 16  ? -18.448 -22.397 44.352  1.00 12.47  ? 16  LEU B O   1 
ATOM   1929 C CB  . LEU B 2 16  ? -17.468 -25.149 45.391  1.00 10.50  ? 16  LEU B CB  1 
ATOM   1930 C CG  . LEU B 2 16  ? -18.018 -26.411 46.085  1.00 11.12  ? 16  LEU B CG  1 
ATOM   1931 C CD1 . LEU B 2 16  ? -17.161 -26.696 47.344  1.00 7.59   ? 16  LEU B CD1 1 
ATOM   1932 C CD2 . LEU B 2 16  ? -19.510 -26.233 46.443  1.00 10.93  ? 16  LEU B CD2 1 
ATOM   1933 N N   . ALA B 2 17  ? -16.754 -22.959 43.018  1.00 9.58   ? 17  ALA B N   1 
ATOM   1934 C CA  . ALA B 2 17  ? -16.330 -21.581 42.862  1.00 10.99  ? 17  ALA B CA  1 
ATOM   1935 C C   . ALA B 2 17  ? -17.182 -20.791 41.872  1.00 11.21  ? 17  ALA B C   1 
ATOM   1936 O O   . ALA B 2 17  ? -17.076 -19.561 41.820  1.00 11.12  ? 17  ALA B O   1 
ATOM   1937 C CB  . ALA B 2 17  ? -14.883 -21.513 42.434  1.00 12.72  ? 17  ALA B CB  1 
ATOM   1938 N N   . HIS B 2 18  ? -18.027 -21.494 41.115  1.00 12.84  ? 18  HIS B N   1 
ATOM   1939 C CA  . HIS B 2 18  ? -18.908 -20.855 40.135  1.00 12.59  ? 18  HIS B CA  1 
ATOM   1940 C C   . HIS B 2 18  ? -19.769 -19.718 40.658  1.00 11.93  ? 18  HIS B C   1 
ATOM   1941 O O   . HIS B 2 18  ? -19.798 -18.633 40.080  1.00 11.70  ? 18  HIS B O   1 
ATOM   1942 C CB  . HIS B 2 18  ? -19.809 -21.885 39.479  1.00 16.82  ? 18  HIS B CB  1 
ATOM   1943 C CG  . HIS B 2 18  ? -20.530 -21.352 38.274  1.00 22.40  ? 18  HIS B CG  1 
ATOM   1944 N ND1 . HIS B 2 18  ? -19.908 -20.785 37.215  1.00 25.28  ? 18  HIS B ND1 1 
ATOM   1945 C CD2 . HIS B 2 18  ? -21.875 -21.304 37.999  1.00 21.64  ? 18  HIS B CD2 1 
ATOM   1946 C CE1 . HIS B 2 18  ? -20.789 -20.401 36.308  1.00 24.21  ? 18  HIS B CE1 1 
ATOM   1947 N NE2 . HIS B 2 18  ? -21.991 -20.707 36.770  1.00 24.88  ? 18  HIS B NE2 1 
ATOM   1948 N N   . ALA B 2 19  ? -20.443 -19.940 41.795  1.00 8.05   ? 19  ALA B N   1 
ATOM   1949 C CA  . ALA B 2 19  ? -21.252 -18.883 42.399  1.00 6.62   ? 19  ALA B CA  1 
ATOM   1950 C C   . ALA B 2 19  ? -20.408 -17.703 42.908  1.00 8.05   ? 19  ALA B C   1 
ATOM   1951 O O   . ALA B 2 19  ? -20.867 -16.547 42.862  1.00 5.27   ? 19  ALA B O   1 
ATOM   1952 C CB  . ALA B 2 19  ? -22.079 -19.444 43.547  1.00 4.82   ? 19  ALA B CB  1 
ATOM   1953 N N   . ILE B 2 20  ? -19.192 -18.002 43.359  1.00 11.96  ? 20  ILE B N   1 
ATOM   1954 C CA  . ILE B 2 20  ? -18.266 -17.005 43.879  1.00 11.85  ? 20  ILE B CA  1 
ATOM   1955 C C   . ILE B 2 20  ? -17.726 -16.124 42.751  1.00 11.26  ? 20  ILE B C   1 
ATOM   1956 O O   . ILE B 2 20  ? -17.707 -14.893 42.879  1.00 11.69  ? 20  ILE B O   1 
ATOM   1957 C CB  . ILE B 2 20  ? -17.095 -17.660 44.648  1.00 13.31  ? 20  ILE B CB  1 
ATOM   1958 C CG1 . ILE B 2 20  ? -17.622 -18.597 45.727  1.00 13.38  ? 20  ILE B CG1 1 
ATOM   1959 C CG2 . ILE B 2 20  ? -16.253 -16.596 45.313  1.00 14.10  ? 20  ILE B CG2 1 
ATOM   1960 C CD1 . ILE B 2 20  ? -16.552 -19.378 46.408  1.00 19.56  ? 20  ILE B CD1 1 
ATOM   1961 N N   . ARG B 2 21  ? -17.309 -16.761 41.648  1.00 11.01  ? 21  ARG B N   1 
ATOM   1962 C CA  . ARG B 2 21  ? -16.814 -16.049 40.473  1.00 11.54  ? 21  ARG B CA  1 
ATOM   1963 C C   . ARG B 2 21  ? -17.870 -15.094 39.931  1.00 9.47   ? 21  ARG B C   1 
ATOM   1964 O O   . ARG B 2 21  ? -17.564 -13.932 39.662  1.00 9.36   ? 21  ARG B O   1 
ATOM   1965 C CB  . ARG B 2 21  ? -16.415 -17.021 39.372  1.00 12.12  ? 21  ARG B CB  1 
ATOM   1966 C CG  . ARG B 2 21  ? -15.280 -17.938 39.726  1.00 17.33  ? 21  ARG B CG  1 
ATOM   1967 C CD  . ARG B 2 21  ? -15.058 -18.991 38.652  1.00 17.97  ? 21  ARG B CD  1 
ATOM   1968 N NE  . ARG B 2 21  ? -13.914 -19.848 38.942  1.00 21.94  ? 21  ARG B NE  1 
ATOM   1969 C CZ  . ARG B 2 21  ? -13.925 -21.176 38.863  1.00 22.78  ? 21  ARG B CZ  1 
ATOM   1970 N NH1 . ARG B 2 21  ? -15.031 -21.819 38.543  1.00 24.52  ? 21  ARG B NH1 1 
ATOM   1971 N NH2 . ARG B 2 21  ? -12.823 -21.856 39.118  1.00 26.62  ? 21  ARG B NH2 1 
ATOM   1972 N N   . LEU B 2 22  ? -19.105 -15.584 39.820  1.00 9.25   ? 22  LEU B N   1 
ATOM   1973 C CA  . LEU B 2 22  ? -20.251 -14.782 39.380  1.00 8.79   ? 22  LEU B CA  1 
ATOM   1974 C C   . LEU B 2 22  ? -20.547 -13.576 40.291  1.00 10.18  ? 22  LEU B C   1 
ATOM   1975 O O   . LEU B 2 22  ? -20.724 -12.441 39.796  1.00 9.42   ? 22  LEU B O   1 
ATOM   1976 C CB  . LEU B 2 22  ? -21.491 -15.660 39.271  1.00 7.20   ? 22  LEU B CB  1 
ATOM   1977 C CG  . LEU B 2 22  ? -21.469 -16.692 38.147  1.00 8.25   ? 22  LEU B CG  1 
ATOM   1978 C CD1 . LEU B 2 22  ? -22.663 -17.606 38.296  1.00 2.00   ? 22  LEU B CD1 1 
ATOM   1979 C CD2 . LEU B 2 22  ? -21.461 -15.992 36.797  1.00 5.17   ? 22  LEU B CD2 1 
ATOM   1980 N N   . LEU B 2 23  ? -20.536 -13.816 41.603  1.00 10.63  ? 23  LEU B N   1 
ATOM   1981 C CA  . LEU B 2 23  ? -20.730 -12.755 42.581  1.00 9.96   ? 23  LEU B CA  1 
ATOM   1982 C C   . LEU B 2 23  ? -19.663 -11.694 42.472  1.00 13.26  ? 23  LEU B C   1 
ATOM   1983 O O   . LEU B 2 23  ? -19.985 -10.509 42.465  1.00 14.03  ? 23  LEU B O   1 
ATOM   1984 C CB  . LEU B 2 23  ? -20.759 -13.315 44.001  1.00 9.93   ? 23  LEU B CB  1 
ATOM   1985 C CG  . LEU B 2 23  ? -21.006 -12.335 45.155  1.00 8.35   ? 23  LEU B CG  1 
ATOM   1986 C CD1 . LEU B 2 23  ? -22.235 -11.524 44.911  1.00 3.53   ? 23  LEU B CD1 1 
ATOM   1987 C CD2 . LEU B 2 23  ? -21.124 -13.080 46.428  1.00 6.93   ? 23  LEU B CD2 1 
ATOM   1988 N N   . LEU B 2 24  ? -18.403 -12.126 42.382  1.00 15.24  ? 24  LEU B N   1 
ATOM   1989 C CA  . LEU B 2 24  ? -17.274 -11.208 42.236  1.00 17.16  ? 24  LEU B CA  1 
ATOM   1990 C C   . LEU B 2 24  ? -17.433 -10.330 40.997  1.00 17.49  ? 24  LEU B C   1 
ATOM   1991 O O   . LEU B 2 24  ? -17.278 -9.098  41.082  1.00 16.27  ? 24  LEU B O   1 
ATOM   1992 C CB  . LEU B 2 24  ? -15.948 -11.982 42.166  1.00 19.57  ? 24  LEU B CB  1 
ATOM   1993 C CG  . LEU B 2 24  ? -15.412 -12.561 43.482  1.00 19.36  ? 24  LEU B CG  1 
ATOM   1994 C CD1 . LEU B 2 24  ? -14.361 -13.608 43.187  1.00 18.47  ? 24  LEU B CD1 1 
ATOM   1995 C CD2 . LEU B 2 24  ? -14.860 -11.456 44.335  1.00 14.45  ? 24  LEU B CD2 1 
ATOM   1996 N N   . GLU B 2 25  ? -17.768 -10.973 39.873  1.00 18.41  ? 25  GLU B N   1 
ATOM   1997 C CA  . GLU B 2 25  ? -18.001 -10.283 38.614  1.00 20.72  ? 25  GLU B CA  1 
ATOM   1998 C C   . GLU B 2 25  ? -19.096 -9.241  38.752  1.00 20.41  ? 25  GLU B C   1 
ATOM   1999 O O   . GLU B 2 25  ? -18.875 -8.041  38.525  1.00 19.46  ? 25  GLU B O   1 
ATOM   2000 C CB  . GLU B 2 25  ? -18.360 -11.288 37.532  1.00 22.04  ? 25  GLU B CB  1 
ATOM   2001 C CG  . GLU B 2 25  ? -17.211 -12.191 37.117  1.00 25.40  ? 25  GLU B CG  1 
ATOM   2002 C CD  . GLU B 2 25  ? -16.066 -11.482 36.433  1.00 27.50  ? 25  GLU B CD  1 
ATOM   2003 O OE1 . GLU B 2 25  ? -16.289 -10.520 35.684  1.00 31.88  ? 25  GLU B OE1 1 
ATOM   2004 O OE2 . GLU B 2 25  ? -14.914 -11.889 36.652  1.00 26.82  ? 25  GLU B OE2 1 
ATOM   2005 N N   . PHE B 2 26  ? -20.277 -9.713  39.152  1.00 21.59  ? 26  PHE B N   1 
ATOM   2006 C CA  . PHE B 2 26  ? -21.442 -8.862  39.353  1.00 21.67  ? 26  PHE B CA  1 
ATOM   2007 C C   . PHE B 2 26  ? -21.137 -7.588  40.162  1.00 21.72  ? 26  PHE B C   1 
ATOM   2008 O O   . PHE B 2 26  ? -21.502 -6.481  39.744  1.00 21.47  ? 26  PHE B O   1 
ATOM   2009 C CB  . PHE B 2 26  ? -22.578 -9.665  40.007  1.00 22.79  ? 26  PHE B CB  1 
ATOM   2010 C CG  . PHE B 2 26  ? -23.798 -8.860  40.304  1.00 22.53  ? 26  PHE B CG  1 
ATOM   2011 C CD1 . PHE B 2 26  ? -24.641 -8.462  39.270  1.00 23.07  ? 26  PHE B CD1 1 
ATOM   2012 C CD2 . PHE B 2 26  ? -24.084 -8.459  41.612  1.00 22.60  ? 26  PHE B CD2 1 
ATOM   2013 C CE1 . PHE B 2 26  ? -25.773 -7.669  39.549  1.00 22.66  ? 26  PHE B CE1 1 
ATOM   2014 C CE2 . PHE B 2 26  ? -25.199 -7.669  41.905  1.00 22.22  ? 26  PHE B CE2 1 
ATOM   2015 C CZ  . PHE B 2 26  ? -26.046 -7.272  40.887  1.00 22.27  ? 26  PHE B CZ  1 
ATOM   2016 N N   . THR B 2 27  ? -20.490 -7.748  41.311  1.00 23.43  ? 27  THR B N   1 
ATOM   2017 C CA  . THR B 2 27  ? -20.234 -6.640  42.202  1.00 25.10  ? 27  THR B CA  1 
ATOM   2018 C C   . THR B 2 27  ? -18.998 -5.828  41.834  1.00 26.60  ? 27  THR B C   1 
ATOM   2019 O O   . THR B 2 27  ? -18.544 -5.021  42.632  1.00 24.37  ? 27  THR B O   1 
ATOM   2020 C CB  . THR B 2 27  ? -20.101 -7.130  43.636  1.00 25.95  ? 27  THR B CB  1 
ATOM   2021 O OG1 . THR B 2 27  ? -19.109 -8.164  43.706  1.00 24.38  ? 27  THR B OG1 1 
ATOM   2022 C CG2 . THR B 2 27  ? -21.415 -7.660  44.147  1.00 28.69  ? 27  THR B CG2 1 
ATOM   2023 N N   . ASP B 2 28  ? -18.462 -6.068  40.632  1.00 30.17  ? 28  ASP B N   1 
ATOM   2024 C CA  . ASP B 2 28  ? -17.259 -5.388  40.147  1.00 31.25  ? 28  ASP B CA  1 
ATOM   2025 C C   . ASP B 2 28  ? -16.071 -5.507  41.120  1.00 32.37  ? 28  ASP B C   1 
ATOM   2026 O O   . ASP B 2 28  ? -15.258 -4.565  41.236  1.00 30.57  ? 28  ASP B O   1 
ATOM   2027 C CB  . ASP B 2 28  ? -17.552 -3.912  39.859  1.00 33.50  ? 28  ASP B CB  1 
ATOM   2028 C CG  . ASP B 2 28  ? -18.401 -3.704  38.612  1.00 38.19  ? 28  ASP B CG  1 
ATOM   2029 O OD1 . ASP B 2 28  ? -17.934 -4.063  37.497  1.00 41.14  ? 28  ASP B OD1 1 
ATOM   2030 O OD2 . ASP B 2 28  ? -19.553 -3.217  38.752  1.00 40.66  ? 28  ASP B OD2 1 
ATOM   2031 N N   . THR B 2 29  ? -15.963 -6.641  41.800  1.00 34.40  ? 29  THR B N   1 
ATOM   2032 C CA  . THR B 2 29  ? -14.909 -6.839  42.784  1.00 34.04  ? 29  THR B CA  1 
ATOM   2033 C C   . THR B 2 29  ? -13.630 -7.257  42.081  1.00 34.74  ? 29  THR B C   1 
ATOM   2034 O O   . THR B 2 29  ? -13.590 -8.308  41.438  1.00 35.20  ? 29  THR B O   1 
ATOM   2035 C CB  . THR B 2 29  ? -15.321 -7.873  43.840  1.00 34.09  ? 29  THR B CB  1 
ATOM   2036 O OG1 . THR B 2 29  ? -16.473 -7.392  44.546  1.00 33.40  ? 29  THR B OG1 1 
ATOM   2037 C CG2 . THR B 2 29  ? -14.222 -8.051  44.829  1.00 35.32  ? 29  THR B CG2 1 
ATOM   2038 N N   . SER B 2 30  ? -12.595 -6.432  42.207  1.00 33.88  ? 30  SER B N   1 
ATOM   2039 C CA  . SER B 2 30  ? -11.284 -6.709  41.610  1.00 32.77  ? 30  SER B CA  1 
ATOM   2040 C C   . SER B 2 30  ? -10.609 -7.899  42.282  1.00 31.34  ? 30  SER B C   1 
ATOM   2041 O O   . SER B 2 30  ? -10.299 -7.850  43.474  1.00 33.24  ? 30  SER B O   1 
ATOM   2042 C CB  . SER B 2 30  ? -10.385 -5.474  41.747  1.00 32.96  ? 30  SER B CB  1 
ATOM   2043 O OG  . SER B 2 30  ? -9.077  -5.707  41.262  1.00 34.64  ? 30  SER B OG  1 
ATOM   2044 N N   . TYR B 2 31  ? -10.404 -8.978  41.517  1.00 28.68  ? 31  TYR B N   1 
ATOM   2045 C CA  . TYR B 2 31  ? -9.828  -10.183 42.073  1.00 26.81  ? 31  TYR B CA  1 
ATOM   2046 C C   . TYR B 2 31  ? -8.879  -10.857 41.112  1.00 28.72  ? 31  TYR B C   1 
ATOM   2047 O O   . TYR B 2 31  ? -8.966  -10.692 39.912  1.00 24.99  ? 31  TYR B O   1 
ATOM   2048 C CB  . TYR B 2 31  ? -10.922 -11.165 42.517  1.00 24.69  ? 31  TYR B CB  1 
ATOM   2049 C CG  . TYR B 2 31  ? -11.600 -11.961 41.427  1.00 24.67  ? 31  TYR B CG  1 
ATOM   2050 C CD1 . TYR B 2 31  ? -12.578 -11.367 40.619  1.00 23.36  ? 31  TYR B CD1 1 
ATOM   2051 C CD2 . TYR B 2 31  ? -11.255 -13.303 41.203  1.00 25.83  ? 31  TYR B CD2 1 
ATOM   2052 C CE1 . TYR B 2 31  ? -13.198 -12.084 39.606  1.00 24.28  ? 31  TYR B CE1 1 
ATOM   2053 C CE2 . TYR B 2 31  ? -11.871 -14.033 40.187  1.00 27.35  ? 31  TYR B CE2 1 
ATOM   2054 C CZ  . TYR B 2 31  ? -12.855 -13.422 39.407  1.00 26.86  ? 31  TYR B CZ  1 
ATOM   2055 O OH  . TYR B 2 31  ? -13.485 -14.156 38.422  1.00 25.28  ? 31  TYR B OH  1 
ATOM   2056 N N   . GLU B 2 32  ? -7.989  -11.665 41.676  1.00 31.91  ? 32  GLU B N   1 
ATOM   2057 C CA  . GLU B 2 32  ? -7.028  -12.433 40.903  1.00 33.06  ? 32  GLU B CA  1 
ATOM   2058 C C   . GLU B 2 32  ? -7.383  -13.877 41.192  1.00 31.07  ? 32  GLU B C   1 
ATOM   2059 O O   . GLU B 2 32  ? -7.754  -14.206 42.314  1.00 28.05  ? 32  GLU B O   1 
ATOM   2060 C CB  . GLU B 2 32  ? -5.619  -12.118 41.409  1.00 38.72  ? 32  GLU B CB  1 
ATOM   2061 C CG  . GLU B 2 32  ? -4.470  -12.713 40.584  1.00 45.27  ? 32  GLU B CG  1 
ATOM   2062 C CD  . GLU B 2 32  ? -3.070  -12.237 41.059  1.00 48.62  ? 32  GLU B CD  1 
ATOM   2063 O OE1 . GLU B 2 32  ? -2.981  -11.395 42.004  1.00 49.57  ? 32  GLU B OE1 1 
ATOM   2064 O OE2 . GLU B 2 32  ? -2.061  -12.721 40.474  1.00 50.62  ? 32  GLU B OE2 1 
ATOM   2065 N N   . GLU B 2 33  ? -7.266  -14.757 40.207  1.00 30.74  ? 33  GLU B N   1 
ATOM   2066 C CA  . GLU B 2 33  ? -7.670  -16.140 40.415  1.00 31.42  ? 33  GLU B CA  1 
ATOM   2067 C C   . GLU B 2 33  ? -6.481  -17.077 40.291  1.00 28.97  ? 33  GLU B C   1 
ATOM   2068 O O   . GLU B 2 33  ? -5.617  -16.873 39.459  1.00 28.63  ? 33  GLU B O   1 
ATOM   2069 C CB  . GLU B 2 33  ? -8.768  -16.541 39.427  1.00 33.15  ? 33  GLU B CB  1 
ATOM   2070 C CG  . GLU B 2 33  ? -9.580  -17.753 39.872  1.00 37.09  ? 33  GLU B CG  1 
ATOM   2071 C CD  . GLU B 2 33  ? -10.831 -18.000 39.023  1.00 40.95  ? 33  GLU B CD  1 
ATOM   2072 O OE1 . GLU B 2 33  ? -11.672 -17.078 38.895  1.00 38.96  ? 33  GLU B OE1 1 
ATOM   2073 O OE2 . GLU B 2 33  ? -10.965 -19.118 38.474  1.00 41.08  ? 33  GLU B OE2 1 
ATOM   2074 N N   . LYS B 2 34  ? -6.477  -18.112 41.119  1.00 27.01  ? 34  LYS B N   1 
ATOM   2075 C CA  . LYS B 2 34  ? -5.438  -19.115 41.119  1.00 26.04  ? 34  LYS B CA  1 
ATOM   2076 C C   . LYS B 2 34  ? -6.093  -20.474 40.948  1.00 27.41  ? 34  LYS B C   1 
ATOM   2077 O O   . LYS B 2 34  ? -6.794  -20.975 41.844  1.00 30.37  ? 34  LYS B O   1 
ATOM   2078 C CB  . LYS B 2 34  ? -4.673  -19.055 42.436  1.00 25.20  ? 34  LYS B CB  1 
ATOM   2079 C CG  . LYS B 2 34  ? -3.588  -20.123 42.584  1.00 28.07  ? 34  LYS B CG  1 
ATOM   2080 C CD  . LYS B 2 34  ? -2.461  -19.921 41.566  1.00 25.80  ? 34  LYS B CD  1 
ATOM   2081 C CE  . LYS B 2 34  ? -1.423  -21.032 41.679  1.00 24.63  ? 34  LYS B CE  1 
ATOM   2082 N NZ  . LYS B 2 34  ? -0.295  -20.809 40.722  1.00 28.39  ? 34  LYS B NZ  1 
ATOM   2083 N N   . ARG B 2 35  ? -5.851  -21.076 39.782  1.00 24.82  ? 35  ARG B N   1 
ATOM   2084 C CA  . ARG B 2 35  ? -6.458  -22.362 39.441  1.00 27.45  ? 35  ARG B CA  1 
ATOM   2085 C C   . ARG B 2 35  ? -5.478  -23.513 39.655  1.00 27.77  ? 35  ARG B C   1 
ATOM   2086 O O   . ARG B 2 35  ? -4.324  -23.441 39.248  1.00 25.89  ? 35  ARG B O   1 
ATOM   2087 C CB  . ARG B 2 35  ? -6.945  -22.364 37.985  1.00 29.40  ? 35  ARG B CB  1 
ATOM   2088 C CG  . ARG B 2 35  ? -8.000  -21.328 37.685  1.00 31.34  ? 35  ARG B CG  1 
ATOM   2089 C CD  . ARG B 2 35  ? -8.249  -21.219 36.209  1.00 35.30  ? 35  ARG B CD  1 
ATOM   2090 N NE  . ARG B 2 35  ? -9.444  -20.425 35.906  1.00 38.89  ? 35  ARG B NE  1 
ATOM   2091 C CZ  . ARG B 2 35  ? -10.704 -20.834 36.074  1.00 40.45  ? 35  ARG B CZ  1 
ATOM   2092 N NH1 . ARG B 2 35  ? -10.973 -22.073 36.514  1.00 39.22  ? 35  ARG B NH1 1 
ATOM   2093 N NH2 . ARG B 2 35  ? -11.710 -19.998 35.797  1.00 40.00  ? 35  ARG B NH2 1 
ATOM   2094 N N   . TYR B 2 36  ? -5.946  -24.572 40.305  1.00 25.95  ? 36  TYR B N   1 
ATOM   2095 C CA  . TYR B 2 36  ? -5.107  -25.726 40.574  1.00 26.59  ? 36  TYR B CA  1 
ATOM   2096 C C   . TYR B 2 36  ? -5.509  -26.834 39.620  1.00 27.73  ? 36  TYR B C   1 
ATOM   2097 O O   . TYR B 2 36  ? -6.673  -27.148 39.508  1.00 29.84  ? 36  TYR B O   1 
ATOM   2098 C CB  . TYR B 2 36  ? -5.241  -26.164 42.051  1.00 25.46  ? 36  TYR B CB  1 
ATOM   2099 C CG  . TYR B 2 36  ? -4.660  -25.161 43.022  1.00 21.36  ? 36  TYR B CG  1 
ATOM   2100 C CD1 . TYR B 2 36  ? -3.283  -25.069 43.223  1.00 22.79  ? 36  TYR B CD1 1 
ATOM   2101 C CD2 . TYR B 2 36  ? -5.484  -24.279 43.711  1.00 20.13  ? 36  TYR B CD2 1 
ATOM   2102 C CE1 . TYR B 2 36  ? -2.729  -24.094 44.101  1.00 20.56  ? 36  TYR B CE1 1 
ATOM   2103 C CE2 . TYR B 2 36  ? -4.949  -23.307 44.580  1.00 22.28  ? 36  TYR B CE2 1 
ATOM   2104 C CZ  . TYR B 2 36  ? -3.576  -23.223 44.755  1.00 22.01  ? 36  TYR B CZ  1 
ATOM   2105 O OH  . TYR B 2 36  ? -3.035  -22.289 45.587  1.00 22.04  ? 36  TYR B OH  1 
ATOM   2106 N N   . THR B 2 37  ? -4.525  -27.440 38.959  1.00 29.45  ? 37  THR B N   1 
ATOM   2107 C CA  . THR B 2 37  ? -4.769  -28.557 38.055  1.00 32.25  ? 37  THR B CA  1 
ATOM   2108 C C   . THR B 2 37  ? -4.730  -29.862 38.820  1.00 33.59  ? 37  THR B C   1 
ATOM   2109 O O   . THR B 2 37  ? -4.113  -29.970 39.867  1.00 37.52  ? 37  THR B O   1 
ATOM   2110 C CB  . THR B 2 37  ? -3.690  -28.599 36.930  1.00 32.06  ? 37  THR B CB  1 
ATOM   2111 O OG1 . THR B 2 37  ? -3.484  -27.281 36.400  1.00 33.60  ? 37  THR B OG1 1 
ATOM   2112 C CG2 . THR B 2 37  ? -4.108  -29.530 35.798  1.00 33.24  ? 37  THR B CG2 1 
ATOM   2113 N N   . CYS B 2 38  ? -5.396  -30.872 38.263  1.00 36.32  ? 38  CYS B N   1 
ATOM   2114 C CA  . CYS B 2 38  ? -5.443  -32.199 38.866  1.00 38.86  ? 38  CYS B CA  1 
ATOM   2115 C C   . CYS B 2 38  ? -4.866  -33.204 37.855  1.00 39.52  ? 38  CYS B C   1 
ATOM   2116 O O   . CYS B 2 38  ? -4.722  -32.895 36.664  1.00 39.64  ? 38  CYS B O   1 
ATOM   2117 C CB  . CYS B 2 38  ? -6.891  -32.571 39.248  1.00 38.65  ? 38  CYS B CB  1 
ATOM   2118 S SG  . CYS B 2 38  ? -7.082  -34.211 40.005  1.00 41.18  ? 38  CYS B SG  1 
ATOM   2119 N N   . GLY B 2 39  ? -4.542  -34.401 38.345  1.00 40.95  ? 39  GLY B N   1 
ATOM   2120 C CA  . GLY B 2 39  ? -4.022  -35.437 37.474  1.00 44.07  ? 39  GLY B CA  1 
ATOM   2121 C C   . GLY B 2 39  ? -5.182  -36.070 36.748  1.00 45.53  ? 39  GLY B C   1 
ATOM   2122 O O   . GLY B 2 39  ? -6.229  -36.289 37.358  1.00 47.34  ? 39  GLY B O   1 
ATOM   2123 N N   . GLU B 2 40  ? -5.009  -36.379 35.467  1.00 45.51  ? 40  GLU B N   1 
ATOM   2124 C CA  . GLU B 2 40  ? -6.049  -37.027 34.665  1.00 47.66  ? 40  GLU B CA  1 
ATOM   2125 C C   . GLU B 2 40  ? -5.891  -38.556 34.643  1.00 48.51  ? 40  GLU B C   1 
ATOM   2126 O O   . GLU B 2 40  ? -6.876  -39.291 34.391  1.00 46.51  ? 40  GLU B O   1 
ATOM   2127 C CB  . GLU B 2 40  ? -6.043  -36.478 33.238  1.00 48.11  ? 40  GLU B CB  1 
ATOM   2128 C CG  . GLU B 2 40  ? -4.721  -36.571 32.550  1.00 51.30  ? 40  GLU B CG  1 
ATOM   2129 C CD  . GLU B 2 40  ? -4.694  -35.772 31.277  1.00 53.05  ? 40  GLU B CD  1 
ATOM   2130 O OE1 . GLU B 2 40  ? -4.432  -34.540 31.364  1.00 53.03  ? 40  GLU B OE1 1 
ATOM   2131 O OE2 . GLU B 2 40  ? -4.925  -36.385 30.198  1.00 51.97  ? 40  GLU B OE2 1 
ATOM   2132 N N   . ALA B 2 41  ? -4.673  -39.019 34.916  1.00 48.32  ? 41  ALA B N   1 
ATOM   2133 C CA  . ALA B 2 41  ? -4.341  -40.443 34.909  1.00 47.45  ? 41  ALA B CA  1 
ATOM   2134 C C   . ALA B 2 41  ? -5.033  -41.095 36.116  1.00 47.38  ? 41  ALA B C   1 
ATOM   2135 O O   . ALA B 2 41  ? -5.526  -40.382 37.007  1.00 50.13  ? 41  ALA B O   1 
ATOM   2136 C CB  . ALA B 2 41  ? -2.820  -40.618 34.991  1.00 45.98  ? 41  ALA B CB  1 
ATOM   2137 N N   . PRO B 2 42  ? -5.047  -42.457 36.184  1.00 46.41  ? 42  PRO B N   1 
ATOM   2138 C CA  . PRO B 2 42  ? -5.658  -43.153 37.319  1.00 47.03  ? 42  PRO B CA  1 
ATOM   2139 C C   . PRO B 2 42  ? -5.274  -42.585 38.662  1.00 47.58  ? 42  PRO B C   1 
ATOM   2140 O O   . PRO B 2 42  ? -6.089  -42.543 39.590  1.00 48.96  ? 42  PRO B O   1 
ATOM   2141 C CB  . PRO B 2 42  ? -5.112  -44.567 37.167  1.00 47.93  ? 42  PRO B CB  1 
ATOM   2142 C CG  . PRO B 2 42  ? -4.922  -44.722 35.697  1.00 47.61  ? 42  PRO B CG  1 
ATOM   2143 C CD  . PRO B 2 42  ? -4.452  -43.392 35.217  1.00 46.00  ? 42  PRO B CD  1 
ATOM   2144 N N   . ASP B 2 43  ? -4.040  -42.117 38.750  1.00 47.51  ? 43  ASP B N   1 
ATOM   2145 C CA  . ASP B 2 43  ? -3.533  -41.440 39.933  1.00 47.08  ? 43  ASP B CA  1 
ATOM   2146 C C   . ASP B 2 43  ? -3.854  -39.964 39.696  1.00 45.42  ? 43  ASP B C   1 
ATOM   2147 O O   . ASP B 2 43  ? -3.065  -39.230 39.057  1.00 46.51  ? 43  ASP B O   1 
ATOM   2148 C CB  . ASP B 2 43  ? -2.010  -41.642 40.045  1.00 48.83  ? 43  ASP B CB  1 
ATOM   2149 C CG  . ASP B 2 43  ? -1.621  -43.111 40.092  1.00 51.85  ? 43  ASP B CG  1 
ATOM   2150 O OD1 . ASP B 2 43  ? -1.575  -43.773 39.028  1.00 54.40  ? 43  ASP B OD1 1 
ATOM   2151 O OD2 . ASP B 2 43  ? -1.373  -43.607 41.208  1.00 56.57  ? 43  ASP B OD2 1 
ATOM   2152 N N   . TYR B 2 44  ? -4.993  -39.518 40.235  1.00 43.21  ? 44  TYR B N   1 
ATOM   2153 C CA  . TYR B 2 44  ? -5.414  -38.128 40.090  1.00 41.34  ? 44  TYR B CA  1 
ATOM   2154 C C   . TYR B 2 44  ? -4.524  -37.205 40.929  1.00 39.67  ? 44  TYR B C   1 
ATOM   2155 O O   . TYR B 2 44  ? -4.936  -36.744 41.993  1.00 40.49  ? 44  TYR B O   1 
ATOM   2156 C CB  . TYR B 2 44  ? -6.884  -37.969 40.473  1.00 40.08  ? 44  TYR B CB  1 
ATOM   2157 C CG  . TYR B 2 44  ? -7.814  -38.660 39.495  1.00 39.21  ? 44  TYR B CG  1 
ATOM   2158 C CD1 . TYR B 2 44  ? -8.102  -38.072 38.243  1.00 38.33  ? 44  TYR B CD1 1 
ATOM   2159 C CD2 . TYR B 2 44  ? -8.396  -39.894 39.812  1.00 38.17  ? 44  TYR B CD2 1 
ATOM   2160 C CE1 . TYR B 2 44  ? -8.944  -38.697 37.326  1.00 38.72  ? 44  TYR B CE1 1 
ATOM   2161 C CE2 . TYR B 2 44  ? -9.260  -40.542 38.895  1.00 39.97  ? 44  TYR B CE2 1 
ATOM   2162 C CZ  . TYR B 2 44  ? -9.518  -39.928 37.651  1.00 39.72  ? 44  TYR B CZ  1 
ATOM   2163 O OH  . TYR B 2 44  ? -10.367 -40.537 36.755  1.00 40.52  ? 44  TYR B OH  1 
ATOM   2164 N N   . ASP B 2 45  ? -3.315  -36.978 40.441  1.00 37.56  ? 45  ASP B N   1 
ATOM   2165 C CA  . ASP B 2 45  ? -2.291  -36.204 41.137  1.00 36.24  ? 45  ASP B CA  1 
ATOM   2166 C C   . ASP B 2 45  ? -2.746  -34.795 41.479  1.00 34.68  ? 45  ASP B C   1 
ATOM   2167 O O   . ASP B 2 45  ? -2.835  -33.923 40.606  1.00 35.20  ? 45  ASP B O   1 
ATOM   2168 C CB  . ASP B 2 45  ? -1.022  -36.157 40.277  1.00 36.19  ? 45  ASP B CB  1 
ATOM   2169 C CG  . ASP B 2 45  ? 0.112   -35.380 40.941  1.00 34.09  ? 45  ASP B CG  1 
ATOM   2170 O OD1 . ASP B 2 45  ? 0.559   -35.797 42.039  1.00 32.42  ? 45  ASP B OD1 1 
ATOM   2171 O OD2 . ASP B 2 45  ? 0.530   -34.354 40.352  1.00 32.28  ? 45  ASP B OD2 1 
ATOM   2172 N N   . ARG B 2 46  ? -3.046  -34.577 42.755  1.00 32.65  ? 46  ARG B N   1 
ATOM   2173 C CA  . ARG B 2 46  ? -3.479  -33.270 43.249  1.00 31.10  ? 46  ARG B CA  1 
ATOM   2174 C C   . ARG B 2 46  ? -2.391  -32.582 44.103  1.00 29.93  ? 46  ARG B C   1 
ATOM   2175 O O   . ARG B 2 46  ? -2.686  -31.709 44.945  1.00 29.27  ? 46  ARG B O   1 
ATOM   2176 C CB  . ARG B 2 46  ? -4.795  -33.393 44.035  1.00 28.19  ? 46  ARG B CB  1 
ATOM   2177 C CG  . ARG B 2 46  ? -4.836  -34.518 45.021  1.00 27.89  ? 46  ARG B CG  1 
ATOM   2178 C CD  . ARG B 2 46  ? -6.026  -34.391 45.959  1.00 28.21  ? 46  ARG B CD  1 
ATOM   2179 N NE  . ARG B 2 46  ? -7.283  -34.099 45.252  1.00 29.15  ? 46  ARG B NE  1 
ATOM   2180 C CZ  . ARG B 2 46  ? -8.022  -34.998 44.586  1.00 29.85  ? 46  ARG B CZ  1 
ATOM   2181 N NH1 . ARG B 2 46  ? -7.644  -36.291 44.493  1.00 27.36  ? 46  ARG B NH1 1 
ATOM   2182 N NH2 . ARG B 2 46  ? -9.165  -34.609 44.003  1.00 29.05  ? 46  ARG B NH2 1 
ATOM   2183 N N   . SER B 2 47  ? -1.138  -32.963 43.861  1.00 28.25  ? 47  SER B N   1 
ATOM   2184 C CA  . SER B 2 47  ? -0.009  -32.415 44.604  1.00 26.37  ? 47  SER B CA  1 
ATOM   2185 C C   . SER B 2 47  ? 0.090   -30.906 44.425  1.00 23.83  ? 47  SER B C   1 
ATOM   2186 O O   . SER B 2 47  ? 0.467   -30.215 45.333  1.00 25.97  ? 47  SER B O   1 
ATOM   2187 C CB  . SER B 2 47  ? 1.295   -33.078 44.169  1.00 25.00  ? 47  SER B CB  1 
ATOM   2188 O OG  . SER B 2 47  ? 1.439   -32.994 42.768  1.00 28.06  ? 47  SER B OG  1 
ATOM   2189 N N   . GLN B 2 48  ? -0.287  -30.402 43.254  1.00 23.10  ? 48  GLN B N   1 
ATOM   2190 C CA  . GLN B 2 48  ? -0.255  -28.973 42.961  1.00 20.76  ? 48  GLN B CA  1 
ATOM   2191 C C   . GLN B 2 48  ? -0.906  -28.146 44.049  1.00 20.12  ? 48  GLN B C   1 
ATOM   2192 O O   . GLN B 2 48  ? -0.476  -27.041 44.316  1.00 21.90  ? 48  GLN B O   1 
ATOM   2193 C CB  . GLN B 2 48  ? -0.955  -28.711 41.627  1.00 21.89  ? 48  GLN B CB  1 
ATOM   2194 C CG  . GLN B 2 48  ? -0.695  -27.330 41.039  1.00 24.82  ? 48  GLN B CG  1 
ATOM   2195 C CD  . GLN B 2 48  ? -1.191  -27.185 39.613  1.00 26.75  ? 48  GLN B CD  1 
ATOM   2196 O OE1 . GLN B 2 48  ? -1.765  -26.170 39.254  1.00 27.50  ? 48  GLN B OE1 1 
ATOM   2197 N NE2 . GLN B 2 48  ? -0.968  -28.199 38.800  1.00 28.16  ? 48  GLN B NE2 1 
ATOM   2198 N N   . TRP B 2 49  ? -1.920  -28.709 44.690  1.00 19.70  ? 49  TRP B N   1 
ATOM   2199 C CA  . TRP B 2 49  ? -2.607  -28.068 45.801  1.00 16.88  ? 49  TRP B CA  1 
ATOM   2200 C C   . TRP B 2 49  ? -1.844  -28.379 47.085  1.00 18.26  ? 49  TRP B C   1 
ATOM   2201 O O   . TRP B 2 49  ? -1.497  -27.479 47.840  1.00 20.31  ? 49  TRP B O   1 
ATOM   2202 C CB  . TRP B 2 49  ? -4.054  -28.574 45.876  1.00 13.47  ? 49  TRP B CB  1 
ATOM   2203 C CG  . TRP B 2 49  ? -4.747  -28.363 47.206  1.00 4.26   ? 49  TRP B CG  1 
ATOM   2204 C CD1 . TRP B 2 49  ? -5.462  -29.284 47.910  1.00 2.00   ? 49  TRP B CD1 1 
ATOM   2205 C CD2 . TRP B 2 49  ? -4.814  -27.136 47.955  1.00 2.00   ? 49  TRP B CD2 1 
ATOM   2206 N NE1 . TRP B 2 49  ? -5.951  -28.732 49.073  1.00 3.14   ? 49  TRP B NE1 1 
ATOM   2207 C CE2 . TRP B 2 49  ? -5.599  -27.420 49.121  1.00 2.00   ? 49  TRP B CE2 1 
ATOM   2208 C CE3 . TRP B 2 49  ? -4.295  -25.856 47.767  1.00 2.00   ? 49  TRP B CE3 1 
ATOM   2209 C CZ2 . TRP B 2 49  ? -5.850  -26.452 50.094  1.00 2.00   ? 49  TRP B CZ2 1 
ATOM   2210 C CZ3 . TRP B 2 49  ? -4.546  -24.888 48.735  1.00 2.00   ? 49  TRP B CZ3 1 
ATOM   2211 C CH2 . TRP B 2 49  ? -5.320  -25.202 49.903  1.00 4.09   ? 49  TRP B CH2 1 
ATOM   2212 N N   . LEU B 2 50  ? -1.637  -29.668 47.336  1.00 19.33  ? 50  LEU B N   1 
ATOM   2213 C CA  . LEU B 2 50  ? -0.988  -30.148 48.544  1.00 20.10  ? 50  LEU B CA  1 
ATOM   2214 C C   . LEU B 2 50  ? 0.363   -29.480 48.887  1.00 21.68  ? 50  LEU B C   1 
ATOM   2215 O O   . LEU B 2 50  ? 0.715   -29.337 50.056  1.00 23.94  ? 50  LEU B O   1 
ATOM   2216 C CB  . LEU B 2 50  ? -0.819  -31.665 48.431  1.00 21.07  ? 50  LEU B CB  1 
ATOM   2217 C CG  . LEU B 2 50  ? -1.974  -32.559 48.902  1.00 21.35  ? 50  LEU B CG  1 
ATOM   2218 C CD1 . LEU B 2 50  ? -3.265  -32.137 48.272  1.00 25.21  ? 50  LEU B CD1 1 
ATOM   2219 C CD2 . LEU B 2 50  ? -1.660  -33.983 48.522  1.00 23.36  ? 50  LEU B CD2 1 
ATOM   2220 N N   . ASP B 2 51  ? 1.116   -29.058 47.874  1.00 21.63  ? 51  ASP B N   1 
ATOM   2221 C CA  . ASP B 2 51  ? 2.408   -28.421 48.105  1.00 25.08  ? 51  ASP B CA  1 
ATOM   2222 C C   . ASP B 2 51  ? 2.251   -27.081 48.813  1.00 24.35  ? 51  ASP B C   1 
ATOM   2223 O O   . ASP B 2 51  ? 2.996   -26.799 49.736  1.00 27.25  ? 51  ASP B O   1 
ATOM   2224 C CB  . ASP B 2 51  ? 3.162   -28.229 46.786  1.00 24.68  ? 51  ASP B CB  1 
ATOM   2225 C CG  . ASP B 2 51  ? 3.496   -29.525 46.105  1.00 25.16  ? 51  ASP B CG  1 
ATOM   2226 O OD1 . ASP B 2 51  ? 4.031   -30.454 46.749  1.00 26.34  ? 51  ASP B OD1 1 
ATOM   2227 O OD2 . ASP B 2 51  ? 3.191   -29.621 44.909  1.00 27.97  ? 51  ASP B OD2 1 
ATOM   2228 N N   . VAL B 2 52  ? 1.291   -26.266 48.385  1.00 22.46  ? 52  VAL B N   1 
ATOM   2229 C CA  . VAL B 2 52  ? 1.109   -24.957 48.978  1.00 21.28  ? 52  VAL B CA  1 
ATOM   2230 C C   . VAL B 2 52  ? 0.050   -24.966 50.064  1.00 19.14  ? 52  VAL B C   1 
ATOM   2231 O O   . VAL B 2 52  ? -0.116  -23.972 50.762  1.00 20.29  ? 52  VAL B O   1 
ATOM   2232 C CB  . VAL B 2 52  ? 0.754   -23.889 47.928  1.00 22.71  ? 52  VAL B CB  1 
ATOM   2233 C CG1 . VAL B 2 52  ? 1.907   -23.713 46.982  1.00 26.58  ? 52  VAL B CG1 1 
ATOM   2234 C CG2 . VAL B 2 52  ? -0.500  -24.260 47.200  1.00 25.95  ? 52  VAL B CG2 1 
ATOM   2235 N N   . LYS B 2 53  ? -0.680  -26.074 50.186  1.00 15.26  ? 53  LYS B N   1 
ATOM   2236 C CA  . LYS B 2 53  ? -1.779  -26.192 51.144  1.00 13.12  ? 53  LYS B CA  1 
ATOM   2237 C C   . LYS B 2 53  ? -1.506  -25.585 52.532  1.00 12.98  ? 53  LYS B C   1 
ATOM   2238 O O   . LYS B 2 53  ? -2.332  -24.795 53.045  1.00 15.99  ? 53  LYS B O   1 
ATOM   2239 C CB  . LYS B 2 53  ? -2.208  -27.660 51.282  1.00 8.81   ? 53  LYS B CB  1 
ATOM   2240 C CG  . LYS B 2 53  ? -3.305  -27.855 52.322  1.00 10.27  ? 53  LYS B CG  1 
ATOM   2241 C CD  . LYS B 2 53  ? -3.751  -29.265 52.426  1.00 6.62   ? 53  LYS B CD  1 
ATOM   2242 C CE  . LYS B 2 53  ? -4.859  -29.366 53.458  1.00 2.00   ? 53  LYS B CE  1 
ATOM   2243 N NZ  . LYS B 2 53  ? -5.286  -30.784 53.668  1.00 4.43   ? 53  LYS B NZ  1 
ATOM   2244 N N   . PHE B 2 54  ? -0.359  -25.935 53.120  1.00 13.24  ? 54  PHE B N   1 
ATOM   2245 C CA  . PHE B 2 54  ? -0.022  -25.487 54.469  1.00 11.20  ? 54  PHE B CA  1 
ATOM   2246 C C   . PHE B 2 54  ? 0.878   -24.265 54.489  1.00 13.91  ? 54  PHE B C   1 
ATOM   2247 O O   . PHE B 2 54  ? 1.549   -24.041 55.481  1.00 14.86  ? 54  PHE B O   1 
ATOM   2248 C CB  . PHE B 2 54  ? 0.597   -26.612 55.290  1.00 7.00   ? 54  PHE B CB  1 
ATOM   2249 C CG  . PHE B 2 54  ? -0.307  -27.792 55.455  1.00 6.83   ? 54  PHE B CG  1 
ATOM   2250 C CD1 . PHE B 2 54  ? -1.332  -27.769 56.407  1.00 3.91   ? 54  PHE B CD1 1 
ATOM   2251 C CD2 . PHE B 2 54  ? -0.153  -28.911 54.623  1.00 7.83   ? 54  PHE B CD2 1 
ATOM   2252 C CE1 . PHE B 2 54  ? -2.190  -28.860 56.536  1.00 2.00   ? 54  PHE B CE1 1 
ATOM   2253 C CE2 . PHE B 2 54  ? -1.005  -30.028 54.724  1.00 6.39   ? 54  PHE B CE2 1 
ATOM   2254 C CZ  . PHE B 2 54  ? -2.028  -30.009 55.683  1.00 3.26   ? 54  PHE B CZ  1 
ATOM   2255 N N   . LYS B 2 55  ? 0.892   -23.499 53.405  1.00 14.66  ? 55  LYS B N   1 
ATOM   2256 C CA  . LYS B 2 55  ? 1.750   -22.315 53.295  1.00 17.23  ? 55  LYS B CA  1 
ATOM   2257 C C   . LYS B 2 55  ? 0.952   -21.048 53.005  1.00 17.76  ? 55  LYS B C   1 
ATOM   2258 O O   . LYS B 2 55  ? 1.528   -19.991 52.739  1.00 19.42  ? 55  LYS B O   1 
ATOM   2259 C CB  . LYS B 2 55  ? 2.813   -22.520 52.219  1.00 17.51  ? 55  LYS B CB  1 
ATOM   2260 C CG  . LYS B 2 55  ? 3.648   -23.783 52.392  1.00 19.82  ? 55  LYS B CG  1 
ATOM   2261 C CD  . LYS B 2 55  ? 4.623   -23.940 51.256  1.00 21.15  ? 55  LYS B CD  1 
ATOM   2262 C CE  . LYS B 2 55  ? 5.374   -25.234 51.367  1.00 23.66  ? 55  LYS B CE  1 
ATOM   2263 N NZ  . LYS B 2 55  ? 6.281   -25.474 50.207  1.00 27.55  ? 55  LYS B NZ  1 
ATOM   2264 N N   . LEU B 2 56  ? -0.366  -21.145 53.065  1.00 18.02  ? 56  LEU B N   1 
ATOM   2265 C CA  . LEU B 2 56  ? -1.233  -20.010 52.744  1.00 18.72  ? 56  LEU B CA  1 
ATOM   2266 C C   . LEU B 2 56  ? -1.752  -19.275 53.966  1.00 19.16  ? 56  LEU B C   1 
ATOM   2267 O O   . LEU B 2 56  ? -2.503  -18.309 53.828  1.00 20.93  ? 56  LEU B O   1 
ATOM   2268 C CB  . LEU B 2 56  ? -2.399  -20.456 51.840  1.00 17.34  ? 56  LEU B CB  1 
ATOM   2269 C CG  . LEU B 2 56  ? -1.951  -21.080 50.518  1.00 14.49  ? 56  LEU B CG  1 
ATOM   2270 C CD1 . LEU B 2 56  ? -3.124  -21.686 49.840  1.00 15.18  ? 56  LEU B CD1 1 
ATOM   2271 C CD2 . LEU B 2 56  ? -1.282  -20.012 49.699  1.00 12.10  ? 56  LEU B CD2 1 
ATOM   2272 N N   . ASP B 2 57  ? -1.341  -19.744 55.144  1.00 18.71  ? 57  ASP B N   1 
ATOM   2273 C CA  . ASP B 2 57  ? -1.798  -19.168 56.416  1.00 19.02  ? 57  ASP B CA  1 
ATOM   2274 C C   . ASP B 2 57  ? -3.320  -19.266 56.609  1.00 17.43  ? 57  ASP B C   1 
ATOM   2275 O O   . ASP B 2 57  ? -3.958  -18.340 57.123  1.00 19.41  ? 57  ASP B O   1 
ATOM   2276 C CB  . ASP B 2 57  ? -1.352  -17.701 56.549  1.00 24.41  ? 57  ASP B CB  1 
ATOM   2277 C CG  . ASP B 2 57  ? 0.145   -17.547 56.735  1.00 30.56  ? 57  ASP B CG  1 
ATOM   2278 O OD1 . ASP B 2 57  ? 0.613   -17.853 57.859  1.00 29.93  ? 57  ASP B OD1 1 
ATOM   2279 O OD2 . ASP B 2 57  ? 0.842   -17.150 55.759  1.00 30.51  ? 57  ASP B OD2 1 
ATOM   2280 N N   . LEU B 2 58  ? -3.897  -20.394 56.229  1.00 14.32  ? 58  LEU B N   1 
ATOM   2281 C CA  . LEU B 2 58  ? -5.329  -20.596 56.372  1.00 13.67  ? 58  LEU B CA  1 
ATOM   2282 C C   . LEU B 2 58  ? -5.557  -21.386 57.668  1.00 12.37  ? 58  LEU B C   1 
ATOM   2283 O O   . LEU B 2 58  ? -4.884  -22.397 57.935  1.00 13.31  ? 58  LEU B O   1 
ATOM   2284 C CB  . LEU B 2 58  ? -5.877  -21.384 55.173  1.00 14.11  ? 58  LEU B CB  1 
ATOM   2285 C CG  . LEU B 2 58  ? -5.690  -20.787 53.792  1.00 11.05  ? 58  LEU B CG  1 
ATOM   2286 C CD1 . LEU B 2 58  ? -6.206  -21.750 52.779  1.00 11.72  ? 58  LEU B CD1 1 
ATOM   2287 C CD2 . LEU B 2 58  ? -6.348  -19.431 53.735  1.00 12.51  ? 58  LEU B CD2 1 
ATOM   2288 N N   . ASP B 2 59  ? -6.551  -20.939 58.441  1.00 11.11  ? 59  ASP B N   1 
ATOM   2289 C CA  . ASP B 2 59  ? -6.889  -21.576 59.702  1.00 10.31  ? 59  ASP B CA  1 
ATOM   2290 C C   . ASP B 2 59  ? -7.386  -23.000 59.475  1.00 11.47  ? 59  ASP B C   1 
ATOM   2291 O O   . ASP B 2 59  ? -7.134  -23.885 60.252  1.00 10.34  ? 59  ASP B O   1 
ATOM   2292 C CB  . ASP B 2 59  ? -7.982  -20.780 60.403  1.00 10.76  ? 59  ASP B CB  1 
ATOM   2293 C CG  . ASP B 2 59  ? -7.566  -19.363 60.697  1.00 13.27  ? 59  ASP B CG  1 
ATOM   2294 O OD1 . ASP B 2 59  ? -7.524  -18.545 59.780  1.00 15.44  ? 59  ASP B OD1 1 
ATOM   2295 O OD2 . ASP B 2 59  ? -7.307  -19.030 61.856  1.00 20.57  ? 59  ASP B OD2 1 
ATOM   2296 N N   . PHE B 2 60  ? -8.068  -23.227 58.372  1.00 14.65  ? 60  PHE B N   1 
ATOM   2297 C CA  . PHE B 2 60  ? -8.535  -24.558 58.018  1.00 15.25  ? 60  PHE B CA  1 
ATOM   2298 C C   . PHE B 2 60  ? -8.267  -24.622 56.520  1.00 17.27  ? 60  PHE B C   1 
ATOM   2299 O O   . PHE B 2 60  ? -9.112  -24.238 55.713  1.00 17.68  ? 60  PHE B O   1 
ATOM   2300 C CB  . PHE B 2 60  ? -10.046 -24.699 58.275  1.00 13.18  ? 60  PHE B CB  1 
ATOM   2301 C CG  . PHE B 2 60  ? -10.431 -24.472 59.698  1.00 2.00   ? 60  PHE B CG  1 
ATOM   2302 C CD1 . PHE B 2 60  ? -10.784 -23.195 60.154  1.00 2.00   ? 60  PHE B CD1 1 
ATOM   2303 C CD2 . PHE B 2 60  ? -10.484 -25.543 60.573  1.00 2.00   ? 60  PHE B CD2 1 
ATOM   2304 C CE1 . PHE B 2 60  ? -11.167 -22.975 61.508  1.00 3.91   ? 60  PHE B CE1 1 
ATOM   2305 C CE2 . PHE B 2 60  ? -10.851 -25.363 61.954  1.00 2.00   ? 60  PHE B CE2 1 
ATOM   2306 C CZ  . PHE B 2 60  ? -11.202 -24.079 62.423  1.00 2.00   ? 60  PHE B CZ  1 
ATOM   2307 N N   . PRO B 2 61  ? -7.078  -25.144 56.123  1.00 21.32  ? 61  PRO B N   1 
ATOM   2308 C CA  . PRO B 2 61  ? -6.696  -25.264 54.719  1.00 17.12  ? 61  PRO B CA  1 
ATOM   2309 C C   . PRO B 2 61  ? -7.725  -26.037 53.931  1.00 15.56  ? 61  PRO B C   1 
ATOM   2310 O O   . PRO B 2 61  ? -8.081  -27.145 54.277  1.00 13.68  ? 61  PRO B O   1 
ATOM   2311 C CB  . PRO B 2 61  ? -5.364  -26.027 54.788  1.00 18.68  ? 61  PRO B CB  1 
ATOM   2312 C CG  . PRO B 2 61  ? -4.816  -25.625 56.114  1.00 20.59  ? 61  PRO B CG  1 
ATOM   2313 C CD  . PRO B 2 61  ? -6.005  -25.567 57.034  1.00 21.03  ? 61  PRO B CD  1 
ATOM   2314 N N   . ASN B 2 62  ? -8.237  -25.401 52.869  1.00 16.10  ? 62  ASN B N   1 
ATOM   2315 C CA  . ASN B 2 62  ? -9.324  -25.968 52.091  1.00 17.03  ? 62  ASN B CA  1 
ATOM   2316 C C   . ASN B 2 62  ? -9.417  -25.218 50.770  1.00 17.25  ? 62  ASN B C   1 
ATOM   2317 O O   . ASN B 2 62  ? -8.755  -24.212 50.561  1.00 17.00  ? 62  ASN B O   1 
ATOM   2318 C CB  . ASN B 2 62  ? -10.650 -25.865 52.864  1.00 17.78  ? 62  ASN B CB  1 
ATOM   2319 C CG  . ASN B 2 62  ? -11.590 -27.015 52.564  1.00 16.01  ? 62  ASN B CG  1 
ATOM   2320 O OD1 . ASN B 2 62  ? -11.341 -27.860 51.693  1.00 14.17  ? 62  ASN B OD1 1 
ATOM   2321 N ND2 . ASN B 2 62  ? -12.689 -27.045 53.285  1.00 13.64  ? 62  ASN B ND2 1 
ATOM   2322 N N   . LEU B 2 63  ? -10.275 -25.741 49.889  1.00 18.45  ? 63  LEU B N   1 
ATOM   2323 C CA  . LEU B 2 63  ? -10.566 -25.127 48.589  1.00 18.74  ? 63  LEU B CA  1 
ATOM   2324 C C   . LEU B 2 63  ? -12.095 -25.082 48.385  1.00 18.33  ? 63  LEU B C   1 
ATOM   2325 O O   . LEU B 2 63  ? -12.808 -26.046 48.631  1.00 20.98  ? 63  LEU B O   1 
ATOM   2326 C CB  . LEU B 2 63  ? -9.933  -25.953 47.463  1.00 19.94  ? 63  LEU B CB  1 
ATOM   2327 C CG  . LEU B 2 63  ? -8.431  -25.857 47.234  1.00 19.52  ? 63  LEU B CG  1 
ATOM   2328 C CD1 . LEU B 2 63  ? -8.066  -26.769 46.093  1.00 19.81  ? 63  LEU B CD1 1 
ATOM   2329 C CD2 . LEU B 2 63  ? -8.030  -24.472 46.924  1.00 19.22  ? 63  LEU B CD2 1 
ATOM   2330 N N   . PRO B 2 64  ? -12.622 -23.935 47.900  1.00 15.35  ? 64  PRO B N   1 
ATOM   2331 C CA  . PRO B 2 64  ? -11.877 -22.729 47.576  1.00 14.06  ? 64  PRO B CA  1 
ATOM   2332 C C   . PRO B 2 64  ? -11.416 -21.934 48.790  1.00 12.52  ? 64  PRO B C   1 
ATOM   2333 O O   . PRO B 2 64  ? -11.863 -22.140 49.915  1.00 11.00  ? 64  PRO B O   1 
ATOM   2334 C CB  . PRO B 2 64  ? -12.894 -21.936 46.753  1.00 15.07  ? 64  PRO B CB  1 
ATOM   2335 C CG  . PRO B 2 64  ? -14.203 -22.304 47.385  1.00 12.97  ? 64  PRO B CG  1 
ATOM   2336 C CD  . PRO B 2 64  ? -14.064 -23.794 47.663  1.00 16.43  ? 64  PRO B CD  1 
ATOM   2337 N N   . TYR B 2 65  ? -10.554 -20.948 48.531  1.00 10.39  ? 65  TYR B N   1 
ATOM   2338 C CA  . TYR B 2 65  ? -10.110 -20.035 49.563  1.00 10.56  ? 65  TYR B CA  1 
ATOM   2339 C C   . TYR B 2 65  ? -10.059 -18.646 48.933  1.00 11.82  ? 65  TYR B C   1 
ATOM   2340 O O   . TYR B 2 65  ? -9.837  -18.500 47.739  1.00 14.16  ? 65  TYR B O   1 
ATOM   2341 C CB  . TYR B 2 65  ? -8.736  -20.471 50.127  1.00 9.53   ? 65  TYR B CB  1 
ATOM   2342 C CG  . TYR B 2 65  ? -7.524  -20.332 49.175  1.00 8.97   ? 65  TYR B CG  1 
ATOM   2343 C CD1 . TYR B 2 65  ? -6.950  -19.064 48.892  1.00 7.09   ? 65  TYR B CD1 1 
ATOM   2344 C CD2 . TYR B 2 65  ? -6.977  -21.464 48.536  1.00 6.27   ? 65  TYR B CD2 1 
ATOM   2345 C CE1 . TYR B 2 65  ? -5.862  -18.944 48.016  1.00 5.55   ? 65  TYR B CE1 1 
ATOM   2346 C CE2 . TYR B 2 65  ? -5.881  -21.332 47.667  1.00 5.59   ? 65  TYR B CE2 1 
ATOM   2347 C CZ  . TYR B 2 65  ? -5.331  -20.087 47.457  1.00 5.46   ? 65  TYR B CZ  1 
ATOM   2348 O OH  . TYR B 2 65  ? -4.272  -19.997 46.620  1.00 6.35   ? 65  TYR B OH  1 
ATOM   2349 N N   . LEU B 2 66  ? -10.224 -17.621 49.764  1.00 14.02  ? 66  LEU B N   1 
ATOM   2350 C CA  . LEU B 2 66  ? -10.176 -16.257 49.303  1.00 14.42  ? 66  LEU B CA  1 
ATOM   2351 C C   . LEU B 2 66  ? -9.226  -15.533 50.259  1.00 17.04  ? 66  LEU B C   1 
ATOM   2352 O O   . LEU B 2 66  ? -9.395  -15.601 51.510  1.00 17.31  ? 66  LEU B O   1 
ATOM   2353 C CB  . LEU B 2 66  ? -11.568 -15.632 49.335  1.00 17.50  ? 66  LEU B CB  1 
ATOM   2354 C CG  . LEU B 2 66  ? -11.653 -14.172 48.917  1.00 17.71  ? 66  LEU B CG  1 
ATOM   2355 C CD1 . LEU B 2 66  ? -11.336 -14.057 47.444  1.00 23.69  ? 66  LEU B CD1 1 
ATOM   2356 C CD2 . LEU B 2 66  ? -13.018 -13.649 49.203  1.00 21.01  ? 66  LEU B CD2 1 
ATOM   2357 N N   . LEU B 2 67  ? -8.261  -14.826 49.675  1.00 19.04  ? 67  LEU B N   1 
ATOM   2358 C CA  . LEU B 2 67  ? -7.306  -14.040 50.449  1.00 18.79  ? 67  LEU B CA  1 
ATOM   2359 C C   . LEU B 2 67  ? -7.567  -12.598 50.091  1.00 19.84  ? 67  LEU B C   1 
ATOM   2360 O O   . LEU B 2 67  ? -7.192  -12.158 49.028  1.00 22.54  ? 67  LEU B O   1 
ATOM   2361 C CB  . LEU B 2 67  ? -5.860  -14.469 50.146  1.00 18.92  ? 67  LEU B CB  1 
ATOM   2362 C CG  . LEU B 2 67  ? -5.553  -15.968 50.151  1.00 20.08  ? 67  LEU B CG  1 
ATOM   2363 C CD1 . LEU B 2 67  ? -4.118  -16.179 49.816  1.00 18.28  ? 67  LEU B CD1 1 
ATOM   2364 C CD2 . LEU B 2 67  ? -5.911  -16.571 51.480  1.00 21.27  ? 67  LEU B CD2 1 
ATOM   2365 N N   . ASP B 2 68  ? -8.190  -11.870 51.002  1.00 20.14  ? 68  ASP B N   1 
ATOM   2366 C CA  . ASP B 2 68  ? -8.428  -10.454 50.826  1.00 22.09  ? 68  ASP B CA  1 
ATOM   2367 C C   . ASP B 2 68  ? -7.598  -9.719  51.889  1.00 23.50  ? 68  ASP B C   1 
ATOM   2368 O O   . ASP B 2 68  ? -8.097  -9.381  52.983  1.00 22.41  ? 68  ASP B O   1 
ATOM   2369 C CB  . ASP B 2 68  ? -9.908  -10.144 50.985  1.00 20.08  ? 68  ASP B CB  1 
ATOM   2370 C CG  . ASP B 2 68  ? -10.222 -8.694  50.702  1.00 19.66  ? 68  ASP B CG  1 
ATOM   2371 O OD1 . ASP B 2 68  ? -9.689  -8.160  49.702  1.00 20.87  ? 68  ASP B OD1 1 
ATOM   2372 O OD2 . ASP B 2 68  ? -11.008 -8.089  51.476  1.00 20.74  ? 68  ASP B OD2 1 
ATOM   2373 N N   . GLY B 2 69  ? -6.336  -9.466  51.550  1.00 24.38  ? 69  GLY B N   1 
ATOM   2374 C CA  . GLY B 2 69  ? -5.422  -8.786  52.463  1.00 23.48  ? 69  GLY B CA  1 
ATOM   2375 C C   . GLY B 2 69  ? -5.266  -9.568  53.756  1.00 25.36  ? 69  GLY B C   1 
ATOM   2376 O O   . GLY B 2 69  ? -4.777  -10.722 53.755  1.00 27.40  ? 69  GLY B O   1 
ATOM   2377 N N   . LYS B 2 70  ? -5.679  -8.957  54.867  1.00 24.79  ? 70  LYS B N   1 
ATOM   2378 C CA  . LYS B 2 70  ? -5.548  -9.586  56.169  1.00 25.01  ? 70  LYS B CA  1 
ATOM   2379 C C   . LYS B 2 70  ? -6.650  -10.605 56.428  1.00 25.26  ? 70  LYS B C   1 
ATOM   2380 O O   . LYS B 2 70  ? -6.594  -11.330 57.410  1.00 25.19  ? 70  LYS B O   1 
ATOM   2381 C CB  . LYS B 2 70  ? -5.543  -8.544  57.295  1.00 28.07  ? 70  LYS B CB  1 
ATOM   2382 C CG  . LYS B 2 70  ? -6.379  -7.275  57.038  1.00 31.61  ? 70  LYS B CG  1 
ATOM   2383 C CD  . LYS B 2 70  ? -7.874  -7.549  57.212  1.00 30.81  ? 70  LYS B CD  1 
ATOM   2384 C CE  . LYS B 2 70  ? -8.728  -6.319  56.928  1.00 32.18  ? 70  LYS B CE  1 
ATOM   2385 N NZ  . LYS B 2 70  ? -8.479  -5.229  57.935  1.00 30.98  ? 70  LYS B NZ  1 
ATOM   2386 N N   . ASN B 2 71  ? -7.653  -10.646 55.558  1.00 23.74  ? 71  ASN B N   1 
ATOM   2387 C CA  . ASN B 2 71  ? -8.769  -11.573 55.719  1.00 21.46  ? 71  ASN B CA  1 
ATOM   2388 C C   . ASN B 2 71  ? -8.621  -12.773 54.794  1.00 20.90  ? 71  ASN B C   1 
ATOM   2389 O O   . ASN B 2 71  ? -8.770  -12.669 53.585  1.00 23.22  ? 71  ASN B O   1 
ATOM   2390 C CB  . ASN B 2 71  ? -10.103 -10.856 55.477  1.00 19.08  ? 71  ASN B CB  1 
ATOM   2391 C CG  . ASN B 2 71  ? -10.499 -9.915  56.638  1.00 17.64  ? 71  ASN B CG  1 
ATOM   2392 O OD1 . ASN B 2 71  ? -11.110 -8.887  56.420  1.00 18.75  ? 71  ASN B OD1 1 
ATOM   2393 N ND2 . ASN B 2 71  ? -10.113 -10.269 57.852  1.00 15.67  ? 71  ASN B ND2 1 
ATOM   2394 N N   . LYS B 2 72  ? -8.332  -13.922 55.389  1.00 20.66  ? 72  LYS B N   1 
ATOM   2395 C CA  . LYS B 2 72  ? -8.207  -15.163 54.644  1.00 20.60  ? 72  LYS B CA  1 
ATOM   2396 C C   . LYS B 2 72  ? -9.384  -16.065 55.013  1.00 21.10  ? 72  LYS B C   1 
ATOM   2397 O O   . LYS B 2 72  ? -9.512  -16.480 56.191  1.00 19.30  ? 72  LYS B O   1 
ATOM   2398 C CB  . LYS B 2 72  ? -6.890  -15.852 55.006  1.00 23.77  ? 72  LYS B CB  1 
ATOM   2399 C CG  . LYS B 2 72  ? -5.677  -14.993 54.759  1.00 26.17  ? 72  LYS B CG  1 
ATOM   2400 C CD  . LYS B 2 72  ? -4.406  -15.571 55.365  1.00 26.58  ? 72  LYS B CD  1 
ATOM   2401 C CE  . LYS B 2 72  ? -3.208  -14.697 55.030  1.00 30.66  ? 72  LYS B CE  1 
ATOM   2402 N NZ  . LYS B 2 72  ? -3.435  -13.263 55.460  1.00 31.12  ? 72  LYS B NZ  1 
ATOM   2403 N N   . ILE B 2 73  ? -10.244 -16.349 54.030  1.00 19.98  ? 73  ILE B N   1 
ATOM   2404 C CA  . ILE B 2 73  ? -11.467 -17.119 54.272  1.00 15.85  ? 73  ILE B CA  1 
ATOM   2405 C C   . ILE B 2 73  ? -11.428 -18.463 53.543  1.00 15.30  ? 73  ILE B C   1 
ATOM   2406 O O   . ILE B 2 73  ? -10.824 -18.578 52.493  1.00 18.74  ? 73  ILE B O   1 
ATOM   2407 C CB  . ILE B 2 73  ? -12.757 -16.315 53.874  1.00 13.27  ? 73  ILE B CB  1 
ATOM   2408 C CG1 . ILE B 2 73  ? -12.759 -14.944 54.556  1.00 11.16  ? 73  ILE B CG1 1 
ATOM   2409 C CG2 . ILE B 2 73  ? -14.014 -17.064 54.306  1.00 9.81   ? 73  ILE B CG2 1 
ATOM   2410 C CD1 . ILE B 2 73  ? -12.126 -13.866 53.752  1.00 11.17  ? 73  ILE B CD1 1 
ATOM   2411 N N   . THR B 2 74  ? -12.098 -19.461 54.124  1.00 13.24  ? 74  THR B N   1 
ATOM   2412 C CA  . THR B 2 74  ? -12.298 -20.770 53.520  1.00 13.45  ? 74  THR B CA  1 
ATOM   2413 C C   . THR B 2 74  ? -13.756 -21.105 53.756  1.00 10.96  ? 74  THR B C   1 
ATOM   2414 O O   . THR B 2 74  ? -14.436 -20.376 54.470  1.00 9.59   ? 74  THR B O   1 
ATOM   2415 C CB  . THR B 2 74  ? -11.417 -21.849 54.149  1.00 14.72  ? 74  THR B CB  1 
ATOM   2416 O OG1 . THR B 2 74  ? -11.313 -21.647 55.560  1.00 21.77  ? 74  THR B OG1 1 
ATOM   2417 C CG2 . THR B 2 74  ? -10.035 -21.805 53.529  1.00 15.58  ? 74  THR B CG2 1 
ATOM   2418 N N   . GLN B 2 75  ? -14.221 -22.195 53.125  1.00 10.69  ? 75  GLN B N   1 
ATOM   2419 C CA  . GLN B 2 75  ? -15.636 -22.626 53.121  1.00 10.99  ? 75  GLN B CA  1 
ATOM   2420 C C   . GLN B 2 75  ? -16.499 -21.711 52.212  1.00 9.92   ? 75  GLN B C   1 
ATOM   2421 O O   . GLN B 2 75  ? -16.680 -20.496 52.505  1.00 3.17   ? 75  GLN B O   1 
ATOM   2422 C CB  . GLN B 2 75  ? -16.231 -22.672 54.535  1.00 9.66   ? 75  GLN B CB  1 
ATOM   2423 C CG  . GLN B 2 75  ? -15.633 -23.715 55.421  1.00 7.80   ? 75  GLN B CG  1 
ATOM   2424 C CD  . GLN B 2 75  ? -16.055 -25.092 55.021  1.00 7.69   ? 75  GLN B CD  1 
ATOM   2425 O OE1 . GLN B 2 75  ? -17.039 -25.237 54.332  1.00 8.83   ? 75  GLN B OE1 1 
ATOM   2426 N NE2 . GLN B 2 75  ? -15.301 -26.098 55.445  1.00 7.70   ? 75  GLN B NE2 1 
ATOM   2427 N N   . SER B 2 76  ? -17.001 -22.292 51.125  1.00 10.10  ? 76  SER B N   1 
ATOM   2428 C CA  . SER B 2 76  ? -17.790 -21.602 50.103  1.00 9.75   ? 76  SER B CA  1 
ATOM   2429 C C   . SER B 2 76  ? -18.803 -20.580 50.622  1.00 9.26   ? 76  SER B C   1 
ATOM   2430 O O   . SER B 2 76  ? -18.753 -19.426 50.239  1.00 8.32   ? 76  SER B O   1 
ATOM   2431 C CB  . SER B 2 76  ? -18.497 -22.637 49.258  1.00 10.18  ? 76  SER B CB  1 
ATOM   2432 O OG  . SER B 2 76  ? -17.552 -23.549 48.707  1.00 17.97  ? 76  SER B OG  1 
ATOM   2433 N N   . ASN B 2 77  ? -19.669 -21.003 51.538  1.00 9.96   ? 77  ASN B N   1 
ATOM   2434 C CA  . ASN B 2 77  ? -20.711 -20.147 52.073  1.00 10.85  ? 77  ASN B CA  1 
ATOM   2435 C C   . ASN B 2 77  ? -20.176 -18.988 52.882  1.00 10.56  ? 77  ASN B C   1 
ATOM   2436 O O   . ASN B 2 77  ? -20.806 -17.948 52.920  1.00 12.05  ? 77  ASN B O   1 
ATOM   2437 C CB  . ASN B 2 77  ? -21.671 -20.963 52.923  1.00 10.52  ? 77  ASN B CB  1 
ATOM   2438 C CG  . ASN B 2 77  ? -22.548 -21.922 52.075  1.00 12.66  ? 77  ASN B CG  1 
ATOM   2439 O OD1 . ASN B 2 77  ? -22.595 -21.846 50.840  1.00 6.26   ? 77  ASN B OD1 1 
ATOM   2440 N ND2 . ASN B 2 77  ? -23.230 -22.833 52.763  1.00 12.22  ? 77  ASN B ND2 1 
ATOM   2441 N N   . ALA B 2 78  ? -19.002 -19.163 53.469  1.00 9.50   ? 78  ALA B N   1 
ATOM   2442 C CA  . ALA B 2 78  ? -18.333 -18.100 54.219  1.00 5.51   ? 78  ALA B CA  1 
ATOM   2443 C C   . ALA B 2 78  ? -17.726 -17.058 53.284  1.00 6.52   ? 78  ALA B C   1 
ATOM   2444 O O   . ALA B 2 78  ? -17.703 -15.875 53.592  1.00 5.22   ? 78  ALA B O   1 
ATOM   2445 C CB  . ALA B 2 78  ? -17.257 -18.697 55.076  1.00 11.97  ? 78  ALA B CB  1 
ATOM   2446 N N   . ILE B 2 79  ? -17.255 -17.515 52.124  1.00 7.81   ? 79  ILE B N   1 
ATOM   2447 C CA  . ILE B 2 79  ? -16.709 -16.634 51.097  1.00 8.23   ? 79  ILE B CA  1 
ATOM   2448 C C   . ILE B 2 79  ? -17.822 -15.801 50.472  1.00 9.14   ? 79  ILE B C   1 
ATOM   2449 O O   . ILE B 2 79  ? -17.702 -14.575 50.348  1.00 8.85   ? 79  ILE B O   1 
ATOM   2450 C CB  . ILE B 2 79  ? -15.988 -17.448 49.983  1.00 8.88   ? 79  ILE B CB  1 
ATOM   2451 C CG1 . ILE B 2 79  ? -14.916 -18.348 50.610  1.00 7.91   ? 79  ILE B CG1 1 
ATOM   2452 C CG2 . ILE B 2 79  ? -15.401 -16.497 48.944  1.00 3.77   ? 79  ILE B CG2 1 
ATOM   2453 C CD1 . ILE B 2 79  ? -14.278 -19.306 49.673  1.00 7.27   ? 79  ILE B CD1 1 
ATOM   2454 N N   . LEU B 2 80  ? -18.912 -16.475 50.090  1.00 7.63   ? 80  LEU B N   1 
ATOM   2455 C CA  . LEU B 2 80  ? -20.076 -15.809 49.502  1.00 8.39   ? 80  LEU B CA  1 
ATOM   2456 C C   . LEU B 2 80  ? -20.669 -14.785 50.444  1.00 6.13   ? 80  LEU B C   1 
ATOM   2457 O O   . LEU B 2 80  ? -20.888 -13.647 50.086  1.00 10.02  ? 80  LEU B O   1 
ATOM   2458 C CB  . LEU B 2 80  ? -21.152 -16.838 49.081  1.00 10.05  ? 80  LEU B CB  1 
ATOM   2459 C CG  . LEU B 2 80  ? -20.865 -17.698 47.831  1.00 7.99   ? 80  LEU B CG  1 
ATOM   2460 C CD1 . LEU B 2 80  ? -21.675 -18.948 47.873  1.00 2.99   ? 80  LEU B CD1 1 
ATOM   2461 C CD2 . LEU B 2 80  ? -21.132 -16.925 46.585  1.00 2.00   ? 80  LEU B CD2 1 
ATOM   2462 N N   . ARG B 2 81  ? -20.921 -15.208 51.671  1.00 6.04   ? 81  ARG B N   1 
ATOM   2463 C CA  . ARG B 2 81  ? -21.420 -14.304 52.681  1.00 8.52   ? 81  ARG B CA  1 
ATOM   2464 C C   . ARG B 2 81  ? -20.504 -13.100 52.865  1.00 10.15  ? 81  ARG B C   1 
ATOM   2465 O O   . ARG B 2 81  ? -21.007 -11.980 52.969  1.00 9.07   ? 81  ARG B O   1 
ATOM   2466 C CB  . ARG B 2 81  ? -21.589 -15.040 54.004  1.00 8.56   ? 81  ARG B CB  1 
ATOM   2467 C CG  . ARG B 2 81  ? -22.825 -15.892 54.085  1.00 10.22  ? 81  ARG B CG  1 
ATOM   2468 C CD  . ARG B 2 81  ? -22.884 -16.673 55.371  1.00 13.06  ? 81  ARG B CD  1 
ATOM   2469 N NE  . ARG B 2 81  ? -24.141 -17.377 55.581  1.00 9.05   ? 81  ARG B NE  1 
ATOM   2470 C CZ  . ARG B 2 81  ? -25.296 -16.779 55.835  1.00 8.25   ? 81  ARG B CZ  1 
ATOM   2471 N NH1 . ARG B 2 81  ? -25.345 -15.470 55.928  1.00 8.03   ? 81  ARG B NH1 1 
ATOM   2472 N NH2 . ARG B 2 81  ? -26.384 -17.509 55.987  1.00 8.79   ? 81  ARG B NH2 1 
ATOM   2473 N N   . TYR B 2 82  ? -19.187 -13.326 52.893  1.00 12.90  ? 82  TYR B N   1 
ATOM   2474 C CA  . TYR B 2 82  ? -18.190 -12.270 53.102  1.00 13.67  ? 82  TYR B CA  1 
ATOM   2475 C C   . TYR B 2 82  ? -18.298 -11.185 52.045  1.00 13.29  ? 82  TYR B C   1 
ATOM   2476 O O   . TYR B 2 82  ? -18.595 -10.036 52.367  1.00 10.53  ? 82  TYR B O   1 
ATOM   2477 C CB  . TYR B 2 82  ? -16.772 -12.860 53.121  1.00 14.64  ? 82  TYR B CB  1 
ATOM   2478 C CG  . TYR B 2 82  ? -15.656 -11.841 53.212  1.00 11.69  ? 82  TYR B CG  1 
ATOM   2479 C CD1 . TYR B 2 82  ? -15.536 -10.994 54.336  1.00 12.10  ? 82  TYR B CD1 1 
ATOM   2480 C CD2 . TYR B 2 82  ? -14.724 -11.702 52.169  1.00 12.31  ? 82  TYR B CD2 1 
ATOM   2481 C CE1 . TYR B 2 82  ? -14.518 -10.034 54.414  1.00 11.00  ? 82  TYR B CE1 1 
ATOM   2482 C CE2 . TYR B 2 82  ? -13.711 -10.744 52.239  1.00 14.57  ? 82  TYR B CE2 1 
ATOM   2483 C CZ  . TYR B 2 82  ? -13.619 -9.924  53.360  1.00 13.13  ? 82  TYR B CZ  1 
ATOM   2484 O OH  . TYR B 2 82  ? -12.625 -8.985  53.408  1.00 13.89  ? 82  TYR B OH  1 
ATOM   2485 N N   . ILE B 2 83  ? -18.081 -11.573 50.785  1.00 16.19  ? 83  ILE B N   1 
ATOM   2486 C CA  . ILE B 2 83  ? -18.138 -10.650 49.652  1.00 16.80  ? 83  ILE B CA  1 
ATOM   2487 C C   . ILE B 2 83  ? -19.510 -9.957  49.576  1.00 16.59  ? 83  ILE B C   1 
ATOM   2488 O O   . ILE B 2 83  ? -19.593 -8.722  49.436  1.00 13.80  ? 83  ILE B O   1 
ATOM   2489 C CB  . ILE B 2 83  ? -17.855 -11.366 48.311  1.00 15.88  ? 83  ILE B CB  1 
ATOM   2490 C CG1 . ILE B 2 83  ? -16.487 -12.028 48.365  1.00 17.81  ? 83  ILE B CG1 1 
ATOM   2491 C CG2 . ILE B 2 83  ? -17.893 -10.389 47.178  1.00 16.81  ? 83  ILE B CG2 1 
ATOM   2492 C CD1 . ILE B 2 83  ? -16.242 -13.019 47.275  1.00 19.62  ? 83  ILE B CD1 1 
ATOM   2493 N N   . ALA B 2 84  ? -20.582 -10.756 49.689  1.00 16.44  ? 84  ALA B N   1 
ATOM   2494 C CA  . ALA B 2 84  ? -21.938 -10.228 49.633  1.00 17.13  ? 84  ALA B CA  1 
ATOM   2495 C C   . ALA B 2 84  ? -22.187 -9.179  50.726  1.00 18.71  ? 84  ALA B C   1 
ATOM   2496 O O   . ALA B 2 84  ? -22.716 -8.107  50.451  1.00 18.49  ? 84  ALA B O   1 
ATOM   2497 C CB  . ALA B 2 84  ? -22.921 -11.343 49.755  1.00 16.65  ? 84  ALA B CB  1 
ATOM   2498 N N   . ARG B 2 85  ? -21.748 -9.488  51.950  1.00 21.70  ? 85  ARG B N   1 
ATOM   2499 C CA  . ARG B 2 85  ? -21.916 -8.596  53.085  1.00 18.32  ? 85  ARG B CA  1 
ATOM   2500 C C   . ARG B 2 85  ? -21.320 -7.240  52.781  1.00 19.26  ? 85  ARG B C   1 
ATOM   2501 O O   . ARG B 2 85  ? -21.887 -6.209  53.105  1.00 20.70  ? 85  ARG B O   1 
ATOM   2502 C CB  . ARG B 2 85  ? -21.232 -9.209  54.295  1.00 15.58  ? 85  ARG B CB  1 
ATOM   2503 C CG  . ARG B 2 85  ? -21.804 -8.775  55.620  1.00 10.98  ? 85  ARG B CG  1 
ATOM   2504 C CD  . ARG B 2 85  ? -20.975 -9.302  56.780  1.00 7.46   ? 85  ARG B CD  1 
ATOM   2505 N NE  . ARG B 2 85  ? -20.853 -10.759 56.802  1.00 6.75   ? 85  ARG B NE  1 
ATOM   2506 C CZ  . ARG B 2 85  ? -19.697 -11.415 56.730  1.00 14.51  ? 85  ARG B CZ  1 
ATOM   2507 N NH1 . ARG B 2 85  ? -18.544 -10.759 56.653  1.00 17.72  ? 85  ARG B NH1 1 
ATOM   2508 N NH2 . ARG B 2 85  ? -19.700 -12.737 56.728  1.00 12.22  ? 85  ARG B NH2 1 
ATOM   2509 N N   . LYS B 2 86  ? -20.166 -7.240  52.124  1.00 20.52  ? 86  LYS B N   1 
ATOM   2510 C CA  . LYS B 2 86  ? -19.471 -6.001  51.784  1.00 21.57  ? 86  LYS B CA  1 
ATOM   2511 C C   . LYS B 2 86  ? -20.256 -5.153  50.792  1.00 22.30  ? 86  LYS B C   1 
ATOM   2512 O O   . LYS B 2 86  ? -20.002 -3.957  50.683  1.00 22.09  ? 86  LYS B O   1 
ATOM   2513 C CB  . LYS B 2 86  ? -18.089 -6.303  51.190  1.00 21.63  ? 86  LYS B CB  1 
ATOM   2514 C CG  . LYS B 2 86  ? -17.214 -7.198  52.083  1.00 25.72  ? 86  LYS B CG  1 
ATOM   2515 C CD  . LYS B 2 86  ? -15.871 -7.516  51.445  1.00 23.11  ? 86  LYS B CD  1 
ATOM   2516 C CE  . LYS B 2 86  ? -14.866 -6.466  51.801  1.00 22.60  ? 86  LYS B CE  1 
ATOM   2517 N NZ  . LYS B 2 86  ? -14.556 -6.463  53.255  1.00 23.88  ? 86  LYS B NZ  1 
ATOM   2518 N N   . HIS B 2 87  ? -21.179 -5.775  50.073  1.00 23.09  ? 87  HIS B N   1 
ATOM   2519 C CA  . HIS B 2 87  ? -21.989 -5.075  49.082  1.00 19.77  ? 87  HIS B CA  1 
ATOM   2520 C C   . HIS B 2 87  ? -23.468 -5.063  49.472  1.00 20.13  ? 87  HIS B C   1 
ATOM   2521 O O   . HIS B 2 87  ? -24.313 -4.789  48.626  1.00 22.87  ? 87  HIS B O   1 
ATOM   2522 C CB  . HIS B 2 87  ? -21.817 -5.724  47.711  1.00 19.04  ? 87  HIS B CB  1 
ATOM   2523 C CG  . HIS B 2 87  ? -20.390 -5.772  47.253  1.00 16.99  ? 87  HIS B CG  1 
ATOM   2524 N ND1 . HIS B 2 87  ? -19.702 -4.652  46.849  1.00 15.01  ? 87  HIS B ND1 1 
ATOM   2525 C CD2 . HIS B 2 87  ? -19.531 -6.815  47.147  1.00 17.33  ? 87  HIS B CD2 1 
ATOM   2526 C CE1 . HIS B 2 87  ? -18.471 -5.003  46.499  1.00 15.13  ? 87  HIS B CE1 1 
ATOM   2527 N NE2 . HIS B 2 87  ? -18.349 -6.301  46.667  1.00 15.79  ? 87  HIS B NE2 1 
ATOM   2528 N N   . ASN B 2 88  ? -23.749 -5.351  50.747  1.00 20.02  ? 88  ASN B N   1 
ATOM   2529 C CA  . ASN B 2 88  ? -25.117 -5.419  51.273  1.00 21.09  ? 88  ASN B CA  1 
ATOM   2530 C C   . ASN B 2 88  ? -26.047 -6.345  50.483  1.00 20.39  ? 88  ASN B C   1 
ATOM   2531 O O   . ASN B 2 88  ? -27.200 -6.031  50.313  1.00 21.89  ? 88  ASN B O   1 
ATOM   2532 C CB  . ASN B 2 88  ? -25.712 -4.014  51.395  1.00 24.56  ? 88  ASN B CB  1 
ATOM   2533 C CG  . ASN B 2 88  ? -27.060 -3.985  52.177  1.00 29.21  ? 88  ASN B CG  1 
ATOM   2534 O OD1 . ASN B 2 88  ? -27.927 -3.171  51.893  1.00 34.22  ? 88  ASN B OD1 1 
ATOM   2535 N ND2 . ASN B 2 88  ? -27.229 -4.898  53.127  1.00 32.62  ? 88  ASN B ND2 1 
ATOM   2536 N N   . MET B 2 89  ? -25.550 -7.466  50.014  1.00 20.63  ? 89  MET B N   1 
ATOM   2537 C CA  . MET B 2 89  ? -26.354 -8.416  49.251  1.00 17.94  ? 89  MET B CA  1 
ATOM   2538 C C   . MET B 2 89  ? -26.736 -9.588  50.141  1.00 18.59  ? 89  MET B C   1 
ATOM   2539 O O   . MET B 2 89  ? -26.607 -10.753 49.780  1.00 17.42  ? 89  MET B O   1 
ATOM   2540 C CB  . MET B 2 89  ? -25.572 -8.882  48.034  1.00 19.31  ? 89  MET B CB  1 
ATOM   2541 C CG  . MET B 2 89  ? -25.437 -7.816  46.980  1.00 19.03  ? 89  MET B CG  1 
ATOM   2542 S SD  . MET B 2 89  ? -24.794 -8.430  45.439  1.00 21.81  ? 89  MET B SD  1 
ATOM   2543 C CE  . MET B 2 89  ? -26.114 -9.383  44.843  1.00 21.71  ? 89  MET B CE  1 
ATOM   2544 N N   . CYS B 2 90  ? -27.303 -9.241  51.295  1.00 18.68  ? 90  CYS B N   1 
ATOM   2545 C CA  . CYS B 2 90  ? -27.843 -10.215 52.244  1.00 22.55  ? 90  CYS B CA  1 
ATOM   2546 C C   . CYS B 2 90  ? -29.212 -9.640  52.625  1.00 24.64  ? 90  CYS B C   1 
ATOM   2547 O O   . CYS B 2 90  ? -29.500 -8.449  52.346  1.00 27.07  ? 90  CYS B O   1 
ATOM   2548 C CB  . CYS B 2 90  ? -26.964 -10.318 53.502  1.00 24.65  ? 90  CYS B CB  1 
ATOM   2549 S SG  . CYS B 2 90  ? -25.281 -11.116 53.302  1.00 24.72  ? 90  CYS B SG  1 
ATOM   2550 N N   . GLY B 2 91  ? -30.068 -10.457 53.240  1.00 24.30  ? 91  GLY B N   1 
ATOM   2551 C CA  . GLY B 2 91  ? -31.383 -9.955  53.602  1.00 26.49  ? 91  GLY B CA  1 
ATOM   2552 C C   . GLY B 2 91  ? -31.288 -8.784  54.569  1.00 29.71  ? 91  GLY B C   1 
ATOM   2553 O O   . GLY B 2 91  ? -30.492 -8.819  55.528  1.00 31.30  ? 91  GLY B O   1 
ATOM   2554 N N   . GLU B 2 92  ? -32.088 -7.740  54.344  1.00 29.40  ? 92  GLU B N   1 
ATOM   2555 C CA  . GLU B 2 92  ? -32.121 -6.594  55.241  1.00 30.29  ? 92  GLU B CA  1 
ATOM   2556 C C   . GLU B 2 92  ? -33.144 -6.748  56.363  1.00 30.43  ? 92  GLU B C   1 
ATOM   2557 O O   . GLU B 2 92  ? -32.912 -6.371  57.495  1.00 32.19  ? 92  GLU B O   1 
ATOM   2558 C CB  . GLU B 2 92  ? -32.401 -5.325  54.442  1.00 30.15  ? 92  GLU B CB  1 
ATOM   2559 C CG  . GLU B 2 92  ? -31.227 -4.886  53.577  1.00 37.10  ? 92  GLU B CG  1 
ATOM   2560 C CD  . GLU B 2 92  ? -31.414 -3.531  52.905  1.00 39.82  ? 92  GLU B CD  1 
ATOM   2561 O OE1 . GLU B 2 92  ? -31.815 -2.567  53.589  1.00 44.56  ? 92  GLU B OE1 1 
ATOM   2562 O OE2 . GLU B 2 92  ? -31.176 -3.433  51.679  1.00 40.53  ? 92  GLU B OE2 1 
ATOM   2563 N N   . THR B 2 93  ? -34.290 -7.325  56.043  1.00 28.93  ? 93  THR B N   1 
ATOM   2564 C CA  . THR B 2 93  ? -35.343 -7.507  57.032  1.00 26.20  ? 93  THR B CA  1 
ATOM   2565 C C   . THR B 2 93  ? -35.275 -8.936  57.586  1.00 25.79  ? 93  THR B C   1 
ATOM   2566 O O   . THR B 2 93  ? -34.726 -9.837  56.928  1.00 25.74  ? 93  THR B O   1 
ATOM   2567 C CB  . THR B 2 93  ? -36.751 -7.247  56.418  1.00 25.48  ? 93  THR B CB  1 
ATOM   2568 O OG1 . THR B 2 93  ? -37.014 -8.186  55.357  1.00 25.69  ? 93  THR B OG1 1 
ATOM   2569 C CG2 . THR B 2 93  ? -36.823 -5.834  55.874  1.00 21.10  ? 93  THR B CG2 1 
ATOM   2570 N N   . GLU B 2 94  ? -35.838 -9.137  58.777  1.00 23.44  ? 94  GLU B N   1 
ATOM   2571 C CA  . GLU B 2 94  ? -35.872 -10.451 59.412  1.00 22.47  ? 94  GLU B CA  1 
ATOM   2572 C C   . GLU B 2 94  ? -36.450 -11.506 58.488  1.00 23.88  ? 94  GLU B C   1 
ATOM   2573 O O   . GLU B 2 94  ? -35.942 -12.618 58.447  1.00 25.54  ? 94  GLU B O   1 
ATOM   2574 C CB  . GLU B 2 94  ? -36.706 -10.396 60.690  1.00 22.23  ? 94  GLU B CB  1 
ATOM   2575 C CG  . GLU B 2 94  ? -36.663 -11.675 61.538  1.00 19.24  ? 94  GLU B CG  1 
ATOM   2576 C CD  . GLU B 2 94  ? -35.249 -12.003 62.088  1.00 19.95  ? 94  GLU B CD  1 
ATOM   2577 O OE1 . GLU B 2 94  ? -34.403 -11.084 62.264  1.00 21.58  ? 94  GLU B OE1 1 
ATOM   2578 O OE2 . GLU B 2 94  ? -34.969 -13.201 62.336  1.00 18.72  ? 94  GLU B OE2 1 
ATOM   2579 N N   . GLU B 2 95  ? -37.496 -11.149 57.751  1.00 24.33  ? 95  GLU B N   1 
ATOM   2580 C CA  . GLU B 2 95  ? -38.141 -12.050 56.795  1.00 23.44  ? 95  GLU B CA  1 
ATOM   2581 C C   . GLU B 2 95  ? -37.177 -12.451 55.668  1.00 18.78  ? 95  GLU B C   1 
ATOM   2582 O O   . GLU B 2 95  ? -37.114 -13.635 55.302  1.00 17.12  ? 95  GLU B O   1 
ATOM   2583 C CB  . GLU B 2 95  ? -39.389 -11.395 56.199  1.00 25.58  ? 95  GLU B CB  1 
ATOM   2584 C CG  . GLU B 2 95  ? -40.598 -11.401 57.107  1.00 28.51  ? 95  GLU B CG  1 
ATOM   2585 C CD  . GLU B 2 95  ? -40.554 -10.314 58.171  1.00 31.67  ? 95  GLU B CD  1 
ATOM   2586 O OE1 . GLU B 2 95  ? -40.274 -9.135  57.850  1.00 33.87  ? 95  GLU B OE1 1 
ATOM   2587 O OE2 . GLU B 2 95  ? -40.780 -10.651 59.351  1.00 34.64  ? 95  GLU B OE2 1 
ATOM   2588 N N   . GLU B 2 96  ? -36.407 -11.487 55.145  1.00 15.11  ? 96  GLU B N   1 
ATOM   2589 C CA  . GLU B 2 96  ? -35.460 -11.775 54.083  1.00 16.61  ? 96  GLU B CA  1 
ATOM   2590 C C   . GLU B 2 96  ? -34.311 -12.632 54.598  1.00 15.73  ? 96  GLU B C   1 
ATOM   2591 O O   . GLU B 2 96  ? -33.888 -13.553 53.920  1.00 16.02  ? 96  GLU B O   1 
ATOM   2592 C CB  . GLU B 2 96  ? -34.905 -10.492 53.496  1.00 16.71  ? 96  GLU B CB  1 
ATOM   2593 C CG  . GLU B 2 96  ? -35.934 -9.618  52.850  1.00 16.01  ? 96  GLU B CG  1 
ATOM   2594 C CD  . GLU B 2 96  ? -35.356 -8.356  52.288  1.00 16.61  ? 96  GLU B CD  1 
ATOM   2595 O OE1 . GLU B 2 96  ? -34.824 -7.568  53.067  1.00 15.35  ? 96  GLU B OE1 1 
ATOM   2596 O OE2 . GLU B 2 96  ? -35.437 -8.127  51.072  1.00 19.50  ? 96  GLU B OE2 1 
ATOM   2597 N N   . LYS B 2 97  ? -33.838 -12.334 55.804  1.00 14.46  ? 97  LYS B N   1 
ATOM   2598 C CA  . LYS B 2 97  ? -32.759 -13.085 56.423  1.00 12.97  ? 97  LYS B CA  1 
ATOM   2599 C C   . LYS B 2 97  ? -33.124 -14.552 56.582  1.00 13.36  ? 97  LYS B C   1 
ATOM   2600 O O   . LYS B 2 97  ? -32.338 -15.427 56.251  1.00 13.91  ? 97  LYS B O   1 
ATOM   2601 C CB  . LYS B 2 97  ? -32.414 -12.468 57.776  1.00 12.76  ? 97  LYS B CB  1 
ATOM   2602 C CG  . LYS B 2 97  ? -31.817 -11.072 57.685  1.00 13.02  ? 97  LYS B CG  1 
ATOM   2603 C CD  . LYS B 2 97  ? -31.391 -10.566 59.029  1.00 12.93  ? 97  LYS B CD  1 
ATOM   2604 C CE  . LYS B 2 97  ? -30.680 -9.243  58.890  1.00 15.10  ? 97  LYS B CE  1 
ATOM   2605 N NZ  . LYS B 2 97  ? -30.297 -8.677  60.210  1.00 16.76  ? 97  LYS B NZ  1 
ATOM   2606 N N   . ILE B 2 98  ? -34.328 -14.811 57.080  1.00 10.71  ? 98  ILE B N   1 
ATOM   2607 C CA  . ILE B 2 98  ? -34.807 -16.167 57.248  1.00 9.68   ? 98  ILE B CA  1 
ATOM   2608 C C   . ILE B 2 98  ? -34.757 -16.925 55.917  1.00 11.64  ? 98  ILE B C   1 
ATOM   2609 O O   . ILE B 2 98  ? -34.236 -18.048 55.852  1.00 8.77   ? 98  ILE B O   1 
ATOM   2610 C CB  . ILE B 2 98  ? -36.243 -16.180 57.795  1.00 8.65   ? 98  ILE B CB  1 
ATOM   2611 C CG1 . ILE B 2 98  ? -36.288 -15.467 59.147  1.00 8.65   ? 98  ILE B CG1 1 
ATOM   2612 C CG2 . ILE B 2 98  ? -36.718 -17.632 57.975  1.00 3.13   ? 98  ILE B CG2 1 
ATOM   2613 C CD1 . ILE B 2 98  ? -37.652 -15.401 59.797  1.00 6.98   ? 98  ILE B CD1 1 
ATOM   2614 N N   . ARG B 2 99  ? -35.300 -16.304 54.866  1.00 15.29  ? 99  ARG B N   1 
ATOM   2615 C CA  . ARG B 2 99  ? -35.303 -16.906 53.534  1.00 13.50  ? 99  ARG B CA  1 
ATOM   2616 C C   . ARG B 2 99  ? -33.872 -17.235 53.069  1.00 12.25  ? 99  ARG B C   1 
ATOM   2617 O O   . ARG B 2 99  ? -33.615 -18.372 52.612  1.00 12.65  ? 99  ARG B O   1 
ATOM   2618 C CB  . ARG B 2 99  ? -35.977 -15.979 52.525  1.00 13.91  ? 99  ARG B CB  1 
ATOM   2619 C CG  . ARG B 2 99  ? -37.464 -16.035 52.560  1.00 13.64  ? 99  ARG B CG  1 
ATOM   2620 C CD  . ARG B 2 99  ? -38.074 -15.180 51.480  1.00 12.04  ? 99  ARG B CD  1 
ATOM   2621 N NE  . ARG B 2 99  ? -39.432 -15.622 51.141  1.00 17.61  ? 99  ARG B NE  1 
ATOM   2622 C CZ  . ARG B 2 99  ? -39.790 -16.216 49.998  1.00 19.52  ? 99  ARG B CZ  1 
ATOM   2623 N NH1 . ARG B 2 99  ? -38.916 -16.378 48.996  1.00 15.56  ? 99  ARG B NH1 1 
ATOM   2624 N NH2 . ARG B 2 99  ? -41.038 -16.657 49.847  1.00 21.79  ? 99  ARG B NH2 1 
ATOM   2625 N N   . VAL B 2 100 ? -32.962 -16.265 53.210  1.00 9.07   ? 100 VAL B N   1 
ATOM   2626 C CA  . VAL B 2 100 ? -31.566 -16.434 52.824  1.00 8.28   ? 100 VAL B CA  1 
ATOM   2627 C C   . VAL B 2 100 ? -30.973 -17.669 53.539  1.00 9.46   ? 100 VAL B C   1 
ATOM   2628 O O   . VAL B 2 100 ? -30.384 -18.531 52.911  1.00 5.49   ? 100 VAL B O   1 
ATOM   2629 C CB  . VAL B 2 100 ? -30.768 -15.151 53.138  1.00 10.26  ? 100 VAL B CB  1 
ATOM   2630 C CG1 . VAL B 2 100 ? -29.264 -15.401 53.015  1.00 12.51  ? 100 VAL B CG1 1 
ATOM   2631 C CG2 . VAL B 2 100 ? -31.202 -14.049 52.216  1.00 6.44   ? 100 VAL B CG2 1 
ATOM   2632 N N   . ASP B 2 101 ? -31.128 -17.740 54.865  1.00 9.76   ? 101 ASP B N   1 
ATOM   2633 C CA  . ASP B 2 101 ? -30.584 -18.834 55.667  1.00 9.19   ? 101 ASP B CA  1 
ATOM   2634 C C   . ASP B 2 101 ? -31.151 -20.180 55.289  1.00 10.49  ? 101 ASP B C   1 
ATOM   2635 O O   . ASP B 2 101 ? -30.406 -21.163 55.248  1.00 11.20  ? 101 ASP B O   1 
ATOM   2636 C CB  . ASP B 2 101 ? -30.838 -18.594 57.157  1.00 10.43  ? 101 ASP B CB  1 
ATOM   2637 C CG  . ASP B 2 101 ? -30.131 -17.338 57.693  1.00 9.55   ? 101 ASP B CG  1 
ATOM   2638 O OD1 . ASP B 2 101 ? -29.216 -16.769 57.058  1.00 5.18   ? 101 ASP B OD1 1 
ATOM   2639 O OD2 . ASP B 2 101 ? -30.507 -16.891 58.785  1.00 13.43  ? 101 ASP B OD2 1 
ATOM   2640 N N   . ILE B 2 102 ? -32.451 -20.224 54.981  1.00 11.06  ? 102 ILE B N   1 
ATOM   2641 C CA  . ILE B 2 102 ? -33.082 -21.475 54.536  1.00 11.95  ? 102 ILE B CA  1 
ATOM   2642 C C   . ILE B 2 102 ? -32.538 -21.905 53.168  1.00 10.73  ? 102 ILE B C   1 
ATOM   2643 O O   . ILE B 2 102 ? -32.176 -23.066 52.966  1.00 9.65   ? 102 ILE B O   1 
ATOM   2644 C CB  . ILE B 2 102 ? -34.642 -21.371 54.476  1.00 13.43  ? 102 ILE B CB  1 
ATOM   2645 C CG1 . ILE B 2 102 ? -35.190 -21.088 55.878  1.00 14.77  ? 102 ILE B CG1 1 
ATOM   2646 C CG2 . ILE B 2 102 ? -35.237 -22.656 53.952  1.00 5.17   ? 102 ILE B CG2 1 
ATOM   2647 C CD1 . ILE B 2 102 ? -36.689 -20.951 55.924  1.00 15.30  ? 102 ILE B CD1 1 
ATOM   2648 N N   . ILE B 2 103 ? -32.480 -20.961 52.229  1.00 9.95   ? 103 ILE B N   1 
ATOM   2649 C CA  . ILE B 2 103 ? -32.014 -21.258 50.885  1.00 13.65  ? 103 ILE B CA  1 
ATOM   2650 C C   . ILE B 2 103 ? -30.592 -21.772 50.921  1.00 14.13  ? 103 ILE B C   1 
ATOM   2651 O O   . ILE B 2 103 ? -30.302 -22.846 50.421  1.00 11.68  ? 103 ILE B O   1 
ATOM   2652 C CB  . ILE B 2 103 ? -32.141 -20.028 49.942  1.00 15.52  ? 103 ILE B CB  1 
ATOM   2653 C CG1 . ILE B 2 103 ? -33.628 -19.746 49.661  1.00 13.71  ? 103 ILE B CG1 1 
ATOM   2654 C CG2 . ILE B 2 103 ? -31.424 -20.293 48.631  1.00 10.91  ? 103 ILE B CG2 1 
ATOM   2655 C CD1 . ILE B 2 103 ? -34.384 -20.921 49.056  1.00 8.63   ? 103 ILE B CD1 1 
ATOM   2656 N N   . GLU B 2 104 ? -29.706 -20.993 51.537  1.00 14.13  ? 104 GLU B N   1 
