data_3GW5
# 
_entry.id   3GW5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GW5         
RCSB  RCSB052381   
WWPDB D_1000052381 
# 
_pdbx_database_status.entry_id                        3GW5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, Z.'         1 
'McKeever, B.M.' 2 
# 
_citation.id                        primary 
_citation.title                     'Design and optimization of renin inhibitors: Orally bioavailable alkyl amines.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            19 
_citation.page_first                3541 
_citation.page_last                 3545 
_citation.year                      2009 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19457666 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2009.04.140 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tice, C.M.'        1  ? 
primary 'Xu, Z.'            2  ? 
primary 'Yuan, J.'          3  ? 
primary 'Simpson, R.D.'     4  ? 
primary 'Cacatian, S.T.'    5  ? 
primary 'Flaherty, P.T.'    6  ? 
primary 'Zhao, W.'          7  ? 
primary 'Guo, J.'           8  ? 
primary 'Ishchenko, A.'     9  ? 
primary 'Singh, S.B.'       10 ? 
primary 'Wu, Z.'            11 ? 
primary 'Scott, B.B.'       12 ? 
primary 'Bukhtiyarov, Y.'   13 ? 
primary 'Berbaum, J.'       14 ? 
primary 'Mason, J.'         15 ? 
primary 'Panemangalore, R.' 16 ? 
primary 'Cappiello, M.G.'   17 ? 
primary 'Muller, D.'        18 ? 
primary 'Harrison, R.K.'    19 ? 
primary 'McGeehan, G.M.'    20 ? 
primary 'Dillard, L.W.'     21 ? 
primary 'Baldwin, J.J.'     22 ? 
primary 'Claremon, D.A.'    23 ? 
# 
_cell.length_a           54.203 
_cell.length_b           97.069 
_cell.length_c           149.546 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3GW5 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3GW5 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Renin 36939.594 2   3.4.23.15 ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
3 non-polymer syn 
;(3R)-3-[(1S)-1-(3-chlorophenyl)-1-hydroxy-5-methoxypentyl]-N-{(1S)-2-cyclohexyl-1-[(methylamino)methyl]ethyl}piperidine-1-carboxamide
;
508.136   2   ?         ? ? ? 
4 non-polymer syn GLYCEROL 92.094    5   ?         ? ? ? 
5 non-polymer syn 'CHLORIDE ION' 35.453    1   ?         ? ? ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?         ? ? ? 
7 water       nat water 18.015    356 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Angiotensinogenase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   THR n 
1 4   THR n 
1 5   SER n 
1 6   SER n 
1 7   VAL n 
1 8   ILE n 
1 9   LEU n 
1 10  THR n 
1 11  ASN n 
1 12  TYR n 
1 13  MET n 
1 14  ASP n 
1 15  THR n 
1 16  GLN n 
1 17  TYR n 
1 18  TYR n 
1 19  GLY n 
1 20  GLU n 
1 21  ILE n 
1 22  GLY n 
1 23  ILE n 
1 24  GLY n 
1 25  THR n 
1 26  PRO n 
1 27  PRO n 
1 28  GLN n 
1 29  THR n 
1 30  PHE n 
1 31  LYS n 
1 32  VAL n 
1 33  VAL n 
1 34  PHE n 
1 35  ASP n 
1 36  THR n 
1 37  GLY n 
1 38  SER n 
1 39  SER n 
1 40  ASN n 
1 41  VAL n 
1 42  TRP n 
1 43  VAL n 
1 44  PRO n 
1 45  SER n 
1 46  SER n 
1 47  LYS n 
1 48  CYS n 
1 49  SER n 
1 50  ARG n 
1 51  LEU n 
1 52  TYR n 
1 53  THR n 
1 54  ALA n 
1 55  CYS n 
1 56  VAL n 
1 57  TYR n 
1 58  HIS n 
1 59  LYS n 
1 60  LEU n 
1 61  PHE n 
1 62  ASP n 
1 63  ALA n 
1 64  SER n 
1 65  ASP n 
1 66  SER n 
1 67  SER n 
1 68  SER n 
1 69  TYR n 
1 70  LYS n 
1 71  HIS n 
1 72  ASN n 
1 73  GLY n 
1 74  THR n 
1 75  GLU n 
1 76  LEU n 
1 77  THR n 
1 78  LEU n 
1 79  ARG n 
1 80  TYR n 
1 81  SER n 
1 82  THR n 
1 83  GLY n 
1 84  THR n 
1 85  VAL n 
1 86  SER n 
1 87  GLY n 
1 88  PHE n 
1 89  LEU n 
1 90  SER n 
1 91  GLN n 
1 92  ASP n 
1 93  ILE n 
1 94  ILE n 
1 95  THR n 
1 96  VAL n 
1 97  GLY n 
1 98  GLY n 
1 99  ILE n 
1 100 THR n 
1 101 VAL n 
1 102 THR n 
1 103 GLN n 
1 104 MET n 
1 105 PHE n 
1 106 GLY n 
1 107 GLU n 
1 108 VAL n 
1 109 THR n 
1 110 GLU n 
1 111 MET n 
1 112 PRO n 
1 113 ALA n 
1 114 LEU n 
1 115 PRO n 
1 116 PHE n 
1 117 MET n 
1 118 LEU n 
1 119 ALA n 
1 120 GLU n 
1 121 PHE n 
1 122 ASP n 
1 123 GLY n 
1 124 VAL n 
1 125 VAL n 
1 126 GLY n 
1 127 MET n 
1 128 GLY n 
1 129 PHE n 
1 130 ILE n 
1 131 GLU n 
1 132 GLN n 
1 133 ALA n 
1 134 ILE n 
1 135 GLY n 
1 136 ARG n 
1 137 VAL n 
1 138 THR n 
1 139 PRO n 
1 140 ILE n 
1 141 PHE n 
1 142 ASP n 
1 143 ASN n 
1 144 ILE n 
1 145 ILE n 
1 146 SER n 
1 147 GLN n 
1 148 GLY n 
1 149 VAL n 
1 150 LEU n 
1 151 LYS n 
1 152 GLU n 
1 153 ASP n 
1 154 VAL n 
1 155 PHE n 
1 156 SER n 
1 157 PHE n 
1 158 TYR n 
1 159 TYR n 
1 160 ASN n 
1 161 ARG n 
1 162 ASP n 
1 163 SER n 
1 164 GLU n 
1 165 ASN n 
1 166 SER n 
1 167 GLN n 
1 168 SER n 
1 169 LEU n 
1 170 GLY n 
1 171 GLY n 
1 172 GLN n 
1 173 ILE n 
1 174 VAL n 
1 175 LEU n 
1 176 GLY n 
1 177 GLY n 
1 178 SER n 
1 179 ASP n 
1 180 PRO n 
1 181 GLN n 
1 182 HIS n 
1 183 TYR n 
1 184 GLU n 
1 185 GLY n 
1 186 ASN n 
1 187 PHE n 
1 188 HIS n 
1 189 TYR n 
1 190 ILE n 
1 191 ASN n 
1 192 LEU n 
1 193 ILE n 
1 194 LYS n 
1 195 THR n 
1 196 GLY n 
1 197 VAL n 
1 198 TRP n 
1 199 GLN n 
1 200 ILE n 
1 201 GLN n 
1 202 MET n 
1 203 LYS n 
1 204 GLY n 
1 205 VAL n 
1 206 SER n 
1 207 VAL n 
1 208 GLY n 
1 209 SER n 
1 210 SER n 
1 211 THR n 
1 212 LEU n 
1 213 LEU n 
1 214 CYS n 
1 215 GLU n 
1 216 ASP n 
1 217 GLY n 
1 218 CYS n 
1 219 LEU n 
1 220 ALA n 
1 221 LEU n 
1 222 VAL n 
1 223 ASP n 
1 224 THR n 
1 225 GLY n 
1 226 ALA n 
1 227 SER n 
1 228 TYR n 
1 229 ILE n 
1 230 SER n 
1 231 GLY n 
1 232 SER n 
1 233 THR n 
1 234 SER n 
1 235 SER n 
1 236 ILE n 
1 237 GLU n 
1 238 LYS n 
1 239 LEU n 
1 240 MET n 
1 241 GLU n 
1 242 ALA n 
1 243 LEU n 
1 244 GLY n 
1 245 ALA n 
1 246 LYS n 
1 247 LYS n 
1 248 ARG n 
1 249 LEU n 
1 250 PHE n 
1 251 ASP n 
1 252 TYR n 
1 253 VAL n 
1 254 VAL n 
1 255 LYS n 
1 256 CYS n 
1 257 ASN n 
1 258 GLU n 
1 259 GLY n 
1 260 PRO n 
1 261 THR n 
1 262 LEU n 
1 263 PRO n 
1 264 ASP n 
1 265 ILE n 
1 266 SER n 
1 267 PHE n 
1 268 HIS n 
1 269 LEU n 
1 270 GLY n 
1 271 GLY n 
1 272 LYS n 
1 273 GLU n 
1 274 TYR n 
1 275 THR n 
1 276 LEU n 
1 277 THR n 
1 278 SER n 
1 279 ALA n 
1 280 ASP n 
1 281 TYR n 
1 282 VAL n 
1 283 PHE n 
1 284 GLN n 
1 285 GLU n 
1 286 SER n 
1 287 TYR n 
1 288 SER n 
1 289 SER n 
1 290 LYS n 
1 291 LYS n 
1 292 LEU n 
1 293 CYS n 
1 294 THR n 
1 295 LEU n 
1 296 ALA n 
1 297 ILE n 
1 298 HIS n 
1 299 ALA n 
1 300 MET n 
1 301 ASP n 
1 302 ILE n 
1 303 PRO n 
1 304 PRO n 
1 305 PRO n 
1 306 THR n 
1 307 GLY n 
1 308 PRO n 
1 309 THR n 
1 310 TRP n 
1 311 ALA n 
1 312 LEU n 
1 313 GLY n 
1 314 ALA n 
1 315 THR n 
1 316 PHE n 
1 317 ILE n 
1 318 ARG n 
1 319 LYS n 
1 320 PHE n 
1 321 TYR n 
1 322 THR n 
1 323 GLU n 
1 324 PHE n 
1 325 ASP n 
1 326 ARG n 
1 327 ARG n 
1 328 ASN n 
1 329 ASN n 
1 330 ARG n 
1 331 ILE n 
1 332 GLY n 
1 333 PHE n 
1 334 ALA n 
1 335 LEU n 
1 336 ALA n 
1 337 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 REN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pcDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RENI_HUMAN 
_struct_ref.pdbx_db_accession          P00797 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
;
_struct_ref.pdbx_align_begin           70 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GW5 A 1 ? 337 ? P00797 70 ? 406 ? 4 340 
2 1 3GW5 B 1 ? 337 ? P00797 70 ? 406 ? 4 340 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
72X non-polymer                  . 