ATOM   2657 C CA  . GLU B 2 104 ? -28.307 -21.373 51.673  1.00 13.59  ? 104 GLU B CA  1 
ATOM   2658 C C   . GLU B 2 104 ? -28.097 -22.833 52.086  1.00 12.54  ? 104 GLU B C   1 
ATOM   2659 O O   . GLU B 2 104 ? -27.336 -23.563 51.460  1.00 12.57  ? 104 GLU B O   1 
ATOM   2660 C CB  . GLU B 2 104 ? -27.624 -20.455 52.678  1.00 11.96  ? 104 GLU B CB  1 
ATOM   2661 C CG  . GLU B 2 104 ? -26.189 -20.832 52.978  1.00 11.97  ? 104 GLU B CG  1 
ATOM   2662 C CD  . GLU B 2 104 ? -25.576 -19.922 53.984  1.00 15.71  ? 104 GLU B CD  1 
ATOM   2663 O OE1 . GLU B 2 104 ? -25.860 -20.089 55.174  1.00 16.96  ? 104 GLU B OE1 1 
ATOM   2664 O OE2 . GLU B 2 104 ? -24.804 -19.043 53.587  1.00 20.52  ? 104 GLU B OE2 1 
ATOM   2665 N N   . ASN B 2 105 ? -28.797 -23.264 53.126  1.00 8.82   ? 105 ASN B N   1 
ATOM   2666 C CA  . ASN B 2 105 ? -28.680 -24.625 53.583  1.00 9.38   ? 105 ASN B CA  1 
ATOM   2667 C C   . ASN B 2 105 ? -29.428 -25.603 52.674  1.00 11.88  ? 105 ASN B C   1 
ATOM   2668 O O   . ASN B 2 105 ? -28.973 -26.732 52.500  1.00 10.60  ? 105 ASN B O   1 
ATOM   2669 C CB  . ASN B 2 105 ? -29.216 -24.741 55.003  1.00 13.00  ? 105 ASN B CB  1 
ATOM   2670 C CG  . ASN B 2 105 ? -28.326 -24.040 56.030  1.00 13.62  ? 105 ASN B CG  1 
ATOM   2671 O OD1 . ASN B 2 105 ? -27.218 -24.499 56.359  1.00 7.05   ? 105 ASN B OD1 1 
ATOM   2672 N ND2 . ASN B 2 105 ? -28.807 -22.910 56.524  1.00 11.85  ? 105 ASN B ND2 1 
ATOM   2673 N N   . GLN B 2 106 ? -30.542 -25.167 52.093  1.00 14.59  ? 106 GLN B N   1 
ATOM   2674 C CA  . GLN B 2 106 ? -31.318 -26.012 51.184  1.00 13.41  ? 106 GLN B CA  1 
ATOM   2675 C C   . GLN B 2 106 ? -30.558 -26.373 49.908  1.00 13.77  ? 106 GLN B C   1 
ATOM   2676 O O   . GLN B 2 106 ? -30.466 -27.540 49.564  1.00 13.09  ? 106 GLN B O   1 
ATOM   2677 C CB  . GLN B 2 106 ? -32.629 -25.331 50.819  1.00 11.57  ? 106 GLN B CB  1 
ATOM   2678 C CG  . GLN B 2 106 ? -33.646 -26.237 50.154  1.00 4.91   ? 106 GLN B CG  1 
ATOM   2679 C CD  . GLN B 2 106 ? -34.045 -27.432 51.033  1.00 8.33   ? 106 GLN B CD  1 
ATOM   2680 O OE1 . GLN B 2 106 ? -34.428 -27.262 52.196  1.00 11.55  ? 106 GLN B OE1 1 
ATOM   2681 N NE2 . GLN B 2 106 ? -33.936 -28.634 50.469  1.00 8.25   ? 106 GLN B NE2 1 
ATOM   2682 N N   . VAL B 2 107 ? -29.980 -25.372 49.231  1.00 15.96  ? 107 VAL B N   1 
ATOM   2683 C CA  . VAL B 2 107 ? -29.155 -25.623 48.031  1.00 19.87  ? 107 VAL B CA  1 
ATOM   2684 C C   . VAL B 2 107 ? -27.962 -26.524 48.354  1.00 21.63  ? 107 VAL B C   1 
ATOM   2685 O O   . VAL B 2 107 ? -27.499 -27.253 47.500  1.00 19.44  ? 107 VAL B O   1 
ATOM   2686 C CB  . VAL B 2 107 ? -28.608 -24.312 47.355  1.00 19.49  ? 107 VAL B CB  1 
ATOM   2687 C CG1 . VAL B 2 107 ? -29.720 -23.440 46.879  1.00 20.17  ? 107 VAL B CG1 1 
ATOM   2688 C CG2 . VAL B 2 107 ? -27.736 -23.563 48.296  1.00 24.84  ? 107 VAL B CG2 1 
ATOM   2689 N N   . MET B 2 108 ? -27.506 -26.500 49.600  1.00 24.43  ? 108 MET B N   1 
ATOM   2690 C CA  . MET B 2 108 ? -26.434 -27.361 50.052  1.00 28.23  ? 108 MET B CA  1 
ATOM   2691 C C   . MET B 2 108 ? -26.908 -28.796 49.986  1.00 27.93  ? 108 MET B C   1 
ATOM   2692 O O   . MET B 2 108 ? -26.209 -29.642 49.457  1.00 26.66  ? 108 MET B O   1 
ATOM   2693 C CB  . MET B 2 108 ? -26.009 -26.974 51.470  1.00 32.30  ? 108 MET B CB  1 
ATOM   2694 C CG  . MET B 2 108 ? -24.744 -27.656 51.953  1.00 38.00  ? 108 MET B CG  1 
ATOM   2695 S SD  . MET B 2 108 ? -23.319 -27.316 50.880  1.00 45.76  ? 108 MET B SD  1 
ATOM   2696 C CE  . MET B 2 108 ? -22.699 -25.788 51.591  1.00 42.77  ? 108 MET B CE  1 
ATOM   2697 N N   . ASP B 2 109 ? -28.100 -29.060 50.532  1.00 29.72  ? 109 ASP B N   1 
ATOM   2698 C CA  . ASP B 2 109 ? -28.703 -30.398 50.514  1.00 30.17  ? 109 ASP B CA  1 
ATOM   2699 C C   . ASP B 2 109 ? -28.895 -30.898 49.090  1.00 29.68  ? 109 ASP B C   1 
ATOM   2700 O O   . ASP B 2 109 ? -28.566 -32.043 48.786  1.00 29.31  ? 109 ASP B O   1 
ATOM   2701 C CB  . ASP B 2 109 ? -30.080 -30.385 51.198  1.00 33.28  ? 109 ASP B CB  1 
ATOM   2702 C CG  . ASP B 2 109 ? -29.990 -30.320 52.709  1.00 36.08  ? 109 ASP B CG  1 
ATOM   2703 O OD1 . ASP B 2 109 ? -28.897 -30.083 53.263  1.00 38.95  ? 109 ASP B OD1 1 
ATOM   2704 O OD2 . ASP B 2 109 ? -31.047 -30.521 53.348  1.00 35.64  ? 109 ASP B OD2 1 
ATOM   2705 N N   . PHE B 2 110 ? -29.397 -30.013 48.242  1.00 27.30  ? 110 PHE B N   1 
ATOM   2706 C CA  . PHE B 2 110 ? -29.633 -30.313 46.842  1.00 23.83  ? 110 PHE B CA  1 
ATOM   2707 C C   . PHE B 2 110 ? -28.336 -30.666 46.121  1.00 20.70  ? 110 PHE B C   1 
ATOM   2708 O O   . PHE B 2 110 ? -28.209 -31.758 45.550  1.00 18.71  ? 110 PHE B O   1 
ATOM   2709 C CB  . PHE B 2 110 ? -30.324 -29.131 46.176  1.00 25.79  ? 110 PHE B CB  1 
ATOM   2710 C CG  . PHE B 2 110 ? -31.089 -29.496 44.928  1.00 27.90  ? 110 PHE B CG  1 
ATOM   2711 C CD1 . PHE B 2 110 ? -31.320 -30.837 44.585  1.00 25.75  ? 110 PHE B CD1 1 
ATOM   2712 C CD2 . PHE B 2 110 ? -31.576 -28.490 44.091  1.00 29.04  ? 110 PHE B CD2 1 
ATOM   2713 C CE1 . PHE B 2 110 ? -32.017 -31.164 43.422  1.00 27.76  ? 110 PHE B CE1 1 
ATOM   2714 C CE2 . PHE B 2 110 ? -32.289 -28.809 42.921  1.00 28.52  ? 110 PHE B CE2 1 
ATOM   2715 C CZ  . PHE B 2 110 ? -32.506 -30.143 42.590  1.00 27.95  ? 110 PHE B CZ  1 
ATOM   2716 N N   . ARG B 2 111 ? -27.370 -29.734 46.160  1.00 18.79  ? 111 ARG B N   1 
ATOM   2717 C CA  . ARG B 2 111 ? -26.070 -29.907 45.515  1.00 21.65  ? 111 ARG B CA  1 
ATOM   2718 C C   . ARG B 2 111 ? -25.352 -31.177 45.932  1.00 23.95  ? 111 ARG B C   1 
ATOM   2719 O O   . ARG B 2 111 ? -24.792 -31.862 45.091  1.00 24.30  ? 111 ARG B O   1 
ATOM   2720 C CB  . ARG B 2 111 ? -25.170 -28.709 45.801  1.00 21.95  ? 111 ARG B CB  1 
ATOM   2721 C CG  . ARG B 2 111 ? -23.794 -28.808 45.240  1.00 20.46  ? 111 ARG B CG  1 
ATOM   2722 C CD  . ARG B 2 111 ? -22.924 -27.703 45.761  1.00 18.82  ? 111 ARG B CD  1 
ATOM   2723 N NE  . ARG B 2 111 ? -23.345 -26.416 45.247  1.00 14.63  ? 111 ARG B NE  1 
ATOM   2724 C CZ  . ARG B 2 111 ? -23.541 -25.340 46.011  1.00 17.24  ? 111 ARG B CZ  1 
ATOM   2725 N NH1 . ARG B 2 111 ? -23.402 -25.423 47.348  1.00 14.27  ? 111 ARG B NH1 1 
ATOM   2726 N NH2 . ARG B 2 111 ? -23.878 -24.187 45.432  1.00 14.26  ? 111 ARG B NH2 1 
ATOM   2727 N N   . THR B 2 112 ? -25.403 -31.497 47.223  1.00 27.68  ? 112 THR B N   1 
ATOM   2728 C CA  . THR B 2 112 ? -24.763 -32.688 47.748  1.00 29.48  ? 112 THR B CA  1 
ATOM   2729 C C   . THR B 2 112 ? -25.270 -33.923 47.028  1.00 29.81  ? 112 THR B C   1 
ATOM   2730 O O   . THR B 2 112 ? -24.497 -34.755 46.596  1.00 31.39  ? 112 THR B O   1 
ATOM   2731 C CB  . THR B 2 112 ? -24.983 -32.810 49.280  1.00 31.65  ? 112 THR B CB  1 
ATOM   2732 O OG1 . THR B 2 112 ? -24.389 -31.682 49.938  1.00 31.99  ? 112 THR B OG1 1 
ATOM   2733 C CG2 . THR B 2 112 ? -24.350 -34.100 49.831  1.00 32.36  ? 112 THR B CG2 1 
ATOM   2734 N N   . GLN B 2 113 ? -26.589 -34.039 46.887  1.00 30.91  ? 113 GLN B N   1 
ATOM   2735 C CA  . GLN B 2 113 ? -27.153 -35.186 46.206  1.00 35.03  ? 113 GLN B CA  1 
ATOM   2736 C C   . GLN B 2 113 ? -26.610 -35.315 44.792  1.00 34.58  ? 113 GLN B C   1 
ATOM   2737 O O   . GLN B 2 113 ? -26.225 -36.398 44.369  1.00 34.53  ? 113 GLN B O   1 
ATOM   2738 C CB  . GLN B 2 113 ? -28.671 -35.067 46.170  1.00 36.56  ? 113 GLN B CB  1 
ATOM   2739 C CG  . GLN B 2 113 ? -29.310 -35.109 47.563  1.00 40.22  ? 113 GLN B CG  1 
ATOM   2740 C CD  . GLN B 2 113 ? -30.824 -35.227 47.518  1.00 40.32  ? 113 GLN B CD  1 
ATOM   2741 O OE1 . GLN B 2 113 ? -31.406 -36.126 48.137  1.00 40.73  ? 113 GLN B OE1 1 
ATOM   2742 N NE2 . GLN B 2 113 ? -31.469 -34.327 46.774  1.00 39.72  ? 113 GLN B NE2 1 
ATOM   2743 N N   . LEU B 2 114 ? -26.564 -34.195 44.071  1.00 33.82  ? 114 LEU B N   1 
ATOM   2744 C CA  . LEU B 2 114 ? -26.068 -34.156 42.700  1.00 31.33  ? 114 LEU B CA  1 
ATOM   2745 C C   . LEU B 2 114 ? -24.612 -34.564 42.624  1.00 30.95  ? 114 LEU B C   1 
ATOM   2746 O O   . LEU B 2 114 ? -24.270 -35.410 41.827  1.00 29.84  ? 114 LEU B O   1 
ATOM   2747 C CB  . LEU B 2 114 ? -26.268 -32.756 42.086  1.00 29.25  ? 114 LEU B CB  1 
ATOM   2748 C CG  . LEU B 2 114 ? -25.862 -32.561 40.612  1.00 27.40  ? 114 LEU B CG  1 
ATOM   2749 C CD1 . LEU B 2 114 ? -26.549 -33.562 39.708  1.00 25.54  ? 114 LEU B CD1 1 
ATOM   2750 C CD2 . LEU B 2 114 ? -26.198 -31.149 40.204  1.00 27.74  ? 114 LEU B CD2 1 
ATOM   2751 N N   . ILE B 2 115 ? -23.762 -33.950 43.462  1.00 30.77  ? 115 ILE B N   1 
ATOM   2752 C CA  . ILE B 2 115 ? -22.325 -34.256 43.504  1.00 32.09  ? 115 ILE B CA  1 
ATOM   2753 C C   . ILE B 2 115 ? -22.137 -35.751 43.700  1.00 32.27  ? 115 ILE B C   1 
ATOM   2754 O O   . ILE B 2 115 ? -21.398 -36.395 42.976  1.00 31.46  ? 115 ILE B O   1 
ATOM   2755 C CB  . ILE B 2 115 ? -21.599 -33.510 44.677  1.00 31.41  ? 115 ILE B CB  1 
ATOM   2756 C CG1 . ILE B 2 115 ? -21.592 -32.010 44.411  1.00 32.41  ? 115 ILE B CG1 1 
ATOM   2757 C CG2 . ILE B 2 115 ? -20.165 -33.990 44.835  1.00 30.12  ? 115 ILE B CG2 1 
ATOM   2758 C CD1 . ILE B 2 115 ? -20.979 -31.199 45.541  1.00 27.54  ? 115 ILE B CD1 1 
ATOM   2759 N N   . ARG B 2 116 ? -22.839 -36.292 44.701  1.00 33.05  ? 116 ARG B N   1 
ATOM   2760 C CA  . ARG B 2 116 ? -22.803 -37.707 45.032  1.00 35.15  ? 116 ARG B CA  1 
ATOM   2761 C C   . ARG B 2 116 ? -23.158 -38.534 43.795  1.00 36.22  ? 116 ARG B C   1 
ATOM   2762 O O   . ARG B 2 116 ? -22.423 -39.452 43.437  1.00 35.81  ? 116 ARG B O   1 
ATOM   2763 C CB  . ARG B 2 116 ? -23.793 -37.964 46.171  1.00 33.79  ? 116 ARG B CB  1 
ATOM   2764 C CG  . ARG B 2 116 ? -23.711 -39.336 46.792  1.00 33.25  ? 116 ARG B CG  1 
ATOM   2765 C CD  . ARG B 2 116 ? -24.731 -39.488 47.929  1.00 34.88  ? 116 ARG B CD  1 
ATOM   2766 N NE  . ARG B 2 116 ? -24.529 -38.457 48.954  1.00 36.48  ? 116 ARG B NE  1 
ATOM   2767 C CZ  . ARG B 2 116 ? -23.740 -38.591 50.022  1.00 38.02  ? 116 ARG B CZ  1 
ATOM   2768 N NH1 . ARG B 2 116 ? -23.081 -39.735 50.232  1.00 40.51  ? 116 ARG B NH1 1 
ATOM   2769 N NH2 . ARG B 2 116 ? -23.607 -37.578 50.886  1.00 33.74  ? 116 ARG B NH2 1 
ATOM   2770 N N   . LEU B 2 117 ? -24.278 -38.196 43.153  1.00 37.76  ? 117 LEU B N   1 
ATOM   2771 C CA  . LEU B 2 117 ? -24.750 -38.883 41.956  1.00 38.70  ? 117 LEU B CA  1 
ATOM   2772 C C   . LEU B 2 117 ? -23.732 -38.806 40.806  1.00 40.16  ? 117 LEU B C   1 
ATOM   2773 O O   . LEU B 2 117 ? -23.527 -39.792 40.093  1.00 41.02  ? 117 LEU B O   1 
ATOM   2774 C CB  . LEU B 2 117 ? -26.105 -38.284 41.528  1.00 40.01  ? 117 LEU B CB  1 
ATOM   2775 C CG  . LEU B 2 117 ? -26.924 -38.668 40.278  1.00 38.95  ? 117 LEU B CG  1 
ATOM   2776 C CD1 . LEU B 2 117 ? -26.456 -37.829 39.088  1.00 42.27  ? 117 LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 2 117 ? -26.783 -40.136 39.992  1.00 40.67  ? 117 LEU B CD2 1 
ATOM   2778 N N   . CYS B 2 118 ? -23.134 -37.627 40.600  1.00 40.52  ? 118 CYS B N   1 
ATOM   2779 C CA  . CYS B 2 118 ? -22.209 -37.400 39.486  1.00 40.44  ? 118 CYS B CA  1 
ATOM   2780 C C   . CYS B 2 118 ? -20.829 -38.021 39.701  1.00 41.28  ? 118 CYS B C   1 
ATOM   2781 O O   . CYS B 2 118 ? -20.218 -38.486 38.753  1.00 42.11  ? 118 CYS B O   1 
ATOM   2782 C CB  . CYS B 2 118 ? -22.063 -35.898 39.218  1.00 39.52  ? 118 CYS B CB  1 
ATOM   2783 S SG  . CYS B 2 118 ? -23.568 -35.145 38.577  1.00 44.36  ? 118 CYS B SG  1 
ATOM   2784 N N   . TYR B 2 119 ? -20.340 -38.035 40.944  1.00 40.77  ? 119 TYR B N   1 
ATOM   2785 C CA  . TYR B 2 119 ? -19.020 -38.574 41.245  1.00 39.85  ? 119 TYR B CA  1 
ATOM   2786 C C   . TYR B 2 119 ? -19.054 -40.090 41.429  1.00 40.83  ? 119 TYR B C   1 
ATOM   2787 O O   . TYR B 2 119 ? -18.086 -40.762 41.061  1.00 42.94  ? 119 TYR B O   1 
ATOM   2788 C CB  . TYR B 2 119 ? -18.443 -37.915 42.502  1.00 39.25  ? 119 TYR B CB  1 
ATOM   2789 C CG  . TYR B 2 119 ? -17.663 -36.648 42.210  1.00 38.08  ? 119 TYR B CG  1 
ATOM   2790 C CD1 . TYR B 2 119 ? -18.324 -35.416 42.061  1.00 38.96  ? 119 TYR B CD1 1 
ATOM   2791 C CD2 . TYR B 2 119 ? -16.260 -36.674 42.062  1.00 38.04  ? 119 TYR B CD2 1 
ATOM   2792 C CE1 . TYR B 2 119 ? -17.598 -34.229 41.784  1.00 36.63  ? 119 TYR B CE1 1 
ATOM   2793 C CE2 . TYR B 2 119 ? -15.528 -35.492 41.782  1.00 36.45  ? 119 TYR B CE2 1 
ATOM   2794 C CZ  . TYR B 2 119 ? -16.205 -34.283 41.648  1.00 34.87  ? 119 TYR B CZ  1 
ATOM   2795 O OH  . TYR B 2 119 ? -15.489 -33.135 41.382  1.00 32.57  ? 119 TYR B OH  1 
ATOM   2796 N N   . SER B 2 120 ? -20.153 -40.614 41.984  1.00 40.28  ? 120 SER B N   1 
ATOM   2797 C CA  . SER B 2 120 ? -20.283 -42.044 42.257  1.00 38.52  ? 120 SER B CA  1 
ATOM   2798 C C   . SER B 2 120 ? -20.028 -42.857 40.987  1.00 40.14  ? 120 SER B C   1 
ATOM   2799 O O   . SER B 2 120 ? -20.377 -42.440 39.872  1.00 40.23  ? 120 SER B O   1 
ATOM   2800 C CB  . SER B 2 120 ? -21.678 -42.359 42.804  1.00 38.23  ? 120 SER B CB  1 
ATOM   2801 O OG  . SER B 2 120 ? -21.856 -43.753 43.024  1.00 42.26  ? 120 SER B OG  1 
ATOM   2802 N N   . SER B 2 121 ? -19.431 -44.033 41.169  1.00 42.46  ? 121 SER B N   1 
ATOM   2803 C CA  . SER B 2 121 ? -19.195 -44.948 40.056  1.00 43.07  ? 121 SER B CA  1 
ATOM   2804 C C   . SER B 2 121 ? -20.553 -45.503 39.577  1.00 44.67  ? 121 SER B C   1 
ATOM   2805 O O   . SER B 2 121 ? -20.767 -45.756 38.382  1.00 44.21  ? 121 SER B O   1 
ATOM   2806 C CB  . SER B 2 121 ? -18.276 -46.091 40.507  1.00 40.62  ? 121 SER B CB  1 
ATOM   2807 O OG  . SER B 2 121 ? -18.705 -46.610 41.760  1.00 38.50  ? 121 SER B OG  1 
ATOM   2808 N N   . ASP B 2 122 ? -21.474 -45.661 40.521  1.00 46.10  ? 122 ASP B N   1 
ATOM   2809 C CA  . ASP B 2 122 ? -22.815 -46.142 40.228  1.00 49.24  ? 122 ASP B CA  1 
ATOM   2810 C C   . ASP B 2 122 ? -23.703 -45.076 39.592  1.00 48.01  ? 122 ASP B C   1 
ATOM   2811 O O   . ASP B 2 122 ? -24.912 -45.268 39.484  1.00 48.59  ? 122 ASP B O   1 
ATOM   2812 C CB  . ASP B 2 122 ? -23.476 -46.650 41.506  1.00 53.76  ? 122 ASP B CB  1 
ATOM   2813 C CG  . ASP B 2 122 ? -22.701 -47.798 42.156  1.00 56.62  ? 122 ASP B CG  1 
ATOM   2814 O OD1 . ASP B 2 122 ? -22.362 -48.783 41.441  1.00 58.63  ? 122 ASP B OD1 1 
ATOM   2815 O OD2 . ASP B 2 122 ? -22.429 -47.697 43.384  1.00 56.95  ? 122 ASP B OD2 1 
ATOM   2816 N N   . HIS B 2 123 ? -23.079 -43.975 39.180  1.00 46.14  ? 123 HIS B N   1 
ATOM   2817 C CA  . HIS B 2 123 ? -23.748 -42.834 38.553  1.00 45.99  ? 123 HIS B CA  1 
ATOM   2818 C C   . HIS B 2 123 ? -24.888 -43.226 37.615  1.00 46.30  ? 123 HIS B C   1 
ATOM   2819 O O   . HIS B 2 123 ? -25.974 -42.610 37.670  1.00 46.27  ? 123 HIS B O   1 
ATOM   2820 C CB  . HIS B 2 123 ? -22.722 -41.981 37.791  1.00 45.87  ? 123 HIS B CB  1 
ATOM   2821 C CG  . HIS B 2 123 ? -23.328 -40.942 36.911  1.00 48.17  ? 123 HIS B CG  1 
ATOM   2822 N ND1 . HIS B 2 123 ? -24.108 -39.898 37.400  1.00 48.53  ? 123 HIS B ND1 1 
ATOM   2823 C CD2 . HIS B 2 123 ? -23.311 -40.770 35.568  1.00 48.50  ? 123 HIS B CD2 1 
ATOM   2824 C CE1 . HIS B 2 123 ? -24.522 -39.153 36.409  1.00 49.56  ? 123 HIS B CE1 1 
ATOM   2825 N NE2 . HIS B 2 123 ? -24.050 -39.656 35.271  1.00 50.64  ? 123 HIS B NE2 1 
ATOM   2826 N N   . GLU B 2 124 ? -24.660 -44.242 36.779  1.00 46.20  ? 124 GLU B N   1 
ATOM   2827 C CA  . GLU B 2 124 ? -25.657 -44.680 35.805  1.00 45.84  ? 124 GLU B CA  1 
ATOM   2828 C C   . GLU B 2 124 ? -26.905 -45.288 36.459  1.00 45.23  ? 124 GLU B C   1 
ATOM   2829 O O   . GLU B 2 124 ? -28.030 -44.831 36.223  1.00 44.60  ? 124 GLU B O   1 
ATOM   2830 C CB  . GLU B 2 124 ? -25.054 -45.656 34.798  1.00 45.68  ? 124 GLU B CB  1 
ATOM   2831 C CG  . GLU B 2 124 ? -26.010 -46.008 33.656  1.00 50.27  ? 124 GLU B CG  1 
ATOM   2832 C CD  . GLU B 2 124 ? -26.641 -44.777 32.973  1.00 51.88  ? 124 GLU B CD  1 
ATOM   2833 O OE1 . GLU B 2 124 ? -25.880 -43.950 32.401  1.00 53.64  ? 124 GLU B OE1 1 
ATOM   2834 O OE2 . GLU B 2 124 ? -27.896 -44.650 33.021  1.00 51.85  ? 124 GLU B OE2 1 
ATOM   2835 N N   . LYS B 2 125 ? -26.715 -46.305 37.304  1.00 44.03  ? 125 LYS B N   1 
ATOM   2836 C CA  . LYS B 2 125 ? -27.843 -46.972 37.945  1.00 42.19  ? 125 LYS B CA  1 
ATOM   2837 C C   . LYS B 2 125 ? -28.582 -46.037 38.919  1.00 42.13  ? 125 LYS B C   1 
ATOM   2838 O O   . LYS B 2 125 ? -29.796 -46.200 39.155  1.00 42.58  ? 125 LYS B O   1 
ATOM   2839 C CB  . LYS B 2 125 ? -27.382 -48.237 38.678  1.00 41.17  ? 125 LYS B CB  1 
ATOM   2840 C CG  . LYS B 2 125 ? -26.232 -48.017 39.656  1.00 42.14  ? 125 LYS B CG  1 
ATOM   2841 C CD  . LYS B 2 125 ? -25.345 -49.233 39.768  1.00 44.61  ? 125 LYS B CD  1 
ATOM   2842 C CE  . LYS B 2 125 ? -24.679 -49.590 38.446  1.00 40.39  ? 125 LYS B CE  1 
ATOM   2843 N NZ  . LYS B 2 125 ? -23.947 -48.435 37.873  1.00 39.45  ? 125 LYS B NZ  1 
ATOM   2844 N N   . LEU B 2 126 ? -27.851 -45.070 39.473  1.00 40.58  ? 126 LEU B N   1 
ATOM   2845 C CA  . LEU B 2 126 ? -28.427 -44.104 40.394  1.00 40.02  ? 126 LEU B CA  1 
ATOM   2846 C C   . LEU B 2 126 ? -29.120 -42.964 39.657  1.00 40.78  ? 126 LEU B C   1 
ATOM   2847 O O   . LEU B 2 126 ? -30.063 -42.358 40.183  1.00 40.16  ? 126 LEU B O   1 
ATOM   2848 C CB  . LEU B 2 126 ? -27.351 -43.573 41.345  1.00 38.85  ? 126 LEU B CB  1 
ATOM   2849 C CG  . LEU B 2 126 ? -27.155 -44.301 42.695  1.00 38.13  ? 126 LEU B CG  1 
ATOM   2850 C CD1 . LEU B 2 126 ? -27.061 -45.819 42.507  1.00 38.94  ? 126 LEU B CD1 1 
ATOM   2851 C CD2 . LEU B 2 126 ? -25.871 -43.802 43.341  1.00 36.55  ? 126 LEU B CD2 1 
ATOM   2852 N N   . LYS B 2 127 ? -28.651 -42.693 38.436  1.00 41.38  ? 127 LYS B N   1 
ATOM   2853 C CA  . LYS B 2 127 ? -29.190 -41.633 37.584  1.00 41.63  ? 127 LYS B CA  1 
ATOM   2854 C C   . LYS B 2 127 ? -30.718 -41.579 37.545  1.00 39.82  ? 127 LYS B C   1 
ATOM   2855 O O   . LYS B 2 127 ? -31.303 -40.531 37.820  1.00 39.85  ? 127 LYS B O   1 
ATOM   2856 C CB  . LYS B 2 127 ? -28.616 -41.730 36.162  1.00 43.83  ? 127 LYS B CB  1 
ATOM   2857 C CG  . LYS B 2 127 ? -28.982 -40.604 35.245  1.00 44.75  ? 127 LYS B CG  1 
ATOM   2858 C CD  . LYS B 2 127 ? -28.367 -40.800 33.875  1.00 48.04  ? 127 LYS B CD  1 
ATOM   2859 C CE  . LYS B 2 127 ? -28.599 -39.576 32.977  1.00 48.90  ? 127 LYS B CE  1 
ATOM   2860 N NZ  . LYS B 2 127 ? -30.074 -39.264 32.776  1.00 49.43  ? 127 LYS B NZ  1 
ATOM   2861 N N   . PRO B 2 128 ? -31.392 -42.721 37.199  1.00 39.32  ? 128 PRO B N   1 
ATOM   2862 C CA  . PRO B 2 128 ? -32.853 -42.727 37.197  1.00 39.33  ? 128 PRO B CA  1 
ATOM   2863 C C   . PRO B 2 128 ? -33.507 -42.298 38.516  1.00 40.47  ? 128 PRO B C   1 
ATOM   2864 O O   . PRO B 2 128 ? -34.480 -41.530 38.509  1.00 42.66  ? 128 PRO B O   1 
ATOM   2865 C CB  . PRO B 2 128 ? -33.178 -44.190 36.853  1.00 38.40  ? 128 PRO B CB  1 
ATOM   2866 C CG  . PRO B 2 128 ? -31.969 -44.652 36.102  1.00 39.24  ? 128 PRO B CG  1 
ATOM   2867 C CD  . PRO B 2 128 ? -30.848 -44.035 36.826  1.00 38.40  ? 128 PRO B CD  1 
ATOM   2868 N N   . GLN B 2 129 ? -32.955 -42.760 39.634  1.00 40.84  ? 129 GLN B N   1 
ATOM   2869 C CA  . GLN B 2 129 ? -33.485 -42.430 40.943  1.00 41.07  ? 129 GLN B CA  1 
ATOM   2870 C C   . GLN B 2 129 ? -33.466 -40.925 41.139  1.00 40.74  ? 129 GLN B C   1 
ATOM   2871 O O   . GLN B 2 129 ? -34.485 -40.341 41.518  1.00 42.69  ? 129 GLN B O   1 
ATOM   2872 C CB  . GLN B 2 129 ? -32.659 -43.100 42.031  1.00 42.04  ? 129 GLN B CB  1 
ATOM   2873 C CG  . GLN B 2 129 ? -32.436 -44.610 41.821  1.00 44.99  ? 129 GLN B CG  1 
ATOM   2874 C CD  . GLN B 2 129 ? -33.738 -45.383 41.619  1.00 46.79  ? 129 GLN B CD  1 
ATOM   2875 O OE1 . GLN B 2 129 ? -34.664 -45.308 42.437  1.00 46.30  ? 129 GLN B OE1 1 
ATOM   2876 N NE2 . GLN B 2 129 ? -33.813 -46.124 40.522  1.00 46.80  ? 129 GLN B NE2 1 
ATOM   2877 N N   . TYR B 2 130 ? -32.323 -40.304 40.854  1.00 39.58  ? 130 TYR B N   1 
ATOM   2878 C CA  . TYR B 2 130 ? -32.176 -38.856 41.000  1.00 37.64  ? 130 TYR B CA  1 
ATOM   2879 C C   . TYR B 2 130 ? -33.227 -38.110 40.168  1.00 38.69  ? 130 TYR B C   1 
ATOM   2880 O O   . TYR B 2 130 ? -33.845 -37.145 40.629  1.00 37.82  ? 130 TYR B O   1 
ATOM   2881 C CB  . TYR B 2 130 ? -30.771 -38.422 40.587  1.00 32.35  ? 130 TYR B CB  1 
ATOM   2882 C CG  . TYR B 2 130 ? -30.498 -36.951 40.811  1.00 30.64  ? 130 TYR B CG  1 
ATOM   2883 C CD1 . TYR B 2 130 ? -30.292 -36.435 42.118  1.00 31.77  ? 130 TYR B CD1 1 
ATOM   2884 C CD2 . TYR B 2 130 ? -30.458 -36.061 39.717  1.00 29.63  ? 130 TYR B CD2 1 
ATOM   2885 C CE1 . TYR B 2 130 ? -30.041 -35.054 42.329  1.00 31.71  ? 130 TYR B CE1 1 
ATOM   2886 C CE2 . TYR B 2 130 ? -30.206 -34.683 39.915  1.00 29.96  ? 130 TYR B CE2 1 
ATOM   2887 C CZ  . TYR B 2 130 ? -29.998 -34.196 41.221  1.00 31.19  ? 130 TYR B CZ  1 
ATOM   2888 O OH  . TYR B 2 130 ? -29.745 -32.856 41.408  1.00 31.25  ? 130 TYR B OH  1 
ATOM   2889 N N   . LEU B 2 131 ? -33.421 -38.566 38.932  1.00 38.17  ? 131 LEU B N   1 
ATOM   2890 C CA  . LEU B 2 131 ? -34.366 -37.940 38.022  1.00 38.37  ? 131 LEU B CA  1 
ATOM   2891 C C   . LEU B 2 131 ? -35.812 -38.088 38.511  1.00 38.57  ? 131 LEU B C   1 
ATOM   2892 O O   . LEU B 2 131 ? -36.577 -37.111 38.481  1.00 38.88  ? 131 LEU B O   1 
ATOM   2893 C CB  . LEU B 2 131 ? -34.212 -38.532 36.621  1.00 37.21  ? 131 LEU B CB  1 
ATOM   2894 C CG  . LEU B 2 131 ? -32.849 -38.297 35.970  1.00 37.70  ? 131 LEU B CG  1 
ATOM   2895 C CD1 . LEU B 2 131 ? -32.831 -38.951 34.588  1.00 35.40  ? 131 LEU B CD1 1 
ATOM   2896 C CD2 . LEU B 2 131 ? -32.564 -36.801 35.903  1.00 36.71  ? 131 LEU B CD2 1 
ATOM   2897 N N   . GLU B 2 132 ? -36.186 -39.279 38.977  1.00 39.04  ? 132 GLU B N   1 
ATOM   2898 C CA  . GLU B 2 132 ? -37.557 -39.507 39.423  1.00 41.32  ? 132 GLU B CA  1 
ATOM   2899 C C   . GLU B 2 132 ? -37.893 -38.679 40.661  1.00 41.01  ? 132 GLU B C   1 
ATOM   2900 O O   . GLU B 2 132 ? -39.071 -38.429 40.956  1.00 41.16  ? 132 GLU B O   1 
ATOM   2901 C CB  . GLU B 2 132 ? -37.809 -40.993 39.671  1.00 41.93  ? 132 GLU B CB  1 
ATOM   2902 C CG  . GLU B 2 132 ? -37.092 -41.565 40.855  1.00 44.48  ? 132 GLU B CG  1 
ATOM   2903 C CD  . GLU B 2 132 ? -37.317 -43.068 41.020  1.00 47.56  ? 132 GLU B CD  1 
ATOM   2904 O OE1 . GLU B 2 132 ? -36.598 -43.852 40.332  1.00 48.14  ? 132 GLU B OE1 1 
ATOM   2905 O OE2 . GLU B 2 132 ? -38.206 -43.449 41.840  1.00 47.28  ? 132 GLU B OE2 1 
ATOM   2906 N N   . GLU B 2 133 ? -36.852 -38.260 41.378  1.00 39.08  ? 133 GLU B N   1 
ATOM   2907 C CA  . GLU B 2 133 ? -37.014 -37.449 42.574  1.00 36.56  ? 133 GLU B CA  1 
ATOM   2908 C C   . GLU B 2 133 ? -36.798 -35.959 42.293  1.00 32.98  ? 133 GLU B C   1 
ATOM   2909 O O   . GLU B 2 133 ? -37.153 -35.105 43.094  1.00 32.86  ? 133 GLU B O   1 
ATOM   2910 C CB  . GLU B 2 133 ? -36.083 -37.956 43.681  1.00 37.64  ? 133 GLU B CB  1 
ATOM   2911 C CG  . GLU B 2 133 ? -36.351 -39.408 44.077  1.00 40.71  ? 133 GLU B CG  1 
ATOM   2912 C CD  . GLU B 2 133 ? -35.245 -39.997 44.952  1.00 43.53  ? 133 GLU B CD  1 
ATOM   2913 O OE1 . GLU B 2 133 ? -35.225 -39.701 46.175  1.00 44.40  ? 133 GLU B OE1 1 
ATOM   2914 O OE2 . GLU B 2 133 ? -34.386 -40.742 44.413  1.00 43.99  ? 133 GLU B OE2 1 
ATOM   2915 N N   . LEU B 2 134 ? -36.208 -35.655 41.146  1.00 30.23  ? 134 LEU B N   1 
ATOM   2916 C CA  . LEU B 2 134 ? -35.865 -34.290 40.789  1.00 27.00  ? 134 LEU B CA  1 
ATOM   2917 C C   . LEU B 2 134 ? -37.047 -33.313 40.746  1.00 24.50  ? 134 LEU B C   1 
ATOM   2918 O O   . LEU B 2 134 ? -36.991 -32.272 41.395  1.00 24.38  ? 134 LEU B O   1 
ATOM   2919 C CB  . LEU B 2 134 ? -35.078 -34.263 39.474  1.00 25.42  ? 134 LEU B CB  1 
ATOM   2920 C CG  . LEU B 2 134 ? -34.384 -32.955 39.106  1.00 24.52  ? 134 LEU B CG  1 
ATOM   2921 C CD1 . LEU B 2 134 ? -33.319 -32.660 40.142  1.00 23.46  ? 134 LEU B CD1 1 
ATOM   2922 C CD2 . LEU B 2 134 ? -33.804 -33.053 37.700  1.00 20.25  ? 134 LEU B CD2 1 
ATOM   2923 N N   . PRO B 2 135 ? -38.135 -33.647 39.978  1.00 22.92  ? 135 PRO B N   1 
ATOM   2924 C CA  . PRO B 2 135 ? -39.268 -32.727 39.863  1.00 21.28  ? 135 PRO B CA  1 
ATOM   2925 C C   . PRO B 2 135 ? -39.836 -32.277 41.208  1.00 22.08  ? 135 PRO B C   1 
ATOM   2926 O O   . PRO B 2 135 ? -40.255 -31.136 41.330  1.00 20.76  ? 135 PRO B O   1 
ATOM   2927 C CB  . PRO B 2 135 ? -40.295 -33.554 39.077  1.00 21.35  ? 135 PRO B CB  1 
ATOM   2928 C CG  . PRO B 2 135 ? -39.455 -34.496 38.272  1.00 20.52  ? 135 PRO B CG  1 
ATOM   2929 C CD  . PRO B 2 135 ? -38.359 -34.879 39.208  1.00 21.34  ? 135 PRO B CD  1 
ATOM   2930 N N   . GLY B 2 136 ? -39.829 -33.157 42.202  1.00 23.97  ? 136 GLY B N   1 
ATOM   2931 C CA  . GLY B 2 136 ? -40.302 -32.820 43.543  1.00 22.80  ? 136 GLY B CA  1 
ATOM   2932 C C   . GLY B 2 136 ? -39.506 -31.686 44.174  1.00 23.46  ? 136 GLY B C   1 
ATOM   2933 O O   . GLY B 2 136 ? -40.084 -30.751 44.743  1.00 21.70  ? 136 GLY B O   1 
ATOM   2934 N N   . GLN B 2 137 ? -38.190 -31.754 44.050  1.00 25.36  ? 137 GLN B N   1 
ATOM   2935 C CA  . GLN B 2 137 ? -37.326 -30.733 44.600  1.00 28.04  ? 137 GLN B CA  1 
ATOM   2936 C C   . GLN B 2 137 ? -37.501 -29.407 43.852  1.00 26.89  ? 137 GLN B C   1 
ATOM   2937 O O   . GLN B 2 137 ? -37.644 -28.352 44.484  1.00 26.73  ? 137 GLN B O   1 
ATOM   2938 C CB  . GLN B 2 137 ? -35.879 -31.190 44.563  1.00 33.03  ? 137 GLN B CB  1 
ATOM   2939 C CG  . GLN B 2 137 ? -34.934 -30.277 45.363  1.00 39.25  ? 137 GLN B CG  1 
ATOM   2940 C CD  . GLN B 2 137 ? -35.195 -30.276 46.854  1.00 40.41  ? 137 GLN B CD  1 
ATOM   2941 O OE1 . GLN B 2 137 ? -35.705 -29.308 47.407  1.00 43.39  ? 137 GLN B OE1 1 
ATOM   2942 N NE2 . GLN B 2 137 ? -34.849 -31.367 47.510  1.00 41.88  ? 137 GLN B NE2 1 
ATOM   2943 N N   . LEU B 2 138 ? -37.521 -29.464 42.518  1.00 24.45  ? 138 LEU B N   1 
ATOM   2944 C CA  . LEU B 2 138 ? -37.722 -28.268 41.710  1.00 21.61  ? 138 LEU B CA  1 
ATOM   2945 C C   . LEU B 2 138 ? -39.071 -27.621 42.024  1.00 18.18  ? 138 LEU B C   1 
ATOM   2946 O O   . LEU B 2 138 ? -39.215 -26.410 42.092  1.00 16.30  ? 138 LEU B O   1 
ATOM   2947 C CB  . LEU B 2 138 ? -37.633 -28.645 40.245  1.00 22.68  ? 138 LEU B CB  1 
ATOM   2948 C CG  . LEU B 2 138 ? -36.258 -28.768 39.591  1.00 23.07  ? 138 LEU B CG  1 
ATOM   2949 C CD1 . LEU B 2 138 ? -35.483 -27.501 39.767  1.00 25.73  ? 138 LEU B CD1 1 
ATOM   2950 C CD2 . LEU B 2 138 ? -35.508 -29.885 40.162  1.00 28.34  ? 138 LEU B CD2 1 
ATOM   2951 N N   . LYS B 2 139 ? -40.052 -28.479 42.273  1.00 19.78  ? 139 LYS B N   1 
ATOM   2952 C CA  . LYS B 2 139 ? -41.393 -28.054 42.619  1.00 19.68  ? 139 LYS B CA  1 
ATOM   2953 C C   . LYS B 2 139 ? -41.339 -27.135 43.821  1.00 17.35  ? 139 LYS B C   1 
ATOM   2954 O O   . LYS B 2 139 ? -41.920 -26.039 43.794  1.00 14.51  ? 139 LYS B O   1 
ATOM   2955 C CB  . LYS B 2 139 ? -42.277 -29.281 42.883  1.00 23.68  ? 139 LYS B CB  1 
ATOM   2956 C CG  . LYS B 2 139 ? -43.737 -28.995 43.123  1.00 28.06  ? 139 LYS B CG  1 
ATOM   2957 C CD  . LYS B 2 139 ? -44.438 -30.269 43.487  1.00 28.14  ? 139 LYS B CD  1 
ATOM   2958 C CE  . LYS B 2 139 ? -45.933 -30.056 43.669  1.00 25.33  ? 139 LYS B CE  1 
ATOM   2959 N NZ  . LYS B 2 139 ? -46.639 -31.324 44.100  1.00 26.15  ? 139 LYS B NZ  1 
ATOM   2960 N N   . GLN B 2 140 ? -40.637 -27.579 44.866  1.00 15.16  ? 140 GLN B N   1 
ATOM   2961 C CA  . GLN B 2 140 ? -40.542 -26.823 46.103  1.00 11.22  ? 140 GLN B CA  1 
ATOM   2962 C C   . GLN B 2 140 ? -39.897 -25.457 45.933  1.00 8.39   ? 140 GLN B C   1 
ATOM   2963 O O   . GLN B 2 140 ? -40.322 -24.487 46.567  1.00 6.67   ? 140 GLN B O   1 
ATOM   2964 C CB  . GLN B 2 140 ? -39.775 -27.612 47.136  1.00 11.88  ? 140 GLN B CB  1 
ATOM   2965 C CG  . GLN B 2 140 ? -40.437 -28.899 47.526  1.00 17.57  ? 140 GLN B CG  1 
ATOM   2966 C CD  . GLN B 2 140 ? -39.774 -29.548 48.715  1.00 19.85  ? 140 GLN B CD  1 
ATOM   2967 O OE1 . GLN B 2 140 ? -40.451 -29.930 49.649  1.00 25.99  ? 140 GLN B OE1 1 
ATOM   2968 N NE2 . GLN B 2 140 ? -38.455 -29.672 48.681  1.00 23.86  ? 140 GLN B NE2 1 
ATOM   2969 N N   . PHE B 2 141 ? -38.906 -25.386 45.040  1.00 10.15  ? 141 PHE B N   1 
ATOM   2970 C CA  . PHE B 2 141 ? -38.204 -24.134 44.731  1.00 9.15   ? 141 PHE B CA  1 
ATOM   2971 C C   . PHE B 2 141 ? -39.128 -23.150 44.023  1.00 9.08   ? 141 PHE B C   1 
ATOM   2972 O O   . PHE B 2 141 ? -39.118 -21.948 44.311  1.00 2.00   ? 141 PHE B O   1 
ATOM   2973 C CB  . PHE B 2 141 ? -36.962 -24.394 43.866  1.00 12.70  ? 141 PHE B CB  1 
ATOM   2974 C CG  . PHE B 2 141 ? -35.749 -24.782 44.658  1.00 18.46  ? 141 PHE B CG  1 
ATOM   2975 C CD1 . PHE B 2 141 ? -34.906 -23.795 45.210  1.00 20.80  ? 141 PHE B CD1 1 
ATOM   2976 C CD2 . PHE B 2 141 ? -35.442 -26.137 44.857  1.00 20.84  ? 141 PHE B CD2 1 
ATOM   2977 C CE1 . PHE B 2 141 ? -33.754 -24.160 45.951  1.00 19.06  ? 141 PHE B CE1 1 
ATOM   2978 C CE2 . PHE B 2 141 ? -34.280 -26.517 45.609  1.00 22.13  ? 141 PHE B CE2 1 
ATOM   2979 C CZ  . PHE B 2 141 ? -33.446 -25.521 46.147  1.00 20.57  ? 141 PHE B CZ  1 
ATOM   2980 N N   . SER B 2 142 ? -39.953 -23.672 43.119  1.00 9.03   ? 142 SER B N   1 
ATOM   2981 C CA  . SER B 2 142 ? -40.944 -22.846 42.434  1.00 9.08   ? 142 SER B CA  1 
ATOM   2982 C C   . SER B 2 142 ? -42.011 -22.321 43.382  1.00 7.51   ? 142 SER B C   1 
ATOM   2983 O O   . SER B 2 142 ? -42.331 -21.123 43.365  1.00 2.00   ? 142 SER B O   1 
ATOM   2984 C CB  . SER B 2 142 ? -41.610 -23.617 41.315  1.00 5.35   ? 142 SER B CB  1 
ATOM   2985 O OG  . SER B 2 142 ? -42.348 -22.731 40.512  1.00 7.95   ? 142 SER B OG  1 
ATOM   2986 N N   . MET B 2 143 ? -42.517 -23.219 44.229  1.00 8.93   ? 143 MET B N   1 
ATOM   2987 C CA  . MET B 2 143 ? -43.496 -22.883 45.241  1.00 10.19  ? 143 MET B CA  1 
ATOM   2988 C C   . MET B 2 143 ? -42.948 -21.795 46.196  1.00 10.19  ? 143 MET B C   1 
ATOM   2989 O O   . MET B 2 143 ? -43.675 -20.869 46.565  1.00 11.33  ? 143 MET B O   1 
ATOM   2990 C CB  . MET B 2 143 ? -43.899 -24.177 45.968  1.00 14.34  ? 143 MET B CB  1 
ATOM   2991 C CG  . MET B 2 143 ? -44.689 -23.986 47.279  1.00 24.21  ? 143 MET B CG  1 
ATOM   2992 S SD  . MET B 2 143 ? -43.649 -23.688 48.899  1.00 23.35  ? 143 MET B SD  1 
ATOM   2993 C CE  . MET B 2 143 ? -44.515 -22.159 49.450  1.00 21.44  ? 143 MET B CE  1 
ATOM   2994 N N   . PHE B 2 144 ? -41.689 -21.936 46.617  1.00 10.90  ? 144 PHE B N   1 
ATOM   2995 C CA  . PHE B 2 144 ? -41.015 -20.978 47.495  1.00 7.45   ? 144 PHE B CA  1 
ATOM   2996 C C   . PHE B 2 144 ? -40.780 -19.619 46.839  1.00 4.35   ? 144 PHE B C   1 
ATOM   2997 O O   . PHE B 2 144 ? -41.023 -18.594 47.448  1.00 5.71   ? 144 PHE B O   1 
ATOM   2998 C CB  . PHE B 2 144 ? -39.678 -21.553 47.948  1.00 8.25   ? 144 PHE B CB  1 
ATOM   2999 C CG  . PHE B 2 144 ? -38.942 -20.679 48.918  1.00 8.56   ? 144 PHE B CG  1 
ATOM   3000 C CD1 . PHE B 2 144 ? -39.220 -20.762 50.298  1.00 10.47  ? 144 PHE B CD1 1 
ATOM   3001 C CD2 . PHE B 2 144 ? -37.982 -19.754 48.461  1.00 8.81   ? 144 PHE B CD2 1 
ATOM   3002 C CE1 . PHE B 2 144 ? -38.530 -19.936 51.230  1.00 10.66  ? 144 PHE B CE1 1 
ATOM   3003 C CE2 . PHE B 2 144 ? -37.299 -18.911 49.374  1.00 6.87   ? 144 PHE B CE2 1 
ATOM   3004 C CZ  . PHE B 2 144 ? -37.574 -19.010 50.769  1.00 5.21   ? 144 PHE B CZ  1 
ATOM   3005 N N   . LEU B 2 145 ? -40.317 -19.616 45.596  1.00 6.84   ? 145 LEU B N   1 
ATOM   3006 C CA  . LEU B 2 145 ? -40.070 -18.386 44.833  1.00 5.50   ? 145 LEU B CA  1 
ATOM   3007 C C   . LEU B 2 145 ? -41.377 -17.563 44.645  1.00 5.18   ? 145 LEU B C   1 
ATOM   3008 O O   . LEU B 2 145 ? -41.401 -16.340 44.965  1.00 3.09   ? 145 LEU B O   1 
ATOM   3009 C CB  . LEU B 2 145 ? -39.435 -18.721 43.466  1.00 3.00   ? 145 LEU B CB  1 
ATOM   3010 C CG  . LEU B 2 145 ? -39.160 -17.531 42.540  1.00 2.00   ? 145 LEU B CG  1 
ATOM   3011 C CD1 . LEU B 2 145 ? -38.351 -16.431 43.265  1.00 2.00   ? 145 LEU B CD1 1 
ATOM   3012 C CD2 . LEU B 2 145 ? -38.424 -18.021 41.321  1.00 2.00   ? 145 LEU B CD2 1 
ATOM   3013 N N   . GLY B 2 146 ? -42.422 -18.241 44.154  1.00 3.45   ? 146 GLY B N   1 
ATOM   3014 C CA  . GLY B 2 146 ? -43.719 -17.613 43.938  1.00 5.07   ? 146 GLY B CA  1 
ATOM   3015 C C   . GLY B 2 146 ? -43.610 -16.472 42.973  1.00 9.77   ? 146 GLY B C   1 
ATOM   3016 O O   . GLY B 2 146 ? -43.025 -16.613 41.916  1.00 11.05  ? 146 GLY B O   1 
ATOM   3017 N N   . LYS B 2 147 ? -44.191 -15.334 43.330  1.00 11.37  ? 147 LYS B N   1 
ATOM   3018 C CA  . LYS B 2 147 ? -44.246 -14.167 42.451  1.00 14.53  ? 147 LYS B CA  1 
ATOM   3019 C C   . LYS B 2 147 ? -43.083 -13.203 42.717  1.00 14.66  ? 147 LYS B C   1 
ATOM   3020 O O   . LYS B 2 147 ? -43.092 -12.086 42.207  1.00 16.00  ? 147 LYS B O   1 
ATOM   3021 C CB  . LYS B 2 147 ? -45.589 -13.398 42.604  1.00 18.51  ? 147 LYS B CB  1 
ATOM   3022 C CG  . LYS B 2 147 ? -46.841 -14.192 42.226  1.00 24.04  ? 147 LYS B CG  1 
ATOM   3023 C CD  . LYS B 2 147 ? -46.834 -14.544 40.768  1.00 32.33  ? 147 LYS B CD  1 
ATOM   3024 C CE  . LYS B 2 147 ? -48.099 -15.300 40.367  1.00 37.67  ? 147 LYS B CE  1 
ATOM   3025 N NZ  . LYS B 2 147 ? -48.225 -16.615 41.090  1.00 37.94  ? 147 LYS B NZ  1 
ATOM   3026 N N   . PHE B 2 148 ? -42.092 -13.625 43.490  1.00 12.10  ? 148 PHE B N   1 
ATOM   3027 C CA  . PHE B 2 148 ? -40.984 -12.749 43.808  1.00 11.51  ? 148 PHE B CA  1 
ATOM   3028 C C   . PHE B 2 148 ? -40.026 -12.699 42.625  1.00 11.41  ? 148 PHE B C   1 
ATOM   3029 O O   . PHE B 2 148 ? -40.003 -13.608 41.796  1.00 12.59  ? 148 PHE B O   1 
ATOM   3030 C CB  . PHE B 2 148 ? -40.291 -13.247 45.073  1.00 11.96  ? 148 PHE B CB  1 
ATOM   3031 C CG  . PHE B 2 148 ? -41.061 -12.971 46.324  1.00 10.34  ? 148 PHE B CG  1 
ATOM   3032 C CD1 . PHE B 2 148 ? -41.484 -11.684 46.639  1.00 13.64  ? 148 PHE B CD1 1 
ATOM   3033 C CD2 . PHE B 2 148 ? -41.353 -13.998 47.192  1.00 10.49  ? 148 PHE B CD2 1 
ATOM   3034 C CE1 . PHE B 2 148 ? -42.208 -11.428 47.824  1.00 11.15  ? 148 PHE B CE1 1 
ATOM   3035 C CE2 . PHE B 2 148 ? -42.076 -13.756 48.384  1.00 6.49   ? 148 PHE B CE2 1 
ATOM   3036 C CZ  . PHE B 2 148 ? -42.498 -12.476 48.695  1.00 8.27   ? 148 PHE B CZ  1 
ATOM   3037 N N   . SER B 2 149 ? -39.207 -11.654 42.575  1.00 9.68   ? 149 SER B N   1 
ATOM   3038 C CA  . SER B 2 149 ? -38.188 -11.530 41.539  1.00 11.91  ? 149 SER B CA  1 
ATOM   3039 C C   . SER B 2 149 ? -36.962 -12.393 41.884  1.00 12.73  ? 149 SER B C   1 
ATOM   3040 O O   . SER B 2 149 ? -36.315 -12.968 41.011  1.00 14.72  ? 149 SER B O   1 
ATOM   3041 C CB  . SER B 2 149 ? -37.745 -10.076 41.415  1.00 10.57  ? 149 SER B CB  1 
ATOM   3042 O OG  . SER B 2 149 ? -38.826 -9.190  41.510  1.00 14.00  ? 149 SER B OG  1 
ATOM   3043 N N   . TRP B 2 150 ? -36.667 -12.470 43.171  1.00 12.71  ? 150 TRP B N   1 
ATOM   3044 C CA  . TRP B 2 150 ? -35.520 -13.204 43.669  1.00 11.94  ? 150 TRP B CA  1 
ATOM   3045 C C   . TRP B 2 150 ? -35.985 -14.049 44.833  1.00 10.23  ? 150 TRP B C   1 
ATOM   3046 O O   . TRP B 2 150 ? -37.044 -13.787 45.390  1.00 10.82  ? 150 TRP B O   1 
ATOM   3047 C CB  . TRP B 2 150 ? -34.425 -12.236 44.121  1.00 9.69   ? 150 TRP B CB  1 
ATOM   3048 C CG  . TRP B 2 150 ? -34.053 -11.214 43.071  1.00 4.63   ? 150 TRP B CG  1 
ATOM   3049 C CD1 . TRP B 2 150 ? -34.249 -9.869  43.141  1.00 4.89   ? 150 TRP B CD1 1 
ATOM   3050 C CD2 . TRP B 2 150 ? -33.525 -11.489 41.752  1.00 2.42   ? 150 TRP B CD2 1 
ATOM   3051 N NE1 . TRP B 2 150 ? -33.803 -9.267  41.981  1.00 6.02   ? 150 TRP B NE1 1 
ATOM   3052 C CE2 . TRP B 2 150 ? -33.387 -10.227 41.114  1.00 2.00   ? 150 TRP B CE2 1 
ATOM   3053 C CE3 . TRP B 2 150 ? -33.119 -12.648 41.086  1.00 2.00   ? 150 TRP B CE3 1 
ATOM   3054 C CZ2 . TRP B 2 150 ? -32.843 -10.121 39.832  1.00 2.00   ? 150 TRP B CZ2 1 
ATOM   3055 C CZ3 . TRP B 2 150 ? -32.569 -12.535 39.822  1.00 2.70   ? 150 TRP B CZ3 1 
ATOM   3056 C CH2 . TRP B 2 150 ? -32.441 -11.278 39.207  1.00 5.14   ? 150 TRP B CH2 1 
ATOM   3057 N N   . PHE B 2 151 ? -35.204 -15.058 45.192  1.00 8.02   ? 151 PHE B N   1 
ATOM   3058 C CA  . PHE B 2 151 ? -35.547 -15.960 46.304  1.00 7.79   ? 151 PHE B CA  1 
ATOM   3059 C C   . PHE B 2 151 ? -35.648 -15.256 47.655  1.00 11.78  ? 151 PHE B C   1 
ATOM   3060 O O   . PHE B 2 151 ? -36.357 -15.715 48.543  1.00 12.79  ? 151 PHE B O   1 
ATOM   3061 C CB  . PHE B 2 151 ? -34.564 -17.117 46.374  1.00 5.92   ? 151 PHE B CB  1 
ATOM   3062 C CG  . PHE B 2 151 ? -34.835 -18.179 45.371  1.00 5.55   ? 151 PHE B CG  1 
ATOM   3063 C CD1 . PHE B 2 151 ? -34.436 -18.000 44.029  1.00 2.00   ? 151 PHE B CD1 1 
ATOM   3064 C CD2 . PHE B 2 151 ? -35.559 -19.331 45.747  1.00 2.66   ? 151 PHE B CD2 1 
ATOM   3065 C CE1 . PHE B 2 151 ? -34.735 -18.978 43.058  1.00 2.00   ? 151 PHE B CE1 1 
ATOM   3066 C CE2 . PHE B 2 151 ? -35.873 -20.332 44.796  1.00 2.89   ? 151 PHE B CE2 1 
ATOM   3067 C CZ  . PHE B 2 151 ? -35.465 -20.155 43.439  1.00 2.00   ? 151 PHE B CZ  1 
ATOM   3068 N N   . ALA B 2 152 ? -34.963 -14.136 47.805  1.00 16.02  ? 152 ALA B N   1 
ATOM   3069 C CA  . ALA B 2 152 ? -35.024 -13.356 49.040  1.00 16.91  ? 152 ALA B CA  1 
ATOM   3070 C C   . ALA B 2 152 ? -36.219 -12.364 49.031  1.00 19.40  ? 152 ALA B C   1 
ATOM   3071 O O   . ALA B 2 152 ? -36.324 -11.470 49.869  1.00 20.40  ? 152 ALA B O   1 
ATOM   3072 C CB  . ALA B 2 152 ? -33.710 -12.599 49.217  1.00 17.77  ? 152 ALA B CB  1 
ATOM   3073 N N   . GLY B 2 153 ? -37.102 -12.505 48.045  1.00 19.38  ? 153 GLY B N   1 
ATOM   3074 C CA  . GLY B 2 153 ? -38.185 -11.554 47.895  1.00 21.19  ? 153 GLY B CA  1 
ATOM   3075 C C   . GLY B 2 153 ? -37.912 -10.637 46.725  1.00 23.58  ? 153 GLY B C   1 
ATOM   3076 O O   . GLY B 2 153 ? -37.825 -11.062 45.582  1.00 26.11  ? 153 GLY B O   1 
ATOM   3077 N N   . GLU B 2 154 ? -37.810 -9.347  47.012  1.00 23.01  ? 154 GLU B N   1 
ATOM   3078 C CA  . GLU B 2 154 ? -37.577 -8.346  45.978  1.00 24.22  ? 154 GLU B CA  1 
ATOM   3079 C C   . GLU B 2 154 ? -36.167 -7.743  46.080  1.00 24.67  ? 154 GLU B C   1 
ATOM   3080 O O   . GLU B 2 154 ? -35.954 -6.581  45.738  1.00 24.99  ? 154 GLU B O   1 
ATOM   3081 C CB  . GLU B 2 154 ? -38.641 -7.245  46.072  1.00 25.09  ? 154 GLU B CB  1 
ATOM   3082 C CG  . GLU B 2 154 ? -40.037 -7.698  45.672  1.00 27.87  ? 154 GLU B CG  1 
ATOM   3083 C CD  . GLU B 2 154 ? -40.107 -8.186  44.226  1.00 29.16  ? 154 GLU B CD  1 
ATOM   3084 O OE1 . GLU B 2 154 ? -39.938 -7.348  43.310  1.00 32.40  ? 154 GLU B OE1 1 
ATOM   3085 O OE2 . GLU B 2 154 ? -40.337 -9.400  44.006  1.00 28.25  ? 154 GLU B OE2 1 
ATOM   3086 N N   . LYS B 2 155 ? -35.215 -8.534  46.552  1.00 25.34  ? 155 LYS B N   1 
ATOM   3087 C CA  . LYS B 2 155 ? -33.848 -8.069  46.726  1.00 22.53  ? 155 LYS B CA  1 
ATOM   3088 C C   . LYS B 2 155 ? -32.894 -9.167  46.286  1.00 20.51  ? 155 LYS B C   1 
ATOM   3089 O O   . LYS B 2 155 ? -33.048 -10.329 46.705  1.00 24.92  ? 155 LYS B O   1 
ATOM   3090 C CB  . LYS B 2 155 ? -33.627 -7.720  48.189  1.00 22.94  ? 155 LYS B CB  1 
ATOM   3091 C CG  . LYS B 2 155 ? -32.478 -6.735  48.411  1.00 22.74  ? 155 LYS B CG  1 
ATOM   3092 C CD  . LYS B 2 155 ? -32.219 -6.452  49.908  1.00 24.78  ? 155 LYS B CD  1 
ATOM   3093 C CE  . LYS B 2 155 ? -33.435 -5.753  50.543  1.00 25.51  ? 155 LYS B CE  1 
ATOM   3094 N NZ  . LYS B 2 155 ? -33.704 -4.386  50.031  1.00 25.11  ? 155 LYS B NZ  1 
ATOM   3095 N N   . LEU B 2 156 ? -31.918 -8.795  45.450  1.00 18.22  ? 156 LEU B N   1 
ATOM   3096 C CA  . LEU B 2 156 ? -30.925 -9.755  44.977  1.00 16.90  ? 156 LEU B CA  1 
ATOM   3097 C C   . LEU B 2 156 ? -29.935 -9.985  46.114  1.00 19.10  ? 156 LEU B C   1 
ATOM   3098 O O   . LEU B 2 156 ? -29.373 -9.037  46.652  1.00 22.95  ? 156 LEU B O   1 
ATOM   3099 C CB  . LEU B 2 156 ? -30.178 -9.198  43.767  1.00 14.35  ? 156 LEU B CB  1 
ATOM   3100 C CG  . LEU B 2 156 ? -29.838 -10.133 42.605  1.00 16.89  ? 156 LEU B CG  1 
ATOM   3101 C CD1 . LEU B 2 156 ? -28.907 -9.396  41.676  1.00 18.14  ? 156 LEU B CD1 1 
ATOM   3102 C CD2 . LEU B 2 156 ? -29.217 -11.409 43.043  1.00 17.95  ? 156 LEU B CD2 1 
ATOM   3103 N N   . THR B 2 157 ? -29.726 -11.249 46.485  1.00 15.85  ? 157 THR B N   1 
ATOM   3104 C CA  . THR B 2 157 ? -28.773 -11.601 47.524  1.00 13.91  ? 157 THR B CA  1 
ATOM   3105 C C   . THR B 2 157 ? -27.856 -12.729 47.031  1.00 13.66  ? 157 THR B C   1 
ATOM   3106 O O   . THR B 2 157 ? -28.029 -13.262 45.916  1.00 10.60  ? 157 THR B O   1 
ATOM   3107 C CB  . THR B 2 157 ? -29.516 -12.061 48.784  1.00 13.18  ? 157 THR B CB  1 
ATOM   3108 O OG1 . THR B 2 157 ? -30.377 -13.172 48.472  1.00 10.04  ? 157 THR B OG1 1 
ATOM   3109 C CG2 . THR B 2 157 ? -30.323 -10.885 49.395  1.00 10.28  ? 157 THR B CG2 1 
ATOM   3110 N N   . PHE B 2 158 ? -26.876 -13.095 47.846  1.00 12.94  ? 158 PHE B N   1 
ATOM   3111 C CA  . PHE B 2 158 ? -25.968 -14.149 47.439  1.00 8.24   ? 158 PHE B CA  1 
ATOM   3112 C C   . PHE B 2 158 ? -26.682 -15.484 47.127  1.00 4.96   ? 158 PHE B C   1 
ATOM   3113 O O   . PHE B 2 158 ? -26.200 -16.273 46.299  1.00 4.96   ? 158 PHE B O   1 
ATOM   3114 C CB  . PHE B 2 158 ? -24.799 -14.301 48.446  1.00 4.01   ? 158 PHE B CB  1 
ATOM   3115 C CG  . PHE B 2 158 ? -25.194 -14.937 49.769  1.00 4.45   ? 158 PHE B CG  1 
ATOM   3116 C CD1 . PHE B 2 158 ? -25.136 -16.337 49.954  1.00 4.66   ? 158 PHE B CD1 1 
ATOM   3117 C CD2 . PHE B 2 158 ? -25.550 -14.121 50.834  1.00 7.50   ? 158 PHE B CD2 1 
ATOM   3118 C CE1 . PHE B 2 158 ? -25.477 -16.909 51.163  1.00 7.44   ? 158 PHE B CE1 1 
ATOM   3119 C CE2 . PHE B 2 158 ? -25.880 -14.678 52.059  1.00 10.75  ? 158 PHE B CE2 1 
ATOM   3120 C CZ  . PHE B 2 158 ? -25.843 -16.078 52.226  1.00 12.82  ? 158 PHE B CZ  1 
ATOM   3121 N N   . VAL B 2 159 ? -27.809 -15.746 47.786  1.00 2.89   ? 159 VAL B N   1 
ATOM   3122 C CA  . VAL B 2 159 ? -28.495 -17.021 47.602  1.00 5.67   ? 159 VAL B CA  1 
ATOM   3123 C C   . VAL B 2 159 ? -28.992 -17.239 46.177  1.00 6.24   ? 159 VAL B C   1 
ATOM   3124 O O   . VAL B 2 159 ? -29.130 -18.373 45.743  1.00 3.80   ? 159 VAL B O   1 
ATOM   3125 C CB  . VAL B 2 159 ? -29.672 -17.207 48.572  1.00 4.04   ? 159 VAL B CB  1 
ATOM   3126 C CG1 . VAL B 2 159 ? -29.132 -17.347 49.955  1.00 3.13   ? 159 VAL B CG1 1 
ATOM   3127 C CG2 . VAL B 2 159 ? -30.635 -16.072 48.505  1.00 2.53   ? 159 VAL B CG2 1 
ATOM   3128 N N   . ASP B 2 160 ? -29.223 -16.154 45.435  1.00 8.63   ? 160 ASP B N   1 
ATOM   3129 C CA  . ASP B 2 160 ? -29.659 -16.247 44.028  1.00 9.17   ? 160 ASP B CA  1 
ATOM   3130 C C   . ASP B 2 160 ? -28.547 -16.831 43.184  1.00 8.97   ? 160 ASP B C   1 
ATOM   3131 O O   . ASP B 2 160 ? -28.802 -17.670 42.342  1.00 12.13  ? 160 ASP B O   1 
ATOM   3132 C CB  . ASP B 2 160 ? -30.083 -14.876 43.492  1.00 6.18   ? 160 ASP B CB  1 
ATOM   3133 C CG  . ASP B 2 160 ? -31.333 -14.368 44.166  1.00 7.99   ? 160 ASP B CG  1 
ATOM   3134 O OD1 . ASP B 2 160 ? -32.381 -15.042 44.045  1.00 9.78   ? 160 ASP B OD1 1 
ATOM   3135 O OD2 . ASP B 2 160 ? -31.288 -13.311 44.830  1.00 8.68   ? 160 ASP B OD2 1 
ATOM   3136 N N   . PHE B 2 161 ? -27.305 -16.439 43.468  1.00 8.48   ? 161 PHE B N   1 
ATOM   3137 C CA  . PHE B 2 161 ? -26.144 -16.970 42.765  1.00 6.75   ? 161 PHE B CA  1 
ATOM   3138 C C   . PHE B 2 161 ? -26.007 -18.463 43.017  1.00 7.09   ? 161 PHE B C   1 
ATOM   3139 O O   . PHE B 2 161 ? -25.707 -19.230 42.117  1.00 6.89   ? 161 PHE B O   1 
ATOM   3140 C CB  . PHE B 2 161 ? -24.882 -16.232 43.183  1.00 3.38   ? 161 PHE B CB  1 
ATOM   3141 C CG  . PHE B 2 161 ? -24.931 -14.760 42.889  1.00 2.00   ? 161 PHE B CG  1 
ATOM   3142 C CD1 . PHE B 2 161 ? -25.711 -13.912 43.665  1.00 3.92   ? 161 PHE B CD1 1 
ATOM   3143 C CD2 . PHE B 2 161 ? -24.204 -14.218 41.828  1.00 2.00   ? 161 PHE B CD2 1 
ATOM   3144 C CE1 . PHE B 2 161 ? -25.758 -12.527 43.387  1.00 5.72   ? 161 PHE B CE1 1 
ATOM   3145 C CE2 . PHE B 2 161 ? -24.247 -12.842 41.538  1.00 2.00   ? 161 PHE B CE2 1 
ATOM   3146 C CZ  . PHE B 2 161 ? -25.018 -11.995 42.310  1.00 2.00   ? 161 PHE B CZ  1 
ATOM   3147 N N   . LEU B 2 162 ? -26.264 -18.870 44.260  1.00 7.71   ? 162 LEU B N   1 
ATOM   3148 C CA  . LEU B 2 162 ? -26.227 -20.279 44.649  1.00 8.75   ? 162 LEU B CA  1 
ATOM   3149 C C   . LEU B 2 162 ? -27.340 -21.054 43.950  1.00 10.69  ? 162 LEU B C   1 
ATOM   3150 O O   . LEU B 2 162 ? -27.064 -22.127 43.384  1.00 9.70   ? 162 LEU B O   1 
ATOM   3151 C CB  . LEU B 2 162 ? -26.436 -20.429 46.160  1.00 10.24  ? 162 LEU B CB  1 
ATOM   3152 C CG  . LEU B 2 162 ? -25.278 -20.081 47.082  1.00 10.79  ? 162 LEU B CG  1 
ATOM   3153 C CD1 . LEU B 2 162 ? -25.773 -20.028 48.492  1.00 8.50   ? 162 LEU B CD1 1 
ATOM   3154 C CD2 . LEU B 2 162 ? -24.195 -21.127 46.900  1.00 10.59  ? 162 LEU B CD2 1 
ATOM   3155 N N   . THR B 2 163 ? -28.556 -20.525 43.988  1.00 13.73  ? 163 THR B N   1 
ATOM   3156 C CA  . THR B 2 163 ? -29.703 -21.204 43.404  1.00 15.39  ? 163 THR B CA  1 
ATOM   3157 C C   . THR B 2 163 ? -29.509 -21.362 41.897  1.00 16.27  ? 163 THR B C   1 
ATOM   3158 O O   . THR B 2 163 ? -29.786 -22.414 41.324  1.00 16.03  ? 163 THR B O   1 
ATOM   3159 C CB  . THR B 2 163 ? -31.001 -20.461 43.713  1.00 17.53  ? 163 THR B CB  1 
ATOM   3160 O OG1 . THR B 2 163 ? -31.085 -20.221 45.125  1.00 20.33  ? 163 THR B OG1 1 
ATOM   3161 C CG2 . THR B 2 163 ? -32.201 -21.313 43.326  1.00 16.02  ? 163 THR B CG2 1 
ATOM   3162 N N   . TYR B 2 164 ? -29.017 -20.303 41.257  1.00 15.81  ? 164 TYR B N   1 
ATOM   3163 C CA  . TYR B 2 164 ? -28.771 -20.335 39.833  1.00 15.69  ? 164 TYR B CA  1 
ATOM   3164 C C   . TYR B 2 164 ? -27.823 -21.449 39.477  1.00 17.96  ? 164 TYR B C   1 
ATOM   3165 O O   . TYR B 2 164 ? -28.109 -22.216 38.586  1.00 17.22  ? 164 TYR B O   1 
ATOM   3166 C CB  . TYR B 2 164 ? -28.241 -18.989 39.340  1.00 19.07  ? 164 TYR B CB  1 
ATOM   3167 C CG  . TYR B 2 164 ? -27.666 -19.023 37.946  1.00 24.14  ? 164 TYR B CG  1 
ATOM   3168 C CD1 . TYR B 2 164 ? -28.506 -19.102 36.827  1.00 26.38  ? 164 TYR B CD1 1 
ATOM   3169 C CD2 . TYR B 2 164 ? -26.281 -18.993 37.746  1.00 24.78  ? 164 TYR B CD2 1 
ATOM   3170 C CE1 . TYR B 2 164 ? -27.975 -19.169 35.528  1.00 28.01  ? 164 TYR B CE1 1 
ATOM   3171 C CE2 . TYR B 2 164 ? -25.728 -19.058 36.455  1.00 28.37  ? 164 TYR B CE2 1 
ATOM   3172 C CZ  . TYR B 2 164 ? -26.579 -19.152 35.354  1.00 28.22  ? 164 TYR B CZ  1 
ATOM   3173 O OH  . TYR B 2 164 ? -26.019 -19.233 34.099  1.00 27.37  ? 164 TYR B OH  1 
ATOM   3174 N N   . ASP B 2 165 ? -26.690 -21.516 40.173  1.00 20.91  ? 165 ASP B N   1 
ATOM   3175 C CA  . ASP B 2 165 ? -25.672 -22.525 39.931  1.00 17.76  ? 165 ASP B CA  1 
ATOM   3176 C C   . ASP B 2 165 ? -26.241 -23.947 39.934  1.00 15.20  ? 165 ASP B C   1 
ATOM   3177 O O   . ASP B 2 165 ? -25.995 -24.717 39.006  1.00 11.60  ? 165 ASP B O   1 
ATOM   3178 C CB  . ASP B 2 165 ? -24.534 -22.379 40.958  1.00 19.87  ? 165 ASP B CB  1 
ATOM   3179 C CG  . ASP B 2 165 ? -23.537 -23.522 40.903  1.00 22.54  ? 165 ASP B CG  1 
ATOM   3180 O OD1 . ASP B 2 165 ? -22.962 -23.765 39.809  1.00 18.95  ? 165 ASP B OD1 1 
ATOM   3181 O OD2 . ASP B 2 165 ? -23.363 -24.181 41.956  1.00 23.35  ? 165 ASP B OD2 1 
ATOM   3182 N N   . ILE B 2 166 ? -26.993 -24.306 40.982  1.00 15.33  ? 166 ILE B N   1 
ATOM   3183 C CA  . ILE B 2 166 ? -27.543 -25.646 41.107  1.00 18.12  ? 166 ILE B CA  1 
ATOM   3184 C C   . ILE B 2 166 ? -28.687 -25.923 40.104  1.00 19.81  ? 166 ILE B C   1 
ATOM   3185 O O   . ILE B 2 166 ? -28.773 -27.024 39.556  1.00 17.30  ? 166 ILE B O   1 
ATOM   3186 C CB  . ILE B 2 166 ? -27.997 -25.951 42.580  1.00 18.54  ? 166 ILE B CB  1 
ATOM   3187 C CG1 . ILE B 2 166 ? -28.259 -27.434 42.729  1.00 21.98  ? 166 ILE B CG1 1 
ATOM   3188 C CG2 . ILE B 2 166 ? -29.231 -25.149 42.978  1.00 21.73  ? 166 ILE B CG2 1 
ATOM   3189 C CD1 . ILE B 2 166 ? -27.080 -28.295 42.392  1.00 24.98  ? 166 ILE B CD1 1 
ATOM   3190 N N   . LEU B 2 167 ? -29.533 -24.919 39.843  1.00 19.26  ? 167 LEU B N   1 
ATOM   3191 C CA  . LEU B 2 167 ? -30.591 -25.064 38.835  1.00 20.76  ? 167 LEU B CA  1 
ATOM   3192 C C   . LEU B 2 167 ? -30.004 -25.188 37.434  1.00 21.56  ? 167 LEU B C   1 
ATOM   3193 O O   . LEU B 2 167 ? -30.498 -25.933 36.613  1.00 24.09  ? 167 LEU B O   1 
ATOM   3194 C CB  . LEU B 2 167 ? -31.562 -23.874 38.871  1.00 18.92  ? 167 LEU B CB  1 
ATOM   3195 C CG  . LEU B 2 167 ? -32.499 -23.674 40.070  1.00 17.23  ? 167 LEU B CG  1 
ATOM   3196 C CD1 . LEU B 2 167 ? -33.368 -22.488 39.807  1.00 12.45  ? 167 LEU B CD1 1 
ATOM   3197 C CD2 . LEU B 2 167 ? -33.320 -24.882 40.323  1.00 14.81  ? 167 LEU B CD2 1 
ATOM   3198 N N   . ASP B 2 168 ? -28.908 -24.476 37.188  1.00 20.55  ? 168 ASP B N   1 
ATOM   3199 C CA  . ASP B 2 168 ? -28.213 -24.561 35.916  1.00 22.68  ? 168 ASP B CA  1 
ATOM   3200 C C   . ASP B 2 168 ? -27.649 -25.942 35.714  1.00 23.73  ? 168 ASP B C   1 
ATOM   3201 O O   . ASP B 2 168 ? -27.870 -26.520 34.679  1.00 24.14  ? 168 ASP B O   1 
ATOM   3202 C CB  . ASP B 2 168 ? -27.086 -23.522 35.864  1.00 24.70  ? 168 ASP B CB  1 
ATOM   3203 C CG  . ASP B 2 168 ? -26.394 -23.459 34.506  1.00 27.80  ? 168 ASP B CG  1 
ATOM   3204 O OD1 . ASP B 2 168 ? -26.978 -23.902 33.486  1.00 31.77  ? 168 ASP B OD1 1 
ATOM   3205 O OD2 . ASP B 2 168 ? -25.240 -22.964 34.485  1.00 31.66  ? 168 ASP B OD2 1 
ATOM   3206 N N   . GLN B 2 169 ? -26.907 -26.457 36.694  1.00 25.53  ? 169 GLN B N   1 
ATOM   3207 C CA  . GLN B 2 169 ? -26.338 -27.795 36.603  1.00 26.64  ? 169 GLN B CA  1 
ATOM   3208 C C   . GLN B 2 169 ? -27.403 -28.846 36.323  1.00 27.09  ? 169 GLN B C   1 
ATOM   3209 O O   . GLN B 2 169 ? -27.199 -29.720 35.475  1.00 27.93  ? 169 GLN B O   1 
ATOM   3210 C CB  . GLN B 2 169 ? -25.615 -28.146 37.894  1.00 25.50  ? 169 GLN B CB  1 
ATOM   3211 C CG  . GLN B 2 169 ? -24.281 -27.455 38.058  1.00 23.03  ? 169 GLN B CG  1 
ATOM   3212 C CD  . GLN B 2 169 ? -23.610 -27.834 39.344  1.00 18.34  ? 169 GLN B CD  1 
ATOM   3213 O OE1 . GLN B 2 169 ? -23.453 -27.021 40.242  1.00 24.56  ? 169 GLN B OE1 1 
ATOM   3214 N NE2 . GLN B 2 169 ? -23.187 -29.071 39.438  1.00 14.22  ? 169 GLN B NE2 1 
ATOM   3215 N N   . ASN B 2 170 ? -28.541 -28.745 37.014  1.00 28.06  ? 170 ASN B N   1 
ATOM   3216 C CA  . ASN B 2 170 ? -29.640 -29.664 36.787  1.00 27.44  ? 170 ASN B CA  1 
ATOM   3217 C C   . ASN B 2 170 ? -30.223 -29.492 35.394  1.00 28.22  ? 170 ASN B C   1 
ATOM   3218 O O   . ASN B 2 170 ? -30.552 -30.487 34.741  1.00 27.20  ? 170 ASN B O   1 
ATOM   3219 C CB  . ASN B 2 170 ? -30.720 -29.459 37.829  1.00 29.22  ? 170 ASN B CB  1 
ATOM   3220 C CG  . ASN B 2 170 ? -30.464 -30.255 39.092  1.00 31.63  ? 170 ASN B CG  1 
ATOM   3221 O OD1 . ASN B 2 170 ? -30.274 -29.683 40.169  1.00 30.97  ? 170 ASN B OD1 1 
ATOM   3222 N ND2 . ASN B 2 170 ? -30.457 -31.582 38.972  1.00 30.38  ? 170 ASN B ND2 1 
ATOM   3223 N N   . ARG B 2 171 ? -30.318 -28.235 34.949  1.00 28.24  ? 171 ARG B N   1 
ATOM   3224 C CA  . ARG B 2 171 ? -30.792 -27.896 33.612  1.00 28.70  ? 171 ARG B CA  1 
ATOM   3225 C C   . ARG B 2 171 ? -29.928 -28.589 32.573  1.00 29.27  ? 171 ARG B C   1 
ATOM   3226 O O   . ARG B 2 171 ? -30.438 -29.113 31.604  1.00 30.96  ? 171 ARG B O   1 
ATOM   3227 C CB  . ARG B 2 171 ? -30.753 -26.374 33.432  1.00 28.60  ? 171 ARG B CB  1 
ATOM   3228 C CG  . ARG B 2 171 ? -30.996 -25.860 32.012  1.00 28.38  ? 171 ARG B CG  1 
ATOM   3229 C CD  . ARG B 2 171 ? -30.075 -24.705 31.667  1.00 24.74  ? 171 ARG B CD  1 
ATOM   3230 N NE  . ARG B 2 171 ? -30.485 -23.467 32.319  1.00 21.48  ? 171 ARG B NE  1 
ATOM   3231 C CZ  . ARG B 2 171 ? -29.818 -22.316 32.227  1.00 25.02  ? 171 ARG B CZ  1 
ATOM   3232 N NH1 . ARG B 2 171 ? -28.672 -22.233 31.559  1.00 23.48  ? 171 ARG B NH1 1 
ATOM   3233 N NH2 . ARG B 2 171 ? -30.293 -21.229 32.823  1.00 24.81  ? 171 ARG B NH2 1 
ATOM   3234 N N   . ILE B 2 172 ? -28.616 -28.594 32.801  1.00 28.20  ? 172 ILE B N   1 
ATOM   3235 C CA  . ILE B 2 172 ? -27.651 -29.241 31.916  1.00 27.19  ? 172 ILE B CA  1 
ATOM   3236 C C   . ILE B 2 172 ? -27.837 -30.750 31.910  1.00 27.24  ? 172 ILE B C   1 
ATOM   3237 O O   . ILE B 2 172 ? -27.718 -31.395 30.892  1.00 30.62  ? 172 ILE B O   1 
ATOM   3238 C CB  . ILE B 2 172 ? -26.200 -28.914 32.356  1.00 25.78  ? 172 ILE B CB  1 
ATOM   3239 C CG1 . ILE B 2 172 ? -25.955 -27.410 32.273  1.00 24.64  ? 172 ILE B CG1 1 
ATOM   3240 C CG2 . ILE B 2 172 ? -25.202 -29.627 31.470  1.00 23.95  ? 172 ILE B CG2 1 
ATOM   3241 C CD1 . ILE B 2 172 ? -24.620 -26.985 32.862  1.00 24.18  ? 172 ILE B CD1 1 
ATOM   3242 N N   . PHE B 2 173 ? -28.122 -31.308 33.082  1.00 28.77  ? 173 PHE B N   1 
ATOM   3243 C CA  . PHE B 2 173 ? -28.301 -32.741 33.231  1.00 29.84  ? 173 PHE B CA  1 
ATOM   3244 C C   . PHE B 2 173 ? -29.587 -33.196 32.547  1.00 31.30  ? 173 PHE B C   1 
ATOM   3245 O O   . PHE B 2 173 ? -29.630 -34.284 31.958  1.00 31.36  ? 173 PHE B O   1 
ATOM   3246 C CB  . PHE B 2 173 ? -28.361 -33.085 34.723  1.00 31.01  ? 173 PHE B CB  1 
ATOM   3247 C CG  . PHE B 2 173 ? -28.124 -34.532 35.019  1.00 33.76  ? 173 PHE B CG  1 
ATOM   3248 C CD1 . PHE B 2 173 ? -26.921 -35.132 34.647  1.00 32.93  ? 173 PHE B CD1 1 
ATOM   3249 C CD2 . PHE B 2 173 ? -29.090 -35.286 35.709  1.00 36.85  ? 173 PHE B CD2 1 
ATOM   3250 C CE1 . PHE B 2 173 ? -26.676 -36.471 34.954  1.00 34.70  ? 173 PHE B CE1 1 
ATOM   3251 C CE2 . PHE B 2 173 ? -28.858 -36.633 36.028  1.00 36.38  ? 173 PHE B CE2 1 
ATOM   3252 C CZ  . PHE B 2 173 ? -27.653 -37.223 35.652  1.00 35.77  ? 173 PHE B CZ  1 
ATOM   3253 N N   . ASP B 2 174 ? -30.618 -32.353 32.634  1.00 32.12  ? 174 ASP B N   1 
ATOM   3254 C CA  . ASP B 2 174 ? -31.899 -32.642 32.010  1.00 31.16  ? 174 ASP B CA  1 
ATOM   3255 C C   . ASP B 2 174 ? -32.590 -31.342 31.637  1.00 29.77  ? 174 ASP B C   1 
ATOM   3256 O O   . ASP B 2 174 ? -33.323 -30.776 32.450  1.00 29.61  ? 174 ASP B O   1 
ATOM   3257 C CB  . ASP B 2 174 ? -32.783 -33.464 32.959  1.00 34.08  ? 174 ASP B CB  1 
ATOM   3258 C CG  . ASP B 2 174 ? -34.187 -33.725 32.383  1.00 38.39  ? 174 ASP B CG  1 
ATOM   3259 O OD1 . ASP B 2 174 ? -34.327 -33.961 31.151  1.00 43.07  ? 174 ASP B OD1 1 
ATOM   3260 O OD2 . ASP B 2 174 ? -35.162 -33.679 33.176  1.00 39.22  ? 174 ASP B OD2 1 
ATOM   3261 N N   . PRO B 2 175 ? -32.389 -30.860 30.386  1.00 29.36  ? 175 PRO B N   1 
ATOM   3262 C CA  . PRO B 2 175 ? -32.939 -29.605 29.870  1.00 29.85  ? 175 PRO B CA  1 
ATOM   3263 C C   . PRO B 2 175 ? -34.428 -29.375 30.116  1.00 28.99  ? 175 PRO B C   1 
ATOM   3264 O O   . PRO B 2 175 ? -34.868 -28.232 30.337  1.00 29.10  ? 175 PRO B O   1 
ATOM   3265 C CB  . PRO B 2 175 ? -32.607 -29.680 28.382  1.00 30.12  ? 175 PRO B CB  1 
ATOM   3266 C CG  . PRO B 2 175 ? -31.366 -30.492 28.363  1.00 28.53  ? 175 PRO B CG  1 
ATOM   3267 C CD  . PRO B 2 175 ? -31.591 -31.563 29.369  1.00 27.79  ? 175 PRO B CD  1 
ATOM   3268 N N   . LYS B 2 176 ? -35.198 -30.440 30.072  1.00 30.75  ? 176 LYS B N   1 
ATOM   3269 C CA  . LYS B 2 176 ? -36.632 -30.350 30.236  1.00 32.26  ? 176 LYS B CA  1 
ATOM   3270 C C   . LYS B 2 176 ? -37.124 -30.159 31.663  1.00 31.30  ? 176 LYS B C   1 
ATOM   3271 O O   . LYS B 2 176 ? -38.273 -29.781 31.854  1.00 32.00  ? 176 LYS B O   1 
ATOM   3272 C CB  . LYS B 2 176 ? -37.306 -31.553 29.598  1.00 32.84  ? 176 LYS B CB  1 
ATOM   3273 C CG  . LYS B 2 176 ? -37.217 -31.536 28.086  1.00 35.69  ? 176 LYS B CG  1 
ATOM   3274 C CD  . LYS B 2 176 ? -37.905 -32.754 27.489  1.00 38.82  ? 176 LYS B CD  1 
ATOM   3275 C CE  . LYS B 2 176 ? -37.791 -32.759 25.957  1.00 38.56  ? 176 LYS B CE  1 
ATOM   3276 N NZ  . LYS B 2 176 ? -38.364 -34.014 25.369  1.00 40.22  ? 176 LYS B NZ  1 
ATOM   3277 N N   . CYS B 2 177 ? -36.270 -30.400 32.661  1.00 28.92  ? 177 CYS B N   1 
ATOM   3278 C CA  . CYS B 2 177 ? -36.681 -30.335 34.081  1.00 27.13  ? 177 CYS B CA  1 
ATOM   3279 C C   . CYS B 2 177 ? -37.428 -29.030 34.492  1.00 26.90  ? 177 CYS B C   1 
ATOM   3280 O O   . CYS B 2 177 ? -38.422 -29.077 35.223  1.00 26.77  ? 177 CYS B O   1 
ATOM   3281 C CB  . CYS B 2 177 ? -35.470 -30.576 35.016  1.00 28.09  ? 177 CYS B CB  1 
ATOM   3282 S SG  . CYS B 2 177 ? -34.051 -29.460 34.841  1.00 27.99  ? 177 CYS B SG  1 
ATOM   3283 N N   . LEU B 2 178 ? -36.973 -27.878 34.003  1.00 25.90  ? 178 LEU B N   1 
ATOM   3284 C CA  . LEU B 2 178 ? -37.574 -26.604 34.370  1.00 23.71  ? 178 LEU B CA  1 
ATOM   3285 C C   . LEU B 2 178 ? -38.824 -26.258 33.562  1.00 24.75  ? 178 LEU B C   1 
ATOM   3286 O O   . LEU B 2 178 ? -39.489 -25.281 33.910  1.00 22.48  ? 178 LEU B O   1 
ATOM   3287 C CB  . LEU B 2 178 ? -36.545 -25.473 34.264  1.00 22.11  ? 178 LEU B CB  1 
ATOM   3288 C CG  . LEU B 2 178 ? -35.619 -25.223 35.462  1.00 21.87  ? 178 LEU B CG  1 
ATOM   3289 C CD1 . LEU B 2 178 ? -34.777 -26.442 35.724  1.00 20.37  ? 178 LEU B CD1 1 
ATOM   3290 C CD2 . LEU B 2 178 ? -34.732 -24.015 35.172  1.00 18.34  ? 178 LEU B CD2 1 
ATOM   3291 N N   . ASP B 2 179 ? -39.129 -27.020 32.508  1.00 26.23  ? 179 ASP B N   1 
ATOM   3292 C CA  . ASP B 2 179 ? -40.256 -26.732 31.605  1.00 24.05  ? 179 ASP B CA  1 
ATOM   3293 C C   . ASP B 2 179 ? -41.584 -26.574 32.328  1.00 23.09  ? 179 ASP B C   1 
ATOM   3294 O O   . ASP B 2 179 ? -42.229 -25.546 32.178  1.00 21.67  ? 179 ASP B O   1 
ATOM   3295 C CB  . ASP B 2 179 ? -40.388 -27.833 30.571  1.00 23.03  ? 179 ASP B CB  1 
ATOM   3296 C CG  . ASP B 2 179 ? -39.401 -27.678 29.433  1.00 21.09  ? 179 ASP B CG  1 
ATOM   3297 O OD1 . ASP B 2 179 ? -38.926 -26.535 29.210  1.00 18.26  ? 179 ASP B OD1 1 
ATOM   3298 O OD2 . ASP B 2 179 ? -39.109 -28.705 28.759  1.00 20.44  ? 179 ASP B OD2 1 
ATOM   3299 N N   . GLU B 2 180 ? -41.954 -27.542 33.151  1.00 22.31  ? 180 GLU B N   1 
ATOM   3300 C CA  . GLU B 2 180 ? -43.187 -27.443 33.916  1.00 23.18  ? 180 GLU B CA  1 
ATOM   3301 C C   . GLU B 2 180 ? -43.162 -26.373 35.012  1.00 22.38  ? 180 GLU B C   1 
ATOM   3302 O O   . GLU B 2 180 ? -44.128 -26.218 35.759  1.00 20.61  ? 180 GLU B O   1 
ATOM   3303 C CB  . GLU B 2 180 ? -43.562 -28.802 34.500  1.00 24.23  ? 180 GLU B CB  1 
ATOM   3304 C CG  . GLU B 2 180 ? -42.543 -29.397 35.451  1.00 27.54  ? 180 GLU B CG  1 
ATOM   3305 C CD  . GLU B 2 180 ? -43.000 -30.717 36.101  1.00 31.90  ? 180 GLU B CD  1 
ATOM   3306 O OE1 . GLU B 2 180 ? -43.853 -30.691 37.040  1.00 30.20  ? 180 GLU B OE1 1 
ATOM   3307 O OE2 . GLU B 2 180 ? -42.492 -31.780 35.653  1.00 34.45  ? 180 GLU B OE2 1 
ATOM   3308 N N   . PHE B 2 181 ? -42.058 -25.635 35.088  1.00 22.81  ? 181 PHE B N   1 
ATOM   3309 C CA  . PHE B 2 181 ? -41.874 -24.590 36.098  1.00 22.68  ? 181 PHE B CA  1 
ATOM   3310 C C   . PHE B 2 181 ? -41.483 -23.249 35.450  1.00 23.41  ? 181 PHE B C   1 
ATOM   3311 O O   . PHE B 2 181 ? -40.370 -22.765 35.642  1.00 25.29  ? 181 PHE B O   1 
ATOM   3312 C CB  . PHE B 2 181 ? -40.828 -24.999 37.152  1.00 17.77  ? 181 PHE B CB  1 
ATOM   3313 C CG  . PHE B 2 181 ? -41.119 -26.284 37.819  1.00 12.42  ? 181 PHE B CG  1 
ATOM   3314 C CD1 . PHE B 2 181 ? -42.223 -26.418 38.637  1.00 10.98  ? 181 PHE B CD1 1 
ATOM   3315 C CD2 . PHE B 2 181 ? -40.302 -27.369 37.608  1.00 11.91  ? 181 PHE B CD2 1 
ATOM   3316 C CE1 . PHE B 2 181 ? -42.517 -27.633 39.251  1.00 12.85  ? 181 PHE B CE1 1 
ATOM   3317 C CE2 . PHE B 2 181 ? -40.587 -28.612 38.208  1.00 11.04  ? 181 PHE B CE2 1 
ATOM   3318 C CZ  . PHE B 2 181 ? -41.696 -28.737 39.033  1.00 10.91  ? 181 PHE B CZ  1 
ATOM   3319 N N   . PRO B 2 182 ? -42.429 -22.601 34.732  1.00 23.94  ? 182 PRO B N   1 
ATOM   3320 C CA  . PRO B 2 182 ? -42.137 -21.332 34.053  1.00 20.96  ? 182 PRO B CA  1 
ATOM   3321 C C   . PRO B 2 182 ? -41.682 -20.259 35.029  1.00 17.48  ? 182 PRO B C   1 
ATOM   3322 O O   . PRO B 2 182 ? -41.173 -19.210 34.650  1.00 14.85  ? 182 PRO B O   1 
ATOM   3323 C CB  . PRO B 2 182 ? -43.497 -20.963 33.468  1.00 23.36  ? 182 PRO B CB  1 
ATOM   3324 C CG  . PRO B 2 182 ? -44.466 -21.615 34.373  1.00 24.92  ? 182 PRO B CG  1 
ATOM   3325 C CD  . PRO B 2 182 ? -43.850 -22.932 34.684  1.00 26.30  ? 182 PRO B CD  1 
ATOM   3326 N N   . ASN B 2 183 ? -41.882 -20.527 36.313  1.00 16.06  ? 183 ASN B N   1 
ATOM   3327 C CA  . ASN B 2 183 ? -41.486 -19.612 37.380  1.00 13.55  ? 183 ASN B CA  1 
ATOM   3328 C C   . ASN B 2 183 ? -39.974 -19.556 37.473  1.00 12.32  ? 183 ASN B C   1 
ATOM   3329 O O   . ASN B 2 183 ? -39.372 -18.474 37.453  1.00 9.84   ? 183 ASN B O   1 
ATOM   3330 C CB  . ASN B 2 183 ? -42.077 -20.076 38.717  1.00 9.47   ? 183 ASN B CB  1 
ATOM   3331 C CG  . ASN B 2 183 ? -42.086 -19.005 39.733  1.00 9.36   ? 183 ASN B CG  1 
ATOM   3332 O OD1 . ASN B 2 183 ? -41.998 -17.814 39.402  1.00 10.83  ? 183 ASN B OD1 1 
ATOM   3333 N ND2 . ASN B 2 183 ? -42.186 -19.390 40.993  1.00 6.27   ? 183 ASN B ND2 1 
ATOM   3334 N N   . LEU B 2 184 ? -39.378 -20.733 37.534  1.00 9.38   ? 184 LEU B N   1 
ATOM   3335 C CA  . LEU B 2 184 ? -37.934 -20.859 37.629  1.00 10.66  ? 184 LEU B CA  1 
ATOM   3336 C C   . LEU B 2 184 ? -37.254 -20.350 36.350  1.00 11.82  ? 184 LEU B C   1 
ATOM   3337 O O   . LEU B 2 184 ? -36.261 -19.612 36.410  1.00 12.66  ? 184 LEU B O   1 
ATOM   3338 C CB  . LEU B 2 184 ? -37.548 -22.314 37.936  1.00 7.79   ? 184 LEU B CB  1 
ATOM   3339 C CG  . LEU B 2 184 ? -38.020 -22.863 39.292  1.00 7.67   ? 184 LEU B CG  1 
ATOM   3340 C CD1 . LEU B 2 184 ? -37.589 -24.270 39.430  1.00 2.00   ? 184 LEU B CD1 1 
ATOM   3341 C CD2 . LEU B 2 184 ? -37.486 -22.012 40.429  1.00 5.11   ? 184 LEU B CD2 1 
ATOM   3342 N N   . LYS B 2 185 ? -37.797 -20.756 35.201  1.00 10.62  ? 185 LYS B N   1 
ATOM   3343 C CA  . LYS B 2 185 ? -37.260 -20.348 33.908  1.00 12.36  ? 185 LYS B CA  1 
ATOM   3344 C C   . LYS B 2 185 ? -37.147 -18.823 33.770  1.00 12.33  ? 185 LYS B C   1 
ATOM   3345 O O   . LYS B 2 185 ? -36.200 -18.310 33.178  1.00 12.81  ? 185 LYS B O   1 
ATOM   3346 C CB  . LYS B 2 185 ? -38.112 -20.918 32.768  1.00 15.21  ? 185 LYS B CB  1 
ATOM   3347 C CG  . LYS B 2 185 ? -38.003 -22.424 32.594  1.00 22.43  ? 185 LYS B CG  1 
ATOM   3348 C CD  . LYS B 2 185 ? -38.668 -22.901 31.321  1.00 26.56  ? 185 LYS B CD  1 
ATOM   3349 C CE  . LYS B 2 185 ? -40.158 -22.628 31.357  1.00 35.66  ? 185 LYS B CE  1 
ATOM   3350 N NZ  . LYS B 2 185 ? -40.863 -23.161 30.149  1.00 40.32  ? 185 LYS B NZ  1 
ATOM   3351 N N   . ALA B 2 186 ? -38.112 -18.096 34.338  1.00 8.58   ? 186 ALA B N   1 
ATOM   3352 C CA  . ALA B 2 186 ? -38.072 -16.652 34.291  1.00 10.13  ? 186 ALA B CA  1 
ATOM   3353 C C   . ALA B 2 186 ? -36.945 -16.142 35.146  1.00 14.05  ? 186 ALA B C   1 
ATOM   3354 O O   . ALA B 2 186 ? -36.299 -15.153 34.799  1.00 15.24  ? 186 ALA B O   1 
ATOM   3355 C CB  . ALA B 2 186 ? -39.401 -16.075 34.768  1.00 11.44  ? 186 ALA B CB  1 
ATOM   3356 N N   . PHE B 2 187 ? -36.710 -16.832 36.256  1.00 16.51  ? 187 PHE B N   1 
ATOM   3357 C CA  . PHE B 2 187 ? -35.626 -16.486 37.169  1.00 16.63  ? 187 PHE B CA  1 
ATOM   3358 C C   . PHE B 2 187 ? -34.265 -16.600 36.452  1.00 14.13  ? 187 PHE B C   1 
ATOM   3359 O O   . PHE B 2 187 ? -33.445 -15.659 36.486  1.00 14.59  ? 187 PHE B O   1 
ATOM   3360 C CB  . PHE B 2 187 ? -35.690 -17.364 38.438  1.00 18.07  ? 187 PHE B CB  1 
ATOM   3361 C CG  . PHE B 2 187 ? -34.445 -17.350 39.270  1.00 19.81  ? 187 PHE B CG  1 
ATOM   3362 C CD1 . PHE B 2 187 ? -34.163 -16.237 40.070  1.00 20.08  ? 187 PHE B CD1 1 
ATOM   3363 C CD2 . PHE B 2 187 ? -33.512 -18.419 39.207  1.00 20.31  ? 187 PHE B CD2 1 
ATOM   3364 C CE1 . PHE B 2 187 ? -32.964 -16.187 40.806  1.00 21.13  ? 187 PHE B CE1 1 
ATOM   3365 C CE2 . PHE B 2 187 ? -32.318 -18.374 39.936  1.00 19.36  ? 187 PHE B CE2 1 
ATOM   3366 C CZ  . PHE B 2 187 ? -32.049 -17.244 40.742  1.00 19.45  ? 187 PHE B CZ  1 
ATOM   3367 N N   . MET B 2 188 ? -34.040 -17.757 35.821  1.00 11.28  ? 188 MET B N   1 
ATOM   3368 C CA  . MET B 2 188 ? -32.813 -18.006 35.081  1.00 12.55  ? 188 MET B CA  1 
ATOM   3369 C C   . MET B 2 188 ? -32.482 -16.919 34.043  1.00 14.58  ? 188 MET B C   1 
ATOM   3370 O O   . MET B 2 188 ? -31.356 -16.449 33.991  1.00 14.37  ? 188 MET B O   1 
ATOM   3371 C CB  . MET B 2 188 ? -32.892 -19.350 34.385  1.00 10.13  ? 188 MET B CB  1 
ATOM   3372 C CG  . MET B 2 188 ? -33.149 -20.510 35.293  1.00 8.24   ? 188 MET B CG  1 
ATOM   3373 S SD  . MET B 2 188 ? -31.757 -20.788 36.419  1.00 11.96  ? 188 MET B SD  1 
ATOM   3374 C CE  . MET B 2 188 ? -31.004 -22.184 35.744  1.00 2.00   ? 188 MET B CE  1 
ATOM   3375 N N   . CYS B 2 189 ? -33.473 -16.519 33.239  1.00 15.20  ? 189 CYS B N   1 
ATOM   3376 C CA  . CYS B 2 189 ? -33.294 -15.492 32.220  1.00 18.22  ? 189 CYS B CA  1 
ATOM   3377 C C   . CYS B 2 189 ? -32.964 -14.181 32.886  1.00 14.89  ? 189 CYS B C   1 
ATOM   3378 O O   . CYS B 2 189 ? -32.026 -13.514 32.470  1.00 14.71  ? 189 CYS B O   1 
ATOM   3379 C CB  . CYS B 2 189 ? -34.572 -15.331 31.385  1.00 20.16  ? 189 CYS B CB  1 
ATOM   3380 S SG  . CYS B 2 189 ? -34.986 -16.738 30.335  1.00 26.53  ? 189 CYS B SG  1 
ATOM   3381 N N   . ARG B 2 190 ? -33.749 -13.813 33.903  1.00 15.04  ? 190 ARG B N   1 
ATOM   3382 C CA  . ARG B 2 190 ? -33.583 -12.547 34.610  1.00 17.24  ? 190 ARG B CA  1 
ATOM   3383 C C   . ARG B 2 190 ? -32.176 -12.442 35.200  1.00 20.10  ? 190 ARG B C   1 
ATOM   3384 O O   . ARG B 2 190 ? -31.579 -11.355 35.136  1.00 18.91  ? 190 ARG B O   1 
ATOM   3385 C CB  . ARG B 2 190 ? -34.622 -12.447 35.719  1.00 16.85  ? 190 ARG B CB  1 
ATOM   3386 C CG  . ARG B 2 190 ? -34.646 -11.124 36.461  1.00 18.19  ? 190 ARG B CG  1 
ATOM   3387 C CD  . ARG B 2 190 ? -35.948 -10.934 37.284  1.00 18.93  ? 190 ARG B CD  1 
ATOM   3388 N NE  . ARG B 2 190 ? -36.268 -12.071 38.147  1.00 19.01  ? 190 ARG B NE  1 
ATOM   3389 C CZ  . ARG B 2 190 ? -37.207 -12.972 37.878  1.00 20.48  ? 190 ARG B CZ  1 
ATOM   3390 N NH1 . ARG B 2 190 ? -37.978 -12.838 36.808  1.00 21.97  ? 190 ARG B NH1 1 
ATOM   3391 N NH2 . ARG B 2 190 ? -37.387 -14.006 38.687  1.00 20.22  ? 190 ARG B NH2 1 
ATOM   3392 N N   . PHE B 2 191 ? -31.658 -13.550 35.742  1.00 19.46  ? 191 PHE B N   1 
ATOM   3393 C CA  . PHE B 2 191 ? -30.315 -13.610 36.299  1.00 18.71  ? 191 PHE B CA  1 
ATOM   3394 C C   . PHE B 2 191 ? -29.222 -13.509 35.210  1.00 16.85  ? 191 PHE B C   1 
ATOM   3395 O O   . PHE B 2 191 ? -28.286 -12.721 35.336  1.00 17.51  ? 191 PHE B O   1 
ATOM   3396 C CB  . PHE B 2 191 ? -30.127 -14.880 37.125  1.00 21.27  ? 191 PHE B CB  1 
ATOM   3397 C CG  . PHE B 2 191 ? -28.790 -14.961 37.823  1.00 22.85  ? 191 PHE B CG  1 
ATOM   3398 C CD1 . PHE B 2 191 ? -28.588 -14.272 39.020  1.00 23.74  ? 191 PHE B CD1 1 
ATOM   3399 C CD2 . PHE B 2 191 ? -27.720 -15.687 37.263  1.00 25.33  ? 191 PHE B CD2 1 
ATOM   3400 C CE1 . PHE B 2 191 ? -27.329 -14.321 39.662  1.00 24.81  ? 191 PHE B CE1 1 
ATOM   3401 C CE2 . PHE B 2 191 ? -26.481 -15.742 37.880  1.00 26.85  ? 191 PHE B CE2 1 
ATOM   3402 C CZ  . PHE B 2 191 ? -26.278 -15.063 39.077  1.00 29.37  ? 191 PHE B CZ  1 
ATOM   3403 N N   . GLU B 2 192 ? -29.339 -14.310 34.154  1.00 14.34  ? 192 GLU B N   1 
ATOM   3404 C CA  . GLU B 2 192 ? -28.345 -14.309 33.089  1.00 12.76  ? 192 GLU B CA  1 
ATOM   3405 C C   . GLU B 2 192 ? -28.390 -13.009 32.307  1.00 14.69  ? 192 GLU B C   1 
ATOM   3406 O O   . GLU B 2 192 ? -27.488 -12.725 31.564  1.00 13.55  ? 192 GLU B O   1 
ATOM   3407 C CB  . GLU B 2 192 ? -28.560 -15.502 32.153  1.00 9.23   ? 192 GLU B CB  1 
ATOM   3408 C CG  . GLU B 2 192 ? -28.341 -16.814 32.844  1.00 10.89  ? 192 GLU B CG  1 
ATOM   3409 C CD  . GLU B 2 192 ? -28.608 -18.043 31.987  1.00 11.45  ? 192 GLU B CD  1 
ATOM   3410 O OE1 . GLU B 2 192 ? -29.796 -18.437 31.884  1.00 14.09  ? 192 GLU B OE1 1 
ATOM   3411 O OE2 . GLU B 2 192 ? -27.643 -18.599 31.399  1.00 16.81  ? 192 GLU B OE2 1 
ATOM   3412 N N   . ALA B 2 193 ? -29.453 -12.235 32.458  1.00 16.76  ? 193 ALA B N   1 
ATOM   3413 C CA  . ALA B 2 193 ? -29.606 -10.977 31.727  1.00 18.73  ? 193 ALA B CA  1 
ATOM   3414 C C   . ALA B 2 193 ? -28.819 -9.833  32.368  1.00 20.00  ? 193 ALA B C   1 
ATOM   3415 O O   . ALA B 2 193 ? -28.589 -8.805  31.747  1.00 21.60  ? 193 ALA B O   1 
ATOM   3416 C CB  . ALA B 2 193 ? -31.091 -10.598 31.644  1.00 19.84  ? 193 ALA B CB  1 
ATOM   3417 N N   . LEU B 2 194 ? -28.386 -10.030 33.602  1.00 22.75  ? 194 LEU B N   1 
ATOM   3418 C CA  . LEU B 2 194 ? -27.643 -8.996  34.293  1.00 23.08  ? 194 LEU B CA  1 
ATOM   3419 C C   . LEU B 2 194 ? -26.312 -8.788  33.580  1.00 26.46  ? 194 LEU B C   1 
ATOM   3420 O O   . LEU B 2 194 ? -25.518 -9.727  33.447  1.00 27.59  ? 194 LEU B O   1 
ATOM   3421 C CB  . LEU B 2 194 ? -27.404 -9.415  35.751  1.00 20.73  ? 194 LEU B CB  1 
ATOM   3422 C CG  . LEU B 2 194 ? -28.611 -9.696  36.670  1.00 22.58  ? 194 LEU B CG  1 
ATOM   3423 C CD1 . LEU B 2 194 ? -28.157 -10.400 37.943  1.00 21.56  ? 194 LEU B CD1 1 
ATOM   3424 C CD2 . LEU B 2 194 ? -29.336 -8.407  36.997  1.00 19.25  ? 194 LEU B CD2 1 
ATOM   3425 N N   . GLU B 2 195 ? -26.084 -7.553  33.125  1.00 27.67  ? 195 GLU B N   1 
ATOM   3426 C CA  . GLU B 2 195 ? -24.885 -7.150  32.363  1.00 29.72  ? 195 GLU B CA  1 
ATOM   3427 C C   . GLU B 2 195 ? -23.610 -7.916  32.679  1.00 28.97  ? 195 GLU B C   1 
ATOM   3428 O O   . GLU B 2 195 ? -23.034 -8.544  31.796  1.00 27.70  ? 195 GLU B O   1 
ATOM   3429 C CB  . GLU B 2 195 ? -24.613 -5.653  32.532  1.00 32.27  ? 195 GLU B CB  1 
ATOM   3430 C CG  . GLU B 2 195 ? -25.515 -4.762  31.694  1.00 39.19  ? 195 GLU B CG  1 
ATOM   3431 C CD  . GLU B 2 195 ? -27.008 -4.873  32.066  1.00 41.64  ? 195 GLU B CD  1 
ATOM   3432 O OE1 . GLU B 2 195 ? -27.421 -4.368  33.145  1.00 44.80  ? 195 GLU B OE1 1 
ATOM   3433 O OE2 . GLU B 2 195 ? -27.768 -5.481  31.274  1.00 42.51  ? 195 GLU B OE2 1 
ATOM   3434 N N   . LYS B 2 196 ? -23.216 -7.922  33.952  1.00 29.11  ? 196 LYS B N   1 
ATOM   3435 C CA  . LYS B 2 196 ? -21.973 -8.572  34.381  1.00 27.34  ? 196 LYS B CA  1 
ATOM   3436 C C   . LYS B 2 196 ? -22.016 -10.082 34.187  1.00 25.23  ? 196 LYS B C   1 
ATOM   3437 O O   . LYS B 2 196 ? -21.045 -10.688 33.736  1.00 23.82  ? 196 LYS B O   1 
ATOM   3438 C CB  . LYS B 2 196 ? -21.651 -8.274  35.848  1.00 29.68  ? 196 LYS B CB  1 
ATOM   3439 C CG  . LYS B 2 196 ? -22.143 -6.934  36.365  1.00 30.86  ? 196 LYS B CG  1 
ATOM   3440 C CD  . LYS B 2 196 ? -21.293 -5.762  35.865  1.00 31.33  ? 196 LYS B CD  1 
ATOM   3441 C CE  . LYS B 2 196 ? -21.735 -4.483  36.606  1.00 36.34  ? 196 LYS B CE  1 
ATOM   3442 N NZ  . LYS B 2 196 ? -21.174 -3.240  36.033  1.00 38.92  ? 196 LYS B NZ  1 
ATOM   3443 N N   . ILE B 2 197 ? -23.175 -10.681 34.465  1.00 23.06  ? 197 ILE B N   1 
ATOM   3444 C CA  . ILE B 2 197 ? -23.338 -12.117 34.351  1.00 20.78  ? 197 ILE B CA  1 
ATOM   3445 C C   . ILE B 2 197 ? -23.310 -12.515 32.885  1.00 19.92  ? 197 ILE B C   1 
ATOM   3446 O O   . ILE B 2 197 ? -22.592 -13.428 32.526  1.00 22.88  ? 197 ILE B O   1 
ATOM   3447 C CB  . ILE B 2 197 ? -24.655 -12.604 34.998  1.00 19.36  ? 197 ILE B CB  1 
ATOM   3448 C CG1 . ILE B 2 197 ? -24.785 -12.040 36.420  1.00 20.98  ? 197 ILE B CG1 1 
ATOM   3449 C CG2 . ILE B 2 197 ? -24.691 -14.117 35.036  1.00 18.86  ? 197 ILE B CG2 1 
ATOM   3450 C CD1 . ILE B 2 197 ? -23.685 -12.445 37.372  1.00 20.45  ? 197 ILE B CD1 1 
ATOM   3451 N N   . ALA B 2 198 ? -24.100 -11.825 32.055  1.00 17.60  ? 198 ALA B N   1 
ATOM   3452 C CA  . ALA B 2 198 ? -24.203 -12.107 30.626  1.00 16.46  ? 198 ALA B CA  1 
ATOM   3453 C C   . ALA B 2 198 ? -22.850 -12.096 29.952  1.00 17.50  ? 198 ALA B C   1 
ATOM   3454 O O   . ALA B 2 198 ? -22.532 -13.037 29.211  1.00 16.47  ? 198 ALA B O   1 
ATOM   3455 C CB  . ALA B 2 198 ? -25.101 -11.098 29.961  1.00 14.79  ? 198 ALA B CB  1 
ATOM   3456 N N   . ALA B 2 199 ? -22.063 -11.055 30.234  1.00 15.74  ? 199 ALA B N   1 
ATOM   3457 C CA  . ALA B 2 199 ? -20.721 -10.918 29.679  1.00 14.61  ? 199 ALA B CA  1 
ATOM   3458 C C   . ALA B 2 199 ? -19.835 -12.108 30.055  1.00 17.12  ? 199 ALA B C   1 
ATOM   3459 O O   . ALA B 2 199 ? -19.192 -12.734 29.207  1.00 20.02  ? 199 ALA B O   1 
ATOM   3460 C CB  . ALA B 2 199 ? -20.105 -9.631  30.138  1.00 12.88  ? 199 ALA B CB  1 
ATOM   3461 N N   . TYR B 2 200 ? -19.833 -12.433 31.342  1.00 18.19  ? 200 TYR B N   1 
ATOM   3462 C CA  . TYR B 2 200 ? -19.021 -13.531 31.844  1.00 19.37  ? 200 TYR B CA  1 
ATOM   3463 C C   . TYR B 2 200 ? -19.434 -14.875 31.248  1.00 23.29  ? 200 TYR B C   1 
ATOM   3464 O O   . TYR B 2 200 ? -18.575 -15.699 30.940  1.00 20.04  ? 200 TYR B O   1 
ATOM   3465 C CB  . TYR B 2 200 ? -19.086 -13.583 33.376  1.00 17.98  ? 200 TYR B CB  1 
ATOM   3466 C CG  . TYR B 2 200 ? -18.279 -14.692 33.996  1.00 17.39  ? 200 TYR B CG  1 
ATOM   3467 C CD1 . TYR B 2 200 ? -16.914 -14.520 34.256  1.00 17.24  ? 200 TYR B CD1 1 
ATOM   3468 C CD2 . TYR B 2 200 ? -18.866 -15.932 34.284  1.00 18.58  ? 200 TYR B CD2 1 
ATOM   3469 C CE1 . TYR B 2 200 ? -16.149 -15.566 34.802  1.00 16.36  ? 200 TYR B CE1 1 
ATOM   3470 C CE2 . TYR B 2 200 ? -18.110 -16.988 34.825  1.00 19.06  ? 200 TYR B CE2 1 
ATOM   3471 C CZ  . TYR B 2 200 ? -16.765 -16.793 35.080  1.00 17.54  ? 200 TYR B CZ  1 
ATOM   3472 O OH  . TYR B 2 200 ? -16.055 -17.842 35.596  1.00 12.53  ? 200 TYR B OH  1 
ATOM   3473 N N   . LEU B 2 201 ? -20.742 -15.096 31.106  1.00 27.07  ? 201 LEU B N   1 
ATOM   3474 C CA  . LEU B 2 201 ? -21.243 -16.355 30.567  1.00 31.27  ? 201 LEU B CA  1 
ATOM   3475 C C   . LEU B 2 201 ? -20.842 -16.568 29.102  1.00 32.75  ? 201 LEU B C   1 
ATOM   3476 O O   . LEU B 2 201 ? -20.763 -17.717 28.631  1.00 32.54  ? 201 LEU B O   1 
ATOM   3477 C CB  . LEU B 2 201 ? -22.758 -16.428 30.708  1.00 33.50  ? 201 LEU B CB  1 
ATOM   3478 C CG  . LEU B 2 201 ? -23.280 -16.432 32.138  1.00 36.45  ? 201 LEU B CG  1 
ATOM   3479 C CD1 . LEU B 2 201 ? -24.781 -16.494 32.126  1.00 36.85  ? 201 LEU B CD1 1 
ATOM   3480 C CD2 . LEU B 2 201 ? -22.708 -17.596 32.890  1.00 36.11  ? 201 LEU B CD2 1 
ATOM   3481 N N   . GLN B 2 202 ? -20.567 -15.477 28.391  1.00 34.91  ? 202 GLN B N   1 
ATOM   3482 C CA  . GLN B 2 202 ? -20.110 -15.561 27.011  1.00 37.70  ? 202 GLN B CA  1 
ATOM   3483 C C   . GLN B 2 202 ? -18.585 -15.619 26.943  1.00 40.00  ? 202 GLN B C   1 
ATOM   3484 O O   . GLN B 2 202 ? -18.017 -15.822 25.876  1.00 40.75  ? 202 GLN B O   1 
ATOM   3485 C CB  . GLN B 2 202 ? -20.638 -14.377 26.197  1.00 37.52  ? 202 GLN B CB  1 
ATOM   3486 C CG  . GLN B 2 202 ? -22.146 -14.349 26.087  1.00 39.88  ? 202 GLN B CG  1 
ATOM   3487 C CD  . GLN B 2 202 ? -22.646 -13.136 25.330  1.00 40.16  ? 202 GLN B CD  1 
ATOM   3488 O OE1 . GLN B 2 202 ? -22.751 -12.044 25.892  1.00 40.10  ? 202 GLN B OE1 1 
ATOM   3489 N NE2 . GLN B 2 202 ? -22.957 -13.325 24.051  1.00 42.14  ? 202 GLN B NE2 1 
ATOM   3490 N N   . SER B 2 203 ? -17.935 -15.434 28.090  1.00 43.11  ? 203 SER B N   1 
ATOM   3491 C CA  . SER B 2 203 ? -16.475 -15.391 28.178  1.00 43.87  ? 203 SER B CA  1 
ATOM   3492 C C   . SER B 2 203 ? -15.827 -16.692 27.718  1.00 43.72  ? 203 SER B C   1 
ATOM   3493 O O   . SER B 2 203 ? -16.364 -17.798 27.930  1.00 44.35  ? 203 SER B O   1 
ATOM   3494 C CB  . SER B 2 203 ? -16.066 -15.108 29.626  1.00 42.65  ? 203 SER B CB  1 
ATOM   3495 O OG  . SER B 2 203 ? -14.682 -14.886 29.748  1.00 44.51  ? 203 SER B OG  1 
ATOM   3496 N N   . ASP B 2 204 ? -14.661 -16.546 27.095  1.00 45.15  ? 204 ASP B N   1 
ATOM   3497 C CA  . ASP B 2 204 ? -13.883 -17.671 26.591  1.00 45.64  ? 204 ASP B CA  1 
ATOM   3498 C C   . ASP B 2 204 ? -13.541 -18.729 27.675  1.00 46.12  ? 204 ASP B C   1 
ATOM   3499 O O   . ASP B 2 204 ? -13.957 -19.898 27.554  1.00 45.56  ? 204 ASP B O   1 
ATOM   3500 C CB  . ASP B 2 204 ? -12.606 -17.185 25.871  1.00 45.93  ? 204 ASP B CB  1 
ATOM   3501 C CG  . ASP B 2 204 ? -11.708 -16.327 26.770  1.00 50.12  ? 204 ASP B CG  1 
ATOM   3502 O OD1 . ASP B 2 204 ? -12.103 -15.181 27.089  1.00 54.36  ? 204 ASP B OD1 1 
ATOM   3503 O OD2 . ASP B 2 204 ? -10.618 -16.811 27.164  1.00 50.69  ? 204 ASP B OD2 1 
ATOM   3504 N N   . GLN B 2 205 ? -12.802 -18.320 28.720  1.00 45.49  ? 205 GLN B N   1 
ATOM   3505 C CA  . GLN B 2 205 ? -12.366 -19.254 29.761  1.00 46.57  ? 205 GLN B CA  1 
ATOM   3506 C C   . GLN B 2 205 ? -13.553 -20.003 30.380  1.00 45.55  ? 205 GLN B C   1 
ATOM   3507 O O   . GLN B 2 205 ? -13.442 -21.214 30.673  1.00 47.46  ? 205 GLN B O   1 
ATOM   3508 C CB  . GLN B 2 205 ? -11.568 -18.545 30.858  1.00 47.91  ? 205 GLN B CB  1 
ATOM   3509 C CG  . GLN B 2 205 ? -12.380 -17.625 31.758  1.00 50.63  ? 205 GLN B CG  1 
ATOM   3510 C CD  . GLN B 2 205 ? -12.433 -16.203 31.210  1.00 50.89  ? 205 GLN B CD  1 
ATOM   3511 O OE1 . GLN B 2 205 ? -12.288 -15.976 29.993  1.00 49.62  ? 205 GLN B OE1 1 
ATOM   3512 N NE2 . GLN B 2 205 ? -12.640 -15.236 32.104  1.00 51.89  ? 205 GLN B NE2 1 
ATOM   3513 N N   . PHE B 2 206 ? -14.686 -19.309 30.533  1.00 43.81  ? 206 PHE B N   1 
ATOM   3514 C CA  . PHE B 2 206 ? -15.876 -19.916 31.102  1.00 43.24  ? 206 PHE B CA  1 
ATOM   3515 C C   . PHE B 2 206 ? -16.296 -21.156 30.310  1.00 43.85  ? 206 PHE B C   1 
ATOM   3516 O O   . PHE B 2 206 ? -16.687 -22.178 30.875  1.00 44.71  ? 206 PHE B O   1 
ATOM   3517 C CB  . PHE B 2 206 ? -17.024 -18.916 31.199  1.00 40.92  ? 206 PHE B CB  1 
ATOM   3518 C CG  . PHE B 2 206 ? -18.302 -19.518 31.666  1.00 36.63  ? 206 PHE B CG  1 
ATOM   3519 C CD1 . PHE B 2 206 ? -18.361 -20.146 32.919  1.00 36.24  ? 206 PHE B CD1 1 
ATOM   3520 C CD2 . PHE B 2 206 ? -19.422 -19.536 30.837  1.00 34.18  ? 206 PHE B CD2 1 
ATOM   3521 C CE1 . PHE B 2 206 ? -19.543 -20.773 33.347  1.00 35.52  ? 206 PHE B CE1 1 
ATOM   3522 C CE2 . PHE B 2 206 ? -20.614 -20.146 31.246  1.00 33.75  ? 206 PHE B CE2 1 
ATOM   3523 C CZ  . PHE B 2 206 ? -20.682 -20.773 32.500  1.00 36.28  ? 206 PHE B CZ  1 
ATOM   3524 N N   . CYS B 2 207 ? -16.211 -21.049 28.984  1.00 44.98  ? 207 CYS B N   1 
ATOM   3525 C CA  . CYS B 2 207 ? -16.603 -22.129 28.100  1.00 46.58  ? 207 CYS B CA  1 
ATOM   3526 C C   . CYS B 2 207 ? -15.666 -23.339 28.182  1.00 46.79  ? 207 CYS B C   1 
ATOM   3527 O O   . CYS B 2 207 ? -16.084 -24.478 27.932  1.00 48.26  ? 207 CYS B O   1 
ATOM   3528 C CB  . CYS B 2 207 ? -16.697 -21.614 26.660  1.00 46.63  ? 207 CYS B CB  1 
ATOM   3529 S SG  . CYS B 2 207 ? -17.830 -20.181 26.471  1.00 51.92  ? 207 CYS B SG  1 
ATOM   3530 N N   . LYS B 2 208 ? -14.406 -23.099 28.527  1.00 46.40  ? 208 LYS B N   1 
ATOM   3531 C CA  . LYS B 2 208 ? -13.423 -24.179 28.612  1.00 45.79  ? 208 LYS B CA  1 
ATOM   3532 C C   . LYS B 2 208 ? -13.333 -24.872 29.978  1.00 45.14  ? 208 LYS B C   1 
ATOM   3533 O O   . LYS B 2 208 ? -12.519 -25.783 30.153  1.00 46.64  ? 208 LYS B O   1 
ATOM   3534 C CB  . LYS B 2 208 ? -12.036 -23.673 28.197  1.00 46.81  ? 208 LYS B CB  1 
ATOM   3535 C CG  . LYS B 2 208 ? -11.691 -23.973 26.727  1.00 48.69  ? 208 LYS B CG  1 
ATOM   3536 C CD  . LYS B 2 208 ? -12.675 -23.273 25.755  1.00 48.27  ? 208 LYS B CD  1 
ATOM   3537 C CE  . LYS B 2 208 ? -12.469 -21.765 25.758  1.00 50.49  ? 208 LYS B CE  1 
ATOM   3538 N NZ  . LYS B 2 208 ? -13.543 -21.066 25.000  1.00 50.33  ? 208 LYS B NZ  1 
ATOM   3539 N N   . MET B 2 209 ? -14.163 -24.445 30.932  1.00 43.84  ? 209 MET B N   1 
ATOM   3540 C CA  . MET B 2 209 ? -14.141 -25.028 32.276  1.00 42.49  ? 209 MET B CA  1 
ATOM   3541 C C   . MET B 2 209 ? -15.115 -26.199 32.433  1.00 41.22  ? 209 MET B C   1 
ATOM   3542 O O   . MET B 2 209 ? -16.310 -26.071 32.117  1.00 41.92  ? 209 MET B O   1 
ATOM   3543 C CB  . MET B 2 209 ? -14.445 -23.964 33.331  1.00 44.90  ? 209 MET B CB  1 
ATOM   3544 C CG  . MET B 2 209 ? -13.236 -23.187 33.756  1.00 46.90  ? 209 MET B CG  1 
ATOM   3545 S SD  . MET B 2 209 ? -13.572 -22.396 35.272  1.00 49.92  ? 209 MET B SD  1 
ATOM   3546 C CE  . MET B 2 209 ? -14.669 -21.072 34.739  1.00 49.33  ? 209 MET B CE  1 
ATOM   3547 N N   . PRO B 2 210 ? -14.604 -27.376 32.873  1.00 40.26  ? 210 PRO B N   1 
ATOM   3548 C CA  . PRO B 2 210 ? -15.452 -28.526 33.184  1.00 40.88  ? 210 PRO B CA  1 
ATOM   3549 C C   . PRO B 2 210 ? -16.366 -28.259 34.345  1.00 40.49  ? 210 PRO B C   1 
ATOM   3550 O O   . PRO B 2 210 ? -16.020 -27.481 35.243  1.00 40.09  ? 210 PRO B O   1 
ATOM   3551 C CB  . PRO B 2 210 ? -14.440 -29.623 33.503  1.00 40.17  ? 210 PRO B CB  1 
ATOM   3552 C CG  . PRO B 2 210 ? -13.166 -29.126 32.870  1.00 39.44  ? 210 PRO B CG  1 
ATOM   3553 C CD  . PRO B 2 210 ? -13.183 -27.677 33.075  1.00 39.22  ? 210 PRO B CD  1 
ATOM   3554 N N   . ILE B 2 211 ? -17.532 -28.914 34.349  1.00 39.92  ? 211 ILE B N   1 
ATOM   3555 C CA  . ILE B 2 211 ? -18.503 -28.715 35.425  1.00 39.90  ? 211 ILE B CA  1 
ATOM   3556 C C   . ILE B 2 211 ? -17.961 -29.304 36.735  1.00 39.84  ? 211 ILE B C   1 
ATOM   3557 O O   . ILE B 2 211 ? -18.010 -28.656 37.798  1.00 37.44  ? 211 ILE B O   1 
ATOM   3558 C CB  . ILE B 2 211 ? -19.880 -29.360 35.086  1.00 39.33  ? 211 ILE B CB  1 
ATOM   3559 C CG1 . ILE B 2 211 ? -20.391 -28.808 33.743  1.00 39.44  ? 211 ILE B CG1 1 
ATOM   3560 C CG2 . ILE B 2 211 ? -20.889 -29.087 36.225  1.00 34.51  ? 211 ILE B CG2 1 
ATOM   3561 C CD1 . ILE B 2 211 ? -21.631 -29.539 33.225  1.00 39.33  ? 211 ILE B CD1 1 
ATOM   3562 N N   . ASN B 2 212 ? -17.428 -30.529 36.636  1.00 39.22  ? 212 ASN B N   1 
ATOM   3563 C CA  . ASN B 2 212 ? -16.904 -31.233 37.787  1.00 39.11  ? 212 ASN B CA  1 
ATOM   3564 C C   . ASN B 2 212 ? -15.464 -31.625 37.502  1.00 39.43  ? 212 ASN B C   1 
ATOM   3565 O O   . ASN B 2 212 ? -15.030 -31.564 36.342  1.00 40.25  ? 212 ASN B O   1 
ATOM   3566 C CB  . ASN B 2 212 ? -17.737 -32.467 38.078  1.00 38.90  ? 212 ASN B CB  1 
ATOM   3567 C CG  . ASN B 2 212 ? -19.169 -32.128 38.445  1.00 40.59  ? 212 ASN B CG  1 
ATOM   3568 O OD1 . ASN B 2 212 ? -19.428 -31.200 39.196  1.00 39.51  ? 212 ASN B OD1 1 
ATOM   3569 N ND2 . ASN B 2 212 ? -20.095 -32.892 37.906  1.00 41.65  ? 212 ASN B ND2 1 
ATOM   3570 N N   . ASN B 2 213 ? -14.733 -32.005 38.549  1.00 39.46  ? 213 ASN B N   1 
ATOM   3571 C CA  . ASN B 2 213 ? -13.319 -32.368 38.421  1.00 39.94  ? 213 ASN B CA  1 
ATOM   3572 C C   . ASN B 2 213 ? -13.157 -33.673 37.640  1.00 39.91  ? 213 ASN B C   1 
ATOM   3573 O O   . ASN B 2 213 ? -14.108 -34.438 37.502  1.00 39.42  ? 213 ASN B O   1 
ATOM   3574 C CB  . ASN B 2 213 ? -12.676 -32.517 39.804  1.00 41.55  ? 213 ASN B CB  1 
ATOM   3575 C CG  . ASN B 2 213 ? -11.189 -32.124 39.812  1.00 42.07  ? 213 ASN B CG  1 
ATOM   3576 O OD1 . ASN B 2 213 ? -10.487 -32.254 38.819  1.00 39.31  ? 213 ASN B OD1 1 
ATOM   3577 N ND2 . ASN B 2 213 ? -10.725 -31.642 40.945  1.00 44.04  ? 213 ASN B ND2 1 
ATOM   3578 N N   . LYS B 2 214 ? -11.956 -33.896 37.115  1.00 41.55  ? 214 LYS B N   1 
ATOM   3579 C CA  . LYS B 2 214 ? -11.631 -35.046 36.265  1.00 43.39  ? 214 LYS B CA  1 
ATOM   3580 C C   . LYS B 2 214 ? -12.120 -36.414 36.757  1.00 45.09  ? 214 LYS B C   1 
ATOM   3581 O O   . LYS B 2 214 ? -12.554 -37.233 35.950  1.00 46.39  ? 214 LYS B O   1 
ATOM   3582 C CB  . LYS B 2 214 ? -10.122 -35.094 36.037  1.00 42.47  ? 214 LYS B CB  1 
ATOM   3583 C CG  . LYS B 2 214 ? -9.580  -33.860 35.353  1.00 41.40  ? 214 LYS B CG  1 
ATOM   3584 C CD  . LYS B 2 214 ? -8.111  -33.981 35.062  1.00 42.24  ? 214 LYS B CD  1 
ATOM   3585 C CE  . LYS B 2 214 ? -7.597  -32.788 34.291  1.00 41.22  ? 214 LYS B CE  1 
ATOM   3586 N NZ  . LYS B 2 214 ? -6.171  -32.963 33.878  1.00 44.44  ? 214 LYS B NZ  1 
ATOM   3587 N N   . MET B 2 215 ? -12.095 -36.655 38.067  1.00 45.32  ? 215 MET B N   1 
ATOM   3588 C CA  . MET B 2 215 ? -12.521 -37.945 38.627  1.00 46.18  ? 215 MET B CA  1 
ATOM   3589 C C   . MET B 2 215 ? -14.052 -38.098 38.718  1.00 46.65  ? 215 MET B C   1 
ATOM   3590 O O   . MET B 2 215 ? -14.551 -39.142 39.156  1.00 47.34  ? 215 MET B O   1 
ATOM   3591 C CB  . MET B 2 215 ? -11.887 -38.164 40.017  1.00 47.48  ? 215 MET B CB  1 
ATOM   3592 C CG  . MET B 2 215 ? -12.364 -37.233 41.131  1.00 48.88  ? 215 MET B CG  1 
ATOM   3593 S SD  . MET B 2 215 ? -11.905 -35.511 40.870  1.00 53.40  ? 215 MET B SD  1 
ATOM   3594 C CE  . MET B 2 215 ? -10.123 -35.582 41.100  1.00 52.40  ? 215 MET B CE  1 
ATOM   3595 N N   . ALA B 2 216 ? -14.789 -37.077 38.299  1.00 46.34  ? 216 ALA B N   1 
ATOM   3596 C CA  . ALA B 2 216 ? -16.241 -37.131 38.363  1.00 46.38  ? 216 ALA B CA  1 
ATOM   3597 C C   . ALA B 2 216 ? -16.737 -37.982 37.198  1.00 45.72  ? 216 ALA B C   1 
ATOM   3598 O O   . ALA B 2 216 ? -16.182 -37.920 36.081  1.00 45.64  ? 216 ALA B O   1 
ATOM   3599 C CB  . ALA B 2 216 ? -16.828 -35.740 38.272  1.00 46.89  ? 216 ALA B CB  1 
ATOM   3600 N N   . GLN B 2 217 ? -17.804 -38.741 37.447  1.00 44.85  ? 217 GLN B N   1 
ATOM   3601 C CA  . GLN B 2 217 ? -18.435 -39.599 36.441  1.00 42.34  ? 217 GLN B CA  1 
ATOM   3602 C C   . GLN B 2 217 ? -19.435 -38.799 35.566  1.00 41.72  ? 217 GLN B C   1 
ATOM   3603 O O   . GLN B 2 217 ? -20.256 -39.384 34.860  1.00 41.91  ? 217 GLN B O   1 
ATOM   3604 C CB  . GLN B 2 217 ? -19.169 -40.761 37.135  1.00 42.41  ? 217 GLN B CB  1 
ATOM   3605 C CG  . GLN B 2 217 ? -19.063 -42.093 36.418  1.00 42.62  ? 217 GLN B CG  1 
ATOM   3606 C CD  . GLN B 2 217 ? -17.659 -42.624 36.406  1.00 41.37  ? 217 GLN B CD  1 
ATOM   3607 O OE1 . GLN B 2 217 ? -17.095 -42.846 35.347  1.00 41.57  ? 217 GLN B OE1 1 
ATOM   3608 N NE2 . GLN B 2 217 ? -17.086 -42.826 37.583  1.00 41.92  ? 217 GLN B NE2 1 
ATOM   3609 N N   . TRP B 2 218 ? -19.334 -37.473 35.609  1.00 39.60  ? 218 TRP B N   1 
ATOM   3610 C CA  . TRP B 2 218 ? -20.195 -36.609 34.815  1.00 38.81  ? 218 TRP B CA  1 
ATOM   3611 C C   . TRP B 2 218 ? -19.643 -35.199 34.892  1.00 39.32  ? 218 TRP B C   1 
ATOM   3612 O O   . TRP B 2 218 ? -19.161 -34.773 35.936  1.00 41.57  ? 218 TRP B O   1 
ATOM   3613 C CB  . TRP B 2 218 ? -21.644 -36.657 35.328  1.00 37.46  ? 218 TRP B CB  1 
ATOM   3614 C CG  . TRP B 2 218 ? -22.583 -35.809 34.513  1.00 36.56  ? 218 TRP B CG  1 
ATOM   3615 C CD1 . TRP B 2 218 ? -23.175 -36.139 33.316  1.00 36.18  ? 218 TRP B CD1 1 
ATOM   3616 C CD2 . TRP B 2 218 ? -22.944 -34.444 34.786  1.00 33.86  ? 218 TRP B CD2 1 
ATOM   3617 N NE1 . TRP B 2 218 ? -23.902 -35.066 32.844  1.00 35.63  ? 218 TRP B NE1 1 
ATOM   3618 C CE2 . TRP B 2 218 ? -23.773 -34.020 33.713  1.00 34.00  ? 218 TRP B CE2 1 
ATOM   3619 C CE3 . TRP B 2 218 ? -22.665 -33.554 35.831  1.00 34.00  ? 218 TRP B CE3 1 
ATOM   3620 C CZ2 . TRP B 2 218 ? -24.322 -32.709 33.661  1.00 32.54  ? 218 TRP B CZ2 1 
ATOM   3621 C CZ3 . TRP B 2 218 ? -23.227 -32.250 35.788  1.00 34.80  ? 218 TRP B CZ3 1 
ATOM   3622 C CH2 . TRP B 2 218 ? -24.046 -31.850 34.704  1.00 29.99  ? 218 TRP B CH2 1 
ATOM   3623 N N   . GLY B 2 219 ? -19.773 -34.463 33.789  1.00 38.87  ? 219 GLY B N   1 
ATOM   3624 C CA  . GLY B 2 219 ? -19.375 -33.064 33.769  1.00 39.73  ? 219 GLY B CA  1 
ATOM   3625 C C   . GLY B 2 219 ? -17.877 -32.800 33.910  1.00 39.89  ? 219 GLY B C   1 
ATOM   3626 O O   . GLY B 2 219 ? -17.443 -31.635 34.023  1.00 40.60  ? 219 GLY B O   1 
ATOM   3627 N N   . ASN B 2 220 ? -17.078 -33.875 33.901  1.00 39.75  ? 220 ASN B N   1 
ATOM   3628 C CA  . ASN B 2 220 ? -15.631 -33.779 34.066  1.00 41.55  ? 220 ASN B CA  1 
ATOM   3629 C C   . ASN B 2 220 ? -14.930 -33.132 32.858  1.00 41.80  ? 220 ASN B C   1 
ATOM   3630 O O   . ASN B 2 220 ? -13.738 -32.800 32.928  1.00 42.23  ? 220 ASN B O   1 
ATOM   3631 C CB  . ASN B 2 220 ? -15.021 -35.167 34.348  1.00 43.41  ? 220 ASN B CB  1 
ATOM   3632 C CG  . ASN B 2 220 ? -15.377 -36.190 33.263  1.00 45.33  ? 220 ASN B CG  1 
ATOM   3633 O OD1 . ASN B 2 220 ? -16.277 -35.983 32.442  1.00 46.93  ? 220 ASN B OD1 1 
ATOM   3634 N ND2 . ASN B 2 220 ? -14.660 -37.308 33.278  1.00 44.54  ? 220 ASN B ND2 1 
ATOM   3635 N N   . LYS B 2 221 ? -15.669 -32.949 31.767  1.00 43.61  ? 221 LYS B N   1 
ATOM   3636 C CA  . LYS B 2 221 ? -15.132 -32.350 30.547  1.00 43.68  ? 221 LYS B CA  1 
ATOM   3637 C C   . LYS B 2 221 ? -15.846 -31.033 30.255  1.00 45.85  ? 221 LYS B C   1 
ATOM   3638 O O   . LYS B 2 221 ? -17.005 -30.842 30.666  1.00 48.31  ? 221 LYS B O   1 
ATOM   3639 C CB  . LYS B 2 221 ? -15.297 -33.312 29.366  1.00 43.49  ? 221 LYS B CB  1 
ATOM   3640 C CG  . LYS B 2 221 ? -14.517 -34.619 29.508  1.00 44.07  ? 221 LYS B CG  1 
ATOM   3641 C CD  . LYS B 2 221 ? -14.662 -35.462 28.259  1.00 42.80  ? 221 LYS B CD  1 
ATOM   3642 C CE  . LYS B 2 221 ? -13.942 -36.793 28.413  1.00 44.68  ? 221 LYS B CE  1 
ATOM   3643 N NZ  . LYS B 2 221 ? -14.542 -37.644 29.478  1.00 45.50  ? 221 LYS B NZ  1 
ATOM   3644 N N   . PRO B 2 222 ? -15.142 -30.088 29.567  1.00 46.27  ? 222 PRO B N   1 
ATOM   3645 C CA  . PRO B 2 222 ? -15.726 -28.808 29.173  1.00 47.46  ? 222 PRO B CA  1 
ATOM   3646 C C   . PRO B 2 222 ? -16.912 -28.975 28.257  1.00 48.15  ? 222 PRO B C   1 
ATOM   3647 O O   . PRO B 2 222 ? -16.901 -29.800 27.342  1.00 46.98  ? 222 PRO B O   1 
ATOM   3648 C CB  . PRO B 2 222 ? -14.564 -28.092 28.459  1.00 47.58  ? 222 PRO B CB  1 
ATOM   3649 C CG  . PRO B 2 222 ? -13.335 -28.747 29.014  1.00 45.75  ? 222 PRO B CG  1 
ATOM   3650 C CD  . PRO B 2 222 ? -13.729 -30.193 29.174  1.00 46.33  ? 222 PRO B CD  1 
ATOM   3651 N N   . VAL B 2 223 ? -17.956 -28.174 28.509  1.00 48.87  ? 223 VAL B N   1 
ATOM   3652 C CA  . VAL B 2 223 ? -19.188 -28.253 27.716  1.00 50.87  ? 223 VAL B CA  1 
ATOM   3653 C C   . VAL B 2 223 ? -19.593 -26.867 27.241  1.00 50.95  ? 223 VAL B C   1 
ATOM   3654 O O   . VAL B 2 223 ? -18.987 -25.851 27.622  1.00 52.22  ? 223 VAL B O   1 
ATOM   3655 C CB  . VAL B 2 223 ? -20.382 -28.887 28.518  1.00 50.25  ? 223 VAL B CB  1 
ATOM   3656 C CG1 . VAL B 2 223 ? -20.077 -30.352 28.831  1.00 49.92  ? 223 VAL B CG1 1 
ATOM   3657 C CG2 . VAL B 2 223 ? -20.649 -28.099 29.797  1.00 50.70  ? 223 VAL B CG2 1 
ATOM   3658 N N   . CYS B 2 224 ? -20.651 -26.828 26.417  1.00 51.13  ? 224 CYS B N   1 
ATOM   3659 C CA  . CYS B 2 224 ? -21.198 -25.580 25.919  1.00 51.11  ? 224 CYS B CA  1 
ATOM   3660 C C   . CYS B 2 224 ? -22.735 -25.652 25.995  1.00 53.20  ? 224 CYS B C   1 
ATOM   3661 O O   . CYS B 2 224 ? -23.271 -26.796 26.083  1.00 56.15  ? 224 CYS B O   1 
ATOM   3662 C CB  . CYS B 2 224 ? -20.710 -25.314 24.480  1.00 49.67  ? 224 CYS B CB  1 
ATOM   3663 S SG  . CYS B 2 224 ? -20.784 -26.756 23.327  1.00 49.79  ? 224 CYS B SG  1 
ATOM   3664 O OXT . CYS B 2 224 ? -23.381 -24.573 25.952  1.00 54.53  ? 224 CYS B OXT 1 
ATOM   3665 N N   . PRO C 1 1   ? 22.124  -1.159  92.502  1.00 32.04  ? 1   PRO C N   1 
ATOM   3666 C CA  . PRO C 1 1   ? 20.764  -0.869  92.938  1.00 29.31  ? 1   PRO C CA  1 
ATOM   3667 C C   . PRO C 1 1   ? 20.178  -2.000  93.774  1.00 27.24  ? 1   PRO C C   1 
ATOM   3668 O O   . PRO C 1 1   ? 20.936  -2.911  94.168  1.00 26.82  ? 1   PRO C O   1 
ATOM   3669 C CB  . PRO C 1 1   ? 20.038  -0.741  91.618  1.00 29.55  ? 1   PRO C CB  1 
ATOM   3670 C CG  . PRO C 1 1   ? 20.703  -1.791  90.786  1.00 31.81  ? 1   PRO C CG  1 
ATOM   3671 C CD  . PRO C 1 1   ? 22.174  -1.689  91.132  1.00 31.42  ? 1   PRO C CD  1 
ATOM   3672 N N   . MET C 1 2   ? 18.862  -1.973  94.005  1.00 25.52  ? 2   MET C N   1 
ATOM   3673 C CA  . MET C 1 2   ? 18.164  -3.007  94.782  1.00 22.15  ? 2   MET C CA  1 
ATOM   3674 C C   . MET C 1 2   ? 18.309  -4.352  94.103  1.00 22.02  ? 2   MET C C   1 
ATOM   3675 O O   . MET C 1 2   ? 18.564  -4.419  92.882  1.00 24.83  ? 2   MET C O   1 
ATOM   3676 C CB  . MET C 1 2   ? 16.687  -2.687  94.902  1.00 22.48  ? 2   MET C CB  1 
ATOM   3677 C CG  . MET C 1 2   ? 16.370  -1.638  95.936  1.00 27.09  ? 2   MET C CG  1 
ATOM   3678 S SD  . MET C 1 2   ? 14.588  -1.437  96.160  1.00 25.65  ? 2   MET C SD  1 
ATOM   3679 C CE  . MET C 1 2   ? 14.292  0.116   95.327  1.00 25.27  ? 2   MET C CE  1 
ATOM   3680 N N   . THR C 1 3   ? 18.188  -5.427  94.896  1.00 20.16  ? 3   THR C N   1 
ATOM   3681 C CA  . THR C 1 3   ? 18.260  -6.768  94.336  1.00 20.81  ? 3   THR C CA  1 
ATOM   3682 C C   . THR C 1 3   ? 17.049  -7.602  94.768  1.00 20.88  ? 3   THR C C   1 
ATOM   3683 O O   . THR C 1 3   ? 16.828  -7.773  95.975  1.00 21.94  ? 3   THR C O   1 
ATOM   3684 C CB  . THR C 1 3   ? 19.564  -7.452  94.765  1.00 19.12  ? 3   THR C CB  1 
ATOM   3685 O OG1 . THR C 1 3   ? 20.666  -6.571  94.497  1.00 19.99  ? 3   THR C OG1 1 
ATOM   3686 C CG2 . THR C 1 3   ? 19.755  -8.761  94.028  1.00 17.48  ? 3   THR C CG2 1 
ATOM   3687 N N   . LEU C 1 4   ? 16.306  -8.127  93.792  1.00 19.57  ? 4   LEU C N   1 
ATOM   3688 C CA  . LEU C 1 4   ? 15.144  -8.960  94.057  1.00 19.03  ? 4   LEU C CA  1 
ATOM   3689 C C   . LEU C 1 4   ? 15.520  -10.372 93.684  1.00 18.81  ? 4   LEU C C   1 
ATOM   3690 O O   . LEU C 1 4   ? 15.909  -10.609 92.558  1.00 20.58  ? 4   LEU C O   1 
ATOM   3691 C CB  . LEU C 1 4   ? 13.943  -8.480  93.231  1.00 19.18  ? 4   LEU C CB  1 
ATOM   3692 C CG  . LEU C 1 4   ? 12.646  -9.294  93.361  1.00 18.50  ? 4   LEU C CG  1 
ATOM   3693 C CD1 . LEU C 1 4   ? 12.060  -9.121  94.757  1.00 18.32  ? 4   LEU C CD1 1 
ATOM   3694 C CD2 . LEU C 1 4   ? 11.649  -8.867  92.286  1.00 15.46  ? 4   LEU C CD2 1 
ATOM   3695 N N   . GLY C 1 5   ? 15.393  -11.303 94.632  1.00 16.88  ? 5   GLY C N   1 
ATOM   3696 C CA  . GLY C 1 5   ? 15.755  -12.681 94.363  1.00 18.52  ? 5   GLY C CA  1 
ATOM   3697 C C   . GLY C 1 5   ? 14.578  -13.614 94.555  1.00 22.52  ? 5   GLY C C   1 
ATOM   3698 O O   . GLY C 1 5   ? 13.946  -13.618 95.602  1.00 24.59  ? 5   GLY C O   1 
ATOM   3699 N N   . TYR C 1 6   ? 14.300  -14.403 93.511  1.00 22.14  ? 6   TYR C N   1 
ATOM   3700 C CA  . TYR C 1 6   ? 13.162  -15.328 93.504  1.00 21.48  ? 6   TYR C CA  1 
ATOM   3701 C C   . TYR C 1 6   ? 13.372  -16.339 92.387  1.00 22.74  ? 6   TYR C C   1 
ATOM   3702 O O   . TYR C 1 6   ? 14.272  -16.156 91.581  1.00 27.14  ? 6   TYR C O   1 
ATOM   3703 C CB  . TYR C 1 6   ? 11.847  -14.577 93.283  1.00 20.62  ? 6   TYR C CB  1 
ATOM   3704 C CG  . TYR C 1 6   ? 10.591  -15.405 93.513  1.00 22.12  ? 6   TYR C CG  1 
ATOM   3705 C CD1 . TYR C 1 6   ? 10.336  -16.012 94.767  1.00 20.00  ? 6   TYR C CD1 1 
ATOM   3706 C CD2 . TYR C 1 6   ? 9.663   -15.595 92.474  1.00 21.40  ? 6   TYR C CD2 1 
ATOM   3707 C CE1 . TYR C 1 6   ? 9.183   -16.787 94.979  1.00 20.45  ? 6   TYR C CE1 1 
ATOM   3708 C CE2 . TYR C 1 6   ? 8.506   -16.365 92.674  1.00 19.19  ? 6   TYR C CE2 1 
ATOM   3709 C CZ  . TYR C 1 6   ? 8.283   -16.957 93.928  1.00 18.74  ? 6   TYR C CZ  1 
ATOM   3710 O OH  . TYR C 1 6   ? 7.152   -17.706 94.128  1.00 19.66  ? 6   TYR C OH  1 
ATOM   3711 N N   . TRP C 1 7   ? 12.554  -17.376 92.339  1.00 22.29  ? 7   TRP C N   1 
ATOM   3712 C CA  . TRP C 1 7   ? 12.646  -18.348 91.266  1.00 21.16  ? 7   TRP C CA  1 
ATOM   3713 C C   . TRP C 1 7   ? 12.343  -17.647 89.937  1.00 21.85  ? 7   TRP C C   1 
ATOM   3714 O O   . TRP C 1 7   ? 11.803  -16.538 89.916  1.00 19.60  ? 7   TRP C O   1 
ATOM   3715 C CB  . TRP C 1 7   ? 11.653  -19.465 91.513  1.00 18.58  ? 7   TRP C CB  1 
ATOM   3716 C CG  . TRP C 1 7   ? 11.868  -20.209 92.772  1.00 21.91  ? 7   TRP C CG  1 
ATOM   3717 C CD1 . TRP C 1 7   ? 11.080  -20.147 93.893  1.00 22.85  ? 7   TRP C CD1 1 
ATOM   3718 C CD2 . TRP C 1 7   ? 12.890  -21.195 93.038  1.00 23.86  ? 7   TRP C CD2 1 
ATOM   3719 N NE1 . TRP C 1 7   ? 11.560  -21.009 94.859  1.00 21.74  ? 7   TRP C NE1 1 
ATOM   3720 C CE2 . TRP C 1 7   ? 12.648  -21.675 94.362  1.00 23.58  ? 7   TRP C CE2 1 
ATOM   3721 C CE3 . TRP C 1 7   ? 13.988  -21.691 92.310  1.00 22.99  ? 7   TRP C CE3 1 
ATOM   3722 C CZ2 . TRP C 1 7   ? 13.486  -22.641 94.971  1.00 24.59  ? 7   TRP C CZ2 1 
ATOM   3723 C CZ3 . TRP C 1 7   ? 14.819  -22.650 92.910  1.00 20.82  ? 7   TRP C CZ3 1 
ATOM   3724 C CH2 . TRP C 1 7   ? 14.565  -23.107 94.235  1.00 24.72  ? 7   TRP C CH2 1 
ATOM   3725 N N   . ASN C 1 8   ? 12.674  -18.304 88.828  1.00 25.02  ? 8   ASN C N   1 
ATOM   3726 C CA  . ASN C 1 8   ? 12.348  -17.794 87.505  1.00 28.04  ? 8   ASN C CA  1 
ATOM   3727 C C   . ASN C 1 8   ? 10.876  -18.164 87.233  1.00 27.03  ? 8   ASN C C   1 
ATOM   3728 O O   . ASN C 1 8   ? 10.538  -18.810 86.243  1.00 28.38  ? 8   ASN C O   1 
ATOM   3729 C CB  . ASN C 1 8   ? 13.270  -18.426 86.451  1.00 30.27  ? 8   ASN C CB  1 
ATOM   3730 C CG  . ASN C 1 8   ? 13.031  -17.869 85.030  1.00 35.15  ? 8   ASN C CG  1 
ATOM   3731 O OD1 . ASN C 1 8   ? 13.465  -16.759 84.709  1.00 35.82  ? 8   ASN C OD1 1 
ATOM   3732 N ND2 . ASN C 1 8   ? 12.297  -18.622 84.206  1.00 36.43  ? 8   ASN C ND2 1 
ATOM   3733 N N   . ILE C 1 9   ? 9.996   -17.687 88.103  1.00 27.13  ? 9   ILE C N   1 
ATOM   3734 C CA  . ILE C 1 9   ? 8.577   -18.014 88.054  1.00 25.05  ? 9   ILE C CA  1 
ATOM   3735 C C   . ILE C 1 9   ? 7.852   -16.718 88.383  1.00 23.22  ? 9   ILE C C   1 
ATOM   3736 O O   . ILE C 1 9   ? 8.389   -15.863 89.084  1.00 21.52  ? 9   ILE C O   1 
ATOM   3737 C CB  . ILE C 1 9   ? 8.206   -19.107 89.093  1.00 26.54  ? 9   ILE C CB  1 
ATOM   3738 C CG1 . ILE C 1 9   ? 8.947   -20.415 88.771  1.00 28.57  ? 9   ILE C CG1 1 
ATOM   3739 C CG2 . ILE C 1 9   ? 6.712   -19.352 89.097  1.00 30.93  ? 9   ILE C CG2 1 
ATOM   3740 C CD1 . ILE C 1 9   ? 8.666   -21.039 87.439  1.00 27.79  ? 9   ILE C CD1 1 
ATOM   3741 N N   . ARG C 1 10  ? 6.618   -16.598 87.898  1.00 21.21  ? 10  ARG C N   1 
ATOM   3742 C CA  . ARG C 1 10  ? 5.749   -15.467 88.209  1.00 18.94  ? 10  ARG C CA  1 
ATOM   3743 C C   . ARG C 1 10  ? 5.501   -15.421 89.720  1.00 15.83  ? 10  ARG C C   1 
ATOM   3744 O O   . ARG C 1 10  ? 5.888   -14.444 90.383  1.00 13.97  ? 10  ARG C O   1 
ATOM   3745 C CB  . ARG C 1 10  ? 4.421   -15.613 87.443  1.00 20.60  ? 10  ARG C CB  1 
ATOM   3746 C CG  . ARG C 1 10  ? 3.348   -14.610 87.800  1.00 24.20  ? 10  ARG C CG  1 
ATOM   3747 C CD  . ARG C 1 10  ? 2.005   -15.022 87.297  1.00 25.95  ? 10  ARG C CD  1 
ATOM   3748 N NE  . ARG C 1 10  ? 0.970   -14.049 87.651  1.00 27.44  ? 10  ARG C NE  1 
ATOM   3749 C CZ  . ARG C 1 10  ? -0.122  -13.809 86.925  1.00 26.60  ? 10  ARG C CZ  1 
ATOM   3750 N NH1 . ARG C 1 10  ? -0.325  -14.441 85.772  1.00 24.84  ? 10  ARG C NH1 1 
ATOM   3751 N NH2 . ARG C 1 10  ? -1.027  -12.932 87.353  1.00 25.57  ? 10  ARG C NH2 1 
ATOM   3752 N N   . GLY C 1 11  ? 4.841   -16.477 90.222  1.00 10.66  ? 11  GLY C N   1 
ATOM   3753 C CA  . GLY C 1 11  ? 4.553   -16.638 91.640  1.00 10.98  ? 11  GLY C CA  1 
ATOM   3754 C C   . GLY C 1 11  ? 4.392   -15.388 92.489  1.00 11.52  ? 11  GLY C C   1 
ATOM   3755 O O   . GLY C 1 11  ? 3.763   -14.391 92.085  1.00 13.64  ? 11  GLY C O   1 
ATOM   3756 N N   . LEU C 1 12  ? 4.993   -15.452 93.682  1.00 10.18  ? 12  LEU C N   1 
ATOM   3757 C CA  . LEU C 1 12  ? 4.929   -14.376 94.669  1.00 9.75   ? 12  LEU C CA  1 
ATOM   3758 C C   . LEU C 1 12  ? 5.696   -13.109 94.269  1.00 11.33  ? 12  LEU C C   1 
ATOM   3759 O O   . LEU C 1 12  ? 5.517   -12.062 94.912  1.00 13.55  ? 12  LEU C O   1 
ATOM   3760 C CB  . LEU C 1 12  ? 5.453   -14.863 96.029  1.00 11.95  ? 12  LEU C CB  1 
ATOM   3761 C CG  . LEU C 1 12  ? 4.747   -16.055 96.672  1.00 11.77  ? 12  LEU C CG  1 
ATOM   3762 C CD1 . LEU C 1 12  ? 5.674   -16.732 97.628  1.00 11.59  ? 12  LEU C CD1 1 
ATOM   3763 C CD2 . LEU C 1 12  ? 3.515   -15.586 97.383  1.00 12.61  ? 12  LEU C CD2 1 
ATOM   3764 N N   . ALA C 1 13  ? 6.535   -13.187 93.236  1.00 14.00  ? 13  ALA C N   1 
ATOM   3765 C CA  . ALA C 1 13  ? 7.355   -12.043 92.844  1.00 14.29  ? 13  ALA C CA  1 
ATOM   3766 C C   . ALA C 1 13  ? 6.619   -11.093 91.879  1.00 16.49  ? 13  ALA C C   1 
ATOM   3767 O O   . ALA C 1 13  ? 7.027   -9.930  91.738  1.00 16.78  ? 13  ALA C O   1 
ATOM   3768 C CB  . ALA C 1 13  ? 8.648   -12.511 92.208  1.00 11.71  ? 13  ALA C CB  1 
ATOM   3769 N N   . HIS C 1 14  ? 5.563   -11.578 91.232  1.00 17.97  ? 14  HIS C N   1 
ATOM   3770 C CA  . HIS C 1 14  ? 4.824   -10.764 90.269  1.00 16.09  ? 14  HIS C CA  1 
ATOM   3771 C C   . HIS C 1 14  ? 4.416   -9.383  90.752  1.00 15.20  ? 14  HIS C C   1 
ATOM   3772 O O   . HIS C 1 14  ? 4.699   -8.389  90.127  1.00 14.84  ? 14  HIS C O   1 
ATOM   3773 C CB  . HIS C 1 14  ? 3.604   -11.516 89.752  1.00 19.89  ? 14  HIS C CB  1 
ATOM   3774 C CG  . HIS C 1 14  ? 3.148   -11.071 88.404  1.00 25.10  ? 14  HIS C CG  1 
ATOM   3775 N ND1 . HIS C 1 14  ? 3.882   -11.240 87.260  1.00 24.28  ? 14  HIS C ND1 1 
ATOM   3776 C CD2 . HIS C 1 14  ? 2.003   -10.422 88.012  1.00 24.54  ? 14  HIS C CD2 1 
ATOM   3777 C CE1 . HIS C 1 14  ? 3.254   -10.719 86.219  1.00 23.92  ? 14  HIS C CE1 1 
ATOM   3778 N NE2 . HIS C 1 14  ? 2.097   -10.208 86.660  1.00 25.10  ? 14  HIS C NE2 1 
ATOM   3779 N N   . SER C 1 15  ? 3.741   -9.316  91.898  1.00 16.25  ? 15  SER C N   1 
ATOM   3780 C CA  . SER C 1 15  ? 3.264   -8.043  92.432  1.00 15.36  ? 15  SER C CA  1 
ATOM   3781 C C   . SER C 1 15  ? 4.428   -7.109  92.761  1.00 16.06  ? 15  SER C C   1 
ATOM   3782 O O   . SER C 1 15  ? 4.267   -5.888  92.669  1.00 16.42  ? 15  SER C O   1 
ATOM   3783 C CB  . SER C 1 15  ? 2.431   -8.271  93.707  1.00 16.99  ? 15  SER C CB  1 
ATOM   3784 O OG  . SER C 1 15  ? 1.362   -9.169  93.470  1.00 22.27  ? 15  SER C OG  1 
ATOM   3785 N N   . ILE C 1 16  ? 5.573   -7.685  93.123  1.00 17.40  ? 16  ILE C N   1 
ATOM   3786 C CA  . ILE C 1 16  ? 6.763   -6.930  93.515  1.00 15.32  ? 16  ILE C CA  1 
ATOM   3787 C C   . ILE C 1 16  ? 7.392   -6.307  92.279  1.00 10.91  ? 16  ILE C C   1 
ATOM   3788 O O   . ILE C 1 16  ? 7.679   -5.102  92.271  1.00 7.34   ? 16  ILE C O   1 
ATOM   3789 C CB  . ILE C 1 16  ? 7.804   -7.814  94.266  1.00 18.26  ? 16  ILE C CB  1 
ATOM   3790 C CG1 . ILE C 1 16  ? 7.142   -8.494  95.474  1.00 20.39  ? 16  ILE C CG1 1 
ATOM   3791 C CG2 . ILE C 1 16  ? 8.951   -6.963  94.752  1.00 18.80  ? 16  ILE C CG2 1 
ATOM   3792 C CD1 . ILE C 1 16  ? 8.017   -9.478  96.183  1.00 22.75  ? 16  ILE C CD1 1 
ATOM   3793 N N   . ARG C 1 17  ? 7.601   -7.132  91.244  1.00 10.53  ? 17  ARG C N   1 
ATOM   3794 C CA  . ARG C 1 17  ? 8.228   -6.666  90.005  1.00 11.59  ? 17  ARG C CA  1 
ATOM   3795 C C   . ARG C 1 17  ? 7.416   -5.506  89.405  1.00 15.24  ? 17  ARG C C   1 
ATOM   3796 O O   . ARG C 1 17  ? 7.990   -4.459  89.011  1.00 16.42  ? 17  ARG C O   1 
ATOM   3797 C CB  . ARG C 1 17  ? 8.320   -7.798  88.986  1.00 3.40   ? 17  ARG C CB  1 
ATOM   3798 C CG  . ARG C 1 17  ? 9.155   -8.987  89.422  1.00 6.00   ? 17  ARG C CG  1 
ATOM   3799 C CD  . ARG C 1 17  ? 9.148   -10.059 88.349  1.00 4.06   ? 17  ARG C CD  1 
ATOM   3800 N NE  . ARG C 1 17  ? 9.984   -11.201 88.728  1.00 5.16   ? 17  ARG C NE  1 
ATOM   3801 C CZ  . ARG C 1 17  ? 9.586   -12.479 88.709  1.00 10.81  ? 17  ARG C CZ  1 
ATOM   3802 N NH1 . ARG C 1 17  ? 8.346   -12.807 88.306  1.00 14.61  ? 17  ARG C NH1 1 
ATOM   3803 N NH2 . ARG C 1 17  ? 10.431  -13.462 89.102  1.00 6.53   ? 17  ARG C NH2 1 
ATOM   3804 N N   . LEU C 1 18  ? 6.089   -5.680  89.379  1.00 14.47  ? 18  LEU C N   1 
ATOM   3805 C CA  . LEU C 1 18  ? 5.166   -4.652  88.876  1.00 14.83  ? 18  LEU C CA  1 
ATOM   3806 C C   . LEU C 1 18  ? 5.304   -3.356  89.675  1.00 14.56  ? 18  LEU C C   1 
ATOM   3807 O O   . LEU C 1 18  ? 5.480   -2.282  89.090  1.00 17.53  ? 18  LEU C O   1 
ATOM   3808 C CB  . LEU C 1 18  ? 3.711   -5.132  88.932  1.00 16.75  ? 18  LEU C CB  1 
ATOM   3809 C CG  . LEU C 1 18  ? 3.283   -6.258  87.991  1.00 14.84  ? 18  LEU C CG  1 
ATOM   3810 C CD1 . LEU C 1 18  ? 1.893   -6.743  88.415  1.00 12.58  ? 18  LEU C CD1 1 
ATOM   3811 C CD2 . LEU C 1 18  ? 3.267   -5.750  86.565  1.00 11.71  ? 18  LEU C CD2 1 
ATOM   3812 N N   . LEU C 1 19  ? 5.263   -3.473  91.003  1.00 13.85  ? 19  LEU C N   1 
ATOM   3813 C CA  . LEU C 1 19  ? 5.395   -2.320  91.882  1.00 14.84  ? 19  LEU C CA  1 
ATOM   3814 C C   . LEU C 1 19  ? 6.720   -1.580  91.653  1.00 18.26  ? 19  LEU C C   1 
ATOM   3815 O O   . LEU C 1 19  ? 6.736   -0.333  91.517  1.00 19.23  ? 19  LEU C O   1 
ATOM   3816 C CB  . LEU C 1 19  ? 5.242   -2.720  93.352  1.00 13.80  ? 19  LEU C CB  1 
ATOM   3817 C CG  . LEU C 1 19  ? 5.102   -1.560  94.359  1.00 18.39  ? 19  LEU C CG  1 
ATOM   3818 C CD1 . LEU C 1 19  ? 4.026   -0.576  93.963  1.00 19.66  ? 19  LEU C CD1 1 
ATOM   3819 C CD2 . LEU C 1 19  ? 4.769   -2.130  95.736  1.00 21.40  ? 19  LEU C CD2 1 
ATOM   3820 N N   . LEU C 1 20  ? 7.814   -2.345  91.582  1.00 18.08  ? 20  LEU C N   1 
ATOM   3821 C CA  . LEU C 1 20  ? 9.123   -1.753  91.341  1.00 16.43  ? 20  LEU C CA  1 
ATOM   3822 C C   . LEU C 1 20  ? 9.110   -0.937  90.054  1.00 16.72  ? 20  LEU C C   1 
ATOM   3823 O O   . LEU C 1 20  ? 9.464   0.255   90.068  1.00 16.03  ? 20  LEU C O   1 
ATOM   3824 C CB  . LEU C 1 20  ? 10.207  -2.835  91.278  1.00 16.50  ? 20  LEU C CB  1 
ATOM   3825 C CG  . LEU C 1 20  ? 10.635  -3.487  92.609  1.00 14.15  ? 20  LEU C CG  1 
ATOM   3826 C CD1 . LEU C 1 20  ? 11.610  -4.650  92.345  1.00 11.92  ? 20  LEU C CD1 1 
ATOM   3827 C CD2 . LEU C 1 20  ? 11.255  -2.448  93.505  1.00 5.29   ? 20  LEU C CD2 1 
ATOM   3828 N N   . GLU C 1 21  ? 8.673   -1.577  88.959  1.00 18.45  ? 21  GLU C N   1 
ATOM   3829 C CA  . GLU C 1 21  ? 8.572   -0.935  87.646  1.00 20.33  ? 21  GLU C CA  1 
ATOM   3830 C C   . GLU C 1 21  ? 7.731   0.337   87.664  1.00 23.12  ? 21  GLU C C   1 
ATOM   3831 O O   . GLU C 1 21  ? 8.169   1.382   87.154  1.00 24.14  ? 21  GLU C O   1 
ATOM   3832 C CB  . GLU C 1 21  ? 7.979   -1.897  86.632  1.00 18.78  ? 21  GLU C CB  1 
ATOM   3833 C CG  . GLU C 1 21  ? 8.926   -3.050  86.303  1.00 16.84  ? 21  GLU C CG  1 
ATOM   3834 C CD  . GLU C 1 21  ? 10.094  -2.663  85.402  1.00 15.84  ? 21  GLU C CD  1 
ATOM   3835 O OE1 . GLU C 1 21  ? 10.120  -1.531  84.858  1.00 19.72  ? 21  GLU C OE1 1 
ATOM   3836 O OE2 . GLU C 1 21  ? 11.001  -3.514  85.252  1.00 9.89   ? 21  GLU C OE2 1 
ATOM   3837 N N   . TYR C 1 22  ? 6.554   0.252   88.283  1.00 24.71  ? 22  TYR C N   1 
ATOM   3838 C CA  . TYR C 1 22  ? 5.649   1.387   88.399  1.00 26.63  ? 22  TYR C CA  1 
ATOM   3839 C C   . TYR C 1 22  ? 6.325   2.551   89.097  1.00 28.07  ? 22  TYR C C   1 
ATOM   3840 O O   . TYR C 1 22  ? 6.110   3.701   88.747  1.00 28.65  ? 22  TYR C O   1 
ATOM   3841 C CB  . TYR C 1 22  ? 4.390   0.965   89.146  1.00 27.84  ? 22  TYR C CB  1 
ATOM   3842 C CG  . TYR C 1 22  ? 3.355   2.044   89.263  1.00 28.22  ? 22  TYR C CG  1 
ATOM   3843 C CD1 . TYR C 1 22  ? 2.461   2.299   88.224  1.00 28.53  ? 22  TYR C CD1 1 
ATOM   3844 C CD2 . TYR C 1 22  ? 3.272   2.825   90.423  1.00 26.68  ? 22  TYR C CD2 1 
ATOM   3845 C CE1 . TYR C 1 22  ? 1.479   3.324   88.348  1.00 28.24  ? 22  TYR C CE1 1 
ATOM   3846 C CE2 . TYR C 1 22  ? 2.311   3.849   90.563  1.00 27.72  ? 22  TYR C CE2 1 
ATOM   3847 C CZ  . TYR C 1 22  ? 1.416   4.087   89.523  1.00 28.05  ? 22  TYR C CZ  1 
ATOM   3848 O OH  . TYR C 1 22  ? 0.476   5.085   89.640  1.00 29.37  ? 22  TYR C OH  1 
ATOM   3849 N N   . THR C 1 23  ? 7.147   2.249   90.092  1.00 31.03  ? 23  THR C N   1 
ATOM   3850 C CA  . THR C 1 23  ? 7.827   3.279   90.856  1.00 30.62  ? 23  THR C CA  1 
ATOM   3851 C C   . THR C 1 23  ? 9.171   3.683   90.260  1.00 32.06  ? 23  THR C C   1 
ATOM   3852 O O   . THR C 1 23  ? 9.877   4.524   90.793  1.00 31.79  ? 23  THR C O   1 
ATOM   3853 C CB  . THR C 1 23  ? 8.045   2.816   92.307  1.00 29.61  ? 23  THR C CB  1 
ATOM   3854 O OG1 . THR C 1 23  ? 8.736   1.553   92.325  1.00 28.21  ? 23  THR C OG1 1 
ATOM   3855 C CG2 . THR C 1 23  ? 6.699   2.678   93.036  1.00 30.19  ? 23  THR C CG2 1 
ATOM   3856 N N   . ASP C 1 24  ? 9.516   3.040   89.145  1.00 33.33  ? 24  ASP C N   1 
ATOM   3857 C CA  . ASP C 1 24  ? 10.788  3.264   88.473  1.00 33.64  ? 24  ASP C CA  1 
ATOM   3858 C C   . ASP C 1 24  ? 11.990  3.029   89.400  1.00 31.36  ? 24  ASP C C   1 
ATOM   3859 O O   . ASP C 1 24  ? 13.038  3.649   89.248  1.00 32.18  ? 24  ASP C O   1 
ATOM   3860 C CB  . ASP C 1 24  ? 10.826  4.675   87.867  1.00 35.15  ? 24  ASP C CB  1 
ATOM   3861 C CG  . ASP C 1 24  ? 9.995   4.804   86.579  1.00 37.67  ? 24  ASP C CG  1 
ATOM   3862 O OD1 . ASP C 1 24  ? 9.877   3.812   85.806  1.00 40.04  ? 24  ASP C OD1 1 
ATOM   3863 O OD2 . ASP C 1 24  ? 9.441   5.909   86.358  1.00 38.01  ? 24  ASP C OD2 1 
ATOM   3864 N N   . SER C 1 25  ? 11.838  2.112   90.340  1.00 28.87  ? 25  SER C N   1 
ATOM   3865 C CA  . SER C 1 25  ? 12.914  1.787   91.260  1.00 28.12  ? 25  SER C CA  1 
ATOM   3866 C C   . SER C 1 25  ? 13.995  1.015   90.511  1.00 28.91  ? 25  SER C C   1 
ATOM   3867 O O   . SER C 1 25  ? 13.714  -0.037  89.913  1.00 30.18  ? 25  SER C O   1 
ATOM   3868 C CB  . SER C 1 25  ? 12.355  0.963   92.428  1.00 28.03  ? 25  SER C CB  1 
ATOM   3869 O OG  . SER C 1 25  ? 11.418  1.731   93.201  1.00 31.62  ? 25  SER C OG  1 
ATOM   3870 N N   . SER C 1 26  ? 15.224  1.524   90.558  1.00 27.54  ? 26  SER C N   1 
ATOM   3871 C CA  . SER C 1 26  ? 16.355  0.876   89.908  1.00 27.08  ? 26  SER C CA  1 
ATOM   3872 C C   . SER C 1 26  ? 16.657  -0.401  90.668  1.00 24.95  ? 26  SER C C   1 
ATOM   3873 O O   . SER C 1 26  ? 17.011  -0.343  91.852  1.00 23.85  ? 26  SER C O   1 
ATOM   3874 C CB  . SER C 1 26  ? 17.577  1.808   89.936  1.00 27.63  ? 26  SER C CB  1 
ATOM   3875 O OG  . SER C 1 26  ? 18.705  1.235   89.278  1.00 26.67  ? 26  SER C OG  1 
ATOM   3876 N N   . TYR C 1 27  ? 16.521  -1.553  89.999  1.00 25.80  ? 27  TYR C N   1 
ATOM   3877 C CA  . TYR C 1 27  ? 16.732  -2.826  90.679  1.00 26.37  ? 27  TYR C CA  1 
ATOM   3878 C C   . TYR C 1 27  ? 17.345  -3.858  89.751  1.00 26.34  ? 27  TYR C C   1 
ATOM   3879 O O   . TYR C 1 27  ? 17.355  -3.681  88.545  1.00 27.25  ? 27  TYR C O   1 
ATOM   3880 C CB  . TYR C 1 27  ? 15.417  -3.341  91.304  1.00 26.43  ? 27  TYR C CB  1 
ATOM   3881 C CG  . TYR C 1 27  ? 14.402  -3.876  90.322  1.00 25.22  ? 27  TYR C CG  1 
ATOM   3882 C CD1 . TYR C 1 27  ? 13.558  -2.996  89.634  1.00 26.85  ? 27  TYR C CD1 1 
ATOM   3883 C CD2 . TYR C 1 27  ? 14.335  -5.252  90.035  1.00 26.45  ? 27  TYR C CD2 1 
ATOM   3884 C CE1 . TYR C 1 27  ? 12.642  -3.481  88.658  1.00 25.79  ? 27  TYR C CE1 1 
ATOM   3885 C CE2 . TYR C 1 27  ? 13.428  -5.755  89.058  1.00 25.63  ? 27  TYR C CE2 1 
ATOM   3886 C CZ  . TYR C 1 27  ? 12.590  -4.861  88.390  1.00 26.28  ? 27  TYR C CZ  1 
ATOM   3887 O OH  . TYR C 1 27  ? 11.731  -5.355  87.445  1.00 27.12  ? 27  TYR C OH  1 
ATOM   3888 N N   . GLU C 1 28  ? 17.816  -4.955  90.344  1.00 27.40  ? 28  GLU C N   1 
ATOM   3889 C CA  . GLU C 1 28  ? 18.373  -6.071  89.598  1.00 29.70  ? 28  GLU C CA  1 
ATOM   3890 C C   . GLU C 1 28  ? 17.734  -7.327  90.129  1.00 27.97  ? 28  GLU C C   1 
ATOM   3891 O O   . GLU C 1 28  ? 17.478  -7.425  91.321  1.00 29.17  ? 28  GLU C O   1 
ATOM   3892 C CB  . GLU C 1 28  ? 19.889  -6.155  89.797  1.00 34.60  ? 28  GLU C CB  1 
ATOM   3893 C CG  . GLU C 1 28  ? 20.663  -4.990  89.193  1.00 40.84  ? 28  GLU C CG  1 
ATOM   3894 C CD  . GLU C 1 28  ? 22.174  -5.140  89.361  1.00 45.64  ? 28  GLU C CD  1 
ATOM   3895 O OE1 . GLU C 1 28  ? 22.656  -5.172  90.539  1.00 43.99  ? 28  GLU C OE1 1 
ATOM   3896 O OE2 . GLU C 1 28  ? 22.863  -5.225  88.302  1.00 48.68  ? 28  GLU C OE2 1 
ATOM   3897 N N   . GLU C 1 29  ? 17.493  -8.296  89.250  1.00 23.75  ? 29  GLU C N   1 
ATOM   3898 C CA  . GLU C 1 29  ? 16.873  -9.547  89.674  1.00 22.23  ? 29  GLU C CA  1 
ATOM   3899 C C   . GLU C 1 29  ? 17.892  -10.677 89.748  1.00 21.11  ? 29  GLU C C   1 
ATOM   3900 O O   . GLU C 1 29  ? 18.821  -10.728 88.952  1.00 21.15  ? 29  GLU C O   1 
ATOM   3901 C CB  . GLU C 1 29  ? 15.756  -9.926  88.709  1.00 20.04  ? 29  GLU C CB  1 
ATOM   3902 C CG  . GLU C 1 29  ? 14.492  -9.095  88.884  1.00 19.54  ? 29  GLU C CG  1 
ATOM   3903 C CD  . GLU C 1 29  ? 13.343  -9.586  88.029  1.00 21.01  ? 29  GLU C CD  1 
ATOM   3904 O OE1 . GLU C 1 29  ? 13.103  -10.819 87.943  1.00 18.92  ? 29  GLU C OE1 1 
ATOM   3905 O OE2 . GLU C 1 29  ? 12.690  -8.713  87.427  1.00 27.10  ? 29  GLU C OE2 1 
ATOM   3906 N N   . LYS C 1 30  ? 17.690  -11.587 90.698  1.00 21.13  ? 30  LYS C N   1 
ATOM   3907 C CA  . LYS C 1 30  ? 18.535  -12.746 90.865  1.00 23.38  ? 30  LYS C CA  1 
ATOM   3908 C C   . LYS C 1 30  ? 17.575  -13.914 90.794  1.00 24.30  ? 30  LYS C C   1 
ATOM   3909 O O   . LYS C 1 30  ? 17.072  -14.390 91.810  1.00 23.83  ? 30  LYS C O   1 
ATOM   3910 C CB  . LYS C 1 30  ? 19.250  -12.671 92.221  1.00 22.56  ? 30  LYS C CB  1 
ATOM   3911 C CG  . LYS C 1 30  ? 20.193  -13.828 92.497  1.00 21.17  ? 30  LYS C CG  1 
ATOM   3912 C CD  . LYS C 1 30  ? 21.396  -13.783 91.585  1.00 24.66  ? 30  LYS C CD  1 
ATOM   3913 C CE  . LYS C 1 30  ? 22.327  -14.985 91.819  1.00 25.18  ? 30  LYS C CE  1 
ATOM   3914 N NZ  . LYS C 1 30  ? 21.646  -16.306 91.511  1.00 28.08  ? 30  LYS C NZ  1 
ATOM   3915 N N   . LYS C 1 31  ? 17.357  -14.409 89.579  1.00 25.29  ? 31  LYS C N   1 
ATOM   3916 C CA  . LYS C 1 31  ? 16.424  -15.507 89.353  1.00 25.47  ? 31  LYS C CA  1 
ATOM   3917 C C   . LYS C 1 31  ? 17.103  -16.830 89.669  1.00 26.32  ? 31  LYS C C   1 
ATOM   3918 O O   . LYS C 1 31  ? 18.258  -17.047 89.313  1.00 28.18  ? 31  LYS C O   1 
ATOM   3919 C CB  . LYS C 1 31  ? 15.913  -15.510 87.908  1.00 23.85  ? 31  LYS C CB  1 
ATOM   3920 C CG  . LYS C 1 31  ? 15.082  -14.313 87.559  1.00 25.17  ? 31  LYS C CG  1 
ATOM   3921 C CD  . LYS C 1 31  ? 14.655  -14.387 86.115  1.00 28.59  ? 31  LYS C CD  1 
ATOM   3922 C CE  . LYS C 1 31  ? 13.860  -13.160 85.690  1.00 31.73  ? 31  LYS C CE  1 
ATOM   3923 N NZ  . LYS C 1 31  ? 13.489  -13.235 84.235  1.00 33.19  ? 31  LYS C NZ  1 
ATOM   3924 N N   . TYR C 1 32  ? 16.380  -17.724 90.345  1.00 23.58  ? 32  TYR C N   1 
ATOM   3925 C CA  . TYR C 1 32  ? 16.910  -19.045 90.647  1.00 23.78  ? 32  TYR C CA  1 
ATOM   3926 C C   . TYR C 1 32  ? 16.181  -20.093 89.799  1.00 21.96  ? 32  TYR C C   1 
ATOM   3927 O O   . TYR C 1 32  ? 14.973  -20.065 89.657  1.00 20.41  ? 32  TYR C O   1 
ATOM   3928 C CB  . TYR C 1 32  ? 16.754  -19.339 92.156  1.00 24.66  ? 32  TYR C CB  1 
ATOM   3929 C CG  . TYR C 1 32  ? 17.582  -18.456 93.038  1.00 24.44  ? 32  TYR C CG  1 
ATOM   3930 C CD1 . TYR C 1 32  ? 18.895  -18.811 93.364  1.00 25.13  ? 32  TYR C CD1 1 
ATOM   3931 C CD2 . TYR C 1 32  ? 17.074  -17.242 93.515  1.00 24.00  ? 32  TYR C CD2 1 
ATOM   3932 C CE1 . TYR C 1 32  ? 19.711  -17.962 94.163  1.00 24.64  ? 32  TYR C CE1 1 
ATOM   3933 C CE2 . TYR C 1 32  ? 17.875  -16.384 94.314  1.00 24.40  ? 32  TYR C CE2 1 
ATOM   3934 C CZ  . TYR C 1 32  ? 19.186  -16.760 94.621  1.00 23.44  ? 32  TYR C CZ  1 
ATOM   3935 O OH  . TYR C 1 32  ? 19.979  -15.965 95.397  1.00 20.16  ? 32  TYR C OH  1 
ATOM   3936 N N   . THR C 1 33  ? 16.934  -21.063 89.289  1.00 21.28  ? 33  THR C N   1 
ATOM   3937 C CA  . THR C 1 33  ? 16.357  -22.108 88.480  1.00 21.55  ? 33  THR C CA  1 
ATOM   3938 C C   . THR C 1 33  ? 16.165  -23.348 89.325  1.00 23.56  ? 33  THR C C   1 
ATOM   3939 O O   . THR C 1 33  ? 16.991  -23.627 90.206  1.00 27.41  ? 33  THR C O   1 
ATOM   3940 C CB  . THR C 1 33  ? 17.286  -22.428 87.304  1.00 21.33  ? 33  THR C CB  1 
ATOM   3941 O OG1 . THR C 1 33  ? 17.615  -21.214 86.616  1.00 19.31  ? 33  THR C OG1 1 
ATOM   3942 C CG2 . THR C 1 33  ? 16.611  -23.394 86.335  1.00 20.94  ? 33  THR C CG2 1 
ATOM   3943 N N   . MET C 1 34  ? 15.083  -24.084 89.035  1.00 26.31  ? 34  MET C N   1 
ATOM   3944 C CA  . MET C 1 34  ? 14.717  -25.322 89.749  1.00 28.47  ? 34  MET C CA  1 
ATOM   3945 C C   . MET C 1 34  ? 14.866  -26.546 88.837  1.00 30.83  ? 34  MET C C   1 
ATOM   3946 O O   . MET C 1 34  ? 14.748  -26.422 87.613  1.00 31.11  ? 34  MET C O   1 
ATOM   3947 C CB  . MET C 1 34  ? 13.270  -25.250 90.242  1.00 27.42  ? 34  MET C CB  1 
ATOM   3948 C CG  . MET C 1 34  ? 12.874  -26.424 91.110  1.00 31.19  ? 34  MET C CG  1 
ATOM   3949 S SD  . MET C 1 34  ? 11.217  -26.279 91.759  1.00 28.70  ? 34  MET C SD  1 
ATOM   3950 C CE  . MET C 1 34  ? 11.468  -25.150 93.161  1.00 29.21  ? 34  MET C CE  1 
ATOM   3951 N N   . GLY C 1 35  ? 15.164  -27.697 89.443  1.00 33.82  ? 35  GLY C N   1 
ATOM   3952 C CA  . GLY C 1 35  ? 15.355  -28.924 88.688  1.00 37.68  ? 35  GLY C CA  1 
ATOM   3953 C C   . GLY C 1 35  ? 14.097  -29.473 88.069  1.00 40.89  ? 35  GLY C C   1 
ATOM   3954 O O   . GLY C 1 35  ? 13.036  -29.396 88.668  1.00 42.27  ? 35  GLY C O   1 
ATOM   3955 N N   . ASP C 1 36  ? 14.230  -30.004 86.858  1.00 44.82  ? 36  ASP C N   1 
ATOM   3956 C CA  . ASP C 1 36  ? 13.124  -30.590 86.095  1.00 46.86  ? 36  ASP C CA  1 
ATOM   3957 C C   . ASP C 1 36  ? 13.012  -32.082 86.349  1.00 46.98  ? 36  ASP C C   1 
ATOM   3958 O O   . ASP C 1 36  ? 11.932  -32.664 86.266  1.00 49.10  ? 36  ASP C O   1 
ATOM   3959 C CB  . ASP C 1 36  ? 13.356  -30.336 84.602  1.00 47.98  ? 36  ASP C CB  1 
ATOM   3960 C CG  . ASP C 1 36  ? 12.302  -30.983 83.722  1.00 49.85  ? 36  ASP C CG  1 
ATOM   3961 O OD1 . ASP C 1 36  ? 11.101  -30.658 83.866  1.00 51.38  ? 36  ASP C OD1 1 
ATOM   3962 O OD2 . ASP C 1 36  ? 12.687  -31.833 82.890  1.00 51.69  ? 36  ASP C OD2 1 
ATOM   3963 N N   . ALA C 1 37  ? 14.140  -32.695 86.663  1.00 47.67  ? 37  ALA C N   1 
ATOM   3964 C CA  . ALA C 1 37  ? 14.209  -34.126 86.931  1.00 47.64  ? 37  ALA C CA  1 
ATOM   3965 C C   . ALA C 1 37  ? 13.345  -34.452 88.161  1.00 45.76  ? 37  ALA C C   1 
ATOM   3966 O O   . ALA C 1 37  ? 12.942  -33.530 88.901  1.00 46.31  ? 37  ALA C O   1 
ATOM   3967 C CB  . ALA C 1 37  ? 15.688  -34.529 87.179  1.00 47.71  ? 37  ALA C CB  1 
ATOM   3968 N N   . PRO C 1 38  ? 13.071  -35.771 88.420  1.00 42.99  ? 38  PRO C N   1 
ATOM   3969 C CA  . PRO C 1 38  ? 12.293  -36.157 89.604  1.00 41.21  ? 38  PRO C CA  1 
ATOM   3970 C C   . PRO C 1 38  ? 12.780  -35.488 90.872  1.00 39.23  ? 38  PRO C C   1 
ATOM   3971 O O   . PRO C 1 38  ? 11.981  -35.133 91.761  1.00 38.80  ? 38  PRO C O   1 
ATOM   3972 C CB  . PRO C 1 38  ? 12.508  -37.676 89.673  1.00 40.53  ? 38  PRO C CB  1 
ATOM   3973 C CG  . PRO C 1 38  ? 12.720  -38.069 88.247  1.00 42.16  ? 38  PRO C CG  1 
ATOM   3974 C CD  . PRO C 1 38  ? 13.508  -36.940 87.636  1.00 42.06  ? 38  PRO C CD  1 
ATOM   3975 N N   . ASP C 1 39  ? 14.087  -35.278 90.933  1.00 37.57  ? 39  ASP C N   1 
ATOM   3976 C CA  . ASP C 1 39  ? 14.717  -34.567 92.031  1.00 37.74  ? 39  ASP C CA  1 
ATOM   3977 C C   . ASP C 1 39  ? 14.733  -33.121 91.593  1.00 37.60  ? 39  ASP C C   1 
ATOM   3978 O O   . ASP C 1 39  ? 15.691  -32.684 90.919  1.00 39.63  ? 39  ASP C O   1 
ATOM   3979 C CB  . ASP C 1 39  ? 16.156  -35.060 92.242  1.00 36.30  ? 39  ASP C CB  1 
ATOM   3980 C CG  . ASP C 1 39  ? 16.272  -36.573 92.115  1.00 38.20  ? 39  ASP C CG  1 
ATOM   3981 O OD1 . ASP C 1 39  ? 16.006  -37.280 93.127  1.00 37.69  ? 39  ASP C OD1 1 
ATOM   3982 O OD2 . ASP C 1 39  ? 16.612  -37.039 90.995  1.00 38.37  ? 39  ASP C OD2 1 
ATOM   3983 N N   . TYR C 1 40  ? 13.702  -32.369 91.994  1.00 34.38  ? 40  TYR C N   1 
ATOM   3984 C CA  . TYR C 1 40  ? 13.613  -30.958 91.632  1.00 32.49  ? 40  TYR C CA  1 
ATOM   3985 C C   . TYR C 1 40  ? 14.780  -30.183 92.277  1.00 33.79  ? 40  TYR C C   1 
ATOM   3986 O O   . TYR C 1 40  ? 14.623  -29.588 93.358  1.00 35.42  ? 40  TYR C O   1 
ATOM   3987 C CB  . TYR C 1 40  ? 12.261  -30.371 92.043  1.00 29.66  ? 40  TYR C CB  1 
ATOM   3988 C CG  . TYR C 1 40  ? 11.096  -31.128 91.432  1.00 29.07  ? 40  TYR C CG  1 
ATOM   3989 C CD1 . TYR C 1 40  ? 10.762  -30.963 90.068  1.00 28.93  ? 40  TYR C CD1 1 
ATOM   3990 C CD2 . TYR C 1 40  ? 10.319  -31.995 92.215  1.00 26.08  ? 40  TYR C CD2 1 
ATOM   3991 C CE1 . TYR C 1 40  ? 9.678   -31.659 89.499  1.00 28.12  ? 40  TYR C CE1 1 
ATOM   3992 C CE2 . TYR C 1 40  ? 9.232   -32.690 91.652  1.00 24.81  ? 40  TYR C CE2 1 
ATOM   3993 C CZ  . TYR C 1 40  ? 8.938   -32.528 90.299  1.00 28.15  ? 40  TYR C CZ  1 
ATOM   3994 O OH  . TYR C 1 40  ? 7.870   -33.206 89.766  1.00 29.57  ? 40  TYR C OH  1 
ATOM   3995 N N   . ASP C 1 41  ? 15.932  -30.224 91.628  1.00 34.32  ? 41  ASP C N   1 
ATOM   3996 C CA  . ASP C 1 41  ? 17.165  -29.650 92.151  1.00 35.16  ? 41  ASP C CA  1 
ATOM   3997 C C   . ASP C 1 41  ? 17.046  -28.165 92.468  1.00 36.79  ? 41  ASP C C   1 
ATOM   3998 O O   . ASP C 1 41  ? 16.911  -27.324 91.564  1.00 38.65  ? 41  ASP C O   1 
ATOM   3999 C CB  . ASP C 1 41  ? 18.308  -29.887 91.162  1.00 36.11  ? 41  ASP C CB  1 
ATOM   4000 C CG  . ASP C 1 41  ? 19.690  -29.610 91.772  1.00 34.42  ? 41  ASP C CG  1 
ATOM   4001 O OD1 . ASP C 1 41  ? 19.920  -29.978 92.955  1.00 33.68  ? 41  ASP C OD1 1 
ATOM   4002 O OD2 . ASP C 1 41  ? 20.532  -28.999 91.066  1.00 32.19  ? 41  ASP C OD2 1 
ATOM   4003 N N   . ARG C 1 42  ? 17.073  -27.848 93.760  1.00 36.96  ? 42  ARG C N   1 
ATOM   4004 C CA  . ARG C 1 42  ? 16.969  -26.477 94.225  1.00 35.94  ? 42  ARG C CA  1 
ATOM   4005 C C   . ARG C 1 42  ? 18.309  -25.957 94.742  1.00 34.37  ? 42  ARG C C   1 
ATOM   4006 O O   . ARG C 1 42  ? 18.356  -24.885 95.371  1.00 33.69  ? 42  ARG C O   1 
ATOM   4007 C CB  . ARG C 1 42  ? 15.922  -26.378 95.339  1.00 37.67  ? 42  ARG C CB  1 
ATOM   4008 C CG  . ARG C 1 42  ? 14.559  -26.979 94.969  1.00 38.28  ? 42  ARG C CG  1 
ATOM   4009 C CD  . ARG C 1 42  ? 13.631  -27.024 96.155  1.00 41.83  ? 42  ARG C CD  1 
ATOM   4010 N NE  . ARG C 1 42  ? 13.347  -25.677 96.669  1.00 42.17  ? 42  ARG C NE  1 
ATOM   4011 C CZ  . ARG C 1 42  ? 12.264  -25.340 97.377  1.00 41.79  ? 42  ARG C CZ  1 
ATOM   4012 N NH1 . ARG C 1 42  ? 11.344  -26.258 97.680  1.00 41.55  ? 42  ARG C NH1 1 
ATOM   4013 N NH2 . ARG C 1 42  ? 12.108  -24.082 97.790  1.00 40.32  ? 42  ARG C NH2 1 
ATOM   4014 N N   . SER C 1 43  ? 19.371  -26.726 94.481  1.00 32.95  ? 43  SER C N   1 
ATOM   4015 C CA  . SER C 1 43  ? 20.723  -26.418 94.972  1.00 30.38  ? 43  SER C CA  1 
ATOM   4016 C C   . SER C 1 43  ? 21.187  -25.001 94.610  1.00 29.67  ? 43  SER C C   1 
ATOM   4017 O O   . SER C 1 43  ? 21.838  -24.350 95.420  1.00 29.57  ? 43  SER C O   1 
ATOM   4018 C CB  . SER C 1 43  ? 21.723  -27.416 94.391  1.00 30.05  ? 43  SER C CB  1 
ATOM   4019 O OG  . SER C 1 43  ? 21.626  -27.458 92.970  1.00 26.61  ? 43  SER C OG  1 
ATOM   4020 N N   . GLN C 1 44  ? 20.809  -24.521 93.430  1.00 30.13  ? 44  GLN C N   1 
ATOM   4021 C CA  . GLN C 1 44  ? 21.140  -23.168 92.987  1.00 28.95  ? 44  GLN C CA  1 
ATOM   4022 C C   . GLN C 1 44  ? 20.814  -22.139 94.085  1.00 26.84  ? 44  GLN C C   1 
ATOM   4023 O O   . GLN C 1 44  ? 21.569  -21.189 94.311  1.00 27.90  ? 44  GLN C O   1 
ATOM   4024 C CB  . GLN C 1 44  ? 20.382  -22.834 91.695  1.00 31.21  ? 44  GLN C CB  1 
ATOM   4025 C CG  . GLN C 1 44  ? 20.934  -21.599 90.953  1.00 35.69  ? 44  GLN C CG  1 
ATOM   4026 C CD  . GLN C 1 44  ? 20.402  -21.479 89.524  1.00 38.86  ? 44  GLN C CD  1 
ATOM   4027 O OE1 . GLN C 1 44  ? 19.667  -20.551 89.222  1.00 41.23  ? 44  GLN C OE1 1 
ATOM   4028 N NE2 . GLN C 1 44  ? 20.761  -22.431 88.662  1.00 38.42  ? 44  GLN C NE2 1 
ATOM   4029 N N   . TRP C 1 45  ? 19.690  -22.343 94.766  1.00 24.97  ? 45  TRP C N   1 
ATOM   4030 C CA  . TRP C 1 45  ? 19.253  -21.457 95.829  1.00 21.92  ? 45  TRP C CA  1 
ATOM   4031 C C   . TRP C 1 45  ? 19.901  -21.915 97.135  1.00 22.00  ? 45  TRP C C   1 
ATOM   4032 O O   . TRP C 1 45  ? 20.479  -21.098 97.844  1.00 21.88  ? 45  TRP C O   1 
ATOM   4033 C CB  . TRP C 1 45  ? 17.718  -21.466 95.927  1.00 16.12  ? 45  TRP C CB  1 
ATOM   4034 C CG  . TRP C 1 45  ? 17.158  -21.062 97.271  1.00 9.57   ? 45  TRP C CG  1 
ATOM   4035 C CD1 . TRP C 1 45  ? 16.420  -21.834 98.127  1.00 8.00   ? 45  TRP C CD1 1 
ATOM   4036 C CD2 . TRP C 1 45  ? 17.280  -19.777 97.882  1.00 3.99   ? 45  TRP C CD2 1 
ATOM   4037 N NE1 . TRP C 1 45  ? 16.060  -21.106 99.233  1.00 2.26   ? 45  TRP C NE1 1 
ATOM   4038 C CE2 . TRP C 1 45  ? 16.562  -19.836 99.119  1.00 2.98   ? 45  TRP C CE2 1 
ATOM   4039 C CE3 . TRP C 1 45  ? 17.919  -18.584 97.528  1.00 4.25   ? 45  TRP C CE3 1 
ATOM   4040 C CZ2 . TRP C 1 45  ? 16.484  -18.720 99.992  1.00 4.22   ? 45  TRP C CZ2 1 
ATOM   4041 C CZ3 . TRP C 1 45  ? 17.851  -17.471 98.402  1.00 5.59   ? 45  TRP C CZ3 1 
ATOM   4042 C CH2 . TRP C 1 45  ? 17.137  -17.555 99.625  1.00 2.32   ? 45  TRP C CH2 1 
ATOM   4043 N N   . LEU C 1 46  ? 19.751  -23.197 97.471  1.00 21.25  ? 46  LEU C N   1 
ATOM   4044 C CA  . LEU C 1 46  ? 20.252  -23.734 98.729  1.00 23.00  ? 46  LEU C CA  1 
ATOM   4045 C C   . LEU C 1 46  ? 21.722  -23.378 99.005  1.00 25.65  ? 46  LEU C C   1 
ATOM   4046 O O   . LEU C 1 46  ? 22.061  -22.959 100.117 1.00 27.91  ? 46  LEU C O   1 
ATOM   4047 C CB  . LEU C 1 46  ? 20.064  -25.243 98.763  1.00 18.79  ? 46  LEU C CB  1 
ATOM   4048 C CG  . LEU C 1 46  ? 18.610  -25.704 98.761  1.00 17.11  ? 46  LEU C CG  1 
ATOM   4049 C CD1 . LEU C 1 46  ? 18.566  -27.233 98.730  1.00 12.89  ? 46  LEU C CD1 1 
ATOM   4050 C CD2 . LEU C 1 46  ? 17.892  -25.179 99.987  1.00 14.94  ? 46  LEU C CD2 1 
ATOM   4051 N N   . ASN C 1 47  ? 22.587  -23.517 97.994  1.00 24.99  ? 47  ASN C N   1 
ATOM   4052 C CA  . ASN C 1 47  ? 24.004  -23.194 98.142  1.00 24.33  ? 47  ASN C CA  1 
ATOM   4053 C C   . ASN C 1 47  ? 24.275  -21.723 98.459  1.00 24.05  ? 47  ASN C C   1 
ATOM   4054 O O   . ASN C 1 47  ? 25.300  -21.397 99.033  1.00 26.33  ? 47  ASN C O   1 
ATOM   4055 C CB  . ASN C 1 47  ? 24.773  -23.593 96.892  1.00 24.80  ? 47  ASN C CB  1 
ATOM   4056 C CG  . ASN C 1 47  ? 24.737  -25.105 96.633  1.00 25.47  ? 47  ASN C CG  1 
ATOM   4057 O OD1 . ASN C 1 47  ? 24.062  -25.866 97.349  1.00 23.99  ? 47  ASN C OD1 1 
ATOM   4058 N ND2 . ASN C 1 47  ? 25.461  -25.536 95.607  1.00 26.10  ? 47  ASN C ND2 1 
ATOM   4059 N N   . GLU C 1 48  ? 23.329  -20.850 98.104  1.00 22.52  ? 48  GLU C N   1 
ATOM   4060 C CA  . GLU C 1 48  ? 23.461  -19.415 98.317  1.00 22.55  ? 48  GLU C CA  1 
ATOM   4061 C C   . GLU C 1 48  ? 22.554  -18.929 99.441  1.00 23.74  ? 48  GLU C C   1 
ATOM   4062 O O   . GLU C 1 48  ? 22.727  -17.801 99.933  1.00 27.15  ? 48  GLU C O   1 
ATOM   4063 C CB  . GLU C 1 48  ? 23.111  -18.688 97.019  1.00 25.49  ? 48  GLU C CB  1 
ATOM   4064 C CG  . GLU C 1 48  ? 23.425  -17.195 96.996  1.00 29.11  ? 48  GLU C CG  1 
ATOM   4065 C CD  . GLU C 1 48  ? 23.299  -16.578 95.598  1.00 30.57  ? 48  GLU C CD  1 
ATOM   4066 O OE1 . GLU C 1 48  ? 23.120  -17.339 94.623  1.00 31.87  ? 48  GLU C OE1 1 
ATOM   4067 O OE2 . GLU C 1 48  ? 23.372  -15.332 95.464  1.00 31.58  ? 48  GLU C OE2 1 
ATOM   4068 N N   . LYS C 1 49  ? 21.592  -19.787 99.814  1.00 21.75  ? 49  LYS C N   1 
ATOM   4069 C CA  . LYS C 1 49  ? 20.557  -19.499 100.838 1.00 18.28  ? 49  LYS C CA  1 
ATOM   4070 C C   . LYS C 1 49  ? 21.081  -18.878 102.156 1.00 18.12  ? 49  LYS C C   1 
ATOM   4071 O O   . LYS C 1 49  ? 20.694  -17.760 102.544 1.00 16.53  ? 49  LYS C O   1 
ATOM   4072 C CB  . LYS C 1 49  ? 19.799  -20.789 101.172 1.00 17.88  ? 49  LYS C CB  1 
ATOM   4073 C CG  . LYS C 1 49  ? 18.730  -20.662 102.188 1.00 12.92  ? 49  LYS C CG  1 
ATOM   4074 C CD  . LYS C 1 49  ? 18.108  -21.999 102.386 1.00 9.40   ? 49  LYS C CD  1 
ATOM   4075 C CE  . LYS C 1 49  ? 16.881  -21.888 103.274 1.00 11.09  ? 49  LYS C CE  1 
ATOM   4076 N NZ  . LYS C 1 49  ? 16.277  -23.247 103.533 1.00 16.01  ? 49  LYS C NZ  1 
ATOM   4077 N N   . PHE C 1 50  ? 21.986  -19.587 102.822 1.00 18.06  ? 50  PHE C N   1 
ATOM   4078 C CA  . PHE C 1 50  ? 22.519  -19.132 104.100 1.00 16.65  ? 50  PHE C CA  1 
ATOM   4079 C C   . PHE C 1 50  ? 23.741  -18.207 103.960 1.00 17.85  ? 50  PHE C C   1 
ATOM   4080 O O   . PHE C 1 50  ? 24.315  -17.814 104.979 1.00 19.67  ? 50  PHE C O   1 
ATOM   4081 C CB  . PHE C 1 50  ? 22.891  -20.327 104.963 1.00 12.68  ? 50  PHE C CB  1 
ATOM   4082 C CG  . PHE C 1 50  ? 21.740  -21.216 105.275 1.00 11.62  ? 50  PHE C CG  1 
ATOM   4083 C CD1 . PHE C 1 50  ? 20.801  -20.853 106.280 1.00 7.38   ? 50  PHE C CD1 1 
ATOM   4084 C CD2 . PHE C 1 50  ? 21.593  -22.427 104.578 1.00 7.36   ? 50  PHE C CD2 1 
ATOM   4085 C CE1 . PHE C 1 50  ? 19.701  -21.694 106.607 1.00 5.10   ? 50  PHE C CE1 1 
ATOM   4086 C CE2 . PHE C 1 50  ? 20.495  -23.296 104.875 1.00 5.41   ? 50  PHE C CE2 1 
ATOM   4087 C CZ  . PHE C 1 50  ? 19.537  -22.914 105.913 1.00 4.37   ? 50  PHE C CZ  1 
ATOM   4088 N N   . LYS C 1 51  ? 24.115  -17.851 102.733 1.00 17.91  ? 51  LYS C N   1 
ATOM   4089 C CA  . LYS C 1 51  ? 25.231  -16.940 102.495 1.00 17.89  ? 51  LYS C CA  1 
ATOM   4090 C C   . LYS C 1 51  ? 24.827  -15.513 102.210 1.00 18.08  ? 51  LYS C C   1 
ATOM   4091 O O   . LYS C 1 51  ? 25.677  -14.678 101.923 1.00 17.44  ? 51  LYS C O   1 
ATOM   4092 C CB  . LYS C 1 51  ? 26.115  -17.470 101.378 1.00 17.54  ? 51  LYS C CB  1 
ATOM   4093 C CG  . LYS C 1 51  ? 26.662  -18.862 101.651 1.00 20.05  ? 51  LYS C CG  1 
ATOM   4094 C CD  . LYS C 1 51  ? 27.573  -19.305 100.537 1.00 18.74  ? 51  LYS C CD  1 
ATOM   4095 C CE  . LYS C 1 51  ? 28.017  -20.733 100.744 1.00 17.13  ? 51  LYS C CE  1 
ATOM   4096 N NZ  . LYS C 1 51  ? 28.839  -21.239 99.591  1.00 22.55  ? 51  LYS C NZ  1 
ATOM   4097 N N   . LEU C 1 52  ? 23.539  -15.215 102.273 1.00 20.83  ? 52  LEU C N   1 
ATOM   4098 C CA  . LEU C 1 52  ? 23.066  -13.860 101.976 1.00 20.83  ? 52  LEU C CA  1 
ATOM   4099 C C   . LEU C 1 52  ? 22.937  -12.933 103.198 1.00 19.39  ? 52  LEU C C   1 
ATOM   4100 O O   . LEU C 1 52  ? 22.852  -11.712 103.025 1.00 21.41  ? 52  LEU C O   1 
ATOM   4101 C CB  . LEU C 1 52  ? 21.726  -13.917 101.232 1.00 22.04  ? 52  LEU C CB  1 
ATOM   4102 C CG  . LEU C 1 52  ? 21.791  -14.609 99.878  1.00 24.87  ? 52  LEU C CG  1 
ATOM   4103 C CD1 . LEU C 1 52  ? 20.373  -14.823 99.338  1.00 27.18  ? 52  LEU C CD1 1 
ATOM   4104 C CD2 . LEU C 1 52  ? 22.602  -13.747 98.969  1.00 23.64  ? 52  LEU C CD2 1 
ATOM   4105 N N   . GLY C 1 53  ? 22.935  -13.501 104.405 1.00 17.79  ? 53  GLY C N   1 
ATOM   4106 C CA  . GLY C 1 53  ? 22.816  -12.700 105.614 1.00 18.24  ? 53  GLY C CA  1 
ATOM   4107 C C   . GLY C 1 53  ? 21.411  -12.189 105.919 1.00 19.00  ? 53  GLY C C   1 
ATOM   4108 O O   . GLY C 1 53  ? 21.258  -11.169 106.612 1.00 23.52  ? 53  GLY C O   1 
ATOM   4109 N N   . LEU C 1 54  ? 20.396  -12.904 105.442 1.00 17.88  ? 54  LEU C N   1 
ATOM   4110 C CA  . LEU C 1 54  ? 19.001  -12.553 105.701 1.00 14.39  ? 54  LEU C CA  1 
ATOM   4111 C C   . LEU C 1 54  ? 18.624  -13.137 107.043 1.00 13.93  ? 54  LEU C C   1 
ATOM   4112 O O   . LEU C 1 54  ? 19.106  -14.238 107.391 1.00 10.94  ? 54  LEU C O   1 