;(3R)-3-[(1S)-1-(3-chlorophenyl)-1-hydroxy-5-methoxypentyl]-N-{(1S)-2-cyclohexyl-1-[(methylamino)methyl]ethyl}piperidine-1-carboxamide
;
?                               'C28 H46 Cl N3 O3' 508.136 
ALA 'L-peptide linking'          y ALANINE ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'          y ARGININE ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'          y ASPARAGINE ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ?                               'C4 H7 N O4'       133.103 
CL  non-polymer                  . 'CHLORIDE ION' ?                               'Cl -1'            35.453  
CYS 'L-peptide linking'          y CYSTEINE ?                               'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking'          y GLUTAMINE ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'            y GLYCINE ?                               'C2 H5 N O2'       75.067  
GOL non-polymer                  . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking'          y HISTIDINE ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                  . WATER ?                               'H2 O'             18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'          y LEUCINE ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'          y LYSINE ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'          y METHIONINE ?                               'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                               'C8 H15 N O6'      
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'          y PROLINE ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking'          y SERINE ?                               'C3 H7 N O3'       105.093 
THR 'L-peptide linking'          y THREONINE ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'          y TYROSINE ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'          y VALINE ?                               'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3GW5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.80 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M Tris-HCl, pH 7-8, 0.2 M (NH4)2SO4, 18-26% PEG3550, 5 mg/ml renin, 1 mM inhibitor , VAPOR DIFFUSION, HANGING DROP, temperature 278K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-10-30 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si (111) double-crystal monochromator' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X8C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X8C 
# 
_reflns.entry_id                     3GW5 
_reflns.d_resolution_high            2.000 
_reflns.d_resolution_low             20 
_reflns.limit_h_max                  27 
_reflns.limit_h_min                  0 
_reflns.limit_k_max                  48 
_reflns.limit_k_min                  0 
_reflns.limit_l_max                  74 
_reflns.limit_l_min                  0 
_reflns.number_all                   54200 
_reflns.number_obs                   45324 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.percent_possible_obs         83.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   76.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_Rsym_value        0.57 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.number_unique_all      4070 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GW5 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    83.5 
_refine.ls_number_reflns_obs                     41273 
_refine.ls_R_factor_R_work                       0.210 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_percent_reflns_R_free                 3.800 
_refine.ls_number_reflns_R_free                  2057 
_refine.B_iso_mean                               35.840 
_refine.aniso_B[1][1]                            0.003 
_refine.aniso_B[2][2]                            -0.116 
_refine.aniso_B[3][3]                            0.114 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          ? 
_refine.B_iso_max                                84.22 
_refine.B_iso_min                                12.69 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          0.00 
_refine.ls_number_reflns_all                     54269 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'pdb entry 3D91' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5149 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         143 
_refine_hist.number_atoms_solvent             356 
_refine_hist.number_atoms_total               5648 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.005 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_d    ? 0.863 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.368 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 2.023 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.126 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 2.807 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_obs                2838 
_refine_ls_shell.number_reflns_R_free             169 
_refine_ls_shell.R_factor_R_work                  0.30 
_refine_ls_shell.R_factor_R_free                  0.40 
_refine_ls_shell.R_factor_R_free_error            0.00 
_refine_ls_shell.percent_reflns_obs               76.5 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 dna-rna_rep.param  dna-rna.top      'X-RAY DIFFRACTION' 
3 water_rep.param    water.top        'X-RAY DIFFRACTION' 
4 ion.param          ion.top          'X-RAY DIFFRACTION' 
5 vtp25720.par       vtp25720.top     'X-RAY DIFFRACTION' 
6 glycerol.par       glycerol.top     'X-RAY DIFFRACTION' 
7 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GW5 
_struct.title                     'Crystal structure of human renin complexed with a novel inhibitor' 
_struct.pdbx_descriptor           'Renin (E.C.3.4.23.15)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GW5 
_struct_keywords.pdbx_keywords   'Hydrolase/Hydrolase inhibitor' 
_struct_keywords.text            
;renin, aspartate protease, hypertension, renin expression, renin inhibitor, Aspartyl protease, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Zymogen, Hydrolase-Hydrolase inhibitor COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 3 ? 
K N N 6 ? 
L N N 4 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 52  ? VAL A 56  ? TYR A 55  VAL A 59  5 ? 5  
HELX_P HELX_P2  2  ASP A 62  ? SER A 66  ? ASP A 65  SER A 69  5 ? 5  
HELX_P HELX_P3  3  PRO A 112 ? MET A 117 ? PRO A 115 MET A 120 1 ? 6  
HELX_P HELX_P4  4  PHE A 129 ? VAL A 137 ? PHE A 132 VAL A 140 5 ? 9  
HELX_P HELX_P5  5  PRO A 139 ? GLY A 148 ? PRO A 142 GLY A 151 1 ? 10 
HELX_P HELX_P6  6  ASP A 179 ? GLN A 181 ? ASP A 182 GLN A 184 5 ? 3  
HELX_P HELX_P7  7  SER A 232 ? GLY A 244 ? SER A 235 GLY A 247 1 ? 13 
HELX_P HELX_P8  8  ASN A 257 ? LEU A 262 ? ASN A 260 LEU A 265 5 ? 6  
HELX_P HELX_P9  9  THR A 277 ? VAL A 282 ? THR A 280 VAL A 285 1 ? 6  
HELX_P HELX_P10 10 GLY A 313 ? ARG A 318 ? GLY A 316 ARG A 321 1 ? 6  
HELX_P HELX_P11 11 THR B 53  ? HIS B 58  ? THR B 56  HIS B 61  1 ? 6  
HELX_P HELX_P12 12 ASP B 62  ? SER B 66  ? ASP B 65  SER B 69  5 ? 5  
HELX_P HELX_P13 13 PRO B 112 ? MET B 117 ? PRO B 115 MET B 120 1 ? 6  
HELX_P HELX_P14 14 PHE B 129 ? VAL B 137 ? PHE B 132 VAL B 140 5 ? 9  
HELX_P HELX_P15 15 PRO B 139 ? GLN B 147 ? PRO B 142 GLN B 150 1 ? 9  
HELX_P HELX_P16 16 ASP B 179 ? GLN B 181 ? ASP B 182 GLN B 184 5 ? 3  
HELX_P HELX_P17 17 SER B 232 ? GLY B 244 ? SER B 235 GLY B 247 1 ? 13 
HELX_P HELX_P18 18 ASN B 257 ? LEU B 262 ? ASN B 260 LEU B 265 5 ? 6  
HELX_P HELX_P19 19 THR B 277 ? VAL B 282 ? THR B 280 VAL B 285 1 ? 6  
HELX_P HELX_P20 20 GLY B 313 ? ARG B 318 ? GLY B 316 ARG B 321 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 48  SG  ? ? ? 1_555 A CYS 55  SG ? ? A CYS 51  A CYS 58  1_555 ? ? ? ? ? ? ? 2.403 ? ?               
disulf2 disulf ?    ? A CYS 214 SG  ? ? ? 1_555 A CYS 218 SG ? ? A CYS 217 A CYS 221 1_555 ? ? ? ? ? ? ? 2.617 ? ?               
disulf3 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 293 SG ? ? A CYS 259 A CYS 296 1_555 ? ? ? ? ? ? ? 2.626 ? ?               
disulf4 disulf ?    ? B CYS 48  SG  ? ? ? 1_555 B CYS 55  SG ? ? B CYS 51  B CYS 58  1_555 ? ? ? ? ? ? ? 2.745 ? ?               
disulf5 disulf ?    ? B CYS 214 SG  ? ? ? 1_555 B CYS 218 SG ? ? B CYS 217 B CYS 221 1_555 ? ? ? ? ? ? ? 2.687 ? ?               
disulf6 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 293 SG ? ? B CYS 259 B CYS 296 1_555 ? ? ? ? ? ? ? 2.626 ? ?               
covale1 covale one  ? A ASN 72  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 75  C NAG 1   1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale2 covale one  ? B ASN 72  ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 75  B NAG 600 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.390 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 25  A . ? THR 28  A PRO 26  A ? PRO 29  A 1 -5.58 
2 LEU 114 A . ? LEU 117 A PRO 115 A ? PRO 118 A 1 7.31  
3 PRO 304 A . ? PRO 307 A PRO 305 A ? PRO 308 A 1 2.80  
4 GLY 307 A . ? GLY 310 A PRO 308 A ? PRO 311 A 1 -1.17 
5 THR 25  B . ? THR 28  B PRO 26  B ? PRO 29  B 1 -5.71 
6 LEU 114 B . ? LEU 117 B PRO 115 B ? PRO 118 B 1 11.66 
7 PRO 304 B . ? PRO 307 B PRO 305 B ? PRO 308 B 1 0.51  
8 GLY 307 B . ? GLY 310 B PRO 308 B ? PRO 311 B 1 -1.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9  ? 
B ? 13 ? 
C ? 3  ? 
D ? 4  ? 
E ? 2  ? 
F ? 3  ? 
G ? 9  ? 
H ? 13 ? 
I ? 4  ? 
J ? 4  ? 
K ? 2  ? 
L ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? parallel      
B 4  5  ? anti-parallel 
B 5  6  ? parallel      
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
B 12 13 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
E 1  2  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? parallel      
H 4  5  ? anti-parallel 
H 5  6  ? parallel      
H 6  7  ? anti-parallel 
H 7  8  ? anti-parallel 
H 8  9  ? anti-parallel 
H 9  10 ? anti-parallel 
H 10 11 ? anti-parallel 
H 11 12 ? anti-parallel 
H 12 13 ? anti-parallel 
I 1  2  ? anti-parallel 
I 2  3  ? anti-parallel 
I 3  4  ? anti-parallel 
J 1  2  ? anti-parallel 
J 2  3  ? anti-parallel 
J 3  4  ? parallel      
K 1  2  ? parallel      
L 1  2  ? anti-parallel 
L 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LYS A 70  ? TYR A 80  ? LYS A 73  TYR A 83  
A 2  GLY A 83  ? VAL A 96  ? GLY A 86  VAL A 99  
A 3  GLN A 16  ? ILE A 23  ? GLN A 19  ILE A 26  
A 4  SER A 5   ? TYR A 12  ? SER A 8   TYR A 15  
A 5  GLY A 171 ? LEU A 175 ? GLY A 174 LEU A 178 
A 6  VAL A 154 ? TYR A 159 ? VAL A 157 TYR A 162 
A 7  PHE A 320 ? ASP A 325 ? PHE A 323 ASP A 328 
A 8  ARG A 330 ? ALA A 336 ? ARG A 333 ALA A 339 
A 9  TYR A 183 ? ASN A 191 ? TYR A 186 ASN A 194 
B 1  LYS A 70  ? TYR A 80  ? LYS A 73  TYR A 83  
B 2  GLY A 83  ? VAL A 96  ? GLY A 86  VAL A 99  
B 3  ILE A 99  ? GLU A 110 ? ILE A 102 GLU A 113 
B 4  VAL A 41  ? PRO A 44  ? VAL A 44  PRO A 47  
B 5  GLY A 123 ? GLY A 126 ? GLY A 126 GLY A 129 
B 6  GLN A 28  ? ASP A 35  ? GLN A 31  ASP A 38  
B 7  GLN A 16  ? ILE A 23  ? GLN A 19  ILE A 26  
B 8  SER A 5   ? TYR A 12  ? SER A 8   TYR A 15  
B 9  GLY A 171 ? LEU A 175 ? GLY A 174 LEU A 178 
B 10 VAL A 154 ? TYR A 159 ? VAL A 157 TYR A 162 
B 11 PHE A 320 ? ASP A 325 ? PHE A 323 ASP A 328 
B 12 ARG A 330 ? ALA A 336 ? ARG A 333 ALA A 339 
B 13 TYR A 183 ? ASN A 191 ? TYR A 186 ASN A 194 
C 1  GLN A 199 ? MET A 202 ? GLN A 202 MET A 205 
C 2  CYS A 218 ? VAL A 222 ? CYS A 221 VAL A 225 
C 3  TRP A 310 ? LEU A 312 ? TRP A 313 LEU A 315 
D 1  SER A 210 ? LEU A 213 ? SER A 213 LEU A 216 
D 2  GLY A 204 ? VAL A 207 ? GLY A 207 VAL A 210 
D 3  ILE A 265 ? LEU A 269 ? ILE A 268 LEU A 272 
D 4  LYS A 272 ? LEU A 276 ? LYS A 275 LEU A 279 
E 1  ILE A 229 ? GLY A 231 ? ILE A 232 GLY A 234 
E 2  ILE A 297 ? ALA A 299 ? ILE A 300 ALA A 302 
F 1  LYS A 246 ? LYS A 247 ? LYS A 249 LYS A 250 
F 2  TYR A 252 ? LYS A 255 ? TYR A 255 LYS A 258 
F 3  LEU A 292 ? THR A 294 ? LEU A 295 THR A 297 
G 1  GLU B 75  ? TYR B 80  ? GLU B 78  TYR B 83  
G 2  GLY B 83  ? VAL B 96  ? GLY B 86  VAL B 99  
G 3  GLN B 16  ? ILE B 23  ? GLN B 19  ILE B 26  
G 4  SER B 5   ? TYR B 12  ? SER B 8   TYR B 15  
G 5  GLY B 171 ? LEU B 175 ? GLY B 174 LEU B 178 
G 6  VAL B 154 ? TYR B 159 ? VAL B 157 TYR B 162 
G 7  PHE B 320 ? ASP B 325 ? PHE B 323 ASP B 328 
G 8  ARG B 330 ? ALA B 336 ? ARG B 333 ALA B 339 
G 9  TYR B 183 ? ASN B 191 ? TYR B 186 ASN B 194 
H 1  GLU B 75  ? TYR B 80  ? GLU B 78  TYR B 83  
H 2  GLY B 83  ? VAL B 96  ? GLY B 86  VAL B 99  
H 3  ILE B 99  ? GLU B 110 ? ILE B 102 GLU B 113 
H 4  VAL B 41  ? PRO B 44  ? VAL B 44  PRO B 47  
H 5  GLY B 123 ? GLY B 126 ? GLY B 126 GLY B 129 
H 6  GLN B 28  ? ASP B 35  ? GLN B 31  ASP B 38  
H 7  GLN B 16  ? ILE B 23  ? GLN B 19  ILE B 26  
H 8  SER B 5   ? TYR B 12  ? SER B 8   TYR B 15  
H 9  GLY B 171 ? LEU B 175 ? GLY B 174 LEU B 178 
H 10 VAL B 154 ? TYR B 159 ? VAL B 157 TYR B 162 
H 11 PHE B 320 ? ASP B 325 ? PHE B 323 ASP B 328 
H 12 ARG B 330 ? ALA B 336 ? ARG B 333 ALA B 339 