ATOM   4113 C CB  . LEU C 1 54  ? 18.102  -13.164 104.619 1.00 15.24  ? 54  LEU C CB  1 
ATOM   4114 C CG  . LEU C 1 54  ? 18.387  -12.881 103.143 1.00 13.12  ? 54  LEU C CG  1 
ATOM   4115 C CD1 . LEU C 1 54  ? 17.624  -13.823 102.299 1.00 13.70  ? 54  LEU C CD1 1 
ATOM   4116 C CD2 . LEU C 1 54  ? 18.024  -11.462 102.818 1.00 9.27   ? 54  LEU C CD2 1 
ATOM   4117 N N   . ASP C 1 55  ? 17.760  -12.446 107.797 1.00 12.02  ? 55  ASP C N   1 
ATOM   4118 C CA  . ASP C 1 55  ? 17.367  -12.939 109.123 1.00 11.96  ? 55  ASP C CA  1 
ATOM   4119 C C   . ASP C 1 55  ? 16.549  -14.238 109.047 1.00 12.40  ? 55  ASP C C   1 
ATOM   4120 O O   . ASP C 1 55  ? 16.726  -15.164 109.851 1.00 15.11  ? 55  ASP C O   1 
ATOM   4121 C CB  . ASP C 1 55  ? 16.563  -11.889 109.881 1.00 10.92  ? 55  ASP C CB  1 
ATOM   4122 C CG  . ASP C 1 55  ? 17.298  -10.557 109.984 1.00 12.47  ? 55  ASP C CG  1 
ATOM   4123 O OD1 . ASP C 1 55  ? 18.327  -10.512 110.669 1.00 19.22  ? 55  ASP C OD1 1 
ATOM   4124 O OD2 . ASP C 1 55  ? 16.855  -9.542  109.409 1.00 13.13  ? 55  ASP C OD2 1 
ATOM   4125 N N   . PHE C 1 56  ? 15.678  -14.307 108.050 1.00 13.84  ? 56  PHE C N   1 
ATOM   4126 C CA  . PHE C 1 56  ? 14.864  -15.487 107.821 1.00 16.15  ? 56  PHE C CA  1 
ATOM   4127 C C   . PHE C 1 56  ? 15.001  -15.815 106.326 1.00 18.50  ? 56  PHE C C   1 
ATOM   4128 O O   . PHE C 1 56  ? 14.203  -15.342 105.488 1.00 20.18  ? 56  PHE C O   1 
ATOM   4129 C CB  . PHE C 1 56  ? 13.396  -15.178 108.129 1.00 12.37  ? 56  PHE C CB  1 
ATOM   4130 C CG  . PHE C 1 56  ? 13.137  -14.891 109.574 1.00 6.51   ? 56  PHE C CG  1 
ATOM   4131 C CD1 . PHE C 1 56  ? 12.940  -15.942 110.493 1.00 2.00   ? 56  PHE C CD1 1 
ATOM   4132 C CD2 . PHE C 1 56  ? 13.038  -13.559 110.011 1.00 3.76   ? 56  PHE C CD2 1 
ATOM   4133 C CE1 . PHE C 1 56  ? 12.661  -15.654 111.842 1.00 5.72   ? 56  PHE C CE1 1 
ATOM   4134 C CE2 . PHE C 1 56  ? 12.767  -13.257 111.364 1.00 2.00   ? 56  PHE C CE2 1 
ATOM   4135 C CZ  . PHE C 1 56  ? 12.575  -14.289 112.273 1.00 4.07   ? 56  PHE C CZ  1 
ATOM   4136 N N   . PRO C 1 57  ? 16.036  -16.631 105.967 1.00 19.47  ? 57  PRO C N   1 
ATOM   4137 C CA  . PRO C 1 57  ? 16.316  -16.984 104.574 1.00 18.04  ? 57  PRO C CA  1 
ATOM   4138 C C   . PRO C 1 57  ? 15.081  -17.534 103.853 1.00 17.34  ? 57  PRO C C   1 
ATOM   4139 O O   . PRO C 1 57  ? 14.503  -18.551 104.243 1.00 17.13  ? 57  PRO C O   1 
ATOM   4140 C CB  . PRO C 1 57  ? 17.413  -18.055 104.699 1.00 17.72  ? 57  PRO C CB  1 
ATOM   4141 C CG  . PRO C 1 57  ? 18.115  -17.674 105.937 1.00 16.51  ? 57  PRO C CG  1 
ATOM   4142 C CD  . PRO C 1 57  ? 17.037  -17.188 106.893 1.00 17.60  ? 57  PRO C CD  1 
ATOM   4143 N N   . ASN C 1 58  ? 14.641  -16.811 102.810 1.00 18.82  ? 58  ASN C N   1 
ATOM   4144 C CA  . ASN C 1 58  ? 13.430  -17.187 102.085 1.00 20.95  ? 58  ASN C CA  1 
ATOM   4145 C C   . ASN C 1 58  ? 13.307  -16.432 100.767 1.00 20.05  ? 58  ASN C C   1 
ATOM   4146 O O   . ASN C 1 58  ? 13.875  -15.356 100.589 1.00 19.83  ? 58  ASN C O   1 
ATOM   4147 C CB  . ASN C 1 58  ? 12.184  -16.930 102.934 1.00 22.12  ? 58  ASN C CB  1 
ATOM   4148 C CG  . ASN C 1 58  ? 10.993  -17.698 102.462 1.00 21.16  ? 58  ASN C CG  1 
ATOM   4149 O OD1 . ASN C 1 58  ? 11.098  -18.856 102.043 1.00 20.26  ? 58  ASN C OD1 1 
ATOM   4150 N ND2 . ASN C 1 58  ? 9.860   -17.043 102.488 1.00 24.10  ? 58  ASN C ND2 1 
ATOM   4151 N N   . LEU C 1 59  ? 12.554  -17.036 99.845  1.00 18.67  ? 59  LEU C N   1 
ATOM   4152 C CA  . LEU C 1 59  ? 12.283  -16.438 98.543  1.00 17.44  ? 59  LEU C CA  1 
ATOM   4153 C C   . LEU C 1 59  ? 10.789  -16.032 98.473  1.00 17.71  ? 59  LEU C C   1 
ATOM   4154 O O   . LEU C 1 59  ? 9.887   -16.804 98.852  1.00 18.79  ? 59  LEU C O   1 
ATOM   4155 C CB  . LEU C 1 59  ? 12.570  -17.451 97.438  1.00 14.64  ? 59  LEU C CB  1 
ATOM   4156 C CG  . LEU C 1 59  ? 14.017  -17.794 97.136  1.00 12.03  ? 59  LEU C CG  1 
ATOM   4157 C CD1 . LEU C 1 59  ? 14.114  -18.951 96.181  1.00 10.65  ? 59  LEU C CD1 1 
ATOM   4158 C CD2 . LEU C 1 59  ? 14.670  -16.577 96.563  1.00 9.05   ? 59  LEU C CD2 1 
ATOM   4159 N N   . PRO C 1 60  ? 10.505  -14.802 97.964  1.00 16.92  ? 60  PRO C N   1 
ATOM   4160 C CA  . PRO C 1 60  ? 11.468  -13.803 97.503  1.00 17.21  ? 60  PRO C CA  1 
ATOM   4161 C C   . PRO C 1 60  ? 12.128  -13.019 98.633  1.00 17.46  ? 60  PRO C C   1 
ATOM   4162 O O   . PRO C 1 60  ? 11.660  -13.021 99.791  1.00 16.98  ? 60  PRO C O   1 
ATOM   4163 C CB  . PRO C 1 60  ? 10.600  -12.877 96.654  1.00 18.26  ? 60  PRO C CB  1 
ATOM   4164 C CG  . PRO C 1 60  ? 9.277   -12.911 97.342  1.00 15.33  ? 60  PRO C CG  1 
ATOM   4165 C CD  . PRO C 1 60  ? 9.113   -14.347 97.805  1.00 15.72  ? 60  PRO C CD  1 
ATOM   4166 N N   . TYR C 1 61  ? 13.198  -12.289 98.272  1.00 17.78  ? 61  TYR C N   1 
ATOM   4167 C CA  . TYR C 1 61  ? 13.869  -11.402 99.215  1.00 16.52  ? 61  TYR C CA  1 
ATOM   4168 C C   . TYR C 1 61  ? 14.263  -10.134 98.471  1.00 17.10  ? 61  TYR C C   1 
ATOM   4169 O O   . TYR C 1 61  ? 14.510  -10.165 97.265  1.00 17.55  ? 61  TYR C O   1 
ATOM   4170 C CB  . TYR C 1 61  ? 15.088  -12.118 99.840  1.00 13.90  ? 61  TYR C CB  1 
ATOM   4171 C CG  . TYR C 1 61  ? 16.236  -12.457 98.899  1.00 12.04  ? 61  TYR C CG  1 
ATOM   4172 C CD1 . TYR C 1 61  ? 17.073  -11.436 98.385  1.00 10.49  ? 61  TYR C CD1 1 
ATOM   4173 C CD2 . TYR C 1 61  ? 16.438  -13.790 98.471  1.00 12.59  ? 61  TYR C CD2 1 
ATOM   4174 C CE1 . TYR C 1 61  ? 18.084  -11.735 97.481  1.00 8.51   ? 61  TYR C CE1 1 
ATOM   4175 C CE2 . TYR C 1 61  ? 17.478  -14.102 97.555  1.00 10.65  ? 61  TYR C CE2 1 
ATOM   4176 C CZ  . TYR C 1 61  ? 18.298  -13.070 97.097  1.00 12.56  ? 61  TYR C CZ  1 
ATOM   4177 O OH  . TYR C 1 61  ? 19.278  -13.341 96.177  1.00 16.72  ? 61  TYR C OH  1 
ATOM   4178 N N   . LEU C 1 62  ? 14.361  -9.025  99.209  1.00 17.34  ? 62  LEU C N   1 
ATOM   4179 C CA  . LEU C 1 62  ? 14.774  -7.781  98.613  1.00 18.63  ? 62  LEU C CA  1 
ATOM   4180 C C   . LEU C 1 62  ? 15.893  -7.187  99.474  1.00 20.85  ? 62  LEU C C   1 
ATOM   4181 O O   . LEU C 1 62  ? 15.729  -7.014  100.704 1.00 21.40  ? 62  LEU C O   1 
ATOM   4182 C CB  . LEU C 1 62  ? 13.610  -6.796  98.530  1.00 20.92  ? 62  LEU C CB  1 
ATOM   4183 C CG  . LEU C 1 62  ? 13.962  -5.430  97.929  1.00 20.54  ? 62  LEU C CG  1 
ATOM   4184 C CD1 . LEU C 1 62  ? 14.106  -5.602  96.459  1.00 18.65  ? 62  LEU C CD1 1 
ATOM   4185 C CD2 . LEU C 1 62  ? 12.918  -4.373  98.296  1.00 25.48  ? 62  LEU C CD2 1 
ATOM   4186 N N   . ILE C 1 63  ? 17.009  -6.860  98.829  1.00 19.93  ? 63  ILE C N   1 
ATOM   4187 C CA  . ILE C 1 63  ? 18.154  -6.259  99.500  1.00 16.24  ? 63  ILE C CA  1 
ATOM   4188 C C   . ILE C 1 63  ? 18.241  -4.833  99.014  1.00 17.08  ? 63  ILE C C   1 
ATOM   4189 O O   . ILE C 1 63  ? 18.534  -4.599  97.859  1.00 16.04  ? 63  ILE C O   1 
ATOM   4190 C CB  . ILE C 1 63  ? 19.435  -7.052  99.185  1.00 14.47  ? 63  ILE C CB  1 
ATOM   4191 C CG1 . ILE C 1 63  ? 19.216  -8.525  99.592  1.00 11.99  ? 63  ILE C CG1 1 
ATOM   4192 C CG2 . ILE C 1 63  ? 20.611  -6.457  99.947  1.00 12.27  ? 63  ILE C CG2 1 
ATOM   4193 C CD1 . ILE C 1 63  ? 20.348  -9.446  99.189  1.00 8.49   ? 63  ILE C CD1 1 
ATOM   4194 N N   . ASP C 1 64  ? 17.999  -3.893  99.920  1.00 18.88  ? 64  ASP C N   1 
ATOM   4195 C CA  . ASP C 1 64  ? 18.100  -2.473  99.629  1.00 22.79  ? 64  ASP C CA  1 
ATOM   4196 C C   . ASP C 1 64  ? 19.091  -1.856  100.624 1.00 25.12  ? 64  ASP C C   1 
ATOM   4197 O O   . ASP C 1 64  ? 18.718  -1.459  101.757 1.00 27.59  ? 64  ASP C O   1 
ATOM   4198 C CB  . ASP C 1 64  ? 16.735  -1.787  99.779  1.00 25.57  ? 64  ASP C CB  1 
ATOM   4199 C CG  . ASP C 1 64  ? 16.761  -0.311  99.355  1.00 28.99  ? 64  ASP C CG  1 
ATOM   4200 O OD1 . ASP C 1 64  ? 17.783  0.176   98.834  1.00 32.71  ? 64  ASP C OD1 1 
ATOM   4201 O OD2 . ASP C 1 64  ? 15.738  0.381   99.554  1.00 34.55  ? 64  ASP C OD2 1 
ATOM   4202 N N   . GLY C 1 65  ? 20.348  -1.745  100.174 1.00 27.33  ? 65  GLY C N   1 
ATOM   4203 C CA  . GLY C 1 65  ? 21.400  -1.147  100.979 1.00 25.49  ? 65  GLY C CA  1 
ATOM   4204 C C   . GLY C 1 65  ? 21.682  -2.048  102.146 1.00 27.10  ? 65  GLY C C   1 
ATOM   4205 O O   . GLY C 1 65  ? 22.080  -3.208  101.964 1.00 26.21  ? 65  GLY C O   1 
ATOM   4206 N N   . THR C 1 66  ? 21.458  -1.531  103.350 1.00 27.26  ? 66  THR C N   1 
ATOM   4207 C CA  . THR C 1 66  ? 21.650  -2.306  104.564 1.00 27.07  ? 66  THR C CA  1 
ATOM   4208 C C   . THR C 1 66  ? 20.386  -3.124  104.871 1.00 27.30  ? 66  THR C C   1 
ATOM   4209 O O   . THR C 1 66  ? 20.446  -4.079  105.674 1.00 28.56  ? 66  THR C O   1 
ATOM   4210 C CB  . THR C 1 66  ? 21.909  -1.360  105.751 1.00 29.45  ? 66  THR C CB  1 
ATOM   4211 O OG1 . THR C 1 66  ? 20.973  -0.266  105.700 1.00 29.79  ? 66  THR C OG1 1 
ATOM   4212 C CG2 . THR C 1 66  ? 23.378  -0.825  105.677 1.00 32.03  ? 66  THR C CG2 1 
ATOM   4213 N N   . HIS C 1 67  ? 19.276  -2.749  104.241 1.00 25.09  ? 67  HIS C N   1 
ATOM   4214 C CA  . HIS C 1 67  ? 18.000  -3.423  104.456 1.00 22.23  ? 67  HIS C CA  1 
ATOM   4215 C C   . HIS C 1 67  ? 17.906  -4.712  103.656 1.00 22.13  ? 67  HIS C C   1 
ATOM   4216 O O   . HIS C 1 67  ? 18.119  -4.718  102.451 1.00 24.11  ? 67  HIS C O   1 
ATOM   4217 C CB  . HIS C 1 67  ? 16.854  -2.496  104.090 1.00 22.30  ? 67  HIS C CB  1 
ATOM   4218 C CG  . HIS C 1 67  ? 16.812  -1.239  104.886 1.00 23.06  ? 67  HIS C CG  1 
ATOM   4219 N ND1 . HIS C 1 67  ? 16.690  0.022   104.311 1.00 21.88  ? 67  HIS C ND1 1 
ATOM   4220 C CD2 . HIS C 1 67  ? 16.866  -1.002  106.227 1.00 23.49  ? 67  HIS C CD2 1 
ATOM   4221 C CE1 . HIS C 1 67  ? 16.675  0.941   105.241 1.00 23.46  ? 67  HIS C CE1 1 
ATOM   4222 N NE2 . HIS C 1 67  ? 16.782  0.348   106.423 1.00 23.84  ? 67  HIS C NE2 1 
ATOM   4223 N N   . LYS C 1 68  ? 17.607  -5.810  104.338 1.00 21.71  ? 68  LYS C N   1 
ATOM   4224 C CA  . LYS C 1 68  ? 17.426  -7.093  103.692 1.00 22.22  ? 68  LYS C CA  1 
ATOM   4225 C C   . LYS C 1 68  ? 16.081  -7.660  104.175 1.00 23.56  ? 68  LYS C C   1 
ATOM   4226 O O   . LYS C 1 68  ? 16.019  -8.314  105.246 1.00 26.17  ? 68  LYS C O   1 
ATOM   4227 C CB  . LYS C 1 68  ? 18.576  -8.029  104.068 1.00 23.49  ? 68  LYS C CB  1 
ATOM   4228 C CG  . LYS C 1 68  ? 19.931  -7.536  103.656 1.00 29.58  ? 68  LYS C CG  1 
ATOM   4229 C CD  . LYS C 1 68  ? 21.042  -8.485  104.148 1.00 33.38  ? 68  LYS C CD  1 
ATOM   4230 C CE  . LYS C 1 68  ? 22.433  -7.966  103.759 1.00 33.51  ? 68  LYS C CE  1 
ATOM   4231 N NZ  . LYS C 1 68  ? 22.672  -6.599  104.332 1.00 35.96  ? 68  LYS C NZ  1 
ATOM   4232 N N   . ILE C 1 69  ? 15.026  -7.426  103.390 1.00 20.93  ? 69  ILE C N   1 
ATOM   4233 C CA  . ILE C 1 69  ? 13.679  -7.823  103.778 1.00 21.32  ? 69  ILE C CA  1 
ATOM   4234 C C   . ILE C 1 69  ? 13.323  -9.145  103.092 1.00 19.33  ? 69  ILE C C   1 
ATOM   4235 O O   . ILE C 1 69  ? 13.752  -9.402  101.960 1.00 22.21  ? 69  ILE C O   1 
ATOM   4236 C CB  . ILE C 1 69  ? 12.619  -6.732  103.440 1.00 22.33  ? 69  ILE C CB  1 
ATOM   4237 C CG1 . ILE C 1 69  ? 13.044  -5.369  103.989 1.00 19.69  ? 69  ILE C CG1 1 
ATOM   4238 C CG2 . ILE C 1 69  ? 11.293  -7.102  104.079 1.00 21.68  ? 69  ILE C CG2 1 
ATOM   4239 C CD1 . ILE C 1 69  ? 13.768  -4.555  103.022 1.00 17.37  ? 69  ILE C CD1 1 
ATOM   4240 N N   . THR C 1 70  ? 12.503  -9.950  103.768 1.00 18.21  ? 70  THR C N   1 
ATOM   4241 C CA  . THR C 1 70  ? 11.914  -11.149 103.187 1.00 18.16  ? 70  THR C CA  1 
ATOM   4242 C C   . THR C 1 70  ? 10.404  -11.047 103.419 1.00 18.54  ? 70  THR C C   1 
ATOM   4243 O O   . THR C 1 70  ? 9.932   -10.081 104.045 1.00 14.51  ? 70  THR C O   1 
ATOM   4244 C CB  . THR C 1 70  ? 12.461  -12.420 103.837 1.00 17.06  ? 70  THR C CB  1 
ATOM   4245 O OG1 . THR C 1 70  ? 12.395  -12.288 105.258 1.00 17.47  ? 70  THR C OG1 1 
ATOM   4246 C CG2 . THR C 1 70  ? 13.905  -12.657 103.423 1.00 15.23  ? 70  THR C CG2 1 
ATOM   4247 N N   . GLN C 1 71  ? 9.661   -12.041 102.907 1.00 17.95  ? 71  GLN C N   1 
ATOM   4248 C CA  . GLN C 1 71  ? 8.185   -12.077 102.988 1.00 16.91  ? 71  GLN C CA  1 
ATOM   4249 C C   . GLN C 1 71  ? 7.551   -11.059 102.012 1.00 16.72  ? 71  GLN C C   1 
ATOM   4250 O O   . GLN C 1 71  ? 7.726   -9.842  102.188 1.00 15.98  ? 71  GLN C O   1 
ATOM   4251 C CB  . GLN C 1 71  ? 7.670   -11.832 104.423 1.00 17.91  ? 71  GLN C CB  1 
ATOM   4252 C CG  . GLN C 1 71  ? 8.062   -12.921 105.427 1.00 16.56  ? 71  GLN C CG  1 
ATOM   4253 C CD  . GLN C 1 71  ? 7.447   -14.275 105.099 1.00 16.18  ? 71  GLN C CD  1 
ATOM   4254 O OE1 . GLN C 1 71  ? 6.417   -14.355 104.495 1.00 20.72  ? 71  GLN C OE1 1 
ATOM   4255 N NE2 . GLN C 1 71  ? 8.095   -15.316 105.525 1.00 15.58  ? 71  GLN C NE2 1 
ATOM   4256 N N   . SER C 1 72  ? 6.823   -11.581 101.028 1.00 16.52  ? 72  SER C N   1 
ATOM   4257 C CA  . SER C 1 72  ? 6.124   -10.825 99.995  1.00 12.82  ? 72  SER C CA  1 
ATOM   4258 C C   . SER C 1 72  ? 5.491   -9.562  100.548 1.00 12.40  ? 72  SER C C   1 
ATOM   4259 O O   . SER C 1 72  ? 5.889   -8.477  100.158 1.00 10.31  ? 72  SER C O   1 
ATOM   4260 C CB  . SER C 1 72  ? 5.040   -11.700 99.369  1.00 16.41  ? 72  SER C CB  1 
ATOM   4261 O OG  . SER C 1 72  ? 5.581   -12.901 98.843  1.00 21.05  ? 72  SER C OG  1 
ATOM   4262 N N   . ASN C 1 73  ? 4.533   -9.704  101.465 1.00 11.53  ? 73  ASN C N   1 
ATOM   4263 C CA  . ASN C 1 73  ? 3.793   -8.566  102.011 1.00 11.25  ? 73  ASN C CA  1 
ATOM   4264 C C   . ASN C 1 73  ? 4.737   -7.528  102.615 1.00 9.82   ? 73  ASN C C   1 
ATOM   4265 O O   . ASN C 1 73  ? 4.504   -6.319  102.440 1.00 10.04  ? 73  ASN C O   1 
ATOM   4266 C CB  . ASN C 1 73  ? 2.802   -9.032  103.083 1.00 10.24  ? 73  ASN C CB  1 
ATOM   4267 C CG  . ASN C 1 73  ? 1.700   -9.883  102.510 1.00 5.46   ? 73  ASN C CG  1 
ATOM   4268 O OD1 . ASN C 1 73  ? 1.319   -9.711  101.384 1.00 4.43   ? 73  ASN C OD1 1 
ATOM   4269 N ND2 . ASN C 1 73  ? 1.194   -10.798 103.304 1.00 5.15   ? 73  ASN C ND2 1 
ATOM   4270 N N   . ALA C 1 74  ? 5.804   -7.995  103.269 1.00 8.13   ? 74  ALA C N   1 
ATOM   4271 C CA  . ALA C 1 74  ? 6.774   -7.110  103.918 1.00 7.66   ? 74  ALA C CA  1 
ATOM   4272 C C   . ALA C 1 74  ? 7.545   -6.296  102.864 1.00 7.61   ? 74  ALA C C   1 
ATOM   4273 O O   . ALA C 1 74  ? 7.716   -5.069  103.010 1.00 8.42   ? 74  ALA C O   1 
ATOM   4274 C CB  . ALA C 1 74  ? 7.727   -7.900  104.773 1.00 9.95   ? 74  ALA C CB  1 
ATOM   4275 N N   . ILE C 1 75  ? 7.961   -6.980  101.790 1.00 7.30   ? 75  ILE C N   1 
ATOM   4276 C CA  . ILE C 1 75  ? 8.695   -6.354  100.688 1.00 8.60   ? 75  ILE C CA  1 
ATOM   4277 C C   . ILE C 1 75  ? 7.807   -5.293  100.031 1.00 11.81  ? 75  ILE C C   1 
ATOM   4278 O O   . ILE C 1 75  ? 8.238   -4.173  99.816  1.00 16.80  ? 75  ILE C O   1 
ATOM   4279 C CB  . ILE C 1 75  ? 9.125   -7.388  99.649  1.00 9.42   ? 75  ILE C CB  1 
ATOM   4280 C CG1 . ILE C 1 75  ? 10.043  -8.443  100.304 1.00 9.87   ? 75  ILE C CG1 1 
ATOM   4281 C CG2 . ILE C 1 75  ? 9.822   -6.695  98.505  1.00 7.47   ? 75  ILE C CG2 1 
ATOM   4282 C CD1 . ILE C 1 75  ? 10.530  -9.544  99.389  1.00 6.67   ? 75  ILE C CD1 1 
ATOM   4283 N N   . LEU C 1 76  ? 6.562   -5.656  99.741  1.00 9.52   ? 76  LEU C N   1 
ATOM   4284 C CA  . LEU C 1 76  ? 5.617   -4.732  99.130  1.00 9.90   ? 76  LEU C CA  1 
ATOM   4285 C C   . LEU C 1 76  ? 5.426   -3.513  100.023 1.00 12.52  ? 76  LEU C C   1 
ATOM   4286 O O   . LEU C 1 76  ? 5.543   -2.374  99.556  1.00 11.11  ? 76  LEU C O   1 
ATOM   4287 C CB  . LEU C 1 76  ? 4.274   -5.442  98.842  1.00 12.23  ? 76  LEU C CB  1 
ATOM   4288 C CG  . LEU C 1 76  ? 4.257   -6.478  97.710  1.00 9.81   ? 76  LEU C CG  1 
ATOM   4289 C CD1 . LEU C 1 76  ? 2.961   -7.167  97.684  1.00 8.68   ? 76  LEU C CD1 1 
ATOM   4290 C CD2 . LEU C 1 76  ? 4.520   -5.804  96.408  1.00 14.26  ? 76  LEU C CD2 1 
ATOM   4291 N N   . ARG C 1 77  ? 5.109   -3.758  101.290 1.00 13.83  ? 77  ARG C N   1 
ATOM   4292 C CA  . ARG C 1 77  ? 4.896   -2.681  102.246 1.00 14.94  ? 77  ARG C CA  1 
ATOM   4293 C C   . ARG C 1 77  ? 6.115   -1.728  102.316 1.00 16.50  ? 77  ARG C C   1 
ATOM   4294 O O   . ARG C 1 77  ? 5.946   -0.480  102.373 1.00 16.30  ? 77  ARG C O   1 
ATOM   4295 C CB  . ARG C 1 77  ? 4.577   -3.258  103.633 1.00 13.54  ? 77  ARG C CB  1 
ATOM   4296 C CG  . ARG C 1 77  ? 3.168   -3.777  103.772 1.00 13.16  ? 77  ARG C CG  1 
ATOM   4297 C CD  . ARG C 1 77  ? 2.888   -4.297  105.148 1.00 13.84  ? 77  ARG C CD  1 
ATOM   4298 N NE  . ARG C 1 77  ? 1.482   -4.580  105.399 1.00 12.87  ? 77  ARG C NE  1 
ATOM   4299 C CZ  . ARG C 1 77  ? 0.591   -3.666  105.763 1.00 17.66  ? 77  ARG C CZ  1 
ATOM   4300 N NH1 . ARG C 1 77  ? 0.963   -2.407  105.924 1.00 16.94  ? 77  ARG C NH1 1 
ATOM   4301 N NH2 . ARG C 1 77  ? -0.666  -4.016  105.971 1.00 22.07  ? 77  ARG C NH2 1 
ATOM   4302 N N   . TYR C 1 78  ? 7.323   -2.304  102.286 1.00 16.44  ? 78  TYR C N   1 
ATOM   4303 C CA  . TYR C 1 78  ? 8.533   -1.504  102.312 1.00 17.06  ? 78  TYR C CA  1 
ATOM   4304 C C   . TYR C 1 78  ? 8.594   -0.547  101.104 1.00 17.37  ? 78  TYR C C   1 
ATOM   4305 O O   . TYR C 1 78  ? 8.733   0.672   101.275 1.00 17.56  ? 78  TYR C O   1 
ATOM   4306 C CB  . TYR C 1 78  ? 9.760   -2.405  102.339 1.00 20.00  ? 78  TYR C CB  1 
ATOM   4307 C CG  . TYR C 1 78  ? 11.062  -1.637  102.248 1.00 21.97  ? 78  TYR C CG  1 
ATOM   4308 C CD1 . TYR C 1 78  ? 11.328  -0.578  103.146 1.00 22.72  ? 78  TYR C CD1 1 
ATOM   4309 C CD2 . TYR C 1 78  ? 12.021  -1.949  101.254 1.00 23.32  ? 78  TYR C CD2 1 
ATOM   4310 C CE1 . TYR C 1 78  ? 12.522  0.155   103.066 1.00 25.45  ? 78  TYR C CE1 1 
ATOM   4311 C CE2 . TYR C 1 78  ? 13.230  -1.226  101.159 1.00 25.08  ? 78  TYR C CE2 1 
ATOM   4312 C CZ  . TYR C 1 78  ? 13.468  -0.170  102.070 1.00 26.92  ? 78  TYR C CZ  1 
ATOM   4313 O OH  . TYR C 1 78  ? 14.646  0.557   102.033 1.00 28.93  ? 78  TYR C OH  1 
ATOM   4314 N N   . ILE C 1 79  ? 8.489   -1.107  99.895  1.00 17.97  ? 79  ILE C N   1 
ATOM   4315 C CA  . ILE C 1 79  ? 8.552   -0.326  98.662  1.00 19.66  ? 79  ILE C CA  1 
ATOM   4316 C C   . ILE C 1 79  ? 7.384   0.685   98.614  1.00 20.58  ? 79  ILE C C   1 
ATOM   4317 O O   . ILE C 1 79  ? 7.568   1.838   98.170  1.00 18.91  ? 79  ILE C O   1 
ATOM   4318 C CB  . ILE C 1 79  ? 8.481   -1.238  97.433  1.00 20.73  ? 79  ILE C CB  1 
ATOM   4319 C CG1 . ILE C 1 79  ? 9.605   -2.276  97.489  1.00 22.92  ? 79  ILE C CG1 1 
ATOM   4320 C CG2 . ILE C 1 79  ? 8.610   -0.407  96.174  1.00 22.82  ? 79  ILE C CG2 1 
ATOM   4321 C CD1 . ILE C 1 79  ? 9.528   -3.343  96.426  1.00 27.08  ? 79  ILE C CD1 1 
ATOM   4322 N N   . ALA C 1 80  ? 6.216   0.249   99.092  1.00 20.61  ? 80  ALA C N   1 
ATOM   4323 C CA  . ALA C 1 80  ? 5.013   1.066   99.127  1.00 20.85  ? 80  ALA C CA  1 
ATOM   4324 C C   . ALA C 1 80  ? 5.274   2.302   99.967  1.00 22.27  ? 80  ALA C C   1 
ATOM   4325 O O   . ALA C 1 80  ? 5.052   3.421   99.515  1.00 24.29  ? 80  ALA C O   1 
ATOM   4326 C CB  . ALA C 1 80  ? 3.880   0.267   99.689  1.00 20.17  ? 80  ALA C CB  1 
ATOM   4327 N N   . ARG C 1 81  ? 5.772   2.092   101.185 1.00 22.98  ? 81  ARG C N   1 
ATOM   4328 C CA  . ARG C 1 81  ? 6.078   3.187   102.096 1.00 22.56  ? 81  ARG C CA  1 
ATOM   4329 C C   . ARG C 1 81  ? 7.132   4.094   101.482 1.00 22.82  ? 81  ARG C C   1 
ATOM   4330 O O   . ARG C 1 81  ? 6.998   5.322   101.519 1.00 22.09  ? 81  ARG C O   1 
ATOM   4331 C CB  . ARG C 1 81  ? 6.560   2.645   103.448 1.00 20.21  ? 81  ARG C CB  1 
ATOM   4332 C CG  . ARG C 1 81  ? 5.463   2.467   104.470 1.00 16.18  ? 81  ARG C CG  1 
ATOM   4333 C CD  . ARG C 1 81  ? 5.990   1.841   105.722 1.00 15.92  ? 81  ARG C CD  1 
ATOM   4334 N NE  . ARG C 1 81  ? 6.308   0.428   105.520 1.00 19.48  ? 81  ARG C NE  1 
ATOM   4335 C CZ  . ARG C 1 81  ? 7.395   -0.160  106.007 1.00 20.41  ? 81  ARG C CZ  1 
ATOM   4336 N NH1 . ARG C 1 81  ? 8.256   0.552   106.711 1.00 15.71  ? 81  ARG C NH1 1 
ATOM   4337 N NH2 . ARG C 1 81  ? 7.628   -1.448  105.790 1.00 17.82  ? 81  ARG C NH2 1 
ATOM   4338 N N   . LYS C 1 82  ? 8.158   3.478   100.898 1.00 25.00  ? 82  LYS C N   1 
ATOM   4339 C CA  . LYS C 1 82  ? 9.258   4.206   100.278 1.00 28.05  ? 82  LYS C CA  1 
ATOM   4340 C C   . LYS C 1 82  ? 8.786   5.092   99.118  1.00 29.97  ? 82  LYS C C   1 
ATOM   4341 O O   . LYS C 1 82  ? 9.520   5.961   98.663  1.00 34.26  ? 82  LYS C O   1 
ATOM   4342 C CB  . LYS C 1 82  ? 10.320  3.222   99.784  1.00 25.66  ? 82  LYS C CB  1 
ATOM   4343 C CG  . LYS C 1 82  ? 11.669  3.842   99.405  1.00 26.64  ? 82  LYS C CG  1 
ATOM   4344 C CD  . LYS C 1 82  ? 12.704  2.751   99.108  1.00 29.67  ? 82  LYS C CD  1 
ATOM   4345 C CE  . LYS C 1 82  ? 12.580  2.220   97.660  1.00 34.20  ? 82  LYS C CE  1 
ATOM   4346 N NZ  . LYS C 1 82  ? 11.362  1.368   97.399  1.00 28.83  ? 82  LYS C NZ  1 
ATOM   4347 N N   . HIS C 1 83  ? 7.573   4.861   98.633  1.00 30.74  ? 83  HIS C N   1 
ATOM   4348 C CA  . HIS C 1 83  ? 7.033   5.682   97.554  1.00 30.03  ? 83  HIS C CA  1 
ATOM   4349 C C   . HIS C 1 83  ? 5.648   6.258   97.880  1.00 30.23  ? 83  HIS C C   1 
ATOM   4350 O O   . HIS C 1 83  ? 4.961   6.763   96.993  1.00 30.14  ? 83  HIS C O   1 
ATOM   4351 C CB  . HIS C 1 83  ? 6.970   4.858   96.273  1.00 30.64  ? 83  HIS C CB  1 
ATOM   4352 C CG  . HIS C 1 83  ? 8.313   4.369   95.812  1.00 33.42  ? 83  HIS C CG  1 
ATOM   4353 N ND1 . HIS C 1 83  ? 9.283   5.212   95.363  1.00 34.31  ? 83  HIS C ND1 1 
ATOM   4354 C CD2 . HIS C 1 83  ? 8.819   3.103   95.756  1.00 32.84  ? 83  HIS C CD2 1 
ATOM   4355 C CE1 . HIS C 1 83  ? 10.360  4.492   95.016  1.00 34.34  ? 83  HIS C CE1 1 
ATOM   4356 N NE2 . HIS C 1 83  ? 10.094  3.238   95.244  1.00 31.39  ? 83  HIS C NE2 1 
ATOM   4357 N N   . ASN C 1 84  ? 5.275   6.192   99.157  1.00 30.40  ? 84  ASN C N   1 
ATOM   4358 C CA  . ASN C 1 84  ? 3.997   6.737   99.644  1.00 31.43  ? 84  ASN C CA  1 
ATOM   4359 C C   . ASN C 1 84  ? 2.737   6.086   99.002  1.00 30.10  ? 84  ASN C C   1 
ATOM   4360 O O   . ASN C 1 84  ? 1.661   6.708   98.925  1.00 28.38  ? 84  ASN C O   1 
ATOM   4361 C CB  . ASN C 1 84  ? 4.002   8.271   99.506  1.00 36.79  ? 84  ASN C CB  1 
ATOM   4362 C CG  . ASN C 1 84  ? 2.870   8.948   100.290 1.00 42.95  ? 84  ASN C CG  1 
ATOM   4363 O OD1 . ASN C 1 84  ? 2.362   9.982   99.875  1.00 48.47  ? 84  ASN C OD1 1 
ATOM   4364 N ND2 . ASN C 1 84  ? 2.455   8.342   101.401 1.00 45.34  ? 84  ASN C ND2 1 
ATOM   4365 N N   . LEU C 1 85  ? 2.859   4.850   98.565  1.00 27.31  ? 85  LEU C N   1 
ATOM   4366 C CA  . LEU C 1 85  ? 1.749   4.146   97.952  1.00 26.03  ? 85  LEU C CA  1 
ATOM   4367 C C   . LEU C 1 85  ? 0.910   3.330   98.943  1.00 25.37  ? 85  LEU C C   1 
ATOM   4368 O O   . LEU C 1 85  ? 0.519   2.189   98.654  1.00 24.75  ? 85  LEU C O   1 
ATOM   4369 C CB  . LEU C 1 85  ? 2.278   3.261   96.825  1.00 23.84  ? 85  LEU C CB  1 
ATOM   4370 C CG  . LEU C 1 85  ? 3.028   3.956   95.671  1.00 20.54  ? 85  LEU C CG  1 
ATOM   4371 C CD1 . LEU C 1 85  ? 3.475   2.927   94.664  1.00 19.73  ? 85  LEU C CD1 1 
ATOM   4372 C CD2 . LEU C 1 85  ? 2.135   4.996   95.009  1.00 16.33  ? 85  LEU C CD2 1 
ATOM   4373 N N   . CYS C 1 86  ? 0.633   3.925   100.101 1.00 26.44  ? 86  CYS C N   1 
ATOM   4374 C CA  . CYS C 1 86  ? -0.079  3.219   101.171 1.00 26.63  ? 86  CYS C CA  1 
ATOM   4375 C C   . CYS C 1 86  ? -1.299  4.021   101.615 1.00 26.19  ? 86  CYS C C   1 
ATOM   4376 O O   . CYS C 1 86  ? -1.421  5.205   101.268 1.00 27.43  ? 86  CYS C O   1 
ATOM   4377 C CB  . CYS C 1 86  ? 0.835   2.999   102.379 1.00 26.48  ? 86  CYS C CB  1 
ATOM   4378 S SG  . CYS C 1 86  ? 2.371   2.123   102.002 1.00 31.23  ? 86  CYS C SG  1 
ATOM   4379 N N   . GLY C 1 87  ? -2.178  3.383   102.396 1.00 25.94  ? 87  GLY C N   1 
ATOM   4380 C CA  . GLY C 1 87  ? -3.359  4.059   102.916 1.00 28.33  ? 87  GLY C CA  1 
ATOM   4381 C C   . GLY C 1 87  ? -3.006  5.019   104.031 1.00 28.60  ? 87  GLY C C   1 
ATOM   4382 O O   . GLY C 1 87  ? -2.225  4.687   104.909 1.00 28.50  ? 87  GLY C O   1 
ATOM   4383 N N   . GLU C 1 88  ? -3.564  6.224   104.001 1.00 29.37  ? 88  GLU C N   1 
ATOM   4384 C CA  . GLU C 1 88  ? -3.260  7.240   104.992 1.00 30.68  ? 88  GLU C CA  1 
ATOM   4385 C C   . GLU C 1 88  ? -4.244  7.230   106.146 1.00 30.96  ? 88  GLU C C   1 
ATOM   4386 O O   . GLU C 1 88  ? -3.840  6.976   107.271 1.00 34.78  ? 88  GLU C O   1 
ATOM   4387 C CB  . GLU C 1 88  ? -3.228  8.620   104.346 1.00 32.10  ? 88  GLU C CB  1 
ATOM   4388 C CG  . GLU C 1 88  ? -2.170  8.750   103.241 1.00 37.07  ? 88  GLU C CG  1 
ATOM   4389 C CD  . GLU C 1 88  ? -2.121  10.148  102.618 1.00 39.93  ? 88  GLU C CD  1 
ATOM   4390 O OE1 . GLU C 1 88  ? -3.181  10.613  102.108 1.00 42.39  ? 88  GLU C OE1 1 
ATOM   4391 O OE2 . GLU C 1 88  ? -1.027  10.778  102.656 1.00 41.02  ? 88  GLU C OE2 1 
ATOM   4392 N N   . SER C 1 89  ? -5.519  7.497   105.872 1.00 28.37  ? 89  SER C N   1 
ATOM   4393 C CA  . SER C 1 89  ? -6.529  7.541   106.927 1.00 27.41  ? 89  SER C CA  1 
ATOM   4394 C C   . SER C 1 89  ? -6.837  6.163   107.471 1.00 28.02  ? 89  SER C C   1 
ATOM   4395 O O   . SER C 1 89  ? -6.633  5.158   106.794 1.00 26.72  ? 89  SER C O   1 
ATOM   4396 C CB  . SER C 1 89  ? -7.817  8.152   106.399 1.00 28.21  ? 89  SER C CB  1 
ATOM   4397 O OG  . SER C 1 89  ? -8.315  7.397   105.306 1.00 29.19  ? 89  SER C OG  1 
ATOM   4398 N N   . GLU C 1 90  ? -7.333  6.126   108.706 1.00 28.14  ? 90  GLU C N   1 
ATOM   4399 C CA  . GLU C 1 90  ? -7.672  4.883   109.386 1.00 28.88  ? 90  GLU C CA  1 
ATOM   4400 C C   . GLU C 1 90  ? -8.510  3.956   108.513 1.00 29.04  ? 90  GLU C C   1 
ATOM   4401 O O   . GLU C 1 90  ? -8.250  2.750   108.418 1.00 29.53  ? 90  GLU C O   1 
ATOM   4402 C CB  . GLU C 1 90  ? -8.401  5.185   110.697 1.00 30.79  ? 90  GLU C CB  1 
ATOM   4403 C CG  . GLU C 1 90  ? -8.858  3.954   111.478 1.00 34.73  ? 90  GLU C CG  1 
ATOM   4404 C CD  . GLU C 1 90  ? -9.590  4.329   112.763 1.00 38.22  ? 90  GLU C CD  1 
ATOM   4405 O OE1 . GLU C 1 90  ? -10.704 4.923   112.672 1.00 38.13  ? 90  GLU C OE1 1 
ATOM   4406 O OE2 . GLU C 1 90  ? -9.046  4.027   113.860 1.00 42.99  ? 90  GLU C OE2 1 
ATOM   4407 N N   . LYS C 1 91  ? -9.495  4.546   107.842 1.00 29.47  ? 91  LYS C N   1 
ATOM   4408 C CA  . LYS C 1 91  ? -10.427 3.804   106.996 1.00 27.33  ? 91  LYS C CA  1 
ATOM   4409 C C   . LYS C 1 91  ? -9.684  3.115   105.867 1.00 24.99  ? 91  LYS C C   1 
ATOM   4410 O O   . LYS C 1 91  ? -9.888  1.918   105.624 1.00 24.10  ? 91  LYS C O   1 
ATOM   4411 C CB  . LYS C 1 91  ? -11.494 4.738   106.415 1.00 29.42  ? 91  LYS C CB  1 
ATOM   4412 C CG  . LYS C 1 91  ? -12.522 5.234   107.438 1.00 34.26  ? 91  LYS C CG  1 
ATOM   4413 C CD  . LYS C 1 91  ? -11.885 6.151   108.527 1.00 36.36  ? 91  LYS C CD  1 
ATOM   4414 C CE  . LYS C 1 91  ? -12.816 6.372   109.699 1.00 40.16  ? 91  LYS C CE  1 
ATOM   4415 N NZ  . LYS C 1 91  ? -12.121 7.081   110.814 1.00 41.60  ? 91  LYS C NZ  1 
ATOM   4416 N N   . GLU C 1 92  ? -8.792  3.862   105.211 1.00 22.81  ? 92  GLU C N   1 
ATOM   4417 C CA  . GLU C 1 92  ? -7.974  3.316   104.129 1.00 21.82  ? 92  GLU C CA  1 
ATOM   4418 C C   . GLU C 1 92  ? -7.095  2.185   104.671 1.00 20.33  ? 92  GLU C C   1 
ATOM   4419 O O   . GLU C 1 92  ? -6.992  1.121   104.053 1.00 20.45  ? 92  GLU C O   1 
ATOM   4420 C CB  . GLU C 1 92  ? -7.098  4.401   103.488 1.00 22.70  ? 92  GLU C CB  1 
ATOM   4421 C CG  . GLU C 1 92  ? -7.897  5.514   102.832 1.00 24.68  ? 92  GLU C CG  1 
ATOM   4422 C CD  . GLU C 1 92  ? -7.033  6.605   102.246 1.00 27.84  ? 92  GLU C CD  1 
ATOM   4423 O OE1 . GLU C 1 92  ? -6.181  7.150   102.960 1.00 29.09  ? 92  GLU C OE1 1 
ATOM   4424 O OE2 . GLU C 1 92  ? -7.185  6.921   101.056 1.00 31.92  ? 92  GLU C OE2 1 
ATOM   4425 N N   . GLN C 1 93  ? -6.481  2.418   105.826 1.00 19.49  ? 93  GLN C N   1 
ATOM   4426 C CA  . GLN C 1 93  ? -5.603  1.435   106.435 1.00 16.82  ? 93  GLN C CA  1 
ATOM   4427 C C   . GLN C 1 93  ? -6.347  0.132   106.759 1.00 14.84  ? 93  GLN C C   1 
ATOM   4428 O O   . GLN C 1 93  ? -5.825  -0.960  106.512 1.00 14.61  ? 93  GLN C O   1 
ATOM   4429 C CB  . GLN C 1 93  ? -4.945  2.020   107.675 1.00 19.12  ? 93  GLN C CB  1 
ATOM   4430 C CG  . GLN C 1 93  ? -4.014  3.167   107.391 1.00 24.11  ? 93  GLN C CG  1 
ATOM   4431 C CD  . GLN C 1 93  ? -3.623  3.940   108.667 1.00 26.90  ? 93  GLN C CD  1 
ATOM   4432 O OE1 . GLN C 1 93  ? -4.415  4.102   109.598 1.00 27.59  ? 93  GLN C OE1 1 
ATOM   4433 N NE2 . GLN C 1 93  ? -2.393  4.411   108.695 1.00 26.39  ? 93  GLN C NE2 1 
ATOM   4434 N N   . ILE C 1 94  ? -7.578  0.242   107.279 1.00 11.65  ? 94  ILE C N   1 
ATOM   4435 C CA  . ILE C 1 94  ? -8.364  -0.937  107.588 1.00 9.71   ? 94  ILE C CA  1 
ATOM   4436 C C   . ILE C 1 94  ? -8.641  -1.751  106.325 1.00 11.19  ? 94  ILE C C   1 
ATOM   4437 O O   . ILE C 1 94  ? -8.526  -2.987  106.347 1.00 9.01   ? 94  ILE C O   1 
ATOM   4438 C CB  . ILE C 1 94  ? -9.720  -0.575  108.230 1.00 8.93   ? 94  ILE C CB  1 
ATOM   4439 C CG1 . ILE C 1 94  ? -9.506  0.214   109.519 1.00 6.50   ? 94  ILE C CG1 1 
ATOM   4440 C CG2 . ILE C 1 94  ? -10.487 -1.866  108.566 1.00 10.62  ? 94  ILE C CG2 1 
ATOM   4441 C CD1 . ILE C 1 94  ? -10.791 0.662   110.192 1.00 9.83   ? 94  ILE C CD1 1 
ATOM   4442 N N   . ARG C 1 95  ? -9.008  -1.045  105.246 1.00 12.50  ? 95  ARG C N   1 
ATOM   4443 C CA  . ARG C 1 95  ? -9.271  -1.669  103.944 1.00 13.07  ? 95  ARG C CA  1 
ATOM   4444 C C   . ARG C 1 95  ? -8.024  -2.393  103.474 1.00 13.32  ? 95  ARG C C   1 
ATOM   4445 O O   . ARG C 1 95  ? -8.085  -3.580  103.116 1.00 14.15  ? 95  ARG C O   1 
ATOM   4446 C CB  . ARG C 1 95  ? -9.630  -0.628  102.905 1.00 16.16  ? 95  ARG C CB  1 
ATOM   4447 C CG  . ARG C 1 95  ? -11.059 -0.238  102.915 1.00 19.97  ? 95  ARG C CG  1 
ATOM   4448 C CD  . ARG C 1 95  ? -11.362 0.676   101.714 1.00 23.98  ? 95  ARG C CD  1 
ATOM   4449 N NE  . ARG C 1 95  ? -12.783 0.674   101.362 1.00 26.95  ? 95  ARG C NE  1 
ATOM   4450 C CZ  . ARG C 1 95  ? -13.303 0.177   100.238 1.00 28.06  ? 95  ARG C CZ  1 
ATOM   4451 N NH1 . ARG C 1 95  ? -12.501 -0.329  99.301  1.00 22.47  ? 95  ARG C NH1 1 
ATOM   4452 N NH2 . ARG C 1 95  ? -14.624 0.194   100.062 1.00 33.35  ? 95  ARG C NH2 1 
ATOM   4453 N N   . GLU C 1 96  ? -6.896  -1.672  103.546 1.00 12.14  ? 96  GLU C N   1 
ATOM   4454 C CA  . GLU C 1 96  ? -5.567  -2.167  103.187 1.00 14.14  ? 96  GLU C CA  1 
ATOM   4455 C C   . GLU C 1 96  ? -5.224  -3.463  103.913 1.00 14.71  ? 96  GLU C C   1 
ATOM   4456 O O   . GLU C 1 96  ? -4.832  -4.456  103.285 1.00 15.63  ? 96  GLU C O   1 
ATOM   4457 C CB  . GLU C 1 96  ? -4.552  -1.092  103.538 1.00 17.04  ? 96  GLU C CB  1 
ATOM   4458 C CG  . GLU C 1 96  ? -3.166  -1.338  103.074 1.00 17.24  ? 96  GLU C CG  1 
ATOM   4459 C CD  . GLU C 1 96  ? -2.364  -0.051  103.092 1.00 17.59  ? 96  GLU C CD  1 
ATOM   4460 O OE1 . GLU C 1 96  ? -1.907  0.341   104.191 1.00 18.27  ? 96  GLU C OE1 1 
ATOM   4461 O OE2 . GLU C 1 96  ? -2.153  0.542   102.005 1.00 22.38  ? 96  GLU C OE2 1 
ATOM   4462 N N   . ASP C 1 97  ? -5.400  -3.449  105.234 1.00 14.35  ? 97  ASP C N   1 
ATOM   4463 C CA  . ASP C 1 97  ? -5.123  -4.606  106.085 1.00 14.82  ? 97  ASP C CA  1 
ATOM   4464 C C   . ASP C 1 97  ? -6.015  -5.824  105.824 1.00 14.78  ? 97  ASP C C   1 
ATOM   4465 O O   . ASP C 1 97  ? -5.501  -6.951  105.682 1.00 14.33  ? 97  ASP C O   1 
ATOM   4466 C CB  . ASP C 1 97  ? -5.249  -4.233  107.565 1.00 15.25  ? 97  ASP C CB  1 
ATOM   4467 C CG  . ASP C 1 97  ? -4.197  -3.253  108.021 1.00 13.70  ? 97  ASP C CG  1 
ATOM   4468 O OD1 . ASP C 1 97  ? -3.225  -2.981  107.295 1.00 11.60  ? 97  ASP C OD1 1 
ATOM   4469 O OD2 . ASP C 1 97  ? -4.365  -2.740  109.140 1.00 15.77  ? 97  ASP C OD2 1 
ATOM   4470 N N   . ILE C 1 98  ? -7.329  -5.581  105.730 1.00 16.10  ? 98  ILE C N   1 
ATOM   4471 C CA  . ILE C 1 98  ? -8.307  -6.629  105.430 1.00 16.14  ? 98  ILE C CA  1 
ATOM   4472 C C   . ILE C 1 98  ? -8.023  -7.249  104.060 1.00 13.80  ? 98  ILE C C   1 
ATOM   4473 O O   . ILE C 1 98  ? -7.960  -8.481  103.932 1.00 12.78  ? 98  ILE C O   1 
ATOM   4474 C CB  . ILE C 1 98  ? -9.768  -6.097  105.453 1.00 19.96  ? 98  ILE C CB  1 
ATOM   4475 C CG1 . ILE C 1 98  ? -10.092 -5.545  106.842 1.00 23.13  ? 98  ILE C CG1 1 
ATOM   4476 C CG2 . ILE C 1 98  ? -10.736 -7.227  105.128 1.00 15.53  ? 98  ILE C CG2 1 
ATOM   4477 C CD1 . ILE C 1 98  ? -11.463 -4.979  106.966 1.00 28.34  ? 98  ILE C CD1 1 
ATOM   4478 N N   . LEU C 1 99  ? -7.848  -6.393  103.047 1.00 11.60  ? 99  LEU C N   1 
ATOM   4479 C CA  . LEU C 1 99  ? -7.576  -6.845  101.691 1.00 14.14  ? 99  LEU C CA  1 
ATOM   4480 C C   . LEU C 1 99  ? -6.259  -7.580  101.557 1.00 15.48  ? 99  LEU C C   1 
ATOM   4481 O O   . LEU C 1 99  ? -6.250  -8.633  100.931 1.00 15.87  ? 99  LEU C O   1 
ATOM   4482 C CB  . LEU C 1 99  ? -7.604  -5.681  100.713 1.00 16.34  ? 99  LEU C CB  1 
ATOM   4483 C CG  . LEU C 1 99  ? -9.007  -5.194  100.318 1.00 15.98  ? 99  LEU C CG  1 
ATOM   4484 C CD1 . LEU C 1 99  ? -8.910  -3.864  99.551  1.00 13.22  ? 99  LEU C CD1 1 
ATOM   4485 C CD2 . LEU C 1 99  ? -9.691  -6.251  99.484  1.00 11.99  ? 99  LEU C CD2 1 
ATOM   4486 N N   . GLU C 1 100 ? -5.184  -7.062  102.154 1.00 16.03  ? 100 GLU C N   1 
ATOM   4487 C CA  . GLU C 1 100 ? -3.873  -7.715  102.110 1.00 17.27  ? 100 GLU C CA  1 
ATOM   4488 C C   . GLU C 1 100 ? -3.979  -9.162  102.561 1.00 17.93  ? 100 GLU C C   1 
ATOM   4489 O O   . GLU C 1 100 ? -3.509  -10.068 101.873 1.00 17.25  ? 100 GLU C O   1 
ATOM   4490 C CB  . GLU C 1 100 ? -2.877  -6.966  102.991 1.00 20.87  ? 100 GLU C CB  1 
ATOM   4491 C CG  . GLU C 1 100 ? -1.490  -7.614  103.060 1.00 24.35  ? 100 GLU C CG  1 
ATOM   4492 C CD  . GLU C 1 100 ? -0.543  -6.919  104.015 1.00 27.50  ? 100 GLU C CD  1 
ATOM   4493 O OE1 . GLU C 1 100 ? -0.916  -6.677  105.183 1.00 27.80  ? 100 GLU C OE1 1 
ATOM   4494 O OE2 . GLU C 1 100 ? 0.579   -6.595  103.582 1.00 31.70  ? 100 GLU C OE2 1 
ATOM   4495 N N   . ASN C 1 101 ? -4.618  -9.369  103.708 1.00 17.15  ? 101 ASN C N   1 
ATOM   4496 C CA  . ASN C 1 101 ? -4.802  -10.702 104.271 1.00 16.00  ? 101 ASN C CA  1 
ATOM   4497 C C   . ASN C 1 101 ? -5.784  -11.534 103.434 1.00 15.75  ? 101 ASN C C   1 
ATOM   4498 O O   . ASN C 1 101 ? -5.509  -12.715 103.147 1.00 16.69  ? 101 ASN C O   1 
ATOM   4499 C CB  . ASN C 1 101 ? -5.314  -10.617 105.709 1.00 16.52  ? 101 ASN C CB  1 
ATOM   4500 C CG  . ASN C 1 101 ? -4.239  -10.233 106.679 1.00 19.06  ? 101 ASN C CG  1 
ATOM   4501 O OD1 . ASN C 1 101 ? -3.480  -11.080 107.159 1.00 22.56  ? 101 ASN C OD1 1 
ATOM   4502 N ND2 . ASN C 1 101 ? -4.149  -8.942  106.967 1.00 18.81  ? 101 ASN C ND2 1 
ATOM   4503 N N   . GLN C 1 102 ? -6.890  -10.914 103.042 1.00 14.65  ? 102 GLN C N   1 
ATOM   4504 C CA  . GLN C 1 102 ? -7.927  -11.585 102.275 1.00 13.70  ? 102 GLN C CA  1 
ATOM   4505 C C   . GLN C 1 102 ? -7.357  -12.073 100.941 1.00 13.00  ? 102 GLN C C   1 
ATOM   4506 O O   . GLN C 1 102 ? -7.633  -13.202 100.535 1.00 13.41  ? 102 GLN C O   1 
ATOM   4507 C CB  . GLN C 1 102 ? -9.120  -10.651 102.084 1.00 11.47  ? 102 GLN C CB  1 
ATOM   4508 C CG  . GLN C 1 102 ? -10.349 -11.323 101.523 1.00 7.77   ? 102 GLN C CG  1 
ATOM   4509 C CD  . GLN C 1 102 ? -10.876 -12.444 102.420 1.00 7.43   ? 102 GLN C CD  1 
ATOM   4510 O OE1 . GLN C 1 102 ? -11.097 -12.243 103.605 1.00 11.10  ? 102 GLN C OE1 1 
ATOM   4511 N NE2 . GLN C 1 102 ? -11.092 -13.613 101.836 1.00 5.05   ? 102 GLN C NE2 1 
ATOM   4512 N N   . PHE C 1 103 ? -6.553  -11.240 100.284 1.00 13.82  ? 103 PHE C N   1 
ATOM   4513 C CA  . PHE C 1 103 ? -6.008  -11.583 98.985  1.00 16.30  ? 103 PHE C CA  1 
ATOM   4514 C C   . PHE C 1 103 ? -5.020  -12.741 99.069  1.00 16.16  ? 103 PHE C C   1 
ATOM   4515 O O   . PHE C 1 103 ? -4.973  -13.598 98.175  1.00 19.29  ? 103 PHE C O   1 
ATOM   4516 C CB  . PHE C 1 103 ? -5.359  -10.371 98.341  1.00 18.41  ? 103 PHE C CB  1 
ATOM   4517 C CG  . PHE C 1 103 ? -6.322  -9.526  97.560  1.00 20.19  ? 103 PHE C CG  1 
ATOM   4518 C CD1 . PHE C 1 103 ? -7.207  -10.101 96.646  1.00 24.91  ? 103 PHE C CD1 1 
ATOM   4519 C CD2 . PHE C 1 103 ? -6.362  -8.153  97.752  1.00 21.43  ? 103 PHE C CD2 1 
ATOM   4520 C CE1 . PHE C 1 103 ? -8.119  -9.306  95.933  1.00 24.42  ? 103 PHE C CE1 1 
ATOM   4521 C CE2 . PHE C 1 103 ? -7.280  -7.352  97.049  1.00 22.43  ? 103 PHE C CE2 1 
ATOM   4522 C CZ  . PHE C 1 103 ? -8.150  -7.921  96.148  1.00 24.30  ? 103 PHE C CZ  1 
ATOM   4523 N N   . MET C 1 104 ? -4.265  -12.796 100.168 1.00 13.00  ? 104 MET C N   1 
ATOM   4524 C CA  . MET C 1 104 ? -3.358  -13.917 100.391 1.00 9.42   ? 104 MET C CA  1 
ATOM   4525 C C   . MET C 1 104 ? -4.180  -15.189 100.509 1.00 9.01   ? 104 MET C C   1 
ATOM   4526 O O   . MET C 1 104 ? -3.793  -16.254 100.007 1.00 6.59   ? 104 MET C O   1 
ATOM   4527 C CB  . MET C 1 104 ? -2.510  -13.698 101.654 1.00 10.92  ? 104 MET C CB  1 
ATOM   4528 C CG  . MET C 1 104 ? -1.484  -14.802 101.948 1.00 12.02  ? 104 MET C CG  1 
ATOM   4529 S SD  . MET C 1 104 ? -0.201  -15.074 100.650 1.00 15.79  ? 104 MET C SD  1 
ATOM   4530 C CE  . MET C 1 104 ? 0.654   -13.523 100.709 1.00 9.06   ? 104 MET C CE  1 
ATOM   4531 N N   . ASP C 1 105 ? -5.330  -15.050 101.164 1.00 11.01  ? 105 ASP C N   1 
ATOM   4532 C CA  . ASP C 1 105 ? -6.238  -16.164 101.368 1.00 11.64  ? 105 ASP C CA  1 
ATOM   4533 C C   . ASP C 1 105 ? -6.576  -16.792 100.033 1.00 10.81  ? 105 ASP C C   1 
ATOM   4534 O O   . ASP C 1 105 ? -6.406  -18.003 99.866  1.00 11.94  ? 105 ASP C O   1 
ATOM   4535 C CB  . ASP C 1 105 ? -7.511  -15.650 102.046 1.00 14.60  ? 105 ASP C CB  1 
ATOM   4536 C CG  . ASP C 1 105 ? -7.988  -16.551 103.194 1.00 19.55  ? 105 ASP C CG  1 
ATOM   4537 O OD1 . ASP C 1 105 ? -8.265  -17.753 102.934 1.00 21.01  ? 105 ASP C OD1 1 
ATOM   4538 O OD2 . ASP C 1 105 ? -8.087  -16.033 104.352 1.00 21.01  ? 105 ASP C OD2 1 
ATOM   4539 N N   . SER C 1 106 ? -7.045  -15.971 99.091  1.00 10.82  ? 106 SER C N   1 
ATOM   4540 C CA  . SER C 1 106 ? -7.402  -16.442 97.757  1.00 10.91  ? 106 SER C CA  1 
ATOM   4541 C C   . SER C 1 106 ? -6.211  -17.057 97.017  1.00 14.43  ? 106 SER C C   1 
ATOM   4542 O O   . SER C 1 106 ? -6.367  -18.123 96.396  1.00 13.61  ? 106 SER C O   1 
ATOM   4543 C CB  . SER C 1 106 ? -7.969  -15.297 96.921  1.00 10.99  ? 106 SER C CB  1 
ATOM   4544 O OG  . SER C 1 106 ? -9.116  -14.730 97.521  1.00 2.00   ? 106 SER C OG  1 
ATOM   4545 N N   . ARG C 1 107 ? -5.046  -16.403 97.122  1.00 16.79  ? 107 ARG C N   1 
ATOM   4546 C CA  . ARG C 1 107 ? -3.804  -16.848 96.489  1.00 19.07  ? 107 ARG C CA  1 
ATOM   4547 C C   . ARG C 1 107 ? -3.485  -18.276 96.907  1.00 19.56  ? 107 ARG C C   1 
ATOM   4548 O O   . ARG C 1 107 ? -3.283  -19.133 96.064  1.00 21.55  ? 107 ARG C O   1 
ATOM   4549 C CB  . ARG C 1 107 ? -2.658  -15.900 96.860  1.00 21.38  ? 107 ARG C CB  1 
ATOM   4550 C CG  . ARG C 1 107 ? -1.287  -16.350 96.403  1.00 25.91  ? 107 ARG C CG  1 
ATOM   4551 C CD  . ARG C 1 107 ? -0.231  -15.380 96.786  1.00 27.36  ? 107 ARG C CD  1 
ATOM   4552 N NE  . ARG C 1 107 ? -0.185  -14.225 95.892  1.00 34.81  ? 107 ARG C NE  1 
ATOM   4553 C CZ  . ARG C 1 107 ? -0.207  -12.956 96.302  1.00 37.71  ? 107 ARG C CZ  1 
ATOM   4554 N NH1 . ARG C 1 107 ? -0.284  -12.657 97.607  1.00 35.87  ? 107 ARG C NH1 1 
ATOM   4555 N NH2 . ARG C 1 107 ? -0.153  -11.974 95.403  1.00 36.61  ? 107 ARG C NH2 1 
ATOM   4556 N N   . MET C 1 108 ? -3.459  -18.528 98.210  1.00 22.16  ? 108 MET C N   1 
ATOM   4557 C CA  . MET C 1 108 ? -3.133  -19.842 98.726  1.00 24.17  ? 108 MET C CA  1 
ATOM   4558 C C   . MET C 1 108 ? -4.169  -20.863 98.328  1.00 23.84  ? 108 MET C C   1 
ATOM   4559 O O   . MET C 1 108 ? -3.808  -22.019 98.108  1.00 21.28  ? 108 MET C O   1 
ATOM   4560 C CB  . MET C 1 108 ? -2.994  -19.795 100.243 1.00 27.70  ? 108 MET C CB  1 
ATOM   4561 C CG  . MET C 1 108 ? -1.770  -18.993 100.737 1.00 30.92  ? 108 MET C CG  1 
ATOM   4562 S SD  . MET C 1 108 ? -0.190  -19.590 100.027 1.00 31.82  ? 108 MET C SD  1 
ATOM   4563 C CE  . MET C 1 108 ? 0.315   -18.120 99.123  1.00 33.12  ? 108 MET C CE  1 
ATOM   4564 N N   . GLN C 1 109 ? -5.426  -20.429 98.226  1.00 24.26  ? 109 GLN C N   1 
ATOM   4565 C CA  . GLN C 1 109 ? -6.524  -21.315 97.829  1.00 26.31  ? 109 GLN C CA  1 
ATOM   4566 C C   . GLN C 1 109 ? -6.370  -21.901 96.417  1.00 24.67  ? 109 GLN C C   1 
ATOM   4567 O O   . GLN C 1 109 ? -6.651  -23.079 96.162  1.00 26.20  ? 109 GLN C O   1 
ATOM   4568 C CB  . GLN C 1 109 ? -7.852  -20.581 97.919  1.00 29.28  ? 109 GLN C CB  1 
ATOM   4569 C CG  . GLN C 1 109 ? -9.088  -21.508 97.830  1.00 34.02  ? 109 GLN C CG  1 
ATOM   4570 C CD  . GLN C 1 109 ? -10.409 -20.739 97.914  1.00 34.35  ? 109 GLN C CD  1 
ATOM   4571 O OE1 . GLN C 1 109 ? -11.348 -20.998 97.159  1.00 36.85  ? 109 GLN C OE1 1 
ATOM   4572 N NE2 . GLN C 1 109 ? -10.476 -19.781 98.829  1.00 35.49  ? 109 GLN C NE2 1 
ATOM   4573 N N   . LEU C 1 110 ? -5.866  -21.081 95.495  1.00 22.06  ? 110 LEU C N   1 
ATOM   4574 C CA  . LEU C 1 110 ? -5.575  -21.565 94.158  1.00 20.48  ? 110 LEU C CA  1 
ATOM   4575 C C   . LEU C 1 110 ? -4.289  -22.396 94.178  1.00 22.44  ? 110 LEU C C   1 
ATOM   4576 O O   . LEU C 1 110 ? -4.218  -23.464 93.566  1.00 23.59  ? 110 LEU C O   1 
ATOM   4577 C CB  . LEU C 1 110 ? -5.443  -20.385 93.178  1.00 16.06  ? 110 LEU C CB  1 
ATOM   4578 C CG  . LEU C 1 110 ? -5.062  -20.711 91.722  1.00 11.51  ? 110 LEU C CG  1 
ATOM   4579 C CD1 . LEU C 1 110 ? -6.130  -21.579 91.083  1.00 11.00  ? 110 LEU C CD1 1 
ATOM   4580 C CD2 . LEU C 1 110 ? -4.881  -19.431 90.947  1.00 11.31  ? 110 LEU C CD2 1 
ATOM   4581 N N   . ALA C 1 111 ? -3.267  -21.885 94.865  1.00 22.47  ? 111 ALA C N   1 
ATOM   4582 C CA  . ALA C 1 111 ? -1.965  -22.541 94.932  1.00 22.42  ? 111 ALA C CA  1 
ATOM   4583 C C   . ALA C 1 111 ? -2.102  -23.987 95.397  1.00 21.51  ? 111 ALA C C   1 
ATOM   4584 O O   . ALA C 1 111 ? -1.660  -24.894 94.696  1.00 19.44  ? 111 ALA C O   1 
ATOM   4585 C CB  . ALA C 1 111 ? -1.022  -21.758 95.851  1.00 22.24  ? 111 ALA C CB  1 
ATOM   4586 N N   . LYS C 1 112 ? -2.736  -24.183 96.555  1.00 22.13  ? 112 LYS C N   1 
ATOM   4587 C CA  . LYS C 1 112 ? -2.895  -25.503 97.137  1.00 23.07  ? 112 LYS C CA  1 
ATOM   4588 C C   . LYS C 1 112 ? -3.553  -26.426 96.153  1.00 22.80  ? 112 LYS C C   1 
ATOM   4589 O O   . LYS C 1 112 ? -3.144  -27.579 96.014  1.00 24.15  ? 112 LYS C O   1 
ATOM   4590 C CB  . LYS C 1 112 ? -3.727  -25.426 98.409  1.00 23.37  ? 112 LYS C CB  1 
ATOM   4591 C CG  . LYS C 1 112 ? -3.874  -26.766 99.143  1.00 27.38  ? 112 LYS C CG  1 
ATOM   4592 C CD  . LYS C 1 112 ? -4.443  -26.595 100.542 1.00 34.23  ? 112 LYS C CD  1 
ATOM   4593 C CE  . LYS C 1 112 ? -5.842  -25.993 100.508 1.00 36.14  ? 112 LYS C CE  1 
ATOM   4594 N NZ  . LYS C 1 112 ? -6.412  -25.866 101.877 1.00 41.15  ? 112 LYS C NZ  1 
ATOM   4595 N N   . LEU C 1 113 ? -4.563  -25.903 95.458  1.00 21.59  ? 113 LEU C N   1 
ATOM   4596 C CA  . LEU C 1 113 ? -5.302  -26.654 94.434  1.00 18.83  ? 113 LEU C CA  1 
ATOM   4597 C C   . LEU C 1 113 ? -4.394  -27.098 93.270  1.00 20.04  ? 113 LEU C C   1 
ATOM   4598 O O   . LEU C 1 113 ? -4.344  -28.287 92.906  1.00 17.01  ? 113 LEU C O   1 
ATOM   4599 C CB  . LEU C 1 113 ? -6.482  -25.795 93.923  1.00 18.71  ? 113 LEU C CB  1 
ATOM   4600 C CG  . LEU C 1 113 ? -7.484  -26.221 92.836  1.00 15.60  ? 113 LEU C CG  1 
ATOM   4601 C CD1 . LEU C 1 113 ? -7.032  -25.629 91.509  1.00 12.60  ? 113 LEU C CD1 1 
ATOM   4602 C CD2 . LEU C 1 113 ? -7.616  -27.739 92.742  1.00 13.02  ? 113 LEU C CD2 1 
ATOM   4603 N N   . CYS C 1 114 ? -3.684  -26.134 92.687  1.00 21.85  ? 114 CYS C N   1 
ATOM   4604 C CA  . CYS C 1 114 ? -2.790  -26.416 91.576  1.00 23.52  ? 114 CYS C CA  1 
ATOM   4605 C C   . CYS C 1 114 ? -1.587  -27.323 91.924  1.00 23.62  ? 114 CYS C C   1 
ATOM   4606 O O   . CYS C 1 114 ? -0.963  -27.902 91.012  1.00 24.26  ? 114 CYS C O   1 
ATOM   4607 C CB  . CYS C 1 114 ? -2.262  -25.116 90.979  1.00 26.65  ? 114 CYS C CB  1 
ATOM   4608 S SG  . CYS C 1 114 ? -3.518  -24.011 90.315  1.00 29.30  ? 114 CYS C SG  1 
ATOM   4609 N N   . TYR C 1 115 ? -1.261  -27.458 93.209  1.00 22.36  ? 115 TYR C N   1 
ATOM   4610 C CA  . TYR C 1 115 ? -0.170  -28.332 93.592  1.00 21.03  ? 115 TYR C CA  1 
ATOM   4611 C C   . TYR C 1 115 ? -0.700  -29.696 94.062  1.00 22.68  ? 115 TYR C C   1 
ATOM   4612 O O   . TYR C 1 115 ? 0.050   -30.675 94.145  1.00 24.86  ? 115 TYR C O   1 
ATOM   4613 C CB  . TYR C 1 115 ? 0.648   -27.693 94.702  1.00 14.22  ? 115 TYR C CB  1 
ATOM   4614 C CG  . TYR C 1 115 ? 1.656   -26.670 94.270  1.00 7.58   ? 115 TYR C CG  1 
ATOM   4615 C CD1 . TYR C 1 115 ? 1.301   -25.325 94.155  1.00 7.85   ? 115 TYR C CD1 1 
ATOM   4616 C CD2 . TYR C 1 115 ? 2.967   -27.044 93.967  1.00 4.17   ? 115 TYR C CD2 1 
ATOM   4617 C CE1 . TYR C 1 115 ? 2.249   -24.346 93.764  1.00 7.79   ? 115 TYR C CE1 1 
ATOM   4618 C CE2 . TYR C 1 115 ? 3.938   -26.059 93.566  1.00 2.00   ? 115 TYR C CE2 1 
ATOM   4619 C CZ  . TYR C 1 115 ? 3.557   -24.723 93.497  1.00 2.00   ? 115 TYR C CZ  1 
ATOM   4620 O OH  . TYR C 1 115 ? 4.454   -23.769 93.108  1.00 2.00   ? 115 TYR C OH  1 
ATOM   4621 N N   . ASP C 1 116 ? -2.005  -29.767 94.334  1.00 24.69  ? 116 ASP C N   1 
ATOM   4622 C CA  . ASP C 1 116 ? -2.597  -31.003 94.828  1.00 27.34  ? 116 ASP C CA  1 
ATOM   4623 C C   . ASP C 1 116 ? -2.695  -32.021 93.726  1.00 29.01  ? 116 ASP C C   1 
ATOM   4624 O O   . ASP C 1 116 ? -3.178  -31.724 92.659  1.00 31.38  ? 116 ASP C O   1 
ATOM   4625 C CB  . ASP C 1 116 ? -3.991  -30.720 95.374  1.00 27.69  ? 116 ASP C CB  1 
ATOM   4626 C CG  . ASP C 1 116 ? -4.497  -31.818 96.289  1.00 28.07  ? 116 ASP C CG  1 
ATOM   4627 O OD1 . ASP C 1 116 ? -4.834  -32.915 95.785  1.00 26.61  ? 116 ASP C OD1 1 
ATOM   4628 O OD2 . ASP C 1 116 ? -4.564  -31.574 97.517  1.00 28.70  ? 116 ASP C OD2 1 
ATOM   4629 N N   . PRO C 1 117 ? -2.213  -33.251 93.970  1.00 32.11  ? 117 PRO C N   1 
ATOM   4630 C CA  . PRO C 1 117 ? -2.262  -34.329 92.980  1.00 33.83  ? 117 PRO C CA  1 
ATOM   4631 C C   . PRO C 1 117 ? -3.641  -34.611 92.398  1.00 33.59  ? 117 PRO C C   1 
ATOM   4632 O O   . PRO C 1 117 ? -3.788  -34.940 91.220  1.00 33.91  ? 117 PRO C O   1 
ATOM   4633 C CB  . PRO C 1 117 ? -1.732  -35.537 93.766  1.00 33.83  ? 117 PRO C CB  1 
ATOM   4634 C CG  . PRO C 1 117 ? -0.857  -34.923 94.784  1.00 33.64  ? 117 PRO C CG  1 
ATOM   4635 C CD  . PRO C 1 117 ? -1.570  -33.673 95.215  1.00 32.33  ? 117 PRO C CD  1 
ATOM   4636 N N   . ASP C 1 118 ? -4.659  -34.466 93.224  1.00 33.76  ? 118 ASP C N   1 
ATOM   4637 C CA  . ASP C 1 118 ? -6.046  -34.667 92.804  1.00 35.51  ? 118 ASP C CA  1 
ATOM   4638 C C   . ASP C 1 118 ? -6.655  -33.434 92.108  1.00 34.35  ? 118 ASP C C   1 
ATOM   4639 O O   . ASP C 1 118 ? -7.856  -33.196 92.202  1.00 33.72  ? 118 ASP C O   1 
ATOM   4640 C CB  . ASP C 1 118 ? -6.898  -35.051 94.016  1.00 34.48  ? 118 ASP C CB  1 
ATOM   4641 C CG  . ASP C 1 118 ? -6.456  -36.339 94.642  1.00 37.85  ? 118 ASP C CG  1 
ATOM   4642 O OD1 . ASP C 1 118 ? -6.650  -37.416 94.032  1.00 39.99  ? 118 ASP C OD1 1 
ATOM   4643 O OD2 . ASP C 1 118 ? -5.907  -36.263 95.755  1.00 41.81  ? 118 ASP C OD2 1 
ATOM   4644 N N   . PHE C 1 119 ? -5.803  -32.661 91.432  1.00 33.86  ? 119 PHE C N   1 
ATOM   4645 C CA  . PHE C 1 119 ? -6.189  -31.441 90.726  1.00 35.30  ? 119 PHE C CA  1 
ATOM   4646 C C   . PHE C 1 119 ? -7.430  -31.677 89.858  1.00 36.63  ? 119 PHE C C   1 
ATOM   4647 O O   . PHE C 1 119 ? -8.331  -30.815 89.817  1.00 36.01  ? 119 PHE C O   1 
ATOM   4648 C CB  . PHE C 1 119 ? -5.007  -30.957 89.869  1.00 31.89  ? 119 PHE C CB  1 
ATOM   4649 C CG  . PHE C 1 119 ? -5.327  -29.781 89.004  1.00 28.96  ? 119 PHE C CG  1 
ATOM   4650 C CD1 . PHE C 1 119 ? -5.394  -28.496 89.569  1.00 26.87  ? 119 PHE C CD1 1 
ATOM   4651 C CD2 . PHE C 1 119 ? -5.587  -29.947 87.625  1.00 27.40  ? 119 PHE C CD2 1 
ATOM   4652 C CE1 . PHE C 1 119 ? -5.719  -27.366 88.760  1.00 27.40  ? 119 PHE C CE1 1 
ATOM   4653 C CE2 . PHE C 1 119 ? -5.903  -28.835 86.813  1.00 26.24  ? 119 PHE C CE2 1 
ATOM   4654 C CZ  . PHE C 1 119 ? -5.970  -27.542 87.383  1.00 25.36  ? 119 PHE C CZ  1 
ATOM   4655 N N   . GLU C 1 120 ? -7.476  -32.829 89.179  1.00 36.90  ? 120 GLU C N   1 
ATOM   4656 C CA  . GLU C 1 120 ? -8.597  -33.187 88.301  1.00 37.83  ? 120 GLU C CA  1 
ATOM   4657 C C   . GLU C 1 120 ? -9.960  -33.054 89.001  1.00 37.79  ? 120 GLU C C   1 
ATOM   4658 O O   . GLU C 1 120 ? -10.819 -32.263 88.585  1.00 38.75  ? 120 GLU C O   1 
ATOM   4659 C CB  . GLU C 1 120 ? -8.420  -34.607 87.762  1.00 37.41  ? 120 GLU C CB  1 
ATOM   4660 C CG  . GLU C 1 120 ? -7.141  -34.808 86.963  1.00 37.49  ? 120 GLU C CG  1 
ATOM   4661 C CD  . GLU C 1 120 ? -6.970  -36.248 86.482  1.00 38.58  ? 120 GLU C CD  1 
ATOM   4662 O OE1 . GLU C 1 120 ? -6.980  -37.181 87.340  1.00 37.02  ? 120 GLU C OE1 1 
ATOM   4663 O OE2 . GLU C 1 120 ? -6.838  -36.439 85.242  1.00 37.30  ? 120 GLU C OE2 1 
ATOM   4664 N N   . LYS C 1 121 ? -10.155 -33.806 90.080  1.00 37.19  ? 121 LYS C N   1 
ATOM   4665 C CA  . LYS C 1 121 ? -11.433 -33.817 90.762  1.00 36.51  ? 121 LYS C CA  1 
ATOM   4666 C C   . LYS C 1 121 ? -11.637 -32.610 91.668  1.00 34.78  ? 121 LYS C C   1 
ATOM   4667 O O   . LYS C 1 121 ? -12.767 -32.270 92.006  1.00 34.92  ? 121 LYS C O   1 
ATOM   4668 C CB  . LYS C 1 121 ? -11.639 -35.124 91.541  1.00 38.47  ? 121 LYS C CB  1 
ATOM   4669 C CG  . LYS C 1 121 ? -10.581 -35.482 92.569  1.00 40.44  ? 121 LYS C CG  1 
ATOM   4670 C CD  . LYS C 1 121 ? -9.348  -36.139 91.925  1.00 41.78  ? 121 LYS C CD  1 
ATOM   4671 C CE  . LYS C 1 121 ? -9.645  -37.453 91.216  1.00 41.17  ? 121 LYS C CE  1 
ATOM   4672 N NZ  . LYS C 1 121 ? -8.389  -38.056 90.663  1.00 41.68  ? 121 LYS C NZ  1 
ATOM   4673 N N   . LEU C 1 122 ? -10.539 -31.966 92.062  1.00 34.01  ? 122 LEU C N   1 
ATOM   4674 C CA  . LEU C 1 122 ? -10.615 -30.811 92.940  1.00 31.41  ? 122 LEU C CA  1 
ATOM   4675 C C   . LEU C 1 122 ? -10.950 -29.538 92.174  1.00 29.86  ? 122 LEU C C   1 
ATOM   4676 O O   . LEU C 1 122 ? -11.587 -28.630 92.731  1.00 29.14  ? 122 LEU C O   1 
ATOM   4677 C CB  . LEU C 1 122 ? -9.302  -30.658 93.720  1.00 32.87  ? 122 LEU C CB  1 
ATOM   4678 C CG  . LEU C 1 122 ? -9.191  -31.356 95.085  1.00 32.81  ? 122 LEU C CG  1 
ATOM   4679 C CD1 . LEU C 1 122 ? -9.503  -32.818 94.993  1.00 29.82  ? 122 LEU C CD1 1 
ATOM   4680 C CD2 . LEU C 1 122 ? -7.796  -31.193 95.577  1.00 33.70  ? 122 LEU C CD2 1 
ATOM   4681 N N   . LYS C 1 123 ? -10.527 -29.478 90.910  1.00 29.39  ? 123 LYS C N   1 
ATOM   4682 C CA  . LYS C 1 123 ? -10.763 -28.303 90.062  1.00 30.21  ? 123 LYS C CA  1 
ATOM   4683 C C   . LYS C 1 123 ? -12.230 -27.824 90.055  1.00 28.12  ? 123 LYS C C   1 
ATOM   4684 O O   . LYS C 1 123 ? -12.493 -26.652 90.315  1.00 28.84  ? 123 LYS C O   1 
ATOM   4685 C CB  . LYS C 1 123 ? -10.273 -28.543 88.622  1.00 29.94  ? 123 LYS C CB  1 
ATOM   4686 C CG  . LYS C 1 123 ? -10.380 -27.329 87.723  1.00 32.28  ? 123 LYS C CG  1 
ATOM   4687 C CD  . LYS C 1 123 ? -9.875  -27.619 86.340  1.00 35.17  ? 123 LYS C CD  1 
ATOM   4688 C CE  . LYS C 1 123 ? -9.954  -26.388 85.465  1.00 36.19  ? 123 LYS C CE  1 
ATOM   4689 N NZ  . LYS C 1 123 ? -9.453  -26.668 84.095  1.00 36.98  ? 123 LYS C NZ  1 
ATOM   4690 N N   . PRO C 1 124 ? -13.204 -28.742 89.769  1.00 26.52  ? 124 PRO C N   1 
ATOM   4691 C CA  . PRO C 1 124 ? -14.615 -28.366 89.778  1.00 24.74  ? 124 PRO C CA  1 
ATOM   4692 C C   . PRO C 1 124 ? -15.075 -27.755 91.091  1.00 26.25  ? 124 PRO C C   1 
ATOM   4693 O O   . PRO C 1 124 ? -15.812 -26.728 91.076  1.00 26.06  ? 124 PRO C O   1 
ATOM   4694 C CB  . PRO C 1 124 ? -15.299 -29.702 89.528  1.00 23.63  ? 124 PRO C CB  1 
ATOM   4695 C CG  . PRO C 1 124 ? -14.315 -30.474 88.770  1.00 23.15  ? 124 PRO C CG  1 
ATOM   4696 C CD  . PRO C 1 124 ? -13.037 -30.155 89.412  1.00 23.82  ? 124 PRO C CD  1 
ATOM   4697 N N   . GLU C 1 125 ? -14.621 -28.353 92.190  1.00 25.12  ? 125 GLU C N   1 
ATOM   4698 C CA  . GLU C 1 125 ? -14.928 -27.871 93.527  1.00 23.89  ? 125 GLU C CA  1 
ATOM   4699 C C   . GLU C 1 125 ? -14.526 -26.400 93.636  1.00 23.77  ? 125 GLU C C   1 
ATOM   4700 O O   . GLU C 1 125 ? -15.291 -25.561 94.105  1.00 24.86  ? 125 GLU C O   1 
ATOM   4701 C CB  . GLU C 1 125 ? -14.193 -28.721 94.549  1.00 24.84  ? 125 GLU C CB  1 
ATOM   4702 C CG  . GLU C 1 125 ? -14.505 -28.376 96.014  1.00 28.83  ? 125 GLU C CG  1 
ATOM   4703 C CD  . GLU C 1 125 ? -13.567 -29.110 96.990  1.00 30.00  ? 125 GLU C CD  1 
ATOM   4704 O OE1 . GLU C 1 125 ? -13.621 -30.378 97.054  1.00 29.30  ? 125 GLU C OE1 1 
ATOM   4705 O OE2 . GLU C 1 125 ? -12.780 -28.407 97.683  1.00 31.59  ? 125 GLU C OE2 1 
ATOM   4706 N N   . TYR C 1 126 ? -13.319 -26.091 93.168  1.00 21.78  ? 126 TYR C N   1 
ATOM   4707 C CA  . TYR C 1 126 ? -12.804 -24.738 93.187  1.00 21.25  ? 126 TYR C CA  1 
ATOM   4708 C C   . TYR C 1 126 ? -13.675 -23.807 92.346  1.00 20.98  ? 126 TYR C C   1 
ATOM   4709 O O   . TYR C 1 126 ? -14.150 -22.774 92.814  1.00 19.82  ? 126 TYR C O   1 
ATOM   4710 C CB  . TYR C 1 126 ? -11.339 -24.713 92.706  1.00 21.24  ? 126 TYR C CB  1 
ATOM   4711 C CG  . TYR C 1 126 ? -10.731 -23.325 92.737  1.00 19.50  ? 126 TYR C CG  1 
ATOM   4712 C CD1 . TYR C 1 126 ? -10.407 -22.707 93.953  1.00 15.89  ? 126 TYR C CD1 1 
ATOM   4713 C CD2 . TYR C 1 126 ? -10.513 -22.613 91.558  1.00 18.46  ? 126 TYR C CD2 1 
ATOM   4714 C CE1 . TYR C 1 126 ? -9.884  -21.419 93.987  1.00 14.97  ? 126 TYR C CE1 1 
ATOM   4715 C CE2 . TYR C 1 126 ? -9.990  -21.322 91.589  1.00 16.38  ? 126 TYR C CE2 1 
ATOM   4716 C CZ  . TYR C 1 126 ? -9.701  -20.738 92.808  1.00 13.89  ? 126 TYR C CZ  1 
ATOM   4717 O OH  . TYR C 1 126 ? -9.196  -19.476 92.852  1.00 12.34  ? 126 TYR C OH  1 
ATOM   4718 N N   . LEU C 1 127 ? -13.851 -24.184 91.080  1.00 22.44  ? 127 LEU C N   1 
ATOM   4719 C CA  . LEU C 1 127 ? -14.594 -23.389 90.106  1.00 22.47  ? 127 LEU C CA  1 
ATOM   4720 C C   . LEU C 1 127 ? -15.969 -22.976 90.629  1.00 23.15  ? 127 LEU C C   1 
ATOM   4721 O O   . LEU C 1 127 ? -16.276 -21.775 90.643  1.00 22.21  ? 127 LEU C O   1 
ATOM   4722 C CB  . LEU C 1 127 ? -14.733 -24.160 88.781  1.00 21.28  ? 127 LEU C CB  1 
ATOM   4723 C CG  . LEU C 1 127 ? -13.457 -24.214 87.938  1.00 22.71  ? 127 LEU C CG  1 
ATOM   4724 C CD1 . LEU C 1 127 ? -13.648 -25.178 86.804  1.00 22.84  ? 127 LEU C CD1 1 
ATOM   4725 C CD2 . LEU C 1 127 ? -13.096 -22.845 87.450  1.00 21.73  ? 127 LEU C CD2 1 
ATOM   4726 N N   . GLN C 1 128 ? -16.779 -23.931 91.078  1.00 23.41  ? 128 GLN C N   1 
ATOM   4727 C CA  . GLN C 1 128 ? -18.120 -23.601 91.548  1.00 26.73  ? 128 GLN C CA  1 
ATOM   4728 C C   . GLN C 1 128 ? -18.152 -22.676 92.784  1.00 25.44  ? 128 GLN C C   1 
ATOM   4729 O O   . GLN C 1 128 ? -19.125 -21.938 92.994  1.00 26.42  ? 128 GLN C O   1 
ATOM   4730 C CB  . GLN C 1 128 ? -18.946 -24.862 91.789  1.00 31.21  ? 128 GLN C CB  1 
ATOM   4731 C CG  . GLN C 1 128 ? -18.334 -25.865 92.727  1.00 36.50  ? 128 GLN C CG  1 
ATOM   4732 C CD  . GLN C 1 128 ? -19.170 -27.147 92.850  1.00 40.36  ? 128 GLN C CD  1 
ATOM   4733 O OE1 . GLN C 1 128 ? -20.325 -27.197 92.413  1.00 45.21  ? 128 GLN C OE1 1 
ATOM   4734 N NE2 . GLN C 1 128 ? -18.579 -28.182 93.451  1.00 39.67  ? 128 GLN C NE2 1 
ATOM   4735 N N   . ALA C 1 129 ? -17.084 -22.701 93.579  1.00 25.68  ? 129 ALA C N   1 
ATOM   4736 C CA  . ALA C 1 129 ? -16.990 -21.855 94.759  1.00 23.40  ? 129 ALA C CA  1 
ATOM   4737 C C   . ALA C 1 129 ? -16.457 -20.457 94.402  1.00 23.19  ? 129 ALA C C   1 
ATOM   4738 O O   . ALA C 1 129 ? -16.738 -19.474 95.114  1.00 23.38  ? 129 ALA C O   1 
ATOM   4739 C CB  . ALA C 1 129 ? -16.105 -22.515 95.787  1.00 20.51  ? 129 ALA C CB  1 
ATOM   4740 N N   . LEU C 1 130 ? -15.694 -20.388 93.313  1.00 22.37  ? 130 LEU C N   1 
ATOM   4741 C CA  . LEU C 1 130 ? -15.068 -19.155 92.849  1.00 21.49  ? 130 LEU C CA  1 
ATOM   4742 C C   . LEU C 1 130 ? -15.984 -17.911 92.767  1.00 21.47  ? 130 LEU C C   1 
ATOM   4743 O O   . LEU C 1 130 ? -15.606 -16.857 93.254  1.00 22.11  ? 130 LEU C O   1 
ATOM   4744 C CB  . LEU C 1 130 ? -14.376 -19.409 91.507  1.00 22.93  ? 130 LEU C CB  1 
ATOM   4745 C CG  . LEU C 1 130 ? -13.504 -18.299 90.917  1.00 21.02  ? 130 LEU C CG  1 
ATOM   4746 C CD1 . LEU C 1 130 ? -12.316 -18.031 91.812  1.00 22.84  ? 130 LEU C CD1 1 
ATOM   4747 C CD2 . LEU C 1 130 ? -13.044 -18.725 89.534  1.00 23.67  ? 130 LEU C CD2 1 
ATOM   4748 N N   . PRO C 1 131 ? -17.185 -18.021 92.134  1.00 23.95  ? 131 PRO C N   1 
ATOM   4749 C CA  . PRO C 1 131 ? -18.052 -16.853 91.971  1.00 22.63  ? 131 PRO C CA  1 
ATOM   4750 C C   . PRO C 1 131 ? -18.350 -16.060 93.243  1.00 23.72  ? 131 PRO C C   1 
ATOM   4751 O O   . PRO C 1 131 ? -18.333 -14.826 93.213  1.00 24.52  ? 131 PRO C O   1 
ATOM   4752 C CB  . PRO C 1 131 ? -19.310 -17.479 91.383  1.00 22.08  ? 131 PRO C CB  1 
ATOM   4753 C CG  . PRO C 1 131 ? -18.811 -18.619 90.640  1.00 22.00  ? 131 PRO C CG  1 
ATOM   4754 C CD  . PRO C 1 131 ? -17.768 -19.192 91.475  1.00 23.34  ? 131 PRO C CD  1 
ATOM   4755 N N   . GLU C 1 132 ? -18.599 -16.740 94.356  1.00 25.61  ? 132 GLU C N   1 
ATOM   4756 C CA  . GLU C 1 132 ? -18.889 -16.051 95.619  1.00 28.73  ? 132 GLU C CA  1 
ATOM   4757 C C   . GLU C 1 132 ? -17.686 -15.230 96.097  1.00 27.88  ? 132 GLU C C   1 
ATOM   4758 O O   . GLU C 1 132 ? -17.842 -14.107 96.611  1.00 30.46  ? 132 GLU C O   1 
ATOM   4759 C CB  . GLU C 1 132 ? -19.271 -17.046 96.707  1.00 30.97  ? 132 GLU C CB  1 
ATOM   4760 C CG  . GLU C 1 132 ? -19.650 -16.382 98.045  1.00 36.75  ? 132 GLU C CG  1 
ATOM   4761 C CD  . GLU C 1 132 ? -20.703 -15.270 97.899  1.00 40.87  ? 132 GLU C CD  1 
ATOM   4762 O OE1 . GLU C 1 132 ? -21.817 -15.563 97.398  1.00 45.53  ? 132 GLU C OE1 1 
ATOM   4763 O OE2 . GLU C 1 132 ? -20.413 -14.105 98.274  1.00 39.61  ? 132 GLU C OE2 1 
ATOM   4764 N N   . MET C 1 133 ? -16.492 -15.784 95.864  1.00 23.26  ? 133 MET C N   1 
ATOM   4765 C CA  . MET C 1 133 ? -15.241 -15.112 96.177  1.00 21.48  ? 133 MET C CA  1 
ATOM   4766 C C   . MET C 1 133 ? -15.159 -13.786 95.421  1.00 19.97  ? 133 MET C C   1 
ATOM   4767 O O   . MET C 1 133 ? -15.034 -12.721 96.041  1.00 19.86  ? 133 MET C O   1 
ATOM   4768 C CB  . MET C 1 133 ? -14.072 -16.027 95.808  1.00 26.88  ? 133 MET C CB  1 
ATOM   4769 C CG  . MET C 1 133 ? -12.705 -15.582 96.286  1.00 28.82  ? 133 MET C CG  1 
ATOM   4770 S SD  . MET C 1 133 ? -11.481 -16.877 95.901  1.00 34.24  ? 133 MET C SD  1 
ATOM   4771 C CE  . MET C 1 133 ? -10.773 -16.156 94.367  1.00 32.05  ? 133 MET C CE  1 
ATOM   4772 N N   . LEU C 1 134 ? -15.231 -13.858 94.094  1.00 16.61  ? 134 LEU C N   1 
ATOM   4773 C CA  . LEU C 1 134 ? -15.138 -12.670 93.272  1.00 16.59  ? 134 LEU C CA  1 
ATOM   4774 C C   . LEU C 1 134 ? -16.282 -11.692 93.554  1.00 18.69  ? 134 LEU C C   1 
ATOM   4775 O O   . LEU C 1 134 ? -16.078 -10.475 93.478  1.00 18.56  ? 134 LEU C O   1 
ATOM   4776 C CB  . LEU C 1 134 ? -15.149 -13.063 91.808  1.00 13.41  ? 134 LEU C CB  1 
ATOM   4777 C CG  . LEU C 1 134 ? -13.922 -13.683 91.149  1.00 12.53  ? 134 LEU C CG  1 
ATOM   4778 C CD1 . LEU C 1 134 ? -12.722 -12.848 91.363  1.00 10.57  ? 134 LEU C CD1 1 
ATOM   4779 C CD2 . LEU C 1 134 ? -13.714 -15.033 91.658  1.00 8.68   ? 134 LEU C CD2 1 
ATOM   4780 N N   . LYS C 1 135 ? -17.451 -12.219 93.914  1.00 18.99  ? 135 LYS C N   1 
ATOM   4781 C CA  . LYS C 1 135 ? -18.615 -11.399 94.223  1.00 20.05  ? 135 LYS C CA  1 
ATOM   4782 C C   . LYS C 1 135 ? -18.279 -10.387 95.299  1.00 18.56  ? 135 LYS C C   1 
ATOM   4783 O O   . LYS C 1 135 ? -18.551 -9.184  95.126  1.00 18.73  ? 135 LYS C O   1 
ATOM   4784 C CB  . LYS C 1 135 ? -19.797 -12.264 94.649  1.00 24.26  ? 135 LYS C CB  1 
ATOM   4785 C CG  . LYS C 1 135 ? -21.056 -11.455 94.931  1.00 30.01  ? 135 LYS C CG  1 
ATOM   4786 C CD  . LYS C 1 135 ? -22.179 -12.333 95.449  1.00 37.85  ? 135 LYS C CD  1 
ATOM   4787 C CE  . LYS C 1 135 ? -22.613 -13.367 94.377  1.00 40.18  ? 135 LYS C CE  1 
ATOM   4788 N NZ  . LYS C 1 135 ? -23.103 -12.719 93.116  1.00 45.05  ? 135 LYS C NZ  1 
ATOM   4789 N N   . LEU C 1 136 ? -17.668 -10.877 96.385  1.00 18.75  ? 136 LEU C N   1 
ATOM   4790 C CA  . LEU C 1 136 ? -17.293 -10.036 97.520  1.00 15.47  ? 136 LEU C CA  1 
ATOM   4791 C C   . LEU C 1 136 ? -16.318 -8.960  97.069  1.00 15.31  ? 136 LEU C C   1 
ATOM   4792 O O   . LEU C 1 136 ? -16.483 -7.788  97.387  1.00 15.97  ? 136 LEU C O   1 
ATOM   4793 C CB  . LEU C 1 136 ? -16.698 -10.888 98.643  1.00 13.86  ? 136 LEU C CB  1 
ATOM   4794 C CG  . LEU C 1 136 ? -17.649 -11.941 99.233  1.00 12.70  ? 136 LEU C CG  1 
ATOM   4795 C CD1 . LEU C 1 136 ? -16.918 -12.891 100.115 1.00 10.42  ? 136 LEU C CD1 1 
ATOM   4796 C CD2 . LEU C 1 136 ? -18.738 -11.247 100.033 1.00 17.25  ? 136 LEU C CD2 1 
ATOM   4797 N N   . TYR C 1 137 ? -15.329 -9.366  96.285  1.00 13.09  ? 137 TYR C N   1 
ATOM   4798 C CA  . TYR C 1 137 ? -14.331 -8.441  95.785  1.00 13.74  ? 137 TYR C CA  1 
ATOM   4799 C C   . TYR C 1 137 ? -14.927 -7.349  94.899  1.00 14.03  ? 137 TYR C C   1 
ATOM   4800 O O   . TYR C 1 137 ? -14.520 -6.193  94.959  1.00 13.44  ? 137 TYR C O   1 
ATOM   4801 C CB  . TYR C 1 137 ? -13.265 -9.210  95.025  1.00 11.53  ? 137 TYR C CB  1 
ATOM   4802 C CG  . TYR C 1 137 ? -12.344 -10.028 95.907  1.00 10.99  ? 137 TYR C CG  1 
ATOM   4803 C CD1 . TYR C 1 137 ? -11.609 -9.414  96.943  1.00 14.47  ? 137 TYR C CD1 1 
ATOM   4804 C CD2 . TYR C 1 137 ? -12.210 -11.429 95.714  1.00 10.97  ? 137 TYR C CD2 1 
ATOM   4805 C CE1 . TYR C 1 137 ? -10.762 -10.185 97.772  1.00 14.56  ? 137 TYR C CE1 1 
ATOM   4806 C CE2 . TYR C 1 137 ? -11.366 -12.202 96.535  1.00 13.16  ? 137 TYR C CE2 1 
ATOM   4807 C CZ  . TYR C 1 137 ? -10.658 -11.563 97.546  1.00 13.23  ? 137 TYR C CZ  1 
ATOM   4808 O OH  . TYR C 1 137 ? -9.854  -12.289 98.362  1.00 10.55  ? 137 TYR C OH  1 
ATOM   4809 N N   . SER C 1 138 ? -15.917 -7.725  94.091  1.00 16.48  ? 138 SER C N   1 
ATOM   4810 C CA  . SER C 1 138 ? -16.586 -6.788  93.198  1.00 16.41  ? 138 SER C CA  1 
ATOM   4811 C C   . SER C 1 138 ? -17.346 -5.774  94.032  1.00 15.86  ? 138 SER C C   1 
ATOM   4812 O O   . SER C 1 138 ? -17.230 -4.564  93.823  1.00 14.56  ? 138 SER C O   1 
ATOM   4813 C CB  . SER C 1 138 ? -17.537 -7.522  92.231  1.00 17.26  ? 138 SER C CB  1 
ATOM   4814 O OG  . SER C 1 138 ? -17.928 -6.658  91.173  1.00 21.42  ? 138 SER C OG  1 
ATOM   4815 N N   . GLN C 1 139 ? -18.131 -6.284  94.976  1.00 17.13  ? 139 GLN C N   1 
ATOM   4816 C CA  . GLN C 1 139 ? -18.942 -5.432  95.827  1.00 17.93  ? 139 GLN C CA  1 
ATOM   4817 C C   . GLN C 1 139 ? -18.041 -4.435  96.554  1.00 18.50  ? 139 GLN C C   1 
ATOM   4818 O O   . GLN C 1 139 ? -18.330 -3.219  96.557  1.00 18.41  ? 139 GLN C O   1 
ATOM   4819 C CB  . GLN C 1 139 ? -19.754 -6.270  96.819  1.00 18.24  ? 139 GLN C CB  1 
ATOM   4820 C CG  . GLN C 1 139 ? -20.808 -7.112  96.177  1.00 22.02  ? 139 GLN C CG  1 
ATOM   4821 C CD  . GLN C 1 139 ? -21.560 -7.991  97.175  1.00 25.48  ? 139 GLN C CD  1 
ATOM   4822 O OE1 . GLN C 1 139 ? -22.569 -7.573  97.727  1.00 28.20  ? 139 GLN C OE1 1 
ATOM   4823 N NE2 . GLN C 1 139 ? -21.065 -9.205  97.402  1.00 28.44  ? 139 GLN C NE2 1 
ATOM   4824 N N   . PHE C 1 140 ? -16.953 -4.947  97.138  1.00 18.37  ? 140 PHE C N   1 
ATOM   4825 C CA  . PHE C 1 140 ? -16.000 -4.121  97.874  1.00 19.21  ? 140 PHE C CA  1 
ATOM   4826 C C   . PHE C 1 140 ? -15.449 -2.966  97.015  1.00 19.45  ? 140 PHE C C   1 
ATOM   4827 O O   . PHE C 1 140 ? -15.424 -1.799  97.451  1.00 20.59  ? 140 PHE C O   1 
ATOM   4828 C CB  . PHE C 1 140 ? -14.845 -4.991  98.375  1.00 22.91  ? 140 PHE C CB  1 
ATOM   4829 C CG  . PHE C 1 140 ? -14.050 -4.366  99.491  1.00 21.73  ? 140 PHE C CG  1 
ATOM   4830 C CD1 . PHE C 1 140 ? -14.569 -4.279  100.792 1.00 21.41  ? 140 PHE C CD1 1 
ATOM   4831 C CD2 . PHE C 1 140 ? -12.790 -3.858  99.239  1.00 23.24  ? 140 PHE C CD2 1 
ATOM   4832 C CE1 . PHE C 1 140 ? -13.854 -3.690  101.824 1.00 20.87  ? 140 PHE C CE1 1 
ATOM   4833 C CE2 . PHE C 1 140 ? -12.058 -3.262  100.266 1.00 26.88  ? 140 PHE C CE2 1 
ATOM   4834 C CZ  . PHE C 1 140 ? -12.599 -3.182  101.565 1.00 26.49  ? 140 PHE C CZ  1 
ATOM   4835 N N   . LEU C 1 141 ? -15.019 -3.304  95.799  1.00 20.02  ? 141 LEU C N   1 
ATOM   4836 C CA  . LEU C 1 141 ? -14.488 -2.338  94.852  1.00 18.90  ? 141 LEU C CA  1 
ATOM   4837 C C   . LEU C 1 141 ? -15.539 -1.299  94.520  1.00 21.46  ? 141 LEU C C   1 
ATOM   4838 O O   . LEU C 1 141 ? -15.224 -0.116  94.495  1.00 22.39  ? 141 LEU C O   1 
ATOM   4839 C CB  . LEU C 1 141 ? -14.021 -3.045  93.583  1.00 17.63  ? 141 LEU C CB  1 
ATOM   4840 C CG  . LEU C 1 141 ? -13.443 -2.207  92.442  1.00 20.06  ? 141 LEU C CG  1 
ATOM   4841 C CD1 . LEU C 1 141 ? -12.299 -1.296  92.915  1.00 23.83  ? 141 LEU C CD1 1 
ATOM   4842 C CD2 . LEU C 1 141 ? -12.941 -3.177  91.375  1.00 20.35  ? 141 LEU C CD2 1 
ATOM   4843 N N   . GLY C 1 142 ? -16.766 -1.762  94.264  1.00 22.68  ? 142 GLY C N   1 
ATOM   4844 C CA  . GLY C 1 142 ? -17.861 -0.873  93.907  1.00 21.57  ? 142 GLY C CA  1 
ATOM   4845 C C   . GLY C 1 142 ? -17.573 -0.143  92.624  1.00 21.86  ? 142 GLY C C   1 
ATOM   4846 O O   . GLY C 1 142 ? -17.086 -0.745  91.678  1.00 20.02  ? 142 GLY C O   1 
ATOM   4847 N N   . LYS C 1 143 ? -17.840 1.152   92.590  1.00 22.23  ? 143 LYS C N   1 
ATOM   4848 C CA  . LYS C 1 143 ? -17.564 1.977   91.419  1.00 23.00  ? 143 LYS C CA  1 
ATOM   4849 C C   . LYS C 1 143 ? -16.262 2.766   91.588  1.00 24.28  ? 143 LYS C C   1 
ATOM   4850 O O   . LYS C 1 143 ? -16.038 3.763   90.897  1.00 26.75  ? 143 LYS C O   1 
ATOM   4851 C CB  . LYS C 1 143 ? -18.743 2.940   91.162  1.00 23.67  ? 143 LYS C CB  1 
ATOM   4852 C CG  . LYS C 1 143 ? -20.099 2.244   90.874  1.00 24.63  ? 143 LYS C CG  1 
ATOM   4853 C CD  . LYS C 1 143 ? -20.221 1.823   89.404  1.00 25.91  ? 143 LYS C CD  1 
ATOM   4854 C CE  . LYS C 1 143 ? -19.596 0.443   89.151  1.00 27.61  ? 143 LYS C CE  1 
ATOM   4855 N NZ  . LYS C 1 143 ? -20.282 -0.641  89.927  1.00 30.04  ? 143 LYS C NZ  1 
ATOM   4856 N N   . GLN C 1 144 ? -15.414 2.313   92.505  1.00 24.57  ? 144 GLN C N   1 
ATOM   4857 C CA  . GLN C 1 144 ? -14.168 3.008   92.797  1.00 22.94  ? 144 GLN C CA  1 
ATOM   4858 C C   . GLN C 1 144 ? -13.170 2.639   91.713  1.00 19.67  ? 144 GLN C C   1 
ATOM   4859 O O   . GLN C 1 144 ? -13.232 1.537   91.167  1.00 21.21  ? 144 GLN C O   1 
ATOM   4860 C CB  . GLN C 1 144 ? -13.627 2.592   94.172  1.00 26.21  ? 144 GLN C CB  1 
ATOM   4861 C CG  . GLN C 1 144 ? -14.532 2.924   95.325  1.00 34.01  ? 144 GLN C CG  1 
ATOM   4862 C CD  . GLN C 1 144 ? -13.993 2.430   96.659  1.00 37.79  ? 144 GLN C CD  1 
ATOM   4863 O OE1 . GLN C 1 144 ? -13.638 3.225   97.526  1.00 37.91  ? 144 GLN C OE1 1 
ATOM   4864 N NE2 . GLN C 1 144 ? -13.941 1.114   96.833  1.00 38.69  ? 144 GLN C NE2 1 
ATOM   4865 N N   . PRO C 1 145 ? -12.238 3.565   91.368  1.00 15.08  ? 145 PRO C N   1 
ATOM   4866 C CA  . PRO C 1 145 ? -11.182 3.263   90.399  1.00 13.86  ? 145 PRO C CA  1 
ATOM   4867 C C   . PRO C 1 145 ? -10.220 2.202   90.929  1.00 16.05  ? 145 PRO C C   1 
ATOM   4868 O O   . PRO C 1 145 ? -9.790  1.308   90.177  1.00 15.37  ? 145 PRO C O   1 
ATOM   4869 C CB  . PRO C 1 145 ? -10.480 4.624   90.214  1.00 9.97   ? 145 PRO C CB  1 
ATOM   4870 C CG  . PRO C 1 145 ? -11.415 5.632   90.770  1.00 7.09   ? 145 PRO C CG  1 
ATOM   4871 C CD  . PRO C 1 145 ? -12.126 4.933   91.884  1.00 10.49  ? 145 PRO C CD  1 
ATOM   4872 N N   . TRP C 1 146 ? -9.868  2.323   92.200  1.00 17.15  ? 146 TRP C N   1 
ATOM   4873 C CA  . TRP C 1 146 ? -8.955  1.396   92.833  1.00 17.07  ? 146 TRP C CA  1 
ATOM   4874 C C   . TRP C 1 146 ? -9.521  1.013   94.193  1.00 17.26  ? 146 TRP C C   1 
ATOM   4875 O O   . TRP C 1 146 ? -10.403 1.722   94.731  1.00 18.20  ? 146 TRP C O   1 
ATOM   4876 C CB  . TRP C 1 146 ? -7.588  2.050   92.983  1.00 17.75  ? 146 TRP C CB  1 
ATOM   4877 C CG  . TRP C 1 146 ? -7.045  2.636   91.699  1.00 17.14  ? 146 TRP C CG  1 
ATOM   4878 C CD1 . TRP C 1 146 ? -7.060  3.938   91.334  1.00 17.59  ? 146 TRP C CD1 1 
ATOM   4879 C CD2 . TRP C 1 146 ? -6.428  1.901   90.617  1.00 19.47  ? 146 TRP C CD2 1 
ATOM   4880 N NE1 . TRP C 1 146 ? -6.463  4.100   90.103  1.00 15.79  ? 146 TRP C NE1 1 
ATOM   4881 C CE2 . TRP C 1 146 ? -6.082  2.901   89.645  1.00 15.88  ? 146 TRP C CE2 1 
ATOM   4882 C CE3 . TRP C 1 146 ? -6.168  0.560   90.393  1.00 18.83  ? 146 TRP C CE3 1 
ATOM   4883 C CZ2 . TRP C 1 146 ? -5.456  2.519   88.427  1.00 13.58  ? 146 TRP C CZ2 1 
ATOM   4884 C CZ3 . TRP C 1 146 ? -5.543  0.188   89.171  1.00 16.96  ? 146 TRP C CZ3 1 
ATOM   4885 C CH2 . TRP C 1 146 ? -5.195  1.184   88.203  1.00 12.93  ? 146 TRP C CH2 1 
ATOM   4886 N N   . PHE C 1 147 ? -9.045  -0.107  94.736  1.00 17.57  ? 147 PHE C N   1 
ATOM   4887 C CA  . PHE C 1 147 ? -9.533  -0.619  96.030  1.00 18.92  ? 147 PHE C CA  1 
ATOM   4888 C C   . PHE C 1 147 ? -9.484  0.360   97.214  1.00 18.95  ? 147 PHE C C   1 
ATOM   4889 O O   . PHE C 1 147 ? -10.408 0.389   98.036  1.00 19.63  ? 147 PHE C O   1 
ATOM   4890 C CB  . PHE C 1 147 ? -8.827  -1.916  96.413  1.00 19.05  ? 147 PHE C CB  1 
ATOM   4891 C CG  . PHE C 1 147 ? -9.327  -3.105  95.689  1.00 18.97  ? 147 PHE C CG  1 
ATOM   4892 C CD1 . PHE C 1 147 ? -8.761  -3.468  94.456  1.00 14.90  ? 147 PHE C CD1 1 
ATOM   4893 C CD2 . PHE C 1 147 ? -10.398 -3.846  96.208  1.00 17.90  ? 147 PHE C CD2 1 
ATOM   4894 C CE1 . PHE C 1 147 ? -9.236  -4.575  93.739  1.00 13.79  ? 147 PHE C CE1 1 
ATOM   4895 C CE2 . PHE C 1 147 ? -10.899 -4.976  95.502  1.00 16.27  ? 147 PHE C CE2 1 
ATOM   4896 C CZ  . PHE C 1 147 ? -10.310 -5.338  94.256  1.00 14.64  ? 147 PHE C CZ  1 
ATOM   4897 N N   . LEU C 1 148 ? -8.446  1.192   97.285  1.00 20.44  ? 148 LEU C N   1 
ATOM   4898 C CA  . LEU C 1 148 ? -8.336  2.153   98.377  1.00 20.95  ? 148 LEU C CA  1 
ATOM   4899 C C   . LEU C 1 148 ? -8.949  3.505   98.011  1.00 23.22  ? 148 LEU C C   1 
ATOM   4900 O O   . LEU C 1 148 ? -8.672  4.511   98.644  1.00 24.19  ? 148 LEU C O   1 
ATOM   4901 C CB  . LEU C 1 148 ? -6.865  2.328   98.780  1.00 19.12  ? 148 LEU C CB  1 
ATOM   4902 C CG  . LEU C 1 148 ? -6.195  1.325   99.743  1.00 19.57  ? 148 LEU C CG  1 
ATOM   4903 C CD1 . LEU C 1 148 ? -6.766  1.526   101.102 1.00 19.21  ? 148 LEU C CD1 1 
ATOM   4904 C CD2 . LEU C 1 148 ? -6.414  -0.120  99.289  1.00 19.86  ? 148 LEU C CD2 1 
ATOM   4905 N N   . GLY C 1 149 ? -9.779  3.516   96.970  1.00 24.15  ? 149 GLY C N   1 
ATOM   4906 C CA  . GLY C 1 149 ? -10.397 4.751   96.509  1.00 24.58  ? 149 GLY C CA  1 
ATOM   4907 C C   . GLY C 1 149 ? -9.885  5.226   95.148  1.00 26.22  ? 149 GLY C C   1 
ATOM   4908 O O   . GLY C 1 149 ? -9.774  4.462   94.182  1.00 26.22  ? 149 GLY C O   1 
ATOM   4909 N N   . ASP C 1 150 ? -9.565  6.515   95.073  1.00 26.19  ? 150 ASP C N   1 
ATOM   4910 C CA  . ASP C 1 150 ? -9.069  7.097   93.834  1.00 26.92  ? 150 ASP C CA  1 
ATOM   4911 C C   . ASP C 1 150 ? -7.584  6.864   93.675  1.00 25.86  ? 150 ASP C C   1 
ATOM   4912 O O   . ASP C 1 150 ? -7.095  6.708   92.571  1.00 26.37  ? 150 ASP C O   1 
ATOM   4913 C CB  . ASP C 1 150 ? -9.346  8.589   93.813  1.00 31.07  ? 150 ASP C CB  1 
ATOM   4914 C CG  . ASP C 1 150 ? -10.730 8.932   94.328  1.00 35.29  ? 150 ASP C CG  1 
ATOM   4915 O OD1 . ASP C 1 150 ? -11.691 8.905   93.508  1.00 35.63  ? 150 ASP C OD1 1 
ATOM   4916 O OD2 . ASP C 1 150 ? -10.856 9.197   95.556  1.00 36.25  ? 150 ASP C OD2 1 
ATOM   4917 N N   . LYS C 1 151 ? -6.863  6.837   94.785  1.00 25.69  ? 151 LYS C N   1 
ATOM   4918 C CA  . LYS C 1 151 ? -5.417  6.667   94.763  1.00 25.45  ? 151 LYS C CA  1 
ATOM   4919 C C   . LYS C 1 151 ? -5.057  5.178   94.701  1.00 23.31  ? 151 LYS C C   1 
ATOM   4920 O O   . LYS C 1 151 ? -5.540  4.355   95.506  1.00 23.18  ? 151 LYS C O   1 
ATOM   4921 C CB  . LYS C 1 151 ? -4.795  7.335   96.004  1.00 27.47  ? 151 LYS C CB  1 
ATOM   4922 C CG  . LYS C 1 151 ? -5.192  6.715   97.373  1.00 32.88  ? 151 LYS C CG  1 
ATOM   4923 C CD  . LYS C 1 151 ? -6.631  7.033   97.779  1.00 35.86  ? 151 LYS C CD  1 
ATOM   4924 C CE  . LYS C 1 151 ? -6.913  8.561   97.797  1.00 34.96  ? 151 LYS C CE  1 
ATOM   4925 N NZ  . LYS C 1 151 ? -8.387  8.842   97.881  1.00 37.46  ? 151 LYS C NZ  1 
ATOM   4926 N N   . ILE C 1 152 ? -4.180  4.836   93.755  1.00 22.49  ? 152 ILE C N   1 
ATOM   4927 C CA  . ILE C 1 152 ? -3.703  3.464   93.606  1.00 23.54  ? 152 ILE C CA  1 
ATOM   4928 C C   . ILE C 1 152 ? -2.654  3.195   94.693  1.00 24.65  ? 152 ILE C C   1 
ATOM   4929 O O   . ILE C 1 152 ? -1.698  3.971   94.860  1.00 26.24  ? 152 ILE C O   1 
ATOM   4930 C CB  . ILE C 1 152 ? -3.127  3.194   92.165  1.00 21.73  ? 152 ILE C CB  1 
ATOM   4931 C CG1 . ILE C 1 152 ? -2.634  1.753   92.057  1.00 22.08  ? 152 ILE C CG1 1 
ATOM   4932 C CG2 . ILE C 1 152 ? -2.000  4.189   91.837  1.00 21.14  ? 152 ILE C CG2 1 
ATOM   4933 C CD1 . ILE C 1 152 ? -2.152  1.382   90.690  1.00 20.44  ? 152 ILE C CD1 1 
ATOM   4934 N N   . THR C 1 153 ? -2.840  2.100   95.429  1.00 22.47  ? 153 THR C N   1 
ATOM   4935 C CA  . THR C 1 153 ? -1.937  1.730   96.494  1.00 21.64  ? 153 THR C CA  1 
ATOM   4936 C C   . THR C 1 153 ? -1.394  0.316   96.251  1.00 22.77  ? 153 THR C C   1 
ATOM   4937 O O   . THR C 1 153 ? -1.831  -0.381  95.315  1.00 22.58  ? 153 THR C O   1 
ATOM   4938 C CB  . THR C 1 153 ? -2.679  1.756   97.835  1.00 23.66  ? 153 THR C CB  1 
ATOM   4939 O OG1 . THR C 1 153 ? -3.757  0.809   97.807  1.00 23.68  ? 153 THR C OG1 1 
ATOM   4940 C CG2 . THR C 1 153 ? -3.227  3.149   98.120  1.00 20.67  ? 153 THR C CG2 1 
ATOM   4941 N N   . PHE C 1 154 ? -0.452  -0.111  97.085  1.00 21.99  ? 154 PHE C N   1 
ATOM   4942 C CA  . PHE C 1 154 ? 0.161   -1.421  96.918  1.00 20.21  ? 154 PHE C CA  1 
ATOM   4943 C C   . PHE C 1 154 ? -0.805  -2.587  96.906  1.00 21.05  ? 154 PHE C C   1 
ATOM   4944 O O   . PHE C 1 154 ? -0.504  -3.650  96.365  1.00 22.36  ? 154 PHE C O   1 
ATOM   4945 C CB  . PHE C 1 154 ? 1.315   -1.627  97.918  1.00 16.80  ? 154 PHE C CB  1 
ATOM   4946 C CG  . PHE C 1 154 ? 0.879   -2.101  99.281  1.00 15.41  ? 154 PHE C CG  1 
ATOM   4947 C CD1 . PHE C 1 154 ? 0.539   -1.174  100.256 1.00 16.58  ? 154 PHE C CD1 1 
ATOM   4948 C CD2 . PHE C 1 154 ? 0.910   -3.471  99.614  1.00 16.12  ? 154 PHE C CD2 1 
ATOM   4949 C CE1 . PHE C 1 154 ? 0.185   -1.610  101.559 1.00 16.50  ? 154 PHE C CE1 1 
ATOM   4950 C CE2 . PHE C 1 154 ? 0.541   -3.917  100.897 1.00 16.06  ? 154 PHE C CE2 1 
ATOM   4951 C CZ  . PHE C 1 154 ? 0.184   -2.983  101.878 1.00 16.13  ? 154 PHE C CZ  1 
ATOM   4952 N N   . VAL C 1 155 ? -1.977  -2.394  97.506  1.00 19.41  ? 155 VAL C N   1 
ATOM   4953 C CA  . VAL C 1 155 ? -2.962  -3.469  97.579  1.00 23.43  ? 155 VAL C CA  1 
ATOM   4954 C C   . VAL C 1 155 ? -3.417  -3.855  96.174  1.00 23.23  ? 155 VAL C C   1 
ATOM   4955 O O   . VAL C 1 155 ? -3.698  -5.037  95.918  1.00 23.70  ? 155 VAL C O   1 
ATOM   4956 C CB  . VAL C 1 155 ? -4.193  -3.070  98.430  1.00 26.50  ? 155 VAL C CB  1 
ATOM   4957 C CG1 . VAL C 1 155 ? -5.160  -4.221  98.534  1.00 24.33  ? 155 VAL C CG1 1 
ATOM   4958 C CG2 . VAL C 1 155 ? -3.726  -2.672  99.820  1.00 28.69  ? 155 VAL C CG2 1 
ATOM   4959 N N   . ASP C 1 156 ? -3.474  -2.869  95.275  1.00 20.67  ? 156 ASP C N   1 
ATOM   4960 C CA  . ASP C 1 156 ? -3.916  -3.091  93.896  1.00 18.64  ? 156 ASP C CA  1 
ATOM   4961 C C   . ASP C 1 156 ? -2.997  -4.029  93.119  1.00 18.31  ? 156 ASP C C   1 
ATOM   4962 O O   . ASP C 1 156 ? -3.441  -4.802  92.255  1.00 18.17  ? 156 ASP C O   1 
ATOM   4963 C CB  . ASP C 1 156 ? -4.067  -1.767  93.167  1.00 17.70  ? 156 ASP C CB  1 
ATOM   4964 C CG  . ASP C 1 156 ? -5.177  -0.908  93.756  1.00 19.12  ? 156 ASP C CG  1 
ATOM   4965 O OD1 . ASP C 1 156 ? -6.346  -1.344  93.813  1.00 23.23  ? 156 ASP C OD1 1 
ATOM   4966 O OD2 . ASP C 1 156 ? -4.896  0.220   94.183  1.00 17.73  ? 156 ASP C OD2 1 
ATOM   4967 N N   . PHE C 1 157 ? -1.712  -3.982  93.462  1.00 16.02  ? 157 PHE C N   1 
ATOM   4968 C CA  . PHE C 1 157 ? -0.718  -4.842  92.828  1.00 13.24  ? 157 PHE C CA  1 
ATOM   4969 C C   . PHE C 1 157 ? -0.866  -6.305  93.252  1.00 12.57  ? 157 PHE C C   1 
ATOM   4970 O O   . PHE C 1 157 ? -0.483  -7.218  92.544  1.00 10.81  ? 157 PHE C O   1 
ATOM   4971 C CB  . PHE C 1 157 ? 0.689   -4.321  93.122  1.00 11.53  ? 157 PHE C CB  1 
ATOM   4972 C CG  . PHE C 1 157 ? 0.972   -2.973  92.518  1.00 12.05  ? 157 PHE C CG  1 
ATOM   4973 C CD1 . PHE C 1 157 ? 0.462   -1.817  93.102  1.00 14.61  ? 157 PHE C CD1 1 
ATOM   4974 C CD2 . PHE C 1 157 ? 1.719   -2.851  91.350  1.00 9.05   ? 157 PHE C CD2 1 
ATOM   4975 C CE1 . PHE C 1 157 ? 0.705   -0.548  92.537  1.00 12.48  ? 157 PHE C CE1 1 
ATOM   4976 C CE2 . PHE C 1 157 ? 1.960   -1.586  90.788  1.00 6.43   ? 157 PHE C CE2 1 
ATOM   4977 C CZ  . PHE C 1 157 ? 1.448   -0.436  91.388  1.00 7.53   ? 157 PHE C CZ  1 
ATOM   4978 N N   . ILE C 1 158 ? -1.460  -6.512  94.423  1.00 10.88  ? 158 ILE C N   1 
ATOM   4979 C CA  . ILE C 1 158 ? -1.733  -7.847  94.929  1.00 12.75  ? 158 ILE C CA  1 
ATOM   4980 C C   . ILE C 1 158 ? -2.994  -8.319  94.240  1.00 14.06  ? 158 ILE C C   1 
ATOM   4981 O O   . ILE C 1 158 ? -3.051  -9.465  93.783  1.00 15.92  ? 158 ILE C O   1 
ATOM   4982 C CB  . ILE C 1 158 ? -1.957  -7.825  96.481  1.00 12.60  ? 158 ILE C CB  1 
ATOM   4983 C CG1 . ILE C 1 158 ? -0.779  -7.115  97.173  1.00 14.32  ? 158 ILE C CG1 1 
ATOM   4984 C CG2 . ILE C 1 158 ? -2.058  -9.241  97.018  1.00 8.92   ? 158 ILE C CG2 1 
ATOM   4985 C CD1 . ILE C 1 158 ? -0.895  -7.001  98.689  1.00 10.98  ? 158 ILE C CD1 1 
ATOM   4986 N N   . ALA C 1 159 ? -3.994  -7.431  94.216  1.00 17.03  ? 159 ALA C N   1 
ATOM   4987 C CA  . ALA C 1 159 ? -5.306  -7.687  93.603  1.00 18.59  ? 159 ALA C CA  1 
ATOM   4988 C C   . ALA C 1 159 ? -5.134  -8.147  92.149  1.00 20.64  ? 159 ALA C C   1 
ATOM   4989 O O   . ALA C 1 159 ? -5.605  -9.245  91.795  1.00 20.87  ? 159 ALA C O   1 
ATOM   4990 C CB  . ALA C 1 159 ? -6.170  -6.451  93.654  1.00 16.75  ? 159 ALA C CB  1 
ATOM   4991 N N   . TYR C 1 160 ? -4.445  -7.333  91.342  1.00 21.42  ? 160 TYR C N   1 
ATOM   4992 C CA  . TYR C 1 160 ? -4.211  -7.639  89.941  1.00 21.86  ? 160 TYR C CA  1 
ATOM   4993 C C   . TYR C 1 160 ? -3.647  -9.032  89.774  1.00 20.66  ? 160 TYR C C   1 
ATOM   4994 O O   . TYR C 1 160 ? -4.118  -9.813  88.975  1.00 22.96  ? 160 TYR C O   1 
ATOM   4995 C CB  . TYR C 1 160 ? -3.307  -6.592  89.300  1.00 25.81  ? 160 TYR C CB  1 
ATOM   4996 C CG  . TYR C 1 160 ? -2.785  -7.047  87.960  1.00 30.76  ? 160 TYR C CG  1 
ATOM   4997 C CD1 . TYR C 1 160 ? -3.589  -6.976  86.799  1.00 32.51  ? 160 TYR C CD1 1 
ATOM   4998 C CD2 . TYR C 1 160 ? -1.499  -7.565  87.844  1.00 32.40  ? 160 TYR C CD2 1 
ATOM   4999 C CE1 . TYR C 1 160 ? -3.111  -7.430  85.543  1.00 32.51  ? 160 TYR C CE1 1 
ATOM   5000 C CE2 . TYR C 1 160 ? -1.014  -8.026  86.592  1.00 34.02  ? 160 TYR C CE2 1 
ATOM   5001 C CZ  . TYR C 1 160 ? -1.836  -7.966  85.464  1.00 33.11  ? 160 TYR C CZ  1 
ATOM   5002 O OH  . TYR C 1 160 ? -1.339  -8.427  84.275  1.00 36.21  ? 160 TYR C OH  1 
ATOM   5003 N N   . ASP C 1 161 ? -2.612  -9.339  90.548  1.00 18.72  ? 161 ASP C N   1 
ATOM   5004 C CA  . ASP C 1 161 ? -1.938  -10.620 90.450  1.00 15.66  ? 161 ASP C CA  1 
ATOM   5005 C C   . ASP C 1 161 ? -2.848  -11.830 90.698  1.00 15.25  ? 161 ASP C C   1 
ATOM   5006 O O   . ASP C 1 161 ? -2.735  -12.847 89.973  1.00 12.27  ? 161 ASP C O   1 
ATOM   5007 C CB  . ASP C 1 161 ? -0.721  -10.659 91.395  1.00 11.62  ? 161 ASP C CB  1 
ATOM   5008 C CG  . ASP C 1 161 ? 0.064   -11.969 91.321  1.00 11.28  ? 161 ASP C CG  1 
ATOM   5009 O OD1 . ASP C 1 161 ? 0.243   -12.492 90.196  1.00 9.06   ? 161 ASP C OD1 1 
ATOM   5010 O OD2 . ASP C 1 161 ? 0.480   -12.485 92.386  1.00 18.22  ? 161 ASP C OD2 1 
ATOM   5011 N N   . VAL C 1 162 ? -3.727  -11.751 91.710  1.00 14.04  ? 162 VAL C N   1 
ATOM   5012 C CA  . VAL C 1 162 ? -4.595  -12.881 92.037  1.00 14.74  ? 162 VAL C CA  1 
ATOM   5013 C C   . VAL C 1 162 ? -5.791  -12.967 91.074  1.00 14.73  ? 162 VAL C C   1 
ATOM   5014 O O   . VAL C 1 162 ? -6.097  -14.057 90.609  1.00 10.22  ? 162 VAL C O   1 
ATOM   5015 C CB  . VAL C 1 162 ? -5.099  -12.851 93.527  1.00 18.85  ? 162 VAL C CB  1 
ATOM   5016 C CG1 . VAL C 1 162 ? -3.892  -12.860 94.489  1.00 15.99  ? 162 VAL C CG1 1 
ATOM   5017 C CG2 . VAL C 1 162 ? -5.955  -11.620 93.796  1.00 20.94  ? 162 VAL C CG2 1 
ATOM   5018 N N   . LEU C 1 163 ? -6.437  -11.837 90.790  1.00 16.18  ? 163 LEU C N   1 
ATOM   5019 C CA  . LEU C 1 163 ? -7.602  -11.789 89.903  1.00 14.46  ? 163 LEU C CA  1 
ATOM   5020 C C   . LEU C 1 163 ? -7.219  -12.242 88.493  1.00 12.50  ? 163 LEU C C   1 
ATOM   5021 O O   . LEU C 1 163 ? -7.823  -13.186 87.954  1.00 11.97  ? 163 LEU C O   1 
ATOM   5022 C CB  . LEU C 1 163 ? -8.184  -10.387 89.863  1.00 12.59  ? 163 LEU C CB  1 
ATOM   5023 C CG  . LEU C 1 163 ? -8.759  -9.850  91.171  1.00 17.42  ? 163 LEU C CG  1 
ATOM   5024 C CD1 . LEU C 1 163 ? -9.291  -8.415  90.935  1.00 19.35  ? 163 LEU C CD1 1 
ATOM   5025 C CD2 . LEU C 1 163 ? -9.855  -10.749 91.699  1.00 16.21  ? 163 LEU C CD2 1 
ATOM   5026 N N   . GLU C 1 164 ? -6.189  -11.599 87.930  1.00 8.76   ? 164 GLU C N   1 
ATOM   5027 C CA  . GLU C 1 164 ? -5.714  -11.914 86.581  1.00 8.44   ? 164 GLU C CA  1 
ATOM   5028 C C   . GLU C 1 164 ? -5.295  -13.376 86.480  1.00 11.97  ? 164 GLU C C   1 
ATOM   5029 O O   . GLU C 1 164 ? -5.526  -14.027 85.488  1.00 15.29  ? 164 GLU C O   1 
ATOM   5030 C CB  . GLU C 1 164 ? -4.540  -11.010 86.223  1.00 7.90   ? 164 GLU C CB  1 
ATOM   5031 C CG  . GLU C 1 164 ? -4.267  -10.858 84.765  1.00 5.46   ? 164 GLU C CG  1 
ATOM   5032 C CD  . GLU C 1 164 ? -3.434  -11.984 84.195  1.00 8.05   ? 164 GLU C CD  1 
ATOM   5033 O OE1 . GLU C 1 164 ? -2.839  -12.779 84.941  1.00 13.52  ? 164 GLU C OE1 1 
ATOM   5034 O OE2 . GLU C 1 164 ? -3.373  -12.089 82.965  1.00 7.84   ? 164 GLU C OE2 1 
ATOM   5035 N N   . ARG C 1 165 ? -4.670  -13.887 87.542  1.00 16.15  ? 165 ARG C N   1 
ATOM   5036 C CA  . ARG C 1 165 ? -4.236  -15.277 87.598  1.00 16.49  ? 165 ARG C CA  1 
ATOM   5037 C C   . ARG C 1 165 ? -5.439  -16.207 87.564  1.00 15.30  ? 165 ARG C C   1 
ATOM   5038 O O   . ARG C 1 165 ? -5.379  -17.290 86.998  1.00 11.62  ? 165 ARG C O   1 
ATOM   5039 C CB  . ARG C 1 165 ? -3.432  -15.496 88.892  1.00 18.11  ? 165 ARG C CB  1 
ATOM   5040 C CG  . ARG C 1 165 ? -2.877  -16.887 89.072  1.00 20.36  ? 165 ARG C CG  1 
ATOM   5041 C CD  . ARG C 1 165 ? -2.129  -16.980 90.380  1.00 26.68  ? 165 ARG C CD  1 
ATOM   5042 N NE  . ARG C 1 165 ? -1.020  -16.028 90.444  1.00 26.88  ? 165 ARG C NE  1 
ATOM   5043 C CZ  . ARG C 1 165 ? 0.056   -16.173 91.213  1.00 25.60  ? 165 ARG C CZ  1 
ATOM   5044 N NH1 . ARG C 1 165 ? 0.160   -17.238 92.020  1.00 25.84  ? 165 ARG C NH1 1 
ATOM   5045 N NH2 . ARG C 1 165 ? 1.015   -15.245 91.165  1.00 22.79  ? 165 ARG C NH2 1 
ATOM   5046 N N   . ASN C 1 166 ? -6.528  -15.777 88.194  1.00 19.38  ? 166 ASN C N   1 
ATOM   5047 C CA  . ASN C 1 166 ? -7.764  -16.560 88.211  1.00 21.85  ? 166 ASN C CA  1 
ATOM   5048 C C   . ASN C 1 166 ? -8.364  -16.557 86.806  1.00 22.64  ? 166 ASN C C   1 
ATOM   5049 O O   . ASN C 1 166 ? -8.894  -17.566 86.328  1.00 21.20  ? 166 ASN C O   1 
ATOM   5050 C CB  . ASN C 1 166 ? -8.757  -15.971 89.211  1.00 21.69  ? 166 ASN C CB  1 
ATOM   5051 C CG  . ASN C 1 166 ? -8.745  -16.684 90.514  1.00 23.45  ? 166 ASN C CG  1 
ATOM   5052 O OD1 . ASN C 1 166 ? -8.649  -16.059 91.558  1.00 27.13  ? 166 ASN C OD1 1 
ATOM   5053 N ND2 . ASN C 1 166 ? -8.841  -18.001 90.475  1.00 22.61  ? 166 ASN C ND2 1 
ATOM   5054 N N   . GLN C 1 167 ? -8.237  -15.413 86.140  1.00 22.91  ? 167 GLN C N   1 
ATOM   5055 C CA  . GLN C 1 167 ? -8.692  -15.252 84.770  1.00 24.66  ? 167 GLN C CA  1 
ATOM   5056 C C   . GLN C 1 167 ? -7.938  -16.154 83.803  1.00 24.92  ? 167 GLN C C   1 
ATOM   5057 O O   . GLN C 1 167 ? -8.541  -16.717 82.908  1.00 26.72  ? 167 GLN C O   1 
ATOM   5058 C CB  . GLN C 1 167 ? -8.557  -13.800 84.333  1.00 27.25  ? 167 GLN C CB  1 
ATOM   5059 C CG  . GLN C 1 167 ? -9.294  -13.478 83.059  1.00 32.30  ? 167 GLN C CG  1 
ATOM   5060 C CD  . GLN C 1 167 ? -9.256  -12.003 82.749  1.00 35.46  ? 167 GLN C CD  1 
ATOM   5061 O OE1 . GLN C 1 167 ? -10.283 -11.316 82.809  1.00 34.71  ? 167 GLN C OE1 1 
ATOM   5062 N NE2 . GLN C 1 167 ? -8.067  -11.503 82.417  1.00 35.13  ? 167 GLN C NE2 1 
ATOM   5063 N N   . VAL C 1 168 ? -6.636  -16.327 83.992  1.00 23.08  ? 168 VAL C N   1 
ATOM   5064 C CA  . VAL C 1 168 ? -5.872  -17.238 83.138  1.00 20.38  ? 168 VAL C CA  1 
ATOM   5065 C C   . VAL C 1 168 ? -6.238  -18.676 83.427  1.00 21.12  ? 168 VAL C C   1 
ATOM   5066 O O   . VAL C 1 168 ? -6.133  -19.520 82.569  1.00 23.36  ? 168 VAL C O   1 
ATOM   5067 C CB  . VAL C 1 168 ? -4.310  -17.028 83.252  1.00 17.72  ? 168 VAL C CB  1 
ATOM   5068 C CG1 . VAL C 1 168 ? -3.967  -15.538 83.225  1.00 13.19  ? 168 VAL C CG1 1 
ATOM   5069 C CG2 . VAL C 1 168 ? -3.757  -17.672 84.490  1.00 17.56  ? 168 VAL C CG2 1 
ATOM   5070 N N   . PHE C 1 169 ? -6.683  -18.946 84.648  1.00 22.09  ? 169 PHE C N   1 
ATOM   5071 C CA  . PHE C 1 169 ? -7.084  -20.286 85.043  1.00 22.09  ? 169 PHE C CA  1 
ATOM   5072 C C   . PHE C 1 169 ? -8.431  -20.621 84.411  1.00 23.26  ? 169 PHE C C   1 
ATOM   5073 O O   . PHE C 1 169 ? -8.698  -21.767 84.044  1.00 24.86  ? 169 PHE C O   1 
ATOM   5074 C CB  . PHE C 1 169 ? -7.157  -20.374 86.586  1.00 17.64  ? 169 PHE C CB  1 
ATOM   5075 C CG  . PHE C 1 169 ? -7.499  -21.747 87.119  1.00 10.54  ? 169 PHE C CG  1 
ATOM   5076 C CD1 . PHE C 1 169 ? -6.504  -22.717 87.235  1.00 5.28   ? 169 PHE C CD1 1 
ATOM   5077 C CD2 . PHE C 1 169 ? -8.805  -22.078 87.473  1.00 9.05   ? 169 PHE C CD2 1 
ATOM   5078 C CE1 . PHE C 1 169 ? -6.779  -24.004 87.702  1.00 4.39   ? 169 PHE C CE1 1 
ATOM   5079 C CE2 . PHE C 1 169 ? -9.106  -23.361 87.939  1.00 9.55   ? 169 PHE C CE2 1 
ATOM   5080 C CZ  . PHE C 1 169 ? -8.071  -24.341 88.058  1.00 8.60   ? 169 PHE C CZ  1 
ATOM   5081 N N   . GLU C 1 170 ? -9.283  -19.599 84.328  1.00 22.50  ? 170 GLU C N   1 
ATOM   5082 C CA  . GLU C 1 170 ? -10.598 -19.732 83.735  1.00 22.56  ? 170 GLU C CA  1 
ATOM   5083 C C   . GLU C 1 170 ? -11.049 -18.371 83.178  1.00 23.48  ? 170 GLU C C   1 
ATOM   5084 O O   . GLU C 1 170 ? -11.600 -17.539 83.938  1.00 24.48  ? 170 GLU C O   1 
ATOM   5085 C CB  . GLU C 1 170 ? -11.615 -20.230 84.775  1.00 22.11  ? 170 GLU C CB  1 
ATOM   5086 C CG  . GLU C 1 170 ? -13.048 -20.407 84.232  1.00 24.12  ? 170 GLU C CG  1 
ATOM   5087 C CD  . GLU C 1 170 ? -13.104 -21.228 82.935  1.00 24.63  ? 170 GLU C CD  1 
ATOM   5088 O OE1 . GLU C 1 170 ? -12.963 -22.486 82.987  1.00 26.03  ? 170 GLU C OE1 1 
ATOM   5089 O OE2 . GLU C 1 170 ? -13.284 -20.593 81.864  1.00 27.12  ? 170 GLU C OE2 1 
ATOM   5090 N N   . PRO C 1 171 ? -10.850 -18.143 81.849  1.00 24.01  ? 171 PRO C N   1 
ATOM   5091 C CA  . PRO C 1 171 ? -11.101 -16.878 81.162  1.00 22.87  ? 171 PRO C CA  1 
ATOM   5092 C C   . PRO C 1 171 ? -12.457 -16.249 81.441  1.00 24.54  ? 171 PRO C C   1 
ATOM   5093 O O   . PRO C 1 171 ? -12.574 -15.016 81.591  1.00 25.12  ? 171 PRO C O   1 
ATOM   5094 C CB  . PRO C 1 171 ? -10.898 -17.245 79.706  1.00 19.64  ? 171 PRO C CB  1 
ATOM   5095 C CG  . PRO C 1 171 ? -9.885  -18.297 79.747  1.00 20.04  ? 171 PRO C CG  1 
ATOM   5096 C CD  . PRO C 1 171 ? -10.248 -19.129 80.930  1.00 20.61  ? 171 PRO C CD  1 
ATOM   5097 N N   . SER C 1 172 ? -13.477 -17.078 81.534  1.00 25.72  ? 172 SER C N   1 
ATOM   5098 C CA  . SER C 1 172 ? -14.828 -16.584 81.719  1.00 26.39  ? 172 SER C CA  1 
ATOM   5099 C C   . SER C 1 172 ? -15.155 -16.088 83.124  1.00 27.47  ? 172 SER C C   1 
ATOM   5100 O O   . SER C 1 172 ? -16.185 -15.423 83.298  1.00 29.25  ? 172 SER C O   1 
ATOM   5101 C CB  . SER C 1 172 ? -15.846 -17.632 81.286  1.00 26.70  ? 172 SER C CB  1 
ATOM   5102 O OG  . SER C 1 172 ? -15.521 -18.886 81.844  1.00 27.48  ? 172 SER C OG  1 
ATOM   5103 N N   . CYS C 1 173 ? -14.316 -16.419 84.108  1.00 25.74  ? 173 CYS C N   1 
ATOM   5104 C CA  . CYS C 1 173 ? -14.614 -16.153 85.520  1.00 24.91  ? 173 CYS C CA  1 
ATOM   5105 C C   . CYS C 1 173 ? -14.988 -14.690 85.828  1.00 25.96  ? 173 CYS C C   1 
ATOM   5106 O O   . CYS C 1 173 ? -15.939 -14.426 86.551  1.00 28.65  ? 173 CYS C O   1 
ATOM   5107 C CB  . CYS C 1 173 ? -13.474 -16.655 86.445  1.00 26.64  ? 173 CYS C CB  1 
ATOM   5108 S SG  . CYS C 1 173 ? -11.820 -15.941 86.287  1.00 24.63  ? 173 CYS C SG  1 
ATOM   5109 N N   . LEU C 1 174 ? -14.246 -13.738 85.273  1.00 25.16  ? 174 LEU C N   1 
ATOM   5110 C CA  . LEU C 1 174 ? -14.518 -12.343 85.560  1.00 27.95  ? 174 LEU C CA  1 
ATOM   5111 C C   . LEU C 1 174 ? -15.603 -11.702 84.676  1.00 29.78  ? 174 LEU C C   1 
ATOM   5112 O O   . LEU C 1 174 ? -15.973 -10.548 84.915  1.00 31.24  ? 174 LEU C O   1 
ATOM   5113 C CB  . LEU C 1 174 ? -13.220 -11.527 85.505  1.00 28.49  ? 174 LEU C CB  1 
ATOM   5114 C CG  . LEU C 1 174 ? -12.498 -11.352 86.856  1.00 29.97  ? 174 LEU C CG  1 
ATOM   5115 C CD1 . LEU C 1 174 ? -12.053 -12.708 87.404  1.00 27.84  ? 174 LEU C CD1 1 
ATOM   5116 C CD2 . LEU C 1 174 ? -11.309 -10.456 86.676  1.00 29.55  ? 174 LEU C CD2 1 
ATOM   5117 N N   . ASP C 1 175 ? -16.114 -12.432 83.687  1.00 31.76  ? 175 ASP C N   1 
ATOM   5118 C CA  . ASP C 1 175 ? -17.147 -11.896 82.786  1.00 30.69  ? 175 ASP C CA  1 
ATOM   5119 C C   . ASP C 1 175 ? -18.377 -11.441 83.572  1.00 29.66  ? 175 ASP C C   1 
ATOM   5120 O O   . ASP C 1 175 ? -18.925 -10.358 83.331  1.00 31.37  ? 175 ASP C O   1 
ATOM   5121 C CB  . ASP C 1 175 ? -17.546 -12.953 81.751  1.00 32.71  ? 175 ASP C CB  1 
ATOM   5122 C CG  . ASP C 1 175 ? -16.432 -13.255 80.747  1.00 35.25  ? 175 ASP C CG  1 
ATOM   5123 O OD1 . ASP C 1 175 ? -15.438 -12.490 80.658  1.00 34.26  ? 175 ASP C OD1 1 
ATOM   5124 O OD2 . ASP C 1 175 ? -16.556 -14.284 80.043  1.00 37.08  ? 175 ASP C OD2 1 
ATOM   5125 N N   . ALA C 1 176 ? -18.775 -12.262 84.533  1.00 26.48  ? 176 ALA C N   1 
ATOM   5126 C CA  . ALA C 1 176 ? -19.937 -11.991 85.357  1.00 24.23  ? 176 ALA C CA  1 
ATOM   5127 C C   . ALA C 1 176 ? -19.755 -10.784 86.242  1.00 23.43  ? 176 ALA C C   1 
ATOM   5128 O O   . ALA C 1 176 ? -20.715 -10.300 86.837  1.00 23.58  ? 176 ALA C O   1 
ATOM   5129 C CB  . ALA C 1 176 ? -20.269 -13.221 86.216  1.00 23.21  ? 176 ALA C CB  1 
ATOM   5130 N N   . PHE C 1 177 ? -18.516 -10.319 86.341  1.00 24.00  ? 177 PHE C N   1 
ATOM   5131 C CA  . PHE C 1 177 ? -18.185 -9.213  87.233  1.00 23.99  ? 177 PHE C CA  1 
ATOM   5132 C C   . PHE C 1 177 ? -17.416 -8.161  86.429  1.00 26.38  ? 177 PHE C C   1 
ATOM   5133 O O   . PHE C 1 177 ? -16.236 -7.927  86.667  1.00 25.56  ? 177 PHE C O   1 
ATOM   5134 C CB  . PHE C 1 177 ? -17.345 -9.652  88.454  1.00 19.48  ? 177 PHE C CB  1 
ATOM   5135 C CG  . PHE C 1 177 ? -17.847 -10.866 89.140  1.00 11.75  ? 177 PHE C CG  1 
ATOM   5136 C CD1 . PHE C 1 177 ? -18.799 -10.753 90.135  1.00 9.57   ? 177 PHE C CD1 1 
ATOM   5137 C CD2 . PHE C 1 177 ? -17.399 -12.134 88.762  1.00 9.95   ? 177 PHE C CD2 1 
ATOM   5138 C CE1 . PHE C 1 177 ? -19.322 -11.917 90.755  1.00 9.69   ? 177 PHE C CE1 1 
ATOM   5139 C CE2 . PHE C 1 177 ? -17.906 -13.298 89.367  1.00 8.43   ? 177 PHE C CE2 1 
ATOM   5140 C CZ  . PHE C 1 177 ? -18.866 -13.191 90.363  1.00 6.56   ? 177 PHE C CZ  1 
ATOM   5141 N N   . PRO C 1 178 ? -18.112 -7.448  85.516  1.00 27.72  ? 178 PRO C N   1 
ATOM   5142 C CA  . PRO C 1 178 ? -17.459 -6.474  84.635  1.00 26.95  ? 178 PRO C CA  1 
ATOM   5143 C C   . PRO C 1 178 ? -16.595 -5.505  85.419  1.00 25.34  ? 178 PRO C C   1 
ATOM   5144 O O   . PRO C 1 178 ? -15.581 -5.027  84.928  1.00 28.27  ? 178 PRO C O   1 
ATOM   5145 C CB  . PRO C 1 178 ? -18.659 -5.743  83.996  1.00 27.07  ? 178 PRO C CB  1 
ATOM   5146 C CG  . PRO C 1 178 ? -19.790 -5.982  84.968  1.00 25.47  ? 178 PRO C CG  1 
ATOM   5147 C CD  . PRO C 1 178 ? -19.569 -7.393  85.433  1.00 26.03  ? 178 PRO C CD  1 
ATOM   5148 N N   . ASN C 1 179 ? -17.017 -5.232  86.654  1.00 26.78  ? 179 ASN C N   1 
ATOM   5149 C CA  . ASN C 1 179 ? -16.342 -4.324  87.588  1.00 26.75  ? 179 ASN C CA  1 
ATOM   5150 C C   . ASN C 1 179 ? -14.863 -4.739  87.776  1.00 26.88  ? 179 ASN C C   1 
ATOM   5151 O O   . ASN C 1 179 ? -13.923 -3.914  87.664  1.00 26.88  ? 179 ASN C O   1 
ATOM   5152 C CB  . ASN C 1 179 ? -17.068 -4.367  88.944  1.00 26.09  ? 179 ASN C CB  1 
ATOM   5153 C CG  . ASN C 1 179 ? -16.556 -3.347  89.883  1.00 27.18  ? 179 ASN C CG  1 
ATOM   5154 O OD1 . ASN C 1 179 ? -15.851 -2.414  89.488  1.00 28.31  ? 179 ASN C OD1 1 
ATOM   5155 N ND2 . ASN C 1 179 ? -16.903 -3.490  91.156  1.00 29.05  ? 179 ASN C ND2 1 
ATOM   5156 N N   . LEU C 1 180 ? -14.669 -6.028  88.014  1.00 26.08  ? 180 LEU C N   1 
ATOM   5157 C CA  . LEU C 1 180 ? -13.344 -6.594  88.199  1.00 24.20  ? 180 LEU C CA  1 
ATOM   5158 C C   . LEU C 1 180 ? -12.596 -6.683  86.874  1.00 25.95  ? 180 LEU C C   1 
ATOM   5159 O O   . LEU C 1 180 ? -11.372 -6.524  86.835  1.00 28.54  ? 180 LEU C O   1 
ATOM   5160 C CB  . LEU C 1 180 ? -13.449 -7.967  88.870  1.00 20.97  ? 180 LEU C CB  1 
ATOM   5161 C CG  . LEU C 1 180 ? -14.129 -8.004  90.250  1.00 15.23  ? 180 LEU C CG  1 
ATOM   5162 C CD1 . LEU C 1 180 ? -14.137 -9.440  90.758  1.00 11.36  ? 180 LEU C CD1 1 
ATOM   5163 C CD2 . LEU C 1 180 ? -13.419 -7.076  91.234  1.00 12.69  ? 180 LEU C CD2 1 
ATOM   5164 N N   . LYS C 1 181 ? -13.335 -6.927  85.791  1.00 26.85  ? 181 LYS C N   1 
ATOM   5165 C CA  . LYS C 1 181 ? -12.733 -7.030  84.470  1.00 28.12  ? 181 LYS C CA  1 
ATOM   5166 C C   . LYS C 1 181 ? -12.147 -5.696  84.001  1.00 26.80  ? 181 LYS C C   1 
ATOM   5167 O O   . LYS C 1 181 ? -11.104 -5.643  83.366  1.00 26.60  ? 181 LYS C O   1 
ATOM   5168 C CB  . LYS C 1 181 ? -13.751 -7.564  83.452  1.00 30.64  ? 181 LYS C CB  1 
ATOM   5169 C CG  . LYS C 1 181 ? -13.108 -8.036  82.140  1.00 34.78  ? 181 LYS C CG  1 
ATOM   5170 C CD  . LYS C 1 181 ? -14.131 -8.202  81.036  1.00 37.07  ? 181 LYS C CD  1 
ATOM   5171 C CE  . LYS C 1 181 ? -15.081 -9.344  81.359  1.00 39.16  ? 181 LYS C CE  1 
ATOM   5172 N NZ  . LYS C 1 181 ? -16.094 -9.588  80.263  1.00 38.62  ? 181 LYS C NZ  1 
ATOM   5173 N N   . ASP C 1 182 ? -12.828 -4.601  84.319  1.00 24.47  ? 182 ASP C N   1 
ATOM   5174 C CA  . ASP C 1 182 ? -12.356 -3.298  83.901  1.00 25.99  ? 182 ASP C CA  1 
ATOM   5175 C C   . ASP C 1 182 ? -11.152 -2.895  84.681  1.00 24.75  ? 182 ASP C C   1 
ATOM   5176 O O   . ASP C 1 182 ? -10.308 -2.187  84.149  1.00 26.39  ? 182 ASP C O   1 
ATOM   5177 C CB  . ASP C 1 182 ? -13.441 -2.239  84.068  1.00 26.05  ? 182 ASP C CB  1 
ATOM   5178 C CG  . ASP C 1 182 ? -14.541 -2.342  82.980  1.00 26.35  ? 182 ASP C CG  1 
ATOM   5179 O OD1 . ASP C 1 182 ? -14.210 -2.535  81.765  1.00 22.95  ? 182 ASP C OD1 1 
ATOM   5180 O OD2 . ASP C 1 182 ? -15.741 -2.237  83.359  1.00 27.32  ? 182 ASP C OD2 1 
ATOM   5181 N N   . PHE C 1 183 ? -11.090 -3.366  85.927  1.00 25.42  ? 183 PHE C N   1 
ATOM   5182 C CA  . PHE C 1 183 ? -9.960  -3.112  86.826  1.00 22.86  ? 183 PHE C CA  1 
ATOM   5183 C C   . PHE C 1 183 ? -8.672  -3.577  86.158  1.00 22.34  ? 183 PHE C C   1 
ATOM   5184 O O   . PHE C 1 183 ? -7.734  -2.791  85.989  1.00 21.44  ? 183 PHE C O   1 
ATOM   5185 C CB  . PHE C 1 183 ? -10.174 -3.831  88.175  1.00 20.40  ? 183 PHE C CB  1 
ATOM   5186 C CG  . PHE C 1 183 ? -9.050  -3.649  89.173  1.00 19.28  ? 183 PHE C CG  1 
ATOM   5187 C CD1 . PHE C 1 183 ? -8.856  -2.411  89.810  1.00 19.99  ? 183 PHE C CD1 1 
ATOM   5188 C CD2 . PHE C 1 183 ? -8.176  -4.716  89.465  1.00 17.84  ? 183 PHE C CD2 1 
ATOM   5189 C CE1 . PHE C 1 183 ? -7.818  -2.240  90.716  1.00 14.67  ? 183 PHE C CE1 1 
ATOM   5190 C CE2 . PHE C 1 183 ? -7.139  -4.555  90.357  1.00 13.64  ? 183 PHE C CE2 1 
ATOM   5191 C CZ  . PHE C 1 183 ? -6.954  -3.319  90.993  1.00 11.58  ? 183 PHE C CZ  1 
ATOM   5192 N N   . ILE C 1 184 ? -8.645  -4.856  85.779  1.00 21.52  ? 184 ILE C N   1 
ATOM   5193 C CA  . ILE C 1 184 ? -7.493  -5.444  85.122  1.00 23.14  ? 184 ILE C CA  1 
ATOM   5194 C C   . ILE C 1 184 ? -7.024  -4.563  83.965  1.00 24.40  ? 184 ILE C C   1 
ATOM   5195 O O   . ILE C 1 184 ? -5.845  -4.278  83.812  1.00 28.44  ? 184 ILE C O   1 
ATOM   5196 C CB  . ILE C 1 184 ? -7.815  -6.869  84.640  1.00 21.52  ? 184 ILE C CB  1 
ATOM   5197 C CG1 . ILE C 1 184 ? -8.119  -7.750  85.848  1.00 22.60  ? 184 ILE C CG1 1 
ATOM   5198 C CG2 . ILE C 1 184 ? -6.674  -7.416  83.820  1.00 20.37  ? 184 ILE C CG2 1 
ATOM   5199 C CD1 . ILE C 1 184 ? -8.288  -9.189  85.516  1.00 24.24  ? 184 ILE C CD1 1 
ATOM   5200 N N   . SER C 1 185 ? -7.981  -4.140  83.127  1.00 23.59  ? 185 SER C N   1 
ATOM   5201 C CA  . SER C 1 185 ? -7.688  -3.314  81.962  1.00 23.95  ? 185 SER C CA  1 
ATOM   5202 C C   . SER C 1 185 ? -7.049  -2.001  82.404  1.00 24.46  ? 185 SER C C   1 
ATOM   5203 O O   . SER C 1 185 ? -6.007  -1.614  81.881  1.00 25.56  ? 185 SER C O   1 
ATOM   5204 C CB  . SER C 1 185 ? -8.982  -3.044  81.156  1.00 22.94  ? 185 SER C CB  1 
ATOM   5205 O OG  . SER C 1 185 ? -9.731  -4.242  80.956  1.00 25.49  ? 185 SER C OG  1 
ATOM   5206 N N   . ARG C 1 186 ? -7.682  -1.334  83.367  1.00 24.97  ? 186 ARG C N   1 
ATOM   5207 C CA  . ARG C 1 186 ? -7.213  -0.047  83.866  1.00 25.08  ? 186 ARG C CA  1 
ATOM   5208 C C   . ARG C 1 186 ? -5.791  -0.158  84.410  1.00 26.66  ? 186 ARG C C   1 
ATOM   5209 O O   . ARG C 1 186 ? -4.969  0.730   84.227  1.00 28.44  ? 186 ARG C O   1 
ATOM   5210 C CB  . ARG C 1 186 ? -8.178  0.435   84.951  1.00 26.87  ? 186 ARG C CB  1 
ATOM   5211 C CG  . ARG C 1 186 ? -7.769  1.718   85.667  1.00 31.19  ? 186 ARG C CG  1 
ATOM   5212 C CD  . ARG C 1 186 ? -8.834  2.230   86.615  1.00 30.58  ? 186 ARG C CD  1 
ATOM   5213 N NE  . ARG C 1 186 ? -9.439  1.147   87.380  1.00 35.88  ? 186 ARG C NE  1 
ATOM   5214 C CZ  . ARG C 1 186 ? -10.674 0.690   87.179  1.00 38.02  ? 186 ARG C CZ  1 
ATOM   5215 N NH1 . ARG C 1 186 ? -11.452 1.239   86.248  1.00 38.24  ? 186 ARG C NH1 1 
ATOM   5216 N NH2 . ARG C 1 186 ? -11.147 -0.309  87.921  1.00 39.94  ? 186 ARG C NH2 1 
ATOM   5217 N N   . PHE C 1 187 ? -5.509  -1.269  85.081  1.00 26.99  ? 187 PHE C N   1 
ATOM   5218 C CA  . PHE C 1 187 ? -4.205  -1.505  85.657  1.00 25.51  ? 187 PHE C CA  1 
ATOM   5219 C C   . PHE C 1 187 ? -3.159  -1.666  84.551  1.00 23.99  ? 187 PHE C C   1 
ATOM   5220 O O   . PHE C 1 187 ? -2.134  -0.956  84.541  1.00 24.14  ? 187 PHE C O   1 
ATOM   5221 C CB  . PHE C 1 187 ? -4.215  -2.733  86.567  1.00 23.44  ? 187 PHE C CB  1 
ATOM   5222 C CG  . PHE C 1 187 ? -2.941  -2.935  87.298  1.00 23.95  ? 187 PHE C CG  1 
ATOM   5223 C CD1 . PHE C 1 187 ? -2.707  -2.256  88.496  1.00 24.87  ? 187 PHE C CD1 1 
ATOM   5224 C CD2 . PHE C 1 187 ? -1.951  -3.771  86.775  1.00 25.21  ? 187 PHE C CD2 1 
ATOM   5225 C CE1 . PHE C 1 187 ? -1.486  -2.426  89.194  1.00 25.51  ? 187 PHE C CE1 1 
ATOM   5226 C CE2 . PHE C 1 187 ? -0.732  -3.953  87.456  1.00 24.57  ? 187 PHE C CE2 1 
ATOM   5227 C CZ  . PHE C 1 187 ? -0.499  -3.274  88.671  1.00 25.87  ? 187 PHE C CZ  1 
ATOM   5228 N N   . GLU C 1 188 ? -3.419  -2.598  83.629  1.00 22.89  ? 188 GLU C N   1 
ATOM   5229 C CA  . GLU C 1 188 ? -2.487  -2.865  82.538  1.00 22.54  ? 188 GLU C CA  1 
ATOM   5230 C C   . GLU C 1 188 ? -2.360  -1.612  81.647  1.00 21.51  ? 188 GLU C C   1 
ATOM   5231 O O   . GLU C 1 188 ? -1.359  -1.441  80.943  1.00 21.35  ? 188 GLU C O   1 
ATOM   5232 C CB  . GLU C 1 188 ? -2.972  -4.061  81.717  1.00 19.87  ? 188 GLU C CB  1 
ATOM   5233 C CG  . GLU C 1 188 ? -3.095  -5.333  82.538  1.00 22.29  ? 188 GLU C CG  1 
ATOM   5234 C CD  . GLU C 1 188 ? -3.656  -6.505  81.751  1.00 22.51  ? 188 GLU C CD  1 
ATOM   5235 O OE1 . GLU C 1 188 ? -4.564  -6.280  80.919  1.00 30.61  ? 188 GLU C OE1 1 
ATOM   5236 O OE2 . GLU C 1 188 ? -3.182  -7.654  81.943  1.00 22.92  ? 188 GLU C OE2 1 
ATOM   5237 N N   . GLY C 1 189 ? -3.372  -0.746  81.706  1.00 18.37  ? 189 GLY C N   1 
ATOM   5238 C CA  . GLY C 1 189 ? -3.359  0.474   80.922  1.00 20.12  ? 189 GLY C CA  1 
ATOM   5239 C C   . GLY C 1 189 ? -2.416  1.522   81.456  1.00 21.83  ? 189 GLY C C   1 
ATOM   5240 O O   . GLY C 1 189 ? -2.156  2.510   80.767  1.00 22.58  ? 189 GLY C O   1 
ATOM   5241 N N   . LEU C 1 190 ? -1.893  1.313   82.664  1.00 24.60  ? 190 LEU C N   1 
ATOM   5242 C CA  . LEU C 1 190 ? -0.959  2.274   83.264  1.00 27.66  ? 190 LEU C CA  1 
ATOM   5243 C C   . LEU C 1 190 ? 0.337   2.311   82.467  1.00 28.02  ? 190 LEU C C   1 
ATOM   5244 O O   . LEU C 1 190 ? 0.937   1.253   82.207  1.00 26.48  ? 190 LEU C O   1 
ATOM   5245 C CB  . LEU C 1 190 ? -0.661  1.909   84.730  1.00 26.78  ? 190 LEU C CB  1 
ATOM   5246 C CG  . LEU C 1 190 ? -1.829  1.979   85.728  1.00 26.17  ? 190 LEU C CG  1 
ATOM   5247 C CD1 . LEU C 1 190 ? -1.410  1.369   87.075  1.00 28.23  ? 190 LEU C CD1 1 
ATOM   5248 C CD2 . LEU C 1 190 ? -2.272  3.417   85.909  1.00 25.23  ? 190 LEU C CD2 1 
ATOM   5249 N N   . GLU C 1 191 ? 0.738   3.512   82.051  1.00 29.25  ? 191 GLU C N   1 
ATOM   5250 C CA  . GLU C 1 191 ? 1.909   3.713   81.198  1.00 32.49  ? 191 GLU C CA  1 
ATOM   5251 C C   . GLU C 1 191 ? 3.135   2.851   81.546  1.00 33.27  ? 191 GLU C C   1 
ATOM   5252 O O   . GLU C 1 191 ? 3.704   2.171   80.673  1.00 33.58  ? 191 GLU C O   1 
ATOM   5253 C CB  . GLU C 1 191 ? 2.320   5.187   81.184  1.00 36.31  ? 191 GLU C CB  1 
ATOM   5254 C CG  . GLU C 1 191 ? 3.439   5.511   80.179  1.00 40.81  ? 191 GLU C CG  1 
ATOM   5255 C CD  . GLU C 1 191 ? 3.058   5.181   78.735  1.00 44.20  ? 191 GLU C CD  1 
ATOM   5256 O OE1 . GLU C 1 191 ? 2.424   6.037   78.065  1.00 47.13  ? 191 GLU C OE1 1 
ATOM   5257 O OE2 . GLU C 1 191 ? 3.391   4.060   78.284  1.00 43.73  ? 191 GLU C OE2 1 
ATOM   5258 N N   . LYS C 1 192 ? 3.523   2.860   82.817  1.00 31.93  ? 192 LYS C N   1 
ATOM   5259 C CA  . LYS C 1 192 ? 4.677   2.103   83.274  1.00 31.31  ? 192 LYS C CA  1 
ATOM   5260 C C   . LYS C 1 192 ? 4.417   0.610   83.160  1.00 31.01  ? 192 LYS C C   1 
ATOM   5261 O O   . LYS C 1 192 ? 5.298   -0.148  82.775  1.00 31.99  ? 192 LYS C O   1 
ATOM   5262 C CB  . LYS C 1 192 ? 5.030   2.479   84.713  1.00 31.10  ? 192 LYS C CB  1 
ATOM   5263 C CG  . LYS C 1 192 ? 5.403   3.949   84.895  1.00 33.68  ? 192 LYS C CG  1 
ATOM   5264 C CD  . LYS C 1 192 ? 4.710   4.535   86.102  1.00 33.64  ? 192 LYS C CD  1 
ATOM   5265 C CE  . LYS C 1 192 ? 5.116   5.989   86.300  1.00 35.10  ? 192 LYS C CE  1 
ATOM   5266 N NZ  . LYS C 1 192 ? 6.578   6.156   86.489  1.00 33.98  ? 192 LYS C NZ  1 
ATOM   5267 N N   . ILE C 1 193 ? 3.190   0.197   83.475  1.00 32.05  ? 193 ILE C N   1 
ATOM   5268 C CA  . ILE C 1 193 ? 2.814   -1.212  83.452  1.00 32.19  ? 193 ILE C CA  1 
ATOM   5269 C C   . ILE C 1 193 ? 2.837   -1.725  82.007  1.00 32.69  ? 193 ILE C C   1 
ATOM   5270 O O   . ILE C 1 193 ? 3.486   -2.734  81.714  1.00 32.80  ? 193 ILE C O   1 
ATOM   5271 C CB  . ILE C 1 193 ? 1.401   -1.440  84.068  1.00 33.08  ? 193 ILE C CB  1 
ATOM   5272 C CG1 . ILE C 1 193 ? 1.369   -0.905  85.501  1.00 29.12  ? 193 ILE C CG1 1 
ATOM   5273 C CG2 . ILE C 1 193 ? 1.044   -2.921  84.035  1.00 33.19  ? 193 ILE C CG2 1 
ATOM   5274 C CD1 . ILE C 1 193 ? 2.405   -1.509  86.414  1.00 28.51  ? 193 ILE C CD1 1 
ATOM   5275 N N   . SER C 1 194 ? 2.138   -1.022  81.105  1.00 32.41  ? 194 SER C N   1 
ATOM   5276 C CA  . SER C 1 194 ? 2.078   -1.410  79.700  1.00 32.87  ? 194 SER C CA  1 
ATOM   5277 C C   . SER C 1 194 ? 3.491   -1.476  79.106  1.00 29.49  ? 194 SER C C   1 
ATOM   5278 O O   . SER C 1 194 ? 3.826   -2.434  78.390  1.00 29.22  ? 194 SER C O   1 
ATOM   5279 C CB  . SER C 1 194 ? 1.187   -0.446  78.898  1.00 34.63  ? 194 SER C CB  1 
ATOM   5280 O OG  . SER C 1 194 ? 1.574   0.902   79.099  1.00 39.67  ? 194 SER C OG  1 
ATOM   5281 N N   . ALA C 1 195 ? 4.304   -0.472  79.423  1.00 27.38  ? 195 ALA C N   1 
ATOM   5282 C CA  . ALA C 1 195 ? 5.676   -0.428  78.970  1.00 25.56  ? 195 ALA C CA  1 
ATOM   5283 C C   . ALA C 1 195 ? 6.430   -1.665  79.441  1.00 25.26  ? 195 ALA C C   1 
ATOM   5284 O O   . ALA C 1 195 ? 7.104   -2.324  78.645  1.00 27.99  ? 195 ALA C O   1 
ATOM   5285 C CB  . ALA C 1 195 ? 6.334   0.836   79.463  1.00 23.72  ? 195 ALA C CB  1 
ATOM   5286 N N   . TYR C 1 196 ? 6.296   -1.981  80.728  1.00 23.58  ? 196 TYR C N   1 
ATOM   5287 C CA  . TYR C 1 196 ? 6.960   -3.143  81.318  1.00 23.35  ? 196 TYR C CA  1 
ATOM   5288 C C   . TYR C 1 196 ? 6.483   -4.434  80.671  1.00 22.25  ? 196 TYR C C   1 
ATOM   5289 O O   . TYR C 1 196 ? 7.265   -5.353  80.421  1.00 23.28  ? 196 TYR C O   1 
ATOM   5290 C CB  . TYR C 1 196 ? 6.713   -3.173  82.832  1.00 23.99  ? 196 TYR C CB  1 
ATOM   5291 C CG  . TYR C 1 196 ? 7.194   -4.429  83.542  1.00 24.55  ? 196 TYR C CG  1 
ATOM   5292 C CD1 . TYR C 1 196 ? 8.497   -4.951  83.328  1.00 24.32  ? 196 TYR C CD1 1 
ATOM   5293 C CD2 . TYR C 1 196 ? 6.332   -5.125  84.404  1.00 22.67  ? 196 TYR C CD2 1 
ATOM   5294 C CE1 . TYR C 1 196 ? 8.921   -6.132  83.969  1.00 23.79  ? 196 TYR C CE1 1 
ATOM   5295 C CE2 . TYR C 1 196 ? 6.757   -6.310  85.045  1.00 22.24  ? 196 TYR C CE2 1 
ATOM   5296 C CZ  . TYR C 1 196 ? 8.041   -6.784  84.824  1.00 24.01  ? 196 TYR C CZ  1 
ATOM   5297 O OH  . TYR C 1 196 ? 8.423   -7.935  85.445  1.00 24.13  ? 196 TYR C OH  1 
ATOM   5298 N N   . MET C 1 197 ? 5.181   -4.501  80.388  1.00 24.23  ? 197 MET C N   1 
ATOM   5299 C CA  . MET C 1 197 ? 4.613   -5.692  79.781  1.00 28.98  ? 197 MET C CA  1 
ATOM   5300 C C   . MET C 1 197 ? 5.090   -5.890  78.328  1.00 29.76  ? 197 MET C C   1 
ATOM   5301 O O   . MET C 1 197 ? 5.061   -7.016  77.796  1.00 28.27  ? 197 MET C O   1 
ATOM   5302 C CB  . MET C 1 197 ? 3.086   -5.623  79.824  1.00 30.07  ? 197 MET C CB  1 
ATOM   5303 C CG  . MET C 1 197 ? 2.516   -5.627  81.205  1.00 33.34  ? 197 MET C CG  1 
ATOM   5304 S SD  . MET C 1 197 ? 0.755   -5.358  81.316  1.00 37.95  ? 197 MET C SD  1 
ATOM   5305 C CE  . MET C 1 197 ? 0.176   -7.027  81.459  1.00 35.34  ? 197 MET C CE  1 
ATOM   5306 N N   . LYS C 1 198 ? 5.551   -4.807  77.697  1.00 30.58  ? 198 LYS C N   1 
ATOM   5307 C CA  . LYS C 1 198 ? 6.158   -4.890  76.372  1.00 33.24  ? 198 LYS C CA  1 
ATOM   5308 C C   . LYS C 1 198 ? 7.618   -5.333  76.493  1.00 35.76  ? 198 LYS C C   1 
ATOM   5309 O O   . LYS C 1 198 ? 8.175   -5.897  75.545  1.00 38.08  ? 198 LYS C O   1 
ATOM   5310 C CB  . LYS C 1 198 ? 6.127   -3.529  75.692  1.00 33.42  ? 198 LYS C CB  1 
ATOM   5311 C CG  . LYS C 1 198 ? 4.735   -2.987  75.428  1.00 35.74  ? 198 LYS C CG  1 
ATOM   5312 C CD  . LYS C 1 198 ? 4.794   -1.538  74.920  1.00 36.44  ? 198 LYS C CD  1 
ATOM   5313 C CE  . LYS C 1 198 ? 3.398   -0.936  74.789  1.00 37.18  ? 198 LYS C CE  1 
ATOM   5314 N NZ  . LYS C 1 198 ? 3.467   0.518   74.446  1.00 38.87  ? 198 LYS C NZ  1 
ATOM   5315 N N   . SER C 1 199 ? 8.216   -5.078  77.651  1.00 35.74  ? 199 SER C N   1 
ATOM   5316 C CA  . SER C 1 199 ? 9.604   -5.422  77.920  1.00 36.07  ? 199 SER C CA  1 
ATOM   5317 C C   . SER C 1 199 ? 9.811   -6.934  78.040  1.00 36.31  ? 199 SER C C   1 
ATOM   5318 O O   . SER C 1 199 ? 8.908   -7.691  78.414  1.00 37.01  ? 199 SER C O   1 
ATOM   5319 C CB  . SER C 1 199 ? 10.052  -4.737  79.207  1.00 35.57  ? 199 SER C CB  1 
ATOM   5320 O OG  . SER C 1 199 ? 11.317  -5.222  79.630  1.00 36.48  ? 199 SER C OG  1 
ATOM   5321 N N   . SER C 1 200 ? 11.030  -7.359  77.739  1.00 34.93  ? 200 SER C N   1 
ATOM   5322 C CA  . SER C 1 200 ? 11.401  -8.765  77.811  1.00 34.99  ? 200 SER C CA  1 
ATOM   5323 C C   . SER C 1 200 ? 11.458  -9.248  79.268  1.00 34.90  ? 200 SER C C   1 
ATOM   5324 O O   . SER C 1 200 ? 11.400  -10.459 79.550  1.00 36.89  ? 200 SER C O   1 
ATOM   5325 C CB  . SER C 1 200 ? 12.757  -8.983  77.140  1.00 37.02  ? 200 SER C CB  1 
ATOM   5326 O OG  . SER C 1 200 ? 13.677  -7.974  77.533  1.00 39.74  ? 200 SER C OG  1 
ATOM   5327 N N   . ARG C 1 201 ? 11.567  -8.298  80.190  1.00 32.86  ? 201 ARG C N   1 
ATOM   5328 C CA  . ARG C 1 201 ? 11.648  -8.612  81.605  1.00 29.65  ? 201 ARG C CA  1 
ATOM   5329 C C   . ARG C 1 201 ? 10.296  -8.955  82.222  1.00 28.55  ? 201 ARG C C   1 
ATOM   5330 O O   . ARG C 1 201 ? 10.192  -9.026  83.464  1.00 29.24  ? 201 ARG C O   1 
ATOM   5331 C CB  . ARG C 1 201 ? 12.268  -7.431  82.370  1.00 28.16  ? 201 ARG C CB  1 
ATOM   5332 C CG  . ARG C 1 201 ? 13.490  -6.809  81.719  1.00 26.92  ? 201 ARG C CG  1 
ATOM   5333 C CD  . ARG C 1 201 ? 13.945  -5.595  82.502  1.00 28.80  ? 201 ARG C CD  1 
ATOM   5334 N NE  . ARG C 1 201 ? 12.855  -4.649  82.750  1.00 29.21  ? 201 ARG C NE  1 
ATOM   5335 C CZ  . ARG C 1 201 ? 12.584  -3.598  81.970  1.00 28.83  ? 201 ARG C CZ  1 
ATOM   5336 N NH1 . ARG C 1 201 ? 13.320  -3.349  80.889  1.00 28.18  ? 201 ARG C NH1 1 
ATOM   5337 N NH2 . ARG C 1 201 ? 11.576  -2.789  82.271  1.00 31.18  ? 201 ARG C NH2 1 
ATOM   5338 N N   . PHE C 1 202 ? 9.275   -9.137  81.386  1.00 27.14  ? 202 PHE C N   1 
ATOM   5339 C CA  . PHE C 1 202 ? 7.927   -9.358  81.888  1.00 26.51  ? 202 PHE C CA  1 
ATOM   5340 C C   . PHE C 1 202 ? 7.701   -10.652 82.714  1.00 25.15  ? 202 PHE C C   1 
ATOM   5341 O O   . PHE C 1 202 ? 7.240   -10.600 83.893  1.00 23.68  ? 202 PHE C O   1 
ATOM   5342 C CB  . PHE C 1 202 ? 6.886   -9.245  80.780  1.00 27.05  ? 202 PHE C CB  1 
ATOM   5343 C CG  . PHE C 1 202 ? 5.486   -9.171  81.287  1.00 25.47  ? 202 PHE C CG  1 
ATOM   5344 C CD1 . PHE C 1 202 ? 5.170   -8.314  82.346  1.00 27.14  ? 202 PHE C CD1 1 
ATOM   5345 C CD2 . PHE C 1 202 ? 4.498   -9.973  80.750  1.00 25.05  ? 202 PHE C CD2 1 
ATOM   5346 C CE1 . PHE C 1 202 ? 3.863   -8.256  82.865  1.00 26.85  ? 202 PHE C CE1 1 
ATOM   5347 C CE2 . PHE C 1 202 ? 3.180   -9.928  81.243  1.00 28.55  ? 202 PHE C CE2 1 
ATOM   5348 C CZ  . PHE C 1 202 ? 2.857   -9.073  82.303  1.00 28.26  ? 202 PHE C CZ  1 
ATOM   5349 N N   . LEU C 1 203 ? 8.036   -11.811 82.118  1.00 23.30  ? 203 LEU C N   1 
ATOM   5350 C CA  . LEU C 1 203 ? 7.853   -13.098 82.819  1.00 24.63  ? 203 LEU C CA  1 
ATOM   5351 C C   . LEU C 1 203 ? 6.441   -13.293 83.460  1.00 25.00  ? 203 LEU C C   1 
ATOM   5352 O O   . LEU C 1 203 ? 6.309   -13.297 84.702  1.00 25.94  ? 203 LEU C O   1 
ATOM   5353 C CB  . LEU C 1 203 ? 8.958   -13.290 83.881  1.00 19.64  ? 203 LEU C CB  1 
ATOM   5354 C CG  . LEU C 1 203 ? 9.071   -14.683 84.514  1.00 19.18  ? 203 LEU C CG  1 
ATOM   5355 C CD1 . LEU C 1 203 ? 9.409   -15.716 83.459  1.00 20.36  ? 203 LEU C CD1 1 
ATOM   5356 C CD2 . LEU C 1 203 ? 10.118  -14.684 85.579  1.00 17.79  ? 203 LEU C CD2 1 
ATOM   5357 N N   . PRO C 1 204 ? 5.370   -13.405 82.625  1.00 26.71  ? 204 PRO C N   1 
ATOM   5358 C CA  . PRO C 1 204 ? 4.008   -13.598 83.127  1.00 25.73  ? 204 PRO C CA  1 
ATOM   5359 C C   . PRO C 1 204 ? 3.704   -15.027 83.509  1.00 24.10  ? 204 PRO C C   1 
ATOM   5360 O O   . PRO C 1 204 ? 2.779   -15.277 84.285  1.00 22.76  ? 204 PRO C O   1 
ATOM   5361 C CB  . PRO C 1 204 ? 3.179   -13.190 81.926  1.00 26.32  ? 204 PRO C CB  1 
ATOM   5362 C CG  . PRO C 1 204 ? 3.989   -13.668 80.790  1.00 26.75  ? 204 PRO C CG  1 
ATOM   5363 C CD  . PRO C 1 204 ? 5.389   -13.343 81.159  1.00 26.41  ? 204 PRO C CD  1 
ATOM   5364 N N   . ARG C 1 205 ? 4.485   -15.960 82.978  1.00 25.91  ? 205 ARG C N   1 
ATOM   5365 C CA  . ARG C 1 205 ? 4.319   -17.377 83.264  1.00 26.62  ? 205 ARG C CA  1 
ATOM   5366 C C   . ARG C 1 205 ? 5.723   -17.966 83.211  1.00 23.53  ? 205 ARG C C   1 
ATOM   5367 O O   . ARG C 1 205 ? 6.601   -17.336 82.646  1.00 26.53  ? 205 ARG C O   1 
ATOM   5368 C CB  . ARG C 1 205 ? 3.409   -18.031 82.225  1.00 30.35  ? 205 ARG C CB  1 
ATOM   5369 C CG  . ARG C 1 205 ? 1.952   -17.617 82.318  1.00 36.16  ? 205 ARG C CG  1 
ATOM   5370 C CD  . ARG C 1 205 ? 1.100   -18.283 81.252  1.00 41.48  ? 205 ARG C CD  1 
ATOM   5371 N NE  . ARG C 1 205 ? -0.236  -17.685 81.167  1.00 47.35  ? 205 ARG C NE  1 
ATOM   5372 C CZ  . ARG C 1 205 ? -1.156  -18.023 80.259  1.00 48.99  ? 205 ARG C CZ  1 
ATOM   5373 N NH1 . ARG C 1 205 ? -0.899  -18.978 79.355  1.00 49.29  ? 205 ARG C NH1 1 
ATOM   5374 N NH2 . ARG C 1 205 ? -2.341  -17.409 80.252  1.00 46.45  ? 205 ARG C NH2 1 
ATOM   5375 N N   . PRO C 1 206 ? 5.963   -19.188 83.791  1.00 19.36  ? 206 PRO C N   1 
ATOM   5376 C CA  . PRO C 1 206 ? 5.059   -20.089 84.499  1.00 20.72  ? 206 PRO C CA  1 
ATOM   5377 C C   . PRO C 1 206 ? 4.418   -19.465 85.707  1.00 21.30  ? 206 PRO C C   1 
ATOM   5378 O O   . PRO C 1 206 ? 4.939   -18.481 86.242  1.00 21.69  ? 206 PRO C O   1 
ATOM   5379 C CB  . PRO C 1 206 ? 5.973   -21.265 84.891  1.00 17.57  ? 206 PRO C CB  1 
ATOM   5380 C CG  . PRO C 1 206 ? 7.055   -21.228 83.933  1.00 15.28  ? 206 PRO C CG  1 
ATOM   5381 C CD  . PRO C 1 206 ? 7.319   -19.756 83.734  1.00 17.32  ? 206 PRO C CD  1 
ATOM   5382 N N   . VAL C 1 207 ? 3.281   -20.016 86.139  1.00 24.23  ? 207 VAL C N   1 
ATOM   5383 C CA  . VAL C 1 207 ? 2.566   -19.449 87.271  1.00 25.23  ? 207 VAL C CA  1 
ATOM   5384 C C   . VAL C 1 207 ? 3.139   -19.982 88.583  1.00 25.00  ? 207 VAL C C   1 
ATOM   5385 O O   . VAL C 1 207 ? 3.345   -19.236 89.542  1.00 25.72  ? 207 VAL C O   1 
ATOM   5386 C CB  . VAL C 1 207 ? 1.058   -19.751 87.205  1.00 26.03  ? 207 VAL C CB  1 
ATOM   5387 C CG1 . VAL C 1 207 ? 0.325   -19.049 88.354  1.00 26.29  ? 207 VAL C CG1 1 
ATOM   5388 C CG2 . VAL C 1 207 ? 0.502   -19.276 85.870  1.00 25.62  ? 207 VAL C CG2 1 
ATOM   5389 N N   . PHE C 1 208 ? 3.419   -21.297 88.610  1.00 23.98  ? 208 PHE C N   1 
ATOM   5390 C CA  . PHE C 1 208 ? 3.984   -21.934 89.789  1.00 22.66  ? 208 PHE C CA  1 
ATOM   5391 C C   . PHE C 1 208 ? 5.309   -22.640 89.460  1.00 23.02  ? 208 PHE C C   1 
ATOM   5392 O O   . PHE C 1 208 ? 5.775   -22.608 88.320  1.00 20.66  ? 208 PHE C O   1 
ATOM   5393 C CB  . PHE C 1 208 ? 2.985   -22.933 90.344  1.00 19.71  ? 208 PHE C CB  1 
ATOM   5394 C CG  . PHE C 1 208 ? 1.712   -22.311 90.807  1.00 19.58  ? 208 PHE C CG  1 
ATOM   5395 C CD1 . PHE C 1 208 ? 1.728   -21.317 91.797  1.00 19.01  ? 208 PHE C CD1 1 
ATOM   5396 C CD2 . PHE C 1 208 ? 0.490   -22.722 90.263  1.00 19.96  ? 208 PHE C CD2 1 
ATOM   5397 C CE1 . PHE C 1 208 ? 0.524   -20.731 92.241  1.00 19.25  ? 208 PHE C CE1 1 
ATOM   5398 C CE2 . PHE C 1 208 ? -0.714  -22.146 90.702  1.00 16.82  ? 208 PHE C CE2 1 
ATOM   5399 C CZ  . PHE C 1 208 ? -0.692  -21.148 91.694  1.00 20.37  ? 208 PHE C CZ  1 
ATOM   5400 N N   . THR C 1 209 ? 5.917   -23.274 90.453  1.00 24.72  ? 209 THR C N   1 
ATOM   5401 C CA  . THR C 1 209 ? 7.179   -23.973 90.260  1.00 25.97  ? 209 THR C CA  1 
ATOM   5402 C C   . THR C 1 209 ? 6.971   -25.280 89.515  1.00 29.93  ? 209 THR C C   1 
ATOM   5403 O O   . THR C 1 209 ? 5.876   -25.828 89.524  1.00 34.25  ? 209 THR C O   1 
ATOM   5404 C CB  . THR C 1 209 ? 7.843   -24.279 91.618  1.00 25.05  ? 209 THR C CB  1 
ATOM   5405 O OG1 . THR C 1 209 ? 6.988   -25.105 92.431  1.00 24.31  ? 209 THR C OG1 1 
ATOM   5406 C CG2 . THR C 1 209 ? 8.127   -22.983 92.370  1.00 26.34  ? 209 THR C CG2 1 
ATOM   5407 N N   . LYS C 1 210 ? 8.023   -25.776 88.862  1.00 31.14  ? 210 LYS C N   1 
ATOM   5408 C CA  . LYS C 1 210 ? 7.976   -27.005 88.060  1.00 33.24  ? 210 LYS C CA  1 
ATOM   5409 C C   . LYS C 1 210 ? 7.270   -28.187 88.694  1.00 33.13  ? 210 LYS C C   1 
ATOM   5410 O O   . LYS C 1 210 ? 6.781   -29.059 87.995  1.00 35.43  ? 210 LYS C O   1 
ATOM   5411 C CB  . LYS C 1 210 ? 9.386   -27.440 87.640  1.00 35.28  ? 210 LYS C CB  1 
ATOM   5412 C CG  . LYS C 1 210 ? 10.093  -26.473 86.704  1.00 37.32  ? 210 LYS C CG  1 
ATOM   5413 C CD  . LYS C 1 210 ? 11.374  -27.048 86.168  1.00 40.47  ? 210 LYS C CD  1 
ATOM   5414 C CE  . LYS C 1 210 ? 12.058  -26.079 85.215  1.00 41.09  ? 210 LYS C CE  1 
ATOM   5415 N NZ  . LYS C 1 210 ? 13.286  -26.674 84.611  1.00 42.18  ? 210 LYS C NZ  1 
ATOM   5416 N N   . MET C 1 211 ? 7.187   -28.205 90.014  1.00 31.99  ? 211 MET C N   1 
ATOM   5417 C CA  . MET C 1 211 ? 6.559   -29.322 90.725  1.00 31.45  ? 211 MET C CA  1 
ATOM   5418 C C   . MET C 1 211 ? 5.028   -29.194 90.946  1.00 29.58  ? 211 MET C C   1 
ATOM   5419 O O   . MET C 1 211 ? 4.430   -30.014 91.648  1.00 29.11  ? 211 MET C O   1 
ATOM   5420 C CB  . MET C 1 211 ? 7.262   -29.558 92.076  1.00 34.10  ? 211 MET C CB  1 
ATOM   5421 C CG  . MET C 1 211 ? 7.452   -28.314 92.929  1.00 35.31  ? 211 MET C CG  1 
ATOM   5422 S SD  . MET C 1 211 ? 8.762   -28.525 94.095  1.00 37.76  ? 211 MET C SD  1 
ATOM   5423 C CE  . MET C 1 211 ? 7.973   -29.732 95.262  1.00 36.50  ? 211 MET C CE  1 
ATOM   5424 N N   . ALA C 1 212 ? 4.404   -28.185 90.341  1.00 29.24  ? 212 ALA C N   1 
ATOM   5425 C CA  . ALA C 1 212 ? 2.969   -27.987 90.449  1.00 29.86  ? 212 ALA C CA  1 
ATOM   5426 C C   . ALA C 1 212 ? 2.297   -28.875 89.443  1.00 31.34  ? 212 ALA C C   1 
ATOM   5427 O O   . ALA C 1 212 ? 2.909   -29.253 88.442  1.00 32.30  ? 212 ALA C O   1 
ATOM   5428 C CB  . ALA C 1 212 ? 2.611   -26.545 90.188  1.00 27.73  ? 212 ALA C CB  1 
ATOM   5429 N N   . VAL C 1 213 ? 1.026   -29.194 89.692  1.00 31.43  ? 213 VAL C N   1 
ATOM   5430 C CA  . VAL C 1 213 ? 0.221   -30.003 88.760  1.00 29.99  ? 213 VAL C CA  1 
ATOM   5431 C C   . VAL C 1 213 ? -0.343  -29.134 87.642  1.00 26.81  ? 213 VAL C C   1 
ATOM   5432 O O   . VAL C 1 213 ? -0.455  -29.579 86.516  1.00 25.27  ? 213 VAL C O   1 
ATOM   5433 C CB  . VAL C 1 213 ? -0.952  -30.730 89.472  1.00 31.30  ? 213 VAL C CB  1 
ATOM   5434 C CG1 . VAL C 1 213 ? -1.674  -31.645 88.519  1.00 30.12  ? 213 VAL C CG1 1 
ATOM   5435 C CG2 . VAL C 1 213 ? -0.387  -31.539 90.657  1.00 30.00  ? 213 VAL C CG2 1 
ATOM   5436 N N   . TRP C 1 214 ? -0.650  -27.879 87.962  1.00 25.53  ? 214 TRP C N   1 
ATOM   5437 C CA  . TRP C 1 214 ? -1.118  -26.910 86.978  1.00 23.88  ? 214 TRP C CA  1 
ATOM   5438 C C   . TRP C 1 214 ? -0.269  -25.653 87.009  1.00 22.26  ? 214 TRP C C   1 
ATOM   5439 O O   . TRP C 1 214 ? 0.193   -25.234 88.045  1.00 20.96  ? 214 TRP C O   1 
ATOM   5440 C CB  . TRP C 1 214 ? -2.582  -26.555 87.246  1.00 22.11  ? 214 TRP C CB  1 
ATOM   5441 C CG  . TRP C 1 214 ? -3.174  -25.592 86.234  1.00 20.50  ? 214 TRP C CG  1 
ATOM   5442 C CD1 . TRP C 1 214 ? -3.792  -25.912 85.060  1.00 19.55  ? 214 TRP C CD1 1 
ATOM   5443 C CD2 . TRP C 1 214 ? -3.111  -24.152 86.277  1.00 17.15  ? 214 TRP C CD2 1 
ATOM   5444 N NE1 . TRP C 1 214 ? -4.125  -24.768 84.380  1.00 17.32  ? 214 TRP C NE1 1 
ATOM   5445 C CE2 . TRP C 1 214 ? -3.717  -23.681 85.099  1.00 16.42  ? 214 TRP C CE2 1 
ATOM   5446 C CE3 . TRP C 1 214 ? -2.626  -23.232 87.208  1.00 16.92  ? 214 TRP C CE3 1 
ATOM   5447 C CZ2 . TRP C 1 214 ? -3.833  -22.307 84.818  1.00 16.37  ? 214 TRP C CZ2 1 
ATOM   5448 C CZ3 . TRP C 1 214 ? -2.755  -21.866 86.932  1.00 13.41  ? 214 TRP C CZ3 1 
ATOM   5449 C CH2 . TRP C 1 214 ? -3.347  -21.421 85.741  1.00 11.98  ? 214 TRP C CH2 1 
ATOM   5450 N N   . GLY C 1 215 ? -0.108  -25.028 85.849  1.00 23.15  ? 215 GLY C N   1 
ATOM   5451 C CA  . GLY C 1 215 ? 0.621   -23.776 85.757  1.00 26.75  ? 215 GLY C CA  1 
ATOM   5452 C C   . GLY C 1 215 ? 2.100   -23.916 86.074  1.00 28.23  ? 215 GLY C C   1 
ATOM   5453 O O   . GLY C 1 215 ? 2.782   -22.904 86.341  1.00 28.02  ? 215 GLY C O   1 
ATOM   5454 N N   . ASN C 1 216 ? 2.590   -25.165 86.028  1.00 29.52  ? 216 ASN C N   1 
ATOM   5455 C CA  . ASN C 1 216 ? 3.963   -25.502 86.365  1.00 32.84  ? 216 ASN C CA  1 
ATOM   5456 C C   . ASN C 1 216 ? 4.888   -25.059 85.246  1.00 36.39  ? 216 ASN C C   1 
ATOM   5457 O O   . ASN C 1 216 ? 4.568   -24.126 84.510  1.00 36.34  ? 216 ASN C O   1 
ATOM   5458 C CB  . ASN C 1 216 ? 4.081   -27.016 86.594  1.00 32.55  ? 216 ASN C CB  1 
ATOM   5459 C CG  . ASN C 1 216 ? 3.465   -27.842 85.440  1.00 33.00  ? 216 ASN C CG  1 
ATOM   5460 O OD1 . ASN C 1 216 ? 3.182   -27.325 84.364  1.00 29.16  ? 216 ASN C OD1 1 
ATOM   5461 N ND2 . ASN C 1 216 ? 3.258   -29.123 85.693  1.00 32.52  ? 216 ASN C ND2 1 
ATOM   5462 N N   . LYS C 1 217 ? 6.048   -25.727 85.172  1.00 38.89  ? 217 LYS C N   1 
ATOM   5463 C CA  . LYS C 1 217 ? 7.123   -25.479 84.202  1.00 40.85  ? 217 LYS C CA  1 
ATOM   5464 C C   . LYS C 1 217 ? 8.101   -24.437 84.764  1.00 44.30  ? 217 LYS C C   1 
ATOM   5465 O O   . LYS C 1 217 ? 9.096   -24.118 84.041  1.00 48.84  ? 217 LYS C O   1 
ATOM   5466 C CB  . LYS C 1 217 ? 6.604   -25.025 82.823  1.00 38.47  ? 217 LYS C CB  1 
ATOM   5467 C CG  . LYS C 1 217 ? 5.635   -26.000 82.134  1.00 35.01  ? 217 LYS C CG  1 
ATOM   5468 C CD  . LYS C 1 217 ? 5.008   -25.369 80.908  1.00 29.45  ? 217 LYS C CD  1 
ATOM   5469 C CE  . LYS C 1 217 ? 4.034   -24.247 81.285  1.00 27.44  ? 217 LYS C CE  1 
ATOM   5470 N NZ  . LYS C 1 217 ? 4.694   -22.958 81.643  1.00 19.02  ? 217 LYS C NZ  1 
ATOM   5471 O OXT . LYS C 1 217 ? 7.865   -23.970 85.920  1.00 45.26  ? 217 LYS C OXT 1 
ATOM   5472 N N   . SER D 2 1   ? -14.352 7.721   132.302 1.00 41.45  ? 1   SER D N   1 
ATOM   5473 C CA  . SER D 2 1   ? -14.742 6.446   131.620 1.00 43.29  ? 1   SER D CA  1 
ATOM   5474 C C   . SER D 2 1   ? -15.279 6.754   130.242 1.00 44.57  ? 1   SER D C   1 
ATOM   5475 O O   . SER D 2 1   ? -15.264 7.927   129.822 1.00 44.41  ? 1   SER D O   1 
ATOM   5476 C CB  . SER D 2 1   ? -15.789 5.725   132.465 1.00 42.48  ? 1   SER D CB  1 
ATOM   5477 O OG  . SER D 2 1   ? -15.363 5.734   133.820 1.00 39.48  ? 1   SER D OG  1 
ATOM   5478 N N   . CYS D 2 2   ? -15.760 5.706   129.549 1.00 45.94  ? 2   CYS D N   1 
ATOM   5479 C CA  . CYS D 2 2   ? -16.352 5.827   128.220 1.00 48.69  ? 2   CYS D CA  1 
ATOM   5480 C C   . CYS D 2 2   ? -16.818 4.450   127.792 1.00 47.77  ? 2   CYS D C   1 
ATOM   5481 O O   . CYS D 2 2   ? -17.989 4.270   127.493 1.00 48.50  ? 2   CYS D O   1 
ATOM   5482 C CB  . CYS D 2 2   ? -15.341 6.387   127.197 1.00 50.42  ? 2   CYS D CB  1 
ATOM   5483 S SG  . CYS D 2 2   ? -13.827 5.391   127.034 1.00 55.47  ? 2   CYS D SG  1 
ATOM   5484 N N   . GLU D 2 3   ? -15.883 3.497   127.781 1.00 46.89  ? 3   GLU D N   1 
ATOM   5485 C CA  . GLU D 2 3   ? -16.136 2.087   127.446 1.00 46.49  ? 3   GLU D CA  1 
ATOM   5486 C C   . GLU D 2 3   ? -16.453 1.893   125.968 1.00 46.08  ? 3   GLU D C   1 
ATOM   5487 O O   . GLU D 2 3   ? -17.501 2.343   125.450 1.00 45.55  ? 3   GLU D O   1 
ATOM   5488 C CB  . GLU D 2 3   ? -17.244 1.470   128.324 1.00 45.69  ? 3   GLU D CB  1 
ATOM   5489 C CG  . GLU D 2 3   ? -16.773 1.058   129.735 1.00 44.40  ? 3   GLU D CG  1 
ATOM   5490 C CD  . GLU D 2 3   ? -16.059 2.209   130.508 1.00 43.23  ? 3   GLU D CD  1 
ATOM   5491 O OE1 . GLU D 2 3   ? -16.769 2.998   131.187 1.00 40.95  ? 3   GLU D OE1 1 
ATOM   5492 O OE2 . GLU D 2 3   ? -14.804 2.335   130.412 1.00 38.03  ? 3   GLU D OE2 1 
ATOM   5493 N N   . SER D 2 4   ? -15.530 1.239   125.289 1.00 46.43  ? 4   SER D N   1 
ATOM   5494 C CA  . SER D 2 4   ? -15.660 0.957   123.863 1.00 45.33  ? 4   SER D CA  1 
ATOM   5495 C C   . SER D 2 4   ? -16.670 -0.161  123.615 1.00 43.97  ? 4   SER D C   1 
ATOM   5496 O O   . SER D 2 4   ? -17.406 -0.138  122.620 1.00 44.15  ? 4   SER D O   1 
ATOM   5497 C CB  . SER D 2 4   ? -14.297 0.585   123.257 1.00 45.58  ? 4   SER D CB  1 
ATOM   5498 O OG  . SER D 2 4   ? -13.289 1.437   123.794 1.00 41.26  ? 4   SER D OG  1 
ATOM   5499 N N   . SER D 2 5   ? -16.673 -1.139  124.525 1.00 42.24  ? 5   SER D N   1 
ATOM   5500 C CA  . SER D 2 5   ? -17.542 -2.316  124.445 1.00 42.15  ? 5   SER D CA  1 
ATOM   5501 C C   . SER D 2 5   ? -17.559 -2.996  123.054 1.00 40.69  ? 5   SER D C   1 
ATOM   5502 O O   . SER D 2 5   ? -18.529 -3.717  122.719 1.00 42.82  ? 5   SER D O   1 
ATOM   5503 C CB  . SER D 2 5   ? -18.958 -1.913  124.873 1.00 40.81  ? 5   SER D CB  1 
ATOM   5504 O OG  . SER D 2 5   ? -18.958 -1.536  126.245 1.00 40.29  ? 5   SER D OG  1 
ATOM   5505 N N   . MET D 2 6   ? -16.500 -2.781  122.279 1.00 36.66  ? 6   MET D N   1 
ATOM   5506 C CA  . MET D 2 6   ? -16.384 -3.376  120.964 1.00 33.08  ? 6   MET D CA  1 
ATOM   5507 C C   . MET D 2 6   ? -16.491 -4.887  121.107 1.00 32.08  ? 6   MET D C   1 
ATOM   5508 O O   . MET D 2 6   ? -15.862 -5.478  121.985 1.00 33.08  ? 6   MET D O   1 
ATOM   5509 C CB  . MET D 2 6   ? -15.056 -2.970  120.337 1.00 31.25  ? 6   MET D CB  1 
ATOM   5510 C CG  . MET D 2 6   ? -13.827 -3.260  121.154 1.00 25.16  ? 6   MET D CG  1 
ATOM   5511 S SD  . MET D 2 6   ? -12.328 -2.939  120.241 1.00 24.80  ? 6   MET D SD  1 
ATOM   5512 C CE  . MET D 2 6   ? -12.134 -1.193  120.461 1.00 18.10  ? 6   MET D CE  1 
ATOM   5513 N N   . VAL D 2 7   ? -17.298 -5.524  120.270 1.00 30.25  ? 7   VAL D N   1 
ATOM   5514 C CA  . VAL D 2 7   ? -17.489 -6.955  120.392 1.00 26.58  ? 7   VAL D CA  1 
ATOM   5515 C C   . VAL D 2 7   ? -16.485 -7.716  119.531 1.00 22.80  ? 7   VAL D C   1 
ATOM   5516 O O   . VAL D 2 7   ? -16.258 -7.390  118.355 1.00 21.92  ? 7   VAL D O   1 
ATOM   5517 C CB  . VAL D 2 7   ? -18.960 -7.389  120.077 1.00 25.38  ? 7   VAL D CB  1 
ATOM   5518 C CG1 . VAL D 2 7   ? -19.893 -6.765  121.089 1.00 20.58  ? 7   VAL D CG1 1 
ATOM   5519 C CG2 . VAL D 2 7   ? -19.353 -6.991  118.684 1.00 27.70  ? 7   VAL D CG2 1 
ATOM   5520 N N   . LEU D 2 8   ? -15.913 -8.756  120.129 1.00 18.93  ? 8   LEU D N   1 
ATOM   5521 C CA  . LEU D 2 8   ? -14.978 -9.625  119.446 1.00 16.36  ? 8   LEU D CA  1 
ATOM   5522 C C   . LEU D 2 8   ? -15.697 -10.943 119.282 1.00 14.40  ? 8   LEU D C   1 
ATOM   5523 O O   . LEU D 2 8   ? -16.121 -11.532 120.260 1.00 10.89  ? 8   LEU D O   1 
ATOM   5524 C CB  . LEU D 2 8   ? -13.679 -9.783  120.276 1.00 17.64  ? 8   LEU D CB  1 
ATOM   5525 C CG  . LEU D 2 8   ? -12.649 -10.811 119.767 1.00 18.29  ? 8   LEU D CG  1 
ATOM   5526 C CD1 . LEU D 2 8   ? -12.166 -10.417 118.390 1.00 18.03  ? 8   LEU D CD1 1 
ATOM   5527 C CD2 . LEU D 2 8   ? -11.462 -10.874 120.727 1.00 24.80  ? 8   LEU D CD2 1 
ATOM   5528 N N   . GLY D 2 9   ? -15.793 -11.427 118.050 1.00 13.04  ? 9   GLY D N   1 
ATOM   5529 C CA  . GLY D 2 9   ? -16.444 -12.698 117.828 1.00 11.87  ? 9   GLY D CA  1 
ATOM   5530 C C   . GLY D 2 9   ? -15.468 -13.744 117.341 1.00 11.67  ? 9   GLY D C   1 
ATOM   5531 O O   . GLY D 2 9   ? -14.681 -13.490 116.428 1.00 11.34  ? 9   GLY D O   1 
ATOM   5532 N N   . TYR D 2 10  ? -15.552 -14.930 117.950 1.00 10.69  ? 10  TYR D N   1 
ATOM   5533 C CA  . TYR D 2 10  ? -14.727 -16.058 117.554 1.00 11.83  ? 10  TYR D CA  1 
ATOM   5534 C C   . TYR D 2 10  ? -15.272 -17.317 118.224 1.00 13.75  ? 10  TYR D C   1 
ATOM   5535 O O   . TYR D 2 10  ? -16.171 -17.238 119.061 1.00 10.83  ? 10  TYR D O   1 
ATOM   5536 C CB  . TYR D 2 10  ? -13.273 -15.798 117.945 1.00 16.88  ? 10  TYR D CB  1 
ATOM   5537 C CG  . TYR D 2 10  ? -12.293 -16.768 117.335 1.00 22.83  ? 10  TYR D CG  1 
ATOM   5538 C CD1 . TYR D 2 10  ? -12.185 -16.883 115.936 1.00 27.24  ? 10  TYR D CD1 1 
ATOM   5539 C CD2 . TYR D 2 10  ? -11.475 -17.565 118.150 1.00 22.93  ? 10  TYR D CD2 1 
ATOM   5540 C CE1 . TYR D 2 10  ? -11.286 -17.776 115.349 1.00 28.09  ? 10  TYR D CE1 1 
ATOM   5541 C CE2 . TYR D 2 10  ? -10.560 -18.465 117.582 1.00 22.85  ? 10  TYR D CE2 1 
ATOM   5542 C CZ  . TYR D 2 10  ? -10.479 -18.573 116.172 1.00 25.51  ? 10  TYR D CZ  1 
ATOM   5543 O OH  . TYR D 2 10  ? -9.567  -19.438 115.592 1.00 22.90  ? 10  TYR D OH  1 
ATOM   5544 N N   . TRP D 2 11  ? -14.697 -18.465 117.883 1.00 16.55  ? 11  TRP D N   1 
ATOM   5545 C CA  . TRP D 2 11  ? -15.054 -19.724 118.528 1.00 22.45  ? 11  TRP D CA  1 
ATOM   5546 C C   . TRP D 2 11  ? -14.709 -19.664 120.006 1.00 26.55  ? 11  TRP D C   1 
ATOM   5547 O O   . TRP D 2 11  ? -13.949 -18.767 120.445 1.00 22.16  ? 11  TRP D O   1 
ATOM   5548 C CB  . TRP D 2 11  ? -14.296 -20.888 117.890 1.00 23.70  ? 11  TRP D CB  1 
ATOM   5549 C CG  . TRP D 2 11  ? -14.550 -21.042 116.418 1.00 26.97  ? 11  TRP D CG  1 
ATOM   5550 C CD1 . TRP D 2 11  ? -13.664 -20.783 115.412 1.00 27.68  ? 11  TRP D CD1 1 
ATOM   5551 C CD2 . TRP D 2 11  ? -15.765 -21.537 115.791 1.00 29.71  ? 11  TRP D CD2 1 
ATOM   5552 N NE1 . TRP D 2 11  ? -14.258 -21.037 114.193 1.00 32.44  ? 11  TRP D NE1 1 
ATOM   5553 C CE2 . TRP D 2 11  ? -15.518 -21.507 114.387 1.00 30.45  ? 11  TRP D CE2 1 
ATOM   5554 C CE3 . TRP D 2 11  ? -17.019 -21.951 116.276 1.00 27.20  ? 11  TRP D CE3 1 
ATOM   5555 C CZ2 . TRP D 2 11  ? -16.526 -21.896 113.456 1.00 31.67  ? 11  TRP D CZ2 1 
ATOM   5556 C CZ3 . TRP D 2 11  ? -18.017 -22.320 115.358 1.00 31.63  ? 11  TRP D CZ3 1 
ATOM   5557 C CH2 . TRP D 2 11  ? -17.755 -22.296 113.955 1.00 32.65  ? 11  TRP D CH2 1 
ATOM   5558 N N   . ASP D 2 12  ? -15.247 -20.628 120.760 1.00 30.37  ? 12  ASP D N   1 
ATOM   5559 C CA  . ASP D 2 12  ? -14.915 -20.774 122.171 1.00 33.47  ? 12  ASP D CA  1 
ATOM   5560 C C   . ASP D 2 12  ? -13.567 -21.525 122.299 1.00 33.87  ? 12  ASP D C   1 
ATOM   5561 O O   . ASP D 2 12  ? -13.434 -22.511 123.023 1.00 35.97  ? 12  ASP D O   1 
ATOM   5562 C CB  . ASP D 2 12  ? -16.032 -21.525 122.891 1.00 38.44  ? 12  ASP D CB  1 
ATOM   5563 C CG  . ASP D 2 12  ? -15.796 -21.651 124.402 1.00 44.88  ? 12  ASP D CG  1 
ATOM   5564 O OD1 . ASP D 2 12  ? -15.133 -20.757 125.020 1.00 47.84  ? 12  ASP D OD1 1 
ATOM   5565 O OD2 . ASP D 2 12  ? -16.264 -22.673 124.963 1.00 47.22  ? 12  ASP D OD2 1 
ATOM   5566 N N   . ILE D 2 13  ? -12.571 -21.007 121.591 1.00 33.86  ? 13  ILE D N   1 
ATOM   5567 C CA  . ILE D 2 13  ? -11.270 -21.632 121.433 1.00 32.93  ? 13  ILE D CA  1 
ATOM   5568 C C   . ILE D 2 13  ? -10.263 -20.502 121.607 1.00 28.69  ? 13  ILE D C   1 
ATOM   5569 O O   . ILE D 2 13  ? -10.574 -19.337 121.367 1.00 28.02  ? 13  ILE D O   1 