H 13 TYR B 183 ? ASN B 191 ? TYR B 186 ASN B 194 
I 1  SER B 210 ? LEU B 213 ? SER B 213 LEU B 216 
I 2  GLN B 199 ? VAL B 207 ? GLN B 202 VAL B 210 
I 3  ILE B 265 ? LEU B 269 ? ILE B 268 LEU B 272 
I 4  LYS B 272 ? LEU B 276 ? LYS B 275 LEU B 279 
J 1  SER B 210 ? LEU B 213 ? SER B 213 LEU B 216 
J 2  GLN B 199 ? VAL B 207 ? GLN B 202 VAL B 210 
J 3  CYS B 218 ? VAL B 222 ? CYS B 221 VAL B 225 
J 4  TRP B 310 ? LEU B 312 ? TRP B 313 LEU B 315 
K 1  ILE B 229 ? GLY B 231 ? ILE B 232 GLY B 234 
K 2  ILE B 297 ? ALA B 299 ? ILE B 300 ALA B 302 
L 1  LYS B 246 ? LYS B 247 ? LYS B 249 LYS B 250 
L 2  TYR B 252 ? LYS B 255 ? TYR B 255 LYS B 258 
L 3  LEU B 292 ? THR B 294 ? LEU B 295 THR B 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N LYS A 70  ? N LYS A 73  O GLN A 91  ? O GLN A 94  
A 2  3  O THR A 95  ? O THR A 98  N GLY A 22  ? N GLY A 25  
A 3  4  O TYR A 18  ? O TYR A 21  N THR A 10  ? N THR A 13  
A 4  5  N SER A 5   ? N SER A 8   O LEU A 175 ? O LEU A 178 
A 5  6  O GLN A 172 ? O GLN A 175 N TYR A 158 ? N TYR A 161 
A 6  7  N PHE A 155 ? N PHE A 158 O PHE A 324 ? O PHE A 327 
A 7  8  N GLU A 323 ? N GLU A 326 O GLY A 332 ? O GLY A 335 
A 8  9  O ILE A 331 ? O ILE A 334 N ILE A 190 ? N ILE A 193 
B 1  2  N LYS A 70  ? N LYS A 73  O GLN A 91  ? O GLN A 94  
B 2  3  N ILE A 94  ? N ILE A 97  O VAL A 101 ? O VAL A 104 
B 3  4  O GLY A 106 ? O GLY A 109 N VAL A 41  ? N VAL A 44  
B 4  5  N TRP A 42  ? N TRP A 45  O VAL A 124 ? O VAL A 127 
B 5  6  O VAL A 125 ? O VAL A 128 N VAL A 33  ? N VAL A 36  
B 6  7  O GLN A 28  ? O GLN A 31  N ILE A 23  ? N ILE A 26  
B 7  8  O TYR A 18  ? O TYR A 21  N THR A 10  ? N THR A 13  
B 8  9  N SER A 5   ? N SER A 8   O LEU A 175 ? O LEU A 178 
B 9  10 O GLN A 172 ? O GLN A 175 N TYR A 158 ? N TYR A 161 
B 10 11 N PHE A 155 ? N PHE A 158 O PHE A 324 ? O PHE A 327 
B 11 12 N GLU A 323 ? N GLU A 326 O GLY A 332 ? O GLY A 335 
B 12 13 O ILE A 331 ? O ILE A 334 N ILE A 190 ? N ILE A 193 
C 1  2  N MET A 202 ? N MET A 205 O CYS A 218 ? O CYS A 221 
C 2  3  N LEU A 221 ? N LEU A 224 O LEU A 312 ? O LEU A 315 
D 1  2  O LEU A 213 ? O LEU A 216 N VAL A 205 ? N VAL A 208 
D 2  3  N GLY A 204 ? N GLY A 207 O HIS A 268 ? O HIS A 271 
D 3  4  N PHE A 267 ? N PHE A 270 O TYR A 274 ? O TYR A 277 
E 1  2  N ILE A 229 ? N ILE A 232 O HIS A 298 ? O HIS A 301 
F 1  2  N LYS A 246 ? N LYS A 249 O VAL A 253 ? O VAL A 256 
F 2  3  N VAL A 254 ? N VAL A 257 O CYS A 293 ? O CYS A 296 
G 1  2  N LEU B 76  ? N LEU B 79  O GLY B 87  ? O GLY B 90  
G 2  3  O THR B 95  ? O THR B 98  N GLY B 22  ? N GLY B 25  
G 3  4  O GLN B 16  ? O GLN B 19  N TYR B 12  ? N TYR B 15  
G 4  5  N SER B 5   ? N SER B 8   O LEU B 175 ? O LEU B 178 
G 5  6  O GLN B 172 ? O GLN B 175 N TYR B 158 ? N TYR B 161 
G 6  7  N PHE B 155 ? N PHE B 158 O PHE B 324 ? O PHE B 327 
G 7  8  N ASP B 325 ? N ASP B 328 O ARG B 330 ? O ARG B 333 
G 8  9  O ILE B 331 ? O ILE B 334 N ILE B 190 ? N ILE B 193 
H 1  2  N LEU B 76  ? N LEU B 79  O GLY B 87  ? O GLY B 90  
H 2  3  N PHE B 88  ? N PHE B 91  O GLU B 107 ? O GLU B 110 
H 3  4  O GLY B 106 ? O GLY B 109 N VAL B 41  ? N VAL B 44  
H 4  5  N TRP B 42  ? N TRP B 45  O VAL B 124 ? O VAL B 127 
H 5  6  O VAL B 125 ? O VAL B 128 N VAL B 33  ? N VAL B 36  
H 6  7  O GLN B 28  ? O GLN B 31  N ILE B 23  ? N ILE B 26  
H 7  8  O GLN B 16  ? O GLN B 19  N TYR B 12  ? N TYR B 15  
H 8  9  N SER B 5   ? N SER B 8   O LEU B 175 ? O LEU B 178 
H 9  10 O GLN B 172 ? O GLN B 175 N TYR B 158 ? N TYR B 161 
H 10 11 N PHE B 155 ? N PHE B 158 O PHE B 324 ? O PHE B 327 
H 11 12 N ASP B 325 ? N ASP B 328 O ARG B 330 ? O ARG B 333 
H 12 13 O ILE B 331 ? O ILE B 334 N ILE B 190 ? N ILE B 193 
I 1  2  O SER B 210 ? O SER B 213 N VAL B 207 ? N VAL B 210 
I 2  3  N GLY B 204 ? N GLY B 207 O HIS B 268 ? O HIS B 271 
I 3  4  N ILE B 265 ? N ILE B 268 O LEU B 276 ? O LEU B 279 
J 1  2  O SER B 210 ? O SER B 213 N VAL B 207 ? N VAL B 210 
J 2  3  N MET B 202 ? N MET B 205 O CYS B 218 ? O CYS B 221 
J 3  4  N LEU B 221 ? N LEU B 224 O LEU B 312 ? O LEU B 315 
K 1  2  N ILE B 229 ? N ILE B 232 O HIS B 298 ? O HIS B 301 
L 1  2  N LYS B 246 ? N LYS B 249 O VAL B 253 ? O VAL B 256 
L 2  3  N VAL B 254 ? N VAL B 257 O CYS B 293 ? O CYS B 296 
# 
_atom_sites.entry_id                    3GW5 
_atom_sites.fract_transf_matrix[1][1]   0.018449 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010302 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006687 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? 22.803 16.221  9.242   1.00 53.93 ? 4   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? 23.543 17.189  8.378   1.00 53.49 ? 4   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? 22.733 17.642  7.179   1.00 52.26 ? 4   GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? 21.523 17.429  7.123   1.00 50.69 ? 4   GLY A O   1 
ATOM   5    N  N   . ASN A 1 2   ? 23.403 18.270  6.217   1.00 52.75 ? 5   ASN A N   1 
ATOM   6    C  CA  . ASN A 1 2   ? 22.735 18.786  5.026   1.00 53.57 ? 5   ASN A CA  1 
ATOM   7    C  C   . ASN A 1 2   ? 23.492 18.404  3.755   1.00 53.62 ? 5   ASN A C   1 
ATOM   8    O  O   . ASN A 1 2   ? 23.295 19.006  2.700   1.00 54.49 ? 5   ASN A O   1 