ATOM   5570 C CB  . ILE D 2 13  ? -11.120 -22.287 120.021 1.00 35.90  ? 13  ILE D CB  1 
ATOM   5571 C CG1 . ILE D 2 13  ? -12.058 -23.493 119.911 1.00 39.17  ? 13  ILE D CG1 1 
ATOM   5572 C CG2 . ILE D 2 13  ? -9.700  -22.754 119.797 1.00 38.74  ? 13  ILE D CG2 1 
ATOM   5573 C CD1 . ILE D 2 13  ? -11.861 -24.576 120.962 1.00 39.56  ? 13  ILE D CD1 1 
ATOM   5574 N N   . ARG D 2 14  ? -9.047  -20.864 121.985 1.00 25.69  ? 14  ARG D N   1 
ATOM   5575 C CA  . ARG D 2 14  ? -7.950  -19.916 122.077 1.00 18.78  ? 14  ARG D CA  1 
ATOM   5576 C C   . ARG D 2 14  ? -7.569  -19.464 120.673 1.00 15.50  ? 14  ARG D C   1 
ATOM   5577 O O   . ARG D 2 14  ? -7.607  -18.266 120.357 1.00 14.41  ? 14  ARG D O   1 
ATOM   5578 C CB  . ARG D 2 14  ? -6.769  -20.589 122.779 1.00 20.74  ? 14  ARG D CB  1 
ATOM   5579 C CG  . ARG D 2 14  ? -5.551  -19.727 122.937 1.00 20.06  ? 14  ARG D CG  1 
ATOM   5580 C CD  . ARG D 2 14  ? -4.436  -20.467 123.627 1.00 19.55  ? 14  ARG D CD  1 
ATOM   5581 N NE  . ARG D 2 14  ? -3.134  -19.878 123.340 1.00 18.59  ? 14  ARG D NE  1 
ATOM   5582 C CZ  . ARG D 2 14  ? -1.974  -20.431 123.684 1.00 17.82  ? 14  ARG D CZ  1 
ATOM   5583 N NH1 . ARG D 2 14  ? -1.958  -21.597 124.314 1.00 18.01  ? 14  ARG D NH1 1 
ATOM   5584 N NH2 . ARG D 2 14  ? -0.845  -19.804 123.393 1.00 23.72  ? 14  ARG D NH2 1 
ATOM   5585 N N   . GLY D 2 15  ? -7.179  -20.447 119.848 1.00 11.07  ? 15  GLY D N   1 
ATOM   5586 C CA  . GLY D 2 15  ? -6.835  -20.203 118.453 1.00 11.51  ? 15  GLY D CA  1 
ATOM   5587 C C   . GLY D 2 15  ? -6.246  -18.851 118.053 1.00 12.05  ? 15  GLY D C   1 
ATOM   5588 O O   . GLY D 2 15  ? -5.311  -18.332 118.688 1.00 11.86  ? 15  GLY D O   1 
ATOM   5589 N N   . LEU D 2 16  ? -6.827  -18.275 116.997 1.00 10.36  ? 16  LEU D N   1 
ATOM   5590 C CA  . LEU D 2 16  ? -6.369  -17.025 116.445 1.00 10.45  ? 16  LEU D CA  1 
ATOM   5591 C C   . LEU D 2 16  ? -6.803  -15.830 117.246 1.00 10.85  ? 16  LEU D C   1 
ATOM   5592 O O   . LEU D 2 16  ? -6.322  -14.749 116.979 1.00 13.52  ? 16  LEU D O   1 
ATOM   5593 C CB  . LEU D 2 16  ? -6.902  -16.863 115.031 1.00 12.66  ? 16  LEU D CB  1 
ATOM   5594 C CG  . LEU D 2 16  ? -6.350  -17.717 113.891 1.00 13.62  ? 16  LEU D CG  1 
ATOM   5595 C CD1 . LEU D 2 16  ? -7.145  -17.447 112.614 1.00 11.91  ? 16  LEU D CD1 1 
ATOM   5596 C CD2 . LEU D 2 16  ? -4.860  -17.375 113.703 1.00 12.69  ? 16  LEU D CD2 1 
ATOM   5597 N N   . ALA D 2 17  ? -7.680  -16.001 118.221 1.00 12.66  ? 17  ALA D N   1 
ATOM   5598 C CA  . ALA D 2 17  ? -8.170  -14.861 118.976 1.00 13.51  ? 17  ALA D CA  1 
ATOM   5599 C C   . ALA D 2 17  ? -7.227  -14.536 120.137 1.00 13.82  ? 17  ALA D C   1 
ATOM   5600 O O   . ALA D 2 17  ? -7.230  -13.387 120.611 1.00 15.33  ? 17  ALA D O   1 
ATOM   5601 C CB  . ALA D 2 17  ? -9.551  -15.132 119.511 1.00 15.89  ? 17  ALA D CB  1 
ATOM   5602 N N   . HIS D 2 18  ? -6.446  -15.526 120.587 1.00 13.94  ? 18  HIS D N   1 
ATOM   5603 C CA  . HIS D 2 18  ? -5.560  -15.366 121.754 1.00 15.01  ? 18  HIS D CA  1 
ATOM   5604 C C   . HIS D 2 18  ? -4.739  -14.084 121.782 1.00 13.91  ? 18  HIS D C   1 
ATOM   5605 O O   . HIS D 2 18  ? -4.819  -13.336 122.743 1.00 15.71  ? 18  HIS D O   1 
ATOM   5606 C CB  . HIS D 2 18  ? -4.630  -16.565 121.868 1.00 19.97  ? 18  HIS D CB  1 
ATOM   5607 C CG  . HIS D 2 18  ? -3.865  -16.617 123.159 1.00 24.71  ? 18  HIS D CG  1 
ATOM   5608 N ND1 . HIS D 2 18  ? -4.479  -16.623 124.372 1.00 28.06  ? 18  HIS D ND1 1 
ATOM   5609 C CD2 . HIS D 2 18  ? -2.524  -16.672 123.385 1.00 23.63  ? 18  HIS D CD2 1 
ATOM   5610 C CE1 . HIS D 2 18  ? -3.552  -16.686 125.334 1.00 28.08  ? 18  HIS D CE1 1 
ATOM   5611 N NE2 . HIS D 2 18  ? -2.375  -16.712 124.759 1.00 29.02  ? 18  HIS D NE2 1 
ATOM   5612 N N   . ALA D 2 19  ? -3.984  -13.810 120.708 1.00 10.39  ? 19  ALA D N   1 
ATOM   5613 C CA  . ALA D 2 19  ? -3.172  -12.602 120.623 1.00 8.74   ? 19  ALA D CA  1 
ATOM   5614 C C   . ALA D 2 19  ? -4.063  -11.364 120.728 1.00 11.06  ? 19  ALA D C   1 
ATOM   5615 O O   . ALA D 2 19  ? -3.654  -10.362 121.294 1.00 10.23  ? 19  ALA D O   1 
ATOM   5616 C CB  . ALA D 2 19  ? -2.391  -12.584 119.310 1.00 4.52   ? 19  ALA D CB  1 
ATOM   5617 N N   . ILE D 2 20  ? -5.273  -11.447 120.195 1.00 13.81  ? 20  ILE D N   1 
ATOM   5618 C CA  . ILE D 2 20  ? -6.195  -10.316 120.174 1.00 13.92  ? 20  ILE D CA  1 
ATOM   5619 C C   . ILE D 2 20  ? -6.723  -10.034 121.580 1.00 13.30  ? 20  ILE D C   1 
ATOM   5620 O O   . ILE D 2 20  ? -6.737  -8.894  122.038 1.00 11.59  ? 20  ILE D O   1 
ATOM   5621 C CB  . ILE D 2 20  ? -7.373  -10.561 119.205 1.00 17.97  ? 20  ILE D CB  1 
ATOM   5622 C CG1 . ILE D 2 20  ? -6.840  -10.979 117.830 1.00 20.11  ? 20  ILE D CG1 1 
ATOM   5623 C CG2 . ILE D 2 20  ? -8.225  -9.278  119.068 1.00 18.24  ? 20  ILE D CG2 1 
ATOM   5624 C CD1 . ILE D 2 20  ? -7.916  -11.321 116.821 1.00 25.11  ? 20  ILE D CD1 1 
ATOM   5625 N N   . ARG D 2 21  ? -7.144  -11.094 122.280 1.00 12.72  ? 21  ARG D N   1 
ATOM   5626 C CA  . ARG D 2 21  ? -7.667  -10.952 123.638 1.00 13.76  ? 21  ARG D CA  1 
ATOM   5627 C C   . ARG D 2 21  ? -6.582  -10.303 124.507 1.00 14.40  ? 21  ARG D C   1 
ATOM   5628 O O   . ARG D 2 21  ? -6.871  -9.338  125.222 1.00 14.97  ? 21  ARG D O   1 
ATOM   5629 C CB  . ARG D 2 21  ? -8.071  -12.314 124.225 1.00 15.58  ? 21  ARG D CB  1 
ATOM   5630 C CG  . ARG D 2 21  ? -9.257  -12.954 123.553 1.00 18.42  ? 21  ARG D CG  1 
ATOM   5631 C CD  . ARG D 2 21  ? -9.417  -14.388 123.961 1.00 18.42  ? 21  ARG D CD  1 
ATOM   5632 N NE  . ARG D 2 21  ? -10.554 -15.031 123.287 1.00 24.84  ? 21  ARG D NE  1 
ATOM   5633 C CZ  . ARG D 2 21  ? -10.566 -16.275 122.794 1.00 25.14  ? 21  ARG D CZ  1 
ATOM   5634 N NH1 . ARG D 2 21  ? -9.484  -17.039 122.816 1.00 28.58  ? 21  ARG D NH1 1 
ATOM   5635 N NH2 . ARG D 2 21  ? -11.684 -16.763 122.278 1.00 27.82  ? 21  ARG D NH2 1 
ATOM   5636 N N   . LEU D 2 22  ? -5.355  -10.819 124.413 1.00 12.90  ? 22  LEU D N   1 
ATOM   5637 C CA  . LEU D 2 22  ? -4.219  -10.317 125.189 1.00 10.15  ? 22  LEU D CA  1 
ATOM   5638 C C   . LEU D 2 22  ? -3.882  -8.872  124.864 1.00 11.63  ? 22  LEU D C   1 
ATOM   5639 O O   . LEU D 2 22  ? -3.513  -8.123  125.747 1.00 13.53  ? 22  LEU D O   1 
ATOM   5640 C CB  . LEU D 2 22  ? -2.987  -11.189 124.969 1.00 6.45   ? 22  LEU D CB  1 
ATOM   5641 C CG  . LEU D 2 22  ? -3.022  -12.601 125.559 1.00 8.55   ? 22  LEU D CG  1 
ATOM   5642 C CD1 . LEU D 2 22  ? -1.829  -13.415 125.099 1.00 5.52   ? 22  LEU D CD1 1 
ATOM   5643 C CD2 . LEU D 2 22  ? -3.045  -12.498 127.051 1.00 6.91   ? 22  LEU D CD2 1 
ATOM   5644 N N   . LEU D 2 23  ? -4.019  -8.470  123.603 1.00 14.19  ? 23  LEU D N   1 
ATOM   5645 C CA  . LEU D 2 23  ? -3.729  -7.089  123.224 1.00 16.52  ? 23  LEU D CA  1 
ATOM   5646 C C   . LEU D 2 23  ? -4.788  -6.165  123.787 1.00 18.91  ? 23  LEU D C   1 
ATOM   5647 O O   . LEU D 2 23  ? -4.480  -5.103  124.301 1.00 17.81  ? 23  LEU D O   1 
ATOM   5648 C CB  . LEU D 2 23  ? -3.638  -6.937  121.708 1.00 15.60  ? 23  LEU D CB  1 
ATOM   5649 C CG  . LEU D 2 23  ? -3.312  -5.531  121.208 1.00 14.47  ? 23  LEU D CG  1 
ATOM   5650 C CD1 . LEU D 2 23  ? -1.995  -5.049  121.791 1.00 12.46  ? 23  LEU D CD1 1 
ATOM   5651 C CD2 . LEU D 2 23  ? -3.265  -5.536  119.678 1.00 12.99  ? 23  LEU D CD2 1 
ATOM   5652 N N   . LEU D 2 24  ? -6.041  -6.613  123.717 1.00 21.50  ? 24  LEU D N   1 
ATOM   5653 C CA  . LEU D 2 24  ? -7.161  -5.867  124.276 1.00 20.83  ? 24  LEU D CA  1 
ATOM   5654 C C   . LEU D 2 24  ? -7.020  -5.669  125.781 1.00 20.61  ? 24  LEU D C   1 
ATOM   5655 O O   . LEU D 2 24  ? -7.264  -4.563  126.287 1.00 21.51  ? 24  LEU D O   1 
ATOM   5656 C CB  . LEU D 2 24  ? -8.483  -6.585  123.964 1.00 22.13  ? 24  LEU D CB  1 
ATOM   5657 C CG  . LEU D 2 24  ? -8.971  -6.544  122.507 1.00 21.05  ? 24  LEU D CG  1 
ATOM   5658 C CD1 . LEU D 2 24  ? -9.936  -7.665  122.234 1.00 19.59  ? 24  LEU D CD1 1 
ATOM   5659 C CD2 . LEU D 2 24  ? -9.604  -5.213  122.241 1.00 18.75  ? 24  LEU D CD2 1 
ATOM   5660 N N   . GLU D 2 25  ? -6.611  -6.735  126.477 1.00 18.59  ? 25  GLU D N   1 
ATOM   5661 C CA  . GLU D 2 25  ? -6.376  -6.683  127.916 1.00 22.74  ? 25  GLU D CA  1 
ATOM   5662 C C   . GLU D 2 25  ? -5.300  -5.644  128.233 1.00 22.32  ? 25  GLU D C   1 
ATOM   5663 O O   . GLU D 2 25  ? -5.568  -4.632  128.880 1.00 19.28  ? 25  GLU D O   1 
ATOM   5664 C CB  . GLU D 2 25  ? -5.949  -8.054  128.440 1.00 24.46  ? 25  GLU D CB  1 
ATOM   5665 C CG  . GLU D 2 25  ? -7.027  -9.120  128.397 1.00 29.34  ? 25  GLU D CG  1 
ATOM   5666 C CD  . GLU D 2 25  ? -8.193  -8.879  129.359 1.00 32.29  ? 25  GLU D CD  1 
ATOM   5667 O OE1 . GLU D 2 25  ? -8.053  -8.057  130.293 1.00 35.67  ? 25  GLU D OE1 1 
ATOM   5668 O OE2 . GLU D 2 25  ? -9.266  -9.512  129.175 1.00 35.64  ? 25  GLU D OE2 1 
ATOM   5669 N N   . PHE D 2 26  ? -4.094  -5.912  127.737 1.00 23.28  ? 26  PHE D N   1 
ATOM   5670 C CA  . PHE D 2 26  ? -2.920  -5.071  127.934 1.00 23.40  ? 26  PHE D CA  1 
ATOM   5671 C C   . PHE D 2 26  ? -3.221  -3.589  127.764 1.00 23.81  ? 26  PHE D C   1 
ATOM   5672 O O   . PHE D 2 26  ? -2.850  -2.771  128.613 1.00 25.84  ? 26  PHE D O   1 
ATOM   5673 C CB  . PHE D 2 26  ? -1.792  -5.507  126.990 1.00 23.71  ? 26  PHE D CB  1 
ATOM   5674 C CG  . PHE D 2 26  ? -0.555  -4.684  127.110 1.00 22.80  ? 26  PHE D CG  1 
ATOM   5675 C CD1 . PHE D 2 26  ? 0.391   -4.974  128.089 1.00 22.83  ? 26  PHE D CD1 1 
ATOM   5676 C CD2 . PHE D 2 26  ? -0.361  -3.577  126.275 1.00 23.07  ? 26  PHE D CD2 1 
ATOM   5677 C CE1 . PHE D 2 26  ? 1.538   -4.168  128.225 1.00 22.28  ? 26  PHE D CE1 1 
ATOM   5678 C CE2 . PHE D 2 26  ? 0.780   -2.764  126.397 1.00 23.04  ? 26  PHE D CE2 1 
ATOM   5679 C CZ  . PHE D 2 26  ? 1.730   -3.061  127.372 1.00 24.47  ? 26  PHE D CZ  1 
ATOM   5680 N N   . THR D 2 27  ? -3.890  -3.241  126.670 1.00 24.67  ? 27  THR D N   1 
ATOM   5681 C CA  . THR D 2 27  ? -4.157  -1.851  126.364 1.00 24.88  ? 27  THR D CA  1 
ATOM   5682 C C   . THR D 2 27  ? -5.377  -1.269  127.088 1.00 26.78  ? 27  THR D C   1 
ATOM   5683 O O   . THR D 2 27  ? -5.813  -0.157  126.740 1.00 25.84  ? 27  THR D O   1 
ATOM   5684 C CB  . THR D 2 27  ? -4.310  -1.617  124.841 1.00 25.40  ? 27  THR D CB  1 
ATOM   5685 O OG1 . THR D 2 27  ? -5.356  -2.453  124.305 1.00 21.37  ? 27  THR D OG1 1 
ATOM   5686 C CG2 . THR D 2 27  ? -2.992  -1.897  124.121 1.00 28.27  ? 27  THR D CG2 1 
ATOM   5687 N N   . ASP D 2 28  ? -5.921  -2.019  128.057 1.00 29.59  ? 28  ASP D N   1 
ATOM   5688 C CA  . ASP D 2 28  ? -7.104  -1.596  128.812 1.00 32.35  ? 28  ASP D CA  1 
ATOM   5689 C C   . ASP D 2 28  ? -8.257  -1.257  127.880 1.00 32.17  ? 28  ASP D C   1 
ATOM   5690 O O   . ASP D 2 28  ? -9.013  -0.316  128.153 1.00 32.33  ? 28  ASP D O   1 
ATOM   5691 C CB  . ASP D 2 28  ? -6.786  -0.359  129.677 1.00 35.24  ? 28  ASP D CB  1 
ATOM   5692 C CG  . ASP D 2 28  ? -5.950  -0.691  130.914 1.00 40.14  ? 28  ASP D CG  1 
ATOM   5693 O OD1 . ASP D 2 28  ? -6.443  -1.445  131.788 1.00 41.16  ? 28  ASP D OD1 1 
ATOM   5694 O OD2 . ASP D 2 28  ? -4.791  -0.205  130.994 1.00 43.92  ? 28  ASP D OD2 1 
ATOM   5695 N N   . THR D 2 29  ? -8.402  -2.016  126.801 1.00 34.09  ? 29  THR D N   1 
ATOM   5696 C CA  . THR D 2 29  ? -9.459  -1.752  125.829 1.00 34.84  ? 29  THR D CA  1 
ATOM   5697 C C   . THR D 2 29  ? -10.752 -2.467  126.248 1.00 35.45  ? 29  THR D C   1 
ATOM   5698 O O   . THR D 2 29  ? -10.798 -3.713  126.314 1.00 36.52  ? 29  THR D O   1 
ATOM   5699 C CB  . THR D 2 29  ? -9.041  -2.157  124.398 1.00 34.81  ? 29  THR D CB  1 
ATOM   5700 O OG1 . THR D 2 29  ? -7.877  -1.416  124.014 1.00 34.76  ? 29  THR D OG1 1 
ATOM   5701 C CG2 . THR D 2 29  ? -10.154 -1.836  123.429 1.00 32.93  ? 29  THR D CG2 1 
ATOM   5702 N N   . SER D 2 30  ? -11.784 -1.683  126.516 1.00 32.96  ? 30  SER D N   1 
ATOM   5703 C CA  . SER D 2 30  ? -13.082 -2.212  126.904 1.00 32.15  ? 30  SER D CA  1 
ATOM   5704 C C   . SER D 2 30  ? -13.678 -2.962  125.724 1.00 31.15  ? 30  SER D C   1 
ATOM   5705 O O   . SER D 2 30  ? -13.918 -2.398  124.664 1.00 33.56  ? 30  SER D O   1 
ATOM   5706 C CB  . SER D 2 30  ? -13.989 -1.050  127.314 1.00 32.52  ? 30  SER D CB  1 
ATOM   5707 O OG  . SER D 2 30  ? -15.294 -1.494  127.631 1.00 36.20  ? 30  SER D OG  1 
ATOM   5708 N N   . TYR D 2 31  ? -13.929 -4.262  125.916 1.00 29.25  ? 31  TYR D N   1 
ATOM   5709 C CA  . TYR D 2 31  ? -14.510 -5.061  124.860 1.00 28.06  ? 31  TYR D CA  1 
ATOM   5710 C C   . TYR D 2 31  ? -15.482 -6.093  125.420 1.00 29.63  ? 31  TYR D C   1 
ATOM   5711 O O   . TYR D 2 31  ? -15.384 -6.502  126.579 1.00 26.83  ? 31  TYR D O   1 
ATOM   5712 C CB  . TYR D 2 31  ? -13.409 -5.739  124.031 1.00 27.67  ? 31  TYR D CB  1 
ATOM   5713 C CG  . TYR D 2 31  ? -12.738 -6.930  124.671 1.00 25.09  ? 31  TYR D CG  1 
ATOM   5714 C CD1 . TYR D 2 31  ? -11.712 -6.752  125.611 1.00 25.56  ? 31  TYR D CD1 1 
ATOM   5715 C CD2 . TYR D 2 31  ? -13.142 -8.229  124.346 1.00 28.68  ? 31  TYR D CD2 1 
ATOM   5716 C CE1 . TYR D 2 31  ? -11.098 -7.832  126.226 1.00 26.26  ? 31  TYR D CE1 1 
ATOM   5717 C CE2 . TYR D 2 31  ? -12.534 -9.334  124.950 1.00 30.83  ? 31  TYR D CE2 1 
ATOM   5718 C CZ  . TYR D 2 31  ? -11.498 -9.134  125.890 1.00 30.34  ? 31  TYR D CZ  1 
ATOM   5719 O OH  . TYR D 2 31  ? -10.888 -10.237 126.491 1.00 27.89  ? 31  TYR D OH  1 
ATOM   5720 N N   . GLU D 2 32  ? -16.393 -6.544  124.556 1.00 31.42  ? 32  GLU D N   1 
ATOM   5721 C CA  . GLU D 2 32  ? -17.350 -7.579  124.895 1.00 32.15  ? 32  GLU D CA  1 
ATOM   5722 C C   . GLU D 2 32  ? -17.001 -8.731  123.973 1.00 31.27  ? 32  GLU D C   1 
ATOM   5723 O O   . GLU D 2 32  ? -16.584 -8.525  122.836 1.00 31.59  ? 32  GLU D O   1 
ATOM   5724 C CB  . GLU D 2 32  ? -18.761 -7.065  124.618 1.00 35.07  ? 32  GLU D CB  1 
ATOM   5725 C CG  . GLU D 2 32  ? -19.887 -8.013  125.022 1.00 41.29  ? 32  GLU D CG  1 
ATOM   5726 C CD  . GLU D 2 32  ? -21.287 -7.387  124.887 1.00 44.98  ? 32  GLU D CD  1 
ATOM   5727 O OE1 . GLU D 2 32  ? -21.417 -6.222  124.416 1.00 46.79  ? 32  GLU D OE1 1 
ATOM   5728 O OE2 . GLU D 2 32  ? -22.264 -8.084  125.262 1.00 47.61  ? 32  GLU D OE2 1 
ATOM   5729 N N   . GLU D 2 33  ? -17.169 -9.961  124.439 1.00 31.40  ? 33  GLU D N   1 
ATOM   5730 C CA  . GLU D 2 33  ? -16.782 -11.100 123.621 1.00 30.39  ? 33  GLU D CA  1 
ATOM   5731 C C   . GLU D 2 33  ? -17.988 -11.974 123.292 1.00 30.56  ? 33  GLU D C   1 
ATOM   5732 O O   . GLU D 2 33  ? -18.842 -12.218 124.131 1.00 31.69  ? 33  GLU D O   1 
ATOM   5733 C CB  . GLU D 2 33  ? -15.706 -11.940 124.324 1.00 30.88  ? 33  GLU D CB  1 
ATOM   5734 C CG  . GLU D 2 33  ? -14.988 -12.904 123.410 1.00 35.50  ? 33  GLU D CG  1 
ATOM   5735 C CD  . GLU D 2 33  ? -13.714 -13.452 123.998 1.00 39.25  ? 33  GLU D CD  1 
ATOM   5736 O OE1 . GLU D 2 33  ? -12.906 -12.670 124.555 1.00 41.09  ? 33  GLU D OE1 1 
ATOM   5737 O OE2 . GLU D 2 33  ? -13.536 -14.684 123.899 1.00 38.51  ? 33  GLU D OE2 1 
ATOM   5738 N N   . LYS D 2 34  ? -18.011 -12.466 122.057 1.00 29.14  ? 34  LYS D N   1 
ATOM   5739 C CA  . LYS D 2 34  ? -19.053 -13.346 121.565 1.00 28.39  ? 34  LYS D CA  1 
ATOM   5740 C C   . LYS D 2 34  ? -18.385 -14.650 121.121 1.00 30.21  ? 34  LYS D C   1 
ATOM   5741 O O   . LYS D 2 34  ? -17.686 -14.718 120.098 1.00 32.70  ? 34  LYS D O   1 
ATOM   5742 C CB  . LYS D 2 34  ? -19.763 -12.670 120.387 1.00 24.76  ? 34  LYS D CB  1 
ATOM   5743 C CG  . LYS D 2 34  ? -20.837 -13.511 119.732 1.00 26.66  ? 34  LYS D CG  1 
ATOM   5744 C CD  . LYS D 2 34  ? -21.973 -13.809 120.699 1.00 28.39  ? 34  LYS D CD  1 
ATOM   5745 C CE  . LYS D 2 34  ? -22.971 -14.805 120.095 1.00 30.23  ? 34  LYS D CE  1 
ATOM   5746 N NZ  . LYS D 2 34  ? -24.103 -15.116 121.069 1.00 30.71  ? 34  LYS D NZ  1 
ATOM   5747 N N   . ARG D 2 35  ? -18.624 -15.705 121.902 1.00 30.34  ? 35  ARG D N   1 
ATOM   5748 C CA  . ARG D 2 35  ? -18.031 -17.004 121.615 1.00 30.33  ? 35  ARG D CA  1 
ATOM   5749 C C   . ARG D 2 35  ? -19.029 -17.893 120.884 1.00 30.40  ? 35  ARG D C   1 
ATOM   5750 O O   . ARG D 2 35  ? -20.214 -17.882 121.198 1.00 28.69  ? 35  ARG D O   1 
ATOM   5751 C CB  . ARG D 2 35  ? -17.579 -17.694 122.904 1.00 30.53  ? 35  ARG D CB  1 
ATOM   5752 C CG  . ARG D 2 35  ? -16.475 -16.975 123.619 1.00 33.05  ? 35  ARG D CG  1 
ATOM   5753 C CD  . ARG D 2 35  ? -16.138 -17.672 124.935 1.00 38.87  ? 35  ARG D CD  1 
ATOM   5754 N NE  . ARG D 2 35  ? -14.945 -17.108 125.570 1.00 41.40  ? 35  ARG D NE  1 
ATOM   5755 C CZ  . ARG D 2 35  ? -13.690 -17.359 125.191 1.00 43.73  ? 35  ARG D CZ  1 
ATOM   5756 N NH1 . ARG D 2 35  ? -13.448 -18.234 124.213 1.00 44.67  ? 35  ARG D NH1 1 
ATOM   5757 N NH2 . ARG D 2 35  ? -12.681 -16.732 125.796 1.00 42.57  ? 35  ARG D NH2 1 
ATOM   5758 N N   . TYR D 2 36  ? -18.549 -18.656 119.906 1.00 29.32  ? 36  TYR D N   1 
ATOM   5759 C CA  . TYR D 2 36  ? -19.397 -19.570 119.152 1.00 28.74  ? 36  TYR D CA  1 
ATOM   5760 C C   . TYR D 2 36  ? -18.957 -20.974 119.509 1.00 30.20  ? 36  TYR D C   1 
ATOM   5761 O O   . TYR D 2 36  ? -17.772 -21.279 119.469 1.00 31.08  ? 36  TYR D O   1 
ATOM   5762 C CB  . TYR D 2 36  ? -19.268 -19.307 117.641 1.00 24.79  ? 36  TYR D CB  1 
ATOM   5763 C CG  . TYR D 2 36  ? -19.792 -17.936 117.238 1.00 22.17  ? 36  TYR D CG  1 
ATOM   5764 C CD1 . TYR D 2 36  ? -21.174 -17.723 117.038 1.00 22.12  ? 36  TYR D CD1 1 
ATOM   5765 C CD2 . TYR D 2 36  ? -18.905 -16.847 117.076 1.00 19.82  ? 36  TYR D CD2 1 
ATOM   5766 C CE1 . TYR D 2 36  ? -21.677 -16.445 116.679 1.00 19.80  ? 36  TYR D CE1 1 
ATOM   5767 C CE2 . TYR D 2 36  ? -19.385 -15.566 116.720 1.00 21.55  ? 36  TYR D CE2 1 
ATOM   5768 C CZ  . TYR D 2 36  ? -20.771 -15.385 116.533 1.00 22.35  ? 36  TYR D CZ  1 
ATOM   5769 O OH  . TYR D 2 36  ? -21.244 -14.147 116.211 1.00 19.21  ? 36  TYR D OH  1 
ATOM   5770 N N   . THR D 2 37  ? -19.926 -21.826 119.839 1.00 31.13  ? 37  THR D N   1 
ATOM   5771 C CA  . THR D 2 37  ? -19.666 -23.232 120.123 1.00 31.55  ? 37  THR D CA  1 
ATOM   5772 C C   . THR D 2 37  ? -19.664 -24.025 118.835 1.00 32.95  ? 37  THR D C   1 
ATOM   5773 O O   . THR D 2 37  ? -20.221 -23.589 117.844 1.00 34.51  ? 37  THR D O   1 
ATOM   5774 C CB  . THR D 2 37  ? -20.740 -23.792 121.082 1.00 32.46  ? 37  THR D CB  1 
ATOM   5775 O OG1 . THR D 2 37  ? -20.961 -22.853 122.145 1.00 35.79  ? 37  THR D OG1 1 
ATOM   5776 C CG2 . THR D 2 37  ? -20.294 -25.127 121.671 1.00 31.39  ? 37  THR D CG2 1 
ATOM   5777 N N   . CYS D 2 38  ? -19.029 -25.195 118.867 1.00 36.13  ? 38  CYS D N   1 
ATOM   5778 C CA  . CYS D 2 38  ? -18.959 -26.093 117.724 1.00 38.59  ? 38  CYS D CA  1 
ATOM   5779 C C   . CYS D 2 38  ? -19.522 -27.466 118.121 1.00 40.07  ? 38  CYS D C   1 
ATOM   5780 O O   . CYS D 2 38  ? -19.605 -27.797 119.304 1.00 39.52  ? 38  CYS D O   1 
ATOM   5781 C CB  . CYS D 2 38  ? -17.509 -26.222 117.248 1.00 38.31  ? 38  CYS D CB  1 
ATOM   5782 S SG  . CYS D 2 38  ? -17.288 -27.231 115.729 1.00 44.21  ? 38  CYS D SG  1 
ATOM   5783 N N   . GLY D 2 39  ? -19.915 -28.250 117.117 1.00 42.18  ? 39  GLY D N   1 
ATOM   5784 C CA  . GLY D 2 39  ? -20.443 -29.578 117.371 1.00 43.41  ? 39  GLY D CA  1 
ATOM   5785 C C   . GLY D 2 39  ? -19.335 -30.520 117.728 1.00 44.61  ? 39  GLY D C   1 
ATOM   5786 O O   . GLY D 2 39  ? -18.283 -30.488 117.111 1.00 45.33  ? 39  GLY D O   1 
ATOM   5787 N N   . GLU D 2 40  ? -19.558 -31.354 118.735 1.00 45.73  ? 40  GLU D N   1 
ATOM   5788 C CA  . GLU D 2 40  ? -18.544 -32.308 119.187 1.00 47.21  ? 40  GLU D CA  1 
ATOM   5789 C C   . GLU D 2 40  ? -18.682 -33.682 118.518 1.00 47.91  ? 40  GLU D C   1 
ATOM   5790 O O   . GLU D 2 40  ? -17.717 -34.457 118.429 1.00 48.30  ? 40  GLU D O   1 
ATOM   5791 C CB  . GLU D 2 40  ? -18.579 -32.464 120.716 1.00 48.43  ? 40  GLU D CB  1 
ATOM   5792 C CG  . GLU D 2 40  ? -19.944 -32.779 121.274 1.00 52.08  ? 40  GLU D CG  1 
ATOM   5793 C CD  . GLU D 2 40  ? -19.994 -32.648 122.783 1.00 54.42  ? 40  GLU D CD  1 
ATOM   5794 O OE1 . GLU D 2 40  ? -20.154 -31.499 123.275 1.00 55.38  ? 40  GLU D OE1 1 
ATOM   5795 O OE2 . GLU D 2 40  ? -19.868 -33.693 123.475 1.00 55.70  ? 40  GLU D OE2 1 
ATOM   5796 N N   . ALA D 2 41  ? -19.883 -33.972 118.039 1.00 47.93  ? 41  ALA D N   1 
ATOM   5797 C CA  . ALA D 2 41  ? -20.172 -35.243 117.387 1.00 48.55  ? 41  ALA D CA  1 
ATOM   5798 C C   . ALA D 2 41  ? -19.445 -35.254 116.040 1.00 48.97  ? 41  ALA D C   1 
ATOM   5799 O O   . ALA D 2 41  ? -18.953 -34.200 115.608 1.00 50.11  ? 41  ALA D O   1 
ATOM   5800 C CB  . ALA D 2 41  ? -21.698 -35.383 117.177 1.00 47.97  ? 41  ALA D CB  1 
ATOM   5801 N N   . PRO D 2 42  ? -19.390 -36.431 115.344 1.00 48.19  ? 42  PRO D N   1 
ATOM   5802 C CA  . PRO D 2 42  ? -18.773 -36.509 114.016 1.00 47.69  ? 42  PRO D CA  1 
ATOM   5803 C C   . PRO D 2 42  ? -19.186 -35.396 113.066 1.00 47.68  ? 42  PRO D C   1 
ATOM   5804 O O   . PRO D 2 42  ? -18.385 -34.900 112.255 1.00 49.48  ? 42  PRO D O   1 
ATOM   5805 C CB  . PRO D 2 42  ? -19.242 -37.876 113.513 1.00 46.74  ? 42  PRO D CB  1 
ATOM   5806 C CG  . PRO D 2 42  ? -19.358 -38.684 114.734 1.00 47.11  ? 42  PRO D CG  1 
ATOM   5807 C CD  . PRO D 2 42  ? -19.916 -37.742 115.766 1.00 48.09  ? 42  PRO D CD  1 
ATOM   5808 N N   . ASP D 2 43  ? -20.427 -34.959 113.205 1.00 47.50  ? 43  ASP D N   1 
ATOM   5809 C CA  . ASP D 2 43  ? -20.933 -33.821 112.459 1.00 47.01  ? 43  ASP D CA  1 
ATOM   5810 C C   . ASP D 2 43  ? -20.635 -32.609 113.318 1.00 45.65  ? 43  ASP D C   1 
ATOM   5811 O O   . ASP D 2 43  ? -21.462 -32.208 114.151 1.00 48.51  ? 43  ASP D O   1 
ATOM   5812 C CB  . ASP D 2 43  ? -22.443 -33.975 112.238 1.00 49.05  ? 43  ASP D CB  1 
ATOM   5813 C CG  . ASP D 2 43  ? -22.795 -35.273 111.509 1.00 52.70  ? 43  ASP D CG  1 
ATOM   5814 O OD1 . ASP D 2 43  ? -22.902 -36.335 112.175 1.00 53.06  ? 43  ASP D OD1 1 
ATOM   5815 O OD2 . ASP D 2 43  ? -22.942 -35.229 110.263 1.00 54.94  ? 43  ASP D OD2 1 
ATOM   5816 N N   . TYR D 2 44  ? -19.467 -32.005 113.094 1.00 42.71  ? 44  TYR D N   1 
ATOM   5817 C CA  . TYR D 2 44  ? -19.057 -30.816 113.838 1.00 41.24  ? 44  TYR D CA  1 
ATOM   5818 C C   . TYR D 2 44  ? -19.946 -29.614 113.465 1.00 40.36  ? 44  TYR D C   1 
ATOM   5819 O O   . TYR D 2 44  ? -19.535 -28.736 112.677 1.00 39.80  ? 44  TYR D O   1 
ATOM   5820 C CB  . TYR D 2 44  ? -17.582 -30.494 113.584 1.00 40.71  ? 44  TYR D CB  1 
ATOM   5821 C CG  . TYR D 2 44  ? -16.629 -31.529 114.155 1.00 41.16  ? 44  TYR D CG  1 
ATOM   5822 C CD1 . TYR D 2 44  ? -16.241 -31.482 115.511 1.00 39.87  ? 44  TYR D CD1 1 
ATOM   5823 C CD2 . TYR D 2 44  ? -16.146 -32.578 113.350 1.00 41.11  ? 44  TYR D CD2 1 
ATOM   5824 C CE1 . TYR D 2 44  ? -15.391 -32.454 116.049 1.00 40.16  ? 44  TYR D CE1 1 
ATOM   5825 C CE2 . TYR D 2 44  ? -15.278 -33.555 113.874 1.00 40.41  ? 44  TYR D CE2 1 
ATOM   5826 C CZ  . TYR D 2 44  ? -14.910 -33.478 115.222 1.00 41.72  ? 44  TYR D CZ  1 
ATOM   5827 O OH  . TYR D 2 44  ? -14.082 -34.442 115.739 1.00 43.31  ? 44  TYR D OH  1 
ATOM   5828 N N   . ASP D 2 45  ? -21.143 -29.605 114.031 1.00 37.24  ? 45  ASP D N   1 
ATOM   5829 C CA  . ASP D 2 45  ? -22.150 -28.603 113.739 1.00 34.55  ? 45  ASP D CA  1 
ATOM   5830 C C   . ASP D 2 45  ? -21.677 -27.217 114.135 1.00 33.73  ? 45  ASP D C   1 
ATOM   5831 O O   . ASP D 2 45  ? -21.563 -26.886 115.308 1.00 34.08  ? 45  ASP D O   1 
ATOM   5832 C CB  . ASP D 2 45  ? -23.460 -28.943 114.442 1.00 33.32  ? 45  ASP D CB  1 
ATOM   5833 C CG  . ASP D 2 45  ? -24.539 -27.883 114.220 1.00 31.72  ? 45  ASP D CG  1 
ATOM   5834 O OD1 . ASP D 2 45  ? -24.854 -27.560 113.042 1.00 28.55  ? 45  ASP D OD1 1 
ATOM   5835 O OD2 . ASP D 2 45  ? -25.057 -27.357 115.231 1.00 33.84  ? 45  ASP D OD2 1 
ATOM   5836 N N   . ARG D 2 46  ? -21.404 -26.400 113.129 1.00 30.37  ? 46  ARG D N   1 
ATOM   5837 C CA  . ARG D 2 46  ? -20.994 -25.027 113.343 1.00 28.85  ? 46  ARG D CA  1 
ATOM   5838 C C   . ARG D 2 46  ? -22.093 -24.047 112.861 1.00 28.20  ? 46  ARG D C   1 
ATOM   5839 O O   . ARG D 2 46  ? -21.801 -22.881 112.474 1.00 28.34  ? 46  ARG D O   1 
ATOM   5840 C CB  . ARG D 2 46  ? -19.664 -24.764 112.619 1.00 28.01  ? 46  ARG D CB  1 
ATOM   5841 C CG  . ARG D 2 46  ? -19.579 -25.292 111.197 1.00 26.66  ? 46  ARG D CG  1 
ATOM   5842 C CD  . ARG D 2 46  ? -18.425 -24.674 110.435 1.00 27.50  ? 46  ARG D CD  1 
ATOM   5843 N NE  . ARG D 2 46  ? -17.176 -24.775 111.185 1.00 27.90  ? 46  ARG D NE  1 
ATOM   5844 C CZ  . ARG D 2 46  ? -16.465 -25.897 111.326 1.00 28.58  ? 46  ARG D CZ  1 
ATOM   5845 N NH1 . ARG D 2 46  ? -16.891 -27.050 110.795 1.00 29.99  ? 46  ARG D NH1 1 
ATOM   5846 N NH2 . ARG D 2 46  ? -15.308 -25.875 111.987 1.00 31.28  ? 46  ARG D NH2 1 
ATOM   5847 N N   . SER D 2 47  ? -23.344 -24.512 112.913 1.00 25.75  ? 47  SER D N   1 
ATOM   5848 C CA  . SER D 2 47  ? -24.474 -23.691 112.501 1.00 25.34  ? 47  SER D CA  1 
ATOM   5849 C C   . SER D 2 47  ? -24.517 -22.401 113.304 1.00 24.97  ? 47  SER D C   1 
ATOM   5850 O O   . SER D 2 47  ? -24.808 -21.340 112.745 1.00 26.27  ? 47  SER D O   1 
ATOM   5851 C CB  . SER D 2 47  ? -25.773 -24.450 112.685 1.00 26.39  ? 47  SER D CB  1 
ATOM   5852 O OG  . SER D 2 47  ? -25.851 -24.964 113.996 1.00 29.16  ? 47  SER D OG  1 
ATOM   5853 N N   . GLN D 2 48  ? -24.191 -22.495 114.593 1.00 24.03  ? 48  GLN D N   1 
ATOM   5854 C CA  . GLN D 2 48  ? -24.182 -21.351 115.502 1.00 22.45  ? 48  GLN D CA  1 
ATOM   5855 C C   . GLN D 2 48  ? -23.576 -20.099 114.861 1.00 20.01  ? 48  GLN D C   1 
ATOM   5856 O O   . GLN D 2 48  ? -24.099 -18.980 115.034 1.00 19.60  ? 48  GLN D O   1 
ATOM   5857 C CB  . GLN D 2 48  ? -23.435 -21.721 116.791 1.00 25.12  ? 48  GLN D CB  1 
ATOM   5858 C CG  . GLN D 2 48  ? -23.731 -20.805 117.990 1.00 28.03  ? 48  GLN D CG  1 
ATOM   5859 C CD  . GLN D 2 48  ? -23.289 -21.387 119.341 1.00 27.17  ? 48  GLN D CD  1 
ATOM   5860 O OE1 . GLN D 2 48  ? -22.748 -20.677 120.176 1.00 28.50  ? 48  GLN D OE1 1 
ATOM   5861 N NE2 . GLN D 2 48  ? -23.512 -22.672 119.543 1.00 23.21  ? 48  GLN D NE2 1 
ATOM   5862 N N   . TRP D 2 49  ? -22.502 -20.305 114.099 1.00 17.66  ? 49  TRP D N   1 
ATOM   5863 C CA  . TRP D 2 49  ? -21.819 -19.233 113.392 1.00 15.89  ? 49  TRP D CA  1 
ATOM   5864 C C   . TRP D 2 49  ? -22.547 -18.930 112.082 1.00 17.13  ? 49  TRP D C   1 
ATOM   5865 O O   . TRP D 2 49  ? -22.839 -17.766 111.763 1.00 14.98  ? 49  TRP D O   1 
ATOM   5866 C CB  . TRP D 2 49  ? -20.344 -19.602 113.155 1.00 12.37  ? 49  TRP D CB  1 
ATOM   5867 C CG  . TRP D 2 49  ? -19.660 -18.828 112.047 1.00 5.59   ? 49  TRP D CG  1 
ATOM   5868 C CD1 . TRP D 2 49  ? -19.014 -19.344 110.979 1.00 2.22   ? 49  TRP D CD1 1 
ATOM   5869 C CD2 . TRP D 2 49  ? -19.593 -17.394 111.922 1.00 2.00   ? 49  TRP D CD2 1 
ATOM   5870 N NE1 . TRP D 2 49  ? -18.586 -18.347 110.157 1.00 2.00   ? 49  TRP D NE1 1 
ATOM   5871 C CE2 . TRP D 2 49  ? -18.885 -17.147 110.715 1.00 2.00   ? 49  TRP D CE2 1 
ATOM   5872 C CE3 . TRP D 2 49  ? -20.026 -16.328 112.710 1.00 2.00   ? 49  TRP D CE3 1 
ATOM   5873 C CZ2 . TRP D 2 49  ? -18.632 -15.842 110.261 1.00 2.00   ? 49  TRP D CZ2 1 
ATOM   5874 C CZ3 . TRP D 2 49  ? -19.769 -15.021 112.269 1.00 2.00   ? 49  TRP D CZ3 1 
ATOM   5875 C CH2 . TRP D 2 49  ? -19.083 -14.793 111.027 1.00 3.98   ? 49  TRP D CH2 1 
ATOM   5876 N N   . LEU D 2 50  ? -22.800 -19.991 111.314 1.00 20.00  ? 50  LEU D N   1 
ATOM   5877 C CA  . LEU D 2 50  ? -23.406 -19.895 109.992 1.00 22.73  ? 50  LEU D CA  1 
ATOM   5878 C C   . LEU D 2 50  ? -24.730 -19.109 109.978 1.00 24.51  ? 50  LEU D C   1 
ATOM   5879 O O   . LEU D 2 50  ? -25.027 -18.408 108.990 1.00 27.26  ? 50  LEU D O   1 
ATOM   5880 C CB  . LEU D 2 50  ? -23.610 -21.305 109.421 1.00 21.82  ? 50  LEU D CB  1 
ATOM   5881 C CG  . LEU D 2 50  ? -22.424 -21.987 108.718 1.00 22.17  ? 50  LEU D CG  1 
ATOM   5882 C CD1 . LEU D 2 50  ? -21.171 -21.946 109.574 1.00 25.68  ? 50  LEU D CD1 1 
ATOM   5883 C CD2 . LEU D 2 50  ? -22.789 -23.419 108.434 1.00 21.49  ? 50  LEU D CD2 1 
ATOM   5884 N N   . ASP D 2 51  ? -25.499 -19.209 111.064 1.00 22.89  ? 51  ASP D N   1 
ATOM   5885 C CA  . ASP D 2 51  ? -26.786 -18.532 111.162 1.00 24.68  ? 51  ASP D CA  1 
ATOM   5886 C C   . ASP D 2 51  ? -26.660 -17.015 111.147 1.00 25.38  ? 51  ASP D C   1 
ATOM   5887 O O   . ASP D 2 51  ? -27.436 -16.332 110.493 1.00 27.49  ? 51  ASP D O   1 
ATOM   5888 C CB  . ASP D 2 51  ? -27.536 -18.979 112.417 1.00 26.99  ? 51  ASP D CB  1 
ATOM   5889 C CG  . ASP D 2 51  ? -27.864 -20.478 112.418 1.00 27.34  ? 51  ASP D CG  1 
ATOM   5890 O OD1 . ASP D 2 51  ? -28.427 -21.018 111.440 1.00 29.03  ? 51  ASP D OD1 1 
ATOM   5891 O OD2 . ASP D 2 51  ? -27.528 -21.134 113.413 1.00 29.87  ? 51  ASP D OD2 1 
ATOM   5892 N N   . VAL D 2 52  ? -25.679 -16.492 111.871 1.00 24.57  ? 52  VAL D N   1 
ATOM   5893 C CA  . VAL D 2 52  ? -25.499 -15.051 111.946 1.00 22.86  ? 52  VAL D CA  1 
ATOM   5894 C C   . VAL D 2 52  ? -24.445 -14.517 111.002 1.00 20.65  ? 52  VAL D C   1 
ATOM   5895 O O   . VAL D 2 52  ? -24.294 -13.287 110.868 1.00 22.64  ? 52  VAL D O   1 
ATOM   5896 C CB  . VAL D 2 52  ? -25.161 -14.579 113.372 1.00 23.31  ? 52  VAL D CB  1 
ATOM   5897 C CG1 . VAL D 2 52  ? -26.372 -14.820 114.289 1.00 24.61  ? 52  VAL D CG1 1 
ATOM   5898 C CG2 . VAL D 2 52  ? -23.927 -15.297 113.866 1.00 24.28  ? 52  VAL D CG2 1 
ATOM   5899 N N   . LYS D 2 53  ? -23.717 -15.431 110.355 1.00 15.82  ? 53  LYS D N   1 
ATOM   5900 C CA  . LYS D 2 53  ? -22.632 -15.065 109.441 1.00 14.63  ? 53  LYS D CA  1 
ATOM   5901 C C   . LYS D 2 53  ? -22.930 -13.893 108.477 1.00 14.38  ? 53  LYS D C   1 
ATOM   5902 O O   . LYS D 2 53  ? -22.141 -12.936 108.349 1.00 16.03  ? 53  LYS D O   1 
ATOM   5903 C CB  . LYS D 2 53  ? -22.184 -16.291 108.640 1.00 12.55  ? 53  LYS D CB  1 
ATOM   5904 C CG  . LYS D 2 53  ? -21.030 -16.037 107.694 1.00 11.33  ? 53  LYS D CG  1 
ATOM   5905 C CD  . LYS D 2 53  ? -20.616 -17.305 107.007 1.00 9.62   ? 53  LYS D CD  1 
ATOM   5906 C CE  . LYS D 2 53  ? -19.449 -17.040 106.097 1.00 6.93   ? 53  LYS D CE  1 
ATOM   5907 N NZ  . LYS D 2 53  ? -18.962 -18.311 105.489 1.00 8.06   ? 53  LYS D NZ  1 
ATOM   5908 N N   . PHE D 2 54  ? -24.076 -13.950 107.806 1.00 15.28  ? 54  PHE D N   1 
ATOM   5909 C CA  . PHE D 2 54  ? -24.417 -12.912 106.831 1.00 14.84  ? 54  PHE D CA  1 
ATOM   5910 C C   . PHE D 2 54  ? -25.286 -11.803 107.428 1.00 16.59  ? 54  PHE D C   1 
ATOM   5911 O O   . PHE D 2 54  ? -25.956 -11.096 106.679 1.00 15.48  ? 54  PHE D O   1 
ATOM   5912 C CB  . PHE D 2 54  ? -25.057 -13.519 105.573 1.00 8.72   ? 54  PHE D CB  1 
ATOM   5913 C CG  . PHE D 2 54  ? -24.189 -14.521 104.880 1.00 4.61   ? 54  PHE D CG  1 
ATOM   5914 C CD1 . PHE D 2 54  ? -23.132 -14.089 104.075 1.00 2.86   ? 54  PHE D CD1 1 
ATOM   5915 C CD2 . PHE D 2 54  ? -24.395 -15.889 105.069 1.00 6.07   ? 54  PHE D CD2 1 
ATOM   5916 C CE1 . PHE D 2 54  ? -22.295 -15.011 103.448 1.00 3.12   ? 54  PHE D CE1 1 
ATOM   5917 C CE2 . PHE D 2 54  ? -23.570 -16.828 104.453 1.00 7.27   ? 54  PHE D CE2 1 
ATOM   5918 C CZ  . PHE D 2 54  ? -22.513 -16.388 103.637 1.00 6.10   ? 54  PHE D CZ  1 
ATOM   5919 N N   . LYS D 2 55  ? -25.293 -11.665 108.746 1.00 18.16  ? 55  LYS D N   1 
ATOM   5920 C CA  . LYS D 2 55  ? -26.127 -10.666 109.399 1.00 19.46  ? 55  LYS D CA  1 
ATOM   5921 C C   . LYS D 2 55  ? -25.310 -9.614  110.134 1.00 20.28  ? 55  LYS D C   1 
ATOM   5922 O O   . LYS D 2 55  ? -25.881 -8.694  110.722 1.00 21.56  ? 55  LYS D O   1 
ATOM   5923 C CB  . LYS D 2 55  ? -27.099 -11.350 110.353 1.00 20.42  ? 55  LYS D CB  1 
ATOM   5924 C CG  . LYS D 2 55  ? -28.000 -12.386 109.667 1.00 24.70  ? 55  LYS D CG  1 
ATOM   5925 C CD  . LYS D 2 55  ? -28.922 -13.086 110.671 1.00 25.76  ? 55  LYS D CD  1 
ATOM   5926 C CE  . LYS D 2 55  ? -29.768 -14.112 109.969 1.00 26.00  ? 55  LYS D CE  1 
ATOM   5927 N NZ  . LYS D 2 55  ? -30.649 -14.840 110.888 1.00 28.34  ? 55  LYS D NZ  1 
ATOM   5928 N N   . LEU D 2 56  ? -23.993 -9.755  110.138 1.00 21.32  ? 56  LEU D N   1 
ATOM   5929 C CA  . LEU D 2 56  ? -23.127 -8.874  110.941 1.00 20.55  ? 56  LEU D CA  1 
ATOM   5930 C C   . LEU D 2 56  ? -22.598 -7.669  110.161 1.00 19.79  ? 56  LEU D C   1 
ATOM   5931 O O   . LEU D 2 56  ? -21.817 -6.888  110.698 1.00 20.18  ? 56  LEU D O   1 
ATOM   5932 C CB  . LEU D 2 56  ? -21.961 -9.671  111.553 1.00 18.64  ? 56  LEU D CB  1 
ATOM   5933 C CG  . LEU D 2 56  ? -22.393 -10.836 112.456 1.00 17.99  ? 56  LEU D CG  1 
ATOM   5934 C CD1 . LEU D 2 56  ? -21.210 -11.728 112.766 1.00 23.26  ? 56  LEU D CD1 1 
ATOM   5935 C CD2 . LEU D 2 56  ? -23.004 -10.271 113.696 1.00 16.63  ? 56  LEU D CD2 1 
ATOM   5936 N N   . ASP D 2 57  ? -23.031 -7.544  108.909 1.00 19.30  ? 57  ASP D N   1 
ATOM   5937 C CA  . ASP D 2 57  ? -22.582 -6.452  108.016 1.00 19.39  ? 57  ASP D CA  1 
ATOM   5938 C C   . ASP D 2 57  ? -21.060 -6.482  107.744 1.00 17.80  ? 57  ASP D C   1 
ATOM   5939 O O   . ASP D 2 57  ? -20.422 -5.444  107.574 1.00 19.20  ? 57  ASP D O   1 
ATOM   5940 C CB  . ASP D 2 57  ? -22.969 -5.076  108.589 1.00 22.57  ? 57  ASP D CB  1 
ATOM   5941 C CG  . ASP D 2 57  ? -24.454 -4.792  108.506 1.00 31.87  ? 57  ASP D CG  1 
ATOM   5942 O OD1 . ASP D 2 57  ? -25.211 -5.290  109.395 1.00 36.61  ? 57  ASP D OD1 1 
ATOM   5943 O OD2 . ASP D 2 57  ? -24.854 -4.096  107.529 1.00 34.83  ? 57  ASP D OD2 1 
ATOM   5944 N N   . LEU D 2 58  ? -20.486 -7.672  107.683 1.00 14.95  ? 58  LEU D N   1 
ATOM   5945 C CA  . LEU D 2 58  ? -19.063 -7.812  107.424 1.00 15.31  ? 58  LEU D CA  1 
ATOM   5946 C C   . LEU D 2 58  ? -18.835 -7.881  105.904 1.00 16.69  ? 58  LEU D C   1 
ATOM   5947 O O   . LEU D 2 58  ? -19.475 -8.682  105.201 1.00 17.39  ? 58  LEU D O   1 
ATOM   5948 C CB  . LEU D 2 58  ? -18.547 -9.099  108.071 1.00 14.81  ? 58  LEU D CB  1 
ATOM   5949 C CG  . LEU D 2 58  ? -18.646 -9.197  109.593 1.00 16.77  ? 58  LEU D CG  1 
ATOM   5950 C CD1 . LEU D 2 58  ? -18.128 -10.542 110.049 1.00 15.88  ? 58  LEU D CD1 1 
ATOM   5951 C CD2 . LEU D 2 58  ? -17.893 -8.036  110.231 1.00 14.68  ? 58  LEU D CD2 1 
ATOM   5952 N N   . ASP D 2 59  ? -17.895 -7.072  105.415 1.00 16.88  ? 59  ASP D N   1 
ATOM   5953 C CA  . ASP D 2 59  ? -17.575 -7.049  103.995 1.00 14.51  ? 59  ASP D CA  1 
ATOM   5954 C C   . ASP D 2 59  ? -17.083 -8.425  103.575 1.00 15.74  ? 59  ASP D C   1 
ATOM   5955 O O   . ASP D 2 59  ? -17.424 -8.913  102.493 1.00 14.81  ? 59  ASP D O   1 
ATOM   5956 C CB  . ASP D 2 59  ? -16.481 -6.032  103.745 1.00 16.56  ? 59  ASP D CB  1 
ATOM   5957 C CG  . ASP D 2 59  ? -16.893 -4.636  104.161 1.00 21.14  ? 59  ASP D CG  1 
ATOM   5958 O OD1 . ASP D 2 59  ? -17.074 -4.388  105.367 1.00 25.99  ? 59  ASP D OD1 1 
ATOM   5959 O OD2 . ASP D 2 59  ? -17.018 -3.759  103.286 1.00 22.38  ? 59  ASP D OD2 1 
ATOM   5960 N N   . PHE D 2 60  ? -16.310 -9.071  104.441 1.00 15.55  ? 60  PHE D N   1 
ATOM   5961 C CA  . PHE D 2 60  ? -15.845 -10.428 104.172 1.00 16.32  ? 60  PHE D CA  1 
ATOM   5962 C C   . PHE D 2 60  ? -16.100 -11.239 105.433 1.00 16.12  ? 60  PHE D C   1 
ATOM   5963 O O   . PHE D 2 60  ? -15.238 -11.326 106.285 1.00 15.37  ? 60  PHE D O   1 
ATOM   5964 C CB  . PHE D 2 60  ? -14.336 -10.433 103.860 1.00 12.34  ? 60  PHE D CB  1 
ATOM   5965 C CG  . PHE D 2 60  ? -13.977 -9.680  102.600 1.00 6.68   ? 60  PHE D CG  1 
ATOM   5966 C CD1 . PHE D 2 60  ? -13.687 -8.300  102.656 1.00 2.00   ? 60  PHE D CD1 1 
ATOM   5967 C CD2 . PHE D 2 60  ? -13.882 -10.366 101.373 1.00 4.88   ? 60  PHE D CD2 1 
ATOM   5968 C CE1 . PHE D 2 60  ? -13.338 -7.588  101.498 1.00 2.00   ? 60  PHE D CE1 1 
ATOM   5969 C CE2 . PHE D 2 60  ? -13.526 -9.684  100.203 1.00 2.00   ? 60  PHE D CE2 1 
ATOM   5970 C CZ  . PHE D 2 60  ? -13.249 -8.271  100.269 1.00 2.00   ? 60  PHE D CZ  1 
ATOM   5971 N N   . PRO D 2 61  ? -17.300 -11.861 105.553 1.00 17.45  ? 61  PRO D N   1 
ATOM   5972 C CA  . PRO D 2 61  ? -17.691 -12.648 106.717 1.00 20.69  ? 61  PRO D CA  1 
ATOM   5973 C C   . PRO D 2 61  ? -16.672 -13.711 107.063 1.00 20.26  ? 61  PRO D C   1 
ATOM   5974 O O   . PRO D 2 61  ? -16.345 -14.566 106.232 1.00 19.27  ? 61  PRO D O   1 
ATOM   5975 C CB  . PRO D 2 61  ? -19.015 -13.270 106.251 1.00 20.92  ? 61  PRO D CB  1 
ATOM   5976 C CG  . PRO D 2 61  ? -19.566 -12.279 105.332 1.00 20.94  ? 61  PRO D CG  1 
ATOM   5977 C CD  . PRO D 2 61  ? -18.374 -11.816 104.559 1.00 20.35  ? 61  PRO D CD  1 
ATOM   5978 N N   . ASN D 2 62  ? -16.147 -13.631 108.293 1.00 22.04  ? 62  ASN D N   1 
ATOM   5979 C CA  . ASN D 2 62  ? -15.059 -14.507 108.724 1.00 21.93  ? 62  ASN D CA  1 
ATOM   5980 C C   . ASN D 2 62  ? -14.896 -14.388 110.208 1.00 21.05  ? 62  ASN D C   1 
ATOM   5981 O O   . ASN D 2 62  ? -15.412 -13.445 110.782 1.00 20.93  ? 62  ASN D O   1 
ATOM   5982 C CB  . ASN D 2 62  ? -13.755 -14.144 108.003 1.00 21.92  ? 62  ASN D CB  1 
ATOM   5983 C CG  . ASN D 2 62  ? -12.760 -15.307 107.962 1.00 21.29  ? 62  ASN D CG  1 
ATOM   5984 O OD1 . ASN D 2 62  ? -12.949 -16.349 108.599 1.00 23.61  ? 62  ASN D OD1 1 
ATOM   5985 N ND2 . ASN D 2 62  ? -11.695 -15.099 107.225 1.00 20.09  ? 62  ASN D ND2 1 
ATOM   5986 N N   . LEU D 2 63  ? -14.176 -15.345 110.800 1.00 21.57  ? 63  LEU D N   1 
ATOM   5987 C CA  . LEU D 2 63  ? -13.852 -15.347 112.229 1.00 23.03  ? 63  LEU D CA  1 
ATOM   5988 C C   . LEU D 2 63  ? -12.330 -15.365 112.384 1.00 22.73  ? 63  LEU D C   1 
ATOM   5989 O O   . LEU D 2 63  ? -11.645 -16.101 111.675 1.00 24.52  ? 63  LEU D O   1 
ATOM   5990 C CB  . LEU D 2 63  ? -14.443 -16.583 112.923 1.00 22.96  ? 63  LEU D CB  1 
ATOM   5991 C CG  . LEU D 2 63  ? -15.940 -16.623 113.214 1.00 21.04  ? 63  LEU D CG  1 
ATOM   5992 C CD1 . LEU D 2 63  ? -16.277 -17.930 113.904 1.00 20.96  ? 63  LEU D CD1 1 
ATOM   5993 C CD2 . LEU D 2 63  ? -16.338 -15.442 114.061 1.00 18.39  ? 63  LEU D CD2 1 
ATOM   5994 N N   . PRO D 2 64  ? -11.780 -14.550 113.335 1.00 22.41  ? 64  PRO D N   1 
ATOM   5995 C CA  . PRO D 2 64  ? -12.505 -13.649 114.228 1.00 19.75  ? 64  PRO D CA  1 
ATOM   5996 C C   . PRO D 2 64  ? -12.925 -12.373 113.565 1.00 16.13  ? 64  PRO D C   1 
ATOM   5997 O O   . PRO D 2 64  ? -12.368 -12.007 112.540 1.00 15.37  ? 64  PRO D O   1 
ATOM   5998 C CB  . PRO D 2 64  ? -11.469 -13.371 115.310 1.00 20.61  ? 64  PRO D CB  1 
ATOM   5999 C CG  . PRO D 2 64  ? -10.198 -13.391 114.555 1.00 20.86  ? 64  PRO D CG  1 
ATOM   6000 C CD  . PRO D 2 64  ? -10.335 -14.533 113.597 1.00 22.44  ? 64  PRO D CD  1 
ATOM   6001 N N   . TYR D 2 65  ? -13.877 -11.660 114.185 1.00 14.52  ? 65  TYR D N   1 
ATOM   6002 C CA  . TYR D 2 65  ? -14.307 -10.358 113.696 1.00 13.32  ? 65  TYR D CA  1 
ATOM   6003 C C   . TYR D 2 65  ? -14.341 -9.434  114.897 1.00 15.70  ? 65  TYR D C   1 
ATOM   6004 O O   . TYR D 2 65  ? -14.571 -9.877  116.026 1.00 16.91  ? 65  TYR D O   1 
ATOM   6005 C CB  . TYR D 2 65  ? -15.684 -10.447 113.001 1.00 11.87  ? 65  TYR D CB  1 
ATOM   6006 C CG  . TYR D 2 65  ? -16.889 -10.761 113.890 1.00 12.16  ? 65  TYR D CG  1 
ATOM   6007 C CD1 . TYR D 2 65  ? -17.516 -9.739  114.638 1.00 9.38   ? 65  TYR D CD1 1 
ATOM   6008 C CD2 . TYR D 2 65  ? -17.332 -12.100 114.060 1.00 11.75  ? 65  TYR D CD2 1 
ATOM   6009 C CE1 . TYR D 2 65  ? -18.555 -10.036 115.517 1.00 7.00   ? 65  TYR D CE1 1 
ATOM   6010 C CE2 . TYR D 2 65  ? -18.396 -12.404 114.951 1.00 11.00  ? 65  TYR D CE2 1 
ATOM   6011 C CZ  . TYR D 2 65  ? -19.004 -11.356 115.643 1.00 9.46   ? 65  TYR D CZ  1 
ATOM   6012 O OH  . TYR D 2 65  ? -19.997 -11.618 116.549 1.00 13.20  ? 65  TYR D OH  1 
ATOM   6013 N N   . LEU D 2 66  ? -14.159 -8.137  114.641 1.00 15.96  ? 66  LEU D N   1 
ATOM   6014 C CA  . LEU D 2 66  ? -14.229 -7.143  115.695 1.00 17.52  ? 66  LEU D CA  1 
ATOM   6015 C C   . LEU D 2 66  ? -15.126 -6.009  115.204 1.00 19.00  ? 66  LEU D C   1 
ATOM   6016 O O   . LEU D 2 66  ? -14.879 -5.426  114.137 1.00 18.67  ? 66  LEU D O   1 
ATOM   6017 C CB  . LEU D 2 66  ? -12.831 -6.613  116.036 1.00 19.59  ? 66  LEU D CB  1 
ATOM   6018 C CG  . LEU D 2 66  ? -12.738 -5.590  117.173 1.00 21.20  ? 66  LEU D CG  1 
ATOM   6019 C CD1 . LEU D 2 66  ? -12.914 -6.308  118.498 1.00 24.21  ? 66  LEU D CD1 1 
ATOM   6020 C CD2 . LEU D 2 66  ? -11.398 -4.886  117.139 1.00 23.50  ? 66  LEU D CD2 1 
ATOM   6021 N N   . LEU D 2 67  ? -16.152 -5.694  115.991 1.00 22.32  ? 67  LEU D N   1 
ATOM   6022 C CA  . LEU D 2 67  ? -17.085 -4.636  115.652 1.00 22.01  ? 67  LEU D CA  1 
ATOM   6023 C C   . LEU D 2 67  ? -16.845 -3.523  116.628 1.00 22.73  ? 67  LEU D C   1 
ATOM   6024 O O   . LEU D 2 67  ? -17.280 -3.587  117.758 1.00 25.60  ? 67  LEU D O   1 
ATOM   6025 C CB  . LEU D 2 67  ? -18.528 -5.149  115.729 1.00 22.37  ? 67  LEU D CB  1 
ATOM   6026 C CG  . LEU D 2 67  ? -18.842 -6.492  115.049 1.00 24.37  ? 67  LEU D CG  1 
ATOM   6027 C CD1 . LEU D 2 67  ? -20.302 -6.842  115.276 1.00 24.91  ? 67  LEU D CD1 1 
ATOM   6028 C CD2 . LEU D 2 67  ? -18.548 -6.425  113.567 1.00 24.74  ? 67  LEU D CD2 1 
ATOM   6029 N N   . ASP D 2 68  ? -16.166 -2.483  116.160 1.00 22.26  ? 68  ASP D N   1 
ATOM   6030 C CA  . ASP D 2 68  ? -15.931 -1.285  116.946 1.00 21.76  ? 68  ASP D CA  1 
ATOM   6031 C C   . ASP D 2 68  ? -16.773 -0.119  116.398 1.00 23.25  ? 68  ASP D C   1 
ATOM   6032 O O   . ASP D 2 68  ? -16.294 0.686   115.589 1.00 22.02  ? 68  ASP D O   1 
ATOM   6033 C CB  . ASP D 2 68  ? -14.439 -0.926  116.937 1.00 20.07  ? 68  ASP D CB  1 
ATOM   6034 C CG  . ASP D 2 68  ? -14.110 0.238   117.857 1.00 20.99  ? 68  ASP D CG  1 
ATOM   6035 O OD1 . ASP D 2 68  ? -14.597 0.241   119.018 1.00 21.38  ? 68  ASP D OD1 1 
ATOM   6036 O OD2 . ASP D 2 68  ? -13.379 1.159   117.423 1.00 19.09  ? 68  ASP D OD2 1 
ATOM   6037 N N   . GLY D 2 69  ? -18.029 -0.039  116.842 1.00 26.28  ? 69  GLY D N   1 
ATOM   6038 C CA  . GLY D 2 69  ? -18.935 0.989   116.354 1.00 27.38  ? 69  GLY D CA  1 
ATOM   6039 C C   . GLY D 2 69  ? -19.108 0.871   114.850 1.00 29.25  ? 69  GLY D C   1 
ATOM   6040 O O   . GLY D 2 69  ? -19.571 -0.163  114.336 1.00 31.15  ? 69  GLY D O   1 
ATOM   6041 N N   . LYS D 2 70  ? -18.734 1.922   114.126 1.00 29.32  ? 70  LYS D N   1 
ATOM   6042 C CA  . LYS D 2 70  ? -18.887 1.943   112.678 1.00 28.58  ? 70  LYS D CA  1 
ATOM   6043 C C   . LYS D 2 70  ? -17.787 1.173   111.962 1.00 27.16  ? 70  LYS D C   1 
ATOM   6044 O O   . LYS D 2 70  ? -17.804 1.092   110.744 1.00 28.42  ? 70  LYS D O   1 
ATOM   6045 C CB  . LYS D 2 70  ? -18.924 3.381   112.139 1.00 30.42  ? 70  LYS D CB  1 
ATOM   6046 C CG  . LYS D 2 70  ? -18.082 4.410   112.912 1.00 34.75  ? 70  LYS D CG  1 
ATOM   6047 C CD  . LYS D 2 70  ? -16.595 4.242   112.624 1.00 35.41  ? 70  LYS D CD  1 
ATOM   6048 C CE  . LYS D 2 70  ? -15.740 5.160   113.483 1.00 36.45  ? 70  LYS D CE  1 
ATOM   6049 N NZ  . LYS D 2 70  ? -16.081 6.593   113.247 1.00 36.54  ? 70  LYS D NZ  1 
ATOM   6050 N N   . ASN D 2 71  ? -16.830 0.639   112.716 1.00 25.09  ? 71  ASN D N   1 
ATOM   6051 C CA  . ASN D 2 71  ? -15.713 -0.095  112.135 1.00 22.83  ? 71  ASN D CA  1 
ATOM   6052 C C   . ASN D 2 71  ? -15.907 -1.581  112.390 1.00 22.02  ? 71  ASN D C   1 
ATOM   6053 O O   . ASN D 2 71  ? -15.834 -2.048  113.511 1.00 21.39  ? 71  ASN D O   1 
ATOM   6054 C CB  . ASN D 2 71  ? -14.367 0.382   112.709 1.00 20.25  ? 71  ASN D CB  1 
ATOM   6055 C CG  . ASN D 2 71  ? -13.904 1.721   112.120 1.00 18.39  ? 71  ASN D CG  1 
ATOM   6056 O OD1 . ASN D 2 71  ? -13.318 2.542   112.814 1.00 18.35  ? 71  ASN D OD1 1 
ATOM   6057 N ND2 . ASN D 2 71  ? -14.188 1.937   110.857 1.00 19.04  ? 71  ASN D ND2 1 
ATOM   6058 N N   . LYS D 2 72  ? -16.143 -2.327  111.320 1.00 22.89  ? 72  LYS D N   1 
ATOM   6059 C CA  . LYS D 2 72  ? -16.289 -3.784  111.388 1.00 22.97  ? 72  LYS D CA  1 
ATOM   6060 C C   . LYS D 2 72  ? -15.122 -4.416  110.633 1.00 21.44  ? 72  LYS D C   1 
ATOM   6061 O O   . LYS D 2 72  ? -14.997 -4.250  109.406 1.00 23.23  ? 72  LYS D O   1 
ATOM   6062 C CB  . LYS D 2 72  ? -17.620 -4.225  110.757 1.00 24.30  ? 72  LYS D CB  1 
ATOM   6063 C CG  . LYS D 2 72  ? -18.818 -3.569  111.391 1.00 28.81  ? 72  LYS D CG  1 
ATOM   6064 C CD  . LYS D 2 72  ? -20.081 -3.828  110.584 1.00 31.59  ? 72  LYS D CD  1 
ATOM   6065 C CE  . LYS D 2 72  ? -21.304 -3.205  111.278 1.00 34.74  ? 72  LYS D CE  1 
ATOM   6066 N NZ  . LYS D 2 72  ? -21.156 -1.721  111.453 1.00 37.54  ? 72  LYS D NZ  1 
ATOM   6067 N N   . ILE D 2 73  ? -14.255 -5.112  111.366 1.00 19.02  ? 73  ILE D N   1 
ATOM   6068 C CA  . ILE D 2 73  ? -13.061 -5.661  110.772 1.00 17.94  ? 73  ILE D CA  1 
ATOM   6069 C C   . ILE D 2 73  ? -13.044 -7.171  110.894 1.00 18.11  ? 73  ILE D C   1 
ATOM   6070 O O   . ILE D 2 73  ? -13.546 -7.745  111.856 1.00 20.78  ? 73  ILE D O   1 
ATOM   6071 C CB  . ILE D 2 73  ? -11.780 -5.074  111.410 1.00 17.81  ? 73  ILE D CB  1 
ATOM   6072 C CG1 . ILE D 2 73  ? -11.859 -3.541  111.470 1.00 13.49  ? 73  ILE D CG1 1 
ATOM   6073 C CG2 . ILE D 2 73  ? -10.561 -5.476  110.556 1.00 18.09  ? 73  ILE D CG2 1 
ATOM   6074 C CD1 . ILE D 2 73  ? -12.411 -3.049  112.744 1.00 14.02  ? 73  ILE D CD1 1 
ATOM   6075 N N   . THR D 2 74  ? -12.418 -7.817  109.907 1.00 14.33  ? 74  THR D N   1 
ATOM   6076 C CA  . THR D 2 74  ? -12.194 -9.263  109.922 1.00 15.81  ? 74  THR D CA  1 
ATOM   6077 C C   . THR D 2 74  ? -10.707 -9.461  109.591 1.00 15.42  ? 74  THR D C   1 
ATOM   6078 O O   . THR D 2 74  ? -10.000 -8.477  109.359 1.00 14.71  ? 74  THR D O   1 
ATOM   6079 C CB  . THR D 2 74  ? -13.084 -9.990  108.863 1.00 18.19  ? 74  THR D CB  1 
ATOM   6080 O OG1 . THR D 2 74  ? -13.418 -9.093  107.794 1.00 23.04  ? 74  THR D OG1 1 
ATOM   6081 C CG2 . THR D 2 74  ? -14.340 -10.486 109.506 1.00 16.67  ? 74  THR D CG2 1 
ATOM   6082 N N   . GLN D 2 75  ? -10.249 -10.722 109.569 1.00 13.46  ? 75  GLN D N   1 
ATOM   6083 C CA  . GLN D 2 75  ? -8.843  -11.061 109.364 1.00 10.35  ? 75  GLN D CA  1 
ATOM   6084 C C   . GLN D 2 75  ? -8.030  -10.668 110.607 1.00 10.50  ? 75  GLN D C   1 
ATOM   6085 O O   . GLN D 2 75  ? -7.934  -9.465  110.949 1.00 6.87   ? 75  GLN D O   1 
ATOM   6086 C CB  . GLN D 2 75  ? -8.278  -10.361 108.128 1.00 8.31   ? 75  GLN D CB  1 
ATOM   6087 C CG  . GLN D 2 75  ? -8.809  -10.899 106.804 1.00 5.21   ? 75  GLN D CG  1 
ATOM   6088 C CD  . GLN D 2 75  ? -8.370  -12.347 106.557 1.00 6.17   ? 75  GLN D CD  1 
ATOM   6089 O OE1 . GLN D 2 75  ? -7.419  -12.817 107.148 1.00 6.01   ? 75  GLN D OE1 1 
ATOM   6090 N NE2 . GLN D 2 75  ? -9.081  -13.030 105.688 1.00 4.99   ? 75  GLN D NE2 1 
ATOM   6091 N N   . SER D 2 76  ? -7.460  -11.676 111.271 1.00 10.77  ? 76  SER D N   1 
ATOM   6092 C CA  . SER D 2 76  ? -6.677  -11.514 112.509 1.00 9.30   ? 76  SER D CA  1 
ATOM   6093 C C   . SER D 2 76  ? -5.682  -10.366 112.480 1.00 10.62  ? 76  SER D C   1 
ATOM   6094 O O   . SER D 2 76  ? -5.783  -9.456  113.281 1.00 10.73  ? 76  SER D O   1 
ATOM   6095 C CB  . SER D 2 76  ? -5.952  -12.813 112.842 1.00 10.39  ? 76  SER D CB  1 
ATOM   6096 O OG  . SER D 2 76  ? -6.887  -13.890 112.917 1.00 15.87  ? 76  SER D OG  1 
ATOM   6097 N N   . ASN D 2 77  ? -4.760  -10.382 111.512 1.00 10.68  ? 77  ASN D N   1 
ATOM   6098 C CA  . ASN D 2 77  ? -3.733  -9.351  111.428 1.00 11.65  ? 77  ASN D CA  1 
ATOM   6099 C C   . ASN D 2 77  ? -4.289  -7.950  111.219 1.00 11.58  ? 77  ASN D C   1 
ATOM   6100 O O   . ASN D 2 77  ? -3.673  -6.968  111.641 1.00 10.22  ? 77  ASN D O   1 
ATOM   6101 C CB  . ASN D 2 77  ? -2.742  -9.665  110.305 1.00 12.59  ? 77  ASN D CB  1 
ATOM   6102 C CG  . ASN D 2 77  ? -1.868  -10.875 110.617 1.00 12.38  ? 77  ASN D CG  1 
ATOM   6103 O OD1 . ASN D 2 77  ? -1.961  -11.451 111.690 1.00 18.42  ? 77  ASN D OD1 1 
ATOM   6104 N ND2 . ASN D 2 77  ? -1.034  -11.269 109.662 1.00 9.56   ? 77  ASN D ND2 1 
ATOM   6105 N N   . ALA D 2 78  ? -5.476  -7.866  110.620 1.00 12.48  ? 78  ALA D N   1 
ATOM   6106 C CA  . ALA D 2 78  ? -6.160  -6.584  110.415 1.00 11.32  ? 78  ALA D CA  1 
ATOM   6107 C C   . ALA D 2 78  ? -6.744  -6.054  111.727 1.00 9.23   ? 78  ALA D C   1 
ATOM   6108 O O   . ALA D 2 78  ? -6.660  -4.875  112.041 1.00 10.92  ? 78  ALA D O   1 
ATOM   6109 C CB  . ALA D 2 78  ? -7.254  -6.741  109.388 1.00 13.78  ? 78  ALA D CB  1 
ATOM   6110 N N   . ILE D 2 79  ? -7.309  -6.961  112.521 1.00 7.15   ? 79  ILE D N   1 
ATOM   6111 C CA  . ILE D 2 79  ? -7.838  -6.617  113.827 1.00 8.84   ? 79  ILE D CA  1 
ATOM   6112 C C   . ILE D 2 79  ? -6.697  -6.139  114.729 1.00 9.85   ? 79  ILE D C   1 
ATOM   6113 O O   . ILE D 2 79  ? -6.826  -5.052  115.315 1.00 10.59  ? 79  ILE D O   1 
ATOM   6114 C CB  . ILE D 2 79  ? -8.544  -7.841  114.474 1.00 12.20  ? 79  ILE D CB  1 
ATOM   6115 C CG1 . ILE D 2 79  ? -9.766  -8.251  113.633 1.00 9.73   ? 79  ILE D CG1 1 
ATOM   6116 C CG2 . ILE D 2 79  ? -8.951  -7.518  115.884 1.00 12.35  ? 79  ILE D CG2 1 
ATOM   6117 C CD1 . ILE D 2 79  ? -10.460 -9.474  114.112 1.00 7.71   ? 79  ILE D CD1 1 
ATOM   6118 N N   . LEU D 2 80  ? -5.630  -6.948  114.833 1.00 10.07  ? 80  LEU D N   1 
ATOM   6119 C CA  . LEU D 2 80  ? -4.445  -6.631  115.648 1.00 8.15   ? 80  LEU D CA  1 
ATOM   6120 C C   . LEU D 2 80  ? -3.818  -5.298  115.236 1.00 8.78   ? 80  LEU D C   1 
ATOM   6121 O O   . LEU D 2 80  ? -3.539  -4.461  116.107 1.00 11.36  ? 80  LEU D O   1 
ATOM   6122 C CB  . LEU D 2 80  ? -3.409  -7.729  115.531 1.00 5.84   ? 80  LEU D CB  1 
ATOM   6123 C CG  . LEU D 2 80  ? -3.746  -8.982  116.322 1.00 10.29  ? 80  LEU D CG  1 
ATOM   6124 C CD1 . LEU D 2 80  ? -2.947  -10.161 115.802 1.00 9.06   ? 80  LEU D CD1 1 
ATOM   6125 C CD2 . LEU D 2 80  ? -3.453  -8.753  117.797 1.00 12.57  ? 80  LEU D CD2 1 
ATOM   6126 N N   . ARG D 2 81  ? -3.644  -5.069  113.929 1.00 5.09   ? 81  ARG D N   1 
ATOM   6127 C CA  . ARG D 2 81  ? -3.080  -3.802  113.452 1.00 9.36   ? 81  ARG D CA  1 
ATOM   6128 C C   . ARG D 2 81  ? -3.979  -2.657  113.821 1.00 11.86  ? 81  ARG D C   1 
ATOM   6129 O O   . ARG D 2 81  ? -3.491  -1.601  114.167 1.00 11.69  ? 81  ARG D O   1 
ATOM   6130 C CB  . ARG D 2 81  ? -2.879  -3.813  111.944 1.00 11.33  ? 81  ARG D CB  1 
ATOM   6131 C CG  . ARG D 2 81  ? -1.644  -4.596  111.494 1.00 12.22  ? 81  ARG D CG  1 
ATOM   6132 C CD  . ARG D 2 81  ? -1.438  -4.469  109.981 1.00 9.73   ? 81  ARG D CD  1 
ATOM   6133 N NE  . ARG D 2 81  ? -0.215  -5.124  109.520 1.00 8.69   ? 81  ARG D NE  1 
ATOM   6134 C CZ  . ARG D 2 81  ? 0.991   -4.571  109.553 1.00 2.06   ? 81  ARG D CZ  1 
ATOM   6135 N NH1 . ARG D 2 81  ? 1.152   -3.342  110.022 1.00 2.00   ? 81  ARG D NH1 1 
ATOM   6136 N NH2 . ARG D 2 81  ? 2.030   -5.247  109.098 1.00 2.00   ? 81  ARG D NH2 1 
ATOM   6137 N N   . TYR D 2 82  ? -5.283  -2.892  113.758 1.00 14.36  ? 82  TYR D N   1 
ATOM   6138 C CA  . TYR D 2 82  ? -6.308  -1.885  114.039 1.00 13.92  ? 82  TYR D CA  1 
ATOM   6139 C C   . TYR D 2 82  ? -6.193  -1.420  115.492 1.00 13.36  ? 82  TYR D C   1 
ATOM   6140 O O   . TYR D 2 82  ? -6.000  -0.219  115.733 1.00 9.45   ? 82  TYR D O   1 
ATOM   6141 C CB  . TYR D 2 82  ? -7.725  -2.430  113.735 1.00 15.23  ? 82  TYR D CB  1 
ATOM   6142 C CG  . TYR D 2 82  ? -8.846  -1.497  114.142 1.00 12.72  ? 82  TYR D CG  1 
ATOM   6143 C CD1 . TYR D 2 82  ? -8.964  -0.224  113.546 1.00 13.39  ? 82  TYR D CD1 1 
ATOM   6144 C CD2 . TYR D 2 82  ? -9.769  -1.870  115.136 1.00 9.47   ? 82  TYR D CD2 1 
ATOM   6145 C CE1 . TYR D 2 82  ? -9.964  0.653   113.933 1.00 14.08  ? 82  TYR D CE1 1 
ATOM   6146 C CE2 . TYR D 2 82  ? -10.790 -0.994  115.542 1.00 12.87  ? 82  TYR D CE2 1 
ATOM   6147 C CZ  . TYR D 2 82  ? -10.872 0.258   114.936 1.00 15.39  ? 82  TYR D CZ  1 
ATOM   6148 O OH  . TYR D 2 82  ? -11.886 1.097   115.312 1.00 14.18  ? 82  TYR D OH  1 
ATOM   6149 N N   . ILE D 2 83  ? -6.319  -2.359  116.441 1.00 15.81  ? 83  ILE D N   1 
ATOM   6150 C CA  . ILE D 2 83  ? -6.281  -2.053  117.881 1.00 18.11  ? 83  ILE D CA  1 
ATOM   6151 C C   . ILE D 2 83  ? -4.906  -1.447  118.240 1.00 18.51  ? 83  ILE D C   1 
ATOM   6152 O O   . ILE D 2 83  ? -4.826  -0.413  118.926 1.00 17.86  ? 83  ILE D O   1 
ATOM   6153 C CB  . ILE D 2 83  ? -6.511  -3.295  118.752 1.00 18.76  ? 83  ILE D CB  1 
ATOM   6154 C CG1 . ILE D 2 83  ? -7.760  -4.026  118.287 1.00 18.50  ? 83  ILE D CG1 1 
ATOM   6155 C CG2 . ILE D 2 83  ? -6.648  -2.894  120.182 1.00 20.64  ? 83  ILE D CG2 1 
ATOM   6156 C CD1 . ILE D 2 83  ? -7.958  -5.368  118.930 1.00 21.50  ? 83  ILE D CD1 1 
ATOM   6157 N N   . ALA D 2 84  ? -3.836  -2.080  117.745 1.00 19.57  ? 84  ALA D N   1 
ATOM   6158 C CA  . ALA D 2 84  ? -2.474  -1.642  118.017 1.00 19.35  ? 84  ALA D CA  1 
ATOM   6159 C C   . ALA D 2 84  ? -2.273  -0.209  117.576 1.00 18.99  ? 84  ALA D C   1 
ATOM   6160 O O   . ALA D 2 84  ? -1.775  0.599   118.321 1.00 17.00  ? 84  ALA D O   1 
ATOM   6161 C CB  . ALA D 2 84  ? -1.481  -2.563  117.329 1.00 18.61  ? 84  ALA D CB  1 
ATOM   6162 N N   . ARG D 2 85  ? -2.709  0.095   116.352 1.00 21.15  ? 85  ARG D N   1 
ATOM   6163 C CA  . ARG D 2 85  ? -2.522  1.408   115.767 1.00 22.35  ? 85  ARG D CA  1 
ATOM   6164 C C   . ARG D 2 85  ? -3.070  2.471   116.673 1.00 23.87  ? 85  ARG D C   1 
ATOM   6165 O O   . ARG D 2 85  ? -2.434  3.506   116.869 1.00 26.34  ? 85  ARG D O   1 
ATOM   6166 C CB  . ARG D 2 85  ? -3.213  1.474   114.412 1.00 18.80  ? 85  ARG D CB  1 
ATOM   6167 C CG  . ARG D 2 85  ? -2.588  2.430   113.424 1.00 16.79  ? 85  ARG D CG  1 
ATOM   6168 C CD  . ARG D 2 85  ? -3.395  2.505   112.110 1.00 18.16  ? 85  ARG D CD  1 
ATOM   6169 N NE  . ARG D 2 85  ? -3.570  1.205   111.457 1.00 17.05  ? 85  ARG D NE  1 
ATOM   6170 C CZ  . ARG D 2 85  ? -4.749  0.660   111.170 1.00 19.88  ? 85  ARG D CZ  1 
ATOM   6171 N NH1 . ARG D 2 85  ? -5.890  1.308   111.417 1.00 19.70  ? 85  ARG D NH1 1 
ATOM   6172 N NH2 . ARG D 2 85  ? -4.781  -0.555  110.639 1.00 15.75  ? 85  ARG D NH2 1 
ATOM   6173 N N   . LYS D 2 86  ? -4.240  2.195   117.257 1.00 23.89  ? 86  LYS D N   1 
ATOM   6174 C CA  . LYS D 2 86  ? -4.909  3.142   118.158 1.00 24.34  ? 86  LYS D CA  1 
ATOM   6175 C C   . LYS D 2 86  ? -4.053  3.423   119.412 1.00 25.07  ? 86  LYS D C   1 
ATOM   6176 O O   . LYS D 2 86  ? -4.104  4.496   120.011 1.00 26.27  ? 86  LYS D O   1 
ATOM   6177 C CB  . LYS D 2 86  ? -6.294  2.603   118.575 1.00 23.91  ? 86  LYS D CB  1 
ATOM   6178 C CG  . LYS D 2 86  ? -7.163  2.167   117.428 1.00 26.27  ? 86  LYS D CG  1 
ATOM   6179 C CD  . LYS D 2 86  ? -8.436  1.552   117.912 1.00 23.27  ? 86  LYS D CD  1 
ATOM   6180 C CE  . LYS D 2 86  ? -9.484  2.618   118.153 1.00 22.75  ? 86  LYS D CE  1 
ATOM   6181 N NZ  . LYS D 2 86  ? -9.887  3.284   116.886 1.00 25.54  ? 86  LYS D NZ  1 
ATOM   6182 N N   . HIS D 2 87  ? -3.258  2.438   119.801 1.00 23.93  ? 87  HIS D N   1 
ATOM   6183 C CA  . HIS D 2 87  ? -2.437  2.564   120.991 1.00 21.19  ? 87  HIS D CA  1 
ATOM   6184 C C   . HIS D 2 87  ? -0.968  2.758   120.626 1.00 21.57  ? 87  HIS D C   1 
ATOM   6185 O O   . HIS D 2 87  ? -0.100  2.563   121.442 1.00 18.85  ? 87  HIS D O   1 
ATOM   6186 C CB  . HIS D 2 87  ? -2.571  1.313   121.856 1.00 21.33  ? 87  HIS D CB  1 
ATOM   6187 C CG  . HIS D 2 87  ? -3.981  1.066   122.358 1.00 20.48  ? 87  HIS D CG  1 
ATOM   6188 N ND1 . HIS D 2 87  ? -4.544  1.790   123.337 1.00 21.08  ? 87  HIS D ND1 1 
ATOM   6189 C CD2 . HIS D 2 87  ? -4.877  0.122   121.947 1.00 22.06  ? 87  HIS D CD2 1 
ATOM   6190 C CE1 . HIS D 2 87  ? -5.803  1.327   123.549 1.00 25.24  ? 87  HIS D CE1 1 
ATOM   6191 N NE2 . HIS D 2 87  ? -5.995  0.345   122.730 1.00 26.23  ? 87  HIS D NE2 1 
ATOM   6192 N N   . ASN D 2 88  ? -0.697  3.162   119.390 1.00 21.52  ? 88  ASN D N   1 
ATOM   6193 C CA  . ASN D 2 88  ? 0.669   3.386   118.919 1.00 22.89  ? 88  ASN D CA  1 
ATOM   6194 C C   . ASN D 2 88  ? 1.609   2.183   119.090 1.00 22.39  ? 88  ASN D C   1 
ATOM   6195 O O   . ASN D 2 88  ? 2.803   2.355   119.243 1.00 21.39  ? 88  ASN D O   1 
ATOM   6196 C CB  . ASN D 2 88  ? 1.252   4.659   119.539 1.00 24.90  ? 88  ASN D CB  1 
ATOM   6197 C CG  . ASN D 2 88  ? 2.573   5.064   118.922 1.00 26.90  ? 88  ASN D CG  1 
ATOM   6198 O OD1 . ASN D 2 88  ? 3.478   5.506   119.617 1.00 30.99  ? 88  ASN D OD1 1 
ATOM   6199 N ND2 . ASN D 2 88  ? 2.701   4.876   117.613 1.00 30.38  ? 88  ASN D ND2 1 
ATOM   6200 N N   . MET D 2 89  ? 1.079   0.984   119.055 1.00 22.95  ? 89  MET D N   1 
ATOM   6201 C CA  . MET D 2 89  ? 1.892   -0.215  119.222 1.00 20.57  ? 89  MET D CA  1 
ATOM   6202 C C   . MET D 2 89  ? 2.290   -0.845  117.879 1.00 21.92  ? 89  MET D C   1 
ATOM   6203 O O   . MET D 2 89  ? 2.082   -2.029  117.617 1.00 21.97  ? 89  MET D O   1 
ATOM   6204 C CB  . MET D 2 89  ? 1.151   -1.204  120.101 1.00 21.16  ? 89  MET D CB  1 
ATOM   6205 C CG  . MET D 2 89  ? 1.028   -0.740  121.536 1.00 21.93  ? 89  MET D CG  1 
ATOM   6206 S SD  . MET D 2 89  ? 0.472   -1.992  122.605 1.00 25.49  ? 89  MET D SD  1 
ATOM   6207 C CE  . MET D 2 89  ? 1.894   -2.951  122.833 1.00 24.02  ? 89  MET D CE  1 
ATOM   6208 N N   . CYS D 2 90  ? 2.943   -0.025  117.056 1.00 22.53  ? 90  CYS D N   1 
ATOM   6209 C CA  . CYS D 2 90  ? 3.505   -0.438  115.765 1.00 24.53  ? 90  CYS D CA  1 
ATOM   6210 C C   . CYS D 2 90  ? 4.891   0.248   115.673 1.00 26.72  ? 90  CYS D C   1 
ATOM   6211 O O   . CYS D 2 90  ? 5.194   1.207   116.420 1.00 28.72  ? 90  CYS D O   1 
ATOM   6212 C CB  . CYS D 2 90  ? 2.635   0.055   114.608 1.00 24.78  ? 90  CYS D CB  1 
ATOM   6213 S SG  . CYS D 2 90  ? 1.053   -0.775  114.457 1.00 27.59  ? 90  CYS D SG  1 
ATOM   6214 N N   . GLY D 2 91  ? 5.744   -0.247  114.775 1.00 26.22  ? 91  GLY D N   1 
ATOM   6215 C CA  . GLY D 2 91  ? 7.059   0.357   114.625 1.00 27.85  ? 91  GLY D CA  1 
ATOM   6216 C C   . GLY D 2 91  ? 6.952   1.836   114.309 1.00 30.44  ? 91  GLY D C   1 
ATOM   6217 O O   . GLY D 2 91  ? 6.217   2.231   113.400 1.00 30.83  ? 91  GLY D O   1 
ATOM   6218 N N   . GLU D 2 92  ? 7.678   2.674   115.043 1.00 31.39  ? 92  GLU D N   1 
ATOM   6219 C CA  . GLU D 2 92  ? 7.670   4.099   114.779 1.00 32.71  ? 92  GLU D CA  1 
ATOM   6220 C C   . GLU D 2 92  ? 8.719   4.502   113.758 1.00 32.17  ? 92  GLU D C   1 
ATOM   6221 O O   . GLU D 2 92  ? 8.471   5.366   112.917 1.00 34.17  ? 92  GLU D O   1 
ATOM   6222 C CB  . GLU D 2 92  ? 7.899   4.871   116.067 1.00 35.25  ? 92  GLU D CB  1 
ATOM   6223 C CG  . GLU D 2 92  ? 6.653   4.941   116.993 1.00 39.85  ? 92  GLU D CG  1 
ATOM   6224 C CD  . GLU D 2 92  ? 6.873   5.812   118.226 1.00 42.93  ? 92  GLU D CD  1 
ATOM   6225 O OE1 . GLU D 2 92  ? 7.361   6.966   118.084 1.00 44.66  ? 92  GLU D OE1 1 
ATOM   6226 O OE2 . GLU D 2 92  ? 6.568   5.323   119.338 1.00 43.20  ? 92  GLU D OE2 1 
ATOM   6227 N N   . THR D 2 93  ? 9.882   3.865   113.807 1.00 31.07  ? 93  THR D N   1 
ATOM   6228 C CA  . THR D 2 93  ? 10.924  4.160   112.833 1.00 29.73  ? 93  THR D CA  1 
ATOM   6229 C C   . THR D 2 93  ? 10.887  3.139   111.691 1.00 30.08  ? 93  THR D C   1 
ATOM   6230 O O   . THR D 2 93  ? 10.397  2.019   111.875 1.00 31.61  ? 93  THR D O   1 
ATOM   6231 C CB  . THR D 2 93  ? 12.308  4.114   113.488 1.00 29.72  ? 93  THR D CB  1 
ATOM   6232 O OG1 . THR D 2 93  ? 12.576  2.787   113.977 1.00 32.66  ? 93  THR D OG1 1 
ATOM   6233 C CG2 . THR D 2 93  ? 12.378  5.116   114.644 1.00 28.40  ? 93  THR D CG2 1 
ATOM   6234 N N   . GLU D 2 94  ? 11.429  3.512   110.534 1.00 28.32  ? 94  GLU D N   1 
ATOM   6235 C CA  . GLU D 2 94  ? 11.478  2.634   109.369 1.00 25.47  ? 94  GLU D CA  1 
ATOM   6236 C C   . GLU D 2 94  ? 12.044  1.258   109.709 1.00 26.77  ? 94  GLU D C   1 
ATOM   6237 O O   . GLU D 2 94  ? 11.519  0.256   109.223 1.00 27.40  ? 94  GLU D O   1 
ATOM   6238 C CB  . GLU D 2 94  ? 12.301  3.273   108.254 1.00 23.53  ? 94  GLU D CB  1 
ATOM   6239 C CG  . GLU D 2 94  ? 12.307  2.482   106.943 1.00 23.45  ? 94  GLU D CG  1 
ATOM   6240 C CD  . GLU D 2 94  ? 10.914  2.374   106.263 1.00 26.59  ? 94  GLU D CD  1 
ATOM   6241 O OE1 . GLU D 2 94  ? 10.041  3.287   106.403 1.00 24.41  ? 94  GLU D OE1 1 
ATOM   6242 O OE2 . GLU D 2 94  ? 10.691  1.331   105.592 1.00 25.26  ? 94  GLU D OE2 1 
ATOM   6243 N N   . GLU D 2 95  ? 13.079  1.215   110.549 1.00 26.44  ? 95  GLU D N   1 
ATOM   6244 C CA  . GLU D 2 95  ? 13.709  -0.042  110.951 1.00 23.79  ? 95  GLU D CA  1 
ATOM   6245 C C   . GLU D 2 95  ? 12.761  -0.877  111.785 1.00 19.84  ? 95  GLU D C   1 
ATOM   6246 O O   . GLU D 2 95  ? 12.725  -2.111  111.640 1.00 17.21  ? 95  GLU D O   1 
ATOM   6247 C CB  . GLU D 2 95  ? 14.980  0.223   111.745 1.00 27.72  ? 95  GLU D CB  1 
ATOM   6248 C CG  . GLU D 2 95  ? 16.176  0.652   110.911 1.00 29.22  ? 95  GLU D CG  1 
ATOM   6249 C CD  . GLU D 2 95  ? 16.083  2.105   110.439 1.00 32.24  ? 95  GLU D CD  1 
ATOM   6250 O OE1 . GLU D 2 95  ? 15.762  3.002   111.266 1.00 35.49  ? 95  GLU D OE1 1 
ATOM   6251 O OE2 . GLU D 2 95  ? 16.314  2.335   109.226 1.00 32.47  ? 95  GLU D OE2 1 
ATOM   6252 N N   . GLU D 2 96  ? 11.974  -0.207  112.631 1.00 17.37  ? 96  GLU D N   1 
ATOM   6253 C CA  . GLU D 2 96  ? 10.988  -0.889  113.476 1.00 18.59  ? 96  GLU D CA  1 
ATOM   6254 C C   . GLU D 2 96  ? 9.798   -1.428  112.654 1.00 17.40  ? 96  GLU D C   1 
ATOM   6255 O O   . GLU D 2 96  ? 9.313   -2.541  112.902 1.00 14.56  ? 96  GLU D O   1 
ATOM   6256 C CB  . GLU D 2 96  ? 10.462  0.050   114.554 1.00 16.34  ? 96  GLU D CB  1 
ATOM   6257 C CG  . GLU D 2 96  ? 11.483  0.390   115.630 1.00 19.82  ? 96  GLU D CG  1 
ATOM   6258 C CD  . GLU D 2 96  ? 10.890  1.256   116.740 1.00 21.89  ? 96  GLU D CD  1 
ATOM   6259 O OE1 . GLU D 2 96  ? 10.201  2.268   116.426 1.00 20.86  ? 96  GLU D OE1 1 
ATOM   6260 O OE2 . GLU D 2 96  ? 11.109  0.907   117.927 1.00 25.23  ? 96  GLU D OE2 1 
ATOM   6261 N N   . LYS D 2 97  ? 9.367   -0.648  111.666 1.00 16.87  ? 97  LYS D N   1 
ATOM   6262 C CA  . LYS D 2 97  ? 8.280   -1.036  110.799 1.00 14.42  ? 97  LYS D CA  1 
ATOM   6263 C C   . LYS D 2 97  ? 8.662   -2.256  110.013 1.00 13.34  ? 97  LYS D C   1 
ATOM   6264 O O   . LYS D 2 97  ? 7.916   -3.215  109.972 1.00 15.64  ? 97  LYS D O   1 
ATOM   6265 C CB  . LYS D 2 97  ? 7.922   0.113   109.881 1.00 16.01  ? 97  LYS D CB  1 
ATOM   6266 C CG  . LYS D 2 97  ? 7.310   1.290   110.596 1.00 15.89  ? 97  LYS D CG  1 
ATOM   6267 C CD  . LYS D 2 97  ? 7.065   2.458   109.678 1.00 18.28  ? 97  LYS D CD  1 
ATOM   6268 C CE  . LYS D 2 97  ? 6.368   3.585   110.440 1.00 17.56  ? 97  LYS D CE  1 
ATOM   6269 N NZ  . LYS D 2 97  ? 6.157   4.808   109.580 1.00 16.21  ? 97  LYS D NZ  1 
ATOM   6270 N N   . ILE D 2 98  ? 9.854   -2.236  109.421 1.00 11.63  ? 98  ILE D N   1 
ATOM   6271 C CA  . ILE D 2 98  ? 10.353  -3.382  108.677 1.00 11.63  ? 98  ILE D CA  1 
ATOM   6272 C C   . ILE D 2 98  ? 10.323  -4.674  109.515 1.00 12.51  ? 98  ILE D C   1 
ATOM   6273 O O   . ILE D 2 98  ? 9.875   -5.717  109.050 1.00 12.06  ? 98  ILE D O   1 
ATOM   6274 C CB  . ILE D 2 98  ? 11.802  -3.109  108.127 1.00 12.43  ? 98  ILE D CB  1 
ATOM   6275 C CG1 . ILE D 2 98  ? 11.781  -1.893  107.196 1.00 8.87   ? 98  ILE D CG1 1 
ATOM   6276 C CG2 . ILE D 2 98  ? 12.352  -4.344  107.377 1.00 9.37   ? 98  ILE D CG2 1 
ATOM   6277 C CD1 . ILE D 2 98  ? 13.129  -1.414  106.801 1.00 10.78  ? 98  ILE D CD1 1 
ATOM   6278 N N   . ARG D 2 99  ? 10.817  -4.595  110.751 1.00 15.52  ? 99  ARG D N   1 
ATOM   6279 C CA  . ARG D 2 99  ? 10.858  -5.743  111.649 1.00 14.42  ? 99  ARG D CA  1 
ATOM   6280 C C   . ARG D 2 99  ? 9.464   -6.273  111.925 1.00 11.89  ? 99  ARG D C   1 
ATOM   6281 O O   . ARG D 2 99  ? 9.264   -7.499  111.870 1.00 10.25  ? 99  ARG D O   1 
ATOM   6282 C CB  . ARG D 2 99  ? 11.531  -5.376  112.968 1.00 15.22  ? 99  ARG D CB  1 
ATOM   6283 C CG  . ARG D 2 99  ? 13.027  -5.444  112.952 1.00 13.07  ? 99  ARG D CG  1 
ATOM   6284 C CD  . ARG D 2 99  ? 13.598  -5.213  114.354 1.00 14.66  ? 99  ARG D CD  1 
ATOM   6285 N NE  . ARG D 2 99  ? 14.968  -5.728  114.483 1.00 16.15  ? 99  ARG D NE  1 
ATOM   6286 C CZ  . ARG D 2 99  ? 15.331  -6.784  115.216 1.00 15.18  ? 99  ARG D CZ  1 
ATOM   6287 N NH1 . ARG D 2 99  ? 14.453  -7.411  116.001 1.00 12.99  ? 99  ARG D NH1 1 
ATOM   6288 N NH2 . ARG D 2 99  ? 16.586  -7.229  115.168 1.00 15.59  ? 99  ARG D NH2 1 
ATOM   6289 N N   . VAL D 2 100 ? 8.519   -5.354  112.184 1.00 9.03   ? 100 VAL D N   1 
ATOM   6290 C CA  . VAL D 2 100 ? 7.121   -5.693  112.457 1.00 11.75  ? 100 VAL D CA  1 
ATOM   6291 C C   . VAL D 2 100 ? 6.500   -6.460  111.273 1.00 11.99  ? 100 VAL D C   1 
ATOM   6292 O O   . VAL D 2 100 ? 5.887   -7.535  111.486 1.00 10.46  ? 100 VAL D O   1 
ATOM   6293 C CB  . VAL D 2 100 ? 6.291   -4.424  112.752 1.00 14.10  ? 100 VAL D CB  1 
ATOM   6294 C CG1 . VAL D 2 100 ? 4.795   -4.728  112.729 1.00 12.52  ? 100 VAL D CG1 1 
ATOM   6295 C CG2 . VAL D 2 100 ? 6.697   -3.862  114.111 1.00 15.97  ? 100 VAL D CG2 1 
ATOM   6296 N N   . ASP D 2 101 ? 6.679   -5.922  110.055 1.00 11.31  ? 101 ASP D N   1 
ATOM   6297 C CA  . ASP D 2 101 ? 6.154   -6.543  108.845 1.00 10.81  ? 101 ASP D CA  1 