ATOM   9    C  CB  . ASN A 1 2   ? 22.600 20.307  5.121   1.00 53.83 ? 5   ASN A CB  1 
ATOM   10   N  N   . THR A 1 3   ? 24.352 17.397  3.860   1.00 53.09 ? 6   THR A N   1 
ATOM   11   C  CA  . THR A 1 3   ? 25.237 17.032  2.761   1.00 52.50 ? 6   THR A CA  1 
ATOM   12   C  C   . THR A 1 3   ? 24.619 16.017  1.803   1.00 52.57 ? 6   THR A C   1 
ATOM   13   O  O   . THR A 1 3   ? 23.950 15.077  2.227   1.00 51.95 ? 6   THR A O   1 
ATOM   14   C  CB  . THR A 1 3   ? 26.548 16.444  3.294   1.00 52.06 ? 6   THR A CB  1 
ATOM   15   O  OG1 . THR A 1 3   ? 27.167 17.385  4.179   1.00 52.98 ? 6   THR A OG1 1 
ATOM   16   C  CG2 . THR A 1 3   ? 27.488 16.126  2.147   1.00 52.01 ? 6   THR A CG2 1 
ATOM   17   N  N   . THR A 1 4   ? 24.846 16.221  0.508   1.00 52.84 ? 7   THR A N   1 
ATOM   18   C  CA  . THR A 1 4   ? 24.577 15.199  -0.497  1.00 53.71 ? 7   THR A CA  1 
ATOM   19   C  C   . THR A 1 4   ? 25.722 15.169  -1.509  1.00 54.17 ? 7   THR A C   1 
ATOM   20   O  O   . THR A 1 4   ? 25.868 16.088  -2.316  1.00 55.61 ? 7   THR A O   1 
ATOM   21   C  CB  . THR A 1 4   ? 23.267 15.477  -1.265  1.00 54.88 ? 7   THR A CB  1 
ATOM   22   O  OG1 . THR A 1 4   ? 23.423 16.653  -2.070  1.00 58.00 ? 7   THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 4   ? 22.110 15.682  -0.299  1.00 55.22 ? 7   THR A CG2 1 
ATOM   24   N  N   . SER A 1 5   ? 26.532 14.115  -1.464  1.00 52.77 ? 8   SER A N   1 
ATOM   25   C  CA  . SER A 1 5   ? 27.634 13.966  -2.405  1.00 51.34 ? 8   SER A CA  1 
ATOM   26   C  C   . SER A 1 5   ? 27.190 13.187  -3.633  1.00 50.22 ? 8   SER A C   1 
ATOM   27   O  O   . SER A 1 5   ? 26.381 12.266  -3.538  1.00 49.78 ? 8   SER A O   1 
ATOM   28   C  CB  . SER A 1 5   ? 28.806 13.243  -1.742  1.00 53.21 ? 8   SER A CB  1 
ATOM   29   O  OG  . SER A 1 5   ? 29.344 14.016  -0.684  1.00 57.52 ? 8   SER A OG  1 
ATOM   30   N  N   . SER A 1 6   ? 27.721 13.569  -4.789  1.00 48.23 ? 9   SER A N   1 
ATOM   31   C  CA  . SER A 1 6   ? 27.450 12.854  -6.025  1.00 46.83 ? 9   SER A CA  1 
ATOM   32   C  C   . SER A 1 6   ? 28.721 12.177  -6.514  1.00 45.06 ? 9   SER A C   1 
ATOM   33   O  O   . SER A 1 6   ? 29.823 12.698  -6.337  1.00 45.70 ? 9   SER A O   1 
ATOM   34   C  CB  . SER A 1 6   ? 26.969 13.819  -7.097  1.00 47.29 ? 9   SER A CB  1 
ATOM   35   O  OG  . SER A 1 6   ? 28.070 14.531  -7.631  1.00 49.94 ? 9   SER A OG  1 
ATOM   36   N  N   . VAL A 1 7   ? 28.570 11.015  -7.138  1.00 42.88 ? 10  VAL A N   1 
ATOM   37   C  CA  . VAL A 1 7   ? 29.703 10.353  -7.766  1.00 38.86 ? 10  VAL A CA  1 
ATOM   38   C  C   . VAL A 1 7   ? 29.393 10.053  -9.222  1.00 36.61 ? 10  VAL A C   1 
ATOM   39   O  O   . VAL A 1 7   ? 28.404 9.388   -9.536  1.00 37.03 ? 10  VAL A O   1 
ATOM   40   C  CB  . VAL A 1 7   ? 30.055 9.030   -7.055  1.00 40.58 ? 10  VAL A CB  1 
ATOM   41   C  CG1 . VAL A 1 7   ? 31.206 8.345   -7.786  1.00 40.54 ? 10  VAL A CG1 1 
ATOM   42   C  CG2 . VAL A 1 7   ? 30.439 9.299   -5.604  1.00 40.10 ? 10  VAL A CG2 1 
ATOM   43   N  N   . ILE A 1 8   ? 30.247 10.546  -10.108 1.00 32.92 ? 11  ILE A N   1 
ATOM   44   C  CA  . ILE A 1 8   ? 30.099 10.308  -11.533 1.00 31.15 ? 11  ILE A CA  1 
ATOM   45   C  C   . ILE A 1 8   ? 30.458 8.867   -11.854 1.00 29.44 ? 11  ILE A C   1 
ATOM   46   O  O   . ILE A 1 8   ? 31.453 8.340   -11.362 1.00 28.69 ? 11  ILE A O   1 
ATOM   47   C  CB  . ILE A 1 8   ? 31.012 11.241  -12.350 1.00 30.88 ? 11  ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 8   ? 30.545 12.687  -12.184 1.00 31.99 ? 11  ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 8   ? 30.995 10.844  -13.820 1.00 32.23 ? 11  ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 8   ? 31.467 13.701  -12.816 1.00 32.84 ? 11  ILE A CD1 1 
ATOM   51   N  N   . LEU A 1 9   ? 29.635 8.231   -12.677 1.00 28.27 ? 12  LEU A N   1 
ATOM   52   C  CA  . LEU A 1 9   ? 29.857 6.842   -13.028 1.00 28.41 ? 12  LEU A CA  1 
ATOM   53   C  C   . LEU A 1 9   ? 30.181 6.719   -14.505 1.00 29.29 ? 12  LEU A C   1 
ATOM   54   O  O   . LEU A 1 9   ? 29.632 7.443   -15.339 1.00 30.61 ? 12  LEU A O   1 
ATOM   55   C  CB  . LEU A 1 9   ? 28.621 6.007   -12.690 1.00 26.50 ? 12  LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 9   ? 28.167 6.042   -11.226 1.00 28.11 ? 12  LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 9   ? 26.905 5.204   -11.059 1.00 27.42 ? 12  LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 9   ? 29.276 5.521   -10.328 1.00 25.32 ? 12  LEU A CD2 1 
ATOM   59   N  N   . THR A 1 10  ? 31.080 5.799   -14.826 1.00 27.91 ? 13  THR A N   1 
ATOM   60   C  CA  . THR A 1 10  ? 31.398 5.502   -16.206 1.00 27.74 ? 13  THR A CA  1 
ATOM   61   C  C   . THR A 1 10  ? 30.487 4.389   -16.706 1.00 28.63 ? 13  THR A C   1 
ATOM   62   O  O   . THR A 1 10  ? 30.212 3.423   -15.985 1.00 30.11 ? 13  THR A O   1 
ATOM   63   C  CB  . THR A 1 10  ? 32.866 5.063   -16.349 1.00 27.41 ? 13  THR A CB  1 
ATOM   64   O  OG1 . THR A 1 10  ? 33.718 6.123   -15.908 1.00 29.84 ? 13  THR A OG1 1 
ATOM   65   C  CG2 . THR A 1 10  ? 33.188 4.737   -17.789 1.00 26.29 ? 13  THR A CG2 1 
ATOM   66   N  N   . ASN A 1 11  ? 30.014 4.542   -17.937 1.00 26.16 ? 14  ASN A N   1 