ATOM   6298 C C   . ASP D 2 101 ? 6.696   -7.946  108.672 1.00 13.01  ? 101 ASP D C   1 
ATOM   6299 O O   . ASP D 2 101 ? 5.944   -8.875  108.389 1.00 15.26  ? 101 ASP D O   1 
ATOM   6300 C CB  . ASP D 2 101 ? 6.461   -5.698  107.626 1.00 9.17   ? 101 ASP D CB  1 
ATOM   6301 C CG  . ASP D 2 101 ? 5.753   -4.344  107.658 1.00 8.58   ? 101 ASP D CG  1 
ATOM   6302 O OD1 . ASP D 2 101 ? 4.787   -4.127  108.460 1.00 5.25   ? 101 ASP D OD1 1 
ATOM   6303 O OD2 . ASP D 2 101 ? 6.193   -3.472  106.869 1.00 9.03   ? 101 ASP D OD2 1 
ATOM   6304 N N   . ILE D 2 102 ? 8.004   -8.101  108.870 1.00 14.76  ? 102 ILE D N   1 
ATOM   6305 C CA  . ILE D 2 102 ? 8.642   -9.394  108.689 1.00 14.44  ? 102 ILE D CA  1 
ATOM   6306 C C   . ILE D 2 102 ? 8.093   -10.404 109.689 1.00 15.78  ? 102 ILE D C   1 
ATOM   6307 O O   . ILE D 2 102 ? 7.662   -11.503 109.303 1.00 14.68  ? 102 ILE D O   1 
ATOM   6308 C CB  . ILE D 2 102 ? 10.214  -9.297  108.802 1.00 16.20  ? 102 ILE D CB  1 
ATOM   6309 C CG1 . ILE D 2 102 ? 10.766  -8.367  107.705 1.00 15.44  ? 102 ILE D CG1 1 
ATOM   6310 C CG2 . ILE D 2 102 ? 10.859  -10.699 108.650 1.00 9.79   ? 102 ILE D CG2 1 
ATOM   6311 C CD1 . ILE D 2 102 ? 12.232  -8.170  107.738 1.00 15.93  ? 102 ILE D CD1 1 
ATOM   6312 N N   . ILE D 2 103 ? 8.118   -10.039 110.979 1.00 14.71  ? 103 ILE D N   1 
ATOM   6313 C CA  . ILE D 2 103 ? 7.638   -10.933 112.037 1.00 15.27  ? 103 ILE D CA  1 
ATOM   6314 C C   . ILE D 2 103 ? 6.186   -11.339 111.822 1.00 12.87  ? 103 ILE D C   1 
ATOM   6315 O O   . ILE D 2 103 ? 5.850   -12.509 111.962 1.00 9.35   ? 103 ILE D O   1 
ATOM   6316 C CB  . ILE D 2 103 ? 7.799   -10.309 113.459 1.00 16.51  ? 103 ILE D CB  1 
ATOM   6317 C CG1 . ILE D 2 103 ? 9.285   -10.190 113.795 1.00 14.04  ? 103 ILE D CG1 1 
ATOM   6318 C CG2 . ILE D 2 103 ? 7.115   -11.170 114.533 1.00 13.84  ? 103 ILE D CG2 1 
ATOM   6319 C CD1 . ILE D 2 103 ? 10.024  -11.528 113.782 1.00 16.80  ? 103 ILE D CD1 1 
ATOM   6320 N N   . GLU D 2 104 ? 5.343   -10.370 111.464 1.00 12.57  ? 104 GLU D N   1 
ATOM   6321 C CA  . GLU D 2 104 ? 3.936   -10.630 111.193 1.00 12.96  ? 104 GLU D CA  1 
ATOM   6322 C C   . GLU D 2 104 ? 3.762   -11.799 110.223 1.00 12.11  ? 104 GLU D C   1 
ATOM   6323 O O   . GLU D 2 104 ? 3.056   -12.764 110.506 1.00 10.99  ? 104 GLU D O   1 
ATOM   6324 C CB  . GLU D 2 104 ? 3.276   -9.370  110.633 1.00 14.40  ? 104 GLU D CB  1 
ATOM   6325 C CG  . GLU D 2 104 ? 1.825   -9.549  110.252 1.00 14.61  ? 104 GLU D CG  1 
ATOM   6326 C CD  . GLU D 2 104 ? 1.200   -8.298  109.685 1.00 18.92  ? 104 GLU D CD  1 
ATOM   6327 O OE1 . GLU D 2 104 ? 1.529   -7.946  108.538 1.00 22.52  ? 104 GLU D OE1 1 
ATOM   6328 O OE2 . GLU D 2 104 ? 0.382   -7.666  110.384 1.00 21.74  ? 104 GLU D OE2 1 
ATOM   6329 N N   . ASN D 2 105 ? 4.401   -11.705 109.064 1.00 11.04  ? 105 ASN D N   1 
ATOM   6330 C CA  . ASN D 2 105 ? 4.222   -12.722 108.051 1.00 10.48  ? 105 ASN D CA  1 
ATOM   6331 C C   . ASN D 2 105 ? 4.954   -13.992 108.459 1.00 11.32  ? 105 ASN D C   1 
ATOM   6332 O O   . ASN D 2 105 ? 4.483   -15.104 108.200 1.00 10.52  ? 105 ASN D O   1 
ATOM   6333 C CB  . ASN D 2 105 ? 4.675   -12.214 106.682 1.00 9.51   ? 105 ASN D CB  1 
ATOM   6334 C CG  . ASN D 2 105 ? 3.829   -11.068 106.188 1.00 11.70  ? 105 ASN D CG  1 
ATOM   6335 O OD1 . ASN D 2 105 ? 2.745   -11.280 105.664 1.00 12.86  ? 105 ASN D OD1 1 
ATOM   6336 N ND2 . ASN D 2 105 ? 4.313   -9.853  106.371 1.00 10.28  ? 105 ASN D ND2 1 
ATOM   6337 N N   . GLN D 2 106 ? 6.113   -13.829 109.094 1.00 12.73  ? 106 GLN D N   1 
ATOM   6338 C CA  . GLN D 2 106 ? 6.913   -14.981 109.501 1.00 12.67  ? 106 GLN D CA  1 
ATOM   6339 C C   . GLN D 2 106 ? 6.153   -15.886 110.509 1.00 15.91  ? 106 GLN D C   1 
ATOM   6340 O O   . GLN D 2 106 ? 6.144   -17.121 110.333 1.00 15.28  ? 106 GLN D O   1 
ATOM   6341 C CB  . GLN D 2 106 ? 8.253   -14.526 110.089 1.00 9.47   ? 106 GLN D CB  1 
ATOM   6342 C CG  . GLN D 2 106 ? 9.207   -15.640 110.346 1.00 7.65   ? 106 GLN D CG  1 
ATOM   6343 C CD  . GLN D 2 106 ? 9.641   -16.345 109.047 1.00 9.75   ? 106 GLN D CD  1 
ATOM   6344 O OE1 . GLN D 2 106 ? 9.859   -15.692 108.018 1.00 14.34  ? 106 GLN D OE1 1 
ATOM   6345 N NE2 . GLN D 2 106 ? 9.752   -17.678 109.108 1.00 2.00   ? 106 GLN D NE2 1 
ATOM   6346 N N   . VAL D 2 107 ? 5.501   -15.280 111.510 1.00 17.42  ? 107 VAL D N   1 
ATOM   6347 C CA  . VAL D 2 107 ? 4.736   -16.062 112.481 1.00 19.19  ? 107 VAL D CA  1 
ATOM   6348 C C   . VAL D 2 107 ? 3.554   -16.723 111.799 1.00 22.52  ? 107 VAL D C   1 
ATOM   6349 O O   . VAL D 2 107 ? 3.121   -17.793 112.227 1.00 21.71  ? 107 VAL D O   1 
ATOM   6350 C CB  . VAL D 2 107 ? 4.230   -15.235 113.688 1.00 20.01  ? 107 VAL D CB  1 
ATOM   6351 C CG1 . VAL D 2 107 ? 5.399   -14.674 114.473 1.00 20.43  ? 107 VAL D CG1 1 
ATOM   6352 C CG2 . VAL D 2 107 ? 3.296   -14.159 113.253 1.00 23.50  ? 107 VAL D CG2 1 
ATOM   6353 N N   . MET D 2 108 ? 3.061   -16.107 110.733 1.00 25.57  ? 108 MET D N   1 
ATOM   6354 C CA  . MET D 2 108 ? 1.966   -16.661 109.954 1.00 28.52  ? 108 MET D CA  1 
ATOM   6355 C C   . MET D 2 108 ? 2.433   -17.985 109.358 1.00 29.72  ? 108 MET D C   1 
ATOM   6356 O O   . MET D 2 108 ? 1.754   -19.001 109.477 1.00 30.15  ? 108 MET D O   1 
ATOM   6357 C CB  . MET D 2 108 ? 1.527   -15.658 108.880 1.00 31.87  ? 108 MET D CB  1 
ATOM   6358 C CG  . MET D 2 108 ? 0.233   -16.023 108.170 1.00 38.00  ? 108 MET D CG  1 
ATOM   6359 S SD  . MET D 2 108 ? -1.188  -16.195 109.302 1.00 43.52  ? 108 MET D SD  1 
ATOM   6360 C CE  . MET D 2 108 ? -1.681  -14.477 109.457 1.00 42.96  ? 108 MET D CE  1 
ATOM   6361 N N   . ASP D 2 109 ? 3.606   -17.965 108.725 1.00 30.66  ? 109 ASP D N   1 
ATOM   6362 C CA  . ASP D 2 109 ? 4.183   -19.168 108.137 1.00 31.18  ? 109 ASP D CA  1 
ATOM   6363 C C   . ASP D 2 109 ? 4.385   -20.270 109.183 1.00 30.19  ? 109 ASP D C   1 
ATOM   6364 O O   . ASP D 2 109 ? 4.041   -21.449 108.954 1.00 30.13  ? 109 ASP D O   1 
ATOM   6365 C CB  . ASP D 2 109 ? 5.528   -18.841 107.477 1.00 36.43  ? 109 ASP D CB  1 
ATOM   6366 C CG  . ASP D 2 109 ? 5.386   -18.019 106.192 1.00 39.43  ? 109 ASP D CG  1 
ATOM   6367 O OD1 . ASP D 2 109 ? 4.273   -17.518 105.868 1.00 40.84  ? 109 ASP D OD1 1 
ATOM   6368 O OD2 . ASP D 2 109 ? 6.425   -17.893 105.502 1.00 43.29  ? 109 ASP D OD2 1 
ATOM   6369 N N   . PHE D 2 110 ? 4.933   -19.863 110.319 1.00 29.02  ? 110 PHE D N   1 
ATOM   6370 C CA  . PHE D 2 110 ? 5.196   -20.780 111.404 1.00 27.15  ? 110 PHE D CA  1 
ATOM   6371 C C   . PHE D 2 110 ? 3.892   -21.386 111.912 1.00 26.05  ? 110 PHE D C   1 
ATOM   6372 O O   . PHE D 2 110 ? 3.784   -22.617 112.032 1.00 23.87  ? 110 PHE D O   1 
ATOM   6373 C CB  . PHE D 2 110 ? 5.941   -20.056 112.516 1.00 29.07  ? 110 PHE D CB  1 
ATOM   6374 C CG  . PHE D 2 110 ? 6.625   -20.977 113.504 1.00 31.90  ? 110 PHE D CG  1 
ATOM   6375 C CD1 . PHE D 2 110 ? 6.684   -22.371 113.279 1.00 30.37  ? 110 PHE D CD1 1 
ATOM   6376 C CD2 . PHE D 2 110 ? 7.210   -20.453 114.656 1.00 31.11  ? 110 PHE D CD2 1 
ATOM   6377 C CE1 . PHE D 2 110 ? 7.309   -23.213 114.184 1.00 30.97  ? 110 PHE D CE1 1 
ATOM   6378 C CE2 . PHE D 2 110 ? 7.852   -21.301 115.579 1.00 29.46  ? 110 PHE D CE2 1 
ATOM   6379 C CZ  . PHE D 2 110 ? 7.899   -22.679 115.336 1.00 31.32  ? 110 PHE D CZ  1 
ATOM   6380 N N   . ARG D 2 111 ? 2.910   -20.522 112.200 1.00 25.37  ? 111 ARG D N   1 
ATOM   6381 C CA  . ARG D 2 111 ? 1.595   -20.927 112.709 1.00 25.23  ? 111 ARG D CA  1 
ATOM   6382 C C   . ARG D 2 111 ? 0.900   -21.916 111.785 1.00 26.78  ? 111 ARG D C   1 
ATOM   6383 O O   . ARG D 2 111 ? 0.356   -22.922 112.264 1.00 26.30  ? 111 ARG D O   1 
ATOM   6384 C CB  . ARG D 2 111 ? 0.697   -19.713 112.907 1.00 24.03  ? 111 ARG D CB  1 
ATOM   6385 C CG  . ARG D 2 111 ? -0.678  -20.047 113.380 1.00 24.34  ? 111 ARG D CG  1 
ATOM   6386 C CD  . ARG D 2 111 ? -1.565  -18.799 113.438 1.00 25.89  ? 111 ARG D CD  1 
ATOM   6387 N NE  . ARG D 2 111 ? -1.141  -17.876 114.486 1.00 26.28  ? 111 ARG D NE  1 
ATOM   6388 C CZ  . ARG D 2 111 ? -1.005  -16.559 114.328 1.00 27.83  ? 111 ARG D CZ  1 
ATOM   6389 N NH1 . ARG D 2 111 ? -1.324  -15.993 113.155 1.00 27.81  ? 111 ARG D NH1 1 
ATOM   6390 N NH2 . ARG D 2 111 ? -0.547  -15.812 115.337 1.00 25.57  ? 111 ARG D NH2 1 
ATOM   6391 N N   . THR D 2 112 ? 0.967   -21.646 110.479 1.00 29.34  ? 112 THR D N   1 
ATOM   6392 C CA  . THR D 2 112 ? 0.363   -22.496 109.457 1.00 32.23  ? 112 THR D CA  1 
ATOM   6393 C C   . THR D 2 112 ? 0.846   -23.930 109.608 1.00 33.14  ? 112 THR D C   1 
ATOM   6394 O O   . THR D 2 112 ? 0.043   -24.854 109.707 1.00 32.34  ? 112 THR D O   1 
ATOM   6395 C CB  . THR D 2 112 ? 0.680   -21.980 108.037 1.00 33.28  ? 112 THR D CB  1 
ATOM   6396 O OG1 . THR D 2 112 ? 0.121   -20.670 107.869 1.00 37.53  ? 112 THR D OG1 1 
ATOM   6397 C CG2 . THR D 2 112 ? 0.087   -22.906 106.980 1.00 32.45  ? 112 THR D CG2 1 
ATOM   6398 N N   . GLN D 2 113 ? 2.170   -24.110 109.641 1.00 34.23  ? 113 GLN D N   1 
ATOM   6399 C CA  . GLN D 2 113 ? 2.768   -25.437 109.773 1.00 34.89  ? 113 GLN D CA  1 
ATOM   6400 C C   . GLN D 2 113 ? 2.224   -26.153 111.010 1.00 34.50  ? 113 GLN D C   1 
ATOM   6401 O O   . GLN D 2 113 ? 1.876   -27.332 110.960 1.00 36.04  ? 113 GLN D O   1 
ATOM   6402 C CB  . GLN D 2 113 ? 4.298   -25.338 109.845 1.00 34.71  ? 113 GLN D CB  1 
ATOM   6403 C CG  . GLN D 2 113 ? 4.924   -24.803 108.561 1.00 36.89  ? 113 GLN D CG  1 
ATOM   6404 C CD  . GLN D 2 113 ? 6.450   -24.877 108.568 1.00 37.04  ? 113 GLN D CD  1 
ATOM   6405 O OE1 . GLN D 2 113 ? 7.067   -25.448 107.658 1.00 37.04  ? 113 GLN D OE1 1 
ATOM   6406 N NE2 . GLN D 2 113 ? 7.058   -24.313 109.607 1.00 35.35  ? 113 GLN D NE2 1 
ATOM   6407 N N   . LEU D 2 114 ? 2.119   -25.422 112.118 1.00 33.54  ? 114 LEU D N   1 
ATOM   6408 C CA  . LEU D 2 114 ? 1.608   -25.987 113.352 1.00 31.40  ? 114 LEU D CA  1 
ATOM   6409 C C   . LEU D 2 114 ? 0.153   -26.393 113.233 1.00 29.72  ? 114 LEU D C   1 
ATOM   6410 O O   . LEU D 2 114 ? -0.203  -27.516 113.558 1.00 28.47  ? 114 LEU D O   1 
ATOM   6411 C CB  . LEU D 2 114 ? 1.819   -25.023 114.528 1.00 28.75  ? 114 LEU D CB  1 
ATOM   6412 C CG  . LEU D 2 114 ? 1.456   -25.506 115.942 1.00 25.79  ? 114 LEU D CG  1 
ATOM   6413 C CD1 . LEU D 2 114 ? 2.129   -26.845 116.249 1.00 24.69  ? 114 LEU D CD1 1 
ATOM   6414 C CD2 . LEU D 2 114 ? 1.848   -24.444 116.946 1.00 25.97  ? 114 LEU D CD2 1 
ATOM   6415 N N   . ILE D 2 115 ? -0.692  -25.469 112.753 1.00 31.57  ? 115 ILE D N   1 
ATOM   6416 C CA  . ILE D 2 115 ? -2.119  -25.744 112.578 1.00 32.55  ? 115 ILE D CA  1 
ATOM   6417 C C   . ILE D 2 115 ? -2.321  -26.974 111.707 1.00 32.70  ? 115 ILE D C   1 
ATOM   6418 O O   . ILE D 2 115 ? -3.097  -27.857 112.051 1.00 33.17  ? 115 ILE D O   1 
ATOM   6419 C CB  . ILE D 2 115 ? -2.862  -24.556 111.920 1.00 30.09  ? 115 ILE D CB  1 
ATOM   6420 C CG1 . ILE D 2 115 ? -2.820  -23.342 112.850 1.00 28.15  ? 115 ILE D CG1 1 
ATOM   6421 C CG2 . ILE D 2 115 ? -4.310  -24.931 111.620 1.00 29.20  ? 115 ILE D CG2 1 
ATOM   6422 C CD1 . ILE D 2 115 ? -3.509  -22.107 112.288 1.00 28.59  ? 115 ILE D CD1 1 
ATOM   6423 N N   . ARG D 2 116 ? -1.572  -27.026 110.599 1.00 33.80  ? 116 ARG D N   1 
ATOM   6424 C CA  . ARG D 2 116 ? -1.588  -28.144 109.671 1.00 35.48  ? 116 ARG D CA  1 
ATOM   6425 C C   . ARG D 2 116 ? -1.243  -29.424 110.407 1.00 34.58  ? 116 ARG D C   1 
ATOM   6426 O O   . ARG D 2 116 ? -1.968  -30.415 110.314 1.00 33.92  ? 116 ARG D O   1 
ATOM   6427 C CB  . ARG D 2 116 ? -0.571  -27.877 108.565 1.00 35.86  ? 116 ARG D CB  1 
ATOM   6428 C CG  . ARG D 2 116 ? -0.656  -28.798 107.358 1.00 33.50  ? 116 ARG D CG  1 
ATOM   6429 C CD  . ARG D 2 116 ? 0.349   -28.366 106.288 1.00 36.44  ? 116 ARG D CD  1 
ATOM   6430 N NE  . ARG D 2 116 ? 0.226   -26.947 105.942 1.00 39.06  ? 116 ARG D NE  1 
ATOM   6431 C CZ  . ARG D 2 116 ? -0.313  -26.489 104.807 1.00 40.95  ? 116 ARG D CZ  1 
ATOM   6432 N NH1 . ARG D 2 116 ? -0.760  -27.342 103.887 1.00 40.72  ? 116 ARG D NH1 1 
ATOM   6433 N NH2 . ARG D 2 116 ? -0.396  -25.182 104.599 1.00 37.84  ? 116 ARG D NH2 1 
ATOM   6434 N N   . LEU D 2 117 ? -0.135  -29.390 111.141 1.00 36.78  ? 117 LEU D N   1 
ATOM   6435 C CA  . LEU D 2 117 ? 0.332   -30.532 111.919 1.00 39.57  ? 117 LEU D CA  1 
ATOM   6436 C C   . LEU D 2 117 ? -0.688  -30.983 112.989 1.00 39.55  ? 117 LEU D C   1 
ATOM   6437 O O   . LEU D 2 117 ? -0.876  -32.185 113.211 1.00 39.83  ? 117 LEU D O   1 
ATOM   6438 C CB  . LEU D 2 117 ? 1.685   -30.184 112.573 1.00 40.23  ? 117 LEU D CB  1 
ATOM   6439 C CG  . LEU D 2 117 ? 2.498   -31.114 113.502 1.00 40.78  ? 117 LEU D CG  1 
ATOM   6440 C CD1 . LEU D 2 117 ? 1.982   -30.966 114.935 1.00 42.19  ? 117 LEU D CD1 1 
ATOM   6441 C CD2 . LEU D 2 117 ? 2.424   -32.560 113.040 1.00 42.19  ? 117 LEU D CD2 1 
ATOM   6442 N N   . CYS D 2 118 ? -1.325  -30.024 113.669 1.00 39.54  ? 118 CYS D N   1 
ATOM   6443 C CA  . CYS D 2 118 ? -2.268  -30.335 114.736 1.00 40.49  ? 118 CYS D CA  1 
ATOM   6444 C C   . CYS D 2 118 ? -3.640  -30.780 114.249 1.00 40.00  ? 118 CYS D C   1 
ATOM   6445 O O   . CYS D 2 118 ? -4.290  -31.565 114.928 1.00 41.34  ? 118 CYS D O   1 
ATOM   6446 C CB  . CYS D 2 118 ? -2.421  -29.130 115.661 1.00 40.73  ? 118 CYS D CB  1 
ATOM   6447 S SG  . CYS D 2 118 ? -0.924  -28.816 116.646 1.00 42.26  ? 118 CYS D SG  1 
ATOM   6448 N N   . TYR D 2 119 ? -4.087  -30.282 113.092 1.00 39.56  ? 119 TYR D N   1 
ATOM   6449 C CA  . TYR D 2 119 ? -5.403  -30.634 112.564 1.00 39.45  ? 119 TYR D CA  1 
ATOM   6450 C C   . TYR D 2 119 ? -5.378  -31.886 111.681 1.00 39.12  ? 119 TYR D C   1 
ATOM   6451 O O   . TYR D 2 119 ? -6.348  -32.647 111.638 1.00 40.51  ? 119 TYR D O   1 
ATOM   6452 C CB  . TYR D 2 119 ? -5.998  -29.472 111.775 1.00 37.56  ? 119 TYR D CB  1 
ATOM   6453 C CG  . TYR D 2 119 ? -6.781  -28.496 112.610 1.00 37.26  ? 119 TYR D CG  1 
ATOM   6454 C CD1 . TYR D 2 119 ? -6.123  -27.513 113.352 1.00 36.79  ? 119 TYR D CD1 1 
ATOM   6455 C CD2 . TYR D 2 119 ? -8.181  -28.551 112.657 1.00 41.07  ? 119 TYR D CD2 1 
ATOM   6456 C CE1 . TYR D 2 119 ? -6.840  -26.590 114.129 1.00 37.00  ? 119 TYR D CE1 1 
ATOM   6457 C CE2 . TYR D 2 119 ? -8.928  -27.630 113.436 1.00 40.54  ? 119 TYR D CE2 1 
ATOM   6458 C CZ  . TYR D 2 119 ? -8.246  -26.647 114.168 1.00 38.23  ? 119 TYR D CZ  1 
ATOM   6459 O OH  . TYR D 2 119 ? -8.968  -25.739 114.927 1.00 38.46  ? 119 TYR D OH  1 
ATOM   6460 N N   . SER D 2 120 ? -4.253  -32.115 111.000 1.00 40.38  ? 120 SER D N   1 
ATOM   6461 C CA  . SER D 2 120 ? -4.106  -33.273 110.128 1.00 41.05  ? 120 SER D CA  1 
ATOM   6462 C C   . SER D 2 120 ? -4.365  -34.591 110.866 1.00 40.75  ? 120 SER D C   1 
ATOM   6463 O O   . SER D 2 120 ? -4.002  -34.773 112.030 1.00 42.22  ? 120 SER D O   1 
ATOM   6464 C CB  . SER D 2 120 ? -2.692  -33.294 109.536 1.00 37.67  ? 120 SER D CB  1 
ATOM   6465 O OG  . SER D 2 120 ? -2.492  -34.444 108.717 1.00 40.61  ? 120 SER D OG  1 
ATOM   6466 N N   . SER D 2 121 ? -4.974  -35.538 110.152 1.00 41.61  ? 121 SER D N   1 
ATOM   6467 C CA  . SER D 2 121 ? -5.230  -36.861 110.707 1.00 43.43  ? 121 SER D CA  1 
ATOM   6468 C C   . SER D 2 121 ? -3.911  -37.588 110.885 1.00 43.60  ? 121 SER D C   1 
ATOM   6469 O O   . SER D 2 121 ? -3.745  -38.389 111.790 1.00 42.82  ? 121 SER D O   1 
ATOM   6470 C CB  . SER D 2 121 ? -6.133  -37.664 109.762 1.00 43.00  ? 121 SER D CB  1 
ATOM   6471 O OG  . SER D 2 121 ? -5.691  -37.538 108.410 1.00 43.54  ? 121 SER D OG  1 
ATOM   6472 N N   . ASP D 2 122 ? -2.963  -37.269 110.018 1.00 45.87  ? 122 ASP D N   1 
ATOM   6473 C CA  . ASP D 2 122 ? -1.626  -37.840 110.075 1.00 47.91  ? 122 ASP D CA  1 
ATOM   6474 C C   . ASP D 2 122 ? -0.761  -37.205 111.158 1.00 48.59  ? 122 ASP D C   1 
ATOM   6475 O O   . ASP D 2 122 ? 0.449   -37.469 111.205 1.00 49.14  ? 122 ASP D O   1 
ATOM   6476 C CB  . ASP D 2 122 ? -0.936  -37.694 108.719 1.00 51.12  ? 122 ASP D CB  1 
ATOM   6477 C CG  . ASP D 2 122 ? -1.734  -38.324 107.590 1.00 56.30  ? 122 ASP D CG  1 
ATOM   6478 O OD1 . ASP D 2 122 ? -1.976  -39.563 107.647 1.00 58.84  ? 122 ASP D OD1 1 
ATOM   6479 O OD2 . ASP D 2 122 ? -2.136  -37.569 106.667 1.00 57.84  ? 122 ASP D OD2 1 
ATOM   6480 N N   . HIS D 2 123 ? -1.393  -36.386 112.004 1.00 46.68  ? 123 HIS D N   1 
ATOM   6481 C CA  . HIS D 2 123 ? -0.731  -35.664 113.098 1.00 45.81  ? 123 HIS D CA  1 
ATOM   6482 C C   . HIS D 2 123 ? 0.400   -36.441 113.755 1.00 44.88  ? 123 HIS D C   1 
ATOM   6483 O O   . HIS D 2 123 ? 1.477   -35.882 114.014 1.00 45.43  ? 123 HIS D O   1 
ATOM   6484 C CB  . HIS D 2 123 ? -1.768  -35.258 114.156 1.00 46.67  ? 123 HIS D CB  1 
ATOM   6485 C CG  . HIS D 2 123 ? -1.184  -34.694 115.400 1.00 47.38  ? 123 HIS D CG  1 
ATOM   6486 N ND1 . HIS D 2 123 ? -0.326  -33.592 115.405 1.00 47.86  ? 123 HIS D ND1 1 
ATOM   6487 C CD2 . HIS D 2 123 ? -1.301  -35.052 116.700 1.00 46.28  ? 123 HIS D CD2 1 
ATOM   6488 C CE1 . HIS D 2 123 ? 0.048   -33.331 116.623 1.00 46.45  ? 123 HIS D CE1 1 
ATOM   6489 N NE2 . HIS D 2 123 ? -0.530  -34.202 117.453 1.00 46.31  ? 123 HIS D NE2 1 
ATOM   6490 N N   . GLU D 2 124 ? 0.168   -37.727 114.005 1.00 44.56  ? 124 GLU D N   1 
ATOM   6491 C CA  . GLU D 2 124 ? 1.152   -38.563 114.665 1.00 44.99  ? 124 GLU D CA  1 
ATOM   6492 C C   . GLU D 2 124 ? 2.393   -38.787 113.795 1.00 44.75  ? 124 GLU D C   1 
ATOM   6493 O O   . GLU D 2 124 ? 3.508   -38.463 114.210 1.00 44.81  ? 124 GLU D O   1 
ATOM   6494 C CB  . GLU D 2 124 ? 0.541   -39.900 115.100 1.00 44.67  ? 124 GLU D CB  1 
ATOM   6495 C CG  . GLU D 2 124 ? 1.476   -40.745 115.989 1.00 48.82  ? 124 GLU D CG  1 
ATOM   6496 C CD  . GLU D 2 124 ? 2.096   -39.945 117.149 1.00 51.70  ? 124 GLU D CD  1 
ATOM   6497 O OE1 . GLU D 2 124 ? 1.327   -39.459 118.021 1.00 52.58  ? 124 GLU D OE1 1 
ATOM   6498 O OE2 . GLU D 2 124 ? 3.350   -39.809 117.173 1.00 52.30  ? 124 GLU D OE2 1 
ATOM   6499 N N   . LYS D 2 125 ? 2.210   -39.332 112.590 1.00 44.37  ? 125 LYS D N   1 
ATOM   6500 C CA  . LYS D 2 125 ? 3.343   -39.645 111.731 1.00 43.58  ? 125 LYS D CA  1 
ATOM   6501 C C   . LYS D 2 125 ? 4.097   -38.380 111.308 1.00 43.48  ? 125 LYS D C   1 
ATOM   6502 O O   . LYS D 2 125 ? 5.317   -38.422 111.073 1.00 43.66  ? 125 LYS D O   1 
ATOM   6503 C CB  . LYS D 2 125 ? 2.897   -40.428 110.500 1.00 43.26  ? 125 LYS D CB  1 
ATOM   6504 C CG  . LYS D 2 125 ? 1.766   -39.798 109.712 1.00 44.15  ? 125 LYS D CG  1 
ATOM   6505 C CD  . LYS D 2 125 ? 0.941   -40.852 108.970 1.00 45.25  ? 125 LYS D CD  1 
ATOM   6506 C CE  . LYS D 2 125 ? 0.178   -41.771 109.935 1.00 45.21  ? 125 LYS D CE  1 
ATOM   6507 N NZ  . LYS D 2 125 ? -0.707  -41.004 110.893 1.00 42.43  ? 125 LYS D NZ  1 
ATOM   6508 N N   . LEU D 2 126 ? 3.374   -37.264 111.215 1.00 42.23  ? 126 LEU D N   1 
ATOM   6509 C CA  . LEU D 2 126 ? 3.965   -35.982 110.840 1.00 41.80  ? 126 LEU D CA  1 
ATOM   6510 C C   . LEU D 2 126 ? 4.673   -35.314 112.023 1.00 42.38  ? 126 LEU D C   1 
ATOM   6511 O O   . LEU D 2 126 ? 5.631   -34.542 111.821 1.00 42.87  ? 126 LEU D O   1 
ATOM   6512 C CB  . LEU D 2 126 ? 2.893   -35.055 110.251 1.00 38.84  ? 126 LEU D CB  1 
ATOM   6513 C CG  . LEU D 2 126 ? 2.672   -35.100 108.719 1.00 39.83  ? 126 LEU D CG  1 
ATOM   6514 C CD1 . LEU D 2 126 ? 2.526   -36.549 108.217 1.00 40.03  ? 126 LEU D CD1 1 
ATOM   6515 C CD2 . LEU D 2 126 ? 1.403   -34.314 108.375 1.00 35.84  ? 126 LEU D CD2 1 
ATOM   6516 N N   . LYS D 2 127 ? 4.202   -35.626 113.233 1.00 41.79  ? 127 LYS D N   1 
ATOM   6517 C CA  . LYS D 2 127 ? 4.745   -35.067 114.470 1.00 41.48  ? 127 LYS D CA  1 
ATOM   6518 C C   . LYS D 2 127 ? 6.291   -35.044 114.525 1.00 39.74  ? 127 LYS D C   1 
ATOM   6519 O O   . LYS D 2 127 ? 6.878   -33.985 114.751 1.00 41.43  ? 127 LYS D O   1 
ATOM   6520 C CB  . LYS D 2 127 ? 4.157   -35.800 115.679 1.00 44.14  ? 127 LYS D CB  1 
ATOM   6521 C CG  . LYS D 2 127 ? 4.560   -35.260 117.015 1.00 45.72  ? 127 LYS D CG  1 
ATOM   6522 C CD  . LYS D 2 127 ? 3.984   -36.112 118.132 1.00 50.25  ? 127 LYS D CD  1 
ATOM   6523 C CE  . LYS D 2 127 ? 4.281   -35.510 119.517 1.00 52.83  ? 127 LYS D CE  1 
ATOM   6524 N NZ  . LYS D 2 127 ? 5.747   -35.374 119.783 1.00 53.84  ? 127 LYS D NZ  1 
ATOM   6525 N N   . PRO D 2 128 ? 6.972   -36.217 114.322 1.00 39.21  ? 128 PRO D N   1 
ATOM   6526 C CA  . PRO D 2 128 ? 8.434   -36.220 114.348 1.00 38.93  ? 128 PRO D CA  1 
ATOM   6527 C C   . PRO D 2 128 ? 9.088   -35.248 113.377 1.00 40.22  ? 128 PRO D C   1 
ATOM   6528 O O   . PRO D 2 128 ? 10.082  -34.584 113.720 1.00 40.40  ? 128 PRO D O   1 
ATOM   6529 C CB  . PRO D 2 128 ? 8.768   -37.683 114.019 1.00 36.98  ? 128 PRO D CB  1 
ATOM   6530 C CG  . PRO D 2 128 ? 7.590   -38.429 114.498 1.00 39.20  ? 128 PRO D CG  1 
ATOM   6531 C CD  . PRO D 2 128 ? 6.449   -37.573 114.103 1.00 39.66  ? 128 PRO D CD  1 
ATOM   6532 N N   . GLN D 2 129 ? 8.516   -35.128 112.185 1.00 41.10  ? 129 GLN D N   1 
ATOM   6533 C CA  . GLN D 2 129 ? 9.048   -34.230 111.173 1.00 40.74  ? 129 GLN D CA  1 
ATOM   6534 C C   . GLN D 2 129 ? 9.038   -32.791 111.666 1.00 40.81  ? 129 GLN D C   1 
ATOM   6535 O O   . GLN D 2 129 ? 10.057  -32.098 111.604 1.00 42.60  ? 129 GLN D O   1 
ATOM   6536 C CB  . GLN D 2 129 ? 8.245   -34.336 109.877 1.00 41.53  ? 129 GLN D CB  1 
ATOM   6537 C CG  . GLN D 2 129 ? 8.082   -35.777 109.344 1.00 42.60  ? 129 GLN D CG  1 
ATOM   6538 C CD  . GLN D 2 129 ? 9.409   -36.530 109.269 1.00 41.69  ? 129 GLN D CD  1 
ATOM   6539 O OE1 . GLN D 2 129 ? 10.376  -36.085 108.605 1.00 41.93  ? 129 GLN D OE1 1 
ATOM   6540 N NE2 . GLN D 2 129 ? 9.471   -37.680 109.954 1.00 40.53  ? 129 GLN D NE2 1 
ATOM   6541 N N   . TYR D 2 130 ? 7.886   -32.363 112.184 1.00 38.33  ? 130 TYR D N   1 
ATOM   6542 C CA  . TYR D 2 130 ? 7.747   -31.017 112.725 1.00 37.01  ? 130 TYR D CA  1 
ATOM   6543 C C   . TYR D 2 130 ? 8.827   -30.795 113.790 1.00 37.79  ? 130 TYR D C   1 
ATOM   6544 O O   . TYR D 2 130 ? 9.511   -29.753 113.790 1.00 38.22  ? 130 TYR D O   1 
ATOM   6545 C CB  . TYR D 2 130 ? 6.353   -30.835 113.338 1.00 35.17  ? 130 TYR D CB  1 
ATOM   6546 C CG  . TYR D 2 130 ? 6.074   -29.441 113.828 1.00 32.77  ? 130 TYR D CG  1 
ATOM   6547 C CD1 . TYR D 2 130 ? 5.920   -28.376 112.915 1.00 31.77  ? 130 TYR D CD1 1 
ATOM   6548 C CD2 . TYR D 2 130 ? 5.949   -29.174 115.206 1.00 31.39  ? 130 TYR D CD2 1 
ATOM   6549 C CE1 . TYR D 2 130 ? 5.648   -27.059 113.359 1.00 30.31  ? 130 TYR D CE1 1 
ATOM   6550 C CE2 . TYR D 2 130 ? 5.681   -27.864 115.671 1.00 30.88  ? 130 TYR D CE2 1 
ATOM   6551 C CZ  . TYR D 2 130 ? 5.532   -26.814 114.735 1.00 29.56  ? 130 TYR D CZ  1 
ATOM   6552 O OH  . TYR D 2 130 ? 5.259   -25.523 115.148 1.00 31.07  ? 130 TYR D OH  1 
ATOM   6553 N N   . LEU D 2 131 ? 8.969   -31.768 114.694 1.00 37.78  ? 131 LEU D N   1 
ATOM   6554 C CA  . LEU D 2 131 ? 9.922   -31.672 115.791 1.00 39.29  ? 131 LEU D CA  1 
ATOM   6555 C C   . LEU D 2 131 ? 11.366  -31.561 115.302 1.00 40.20  ? 131 LEU D C   1 
ATOM   6556 O O   . LEU D 2 131 ? 12.147  -30.774 115.850 1.00 40.60  ? 131 LEU D O   1 
ATOM   6557 C CB  . LEU D 2 131 ? 9.759   -32.847 116.754 1.00 37.28  ? 131 LEU D CB  1 
ATOM   6558 C CG  . LEU D 2 131 ? 8.414   -32.907 117.479 1.00 39.20  ? 131 LEU D CG  1 
ATOM   6559 C CD1 . LEU D 2 131 ? 8.384   -34.147 118.338 1.00 38.86  ? 131 LEU D CD1 1 
ATOM   6560 C CD2 . LEU D 2 131 ? 8.188   -31.643 118.308 1.00 37.88  ? 131 LEU D CD2 1 
ATOM   6561 N N   . GLU D 2 132 ? 11.719  -32.324 114.267 1.00 40.45  ? 132 GLU D N   1 
ATOM   6562 C CA  . GLU D 2 132 ? 13.090  -32.325 113.778 1.00 42.35  ? 132 GLU D CA  1 
ATOM   6563 C C   . GLU D 2 132 ? 13.435  -31.050 113.009 1.00 41.09  ? 132 GLU D C   1 
ATOM   6564 O O   . GLU D 2 132 ? 14.605  -30.761 112.737 1.00 43.00  ? 132 GLU D O   1 
ATOM   6565 C CB  . GLU D 2 132 ? 13.369  -33.564 112.923 1.00 43.33  ? 132 GLU D CB  1 
ATOM   6566 C CG  . GLU D 2 132 ? 12.561  -33.658 111.652 1.00 45.06  ? 132 GLU D CG  1 
ATOM   6567 C CD  . GLU D 2 132 ? 12.834  -34.939 110.856 1.00 46.53  ? 132 GLU D CD  1 
ATOM   6568 O OE1 . GLU D 2 132 ? 12.228  -36.002 111.177 1.00 47.71  ? 132 GLU D OE1 1 
ATOM   6569 O OE2 . GLU D 2 132 ? 13.655  -34.868 109.904 1.00 43.93  ? 132 GLU D OE2 1 
ATOM   6570 N N   . GLU D 2 133 ? 12.406  -30.285 112.654 1.00 38.86  ? 133 GLU D N   1 
ATOM   6571 C CA  . GLU D 2 133 ? 12.619  -29.028 111.958 1.00 36.57  ? 133 GLU D CA  1 
ATOM   6572 C C   . GLU D 2 133 ? 12.394  -27.814 112.877 1.00 32.66  ? 133 GLU D C   1 
ATOM   6573 O O   . GLU D 2 133 ? 12.792  -26.673 112.543 1.00 31.52  ? 133 GLU D O   1 
ATOM   6574 C CB  . GLU D 2 133 ? 11.699  -28.969 110.742 1.00 39.92  ? 133 GLU D CB  1 
ATOM   6575 C CG  . GLU D 2 133 ? 11.930  -30.101 109.765 1.00 43.31  ? 133 GLU D CG  1 
ATOM   6576 C CD  . GLU D 2 133 ? 10.845  -30.187 108.718 1.00 45.91  ? 133 GLU D CD  1 
ATOM   6577 O OE1 . GLU D 2 133 ? 10.846  -29.320 107.810 1.00 46.25  ? 133 GLU D OE1 1 
ATOM   6578 O OE2 . GLU D 2 133 ? 9.997   -31.114 108.800 1.00 46.59  ? 133 GLU D OE2 1 
ATOM   6579 N N   . LEU D 2 134 ? 11.758  -28.080 114.015 1.00 28.90  ? 134 LEU D N   1 
ATOM   6580 C CA  . LEU D 2 134 ? 11.433  -27.065 115.008 1.00 24.81  ? 134 LEU D CA  1 
ATOM   6581 C C   . LEU D 2 134 ? 12.615  -26.249 115.525 1.00 23.00  ? 134 LEU D C   1 
ATOM   6582 O O   . LEU D 2 134 ? 12.585  -25.031 115.478 1.00 22.81  ? 134 LEU D O   1 
ATOM   6583 C CB  . LEU D 2 134 ? 10.642  -27.677 116.167 1.00 23.05  ? 134 LEU D CB  1 
ATOM   6584 C CG  . LEU D 2 134 ? 9.889   -26.708 117.082 1.00 20.39  ? 134 LEU D CG  1 
ATOM   6585 C CD1 . LEU D 2 134 ? 8.895   -25.928 116.255 1.00 17.63  ? 134 LEU D CD1 1 
ATOM   6586 C CD2 . LEU D 2 134 ? 9.217   -27.479 118.210 1.00 17.05  ? 134 LEU D CD2 1 
ATOM   6587 N N   . PRO D 2 135 ? 13.691  -26.916 116.022 1.00 19.95  ? 135 PRO D N   1 
ATOM   6588 C CA  . PRO D 2 135 ? 14.847  -26.175 116.517 1.00 21.92  ? 135 PRO D CA  1 
ATOM   6589 C C   . PRO D 2 135 ? 15.401  -25.098 115.570 1.00 22.87  ? 135 PRO D C   1 
ATOM   6590 O O   . PRO D 2 135 ? 15.769  -23.997 116.020 1.00 22.77  ? 135 PRO D O   1 
ATOM   6591 C CB  . PRO D 2 135 ? 15.872  -27.296 116.773 1.00 21.09  ? 135 PRO D CB  1 
ATOM   6592 C CG  . PRO D 2 135 ? 15.044  -28.467 117.052 1.00 20.49  ? 135 PRO D CG  1 
ATOM   6593 C CD  . PRO D 2 135 ? 13.903  -28.362 116.101 1.00 18.87  ? 135 PRO D CD  1 
ATOM   6594 N N   . GLY D 2 136 ? 15.432  -25.402 114.279 1.00 24.48  ? 136 GLY D N   1 
ATOM   6595 C CA  . GLY D 2 136 ? 15.920  -24.454 113.288 1.00 25.00  ? 136 GLY D CA  1 
ATOM   6596 C C   . GLY D 2 136 ? 15.109  -23.170 113.275 1.00 26.50  ? 136 GLY D C   1 
ATOM   6597 O O   . GLY D 2 136 ? 15.664  -22.063 113.273 1.00 24.56  ? 136 GLY D O   1 
ATOM   6598 N N   . GLN D 2 137 ? 13.787  -23.316 113.267 1.00 27.00  ? 137 GLN D N   1 
ATOM   6599 C CA  . GLN D 2 137 ? 12.894  -22.171 113.235 1.00 27.34  ? 137 GLN D CA  1 
ATOM   6600 C C   . GLN D 2 137 ? 13.077  -21.339 114.485 1.00 25.53  ? 137 GLN D C   1 
ATOM   6601 O O   . GLN D 2 137 ? 13.203  -20.114 114.375 1.00 24.60  ? 137 GLN D O   1 
ATOM   6602 C CB  . GLN D 2 137 ? 11.437  -22.614 113.129 1.00 33.01  ? 137 GLN D CB  1 
ATOM   6603 C CG  . GLN D 2 137 ? 10.462  -21.476 112.825 1.00 38.91  ? 137 GLN D CG  1 
ATOM   6604 C CD  . GLN D 2 137 ? 10.708  -20.817 111.461 1.00 38.93  ? 137 GLN D CD  1 
ATOM   6605 O OE1 . GLN D 2 137 ? 11.246  -19.721 111.376 1.00 42.33  ? 137 GLN D OE1 1 
ATOM   6606 N NE2 . GLN D 2 137 ? 10.315  -21.494 110.401 1.00 37.66  ? 137 GLN D NE2 1 
ATOM   6607 N N   . LEU D 2 138 ? 13.098  -21.999 115.650 1.00 23.81  ? 138 LEU D N   1 
ATOM   6608 C CA  . LEU D 2 138 ? 13.301  -21.311 116.926 1.00 22.04  ? 138 LEU D CA  1 
ATOM   6609 C C   . LEU D 2 138 ? 14.666  -20.584 116.939 1.00 21.41  ? 138 LEU D C   1 
ATOM   6610 O O   . LEU D 2 138 ? 14.785  -19.422 117.376 1.00 19.85  ? 138 LEU D O   1 
ATOM   6611 C CB  . LEU D 2 138 ? 13.221  -22.318 118.077 1.00 25.38  ? 138 LEU D CB  1 
ATOM   6612 C CG  . LEU D 2 138 ? 11.848  -22.708 118.649 1.00 26.26  ? 138 LEU D CG  1 
ATOM   6613 C CD1 . LEU D 2 138 ? 11.136  -21.504 119.170 1.00 27.62  ? 138 LEU D CD1 1 
ATOM   6614 C CD2 . LEU D 2 138 ? 11.007  -23.354 117.598 1.00 32.55  ? 138 LEU D CD2 1 
ATOM   6615 N N   . LYS D 2 139 ? 15.678  -21.269 116.400 1.00 19.61  ? 139 LYS D N   1 
ATOM   6616 C CA  . LYS D 2 139 ? 17.023  -20.724 116.250 1.00 18.00  ? 139 LYS D CA  1 
ATOM   6617 C C   . LYS D 2 139 ? 17.022  -19.372 115.562 1.00 17.07  ? 139 LYS D C   1 
ATOM   6618 O O   . LYS D 2 139 ? 17.682  -18.462 116.031 1.00 18.49  ? 139 LYS D O   1 
ATOM   6619 C CB  . LYS D 2 139 ? 17.880  -21.705 115.460 1.00 23.55  ? 139 LYS D CB  1 
ATOM   6620 C CG  . LYS D 2 139 ? 19.318  -21.315 115.270 1.00 26.29  ? 139 LYS D CG  1 
ATOM   6621 C CD  . LYS D 2 139 ? 20.014  -22.371 114.423 1.00 28.85  ? 139 LYS D CD  1 
ATOM   6622 C CE  . LYS D 2 139 ? 21.506  -22.073 114.255 1.00 30.30  ? 139 LYS D CE  1 
ATOM   6623 N NZ  . LYS D 2 139 ? 22.190  -23.079 113.384 1.00 26.55  ? 139 LYS D NZ  1 
ATOM   6624 N N   . GLN D 2 140 ? 16.270  -19.265 114.470 1.00 14.48  ? 140 GLN D N   1 
ATOM   6625 C CA  . GLN D 2 140 ? 16.139  -18.030 113.715 1.00 12.66  ? 140 GLN D CA  1 
ATOM   6626 C C   . GLN D 2 140 ? 15.471  -16.917 114.488 1.00 11.67  ? 140 GLN D C   1 
ATOM   6627 O O   . GLN D 2 140 ? 15.886  -15.771 114.381 1.00 11.94  ? 140 GLN D O   1 
ATOM   6628 C CB  . GLN D 2 140 ? 15.335  -18.277 112.458 1.00 16.19  ? 140 GLN D CB  1 
ATOM   6629 C CG  . GLN D 2 140 ? 15.973  -19.245 111.472 1.00 19.02  ? 140 GLN D CG  1 
ATOM   6630 C CD  . GLN D 2 140 ? 15.273  -19.232 110.116 1.00 20.20  ? 140 GLN D CD  1 
ATOM   6631 O OE1 . GLN D 2 140 ? 15.912  -19.149 109.065 1.00 24.84  ? 140 GLN D OE1 1 
ATOM   6632 N NE2 . GLN D 2 140 ? 13.955  -19.326 110.145 1.00 24.69  ? 140 GLN D NE2 1 
ATOM   6633 N N   . PHE D 2 141 ? 14.467  -17.258 115.293 1.00 12.83  ? 141 PHE D N   1 
ATOM   6634 C CA  . PHE D 2 141 ? 13.780  -16.260 116.112 1.00 15.28  ? 141 PHE D CA  1 
ATOM   6635 C C   . PHE D 2 141 ? 14.719  -15.699 117.173 1.00 14.17  ? 141 PHE D C   1 
ATOM   6636 O O   . PHE D 2 141 ? 14.771  -14.481 117.400 1.00 10.66  ? 141 PHE D O   1 
ATOM   6637 C CB  . PHE D 2 141 ? 12.538  -16.875 116.769 1.00 19.42  ? 141 PHE D CB  1 
ATOM   6638 C CG  . PHE D 2 141 ? 11.306  -16.821 115.906 1.00 22.83  ? 141 PHE D CG  1 
ATOM   6639 C CD1 . PHE D 2 141 ? 10.476  -15.682 115.907 1.00 23.74  ? 141 PHE D CD1 1 
ATOM   6640 C CD2 . PHE D 2 141 ? 11.000  -17.893 115.058 1.00 24.82  ? 141 PHE D CD2 1 
ATOM   6641 C CE1 . PHE D 2 141 ? 9.357   -15.616 115.082 1.00 20.24  ? 141 PHE D CE1 1 
ATOM   6642 C CE2 . PHE D 2 141 ? 9.878   -17.840 114.213 1.00 23.64  ? 141 PHE D CE2 1 
ATOM   6643 C CZ  . PHE D 2 141 ? 9.054   -16.699 114.228 1.00 23.68  ? 141 PHE D CZ  1 
ATOM   6644 N N   . SER D 2 142 ? 15.479  -16.593 117.808 1.00 12.41  ? 142 SER D N   1 
ATOM   6645 C CA  . SER D 2 142 ? 16.469  -16.195 118.810 1.00 12.14  ? 142 SER D CA  1 
ATOM   6646 C C   . SER D 2 142 ? 17.516  -15.255 118.190 1.00 11.47  ? 142 SER D C   1 
ATOM   6647 O O   . SER D 2 142 ? 17.807  -14.192 118.735 1.00 10.81  ? 142 SER D O   1 
ATOM   6648 C CB  . SER D 2 142 ? 17.149  -17.427 119.399 1.00 11.37  ? 142 SER D CB  1 
ATOM   6649 O OG  . SER D 2 142 ? 17.722  -17.112 120.646 1.00 16.05  ? 142 SER D OG  1 
ATOM   6650 N N   . MET D 2 143 ? 18.040  -15.656 117.034 1.00 11.19  ? 143 MET D N   1 
ATOM   6651 C CA  . MET D 2 143 ? 19.026  -14.896 116.297 1.00 11.68  ? 143 MET D CA  1 
ATOM   6652 C C   . MET D 2 143 ? 18.459  -13.511 115.963 1.00 10.55  ? 143 MET D C   1 
ATOM   6653 O O   . MET D 2 143 ? 19.163  -12.498 116.097 1.00 11.86  ? 143 MET D O   1 
ATOM   6654 C CB  . MET D 2 143 ? 19.441  -15.702 115.058 1.00 14.79  ? 143 MET D CB  1 
ATOM   6655 C CG  . MET D 2 143 ? 20.132  -14.881 113.963 1.00 22.52  ? 143 MET D CG  1 
ATOM   6656 S SD  . MET D 2 143 ? 18.939  -13.975 112.666 1.00 23.48  ? 143 MET D SD  1 
ATOM   6657 C CE  . MET D 2 143 ? 19.762  -12.341 112.728 1.00 26.01  ? 143 MET D CE  1 
ATOM   6658 N N   . PHE D 2 144 ? 17.210  -13.472 115.495 1.00 8.85   ? 144 PHE D N   1 
ATOM   6659 C CA  . PHE D 2 144 ? 16.569  -12.221 115.103 1.00 7.22   ? 144 PHE D CA  1 
ATOM   6660 C C   . PHE D 2 144 ? 16.218  -11.284 116.281 1.00 8.19   ? 144 PHE D C   1 
ATOM   6661 O O   . PHE D 2 144 ? 16.281  -10.044 116.148 1.00 8.22   ? 144 PHE D O   1 
ATOM   6662 C CB  . PHE D 2 144 ? 15.307  -12.515 114.312 1.00 6.78   ? 144 PHE D CB  1 
ATOM   6663 C CG  . PHE D 2 144 ? 14.582  -11.278 113.853 1.00 4.85   ? 144 PHE D CG  1 
ATOM   6664 C CD1 . PHE D 2 144 ? 15.029  -10.598 112.703 1.00 4.10   ? 144 PHE D CD1 1 
ATOM   6665 C CD2 . PHE D 2 144 ? 13.465  -10.774 114.564 1.00 2.56   ? 144 PHE D CD2 1 
ATOM   6666 C CE1 . PHE D 2 144 ? 14.375  -9.429  112.248 1.00 2.84   ? 144 PHE D CE1 1 
ATOM   6667 C CE2 . PHE D 2 144 ? 12.810  -9.592  114.128 1.00 3.18   ? 144 PHE D CE2 1 
ATOM   6668 C CZ  . PHE D 2 144 ? 13.268  -8.921  112.958 1.00 3.87   ? 144 PHE D CZ  1 
ATOM   6669 N N   . LEU D 2 145 ? 15.867  -11.860 117.432 1.00 8.00   ? 145 LEU D N   1 
ATOM   6670 C CA  . LEU D 2 145 ? 15.595  -11.054 118.625 1.00 7.04   ? 145 LEU D CA  1 
ATOM   6671 C C   . LEU D 2 145 ? 16.924  -10.440 119.165 1.00 9.74   ? 145 LEU D C   1 
ATOM   6672 O O   . LEU D 2 145 ? 16.995  -9.221  119.483 1.00 8.79   ? 145 LEU D O   1 
ATOM   6673 C CB  . LEU D 2 145 ? 14.925  -11.908 119.711 1.00 5.14   ? 145 LEU D CB  1 
ATOM   6674 C CG  . LEU D 2 145 ? 14.579  -11.206 121.018 1.00 2.00   ? 145 LEU D CG  1 
ATOM   6675 C CD1 . LEU D 2 145 ? 13.861  -9.923  120.743 1.00 9.41   ? 145 LEU D CD1 1 
ATOM   6676 C CD2 . LEU D 2 145 ? 13.737  -12.118 121.852 1.00 2.00   ? 145 LEU D CD2 1 
ATOM   6677 N N   . GLY D 2 146 ? 17.959  -11.285 119.269 1.00 6.14   ? 146 GLY D N   1 
ATOM   6678 C CA  . GLY D 2 146 ? 19.254  -10.819 119.743 1.00 8.21   ? 146 GLY D CA  1 
ATOM   6679 C C   . GLY D 2 146 ? 19.201  -10.310 121.168 1.00 11.09  ? 146 GLY D C   1 
ATOM   6680 O O   . GLY D 2 146 ? 18.693  -10.985 122.069 1.00 9.38   ? 146 GLY D O   1 
ATOM   6681 N N   . LYS D 2 147 ? 19.729  -9.108  121.378 1.00 13.09  ? 147 LYS D N   1 
ATOM   6682 C CA  . LYS D 2 147 ? 19.808  -8.489  122.707 1.00 16.12  ? 147 LYS D CA  1 
ATOM   6683 C C   . LYS D 2 147 ? 18.673  -7.470  122.921 1.00 15.72  ? 147 LYS D C   1 
ATOM   6684 O O   . LYS D 2 147 ? 18.704  -6.683  123.863 1.00 14.67  ? 147 LYS D O   1 
ATOM   6685 C CB  . LYS D 2 147 ? 21.168  -7.783  122.890 1.00 20.40  ? 147 LYS D CB  1 
ATOM   6686 C CG  . LYS D 2 147 ? 22.344  -8.714  122.957 1.00 29.78  ? 147 LYS D CG  1 
ATOM   6687 C CD  . LYS D 2 147 ? 22.242  -9.701  124.151 1.00 35.59  ? 147 LYS D CD  1 
ATOM   6688 C CE  . LYS D 2 147 ? 23.533  -10.536 124.310 1.00 38.26  ? 147 LYS D CE  1 
ATOM   6689 N NZ  . LYS D 2 147 ? 23.814  -11.407 123.114 1.00 39.99  ? 147 LYS D NZ  1 
ATOM   6690 N N   . PHE D 2 148 ? 17.669  -7.474  122.051 1.00 14.99  ? 148 PHE D N   1 
ATOM   6691 C CA  . PHE D 2 148 ? 16.574  -6.513  122.173 1.00 15.07  ? 148 PHE D CA  1 
ATOM   6692 C C   . PHE D 2 148 ? 15.597  -7.012  123.239 1.00 14.02  ? 148 PHE D C   1 
ATOM   6693 O O   . PHE D 2 148 ? 15.561  -8.223  123.551 1.00 12.65  ? 148 PHE D O   1 
ATOM   6694 C CB  . PHE D 2 148 ? 15.852  -6.339  120.826 1.00 16.00  ? 148 PHE D CB  1 
ATOM   6695 C CG  . PHE D 2 148 ? 16.629  -5.565  119.822 1.00 14.32  ? 148 PHE D CG  1 
ATOM   6696 C CD1 . PHE D 2 148 ? 16.929  -4.221  120.049 1.00 14.17  ? 148 PHE D CD1 1 
ATOM   6697 C CD2 . PHE D 2 148 ? 17.076  -6.183  118.650 1.00 13.79  ? 148 PHE D CD2 1 
ATOM   6698 C CE1 . PHE D 2 148 ? 17.674  -3.481  119.096 1.00 14.36  ? 148 PHE D CE1 1 
ATOM   6699 C CE2 . PHE D 2 148 ? 17.820  -5.469  117.699 1.00 12.68  ? 148 PHE D CE2 1 
ATOM   6700 C CZ  . PHE D 2 148 ? 18.121  -4.105  117.923 1.00 13.08  ? 148 PHE D CZ  1 
ATOM   6701 N N   . SER D 2 149 ? 14.793  -6.091  123.771 1.00 13.46  ? 149 SER D N   1 
ATOM   6702 C CA  . SER D 2 149 ? 13.776  -6.425  124.761 1.00 16.33  ? 149 SER D CA  1 
ATOM   6703 C C   . SER D 2 149 ? 12.547  -7.003  124.086 1.00 16.99  ? 149 SER D C   1 
ATOM   6704 O O   . SER D 2 149 ? 11.887  -7.891  124.625 1.00 18.01  ? 149 SER D O   1 
ATOM   6705 C CB  . SER D 2 149 ? 13.382  -5.181  125.540 1.00 15.89  ? 149 SER D CB  1 
ATOM   6706 O OG  . SER D 2 149 ? 14.541  -4.504  125.987 1.00 20.62  ? 149 SER D OG  1 
ATOM   6707 N N   . TRP D 2 150 ? 12.269  -6.495  122.893 1.00 17.40  ? 150 TRP D N   1 
ATOM   6708 C CA  . TRP D 2 150 ? 11.111  -6.906  122.104 1.00 12.14  ? 150 TRP D CA  1 
ATOM   6709 C C   . TRP D 2 150 ? 11.565  -7.126  120.670 1.00 12.20  ? 150 TRP D C   1 
ATOM   6710 O O   . TRP D 2 150 ? 12.675  -6.648  120.310 1.00 12.44  ? 150 TRP D O   1 
ATOM   6711 C CB  . TRP D 2 150 ? 10.030  -5.825  122.133 1.00 13.17  ? 150 TRP D CB  1 
ATOM   6712 C CG  . TRP D 2 150 ? 9.620   -5.440  123.526 1.00 10.70  ? 150 TRP D CG  1 
ATOM   6713 C CD1 . TRP D 2 150 ? 9.738   -4.200  124.116 1.00 7.65   ? 150 TRP D CD1 1 
ATOM   6714 C CD2 . TRP D 2 150 ? 9.083   -6.332  124.531 1.00 6.04   ? 150 TRP D CD2 1 
ATOM   6715 N NE1 . TRP D 2 150 ? 9.248   -4.253  125.409 1.00 2.01   ? 150 TRP D NE1 1 
ATOM   6716 C CE2 . TRP D 2 150 ? 8.870   -5.513  125.690 1.00 3.83   ? 150 TRP D CE2 1 
ATOM   6717 C CE3 . TRP D 2 150 ? 8.729   -7.686  124.535 1.00 4.49   ? 150 TRP D CE3 1 
ATOM   6718 C CZ2 . TRP D 2 150 ? 8.281   -6.067  126.865 1.00 7.95   ? 150 TRP D CZ2 1 
ATOM   6719 C CZ3 . TRP D 2 150 ? 8.149   -8.225  125.705 1.00 9.13   ? 150 TRP D CZ3 1 
ATOM   6720 C CH2 . TRP D 2 150 ? 7.936   -7.402  126.858 1.00 9.99   ? 150 TRP D CH2 1 
ATOM   6721 N N   . PHE D 2 151 ? 10.749  -7.830  119.883 1.00 11.91  ? 151 PHE D N   1 
ATOM   6722 C CA  . PHE D 2 151 ? 11.076  -8.151  118.487 1.00 11.23  ? 151 PHE D CA  1 
ATOM   6723 C C   . PHE D 2 151 ? 11.160  -6.935  117.595 1.00 12.70  ? 151 PHE D C   1 
ATOM   6724 O O   . PHE D 2 151 ? 11.846  -6.948  116.584 1.00 14.89  ? 151 PHE D O   1 
ATOM   6725 C CB  . PHE D 2 151 ? 10.109  -9.163  117.907 1.00 7.39   ? 151 PHE D CB  1 
ATOM   6726 C CG  . PHE D 2 151 ? 10.436  -10.575 118.297 1.00 5.81   ? 151 PHE D CG  1 
ATOM   6727 C CD1 . PHE D 2 151 ? 10.056  -11.080 119.559 1.00 2.58   ? 151 PHE D CD1 1 
ATOM   6728 C CD2 . PHE D 2 151 ? 11.111  -11.417 117.406 1.00 2.00   ? 151 PHE D CD2 1 
ATOM   6729 C CE1 . PHE D 2 151 ? 10.340  -12.417 119.940 1.00 2.00   ? 151 PHE D CE1 1 
ATOM   6730 C CE2 . PHE D 2 151 ? 11.401  -12.751 117.774 1.00 2.57   ? 151 PHE D CE2 1 
ATOM   6731 C CZ  . PHE D 2 151 ? 11.015  -13.253 119.048 1.00 2.00   ? 151 PHE D CZ  1 
ATOM   6732 N N   . ALA D 2 152 ? 10.522  -5.856  118.008 1.00 13.87  ? 152 ALA D N   1 
ATOM   6733 C CA  . ALA D 2 152 ? 10.579  -4.609  117.255 1.00 16.18  ? 152 ALA D CA  1 
ATOM   6734 C C   . ALA D 2 152 ? 11.714  -3.722  117.734 1.00 18.06  ? 152 ALA D C   1 
ATOM   6735 O O   . ALA D 2 152 ? 11.762  -2.531  117.431 1.00 20.62  ? 152 ALA D O   1 
ATOM   6736 C CB  . ALA D 2 152 ? 9.260   -3.858  117.372 1.00 17.24  ? 152 ALA D CB  1 
ATOM   6737 N N   . GLY D 2 153 ? 12.604  -4.316  118.518 1.00 19.64  ? 153 GLY D N   1 
ATOM   6738 C CA  . GLY D 2 153 ? 13.689  -3.563  119.101 1.00 20.38  ? 153 GLY D CA  1 
ATOM   6739 C C   . GLY D 2 153 ? 13.401  -3.293  120.553 1.00 21.73  ? 153 GLY D C   1 
ATOM   6740 O O   . GLY D 2 153 ? 13.191  -4.222  121.341 1.00 24.73  ? 153 GLY D O   1 
ATOM   6741 N N   . GLU D 2 154 ? 13.416  -2.018  120.917 1.00 21.09  ? 154 GLU D N   1 
ATOM   6742 C CA  . GLU D 2 154 ? 13.170  -1.628  122.300 1.00 23.12  ? 154 GLU D CA  1 
ATOM   6743 C C   . GLU D 2 154 ? 11.745  -1.071  122.493 1.00 25.29  ? 154 GLU D C   1 
ATOM   6744 O O   . GLU D 2 154 ? 11.523  -0.159  123.291 1.00 25.44  ? 154 GLU D O   1 
ATOM   6745 C CB  . GLU D 2 154 ? 14.215  -0.605  122.754 1.00 23.55  ? 154 GLU D CB  1 
ATOM   6746 C CG  . GLU D 2 154 ? 15.616  -1.167  122.901 1.00 26.55  ? 154 GLU D CG  1 
ATOM   6747 C CD  . GLU D 2 154 ? 15.708  -2.276  123.951 1.00 27.70  ? 154 GLU D CD  1 
ATOM   6748 O OE1 . GLU D 2 154 ? 15.466  -1.984  125.156 1.00 30.63  ? 154 GLU D OE1 1 
ATOM   6749 O OE2 . GLU D 2 154 ? 16.029  -3.429  123.550 1.00 26.61  ? 154 GLU D OE2 1 
ATOM   6750 N N   . LYS D 2 155 ? 10.790  -1.602  121.742 1.00 27.18  ? 155 LYS D N   1 
ATOM   6751 C CA  . LYS D 2 155 ? 9.422   -1.110  121.780 1.00 24.58  ? 155 LYS D CA  1 
ATOM   6752 C C   . LYS D 2 155 ? 8.462   -2.295  121.628 1.00 22.65  ? 155 LYS D C   1 
ATOM   6753 O O   . LYS D 2 155 ? 8.624   -3.143  120.736 1.00 22.94  ? 155 LYS D O   1 
ATOM   6754 C CB  . LYS D 2 155 ? 9.226   -0.101  120.657 1.00 24.19  ? 155 LYS D CB  1 
ATOM   6755 C CG  . LYS D 2 155 ? 8.031   0.806   120.849 1.00 20.06  ? 155 LYS D CG  1 
ATOM   6756 C CD  . LYS D 2 155 ? 8.041   1.945   119.823 1.00 17.56  ? 155 LYS D CD  1 
ATOM   6757 C CE  . LYS D 2 155 ? 9.280   2.800   120.024 1.00 18.59  ? 155 LYS D CE  1 
ATOM   6758 N NZ  . LYS D 2 155 ? 9.415   3.934   119.037 1.00 20.00  ? 155 LYS D NZ  1 
ATOM   6759 N N   . LEU D 2 156 ? 7.458   -2.343  122.504 1.00 21.48  ? 156 LEU D N   1 
ATOM   6760 C CA  . LEU D 2 156 ? 6.446   -3.398  122.465 1.00 19.15  ? 156 LEU D CA  1 
ATOM   6761 C C   . LEU D 2 156 ? 5.435   -3.070  121.360 1.00 19.00  ? 156 LEU D C   1 
ATOM   6762 O O   . LEU D 2 156 ? 4.788   -2.000  121.385 1.00 20.94  ? 156 LEU D O   1 
ATOM   6763 C CB  . LEU D 2 156 ? 5.719   -3.481  123.806 1.00 16.35  ? 156 LEU D CB  1 
ATOM   6764 C CG  . LEU D 2 156 ? 5.423   -4.873  124.362 1.00 20.25  ? 156 LEU D CG  1 
ATOM   6765 C CD1 . LEU D 2 156 ? 4.548   -4.731  125.598 1.00 20.59  ? 156 LEU D CD1 1 
ATOM   6766 C CD2 . LEU D 2 156 ? 4.718   -5.724  123.347 1.00 20.29  ? 156 LEU D CD2 1 
ATOM   6767 N N   . THR D 2 157 ? 5.291   -3.987  120.402 1.00 16.46  ? 157 THR D N   1 
ATOM   6768 C CA  . THR D 2 157 ? 4.364   -3.803  119.291 1.00 14.19  ? 157 THR D CA  1 
ATOM   6769 C C   . THR D 2 157 ? 3.512   -5.069  119.186 1.00 15.67  ? 157 THR D C   1 
ATOM   6770 O O   . THR D 2 157 ? 3.804   -6.072  119.867 1.00 14.94  ? 157 THR D O   1 
ATOM   6771 C CB  . THR D 2 157 ? 5.109   -3.594  117.956 1.00 13.90  ? 157 THR D CB  1 
ATOM   6772 O OG1 . THR D 2 157 ? 6.074   -4.633  117.790 1.00 15.57  ? 157 THR D OG1 1 
ATOM   6773 C CG2 . THR D 2 157 ? 5.830   -2.264  117.918 1.00 14.47  ? 157 THR D CG2 1 
ATOM   6774 N N   . PHE D 2 158 ? 2.468   -5.032  118.367 1.00 12.67  ? 158 PHE D N   1 
ATOM   6775 C CA  . PHE D 2 158 ? 1.561   -6.159  118.274 1.00 10.82  ? 158 PHE D CA  1 
ATOM   6776 C C   . PHE D 2 158 ? 2.231   -7.487  117.954 1.00 8.16   ? 158 PHE D C   1 
ATOM   6777 O O   . PHE D 2 158 ? 1.726   -8.557  118.316 1.00 10.85  ? 158 PHE D O   1 
ATOM   6778 C CB  . PHE D 2 158 ? 0.360   -5.853  117.343 1.00 10.47  ? 158 PHE D CB  1 
ATOM   6779 C CG  . PHE D 2 158 ? 0.722   -5.695  115.873 1.00 6.46   ? 158 PHE D CG  1 
ATOM   6780 C CD1 . PHE D 2 158 ? 0.679   -6.796  115.012 1.00 8.05   ? 158 PHE D CD1 1 
ATOM   6781 C CD2 . PHE D 2 158 ? 1.010   -4.434  115.354 1.00 10.60  ? 158 PHE D CD2 1 
ATOM   6782 C CE1 . PHE D 2 158 ? 0.991   -6.662  113.661 1.00 9.65   ? 158 PHE D CE1 1 
ATOM   6783 C CE2 . PHE D 2 158 ? 1.324   -4.273  113.976 1.00 8.05   ? 158 PHE D CE2 1 
ATOM   6784 C CZ  . PHE D 2 158 ? 1.309   -5.385  113.135 1.00 11.36  ? 158 PHE D CZ  1 
ATOM   6785 N N   . VAL D 2 159 ? 3.361   -7.426  117.250 1.00 3.75   ? 159 VAL D N   1 
ATOM   6786 C CA  . VAL D 2 159 ? 4.063   -8.659  116.845 1.00 6.37   ? 159 VAL D CA  1 
ATOM   6787 C C   . VAL D 2 159 ? 4.540   -9.502  118.030 1.00 7.11   ? 159 VAL D C   1 
ATOM   6788 O O   . VAL D 2 159 ? 4.645   -10.726 117.954 1.00 4.98   ? 159 VAL D O   1 
ATOM   6789 C CB  . VAL D 2 159 ? 5.302   -8.390  115.878 1.00 7.18   ? 159 VAL D CB  1 
ATOM   6790 C CG1 . VAL D 2 159 ? 4.785   -7.997  114.464 1.00 2.61   ? 159 VAL D CG1 1 
ATOM   6791 C CG2 . VAL D 2 159 ? 6.230   -7.322  116.448 1.00 2.00   ? 159 VAL D CG2 1 
ATOM   6792 N N   . ASP D 2 160 ? 4.797   -8.842  119.153 1.00 7.61   ? 160 ASP D N   1 
ATOM   6793 C CA  . ASP D 2 160 ? 5.247   -9.541  120.356 1.00 7.55   ? 160 ASP D CA  1 
ATOM   6794 C C   . ASP D 2 160 ? 4.161   -10.466 120.895 1.00 7.83   ? 160 ASP D C   1 
ATOM   6795 O O   . ASP D 2 160 ? 4.461   -11.590 121.347 1.00 5.46   ? 160 ASP D O   1 
ATOM   6796 C CB  . ASP D 2 160 ? 5.688   -8.533  121.427 1.00 7.62   ? 160 ASP D CB  1 
ATOM   6797 C CG  . ASP D 2 160 ? 7.000   -7.830  121.061 1.00 7.02   ? 160 ASP D CG  1 
ATOM   6798 O OD1 . ASP D 2 160 ? 8.019   -8.546  121.020 1.00 8.03   ? 160 ASP D OD1 1 
ATOM   6799 O OD2 . ASP D 2 160 ? 7.028   -6.596  120.813 1.00 2.00   ? 160 ASP D OD2 1 
ATOM   6800 N N   . PHE D 2 161 ? 2.904   -10.012 120.780 1.00 10.33  ? 161 PHE D N   1 
ATOM   6801 C CA  . PHE D 2 161 ? 1.711   -10.798 121.159 1.00 5.95   ? 161 PHE D CA  1 
ATOM   6802 C C   . PHE D 2 161 ? 1.511   -11.996 120.229 1.00 4.44   ? 161 PHE D C   1 
ATOM   6803 O O   . PHE D 2 161 ? 1.141   -13.084 120.679 1.00 3.41   ? 161 PHE D O   1 
ATOM   6804 C CB  . PHE D 2 161 ? 0.453   -9.944  121.148 1.00 2.10   ? 161 PHE D CB  1 
ATOM   6805 C CG  . PHE D 2 161 ? 0.545   -8.759  122.048 1.00 2.07   ? 161 PHE D CG  1 
ATOM   6806 C CD1 . PHE D 2 161 ? 1.305   -7.615  121.688 1.00 2.00   ? 161 PHE D CD1 1 
ATOM   6807 C CD2 . PHE D 2 161 ? -0.101  -8.775  123.288 1.00 2.00   ? 161 PHE D CD2 1 
ATOM   6808 C CE1 . PHE D 2 161 ? 1.426   -6.470  122.588 1.00 2.00   ? 161 PHE D CE1 1 
ATOM   6809 C CE2 . PHE D 2 161 ? 0.018   -7.638  124.192 1.00 4.78   ? 161 PHE D CE2 1 
ATOM   6810 C CZ  . PHE D 2 161 ? 0.786   -6.490  123.822 1.00 2.00   ? 161 PHE D CZ  1 
ATOM   6811 N N   . LEU D 2 162 ? 1.809   -11.794 118.943 1.00 3.12   ? 162 LEU D N   1 
ATOM   6812 C CA  . LEU D 2 162 ? 1.756   -12.858 117.937 1.00 6.45   ? 162 LEU D CA  1 
ATOM   6813 C C   . LEU D 2 162 ? 2.855   -13.897 118.180 1.00 9.13   ? 162 LEU D C   1 
ATOM   6814 O O   . LEU D 2 162 ? 2.595   -15.108 118.173 1.00 10.97  ? 162 LEU D O   1 
ATOM   6815 C CB  . LEU D 2 162 ? 1.915   -12.264 116.527 1.00 10.34  ? 162 LEU D CB  1 
ATOM   6816 C CG  . LEU D 2 162 ? 0.729   -11.508 115.920 1.00 8.25   ? 162 LEU D CG  1 
ATOM   6817 C CD1 . LEU D 2 162 ? 1.118   -10.870 114.619 1.00 9.01   ? 162 LEU D CD1 1 
ATOM   6818 C CD2 . LEU D 2 162 ? -0.374  -12.473 115.711 1.00 5.78   ? 162 LEU D CD2 1 
ATOM   6819 N N   . THR D 2 163 ? 4.068   -13.417 118.402 1.00 12.98  ? 163 THR D N   1 
ATOM   6820 C CA  . THR D 2 163 ? 5.221   -14.282 118.614 1.00 15.52  ? 163 THR D CA  1 
ATOM   6821 C C   . THR D 2 163 ? 5.011   -15.070 119.905 1.00 16.84  ? 163 THR D C   1 
ATOM   6822 O O   . THR D 2 163 ? 5.232   -16.275 119.927 1.00 17.55  ? 163 THR D O   1 
ATOM   6823 C CB  . THR D 2 163 ? 6.537   -13.482 118.681 1.00 15.67  ? 163 THR D CB  1 
ATOM   6824 O OG1 . THR D 2 163 ? 6.651   -12.627 117.532 1.00 15.89  ? 163 THR D OG1 1 
ATOM   6825 C CG2 . THR D 2 163 ? 7.696   -14.405 118.692 1.00 15.98  ? 163 THR D CG2 1 
ATOM   6826 N N   . TYR D 2 164 ? 4.555   -14.399 120.959 1.00 16.17  ? 164 TYR D N   1 
ATOM   6827 C CA  . TYR D 2 164 ? 4.269   -15.076 122.203 1.00 16.42  ? 164 TYR D CA  1 
ATOM   6828 C C   . TYR D 2 164 ? 3.341   -16.263 121.996 1.00 18.03  ? 164 TYR D C   1 
ATOM   6829 O O   . TYR D 2 164 ? 3.669   -17.364 122.411 1.00 18.45  ? 164 TYR D O   1 
ATOM   6830 C CB  . TYR D 2 164 ? 3.707   -14.108 123.235 1.00 19.16  ? 164 TYR D CB  1 
ATOM   6831 C CG  . TYR D 2 164 ? 3.134   -14.801 124.449 1.00 22.61  ? 164 TYR D CG  1 
ATOM   6832 C CD1 . TYR D 2 164 ? 3.972   -15.370 125.431 1.00 26.04  ? 164 TYR D CD1 1 
ATOM   6833 C CD2 . TYR D 2 164 ? 1.759   -14.895 124.610 1.00 23.01  ? 164 TYR D CD2 1 
ATOM   6834 C CE1 . TYR D 2 164 ? 3.436   -16.043 126.551 1.00 25.28  ? 164 TYR D CE1 1 
ATOM   6835 C CE2 . TYR D 2 164 ? 1.204   -15.561 125.722 1.00 26.03  ? 164 TYR D CE2 1 
ATOM   6836 C CZ  . TYR D 2 164 ? 2.044   -16.137 126.675 1.00 24.94  ? 164 TYR D CZ  1 
ATOM   6837 O OH  . TYR D 2 164 ? 1.454   -16.763 127.743 1.00 23.06  ? 164 TYR D OH  1 
ATOM   6838 N N   . ASP D 2 165 ? 2.189   -16.022 121.369 1.00 21.60  ? 165 ASP D N   1 
ATOM   6839 C CA  . ASP D 2 165 ? 1.178   -17.044 121.137 1.00 21.29  ? 165 ASP D CA  1 
ATOM   6840 C C   . ASP D 2 165 ? 1.739   -18.293 120.496 1.00 19.26  ? 165 ASP D C   1 
ATOM   6841 O O   . ASP D 2 165 ? 1.505   -19.399 120.992 1.00 18.39  ? 165 ASP D O   1 
ATOM   6842 C CB  . ASP D 2 165 ? 0.040   -16.496 120.277 1.00 22.31  ? 165 ASP D CB  1 
ATOM   6843 C CG  . ASP D 2 165 ? -0.998  -17.576 119.884 1.00 22.08  ? 165 ASP D CG  1 
ATOM   6844 O OD1 . ASP D 2 165 ? -1.550  -18.255 120.782 1.00 21.97  ? 165 ASP D OD1 1 
ATOM   6845 O OD2 . ASP D 2 165 ? -1.254  -17.781 118.677 1.00 23.08  ? 165 ASP D OD2 1 
ATOM   6846 N N   . ILE D 2 166 ? 2.497   -18.125 119.409 1.00 17.58  ? 166 ILE D N   1 
ATOM   6847 C CA  . ILE D 2 166 ? 3.061   -19.254 118.691 1.00 17.99  ? 166 ILE D CA  1 
ATOM   6848 C C   . ILE D 2 166 ? 4.176   -19.979 119.485 1.00 15.13  ? 166 ILE D C   1 
ATOM   6849 O O   . ILE D 2 166 ? 4.236   -21.216 119.491 1.00 12.90  ? 166 ILE D O   1 
ATOM   6850 C CB  . ILE D 2 166 ? 3.540   -18.841 117.233 1.00 20.81  ? 166 ILE D CB  1 
ATOM   6851 C CG1 . ILE D 2 166 ? 3.851   -20.084 116.393 1.00 22.37  ? 166 ILE D CG1 1 
ATOM   6852 C CG2 . ILE D 2 166 ? 4.752   -17.904 117.303 1.00 24.77  ? 166 ILE D CG2 1 
ATOM   6853 C CD1 . ILE D 2 166 ? 2.683   -20.984 116.199 1.00 24.68  ? 166 ILE D CD1 1 
ATOM   6854 N N   . LEU D 2 167 ? 5.033   -19.209 120.173 1.00 14.80  ? 167 LEU D N   1 
ATOM   6855 C CA  . LEU D 2 167 ? 6.102   -19.798 120.992 1.00 17.16  ? 167 LEU D CA  1 
ATOM   6856 C C   . LEU D 2 167 ? 5.517   -20.532 122.196 1.00 17.70  ? 167 LEU D C   1 
ATOM   6857 O O   . LEU D 2 167 ? 6.039   -21.552 122.596 1.00 16.36  ? 167 LEU D O   1 
ATOM   6858 C CB  . LEU D 2 167 ? 7.087   -18.735 121.490 1.00 13.65  ? 167 LEU D CB  1 
ATOM   6859 C CG  . LEU D 2 167 ? 7.943   -17.999 120.455 1.00 11.23  ? 167 LEU D CG  1 
ATOM   6860 C CD1 . LEU D 2 167 ? 8.799   -16.965 121.161 1.00 5.59   ? 167 LEU D CD1 1 
ATOM   6861 C CD2 . LEU D 2 167 ? 8.755   -18.963 119.665 1.00 7.29   ? 167 LEU D CD2 1 
ATOM   6862 N N   . ASP D 2 168 ? 4.408   -20.022 122.718 1.00 20.06  ? 168 ASP D N   1 
ATOM   6863 C CA  . ASP D 2 168 ? 3.702   -20.645 123.825 1.00 21.62  ? 168 ASP D CA  1 
ATOM   6864 C C   . ASP D 2 168 ? 3.170   -21.979 123.366 1.00 24.63  ? 168 ASP D C   1 
ATOM   6865 O O   . ASP D 2 168 ? 3.377   -22.984 124.021 1.00 27.83  ? 168 ASP D O   1 
ATOM   6866 C CB  . ASP D 2 168 ? 2.567   -19.734 124.306 1.00 23.30  ? 168 ASP D CB  1 
ATOM   6867 C CG  . ASP D 2 168 ? 1.874   -20.254 125.574 1.00 25.09  ? 168 ASP D CG  1 
ATOM   6868 O OD1 . ASP D 2 168 ? 2.311   -21.279 126.158 1.00 25.67  ? 168 ASP D OD1 1 
ATOM   6869 O OD2 . ASP D 2 168 ? 0.870   -19.622 125.980 1.00 29.30  ? 168 ASP D OD2 1 
ATOM   6870 N N   . GLN D 2 169 ? 2.460   -21.980 122.242 1.00 24.86  ? 169 GLN D N   1 
ATOM   6871 C CA  . GLN D 2 169 ? 1.894   -23.202 121.703 1.00 25.40  ? 169 GLN D CA  1 
ATOM   6872 C C   . GLN D 2 169 ? 2.972   -24.280 121.526 1.00 26.75  ? 169 GLN D C   1 
ATOM   6873 O O   . GLN D 2 169 ? 2.765   -25.435 121.908 1.00 29.12  ? 169 GLN D O   1 
ATOM   6874 C CB  . GLN D 2 169 ? 1.213   -22.903 120.372 1.00 22.83  ? 169 GLN D CB  1 
ATOM   6875 C CG  . GLN D 2 169 ? -0.072  -22.168 120.534 1.00 19.85  ? 169 GLN D CG  1 
ATOM   6876 C CD  . GLN D 2 169 ? -0.725  -21.828 119.211 1.00 18.27  ? 169 GLN D CD  1 
ATOM   6877 O OE1 . GLN D 2 169 ? -0.721  -20.668 118.787 1.00 19.76  ? 169 GLN D OE1 1 
ATOM   6878 N NE2 . GLN D 2 169 ? -1.293  -22.839 118.554 1.00 20.84  ? 169 GLN D NE2 1 
ATOM   6879 N N   . ASN D 2 170 ? 4.120   -23.894 120.957 1.00 27.89  ? 170 ASN D N   1 
ATOM   6880 C CA  . ASN D 2 170 ? 5.233   -24.814 120.759 1.00 28.52  ? 170 ASN D CA  1 
ATOM   6881 C C   . ASN D 2 170 ? 5.743   -25.310 122.078 1.00 28.90  ? 170 ASN D C   1 
ATOM   6882 O O   . ASN D 2 170 ? 5.941   -26.509 122.232 1.00 30.53  ? 170 ASN D O   1 
ATOM   6883 C CB  . ASN D 2 170 ? 6.357   -24.163 119.976 1.00 27.37  ? 170 ASN D CB  1 
ATOM   6884 C CG  . ASN D 2 170 ? 6.170   -24.314 118.503 1.00 27.30  ? 170 ASN D CG  1 
ATOM   6885 O OD1 . ASN D 2 170 ? 5.811   -23.367 117.828 1.00 27.09  ? 170 ASN D OD1 1 
ATOM   6886 N ND2 . ASN D 2 170 ? 6.417   -25.510 117.987 1.00 24.82  ? 170 ASN D ND2 1 
ATOM   6887 N N   . ARG D 2 171 ? 5.903   -24.385 123.034 1.00 28.89  ? 171 ARG D N   1 
ATOM   6888 C CA  . ARG D 2 171 ? 6.355   -24.696 124.398 1.00 28.60  ? 171 ARG D CA  1 
ATOM   6889 C C   . ARG D 2 171 ? 5.469   -25.779 124.992 1.00 29.52  ? 171 ARG D C   1 
ATOM   6890 O O   . ARG D 2 171 ? 5.953   -26.654 125.671 1.00 30.22  ? 171 ARG D O   1 
ATOM   6891 C CB  . ARG D 2 171 ? 6.307   -23.420 125.258 1.00 29.44  ? 171 ARG D CB  1 
ATOM   6892 C CG  . ARG D 2 171 ? 6.516   -23.600 126.724 1.00 26.78  ? 171 ARG D CG  1 
ATOM   6893 C CD  . ARG D 2 171 ? 5.607   -22.699 127.522 1.00 23.50  ? 171 ARG D CD  1 
ATOM   6894 N NE  . ARG D 2 171 ? 6.017   -21.301 127.442 1.00 22.57  ? 171 ARG D NE  1 
ATOM   6895 C CZ  . ARG D 2 171 ? 5.391   -20.297 128.060 1.00 22.89  ? 171 ARG D CZ  1 
ATOM   6896 N NH1 . ARG D 2 171 ? 4.301   -20.502 128.795 1.00 21.26  ? 171 ARG D NH1 1 
ATOM   6897 N NH2 . ARG D 2 171 ? 5.847   -19.060 127.936 1.00 24.38  ? 171 ARG D NH2 1 
ATOM   6898 N N   . ILE D 2 172 ? 4.174   -25.706 124.711 1.00 28.64  ? 172 ILE D N   1 
ATOM   6899 C CA  . ILE D 2 172 ? 3.197   -26.681 125.167 1.00 27.12  ? 172 ILE D CA  1 
ATOM   6900 C C   . ILE D 2 172 ? 3.402   -28.005 124.460 1.00 26.61  ? 172 ILE D C   1 
ATOM   6901 O O   . ILE D 2 172 ? 3.285   -29.050 125.075 1.00 26.39  ? 172 ILE D O   1 
ATOM   6902 C CB  . ILE D 2 172 ? 1.737   -26.176 124.921 1.00 26.05  ? 172 ILE D CB  1 
ATOM   6903 C CG1 . ILE D 2 172 ? 1.511   -24.841 125.638 1.00 28.63  ? 172 ILE D CG1 1 
ATOM   6904 C CG2 . ILE D 2 172 ? 0.738   -27.189 125.440 1.00 24.55  ? 172 ILE D CG2 1 
ATOM   6905 C CD1 . ILE D 2 172 ? 0.154   -24.233 125.413 1.00 29.16  ? 172 ILE D CD1 1 
ATOM   6906 N N   . PHE D 2 173 ? 3.687   -27.947 123.162 1.00 28.88  ? 173 PHE D N   1 
ATOM   6907 C CA  . PHE D 2 173 ? 3.852   -29.146 122.368 1.00 30.66  ? 173 PHE D CA  1 
ATOM   6908 C C   . PHE D 2 173 ? 5.094   -29.888 122.809 1.00 30.42  ? 173 PHE D C   1 
ATOM   6909 O O   . PHE D 2 173 ? 5.081   -31.135 122.842 1.00 32.14  ? 173 PHE D O   1 
ATOM   6910 C CB  . PHE D 2 173 ? 3.966   -28.777 120.894 1.00 31.65  ? 173 PHE D CB  1 
ATOM   6911 C CG  . PHE D 2 173 ? 3.670   -29.922 119.946 1.00 33.55  ? 173 PHE D CG  1 
ATOM   6912 C CD1 . PHE D 2 173 ? 2.486   -30.650 120.053 1.00 35.10  ? 173 PHE D CD1 1 
ATOM   6913 C CD2 . PHE D 2 173 ? 4.579   -30.249 118.926 1.00 34.58  ? 173 PHE D CD2 1 
ATOM   6914 C CE1 . PHE D 2 173 ? 2.216   -31.693 119.170 1.00 36.49  ? 173 PHE D CE1 1 
ATOM   6915 C CE2 . PHE D 2 173 ? 4.319   -31.289 118.038 1.00 34.23  ? 173 PHE D CE2 1 
ATOM   6916 C CZ  . PHE D 2 173 ? 3.136   -32.010 118.158 1.00 35.22  ? 173 PHE D CZ  1 
ATOM   6917 N N   . ASP D 2 174 ? 6.138   -29.119 123.152 1.00 30.36  ? 174 ASP D N   1 
ATOM   6918 C CA  . ASP D 2 174 ? 7.403   -29.678 123.620 1.00 29.99  ? 174 ASP D CA  1 
ATOM   6919 C C   . ASP D 2 174 ? 8.114   -28.687 124.514 1.00 28.47  ? 174 ASP D C   1 
ATOM   6920 O O   . ASP D 2 174 ? 8.801   -27.790 124.005 1.00 25.87  ? 174 ASP D O   1 
ATOM   6921 C CB  . ASP D 2 174 ? 8.309   -30.047 122.441 1.00 33.39  ? 174 ASP D CB  1 
ATOM   6922 C CG  . ASP D 2 174 ? 9.687   -30.527 122.883 1.00 36.96  ? 174 ASP D CG  1 
ATOM   6923 O OD1 . ASP D 2 174 ? 9.755   -31.369 123.811 1.00 39.17  ? 174 ASP D OD1 1 
ATOM   6924 O OD2 . ASP D 2 174 ? 10.694  -30.048 122.308 1.00 38.36  ? 174 ASP D OD2 1 
ATOM   6925 N N   . PRO D 2 175 ? 7.957   -28.837 125.866 1.00 27.40  ? 175 PRO D N   1 
ATOM   6926 C CA  . PRO D 2 175 ? 8.490   -27.925 126.880 1.00 29.21  ? 175 PRO D CA  1 
ATOM   6927 C C   . PRO D 2 175 ? 9.970   -27.585 126.729 1.00 29.72  ? 175 PRO D C   1 
ATOM   6928 O O   . PRO D 2 175 ? 10.397  -26.432 127.019 1.00 30.79  ? 175 PRO D O   1 
ATOM   6929 C CB  . PRO D 2 175 ? 8.172   -28.652 128.192 1.00 28.93  ? 175 PRO D CB  1 
ATOM   6930 C CG  . PRO D 2 175 ? 6.930   -29.397 127.858 1.00 27.34  ? 175 PRO D CG  1 
ATOM   6931 C CD  . PRO D 2 175 ? 7.157   -29.912 126.480 1.00 25.64  ? 175 PRO D CD  1 
ATOM   6932 N N   . LYS D 2 176 ? 10.747  -28.554 126.278 1.00 29.50  ? 176 LYS D N   1 
ATOM   6933 C CA  . LYS D 2 176 ? 12.184  -28.379 126.154 1.00 30.04  ? 176 LYS D CA  1 
ATOM   6934 C C   . LYS D 2 176 ? 12.641  -27.542 124.956 1.00 30.09  ? 176 LYS D C   1 
ATOM   6935 O O   . LYS D 2 176 ? 13.826  -27.147 124.899 1.00 31.81  ? 176 LYS D O   1 
ATOM   6936 C CB  . LYS D 2 176 ? 12.897  -29.724 126.179 1.00 29.76  ? 176 LYS D CB  1 
ATOM   6937 C CG  . LYS D 2 176 ? 12.853  -30.383 127.566 1.00 31.45  ? 176 LYS D CG  1 
ATOM   6938 C CD  . LYS D 2 176 ? 13.718  -31.628 127.594 1.00 35.23  ? 176 LYS D CD  1 
ATOM   6939 C CE  . LYS D 2 176 ? 13.635  -32.320 128.960 1.00 33.87  ? 176 LYS D CE  1 
ATOM   6940 N NZ  . LYS D 2 176 ? 14.381  -33.644 128.927 1.00 33.73  ? 176 LYS D NZ  1 
ATOM   6941 N N   . CYS D 2 177 ? 11.729  -27.265 124.023 1.00 28.99  ? 177 CYS D N   1 
ATOM   6942 C CA  . CYS D 2 177 ? 12.085  -26.573 122.782 1.00 27.51  ? 177 CYS D CA  1 
ATOM   6943 C C   . CYS D 2 177 ? 12.814  -25.228 122.987 1.00 26.60  ? 177 CYS D C   1 
ATOM   6944 O O   . CYS D 2 177 ? 13.671  -24.866 122.172 1.00 25.63  ? 177 CYS D O   1 
ATOM   6945 C CB  . CYS D 2 177 ? 10.862  -26.399 121.873 1.00 28.55  ? 177 CYS D CB  1 
ATOM   6946 S SG  . CYS D 2 177 ? 9.485   -25.461 122.491 1.00 30.45  ? 177 CYS D SG  1 
ATOM   6947 N N   . LEU D 2 178 ? 12.509  -24.507 124.064 1.00 26.95  ? 178 LEU D N   1 
ATOM   6948 C CA  . LEU D 2 178 ? 13.138  -23.211 124.314 1.00 24.54  ? 178 LEU D CA  1 
ATOM   6949 C C   . LEU D 2 178 ? 14.407  -23.264 125.180 1.00 22.89  ? 178 LEU D C   1 
ATOM   6950 O O   . LEU D 2 178 ? 15.111  -22.259 125.300 1.00 18.35  ? 178 LEU D O   1 
ATOM   6951 C CB  . LEU D 2 178 ? 12.120  -22.243 124.919 1.00 23.62  ? 178 LEU D CB  1 
ATOM   6952 C CG  . LEU D 2 178 ? 11.222  -21.470 123.941 1.00 23.23  ? 178 LEU D CG  1 
ATOM   6953 C CD1 . LEU D 2 178 ? 10.171  -22.394 123.341 1.00 22.51  ? 178 LEU D CD1 1 
ATOM   6954 C CD2 . LEU D 2 178 ? 10.545  -20.333 124.695 1.00 23.38  ? 178 LEU D CD2 1 
ATOM   6955 N N   . ASP D 2 179 ? 14.704  -24.422 125.769 1.00 23.31  ? 179 ASP D N   1 
ATOM   6956 C CA  . ASP D 2 179 ? 15.856  -24.573 126.663 1.00 24.63  ? 179 ASP D CA  1 
ATOM   6957 C C   . ASP D 2 179 ? 17.174  -24.046 126.103 1.00 23.59  ? 179 ASP D C   1 
ATOM   6958 O O   . ASP D 2 179 ? 17.794  -23.162 126.678 1.00 24.47  ? 179 ASP D O   1 
ATOM   6959 C CB  . ASP D 2 179 ? 16.022  -26.033 127.071 1.00 21.60  ? 179 ASP D CB  1 
ATOM   6960 C CG  . ASP D 2 179 ? 14.996  -26.466 128.117 1.00 18.91  ? 179 ASP D CG  1 
ATOM   6961 O OD1 . ASP D 2 179 ? 14.223  -25.585 128.593 1.00 17.01  ? 179 ASP D OD1 1 
ATOM   6962 O OD2 . ASP D 2 179 ? 14.963  -27.682 128.455 1.00 15.24  ? 179 ASP D OD2 1 
ATOM   6963 N N   . GLU D 2 180 ? 17.579  -24.557 124.944 1.00 24.48  ? 180 GLU D N   1 
ATOM   6964 C CA  . GLU D 2 180 ? 18.812  -24.092 124.291 1.00 23.63  ? 180 GLU D CA  1 
ATOM   6965 C C   . GLU D 2 180 ? 18.719  -22.659 123.717 1.00 23.88  ? 180 GLU D C   1 
ATOM   6966 O O   . GLU D 2 180 ? 19.621  -22.207 123.010 1.00 22.75  ? 180 GLU D O   1 
ATOM   6967 C CB  . GLU D 2 180 ? 19.241  -25.081 123.186 1.00 23.68  ? 180 GLU D CB  1 
ATOM   6968 C CG  . GLU D 2 180 ? 18.219  -25.291 122.093 1.00 28.01  ? 180 GLU D CG  1 
ATOM   6969 C CD  . GLU D 2 180 ? 18.726  -26.191 120.972 1.00 31.35  ? 180 GLU D CD  1 
ATOM   6970 O OE1 . GLU D 2 180 ? 19.586  -25.733 120.162 1.00 33.10  ? 180 GLU D OE1 1 
ATOM   6971 O OE2 . GLU D 2 180 ? 18.256  -27.360 120.911 1.00 31.35  ? 180 GLU D OE2 1 
ATOM   6972 N N   . PHE D 2 181 ? 17.640  -21.962 124.052 1.00 24.10  ? 181 PHE D N   1 
ATOM   6973 C CA  . PHE D 2 181 ? 17.437  -20.594 123.616 1.00 24.15  ? 181 PHE D CA  1 
ATOM   6974 C C   . PHE D 2 181 ? 17.023  -19.707 124.810 1.00 26.24  ? 181 PHE D C   1 
ATOM   6975 O O   . PHE D 2 181 ? 15.883  -19.229 124.881 1.00 28.25  ? 181 PHE D O   1 
ATOM   6976 C CB  . PHE D 2 181 ? 16.370  -20.530 122.524 1.00 21.80  ? 181 PHE D CB  1 
ATOM   6977 C CG  . PHE D 2 181 ? 16.654  -21.396 121.342 1.00 17.88  ? 181 PHE D CG  1 
ATOM   6978 C CD1 . PHE D 2 181 ? 17.618  -21.019 120.423 1.00 14.89  ? 181 PHE D CD1 1 
ATOM   6979 C CD2 . PHE D 2 181 ? 15.952  -22.597 121.155 1.00 19.00  ? 181 PHE D CD2 1 
ATOM   6980 C CE1 . PHE D 2 181 ? 17.913  -21.847 119.326 1.00 13.91  ? 181 PHE D CE1 1 
ATOM   6981 C CE2 . PHE D 2 181 ? 16.212  -23.432 120.055 1.00 18.61  ? 181 PHE D CE2 1 
ATOM   6982 C CZ  . PHE D 2 181 ? 17.198  -23.062 119.138 1.00 14.67  ? 181 PHE D CZ  1 
ATOM   6983 N N   . PRO D 2 182 ? 17.983  -19.407 125.726 1.00 27.59  ? 182 PRO D N   1 
ATOM   6984 C CA  . PRO D 2 182 ? 17.691  -18.596 126.918 1.00 24.15  ? 182 PRO D CA  1 
ATOM   6985 C C   . PRO D 2 182 ? 17.140  -17.249 126.531 1.00 20.64  ? 182 PRO D C   1 
ATOM   6986 O O   . PRO D 2 182 ? 16.393  -16.620 127.250 1.00 21.07  ? 182 PRO D O   1 
ATOM   6987 C CB  . PRO D 2 182 ? 19.077  -18.432 127.563 1.00 22.87  ? 182 PRO D CB  1 
ATOM   6988 C CG  . PRO D 2 182 ? 20.014  -18.587 126.447 1.00 24.13  ? 182 PRO D CG  1 
ATOM   6989 C CD  . PRO D 2 182 ? 19.409  -19.694 125.603 1.00 26.92  ? 182 PRO D CD  1 
ATOM   6990 N N   . ASN D 2 183 ? 17.516  -16.809 125.340 1.00 18.94  ? 183 ASN D N   1 
ATOM   6991 C CA  . ASN D 2 183 ? 17.074  -15.528 124.778 1.00 15.62  ? 183 ASN D CA  1 
ATOM   6992 C C   . ASN D 2 183 ? 15.517  -15.475 124.741 1.00 16.52  ? 183 ASN D C   1 
ATOM   6993 O O   . ASN D 2 183 ? 14.886  -14.535 125.237 1.00 15.59  ? 183 ASN D O   1 
ATOM   6994 C CB  . ASN D 2 183 ? 17.640  -15.388 123.347 1.00 10.58  ? 183 ASN D CB  1 
ATOM   6995 C CG  . ASN D 2 183 ? 17.523  -14.022 122.843 1.00 6.84   ? 183 ASN D CG  1 
ATOM   6996 O OD1 . ASN D 2 183 ? 17.337  -13.080 123.619 1.00 8.92   ? 183 ASN D OD1 1 
ATOM   6997 N ND2 . ASN D 2 183 ? 17.633  -13.865 121.550 1.00 7.99   ? 183 ASN D ND2 1 
ATOM   6998 N N   . LEU D 2 184 ? 14.928  -16.503 124.158 1.00 15.11  ? 184 LEU D N   1 
ATOM   6999 C CA  . LEU D 2 184 ? 13.492  -16.593 123.965 1.00 12.60  ? 184 LEU D CA  1 
ATOM   7000 C C   . LEU D 2 184 ? 12.781  -16.798 125.291 1.00 12.76  ? 184 LEU D C   1 
ATOM   7001 O O   . LEU D 2 184 ? 11.732  -16.197 125.519 1.00 14.33  ? 184 LEU D O   1 
ATOM   7002 C CB  . LEU D 2 184 ? 13.141  -17.722 122.983 1.00 9.98   ? 184 LEU D CB  1 
ATOM   7003 C CG  . LEU D 2 184 ? 13.665  -17.562 121.552 1.00 6.59   ? 184 LEU D CG  1 
ATOM   7004 C CD1 . LEU D 2 184 ? 13.266  -18.793 120.731 1.00 5.27   ? 184 LEU D CD1 1 
ATOM   7005 C CD2 . LEU D 2 184 ? 13.165  -16.249 120.959 1.00 3.73   ? 184 LEU D CD2 1 
ATOM   7006 N N   . LYS D 2 185 ? 13.334  -17.649 126.166 1.00 13.47  ? 185 LYS D N   1 
ATOM   7007 C CA  . LYS D 2 185 ? 12.743  -17.875 127.487 1.00 12.56  ? 185 LYS D CA  1 
ATOM   7008 C C   . LYS D 2 185 ? 12.578  -16.578 128.257 1.00 8.71   ? 185 LYS D C   1 
ATOM   7009 O O   . LYS D 2 185 ? 11.538  -16.321 128.847 1.00 7.88   ? 185 LYS D O   1 
ATOM   7010 C CB  . LYS D 2 185 ? 13.577  -18.868 128.298 1.00 14.78  ? 185 LYS D CB  1 
ATOM   7011 C CG  . LYS D 2 185 ? 13.633  -20.252 127.663 1.00 23.35  ? 185 LYS D CG  1 
ATOM   7012 C CD  . LYS D 2 185 ? 14.236  -21.302 128.601 1.00 30.02  ? 185 LYS D CD  1 
ATOM   7013 C CE  . LYS D 2 185 ? 15.756  -21.100 128.727 1.00 37.59  ? 185 LYS D CE  1 
ATOM   7014 N NZ  . LYS D 2 185 ? 16.395  -22.202 129.494 1.00 39.07  ? 185 LYS D NZ  1 
ATOM   7015 N N   . ALA D 2 186 ? 13.610  -15.739 128.191 1.00 5.80   ? 186 ALA D N   1 
ATOM   7016 C CA  . ALA D 2 186 ? 13.577  -14.425 128.810 1.00 8.29   ? 186 ALA D CA  1 
ATOM   7017 C C   . ALA D 2 186 ? 12.430  -13.570 128.285 1.00 13.35  ? 186 ALA D C   1 
ATOM   7018 O O   . ALA D 2 186 ? 11.719  -12.939 129.062 1.00 16.82  ? 186 ALA D O   1 
ATOM   7019 C CB  . ALA D 2 186 ? 14.925  -13.700 128.576 1.00 10.10  ? 186 ALA D CB  1 
ATOM   7020 N N   . PHE D 2 187 ? 12.261  -13.571 126.962 1.00 16.42  ? 187 PHE D N   1 
ATOM   7021 C CA  . PHE D 2 187 ? 11.165  -12.874 126.313 1.00 14.41  ? 187 PHE D CA  1 
ATOM   7022 C C   . PHE D 2 187 ? 9.834   -13.315 126.945 1.00 13.75  ? 187 PHE D C   1 
ATOM   7023 O O   . PHE D 2 187 ? 9.015   -12.478 127.339 1.00 14.01  ? 187 PHE D O   1 
ATOM   7024 C CB  . PHE D 2 187 ? 11.176  -13.152 124.802 1.00 17.47  ? 187 PHE D CB  1 
ATOM   7025 C CG  . PHE D 2 187 ? 9.931   -12.722 124.097 1.00 19.66  ? 187 PHE D CG  1 