ATOM   67   C  CA  . ASN A 1 11  ? 29.159 3.551   -18.574 1.00 28.62 ? 14  ASN A CA  1 
ATOM   68   C  C   . ASN A 1 11  ? 29.931 2.899   -19.706 1.00 28.00 ? 14  ASN A C   1 
ATOM   69   O  O   . ASN A 1 11  ? 30.233 3.532   -20.719 1.00 28.88 ? 14  ASN A O   1 
ATOM   70   C  CB  . ASN A 1 11  ? 27.897 4.217   -19.129 1.00 27.83 ? 14  ASN A CB  1 
ATOM   71   C  CG  . ASN A 1 11  ? 27.041 3.271   -19.947 1.00 28.72 ? 14  ASN A CG  1 
ATOM   72   O  OD1 . ASN A 1 11  ? 27.461 2.169   -20.290 1.00 27.72 ? 14  ASN A OD1 1 
ATOM   73   N  ND2 . ASN A 1 11  ? 25.826 3.708   -20.273 1.00 29.28 ? 14  ASN A ND2 1 
ATOM   74   N  N   . TYR A 1 12  ? 30.245 1.627   -19.529 1.00 27.77 ? 15  TYR A N   1 
ATOM   75   C  CA  . TYR A 1 12  ? 30.931 0.882   -20.559 1.00 29.94 ? 15  TYR A CA  1 
ATOM   76   C  C   . TYR A 1 12  ? 29.932 0.004   -21.297 1.00 31.63 ? 15  TYR A C   1 
ATOM   77   O  O   . TYR A 1 12  ? 29.480 -1.019  -20.774 1.00 28.98 ? 15  TYR A O   1 
ATOM   78   C  CB  . TYR A 1 12  ? 32.036 0.027   -19.935 1.00 30.44 ? 15  TYR A CB  1 
ATOM   79   C  CG  . TYR A 1 12  ? 32.773 -0.843  -20.920 1.00 32.22 ? 15  TYR A CG  1 
ATOM   80   C  CD1 . TYR A 1 12  ? 33.698 -0.298  -21.806 1.00 31.74 ? 15  TYR A CD1 1 
ATOM   81   C  CD2 . TYR A 1 12  ? 32.559 -2.212  -20.955 1.00 33.17 ? 15  TYR A CD2 1 
ATOM   82   C  CE1 . TYR A 1 12  ? 34.389 -1.098  -22.696 1.00 33.47 ? 15  TYR A CE1 1 
ATOM   83   C  CE2 . TYR A 1 12  ? 33.245 -3.021  -21.843 1.00 34.32 ? 15  TYR A CE2 1 
ATOM   84   C  CZ  . TYR A 1 12  ? 34.158 -2.460  -22.708 1.00 34.70 ? 15  TYR A CZ  1 
ATOM   85   O  OH  . TYR A 1 12  ? 34.841 -3.270  -23.584 1.00 38.09 ? 15  TYR A OH  1 
ATOM   86   N  N   . MET A 1 13  ? 29.589 0.422   -22.513 1.00 32.47 ? 16  MET A N   1 
ATOM   87   C  CA  . MET A 1 13  ? 28.744 -0.362  -23.412 1.00 32.77 ? 16  MET A CA  1 
ATOM   88   C  C   . MET A 1 13  ? 27.391 -0.727  -22.817 1.00 31.39 ? 16  MET A C   1 
ATOM   89   O  O   . MET A 1 13  ? 26.792 -1.727  -23.200 1.00 30.78 ? 16  MET A O   1 
ATOM   90   C  CB  . MET A 1 13  ? 29.470 -1.638  -23.834 1.00 37.89 ? 16  MET A CB  1 
ATOM   91   C  CG  . MET A 1 13  ? 30.727 -1.389  -24.663 1.00 44.54 ? 16  MET A CG  1 
ATOM   92   S  SD  . MET A 1 13  ? 31.499 -2.944  -25.165 1.00 53.97 ? 16  MET A SD  1 
ATOM   93   C  CE  . MET A 1 13  ? 30.431 -3.415  -26.548 1.00 51.68 ? 16  MET A CE  1 
ATOM   94   N  N   . ASP A 1 14  ? 26.913 0.079   -21.877 1.00 30.50 ? 17  ASP A N   1 
ATOM   95   C  CA  . ASP A 1 14  ? 25.612 -0.169  -21.266 1.00 31.09 ? 17  ASP A CA  1 
ATOM   96   C  C   . ASP A 1 14  ? 25.553 -1.522  -20.551 1.00 30.41 ? 17  ASP A C   1 
ATOM   97   O  O   . ASP A 1 14  ? 24.464 -2.046  -20.308 1.00 29.07 ? 17  ASP A O   1 
ATOM   98   C  CB  . ASP A 1 14  ? 24.503 -0.116  -22.325 1.00 30.15 ? 17  ASP A CB  1 
ATOM   99   C  CG  . ASP A 1 14  ? 24.360 1.258   -22.963 1.00 34.54 ? 17  ASP A CG  1 
ATOM   100  O  OD1 . ASP A 1 14  ? 24.314 2.264   -22.221 1.00 32.82 ? 17  ASP A OD1 1 
ATOM   101  O  OD2 . ASP A 1 14  ? 24.289 1.327   -24.214 1.00 35.58 ? 17  ASP A OD2 1 
ATOM   102  N  N   . THR A 1 15  ? 26.711 -2.092  -20.222 1.00 29.51 ? 18  THR A N   1 
ATOM   103  C  CA  . THR A 1 15  ? 26.731 -3.334  -19.462 1.00 30.77 ? 18  THR A CA  1 
ATOM   104  C  C   . THR A 1 15  ? 27.519 -3.226  -18.157 1.00 30.60 ? 18  THR A C   1 
ATOM   105  O  O   . THR A 1 15  ? 27.204 -3.917  -17.197 1.00 34.39 ? 18  THR A O   1 
ATOM   106  C  CB  . THR A 1 15  ? 27.297 -4.518  -20.297 1.00 29.99 ? 18  THR A CB  1 
ATOM   107  O  OG1 . THR A 1 15  ? 28.706 -4.359  -20.465 1.00 33.41 ? 18  THR A OG1 1 
ATOM   108  C  CG2 . THR A 1 15  ? 26.647 -4.559  -21.676 1.00 29.39 ? 18  THR A CG2 1 
ATOM   109  N  N   . GLN A 1 16  ? 28.537 -2.369  -18.109 1.00 29.18 ? 19  GLN A N   1 
ATOM   110  C  CA  . GLN A 1 16  ? 29.270 -2.162  -16.859 1.00 28.21 ? 19  GLN A CA  1 
ATOM   111  C  C   . GLN A 1 16  ? 29.224 -0.711  -16.400 1.00 28.46 ? 19  GLN A C   1 
ATOM   112  O  O   . GLN A 1 16  ? 29.644 0.187   -17.125 1.00 28.75 ? 19  GLN A O   1 
ATOM   113  C  CB  . GLN A 1 16  ? 30.732 -2.601  -17.010 1.00 26.97 ? 19  GLN A CB  1 
ATOM   114  C  CG  . GLN A 1 16  ? 30.910 -4.070  -17.353 1.00 25.69 ? 19  GLN A CG  1 
ATOM   115  C  CD  . GLN A 1 16  ? 32.371 -4.489  -17.375 1.00 24.92 ? 19  GLN A CD  1 
ATOM   116  O  OE1 . GLN A 1 16  ? 33.185 -3.971  -16.614 1.00 23.92 ? 19  GLN A OE1 1 
ATOM   117  N  NE2 . GLN A 1 16  ? 32.707 -5.427  -18.253 1.00 22.43 ? 19  GLN A NE2 1 
ATOM   118  N  N   . TYR A 1 17  ? 28.714 -0.486  -15.192 1.00 26.85 ? 20  TYR A N   1 
ATOM   119  C  CA  . TYR A 1 17  ? 28.690 0.854   -14.607 1.00 26.42 ? 20  TYR A CA  1 
ATOM   120  C  C   . TYR A 1 17  ? 29.536 0.884   -13.351 1.00 24.88 ? 20  TYR A C   1 
ATOM   121  O  O   . TYR A 1 17  ? 29.348 0.066   -12.453 1.00 25.28 ? 20  TYR A O   1 
ATOM   122  C  CB  . TYR A 1 17  ? 27.259 1.267   -14.248 1.00 25.39 ? 20  TYR A CB  1 
ATOM   123  C  CG  . TYR A 1 17  ? 26.354 1.464   -15.433 1.00 25.60 ? 20  TYR A CG  1 
ATOM   124  C  CD1 . TYR A 1 17  ? 26.011 2.739   -15.864 1.00 27.06 ? 20  TYR A CD1 1 
ATOM   125  C  CD2 . TYR A 1 17  ? 25.835 0.377   -16.122 1.00 26.63 ? 20  TYR A CD2 1 
ATOM   126  C  CE1 . TYR A 1 17  ? 25.177 2.930   -16.947 1.00 25.24 ? 20  TYR A CE1 1 
ATOM   127  C  CE2 . TYR A 1 17  ? 25.002 0.555   -17.207 1.00 28.26 ? 20  TYR A CE2 1 
ATOM   128  C  CZ  . TYR A 1 17  ? 24.675 1.836   -17.612 1.00 27.06 ? 20  TYR A CZ  1 
ATOM   129  O  OH  . TYR A 1 17  ? 23.832 2.015   -18.674 1.00 29.32 ? 20  TYR A OH  1 
ATOM   130  N  N   . TYR A 1 18  ? 30.468 1.830   -13.285 1.00 24.31 ? 21  TYR A N   1 
ATOM   131  C  CA  . TYR A 1 18  ? 31.339 1.953   -12.123 1.00 22.92 ? 21  TYR A CA  1 
ATOM   132  C  C   . TYR A 1 18  ? 31.811 3.385   -11.934 1.00 24.20 ? 21  TYR A C   1 
ATOM   133  O  O   . TYR A 1 18  ? 31.759 4.198   -12.857 1.00 20.80 ? 21  TYR A O   1 
ATOM   134  C  CB  . TYR A 1 18  ? 32.559 1.042   -12.275 1.00 22.78 ? 21  TYR A CB  1 
ATOM   135  C  CG  . TYR A 1 18  ? 33.433 1.394   -13.457 1.00 23.55 ? 21  TYR A CG  1 
ATOM   136  C  CD1 . TYR A 1 18  ? 33.189 0.850   -14.712 1.00 23.55 ? 21  TYR A CD1 1 
ATOM   137  C  CD2 . TYR A 1 18  ? 34.489 2.287   -13.325 1.00 24.28 ? 21  TYR A CD2 1 
ATOM   138  C  CE1 . TYR A 1 18  ? 33.966 1.186   -15.804 1.00 22.36 ? 21  TYR A CE1 1 
ATOM   139  C  CE2 . TYR A 1 18  ? 35.275 2.629   -14.413 1.00 23.04 ? 21  TYR A CE2 1 
ATOM   140  C  CZ  . TYR A 1 18  ? 35.007 2.076   -15.647 1.00 24.80 ? 21  TYR A CZ  1 
ATOM   141  O  OH  . TYR A 1 18  ? 35.786 2.408   -16.733 1.00 28.59 ? 21  TYR A OH  1 
ATOM   142  N  N   . GLY A 1 19  ? 32.276 3.678   -10.725 1.00 23.20 ? 22  GLY A N   1 
ATOM   143  C  CA  . GLY A 1 19  ? 32.785 4.993   -10.414 1.00 27.14 ? 22  GLY A CA  1 
ATOM   144  C  C   . GLY A 1 19  ? 34.155 4.873   -9.784  1.00 29.56 ? 22  GLY A C   1 
ATOM   145  O  O   . GLY A 1 19  ? 34.840 3.867   -9.957  1.00 30.57 ? 22  GLY A O   1 
ATOM   146  N  N   . GLU A 1 20  ? 34.552 5.896   -9.042  1.00 29.76 ? 23  GLU A N   1 
ATOM   147  C  CA  . GLU A 1 20  ? 35.896 5.950   -8.495  1.00 31.69 ? 23  GLU A CA  1 
ATOM   148  C  C   . GLU A 1 20  ? 35.875 6.270   -7.001  1.00 30.20 ? 23  GLU A C   1 
ATOM   149  O  O   . GLU A 1 20  ? 35.085 7.098   -6.544  1.00 31.33 ? 23  GLU A O   1 
ATOM   150  C  CB  . GLU A 1 20  ? 36.701 7.002   -9.255  1.00 34.12 ? 23  GLU A CB  1 
ATOM   151  C  CG  . GLU A 1 20  ? 38.119 7.182   -8.777  1.00 39.07 ? 23  GLU A CG  1 
ATOM   152  C  CD  . GLU A 1 20  ? 38.858 8.225   -9.589  1.00 41.65 ? 23  GLU A CD  1 
ATOM   153  O  OE1 . GLU A 1 20  ? 39.436 7.863   -10.638 1.00 42.83 ? 23  GLU A OE1 1 
ATOM   154  O  OE2 . GLU A 1 20  ? 38.852 9.407   -9.178  1.00 42.07 ? 23  GLU A OE2 1 
ATOM   155  N  N   . ILE A 1 21  ? 36.728 5.590   -6.243  1.00 28.62 ? 24  ILE A N   1 
ATOM   156  C  CA  . ILE A 1 21  ? 36.939 5.923   -4.840  1.00 25.31 ? 24  ILE A CA  1 
ATOM   157  C  C   . ILE A 1 21  ? 38.426 6.077   -4.563  1.00 25.49 ? 24  ILE A C   1 
ATOM   158  O  O   . ILE A 1 21  ? 39.268 5.628   -5.343  1.00 26.27 ? 24  ILE A O   1 
ATOM   159  C  CB  . ILE A 1 21  ? 36.385 4.835   -3.890  1.00 23.21 ? 24  ILE A CB  1 
ATOM   160  C  CG1 . ILE A 1 21  ? 37.093 3.502   -4.152  1.00 23.96 ? 24  ILE A CG1 1 
ATOM   161  C  CG2 . ILE A 1 21  ? 34.879 4.719   -4.052  1.00 22.26 ? 24  ILE A CG2 1 
ATOM   162  C  CD1 . ILE A 1 21  ? 36.962 2.513   -3.012  1.00 23.19 ? 24  ILE A CD1 1 
ATOM   163  N  N   . GLY A 1 22  ? 38.746 6.719   -3.448  1.00 25.96 ? 25  GLY A N   1 
ATOM   164  C  CA  . GLY A 1 22  ? 40.137 6.892   -3.084  1.00 28.09 ? 25  GLY A CA  1 
ATOM   165  C  C   . GLY A 1 22  ? 40.423 6.204   -1.770  1.00 28.09 ? 25  GLY A C   1 
ATOM   166  O  O   . GLY A 1 22  ? 39.682 6.380   -0.807  1.00 28.77 ? 25  GLY A O   1 
ATOM   167  N  N   . ILE A 1 23  ? 41.489 5.412   -1.726  1.00 28.97 ? 26  ILE A N   1 
ATOM   168  C  CA  . ILE A 1 23  ? 41.840 4.692   -0.506  1.00 28.11 ? 26  ILE A CA  1 
ATOM   169  C  C   . ILE A 1 23  ? 43.228 5.079   -0.024  1.00 29.62 ? 26  ILE A C   1 
ATOM   170  O  O   . ILE A 1 23  ? 44.186 5.065   -0.801  1.00 31.37 ? 26  ILE A O   1 
ATOM   171  C  CB  . ILE A 1 23  ? 41.824 3.164   -0.728  1.00 27.73 ? 26  ILE A CB  1 
ATOM   172  C  CG1 . ILE A 1 23  ? 40.480 2.737   -1.316  1.00 24.23 ? 26  ILE A CG1 1 
ATOM   173  C  CG2 . ILE A 1 23  ? 42.078 2.441   0.595   1.00 24.33 ? 26  ILE A CG2 1 
ATOM   174  C  CD1 . ILE A 1 23  ? 40.345 1.235   -1.480  1.00 32.21 ? 26  ILE A CD1 1 
ATOM   175  N  N   . GLY A 1 24  ? 43.329 5.417   1.259   1.00 29.29 ? 27  GLY A N   1 
ATOM   176  C  CA  . GLY A 1 24  ? 44.619 5.645   1.872   1.00 30.11 ? 27  GLY A CA  1 
ATOM   177  C  C   . GLY A 1 24  ? 45.022 7.103   1.982   1.00 30.84 ? 27  GLY A C   1 
ATOM   178  O  O   . GLY A 1 24  ? 44.276 8.000   1.592   1.00 31.04 ? 27  GLY A O   1 
ATOM   179  N  N   . THR A 1 25  ? 46.212 7.328   2.530   1.00 33.12 ? 28  THR A N   1 
ATOM   180  C  CA  . THR A 1 25  ? 46.830 8.650   2.547   1.00 34.02 ? 28  THR A CA  1 
ATOM   181  C  C   . THR A 1 25  ? 48.282 8.536   2.090   1.00 34.00 ? 28  THR A C   1 
ATOM   182  O  O   . THR A 1 25  ? 49.091 7.864   2.725   1.00 35.54 ? 28  THR A O   1 
ATOM   183  C  CB  . THR A 1 25  ? 46.824 9.253   3.958   1.00 34.33 ? 28  THR A CB  1 
ATOM   184  O  OG1 . THR A 1 25  ? 45.487 9.275   4.467   1.00 31.45 ? 28  THR A OG1 1 