ATOM   7026 C CD1 . PHE D 2 187 ? 9.700   -11.364 123.831 1.00 22.18  ? 187 PHE D CD1 1 
ATOM   7027 C CD2 . PHE D 2 187 ? 8.941   -13.660 123.781 1.00 19.82  ? 187 PHE D CD2 1 
ATOM   7028 C CE1 . PHE D 2 187 ? 8.498   -10.956 123.241 1.00 19.70  ? 187 PHE D CE1 1 
ATOM   7029 C CE2 . PHE D 2 187 ? 7.757   -13.257 123.211 1.00 16.59  ? 187 PHE D CE2 1 
ATOM   7030 C CZ  . PHE D 2 187 ? 7.539   -11.896 122.940 1.00 16.15  ? 187 PHE D CZ  1 
ATOM   7031 N N   . MET D 2 188 ? 9.629   -14.631 127.019 1.00 11.76  ? 188 MET D N   1 
ATOM   7032 C CA  . MET D 2 188 ? 8.402   -15.185 127.557 1.00 11.03  ? 188 MET D CA  1 
ATOM   7033 C C   . MET D 2 188 ? 8.103   -14.655 128.938 1.00 15.69  ? 188 MET D C   1 
ATOM   7034 O O   . MET D 2 188 ? 7.017   -14.150 129.165 1.00 17.80  ? 188 MET D O   1 
ATOM   7035 C CB  . MET D 2 188 ? 8.472   -16.693 127.587 1.00 5.83   ? 188 MET D CB  1 
ATOM   7036 C CG  . MET D 2 188 ? 8.701   -17.318 126.205 1.00 8.11   ? 188 MET D CG  1 
ATOM   7037 S SD  . MET D 2 188 ? 7.384   -16.997 125.008 1.00 10.78  ? 188 MET D SD  1 
ATOM   7038 C CE  . MET D 2 188 ? 6.684   -18.578 124.949 1.00 5.02   ? 188 MET D CE  1 
ATOM   7039 N N   . CYS D 2 189 ? 9.078   -14.728 129.849 1.00 16.67  ? 189 CYS D N   1 
ATOM   7040 C CA  . CYS D 2 189 ? 8.872   -14.246 131.217 1.00 16.55  ? 189 CYS D CA  1 
ATOM   7041 C C   . CYS D 2 189 ? 8.567   -12.754 131.239 1.00 16.17  ? 189 CYS D C   1 
ATOM   7042 O O   . CYS D 2 189 ? 7.682   -12.298 131.933 1.00 17.12  ? 189 CYS D O   1 
ATOM   7043 C CB  . CYS D 2 189 ? 10.107  -14.514 132.076 1.00 15.96  ? 189 CYS D CB  1 
ATOM   7044 S SG  . CYS D 2 189 ? 10.446  -16.291 132.373 1.00 20.54  ? 189 CYS D SG  1 
ATOM   7045 N N   . ARG D 2 190 ? 9.315   -11.994 130.441 1.00 16.98  ? 190 ARG D N   1 
ATOM   7046 C CA  . ARG D 2 190 ? 9.157   -10.548 130.365 1.00 18.08  ? 190 ARG D CA  1 
ATOM   7047 C C   . ARG D 2 190 ? 7.759   -10.205 129.886 1.00 20.29  ? 190 ARG D C   1 
ATOM   7048 O O   . ARG D 2 190 ? 7.176   -9.243  130.386 1.00 22.62  ? 190 ARG D O   1 
ATOM   7049 C CB  . ARG D 2 190 ? 10.193  -9.980  129.395 1.00 18.60  ? 190 ARG D CB  1 
ATOM   7050 C CG  . ARG D 2 190 ? 10.208  -8.488  129.258 1.00 19.21  ? 190 ARG D CG  1 
ATOM   7051 C CD  . ARG D 2 190 ? 11.565  -7.933  128.819 1.00 21.28  ? 190 ARG D CD  1 
ATOM   7052 N NE  . ARG D 2 190 ? 12.005  -8.453  127.535 1.00 24.04  ? 190 ARG D NE  1 
ATOM   7053 C CZ  . ARG D 2 190 ? 12.774  -9.523  127.389 1.00 25.08  ? 190 ARG D CZ  1 
ATOM   7054 N NH1 . ARG D 2 190 ? 13.177  -10.232 128.434 1.00 23.35  ? 190 ARG D NH1 1 
ATOM   7055 N NH2 . ARG D 2 190 ? 13.141  -9.890  126.175 1.00 25.60  ? 190 ARG D NH2 1 
ATOM   7056 N N   . PHE D 2 191 ? 7.234   -10.984 128.940 1.00 22.53  ? 191 PHE D N   1 
ATOM   7057 C CA  . PHE D 2 191 ? 5.890   -10.782 128.410 1.00 20.37  ? 191 PHE D CA  1 
ATOM   7058 C C   . PHE D 2 191 ? 4.787   -11.161 129.420 1.00 14.98  ? 191 PHE D C   1 
ATOM   7059 O O   . PHE D 2 191 ? 3.883   -10.378 129.694 1.00 14.67  ? 191 PHE D O   1 
ATOM   7060 C CB  . PHE D 2 191 ? 5.713   -11.553 127.105 1.00 22.93  ? 191 PHE D CB  1 
ATOM   7061 C CG  . PHE D 2 191 ? 4.421   -11.268 126.402 1.00 26.18  ? 191 PHE D CG  1 
ATOM   7062 C CD1 . PHE D 2 191 ? 4.291   -10.111 125.618 1.00 26.23  ? 191 PHE D CD1 1 
ATOM   7063 C CD2 . PHE D 2 191 ? 3.307   -12.117 126.574 1.00 28.68  ? 191 PHE D CD2 1 
ATOM   7064 C CE1 . PHE D 2 191 ? 3.067   -9.809  124.997 1.00 28.33  ? 191 PHE D CE1 1 
ATOM   7065 C CE2 . PHE D 2 191 ? 2.073   -11.834 125.966 1.00 31.01  ? 191 PHE D CE2 1 
ATOM   7066 C CZ  . PHE D 2 191 ? 1.950   -10.681 125.177 1.00 31.16  ? 191 PHE D CZ  1 
ATOM   7067 N N   . GLU D 2 192 ? 4.874   -12.372 129.967 1.00 12.21  ? 192 GLU D N   1 
ATOM   7068 C CA  . GLU D 2 192 ? 3.913   -12.839 130.945 1.00 13.19  ? 192 GLU D CA  1 
ATOM   7069 C C   . GLU D 2 192 ? 3.942   -12.066 132.267 1.00 16.55  ? 192 GLU D C   1 
ATOM   7070 O O   . GLU D 2 192 ? 2.991   -12.108 133.029 1.00 17.02  ? 192 GLU D O   1 
ATOM   7071 C CB  . GLU D 2 192 ? 4.141   -14.323 131.204 1.00 8.51   ? 192 GLU D CB  1 
ATOM   7072 C CG  . GLU D 2 192 ? 3.887   -15.184 129.992 1.00 8.34   ? 192 GLU D CG  1 
ATOM   7073 C CD  . GLU D 2 192 ? 4.262   -16.640 130.191 1.00 8.86   ? 192 GLU D CD  1 
ATOM   7074 O OE1 . GLU D 2 192 ? 5.477   -16.907 130.128 1.00 10.89  ? 192 GLU D OE1 1 
ATOM   7075 O OE2 . GLU D 2 192 ? 3.375   -17.508 130.415 1.00 15.12  ? 192 GLU D OE2 1 
ATOM   7076 N N   . ALA D 2 193 ? 5.030   -11.358 132.536 1.00 19.08  ? 193 ALA D N   1 
ATOM   7077 C CA  . ALA D 2 193 ? 5.155   -10.589 133.761 1.00 22.11  ? 193 ALA D CA  1 
ATOM   7078 C C   . ALA D 2 193 ? 4.441   -9.243  133.674 1.00 23.88  ? 193 ALA D C   1 
ATOM   7079 O O   . ALA D 2 193 ? 4.349   -8.523  134.672 1.00 26.21  ? 193 ALA D O   1 
ATOM   7080 C CB  . ALA D 2 193 ? 6.628   -10.361 134.053 1.00 21.54  ? 193 ALA D CB  1 
ATOM   7081 N N   . LEU D 2 194 ? 3.929   -8.909  132.496 1.00 25.02  ? 194 LEU D N   1 
ATOM   7082 C CA  . LEU D 2 194 ? 3.214   -7.656  132.332 1.00 26.47  ? 194 LEU D CA  1 
ATOM   7083 C C   . LEU D 2 194 ? 1.935   -7.767  133.112 1.00 28.99  ? 194 LEU D C   1 
ATOM   7084 O O   . LEU D 2 194 ? 1.183   -8.697  132.902 1.00 31.09  ? 194 LEU D O   1 
ATOM   7085 C CB  . LEU D 2 194 ? 2.926   -7.406  130.845 1.00 25.75  ? 194 LEU D CB  1 
ATOM   7086 C CG  . LEU D 2 194 ? 4.133   -7.199  129.899 1.00 24.84  ? 194 LEU D CG  1 
ATOM   7087 C CD1 . LEU D 2 194 ? 3.693   -7.240  128.446 1.00 21.97  ? 194 LEU D CD1 1 
ATOM   7088 C CD2 . LEU D 2 194 ? 4.805   -5.855  130.208 1.00 24.44  ? 194 LEU D CD2 1 
ATOM   7089 N N   . GLU D 2 195 ? 1.708   -6.815  134.017 1.00 30.51  ? 195 GLU D N   1 
ATOM   7090 C CA  . GLU D 2 195 ? 0.533   -6.769  134.908 1.00 30.50  ? 195 GLU D CA  1 
ATOM   7091 C C   . GLU D 2 195 ? -0.760  -7.323  134.283 1.00 29.52  ? 195 GLU D C   1 
ATOM   7092 O O   . GLU D 2 195 ? -1.311  -8.332  134.787 1.00 28.54  ? 195 GLU D O   1 
ATOM   7093 C CB  . GLU D 2 195 ? 0.285   -5.326  135.411 1.00 34.48  ? 195 GLU D CB  1 
ATOM   7094 C CG  . GLU D 2 195 ? 1.200   -4.881  136.565 1.00 40.09  ? 195 GLU D CG  1 
ATOM   7095 C CD  . GLU D 2 195 ? 2.704   -4.830  136.166 1.00 42.70  ? 195 GLU D CD  1 
ATOM   7096 O OE1 . GLU D 2 195 ? 3.144   -3.787  135.605 1.00 41.77  ? 195 GLU D OE1 1 
ATOM   7097 O OE2 . GLU D 2 195 ? 3.431   -5.841  136.388 1.00 44.01  ? 195 GLU D OE2 1 
ATOM   7098 N N   . LYS D 2 196 ? -1.203  -6.688  133.193 1.00 28.72  ? 196 LYS D N   1 
ATOM   7099 C CA  . LYS D 2 196 ? -2.422  -7.076  132.490 1.00 27.42  ? 196 LYS D CA  1 
ATOM   7100 C C   . LYS D 2 196 ? -2.377  -8.524  131.993 1.00 23.95  ? 196 LYS D C   1 
ATOM   7101 O O   . LYS D 2 196 ? -3.357  -9.277  132.139 1.00 23.29  ? 196 LYS D O   1 
ATOM   7102 C CB  . LYS D 2 196 ? -2.653  -6.132  131.325 1.00 29.81  ? 196 LYS D CB  1 
ATOM   7103 C CG  . LYS D 2 196 ? -3.395  -4.865  131.696 1.00 32.75  ? 196 LYS D CG  1 
ATOM   7104 C CD  . LYS D 2 196 ? -2.495  -3.897  132.416 1.00 35.56  ? 196 LYS D CD  1 
ATOM   7105 C CE  . LYS D 2 196 ? -3.201  -2.557  132.632 1.00 37.59  ? 196 LYS D CE  1 
ATOM   7106 N NZ  . LYS D 2 196 ? -2.418  -1.575  133.456 1.00 39.30  ? 196 LYS D NZ  1 
ATOM   7107 N N   . ILE D 2 197 ? -1.227  -8.926  131.455 1.00 20.27  ? 197 ILE D N   1 
ATOM   7108 C CA  . ILE D 2 197 ? -1.067  -10.254 130.886 1.00 20.86  ? 197 ILE D CA  1 
ATOM   7109 C C   . ILE D 2 197 ? -1.120  -11.321 131.969 1.00 19.87  ? 197 ILE D C   1 
ATOM   7110 O O   . ILE D 2 197 ? -1.877  -12.276 131.866 1.00 21.43  ? 197 ILE D O   1 
ATOM   7111 C CB  . ILE D 2 197 ? 0.243   -10.378 130.077 1.00 20.65  ? 197 ILE D CB  1 
ATOM   7112 C CG1 . ILE D 2 197 ? 0.366   -9.184  129.113 1.00 20.07  ? 197 ILE D CG1 1 
ATOM   7113 C CG2 . ILE D 2 197 ? 0.283   -11.718 129.323 1.00 21.67  ? 197 ILE D CG2 1 
ATOM   7114 C CD1 . ILE D 2 197 ? -0.707  -9.104  128.049 1.00 21.02  ? 197 ILE D CD1 1 
ATOM   7115 N N   . ALA D 2 198 ? -0.307  -11.139 133.019 1.00 19.85  ? 198 ALA D N   1 
ATOM   7116 C CA  . ALA D 2 198 ? -0.224  -12.081 134.140 1.00 17.77  ? 198 ALA D CA  1 
ATOM   7117 C C   . ALA D 2 198 ? -1.589  -12.345 134.782 1.00 18.32  ? 198 ALA D C   1 
ATOM   7118 O O   . ALA D 2 198 ? -1.959  -13.519 135.014 1.00 16.58  ? 198 ALA D O   1 
ATOM   7119 C CB  . ALA D 2 198 ? 0.720   -11.529 135.194 1.00 18.59  ? 198 ALA D CB  1 
ATOM   7120 N N   . ALA D 2 199 ? -2.321  -11.264 135.028 1.00 16.06  ? 199 ALA D N   1 
ATOM   7121 C CA  . ALA D 2 199 ? -3.641  -11.336 135.614 1.00 13.71  ? 199 ALA D CA  1 
ATOM   7122 C C   . ALA D 2 199 ? -4.544  -12.206 134.725 1.00 16.78  ? 199 ALA D C   1 
ATOM   7123 O O   . ALA D 2 199 ? -5.144  -13.178 135.231 1.00 20.15  ? 199 ALA D O   1 
ATOM   7124 C CB  . ALA D 2 199 ? -4.198  -9.954  135.777 1.00 13.08  ? 199 ALA D CB  1 
ATOM   7125 N N   . TYR D 2 200 ? -4.611  -11.872 133.434 1.00 19.63  ? 200 TYR D N   1 
ATOM   7126 C CA  . TYR D 2 200 ? -5.431  -12.598 132.470 1.00 21.00  ? 200 TYR D CA  1 
ATOM   7127 C C   . TYR D 2 200 ? -5.049  -14.081 132.430 1.00 23.44  ? 200 TYR D C   1 
ATOM   7128 O O   . TYR D 2 200 ? -5.917  -14.947 132.414 1.00 23.92  ? 200 TYR D O   1 
ATOM   7129 C CB  . TYR D 2 200 ? -5.294  -11.968 131.078 1.00 20.98  ? 200 TYR D CB  1 
ATOM   7130 C CG  . TYR D 2 200 ? -6.105  -12.687 130.008 1.00 22.99  ? 200 TYR D CG  1 
ATOM   7131 C CD1 . TYR D 2 200 ? -7.457  -12.350 129.799 1.00 19.98  ? 200 TYR D CD1 1 
ATOM   7132 C CD2 . TYR D 2 200 ? -5.546  -13.754 129.260 1.00 21.74  ? 200 TYR D CD2 1 
ATOM   7133 C CE1 . TYR D 2 200 ? -8.244  -13.050 128.865 1.00 19.18  ? 200 TYR D CE1 1 
ATOM   7134 C CE2 . TYR D 2 200 ? -6.314  -14.461 128.338 1.00 20.69  ? 200 TYR D CE2 1 
ATOM   7135 C CZ  . TYR D 2 200 ? -7.672  -14.110 128.146 1.00 19.64  ? 200 TYR D CZ  1 
ATOM   7136 O OH  . TYR D 2 200 ? -8.444  -14.842 127.252 1.00 17.80  ? 200 TYR D OH  1 
ATOM   7137 N N   . LEU D 2 201 ? -3.750  -14.378 132.395 1.00 25.68  ? 201 LEU D N   1 
ATOM   7138 C CA  . LEU D 2 201 ? -3.290  -15.764 132.296 1.00 31.23  ? 201 LEU D CA  1 
ATOM   7139 C C   . LEU D 2 201 ? -3.715  -16.613 133.501 1.00 32.16  ? 201 LEU D C   1 
ATOM   7140 O O   . LEU D 2 201 ? -3.846  -17.821 133.398 1.00 32.49  ? 201 LEU D O   1 
ATOM   7141 C CB  . LEU D 2 201 ? -1.763  -15.803 132.112 1.00 32.66  ? 201 LEU D CB  1 
ATOM   7142 C CG  . LEU D 2 201 ? -1.219  -15.100 130.855 1.00 34.32  ? 201 LEU D CG  1 
ATOM   7143 C CD1 . LEU D 2 201 ? 0.296   -15.127 130.856 1.00 32.82  ? 201 LEU D CD1 1 
ATOM   7144 C CD2 . LEU D 2 201 ? -1.770  -15.772 129.619 1.00 33.80  ? 201 LEU D CD2 1 
ATOM   7145 N N   . GLN D 2 202 ? -3.921  -15.969 134.640 1.00 35.16  ? 202 GLN D N   1 
ATOM   7146 C CA  . GLN D 2 202 ? -4.352  -16.657 135.838 1.00 38.10  ? 202 GLN D CA  1 
ATOM   7147 C C   . GLN D 2 202 ? -5.871  -16.730 135.912 1.00 41.53  ? 202 GLN D C   1 
ATOM   7148 O O   . GLN D 2 202 ? -6.413  -17.381 136.821 1.00 41.61  ? 202 GLN D O   1 
ATOM   7149 C CB  . GLN D 2 202 ? -3.809  -15.938 137.072 1.00 38.79  ? 202 GLN D CB  1 
ATOM   7150 C CG  . GLN D 2 202 ? -2.275  -16.025 137.217 1.00 40.23  ? 202 GLN D CG  1 
ATOM   7151 C CD  . GLN D 2 202 ? -1.767  -15.371 138.496 1.00 39.41  ? 202 GLN D CD  1 
ATOM   7152 O OE1 . GLN D 2 202 ? -1.473  -14.178 138.517 1.00 37.02  ? 202 GLN D OE1 1 
ATOM   7153 N NE2 . GLN D 2 202 ? -1.666  -16.152 139.563 1.00 39.50  ? 202 GLN D NE2 1 
ATOM   7154 N N   . SER D 2 203 ? -6.547  -16.064 134.973 1.00 44.13  ? 203 SER D N   1 
ATOM   7155 C CA  . SER D 2 203 ? -8.014  -16.000 134.950 1.00 43.75  ? 203 SER D CA  1 
ATOM   7156 C C   . SER D 2 203 ? -8.677  -17.361 134.711 1.00 44.02  ? 203 SER D C   1 
ATOM   7157 O O   . SER D 2 203 ? -8.118  -18.249 134.035 1.00 45.46  ? 203 SER D O   1 
ATOM   7158 C CB  . SER D 2 203 ? -8.475  -15.054 133.851 1.00 43.90  ? 203 SER D CB  1 
ATOM   7159 O OG  . SER D 2 203 ? -9.857  -14.820 133.959 1.00 46.95  ? 203 SER D OG  1 
ATOM   7160 N N   . ASP D 2 204 ? -9.858  -17.527 135.296 1.00 44.37  ? 204 ASP D N   1 
ATOM   7161 C CA  . ASP D 2 204 ? -10.604 -18.775 135.223 1.00 45.94  ? 204 ASP D CA  1 
ATOM   7162 C C   . ASP D 2 204 ? -10.934 -19.207 133.769 1.00 45.88  ? 204 ASP D C   1 
ATOM   7163 O O   . ASP D 2 204 ? -10.523 -20.284 133.336 1.00 45.07  ? 204 ASP D O   1 
ATOM   7164 C CB  . ASP D 2 204 ? -11.882 -18.670 136.071 1.00 48.36  ? 204 ASP D CB  1 
ATOM   7165 C CG  . ASP D 2 204 ? -12.769 -17.474 135.663 1.00 52.16  ? 204 ASP D CG  1 
ATOM   7166 O OD1 . ASP D 2 204 ? -12.380 -16.312 135.929 1.00 57.78  ? 204 ASP D OD1 1 
ATOM   7167 O OD2 . ASP D 2 204 ? -13.853 -17.699 135.067 1.00 51.89  ? 204 ASP D OD2 1 
ATOM   7168 N N   . GLN D 2 205 ? -11.657 -18.365 133.021 1.00 45.66  ? 205 GLN D N   1 
ATOM   7169 C CA  . GLN D 2 205 ? -12.079 -18.716 131.664 1.00 46.77  ? 205 GLN D CA  1 
ATOM   7170 C C   . GLN D 2 205 ? -10.879 -19.132 130.829 1.00 45.93  ? 205 GLN D C   1 
ATOM   7171 O O   . GLN D 2 205 ? -10.968 -20.119 130.085 1.00 46.78  ? 205 GLN D O   1 
ATOM   7172 C CB  . GLN D 2 205 ? -12.849 -17.562 130.985 1.00 47.91  ? 205 GLN D CB  1 
ATOM   7173 C CG  . GLN D 2 205 ? -12.041 -16.311 130.654 1.00 50.32  ? 205 GLN D CG  1 
ATOM   7174 C CD  . GLN D 2 205 ? -12.093 -15.272 131.793 1.00 51.99  ? 205 GLN D CD  1 
ATOM   7175 O OE1 . GLN D 2 205 ? -12.291 -15.617 132.990 1.00 53.23  ? 205 GLN D OE1 1 
ATOM   7176 N NE2 . GLN D 2 205 ? -11.916 -13.995 131.426 1.00 51.64  ? 205 GLN D NE2 1 
ATOM   7177 N N   . PHE D 2 206 ? -9.768  -18.403 130.974 1.00 43.91  ? 206 PHE D N   1 
ATOM   7178 C CA  . PHE D 2 206 ? -8.565  -18.671 130.207 1.00 43.24  ? 206 PHE D CA  1 
ATOM   7179 C C   . PHE D 2 206 ? -8.124  -20.138 130.330 1.00 44.33  ? 206 PHE D C   1 
ATOM   7180 O O   . PHE D 2 206 ? -7.697  -20.776 129.355 1.00 46.20  ? 206 PHE D O   1 
ATOM   7181 C CB  . PHE D 2 206 ? -7.443  -17.714 130.605 1.00 40.27  ? 206 PHE D CB  1 
ATOM   7182 C CG  . PHE D 2 206 ? -6.160  -17.964 129.890 1.00 37.41  ? 206 PHE D CG  1 
ATOM   7183 C CD1 . PHE D 2 206 ? -6.093  -17.843 128.499 1.00 36.60  ? 206 PHE D CD1 1 
ATOM   7184 C CD2 . PHE D 2 206 ? -5.034  -18.390 130.586 1.00 36.00  ? 206 PHE D CD2 1 
ATOM   7185 C CE1 . PHE D 2 206 ? -4.903  -18.132 127.809 1.00 34.00  ? 206 PHE D CE1 1 
ATOM   7186 C CE2 . PHE D 2 206 ? -3.828  -18.678 129.909 1.00 34.85  ? 206 PHE D CE2 1 
ATOM   7187 C CZ  . PHE D 2 206 ? -3.762  -18.553 128.517 1.00 35.35  ? 206 PHE D CZ  1 
ATOM   7188 N N   . CYS D 2 207 ? -8.239  -20.674 131.547 1.00 45.95  ? 207 CYS D N   1 
ATOM   7189 C CA  . CYS D 2 207 ? -7.826  -22.038 131.822 1.00 46.83  ? 207 CYS D CA  1 
ATOM   7190 C C   . CYS D 2 207 ? -8.769  -23.070 131.201 1.00 47.01  ? 207 CYS D C   1 
ATOM   7191 O O   . CYS D 2 207 ? -8.379  -24.213 130.947 1.00 48.71  ? 207 CYS D O   1 
ATOM   7192 C CB  . CYS D 2 207 ? -7.707  -22.262 133.338 1.00 47.35  ? 207 CYS D CB  1 
ATOM   7193 S SG  . CYS D 2 207 ? -6.553  -21.093 134.196 1.00 52.74  ? 207 CYS D SG  1 
ATOM   7194 N N   . LYS D 2 208 ? -10.016 -22.684 130.972 1.00 47.82  ? 208 LYS D N   1 
ATOM   7195 C CA  . LYS D 2 208 ? -10.989 -23.624 130.422 1.00 47.93  ? 208 LYS D CA  1 
ATOM   7196 C C   . LYS D 2 208 ? -11.074 -23.616 128.891 1.00 45.40  ? 208 LYS D C   1 
ATOM   7197 O O   . LYS D 2 208 ? -11.859 -24.371 128.316 1.00 44.87  ? 208 LYS D O   1 
ATOM   7198 C CB  . LYS D 2 208 ? -12.378 -23.369 131.027 1.00 47.61  ? 208 LYS D CB  1 
ATOM   7199 C CG  . LYS D 2 208 ? -12.735 -24.314 132.184 1.00 49.44  ? 208 LYS D CG  1 
ATOM   7200 C CD  . LYS D 2 208 ? -11.814 -24.101 133.390 1.00 50.83  ? 208 LYS D CD  1 
ATOM   7201 C CE  . LYS D 2 208 ? -12.057 -22.744 134.032 1.00 52.63  ? 208 LYS D CE  1 
ATOM   7202 N NZ  . LYS D 2 208 ? -11.014 -22.423 135.062 1.00 51.06  ? 208 LYS D NZ  1 
ATOM   7203 N N   . MET D 2 209 ? -10.273 -22.769 128.238 1.00 44.08  ? 209 MET D N   1 
ATOM   7204 C CA  . MET D 2 209 ? -10.282 -22.681 126.771 1.00 43.94  ? 209 MET D CA  1 
ATOM   7205 C C   . MET D 2 209 ? -9.300  -23.659 126.114 1.00 42.31  ? 209 MET D C   1 
ATOM   7206 O O   . MET D 2 209 ? -8.123  -23.696 126.467 1.00 41.46  ? 209 MET D O   1 
ATOM   7207 C CB  . MET D 2 209 ? -9.939  -21.262 126.323 1.00 45.51  ? 209 MET D CB  1 
ATOM   7208 C CG  . MET D 2 209 ? -11.141 -20.341 126.274 1.00 46.79  ? 209 MET D CG  1 
ATOM   7209 S SD  . MET D 2 209 ? -10.730 -18.875 125.328 1.00 51.69  ? 209 MET D SD  1 
ATOM   7210 C CE  . MET D 2 209 ? -9.805  -17.917 126.566 1.00 48.63  ? 209 MET D CE  1 
ATOM   7211 N N   . PRO D 2 210 ? -9.791  -24.511 125.193 1.00 41.24  ? 210 PRO D N   1 
ATOM   7212 C CA  . PRO D 2 210 ? -8.923  -25.383 124.416 1.00 39.97  ? 210 PRO D CA  1 
ATOM   7213 C C   . PRO D 2 210 ? -8.040  -24.595 123.487 1.00 40.18  ? 210 PRO D C   1 
ATOM   7214 O O   . PRO D 2 210 ? -8.390  -23.498 123.057 1.00 40.09  ? 210 PRO D O   1 
ATOM   7215 C CB  . PRO D 2 210 ? -9.916  -26.248 123.656 1.00 39.29  ? 210 PRO D CB  1 
ATOM   7216 C CG  . PRO D 2 210 ? -11.188 -26.145 124.435 1.00 41.01  ? 210 PRO D CG  1 
ATOM   7217 C CD  . PRO D 2 210 ? -11.200 -24.722 124.869 1.00 40.18  ? 210 PRO D CD  1 
ATOM   7218 N N   . ILE D 2 211 ? -6.882  -25.164 123.152 1.00 38.99  ? 211 ILE D N   1 
ATOM   7219 C CA  . ILE D 2 211 ? -5.929  -24.466 122.286 1.00 39.77  ? 211 ILE D CA  1 
ATOM   7220 C C   . ILE D 2 211 ? -6.522  -24.424 120.875 1.00 39.33  ? 211 ILE D C   1 
ATOM   7221 O O   . ILE D 2 211 ? -6.532  -23.362 120.234 1.00 37.63  ? 211 ILE D O   1 
ATOM   7222 C CB  . ILE D 2 211 ? -4.530  -25.166 122.245 1.00 39.39  ? 211 ILE D CB  1 
ATOM   7223 C CG1 . ILE D 2 211 ? -3.985  -25.312 123.666 1.00 38.01  ? 211 ILE D CG1 1 
ATOM   7224 C CG2 . ILE D 2 211 ? -3.554  -24.359 121.403 1.00 38.47  ? 211 ILE D CG2 1 
ATOM   7225 C CD1 . ILE D 2 211 ? -2.755  -26.204 123.762 1.00 40.54  ? 211 ILE D CD1 1 
ATOM   7226 N N   . ASN D 2 212 ? -7.023  -25.581 120.414 1.00 38.78  ? 212 ASN D N   1 
ATOM   7227 C CA  . ASN D 2 212 ? -7.579  -25.716 119.076 1.00 40.46  ? 212 ASN D CA  1 
ATOM   7228 C C   . ASN D 2 212 ? -9.037  -26.146 119.158 1.00 41.78  ? 212 ASN D C   1 
ATOM   7229 O O   . ASN D 2 212 ? -9.514  -26.551 120.216 1.00 41.04  ? 212 ASN D O   1 
ATOM   7230 C CB  . ASN D 2 212 ? -6.787  -26.733 118.271 1.00 40.88  ? 212 ASN D CB  1 
ATOM   7231 C CG  . ASN D 2 212 ? -5.318  -26.346 118.122 1.00 41.80  ? 212 ASN D CG  1 
ATOM   7232 O OD1 . ASN D 2 212 ? -4.964  -25.163 118.094 1.00 43.52  ? 212 ASN D OD1 1 
ATOM   7233 N ND2 . ASN D 2 212 ? -4.462  -27.359 118.036 1.00 40.57  ? 212 ASN D ND2 1 
ATOM   7234 N N   . ASN D 2 213 ? -9.749  -26.032 118.045 1.00 41.26  ? 213 ASN D N   1 
ATOM   7235 C CA  . ASN D 2 213 ? -11.171 -26.390 118.006 1.00 41.76  ? 213 ASN D CA  1 
ATOM   7236 C C   . ASN D 2 213 ? -11.324 -27.908 118.129 1.00 41.37  ? 213 ASN D C   1 
ATOM   7237 O O   . ASN D 2 213 ? -10.356 -28.661 117.914 1.00 41.61  ? 213 ASN D O   1 
ATOM   7238 C CB  . ASN D 2 213 ? -11.797 -25.912 116.681 1.00 42.87  ? 213 ASN D CB  1 
ATOM   7239 C CG  . ASN D 2 213 ? -13.303 -25.600 116.803 1.00 43.63  ? 213 ASN D CG  1 
ATOM   7240 O OD1 . ASN D 2 213 ? -14.012 -26.218 117.573 1.00 44.12  ? 213 ASN D OD1 1 
ATOM   7241 N ND2 . ASN D 2 213 ? -13.767 -24.629 116.038 1.00 44.18  ? 213 ASN D ND2 1 
ATOM   7242 N N   . LYS D 2 214 ? -12.543 -28.337 118.478 1.00 41.61  ? 214 LYS D N   1 
ATOM   7243 C CA  . LYS D 2 214 ? -12.885 -29.751 118.690 1.00 41.96  ? 214 LYS D CA  1 
ATOM   7244 C C   . LYS D 2 214 ? -12.441 -30.742 117.609 1.00 43.10  ? 214 LYS D C   1 
ATOM   7245 O O   . LYS D 2 214 ? -12.089 -31.886 117.936 1.00 44.84  ? 214 LYS D O   1 
ATOM   7246 C CB  . LYS D 2 214 ? -14.392 -29.911 118.903 1.00 42.34  ? 214 LYS D CB  1 
ATOM   7247 C CG  . LYS D 2 214 ? -14.911 -29.220 120.126 1.00 40.06  ? 214 LYS D CG  1 
ATOM   7248 C CD  . LYS D 2 214 ? -16.398 -29.404 120.277 1.00 41.08  ? 214 LYS D CD  1 
ATOM   7249 C CE  . LYS D 2 214 ? -16.944 -28.670 121.509 1.00 42.97  ? 214 LYS D CE  1 
ATOM   7250 N NZ  . LYS D 2 214 ? -18.409 -28.916 121.716 1.00 41.69  ? 214 LYS D NZ  1 
ATOM   7251 N N   . MET D 2 215 ? -12.416 -30.322 116.344 1.00 43.23  ? 215 MET D N   1 
ATOM   7252 C CA  . MET D 2 215 ? -11.999 -31.202 115.253 1.00 46.02  ? 215 MET D CA  1 
ATOM   7253 C C   . MET D 2 215 ? -10.486 -31.314 115.093 1.00 45.98  ? 215 MET D C   1 
ATOM   7254 O O   . MET D 2 215 ? -10.022 -32.030 114.214 1.00 46.79  ? 215 MET D O   1 
ATOM   7255 C CB  . MET D 2 215 ? -12.627 -30.747 113.930 1.00 47.61  ? 215 MET D CB  1 
ATOM   7256 C CG  . MET D 2 215 ? -12.133 -29.408 113.402 1.00 50.66  ? 215 MET D CG  1 
ATOM   7257 S SD  . MET D 2 215 ? -12.672 -28.000 114.409 1.00 56.03  ? 215 MET D SD  1 
ATOM   7258 C CE  . MET D 2 215 ? -14.462 -28.068 114.179 1.00 53.01  ? 215 MET D CE  1 
ATOM   7259 N N   . ALA D 2 216 ? -9.732  -30.639 115.950 1.00 46.97  ? 216 ALA D N   1 
ATOM   7260 C CA  . ALA D 2 216 ? -8.280  -30.685 115.894 1.00 46.38  ? 216 ALA D CA  1 
ATOM   7261 C C   . ALA D 2 216 ? -7.782  -31.996 116.486 1.00 45.76  ? 216 ALA D C   1 
ATOM   7262 O O   . ALA D 2 216 ? -8.336  -32.508 117.460 1.00 46.20  ? 216 ALA D O   1 
ATOM   7263 C CB  . ALA D 2 216 ? -7.692  -29.519 116.656 1.00 48.13  ? 216 ALA D CB  1 
ATOM   7264 N N   . GLN D 2 217 ? -6.705  -32.521 115.913 1.00 45.27  ? 217 GLN D N   1 
ATOM   7265 C CA  . GLN D 2 217 ? -6.086  -33.752 116.391 1.00 43.40  ? 217 GLN D CA  1 
ATOM   7266 C C   . GLN D 2 217 ? -5.114  -33.479 117.573 1.00 41.83  ? 217 GLN D C   1 
ATOM   7267 O O   . GLN D 2 217 ? -4.362  -34.373 117.991 1.00 42.37  ? 217 GLN D O   1 
ATOM   7268 C CB  . GLN D 2 217 ? -5.312  -34.405 115.244 1.00 44.38  ? 217 GLN D CB  1 
ATOM   7269 C CG  . GLN D 2 217 ? -5.349  -35.904 115.254 1.00 45.05  ? 217 GLN D CG  1 
ATOM   7270 C CD  . GLN D 2 217 ? -6.700  -36.450 114.908 1.00 45.25  ? 217 GLN D CD  1 
ATOM   7271 O OE1 . GLN D 2 217 ? -7.185  -37.384 115.558 1.00 46.70  ? 217 GLN D OE1 1 
ATOM   7272 N NE2 . GLN D 2 217 ? -7.330  -35.879 113.881 1.00 45.62  ? 217 GLN D NE2 1 
ATOM   7273 N N   . TRP D 2 218 ? -5.144  -32.257 118.107 1.00 40.24  ? 218 TRP D N   1 
ATOM   7274 C CA  . TRP D 2 218 ? -4.307  -31.887 119.247 1.00 39.75  ? 218 TRP D CA  1 
ATOM   7275 C C   . TRP D 2 218 ? -4.839  -30.597 119.860 1.00 39.49  ? 218 TRP D C   1 
ATOM   7276 O O   . TRP D 2 218 ? -5.354  -29.735 119.143 1.00 39.78  ? 218 TRP D O   1 
ATOM   7277 C CB  . TRP D 2 218 ? -2.852  -31.719 118.800 1.00 37.35  ? 218 TRP D CB  1 
ATOM   7278 C CG  . TRP D 2 218 ? -1.933  -31.303 119.910 1.00 34.86  ? 218 TRP D CG  1 
ATOM   7279 C CD1 . TRP D 2 218 ? -1.348  -32.119 120.835 1.00 34.74  ? 218 TRP D CD1 1 
ATOM   7280 C CD2 . TRP D 2 218 ? -1.532  -29.953 120.233 1.00 34.47  ? 218 TRP D CD2 1 
ATOM   7281 N NE1 . TRP D 2 218 ? -0.588  -31.365 121.711 1.00 34.75  ? 218 TRP D NE1 1 
ATOM   7282 C CE2 . TRP D 2 218 ? -0.678  -30.049 121.370 1.00 35.70  ? 218 TRP D CE2 1 
ATOM   7283 C CE3 . TRP D 2 218 ? -1.803  -28.695 119.673 1.00 33.30  ? 218 TRP D CE3 1 
ATOM   7284 C CZ2 . TRP D 2 218 ? -0.102  -28.890 121.965 1.00 34.52  ? 218 TRP D CZ2 1 
ATOM   7285 C CZ3 . TRP D 2 218 ? -1.215  -27.541 120.258 1.00 32.87  ? 218 TRP D CZ3 1 
ATOM   7286 C CH2 . TRP D 2 218 ? -0.379  -27.657 121.400 1.00 33.67  ? 218 TRP D CH2 1 
ATOM   7287 N N   . GLY D 2 219 ? -4.673  -30.461 121.177 1.00 38.77  ? 219 GLY D N   1 
ATOM   7288 C CA  . GLY D 2 219 ? -5.053  -29.242 121.869 1.00 39.60  ? 219 GLY D CA  1 
ATOM   7289 C C   . GLY D 2 219 ? -6.540  -28.920 121.866 1.00 40.27  ? 219 GLY D C   1 
ATOM   7290 O O   . GLY D 2 219 ? -6.931  -27.823 122.271 1.00 40.13  ? 219 GLY D O   1 
ATOM   7291 N N   . ASN D 2 220 ? -7.362  -29.866 121.407 1.00 41.08  ? 220 ASN D N   1 
ATOM   7292 C CA  . ASN D 2 220 ? -8.811  -29.684 121.290 1.00 41.91  ? 220 ASN D CA  1 
ATOM   7293 C C   . ASN D 2 220 ? -9.503  -29.652 122.655 1.00 42.20  ? 220 ASN D C   1 
ATOM   7294 O O   . ASN D 2 220 ? -10.671 -29.280 122.758 1.00 42.67  ? 220 ASN D O   1 
ATOM   7295 C CB  . ASN D 2 220 ? -9.442  -30.784 120.418 1.00 42.94  ? 220 ASN D CB  1 
ATOM   7296 C CG  . ASN D 2 220 ? -9.163  -32.170 120.957 1.00 44.79  ? 220 ASN D CG  1 
ATOM   7297 O OD1 . ASN D 2 220 ? -8.217  -32.386 121.702 1.00 46.82  ? 220 ASN D OD1 1 
ATOM   7298 N ND2 . ASN D 2 220 ? -9.983  -33.116 120.550 1.00 47.65  ? 220 ASN D ND2 1 
ATOM   7299 N N   . LYS D 2 221 ? -8.767  -30.017 123.703 1.00 43.91  ? 221 LYS D N   1 
ATOM   7300 C CA  . LYS D 2 221 ? -9.310  -30.027 125.059 1.00 43.70  ? 221 LYS D CA  1 
ATOM   7301 C C   . LYS D 2 221 ? -8.608  -28.956 125.892 1.00 44.89  ? 221 LYS D C   1 
ATOM   7302 O O   . LYS D 2 221 ? -7.464  -28.586 125.595 1.00 46.06  ? 221 LYS D O   1 
ATOM   7303 C CB  . LYS D 2 221 ? -9.137  -31.406 125.704 1.00 42.85  ? 221 LYS D CB  1 
ATOM   7304 C CG  . LYS D 2 221 ? -9.926  -32.498 125.005 1.00 44.65  ? 221 LYS D CG  1 
ATOM   7305 C CD  . LYS D 2 221 ? -9.664  -33.854 125.635 1.00 45.42  ? 221 LYS D CD  1 
ATOM   7306 C CE  . LYS D 2 221 ? -10.430 -34.966 124.924 1.00 47.31  ? 221 LYS D CE  1 
ATOM   7307 N NZ  . LYS D 2 221 ? -9.922  -35.196 123.539 1.00 46.57  ? 221 LYS D NZ  1 
ATOM   7308 N N   . PRO D 2 222 ? -9.308  -28.412 126.927 1.00 45.77  ? 222 PRO D N   1 
ATOM   7309 C CA  . PRO D 2 222 ? -8.712  -27.434 127.838 1.00 47.06  ? 222 PRO D CA  1 
ATOM   7310 C C   . PRO D 2 222 ? -7.510  -28.001 128.545 1.00 47.65  ? 222 PRO D C   1 
ATOM   7311 O O   . PRO D 2 222 ? -7.482  -29.168 128.920 1.00 48.45  ? 222 PRO D O   1 
ATOM   7312 C CB  . PRO D 2 222 ? -9.854  -27.136 128.825 1.00 47.77  ? 222 PRO D CB  1 
ATOM   7313 C CG  . PRO D 2 222 ? -11.109 -27.481 128.059 1.00 45.69  ? 222 PRO D CG  1 
ATOM   7314 C CD  . PRO D 2 222 ? -10.717 -28.680 127.243 1.00 46.23  ? 222 PRO D CD  1 
ATOM   7315 N N   . VAL D 2 223 ? -6.494  -27.157 128.739 1.00 48.25  ? 223 VAL D N   1 
ATOM   7316 C CA  . VAL D 2 223 ? -5.267  -27.603 129.397 1.00 50.00  ? 223 VAL D CA  1 
ATOM   7317 C C   . VAL D 2 223 ? -4.859  -26.607 130.472 1.00 50.71  ? 223 VAL D C   1 
ATOM   7318 O O   . VAL D 2 223 ? -5.449  -25.527 130.619 1.00 50.58  ? 223 VAL D O   1 
ATOM   7319 C CB  . VAL D 2 223 ? -4.074  -27.774 128.393 1.00 50.67  ? 223 VAL D CB  1 
ATOM   7320 C CG1 . VAL D 2 223 ? -4.399  -28.872 127.402 1.00 51.64  ? 223 VAL D CG1 1 
ATOM   7321 C CG2 . VAL D 2 223 ? -3.772  -26.448 127.677 1.00 50.64  ? 223 VAL D CG2 1 
ATOM   7322 N N   . CYS D 2 224 ? -3.815  -26.972 131.230 1.00 50.66  ? 224 CYS D N   1 
ATOM   7323 C CA  . CYS D 2 224 ? -3.262  -26.113 132.270 1.00 50.17  ? 224 CYS D CA  1 
ATOM   7324 C C   . CYS D 2 224 ? -1.718  -26.211 132.226 1.00 50.34  ? 224 CYS D C   1 
ATOM   7325 O O   . CYS D 2 224 ? -1.199  -27.186 131.604 1.00 51.37  ? 224 CYS D O   1 
ATOM   7326 C CB  . CYS D 2 224 ? -3.798  -26.543 133.643 1.00 50.81  ? 224 CYS D CB  1 
ATOM   7327 S SG  . CYS D 2 224 ? -3.608  -28.330 134.026 1.00 51.23  ? 224 CYS D SG  1 
ATOM   7328 O OXT . CYS D 2 224 ? -1.051  -25.317 132.808 1.00 52.94  ? 224 CYS D OXT 1 
HETATM 7329 O O   . HOH E 3 .   ? -26.308 -35.199 63.223  1.00 2.77   ? 218 HOH A O   1 
HETATM 7330 O O   . HOH E 3 .   ? -24.858 -40.467 55.588  1.00 47.84  ? 219 HOH A O   1 
HETATM 7331 O O   . HOH E 3 .   ? -39.656 -24.287 55.013  1.00 22.11  ? 220 HOH A O   1 
HETATM 7332 O O   . HOH E 3 .   ? -26.586 -27.114 62.396  1.00 65.72  ? 221 HOH A O   1 
HETATM 7333 O O   . HOH E 3 .   ? -28.750 -26.566 58.280  1.00 13.50  ? 222 HOH A O   1 
HETATM 7334 O O   . HOH E 3 .   ? -32.363 -35.991 61.008  1.00 14.95  ? 223 HOH A O   1 
HETATM 7335 O O   . HOH E 3 .   ? -28.985 -38.575 61.961  1.00 6.95   ? 224 HOH A O   1 
HETATM 7336 O O   . HOH E 3 .   ? -28.901 -36.056 62.878  1.00 54.71  ? 225 HOH A O   1 
HETATM 7337 O O   . HOH E 3 .   ? -48.198 -35.333 55.088  1.00 38.05  ? 226 HOH A O   1 
HETATM 7338 O O   . HOH E 3 .   ? -34.374 -29.362 58.582  1.00 27.21  ? 227 HOH A O   1 
HETATM 7339 O O   . HOH E 3 .   ? -35.840 -35.668 56.813  1.00 73.58  ? 228 HOH A O   1 
HETATM 7340 O O   . HOH E 3 .   ? -30.448 -29.020 58.408  1.00 24.87  ? 229 HOH A O   1 
HETATM 7341 O O   . HOH E 3 .   ? -11.272 -29.052 61.173  1.00 44.21  ? 230 HOH A O   1 
HETATM 7342 O O   . HOH E 3 .   ? -32.859 -17.966 59.992  1.00 2.00   ? 231 HOH A O   1 
HETATM 7343 O O   . HOH E 3 .   ? -19.534 -23.536 52.694  1.00 2.00   ? 232 HOH A O   1 
HETATM 7344 O O   . HOH E 3 .   ? -12.116 -24.704 55.527  1.00 15.16  ? 233 HOH A O   1 
HETATM 7345 O O   . HOH E 3 .   ? -22.734 -20.300 56.178  1.00 22.79  ? 234 HOH A O   1 
HETATM 7346 O O   . HOH F 3 .   ? -35.711 -27.866 54.717  1.00 25.72  ? 225 HOH B O   1 
HETATM 7347 O O   . HOH F 3 .   ? -17.564 -14.482 56.093  1.00 9.83   ? 226 HOH B O   1 
HETATM 7348 O O   . HOH F 3 .   ? -9.845  -20.985 40.282  1.00 12.16  ? 227 HOH B O   1 
HETATM 7349 O O   . HOH F 3 .   ? -20.552 -29.091 41.231  1.00 18.64  ? 228 HOH B O   1 
HETATM 7350 O O   . HOH F 3 .   ? -8.928  -19.737 57.176  1.00 29.56  ? 229 HOH B O   1 
HETATM 7351 O O   . HOH F 3 .   ? -32.551 -23.362 48.433  1.00 100.00 ? 230 HOH B O   1 
HETATM 7352 O O   . HOH F 3 .   ? -21.024 -22.387 45.384  1.00 38.86  ? 231 HOH B O   1 
HETATM 7353 O O   . HOH F 3 .   ? -26.785 -21.335 57.359  1.00 2.00   ? 232 HOH B O   1 
HETATM 7354 O O   . HOH F 3 .   ? -13.526 -16.252 36.273  1.00 31.24  ? 233 HOH B O   1 
HETATM 7355 O O   . HOH F 3 .   ? -17.369 -20.131 36.589  1.00 37.24  ? 234 HOH B O   1 
HETATM 7356 O O   . HOH F 3 .   ? -21.092 -22.356 42.587  1.00 2.00   ? 235 HOH B O   1 
HETATM 7357 O O   . HOH F 3 .   ? -13.190 -24.336 51.514  1.00 10.00  ? 236 HOH B O   1 
HETATM 7358 O O   . HOH F 3 .   ? -18.856 -26.258 51.997  1.00 18.51  ? 237 HOH B O   1 
HETATM 7359 O O   . HOH F 3 .   ? -21.046 -25.681 39.497  1.00 16.29  ? 238 HOH B O   1 
HETATM 7360 O O   . HOH F 3 .   ? -12.524 -32.312 43.014  1.00 39.27  ? 239 HOH B O   1 
HETATM 7361 O O   . HOH F 3 .   ? -16.562 -24.983 50.909  1.00 16.01  ? 240 HOH B O   1 
HETATM 7362 O O   . HOH F 3 .   ? -27.598 -36.314 31.611  1.00 31.59  ? 241 HOH B O   1 
HETATM 7363 O O   . HOH F 3 .   ? -19.128 -23.992 31.175  1.00 77.93  ? 242 HOH B O   1 
HETATM 7364 O O   . HOH F 3 .   ? -14.043 -28.244 47.441  1.00 41.27  ? 243 HOH B O   1 
HETATM 7365 O O   . HOH G 3 .   ? 1.500   -18.087 94.520  1.00 19.98  ? 218 HOH C O   1 
HETATM 7366 O O   . HOH G 3 .   ? 0.235   -26.033 99.001  1.00 47.47  ? 219 HOH C O   1 
HETATM 7367 O O   . HOH G 3 .   ? 14.933  -11.872 106.850 1.00 15.30  ? 220 HOH C O   1 
HETATM 7368 O O   . HOH G 3 .   ? 11.292  -14.869 105.576 1.00 42.80  ? 221 HOH C O   1 
HETATM 7369 O O   . HOH G 3 .   ? 1.671   -10.961 98.857  1.00 79.01  ? 222 HOH C O   1 
HETATM 7370 O O   . HOH G 3 .   ? 4.130   -12.074 102.772 1.00 14.30  ? 223 HOH C O   1 
HETATM 7371 O O   . HOH G 3 .   ? 6.953   -19.605 95.983  1.00 2.00   ? 224 HOH C O   1 
HETATM 7372 O O   . HOH G 3 .   ? 5.322   -21.277 93.951  1.00 16.64  ? 225 HOH C O   1 
HETATM 7373 O O   . HOH G 3 .   ? 4.334   -18.310 94.335  1.00 55.65  ? 226 HOH C O   1 
HETATM 7374 O O   . HOH G 3 .   ? 23.743  -21.043 101.478 1.00 21.53  ? 227 HOH C O   1 
HETATM 7375 O O   . HOH G 3 .   ? 10.075  -14.578 101.528 1.00 26.47  ? 228 HOH C O   1 
HETATM 7376 O O   . HOH G 3 .   ? 10.757  -20.721 99.557  1.00 72.63  ? 229 HOH C O   1 
HETATM 7377 O O   . HOH G 3 .   ? 5.541   -14.121 101.549 1.00 10.72  ? 230 HOH C O   1 
HETATM 7378 O O   . HOH G 3 .   ? -13.265 -13.552 99.286  1.00 43.01  ? 231 HOH C O   1 
HETATM 7379 O O   . HOH G 3 .   ? 8.503   -3.924  105.491 1.00 2.00   ? 232 HOH C O   1 
HETATM 7380 O O   . HOH G 3 .   ? -4.928  -12.177 109.231 1.00 2.00   ? 233 HOH C O   1 
HETATM 7381 O O   . HOH G 3 .   ? -1.734  -7.626  107.795 1.00 26.09  ? 234 HOH C O   1 
HETATM 7382 O O   . HOH H 3 .   ? -7.062  -2.842  110.232 1.00 12.52  ? 225 HOH D O   1 
HETATM 7383 O O   . HOH H 3 .   ? -14.360 -15.867 121.607 1.00 16.18  ? 226 HOH D O   1 
HETATM 7384 O O   . HOH H 3 .   ? -4.067  -21.874 117.394 1.00 22.73  ? 227 HOH D O   1 
HETATM 7385 O O   . HOH H 3 .   ? -15.425 -6.311  107.031 1.00 24.54  ? 228 HOH D O   1 
HETATM 7386 O O   . HOH H 3 .   ? 8.090   -13.870 113.128 1.00 100.00 ? 229 HOH D O   1 
HETATM 7387 O O   . HOH H 3 .   ? -3.477  -14.187 116.596 1.00 11.65  ? 230 HOH D O   1 
HETATM 7388 O O   . HOH H 3 .   ? 2.440   -7.750  106.041 1.00 10.32  ? 231 HOH D O   1 
HETATM 7389 O O   . HOH H 3 .   ? -10.945 -13.173 127.211 1.00 19.25  ? 232 HOH D O   1 
HETATM 7390 O O   . HOH H 3 .   ? -12.504 -12.266 106.147 1.00 2.00   ? 233 HOH D O   1 
HETATM 7391 O O   . HOH H 3 .   ? -7.048  -16.447 125.253 1.00 44.60  ? 234 HOH D O   1 
HETATM 7392 O O   . HOH H 3 .   ? -3.591  -15.969 118.954 1.00 2.00   ? 235 HOH D O   1 
HETATM 7393 O O   . HOH H 3 .   ? -11.177 -13.337 110.181 1.00 4.84   ? 236 HOH D O   1 
HETATM 7394 O O   . HOH H 3 .   ? -5.809  -14.757 108.240 1.00 26.37  ? 237 HOH D O   1 
HETATM 7395 O O   . HOH H 3 .   ? -3.583  -20.328 119.784 1.00 22.75  ? 238 HOH D O   1 
HETATM 7396 O O   . HOH H 3 .   ? -11.430 -24.323 113.823 1.00 33.27  ? 239 HOH D O   1 
HETATM 7397 O O   . HOH H 3 .   ? -7.699  -14.248 110.231 1.00 12.90  ? 240 HOH D O   1 
HETATM 7398 O O   . HOH H 3 .   ? 3.161   -32.937 122.288 1.00 35.04  ? 241 HOH D O   1 
HETATM 7399 O O   . HOH H 3 .   ? -5.191  -21.736 128.080 1.00 81.67  ? 242 HOH D O   1 
HETATM 7400 O O   . HOH H 3 .   ? -11.450 -18.947 111.833 1.00 56.08  ? 243 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   MET 2   2   2   MET MET A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  HIS 14  14  14  HIS HIS A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  MET 34  34  34  MET MET A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  TYR 40  40  40  TYR TYR A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  TRP 45  45  45  TRP TRP A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  HIS 83  83  83  HIS HIS A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  GLN 93  93  93  GLN GLN A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 MET 104 104 104 MET MET A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 CYS 114 114 114 CYS CYS A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 GLN 144 144 144 GLN GLN A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 CYS 173 173 173 CYS CYS A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 MET 197 197 197 MET MET A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASN 216 216 216 ASN ASN A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
B 2 1   SER 1   1   1   SER SER B . n 
B 2 2   CYS 2   2   2   CYS CYS B . n 
B 2 3   GLU 3   3   3   GLU GLU B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   SER 5   5   5   SER SER B . n 
B 2 6   MET 6   6   6   MET MET B . n 
B 2 7   VAL 7   7   7   VAL VAL B . n 
B 2 8   LEU 8   8   8   LEU LEU B . n 
B 2 9   GLY 9   9   9   GLY GLY B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  TRP 11  11  11  TRP TRP B . n 
B 2 12  ASP 12  12  12  ASP ASP B . n 
B 2 13  ILE 13  13  13  ILE ILE B . n 
B 2 14  ARG 14  14  14  ARG ARG B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  LEU 16  16  16  LEU LEU B . n 
B 2 17  ALA 17  17  17  ALA ALA B . n 
B 2 18  HIS 18  18  18  HIS HIS B . n 
B 2 19  ALA 19  19  19  ALA ALA B . n 
B 2 20  ILE 20  20  20  ILE ILE B . n 
B 2 21  ARG 21  21  21  ARG ARG B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  LEU 24  24  24  LEU LEU B . n 
B 2 25  GLU 25  25  25  GLU GLU B . n 
B 2 26  PHE 26  26  26  PHE PHE B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  ASP 28  28  28  ASP ASP B . n 
B 2 29  THR 29  29  29  THR THR B . n 
B 2 30  SER 30  30  30  SER SER B . n 
B 2 31  TYR 31  31  31  TYR TYR B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  GLU 33  33  33  GLU GLU B . n 
B 2 34  LYS 34  34  34  LYS LYS B . n 
B 2 35  ARG 35  35  35  ARG ARG B . n 
B 2 36  TYR 36  36  36  TYR TYR B . n 
B 2 37  THR 37  37  37  THR THR B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  GLY 39  39  39  GLY GLY B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  ALA 41  41  41  ALA ALA B . n 
B 2 42  PRO 42  42  42  PRO PRO B . n 
B 2 43  ASP 43  43  43  ASP ASP B . n 
B 2 44  TYR 44  44  44  TYR TYR B . n 
B 2 45  ASP 45  45  45  ASP ASP B . n 
B 2 46  ARG 46  46  46  ARG ARG B . n 
B 2 47  SER 47  47  47  SER SER B . n 
B 2 48  GLN 48  48  48  GLN GLN B . n 
B 2 49  TRP 49  49  49  TRP TRP B . n 
B 2 50  LEU 50  50  50  LEU LEU B . n 
B 2 51  ASP 51  51  51  ASP ASP B . n 
B 2 52  VAL 52  52  52  VAL VAL B . n 
B 2 53  LYS 53  53  53  LYS LYS B . n 
B 2 54  PHE 54  54  54  PHE PHE B . n 
B 2 55  LYS 55  55  55  LYS LYS B . n 
B 2 56  LEU 56  56  56  LEU LEU B . n 
B 2 57  ASP 57  57  57  ASP ASP B . n 
B 2 58  LEU 58  58  58  LEU LEU B . n 
B 2 59  ASP 59  59  59  ASP ASP B . n 
B 2 60  PHE 60  60  60  PHE PHE B . n 
B 2 61  PRO 61  61  61  PRO PRO B . n 
B 2 62  ASN 62  62  62  ASN ASN B . n 
B 2 63  LEU 63  63  63  LEU LEU B . n 
B 2 64  PRO 64  64  64  PRO PRO B . n 
B 2 65  TYR 65  65  65  TYR TYR B . n 
B 2 66  LEU 66  66  66  LEU LEU B . n 
B 2 67  LEU 67  67  67  LEU LEU B . n 
B 2 68  ASP 68  68  68  ASP ASP B . n 
B 2 69  GLY 69  69  69  GLY GLY B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  ASN 71  71  71  ASN ASN B . n 
B 2 72  LYS 72  72  72  LYS LYS B . n 
B 2 73  ILE 73  73  73  ILE ILE B . n 
B 2 74  THR 74  74  74  THR THR B . n 
B 2 75  GLN 75  75  75  GLN GLN B . n 
B 2 76  SER 76  76  76  SER SER B . n 
B 2 77  ASN 77  77  77  ASN ASN B . n 
B 2 78  ALA 78  78  78  ALA ALA B . n 
B 2 79  ILE 79  79  79  ILE ILE B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ARG 81  81  81  ARG ARG B . n 
B 2 82  TYR 82  82  82  TYR TYR B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  ALA 84  84  84  ALA ALA B . n 
B 2 85  ARG 85  85  85  ARG ARG B . n 
B 2 86  LYS 86  86  86  LYS LYS B . n 
B 2 87  HIS 87  87  87  HIS HIS B . n 
B 2 88  ASN 88  88  88  ASN ASN B . n 
B 2 89  MET 89  89  89  MET MET B . n 
B 2 90  CYS 90  90  90  CYS CYS B . n 
B 2 91  GLY 91  91  91  GLY GLY B . n 
B 2 92  GLU 92  92  92  GLU GLU B . n 
B 2 93  THR 93  93  93  THR THR B . n 
B 2 94  GLU 94  94  94  GLU GLU B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  GLU 96  96  96  GLU GLU B . n 
B 2 97  LYS 97  97  97  LYS LYS B . n 
B 2 98  ILE 98  98  98  ILE ILE B . n 
B 2 99  ARG 99  99  99  ARG ARG B . n 
B 2 100 VAL 100 100 100 VAL VAL B . n 
B 2 101 ASP 101 101 101 ASP ASP B . n 
B 2 102 ILE 102 102 102 ILE ILE B . n 
B 2 103 ILE 103 103 103 ILE ILE B . n 
B 2 104 GLU 104 104 104 GLU GLU B . n 
B 2 105 ASN 105 105 105 ASN ASN B . n 
B 2 106 GLN 106 106 106 GLN GLN B . n 
B 2 107 VAL 107 107 107 VAL VAL B . n 
B 2 108 MET 108 108 108 MET MET B . n 
B 2 109 ASP 109 109 109 ASP ASP B . n 
B 2 110 PHE 110 110 110 PHE PHE B . n 
B 2 111 ARG 111 111 111 ARG ARG B . n 
B 2 112 THR 112 112 112 THR THR B . n 
B 2 113 GLN 113 113 113 GLN GLN B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 ILE 115 115 115 ILE ILE B . n 
B 2 116 ARG 116 116 116 ARG ARG B . n 
B 2 117 LEU 117 117 117 LEU LEU B . n 
B 2 118 CYS 118 118 118 CYS CYS B . n 
B 2 119 TYR 119 119 119 TYR TYR B . n 
B 2 120 SER 120 120 120 SER SER B . n 
B 2 121 SER 121 121 121 SER SER B . n 
B 2 122 ASP 122 122 122 ASP ASP B . n 
B 2 123 HIS 123 123 123 HIS HIS B . n 
B 2 124 GLU 124 124 124 GLU GLU B . n 
B 2 125 LYS 125 125 125 LYS LYS B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 LYS 127 127 127 LYS LYS B . n 
B 2 128 PRO 128 128 128 PRO PRO B . n 
B 2 129 GLN 129 129 129 GLN GLN B . n 
B 2 130 TYR 130 130 130 TYR TYR B . n 
B 2 131 LEU 131 131 131 LEU LEU B . n 
B 2 132 GLU 132 132 132 GLU GLU B . n 
B 2 133 GLU 133 133 133 GLU GLU B . n 
B 2 134 LEU 134 134 134 LEU LEU B . n 
B 2 135 PRO 135 135 135 PRO PRO B . n 
B 2 136 GLY 136 136 136 GLY GLY B . n 
B 2 137 GLN 137 137 137 GLN GLN B . n 
B 2 138 LEU 138 138 138 LEU LEU B . n 
B 2 139 LYS 139 139 139 LYS LYS B . n 
B 2 140 GLN 140 140 140 GLN GLN B . n 
B 2 141 PHE 141 141 141 PHE PHE B . n 
B 2 142 SER 142 142 142 SER SER B . n 
B 2 143 MET 143 143 143 MET MET B . n 
B 2 144 PHE 144 144 144 PHE PHE B . n 
B 2 145 LEU 145 145 145 LEU LEU B . n 
B 2 146 GLY 146 146 146 GLY GLY B . n 
B 2 147 LYS 147 147 147 LYS LYS B . n 
B 2 148 PHE 148 148 148 PHE PHE B . n 
B 2 149 SER 149 149 149 SER SER B . n 
B 2 150 TRP 150 150 150 TRP TRP B . n 
B 2 151 PHE 151 151 151 PHE PHE B . n 
B 2 152 ALA 152 152 152 ALA ALA B . n 
B 2 153 GLY 153 153 153 GLY GLY B . n 
B 2 154 GLU 154 154 154 GLU GLU B . n 
B 2 155 LYS 155 155 155 LYS LYS B . n 
B 2 156 LEU 156 156 156 LEU LEU B . n 
B 2 157 THR 157 157 157 THR THR B . n 
B 2 158 PHE 158 158 158 PHE PHE B . n 
B 2 159 VAL 159 159 159 VAL VAL B . n 
B 2 160 ASP 160 160 160 ASP ASP B . n 
B 2 161 PHE 161 161 161 PHE PHE B . n 
B 2 162 LEU 162 162 162 LEU LEU B . n 
B 2 163 THR 163 163 163 THR THR B . n 
B 2 164 TYR 164 164 164 TYR TYR B . n 
B 2 165 ASP 165 165 165 ASP ASP B . n 
B 2 166 ILE 166 166 166 ILE ILE B . n 
B 2 167 LEU 167 167 167 LEU LEU B . n 
B 2 168 ASP 168 168 168 ASP ASP B . n 
B 2 169 GLN 169 169 169 GLN GLN B . n 
B 2 170 ASN 170 170 170 ASN ASN B . n 
B 2 171 ARG 171 171 171 ARG ARG B . n 
B 2 172 ILE 172 172 172 ILE ILE B . n 
B 2 173 PHE 173 173 173 PHE PHE B . n 
B 2 174 ASP 174 174 174 ASP ASP B . n 
B 2 175 PRO 175 175 175 PRO PRO B . n 
B 2 176 LYS 176 176 176 LYS LYS B . n 
B 2 177 CYS 177 177 177 CYS CYS B . n 
B 2 178 LEU 178 178 178 LEU LEU B . n 
B 2 179 ASP 179 179 179 ASP ASP B . n 
B 2 180 GLU 180 180 180 GLU GLU B . n 
B 2 181 PHE 181 181 181 PHE PHE B . n 
B 2 182 PRO 182 182 182 PRO PRO B . n 
B 2 183 ASN 183 183 183 ASN ASN B . n 
B 2 184 LEU 184 184 184 LEU LEU B . n 
B 2 185 LYS 185 185 185 LYS LYS B . n 
B 2 186 ALA 186 186 186 ALA ALA B . n 
B 2 187 PHE 187 187 187 PHE PHE B . n 
B 2 188 MET 188 188 188 MET MET B . n 
B 2 189 CYS 189 189 189 CYS CYS B . n 
B 2 190 ARG 190 190 190 ARG ARG B . n 
B 2 191 PHE 191 191 191 PHE PHE B . n 
B 2 192 GLU 192 192 192 GLU GLU B . n 
B 2 193 ALA 193 193 193 ALA ALA B . n 
B 2 194 LEU 194 194 194 LEU LEU B . n 
B 2 195 GLU 195 195 195 GLU GLU B . n 
B 2 196 LYS 196 196 196 LYS LYS B . n 
B 2 197 ILE 197 197 197 ILE ILE B . n 
B 2 198 ALA 198 198 198 ALA ALA B . n 
B 2 199 ALA 199 199 199 ALA ALA B . n 
B 2 200 TYR 200 200 200 TYR TYR B . n 
B 2 201 LEU 201 201 201 LEU LEU B . n 
B 2 202 GLN 202 202 202 GLN GLN B . n 
B 2 203 SER 203 203 203 SER SER B . n 
B 2 204 ASP 204 204 204 ASP ASP B . n 
B 2 205 GLN 205 205 205 GLN GLN B . n 
B 2 206 PHE 206 206 206 PHE PHE B . n 
B 2 207 CYS 207 207 207 CYS CYS B . n 
B 2 208 LYS 208 208 208 LYS LYS B . n 
B 2 209 MET 209 209 209 MET MET B . n 
B 2 210 PRO 210 210 210 PRO PRO B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 ASN 212 212 212 ASN ASN B . n 
B 2 213 ASN 213 213 213 ASN ASN B . n 
B 2 214 LYS 214 214 214 LYS LYS B . n 
B 2 215 MET 215 215 215 MET MET B . n 
B 2 216 ALA 216 216 216 ALA ALA B . n 
B 2 217 GLN 217 217 217 GLN GLN B . n 
B 2 218 TRP 218 218 218 TRP TRP B . n 
B 2 219 GLY 219 219 219 GLY GLY B . n 
B 2 220 ASN 220 220 220 ASN ASN B . n 
B 2 221 LYS 221 221 221 LYS LYS B . n 
B 2 222 PRO 222 222 222 PRO PRO B . n 
B 2 223 VAL 223 223 223 VAL VAL B . n 
B 2 224 CYS 224 224 224 CYS CYS B . n 
C 1 1   PRO 1   1   1   PRO PRO C . n 
C 1 2   MET 2   2   2   MET MET C . n 
C 1 3   THR 3   3   3   THR THR C . n 
C 1 4   LEU 4   4   4   LEU LEU C . n 
C 1 5   GLY 5   5   5   GLY GLY C . n 
C 1 6   TYR 6   6   6   TYR TYR C . n 
C 1 7   TRP 7   7   7   TRP TRP C . n 
C 1 8   ASN 8   8   8   ASN ASN C . n 
C 1 9   ILE 9   9   9   ILE ILE C . n 
C 1 10  ARG 10  10  10  ARG ARG C . n 
C 1 11  GLY 11  11  11  GLY GLY C . n 
C 1 12  LEU 12  12  12  LEU LEU C . n 
C 1 13  ALA 13  13  13  ALA ALA C . n 
C 1 14  HIS 14  14  14  HIS HIS C . n 
C 1 15  SER 15  15  15  SER SER C . n 
C 1 16  ILE 16  16  16  ILE ILE C . n 
C 1 17  ARG 17  17  17  ARG ARG C . n 
C 1 18  LEU 18  18  18  LEU LEU C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  LEU 20  20  20  LEU LEU C . n 
C 1 21  GLU 21  21  21  GLU GLU C . n 
C 1 22  TYR 22  22  22  TYR TYR C . n 
C 1 23  THR 23  23  23  THR THR C . n 
C 1 24  ASP 24  24  24  ASP ASP C . n 
C 1 25  SER 25  25  25  SER SER C . n 
C 1 26  SER 26  26  26  SER SER C . n 
C 1 27  TYR 27  27  27  TYR TYR C . n 
C 1 28  GLU 28  28  28  GLU GLU C . n 
C 1 29  GLU 29  29  29  GLU GLU C . n 
C 1 30  LYS 30  30  30  LYS LYS C . n 
C 1 31  LYS 31  31  31  LYS LYS C . n 
C 1 32  TYR 32  32  32  TYR TYR C . n 
C 1 33  THR 33  33  33  THR THR C . n 
C 1 34  MET 34  34  34  MET MET C . n 
C 1 35  GLY 35  35  35  GLY GLY C . n 
C 1 36  ASP 36  36  36  ASP ASP C . n 
C 1 37  ALA 37  37  37  ALA ALA C . n 
C 1 38  PRO 38  38  38  PRO PRO C . n 
C 1 39  ASP 39  39  39  ASP ASP C . n 
C 1 40  TYR 40  40  40  TYR TYR C . n 
C 1 41  ASP 41  41  41  ASP ASP C . n 
C 1 42  ARG 42  42  42  ARG ARG C . n 
C 1 43  SER 43  43  43  SER SER C . n 
C 1 44  GLN 44  44  44  GLN GLN C . n 
C 1 45  TRP 45  45  45  TRP TRP C . n 
C 1 46  LEU 46  46  46  LEU LEU C . n 
C 1 47  ASN 47  47  47  ASN ASN C . n 
C 1 48  GLU 48  48  48  GLU GLU C . n 
C 1 49  LYS 49  49  49  LYS LYS C . n 
C 1 50  PHE 50  50  50  PHE PHE C . n 
C 1 51  LYS 51  51  51  LYS LYS C . n 
C 1 52  LEU 52  52  52  LEU LEU C . n 
C 1 53  GLY 53  53  53  GLY GLY C . n 
C 1 54  LEU 54  54  54  LEU LEU C . n 
C 1 55  ASP 55  55  55  ASP ASP C . n 
C 1 56  PHE 56  56  56  PHE PHE C . n 
C 1 57  PRO 57  57  57  PRO PRO C . n 
C 1 58  ASN 58  58  58  ASN ASN C . n 
C 1 59  LEU 59  59  59  LEU LEU C . n 
C 1 60  PRO 60  60  60  PRO PRO C . n 
C 1 61  TYR 61  61  61  TYR TYR C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  ILE 63  63  63  ILE ILE C . n 
C 1 64  ASP 64  64  64  ASP ASP C . n 
C 1 65  GLY 65  65  65  GLY GLY C . n 
C 1 66  THR 66  66  66  THR THR C . n 
C 1 67  HIS 67  67  67  HIS HIS C . n 
C 1 68  LYS 68  68  68  LYS LYS C . n 
C 1 69  ILE 69  69  69  ILE ILE C . n 
C 1 70  THR 70  70  70  THR THR C . n 
C 1 71  GLN 71  71  71  GLN GLN C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  ASN 73  73  73  ASN ASN C . n 
C 1 74  ALA 74  74  74  ALA ALA C . n 
C 1 75  ILE 75  75  75  ILE ILE C . n 
C 1 76  LEU 76  76  76  LEU LEU C . n 
C 1 77  ARG 77  77  77  ARG ARG C . n 
C 1 78  TYR 78  78  78  TYR TYR C . n 
C 1 79  ILE 79  79  79  ILE ILE C . n 
C 1 80  ALA 80  80  80  ALA ALA C . n 
C 1 81  ARG 81  81  81  ARG ARG C . n 
C 1 82  LYS 82  82  82  LYS LYS C . n 
C 1 83  HIS 83  83  83  HIS HIS C . n 
C 1 84  ASN 84  84  84  ASN ASN C . n 
C 1 85  LEU 85  85  85  LEU LEU C . n 
C 1 86  CYS 86  86  86  CYS CYS C . n 
C 1 87  GLY 87  87  87  GLY GLY C . n 
C 1 88  GLU 88  88  88  GLU GLU C . n 
C 1 89  SER 89  89  89  SER SER C . n 
C 1 90  GLU 90  90  90  GLU GLU C . n 
C 1 91  LYS 91  91  91  LYS LYS C . n 
C 1 92  GLU 92  92  92  GLU GLU C . n 
C 1 93  GLN 93  93  93  GLN GLN C . n 
C 1 94  ILE 94  94  94  ILE ILE C . n 
C 1 95  ARG 95  95  95  ARG ARG C . n 
C 1 96  GLU 96  96  96  GLU GLU C . n 
C 1 97  ASP 97  97  97  ASP ASP C . n 
C 1 98  ILE 98  98  98  ILE ILE C . n 
C 1 99  LEU 99  99  99  LEU LEU C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 ASN 101 101 101 ASN ASN C . n 
C 1 102 GLN 102 102 102 GLN GLN C . n 
C 1 103 PHE 103 103 103 PHE PHE C . n 
C 1 104 MET 104 104 104 MET MET C . n 
C 1 105 ASP 105 105 105 ASP ASP C . n 
C 1 106 SER 106 106 106 SER SER C . n 
C 1 107 ARG 107 107 107 ARG ARG C . n 
C 1 108 MET 108 108 108 MET MET C . n 
C 1 109 GLN 109 109 109 GLN GLN C . n 
C 1 110 LEU 110 110 110 LEU LEU C . n 
C 1 111 ALA 111 111 111 ALA ALA C . n 
C 1 112 LYS 112 112 112 LYS LYS C . n 
C 1 113 LEU 113 113 113 LEU LEU C . n 
C 1 114 CYS 114 114 114 CYS CYS C . n 
C 1 115 TYR 115 115 115 TYR TYR C . n 
C 1 116 ASP 116 116 116 ASP ASP C . n 
C 1 117 PRO 117 117 117 PRO PRO C . n 
C 1 118 ASP 118 118 118 ASP ASP C . n 
C 1 119 PHE 119 119 119 PHE PHE C . n 
C 1 120 GLU 120 120 120 GLU GLU C . n 
C 1 121 LYS 121 121 121 LYS LYS C . n 
C 1 122 LEU 122 122 122 LEU LEU C . n 
C 1 123 LYS 123 123 123 LYS LYS C . n 
C 1 124 PRO 124 124 124 PRO PRO C . n 
C 1 125 GLU 125 125 125 GLU GLU C . n 
C 1 126 TYR 126 126 126 TYR TYR C . n 
C 1 127 LEU 127 127 127 LEU LEU C . n 
C 1 128 GLN 128 128 128 GLN GLN C . n 
C 1 129 ALA 129 129 129 ALA ALA C . n 
C 1 130 LEU 130 130 130 LEU LEU C . n 
C 1 131 PRO 131 131 131 PRO PRO C . n 
C 1 132 GLU 132 132 132 GLU GLU C . n 
C 1 133 MET 133 133 133 MET MET C . n 
C 1 134 LEU 134 134 134 LEU LEU C . n 
C 1 135 LYS 135 135 135 LYS LYS C . n 
C 1 136 LEU 136 136 136 LEU LEU C . n 
C 1 137 TYR 137 137 137 TYR TYR C . n 
C 1 138 SER 138 138 138 SER SER C . n 
C 1 139 GLN 139 139 139 GLN GLN C . n 
C 1 140 PHE 140 140 140 PHE PHE C . n 
C 1 141 LEU 141 141 141 LEU LEU C . n 
C 1 142 GLY 142 142 142 GLY GLY C . n 
C 1 143 LYS 143 143 143 LYS LYS C . n 
C 1 144 GLN 144 144 144 GLN GLN C . n 
C 1 145 PRO 145 145 145 PRO PRO C . n 
C 1 146 TRP 146 146 146 TRP TRP C . n 
C 1 147 PHE 147 147 147 PHE PHE C . n 
C 1 148 LEU 148 148 148 LEU LEU C . n 
C 1 149 GLY 149 149 149 GLY GLY C . n 
C 1 150 ASP 150 150 150 ASP ASP C . n 
C 1 151 LYS 151 151 151 LYS LYS C . n 
C 1 152 ILE 152 152 152 ILE ILE C . n 
C 1 153 THR 153 153 153 THR THR C . n 
C 1 154 PHE 154 154 154 PHE PHE C . n 
C 1 155 VAL 155 155 155 VAL VAL C . n 
C 1 156 ASP 156 156 156 ASP ASP C . n 
C 1 157 PHE 157 157 157 PHE PHE C . n 
C 1 158 ILE 158 158 158 ILE ILE C . n 
C 1 159 ALA 159 159 159 ALA ALA C . n 
C 1 160 TYR 160 160 160 TYR TYR C . n 
C 1 161 ASP 161 161 161 ASP ASP C . n 
C 1 162 VAL 162 162 162 VAL VAL C . n 
C 1 163 LEU 163 163 163 LEU LEU C . n 
C 1 164 GLU 164 164 164 GLU GLU C . n 
C 1 165 ARG 165 165 165 ARG ARG C . n 
C 1 166 ASN 166 166 166 ASN ASN C . n 
C 1 167 GLN 167 167 167 GLN GLN C . n 
C 1 168 VAL 168 168 168 VAL VAL C . n 
C 1 169 PHE 169 169 169 PHE PHE C . n 
C 1 170 GLU 170 170 170 GLU GLU C . n 
C 1 171 PRO 171 171 171 PRO PRO C . n 
C 1 172 SER 172 172 172 SER SER C . n 
C 1 173 CYS 173 173 173 CYS CYS C . n 
C 1 174 LEU 174 174 174 LEU LEU C . n 
C 1 175 ASP 175 175 175 ASP ASP C . n 
C 1 176 ALA 176 176 176 ALA ALA C . n 
C 1 177 PHE 177 177 177 PHE PHE C . n 
C 1 178 PRO 178 178 178 PRO PRO C . n 
C 1 179 ASN 179 179 179 ASN ASN C . n 
C 1 180 LEU 180 180 180 LEU LEU C . n 
C 1 181 LYS 181 181 181 LYS LYS C . n 
C 1 182 ASP 182 182 182 ASP ASP C . n 
C 1 183 PHE 183 183 183 PHE PHE C . n 
C 1 184 ILE 184 184 184 ILE ILE C . n 
C 1 185 SER 185 185 185 SER SER C . n 
C 1 186 ARG 186 186 186 ARG ARG C . n 
C 1 187 PHE 187 187 187 PHE PHE C . n 
C 1 188 GLU 188 188 188 GLU GLU C . n 
C 1 189 GLY 189 189 189 GLY GLY C . n 
C 1 190 LEU 190 190 190 LEU LEU C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 LYS 192 192 192 LYS LYS C . n 
C 1 193 ILE 193 193 193 ILE ILE C . n 
C 1 194 SER 194 194 194 SER SER C . n 
C 1 195 ALA 195 195 195 ALA ALA C . n 
C 1 196 TYR 196 196 196 TYR TYR C . n 
C 1 197 MET 197 197 197 MET MET C . n 
C 1 198 LYS 198 198 198 LYS LYS C . n 
C 1 199 SER 199 199 199 SER SER C . n 
C 1 200 SER 200 200 200 SER SER C . n 
C 1 201 ARG 201 201 201 ARG ARG C . n 
C 1 202 PHE 202 202 202 PHE PHE C . n 
C 1 203 LEU 203 203 203 LEU LEU C . n 
C 1 204 PRO 204 204 204 PRO PRO C . n 
C 1 205 ARG 205 205 205 ARG ARG C . n 
C 1 206 PRO 206 206 206 PRO PRO C . n 
C 1 207 VAL 207 207 207 VAL VAL C . n 
C 1 208 PHE 208 208 208 PHE PHE C . n 
C 1 209 THR 209 209 209 THR THR C . n 
C 1 210 LYS 210 210 210 LYS LYS C . n 
C 1 211 MET 211 211 211 MET MET C . n 
C 1 212 ALA 212 212 212 ALA ALA C . n 
C 1 213 VAL 213 213 213 VAL VAL C . n 
C 1 214 TRP 214 214 214 TRP TRP C . n 
C 1 215 GLY 215 215 215 GLY GLY C . n 
C 1 216 ASN 216 216 216 ASN ASN C . n 
C 1 217 LYS 217 217 217 LYS LYS C . n 
D 2 1   SER 1   1   1   SER SER D . n 
D 2 2   CYS 2   2   2   CYS CYS D . n 
D 2 3   GLU 3   3   3   GLU GLU D . n 
D 2 4   SER 4   4   4   SER SER D . n 
D 2 5   SER 5   5   5   SER SER D . n 
D 2 6   MET 6   6   6   MET MET D . n 
D 2 7   VAL 7   7   7   VAL VAL D . n 
D 2 8   LEU 8   8   8   LEU LEU D . n 
D 2 9   GLY 9   9   9   GLY GLY D . n 
D 2 10  TYR 10  10  10  TYR TYR D . n 
D 2 11  TRP 11  11  11  TRP TRP D . n 
D 2 12  ASP 12  12  12  ASP ASP D . n 
D 2 13  ILE 13  13  13  ILE ILE D . n 
D 2 14  ARG 14  14  14  ARG ARG D . n 
D 2 15  GLY 15  15  15  GLY GLY D . n 
D 2 16  LEU 16  16  16  LEU LEU D . n 
D 2 17  ALA 17  17  17  ALA ALA D . n 
D 2 18  HIS 18  18  18  HIS HIS D . n 
D 2 19  ALA 19  19  19  ALA ALA D . n 
D 2 20  ILE 20  20  20  ILE ILE D . n 
D 2 21  ARG 21  21  21  ARG ARG D . n 
D 2 22  LEU 22  22  22  LEU LEU D . n 
D 2 23  LEU 23  23  23  LEU LEU D . n 
D 2 24  LEU 24  24  24  LEU LEU D . n 
D 2 25  GLU 25  25  25  GLU GLU D . n 
D 2 26  PHE 26  26  26  PHE PHE D . n 
D 2 27  THR 27  27  27  THR THR D . n 
D 2 28  ASP 28  28  28  ASP ASP D . n 
D 2 29  THR 29  29  29  THR THR D . n 
D 2 30  SER 30  30  30  SER SER D . n 
D 2 31  TYR 31  31  31  TYR TYR D . n 
D 2 32  GLU 32  32  32  GLU GLU D . n 
D 2 33  GLU 33  33  33  GLU GLU D . n 
D 2 34  LYS 34  34  34  LYS LYS D . n 
D 2 35  ARG 35  35  35  ARG ARG D . n 
D 2 36  TYR 36  36  36  TYR TYR D . n 
D 2 37  THR 37  37  37  THR THR D . n 
D 2 38  CYS 38  38  38  CYS CYS D . n 
D 2 39  GLY 39  39  39  GLY GLY D . n 
D 2 40  GLU 40  40  40  GLU GLU D . n 
D 2 41  ALA 41  41  41  ALA ALA D . n 
D 2 42  PRO 42  42  42  PRO PRO D . n 
D 2 43  ASP 43  43  43  ASP ASP D . n 
D 2 44  TYR 44  44  44  TYR TYR D . n 
D 2 45  ASP 45  45  45  ASP ASP D . n 
D 2 46  ARG 46  46  46  ARG ARG D . n 
D 2 47  SER 47  47  47  SER SER D . n 
D 2 48  GLN 48  48  48  GLN GLN D . n 
D 2 49  TRP 49  49  49  TRP TRP D . n 
D 2 50  LEU 50  50  50  LEU LEU D . n 
D 2 51  ASP 51  51  51  ASP ASP D . n 
D 2 52  VAL 52  52  52  VAL VAL D . n 
D 2 53  LYS 53  53  53  LYS LYS D . n 
D 2 54  PHE 54  54  54  PHE PHE D . n 
D 2 55  LYS 55  55  55  LYS LYS D . n 
D 2 56  LEU 56  56  56  LEU LEU D . n 
D 2 57  ASP 57  57  57  ASP ASP D . n 
D 2 58  LEU 58  58  58  LEU LEU D . n 
D 2 59  ASP 59  59  59  ASP ASP D . n 
D 2 60  PHE 60  60  60  PHE PHE D . n 
D 2 61  PRO 61  61  61  PRO PRO D . n 
D 2 62  ASN 62  62  62  ASN ASN D . n 
D 2 63  LEU 63  63  63  LEU LEU D . n 
D 2 64  PRO 64  64  64  PRO PRO D . n 
D 2 65  TYR 65  65  65  TYR TYR D . n 
D 2 66  LEU 66  66  66  LEU LEU D . n 
D 2 67  LEU 67  67  67  LEU LEU D . n 
D 2 68  ASP 68  68  68  ASP ASP D . n 
D 2 69  GLY 69  69  69  GLY GLY D . n 
D 2 70  LYS 70  70  70  LYS LYS D . n 
D 2 71  ASN 71  71  71  ASN ASN D . n 
D 2 72  LYS 72  72  72  LYS LYS D . n 
D 2 73  ILE 73  73  73  ILE ILE D . n 
D 2 74  THR 74  74  74  THR THR D . n 
D 2 75  GLN 75  75  75  GLN GLN D . n 
D 2 76  SER 76  76  76  SER SER D . n 
D 2 77  ASN 77  77  77  ASN ASN D . n 
D 2 78  ALA 78  78  78  ALA ALA D . n 
D 2 79  ILE 79  79  79  ILE ILE D . n 
D 2 80  LEU 80  80  80  LEU LEU D . n 
D 2 81  ARG 81  81  81  ARG ARG D . n 
D 2 82  TYR 82  82  82  TYR TYR D . n 
D 2 83  ILE 83  83  83  ILE ILE D . n 
D 2 84  ALA 84  84  84  ALA ALA D . n 
D 2 85  ARG 85  85  85  ARG ARG D . n 
D 2 86  LYS 86  86  86  LYS LYS D . n 
D 2 87  HIS 87  87  87  HIS HIS D . n 
D 2 88  ASN 88  88  88  ASN ASN D . n 
D 2 89  MET 89  89  89  MET MET D . n 
D 2 90  CYS 90  90  90  CYS CYS D . n 
D 2 91  GLY 91  91  91  GLY GLY D . n 
D 2 92  GLU 92  92  92  GLU GLU D . n 
D 2 93  THR 93  93  93  THR THR D . n 
D 2 94  GLU 94  94  94  GLU GLU D . n 
D 2 95  GLU 95  95  95  GLU GLU D . n 
D 2 96  GLU 96  96  96  GLU GLU D . n 
D 2 97  LYS 97  97  97  LYS LYS D . n 
D 2 98  ILE 98  98  98  ILE ILE D . n 
D 2 99  ARG 99  99  99  ARG ARG D . n 
D 2 100 VAL 100 100 100 VAL VAL D . n 
D 2 101 ASP 101 101 101 ASP ASP D . n 
D 2 102 ILE 102 102 102 ILE ILE D . n 
D 2 103 ILE 103 103 103 ILE ILE D . n 
D 2 104 GLU 104 104 104 GLU GLU D . n 
D 2 105 ASN 105 105 105 ASN ASN D . n 
D 2 106 GLN 106 106 106 GLN GLN D . n 
D 2 107 VAL 107 107 107 VAL VAL D . n 
D 2 108 MET 108 108 108 MET MET D . n 
D 2 109 ASP 109 109 109 ASP ASP D . n 
D 2 110 PHE 110 110 110 PHE PHE D . n 
D 2 111 ARG 111 111 111 ARG ARG D . n 
D 2 112 THR 112 112 112 THR THR D . n 
D 2 113 GLN 113 113 113 GLN GLN D . n 
D 2 114 LEU 114 114 114 LEU LEU D . n 
D 2 115 ILE 115 115 115 ILE ILE D . n 
D 2 116 ARG 116 116 116 ARG ARG D . n 
D 2 117 LEU 117 117 117 LEU LEU D . n 
D 2 118 CYS 118 118 118 CYS CYS D . n 
D 2 119 TYR 119 119 119 TYR TYR D . n 
D 2 120 SER 120 120 120 SER SER D . n 
D 2 121 SER 121 121 121 SER SER D . n 
D 2 122 ASP 122 122 122 ASP ASP D . n 
D 2 123 HIS 123 123 123 HIS HIS D . n 
D 2 124 GLU 124 124 124 GLU GLU D . n 
D 2 125 LYS 125 125 125 LYS LYS D . n 
D 2 126 LEU 126 126 126 LEU LEU D . n 
D 2 127 LYS 127 127 127 LYS LYS D . n 
D 2 128 PRO 128 128 128 PRO PRO D . n 
D 2 129 GLN 129 129 129 GLN GLN D . n 
D 2 130 TYR 130 130 130 TYR TYR D . n 
D 2 131 LEU 131 131 131 LEU LEU D . n 
D 2 132 GLU 132 132 132 GLU GLU D . n 
D 2 133 GLU 133 133 133 GLU GLU D . n 
D 2 134 LEU 134 134 134 LEU LEU D . n 
D 2 135 PRO 135 135 135 PRO PRO D . n 
D 2 136 GLY 136 136 136 GLY GLY D . n 
D 2 137 GLN 137 137 137 GLN GLN D . n 
D 2 138 LEU 138 138 138 LEU LEU D . n 
D 2 139 LYS 139 139 139 LYS LYS D . n 
D 2 140 GLN 140 140 140 GLN GLN D . n 
D 2 141 PHE 141 141 141 PHE PHE D . n 
D 2 142 SER 142 142 142 SER SER D . n 
D 2 143 MET 143 143 143 MET MET D . n 
D 2 144 PHE 144 144 144 PHE PHE D . n 
D 2 145 LEU 145 145 145 LEU LEU D . n 
D 2 146 GLY 146 146 146 GLY GLY D . n 
D 2 147 LYS 147 147 147 LYS LYS D . n 
D 2 148 PHE 148 148 148 PHE PHE D . n 
D 2 149 SER 149 149 149 SER SER D . n 
D 2 150 TRP 150 150 150 TRP TRP D . n 
D 2 151 PHE 151 151 151 PHE PHE D . n 
D 2 152 ALA 152 152 152 ALA ALA D . n 
D 2 153 GLY 153 153 153 GLY GLY D . n 
D 2 154 GLU 154 154 154 GLU GLU D . n 
D 2 155 LYS 155 155 155 LYS LYS D . n 
D 2 156 LEU 156 156 156 LEU LEU D . n 
D 2 157 THR 157 157 157 THR THR D . n 
D 2 158 PHE 158 158 158 PHE PHE D . n 
D 2 159 VAL 159 159 159 VAL VAL D . n 
D 2 160 ASP 160 160 160 ASP ASP D . n 
D 2 161 PHE 161 161 161 PHE PHE D . n 
D 2 162 LEU 162 162 162 LEU LEU D . n 
D 2 163 THR 163 163 163 THR THR D . n 
D 2 164 TYR 164 164 164 TYR TYR D . n 
D 2 165 ASP 165 165 165 ASP ASP D . n 
D 2 166 ILE 166 166 166 ILE ILE D . n 
D 2 167 LEU 167 167 167 LEU LEU D . n 
D 2 168 ASP 168 168 168 ASP ASP D . n 
D 2 169 GLN 169 169 169 GLN GLN D . n 
D 2 170 ASN 170 170 170 ASN ASN D . n 
D 2 171 ARG 171 171 171 ARG ARG D . n 
D 2 172 ILE 172 172 172 ILE ILE D . n 
D 2 173 PHE 173 173 173 PHE PHE D . n 
D 2 174 ASP 174 174 174 ASP ASP D . n 
D 2 175 PRO 175 175 175 PRO PRO D . n 
D 2 176 LYS 176 176 176 LYS LYS D . n 
D 2 177 CYS 177 177 177 CYS CYS D . n 
D 2 178 LEU 178 178 178 LEU LEU D . n 
D 2 179 ASP 179 179 179 ASP ASP D . n 
D 2 180 GLU 180 180 180 GLU GLU D . n 
D 2 181 PHE 181 181 181 PHE PHE D . n 
D 2 182 PRO 182 182 182 PRO PRO D . n 
D 2 183 ASN 183 183 183 ASN ASN D . n 
D 2 184 LEU 184 184 184 LEU LEU D . n 
D 2 185 LYS 185 185 185 LYS LYS D . n 
D 2 186 ALA 186 186 186 ALA ALA D . n 
D 2 187 PHE 187 187 187 PHE PHE D . n 
D 2 188 MET 188 188 188 MET MET D . n 
D 2 189 CYS 189 189 189 CYS CYS D . n 
D 2 190 ARG 190 190 190 ARG ARG D . n 
D 2 191 PHE 191 191 191 PHE PHE D . n 
D 2 192 GLU 192 192 192 GLU GLU D . n 
D 2 193 ALA 193 193 193 ALA ALA D . n 
D 2 194 LEU 194 194 194 LEU LEU D . n 
D 2 195 GLU 195 195 195 GLU GLU D . n 
D 2 196 LYS 196 196 196 LYS LYS D . n 
D 2 197 ILE 197 197 197 ILE ILE D . n 
D 2 198 ALA 198 198 198 ALA ALA D . n 
D 2 199 ALA 199 199 199 ALA ALA D . n 
D 2 200 TYR 200 200 200 TYR TYR D . n 
D 2 201 LEU 201 201 201 LEU LEU D . n 
D 2 202 GLN 202 202 202 GLN GLN D . n 
D 2 203 SER 203 203 203 SER SER D . n 
D 2 204 ASP 204 204 204 ASP ASP D . n 
D 2 205 GLN 205 205 205 GLN GLN D . n 
D 2 206 PHE 206 206 206 PHE PHE D . n 
D 2 207 CYS 207 207 207 CYS CYS D . n 
D 2 208 LYS 208 208 208 LYS LYS D . n 
D 2 209 MET 209 209 209 MET MET D . n 
D 2 210 PRO 210 210 210 PRO PRO D . n 
D 2 211 ILE 211 211 211 ILE ILE D . n 
D 2 212 ASN 212 212 212 ASN ASN D . n 
D 2 213 ASN 213 213 213 ASN ASN D . n 
D 2 214 LYS 214 214 214 LYS LYS D . n 
D 2 215 MET 215 215 215 MET MET D . n 
D 2 216 ALA 216 216 216 ALA ALA D . n 
D 2 217 GLN 217 217 217 GLN GLN D . n 
D 2 218 TRP 218 218 218 TRP TRP D . n 
D 2 219 GLY 219 219 219 GLY GLY D . n 
D 2 220 ASN 220 220 220 ASN ASN D . n 
D 2 221 LYS 221 221 221 LYS LYS D . n 
D 2 222 PRO 222 222 222 PRO PRO D . n 
D 2 223 VAL 223 223 223 VAL VAL D . n 
D 2 224 CYS 224 224 224 CYS CYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  218 1  HOH HOH A . 
E 3 HOH 2  219 2  HOH HOH A . 
E 3 HOH 3  220 3  HOH HOH A . 
E 3 HOH 4  221 5  HOH HOH A . 
E 3 HOH 5  222 7  HOH HOH A . 
E 3 HOH 6  223 8  HOH HOH A . 
E 3 HOH 7  224 9  HOH HOH A . 
E 3 HOH 8  225 10 HOH HOH A . 
E 3 HOH 9  226 11 HOH HOH A . 
E 3 HOH 10 227 12 HOH HOH A . 
E 3 HOH 11 228 13 HOH HOH A . 
E 3 HOH 12 229 14 HOH HOH A . 
E 3 HOH 13 230 18 HOH HOH A . 
E 3 HOH 14 231 21 HOH HOH A . 
E 3 HOH 15 232 22 HOH HOH A . 
E 3 HOH 16 233 25 HOH HOH A . 
E 3 HOH 17 234 28 HOH HOH A . 
F 3 HOH 1  225 4  HOH HOH B . 
F 3 HOH 2  226 6  HOH HOH B . 
F 3 HOH 3  227 15 HOH HOH B . 
F 3 HOH 4  228 16 HOH HOH B . 
F 3 HOH 5  229 17 HOH HOH B . 
F 3 HOH 6  230 19 HOH HOH B . 
F 3 HOH 7  231 20 HOH HOH B . 
F 3 HOH 8  232 23 HOH HOH B . 
F 3 HOH 9  233 24 HOH HOH B . 
F 3 HOH 10 234 26 HOH HOH B . 
F 3 HOH 11 235 27 HOH HOH B . 
F 3 HOH 12 236 29 HOH HOH B . 
F 3 HOH 13 237 30 HOH HOH B . 
F 3 HOH 14 238 31 HOH HOH B . 
F 3 HOH 15 239 32 HOH HOH B . 
F 3 HOH 16 240 33 HOH HOH B . 
F 3 HOH 17 241 34 HOH HOH B . 
F 3 HOH 18 242 35 HOH HOH B . 
F 3 HOH 19 243 36 HOH HOH B . 
G 3 HOH 1  218 37 HOH HOH C . 
G 3 HOH 2  219 38 HOH HOH C . 
G 3 HOH 3  220 39 HOH HOH C . 
G 3 HOH 4  221 40 HOH HOH C . 
G 3 HOH 5  222 41 HOH HOH C . 
G 3 HOH 6  223 43 HOH HOH C . 
G 3 HOH 7  224 44 HOH HOH C . 
G 3 HOH 8  225 45 HOH HOH C . 
G 3 HOH 9  226 46 HOH HOH C . 
G 3 HOH 10 227 47 HOH HOH C . 
G 3 HOH 11 228 48 HOH HOH C . 
G 3 HOH 12 229 49 HOH HOH C . 
G 3 HOH 13 230 50 HOH HOH C . 
G 3 HOH 14 231 54 HOH HOH C . 
G 3 HOH 15 232 57 HOH HOH C . 
G 3 HOH 16 233 58 HOH HOH C . 
G 3 HOH 17 234 64 HOH HOH C . 
H 3 HOH 1  225 42 HOH HOH D . 
H 3 HOH 2  226 51 HOH HOH D . 
H 3 HOH 3  227 52 HOH HOH D . 
H 3 HOH 4  228 53 HOH HOH D . 
H 3 HOH 5  229 55 HOH HOH D . 
H 3 HOH 6  230 56 HOH HOH D . 
H 3 HOH 7  231 59 HOH HOH D . 
H 3 HOH 8  232 60 HOH HOH D . 
H 3 HOH 9  233 61 HOH HOH D . 
H 3 HOH 10 234 62 HOH HOH D . 
H 3 HOH 11 235 63 HOH HOH D . 
H 3 HOH 12 236 65 HOH HOH D . 
H 3 HOH 13 237 66 HOH HOH D . 
H 3 HOH 14 238 67 HOH HOH D . 
H 3 HOH 15 239 68 HOH HOH D . 
H 3 HOH 16 240 69 HOH HOH D . 
H 3 HOH 17 241 70 HOH HOH D . 
H 3 HOH 18 242 71 HOH HOH D . 
H 3 HOH 19 243 72 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 author_and_software_defined_assembly PISA dimeric    2 
3 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
3 1 A,B,E,F 
3 2 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2630  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  19690 ? 
2 'ABSA (A^2)' 2610  ? 
2 MORE         -11   ? 
2 'SSA (A^2)'  19770 ? 
3 'ABSA (A^2)' 6360  ? 
3 MORE         -35   ? 
3 'SSA (A^2)'  38330 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000    
2 'crystal symmetry operation' 1_454 x-1,y,z-1 1.0000000000 0.0000000000 0.0000000000 -41.4624693878 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -103.4447114619 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-29 
2 'Structure model' 1 1 2008-03-25 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.851 ? 1 
X-PLOR refinement       3.851 ? 2 
XDS    'data reduction' .     ? 3 
XSCALE 'data scaling'   .     ? 4 
X-PLOR phasing          3.851 ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             143 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             143 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.981 
_pdbx_validate_rmsd_bond.bond_target_value         1.807 
_pdbx_validate_rmsd_bond.bond_deviation            0.174 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.026 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 71  ? ? 75.78   115.22  
2  1 LEU A 85  ? ? -89.72  48.04   
3  1 ASP A 118 ? ? -78.40  27.10   
4  1 LEU A 203 ? ? 54.27   70.72   
5  1 ASN A 216 ? ? -80.29  -153.77 
6  1 ASP B 45  ? ? -57.32  105.16  
7  1 GLN B 75  ? ? 73.58   113.42  
8  1 MET B 89  ? ? -102.73 52.20   
9  1 GLU B 180 ? ? -68.91  3.00    
10 1 TYR C 40  ? ? -64.38  82.63   
11 1 GLN C 71  ? ? 73.85   115.32  
12 1 LEU C 85  ? ? -91.64  42.90   
13 1 GLU C 88  ? ? -93.50  -62.67  
14 1 ASP C 118 ? ? -82.47  30.24   
15 1 ASN C 216 ? ? -74.47  -155.70 
16 1 CYS D 2   ? ? -178.01 -56.80  
17 1 GLU D 3   ? ? 70.01   111.93  
18 1 SER D 5   ? ? 47.32   23.25   
19 1 TYR D 44  ? ? -68.14  77.86   
20 1 GLN D 75  ? ? 70.89   115.88  
21 1 MET D 89  ? ? -96.85  56.71   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#