ATOM   185  C  CG2 . THR A 1 25  ? 47.376 10.675  3.925   1.00 35.94 ? 28  THR A CG2 1 
ATOM   186  N  N   . PRO A 1 26  ? 48.626 9.184   0.968   1.00 33.84 ? 29  PRO A N   1 
ATOM   187  C  CA  . PRO A 1 26  ? 47.674 9.887   0.105   1.00 33.45 ? 29  PRO A CA  1 
ATOM   188  C  C   . PRO A 1 26  ? 46.747 8.891   -0.593  1.00 33.63 ? 29  PRO A C   1 
ATOM   189  O  O   . PRO A 1 26  ? 47.015 7.690   -0.616  1.00 31.40 ? 29  PRO A O   1 
ATOM   190  C  CB  . PRO A 1 26  ? 48.569 10.623  -0.884  1.00 32.38 ? 29  PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 26  ? 49.791 9.791   -0.956  1.00 31.87 ? 29  PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 26  ? 49.992 9.225   0.423   1.00 33.23 ? 29  PRO A CD  1 
ATOM   193  N  N   . PRO A 1 27  ? 45.646 9.383   -1.172  1.00 33.77 ? 30  PRO A N   1 
ATOM   194  C  CA  . PRO A 1 27  ? 44.640 8.503   -1.774  1.00 35.11 ? 30  PRO A CA  1 
ATOM   195  C  C   . PRO A 1 27  ? 45.113 7.708   -2.990  1.00 34.50 ? 30  PRO A C   1 
ATOM   196  O  O   . PRO A 1 27  ? 45.680 8.257   -3.934  1.00 34.91 ? 30  PRO A O   1 
ATOM   197  C  CB  . PRO A 1 27  ? 43.482 9.447   -2.112  1.00 35.57 ? 30  PRO A CB  1 
ATOM   198  C  CG  . PRO A 1 27  ? 44.093 10.803  -2.166  1.00 36.60 ? 30  PRO A CG  1 
ATOM   199  C  CD  . PRO A 1 27  ? 45.241 10.798  -1.206  1.00 33.87 ? 30  PRO A CD  1 
ATOM   200  N  N   . GLN A 1 28  ? 44.878 6.402   -2.947  1.00 32.27 ? 31  GLN A N   1 
ATOM   201  C  CA  . GLN A 1 28  ? 45.070 5.550   -4.116  1.00 31.18 ? 31  GLN A CA  1 
ATOM   202  C  C   . GLN A 1 28  ? 43.700 5.354   -4.751  1.00 28.90 ? 31  GLN A C   1 
ATOM   203  O  O   . GLN A 1 28  ? 42.750 4.968   -4.071  1.00 27.69 ? 31  GLN A O   1 
ATOM   204  C  CB  . GLN A 1 28  ? 45.656 4.204   -3.691  1.00 29.27 ? 31  GLN A CB  1 
ATOM   205  C  CG  . GLN A 1 28  ? 47.073 4.306   -3.140  1.00 33.13 ? 31  GLN A CG  1 
ATOM   206  C  CD  . GLN A 1 28  ? 47.611 2.968   -2.664  1.00 33.94 ? 31  GLN A CD  1 
ATOM   207  O  OE1 . GLN A 1 28  ? 47.534 1.966   -3.376  1.00 37.83 ? 31  GLN A OE1 1 
ATOM   208  N  NE2 . GLN A 1 28  ? 48.153 2.946   -1.452  1.00 34.05 ? 31  GLN A NE2 1 
ATOM   209  N  N   . THR A 1 29  ? 43.595 5.636   -6.045  1.00 27.30 ? 32  THR A N   1 
ATOM   210  C  CA  . THR A 1 29  ? 42.298 5.634   -6.709  1.00 26.74 ? 32  THR A CA  1 
ATOM   211  C  C   . THR A 1 29  ? 41.956 4.270   -7.281  1.00 25.96 ? 32  THR A C   1 
ATOM   212  O  O   . THR A 1 29  ? 42.804 3.594   -7.862  1.00 26.83 ? 32  THR A O   1 
ATOM   213  C  CB  . THR A 1 29  ? 42.244 6.645   -7.862  1.00 26.52 ? 32  THR A CB  1 
ATOM   214  O  OG1 . THR A 1 29  ? 43.263 6.326   -8.815  1.00 29.72 ? 32  THR A OG1 1 
ATOM   215  C  CG2 . THR A 1 29  ? 42.437 8.062   -7.349  1.00 28.31 ? 32  THR A CG2 1 
ATOM   216  N  N   . PHE A 1 30  ? 40.701 3.876   -7.127  1.00 24.71 ? 33  PHE A N   1 
ATOM   217  C  CA  . PHE A 1 30  ? 40.230 2.643   -7.737  1.00 24.35 ? 33  PHE A CA  1 
ATOM   218  C  C   . PHE A 1 30  ? 38.905 2.840   -8.459  1.00 25.02 ? 33  PHE A C   1 
ATOM   219  O  O   . PHE A 1 30  ? 38.068 3.649   -8.042  1.00 25.17 ? 33  PHE A O   1 
ATOM   220  C  CB  . PHE A 1 30  ? 40.102 1.554   -6.666  1.00 22.91 ? 33  PHE A CB  1 
ATOM   221  C  CG  . PHE A 1 30  ? 41.409 1.191   -6.032  1.00 21.62 ? 33  PHE A CG  1 
ATOM   222  C  CD1 . PHE A 1 30  ? 42.199 0.182   -6.570  1.00 24.48 ? 33  PHE A CD1 1 
ATOM   223  C  CD2 . PHE A 1 30  ? 41.879 1.896   -4.935  1.00 21.53 ? 33  PHE A CD2 1 
ATOM   224  C  CE1 . PHE A 1 30  ? 43.448 -0.113  -6.020  1.00 22.87 ? 33  PHE A CE1 1 
ATOM   225  C  CE2 . PHE A 1 30  ? 43.110 1.613   -4.385  1.00 23.19 ? 33  PHE A CE2 1 
ATOM   226  C  CZ  . PHE A 1 30  ? 43.903 0.605   -4.927  1.00 23.74 ? 33  PHE A CZ  1 
ATOM   227  N  N   . LYS A 1 31  ? 38.737 2.115   -9.561  1.00 25.32 ? 34  LYS A N   1 
ATOM   228  C  CA  . LYS A 1 31  ? 37.442 1.994   -10.220 1.00 25.96 ? 34  LYS A CA  1 
ATOM   229  C  C   . LYS A 1 31  ? 36.689 0.837   -9.565  1.00 26.54 ? 34  LYS A C   1 
ATOM   230  O  O   . LYS A 1 31  ? 37.191 -0.288  -9.526  1.00 27.13 ? 34  LYS A O   1 
ATOM   231  C  CB  . LYS A 1 31  ? 37.629 1.684   -11.708 1.00 27.95 ? 34  LYS A CB  1 
ATOM   232  C  CG  . LYS A 1 31  ? 38.263 2.794   -12.530 1.00 31.70 ? 34  LYS A CG  1 
ATOM   233  C  CD  . LYS A 1 31  ? 38.779 2.231   -13.845 1.00 36.15 ? 34  LYS A CD  1 
ATOM   234  C  CE  . LYS A 1 31  ? 39.399 3.312   -14.714 1.00 40.77 ? 34  LYS A CE  1 
ATOM   235  N  NZ  . LYS A 1 31  ? 40.128 2.732   -15.879 1.00 41.82 ? 34  LYS A NZ  1 
ATOM   236  N  N   . VAL A 1 32  ? 35.488 1.112   -9.064  1.00 26.49 ? 35  VAL A N   1 
ATOM   237  C  CA  . VAL A 1 32  ? 34.706 0.104   -8.361  1.00 25.27 ? 35  VAL A CA  1 
ATOM   238  C  C   . VAL A 1 32  ? 33.246 0.120   -8.781  1.00 25.58 ? 35  VAL A C   1 
ATOM   239  O  O   . VAL A 1 32  ? 32.712 1.154   -9.190  1.00 23.77 ? 35  VAL A O   1 
ATOM   240  C  CB  . VAL A 1 32  ? 34.759 0.312   -6.834  1.00 24.73 ? 35  VAL A CB  1 
ATOM   241  C  CG1 . VAL A 1 32  ? 36.194 0.186   -6.334  1.00 24.30 ? 35  VAL A CG1 1 
ATOM   242  C  CG2 . VAL A 1 32  ? 34.187 1.668   -6.487  1.00 24.44 ? 35  VAL A CG2 1 
ATOM   243  N  N   . VAL A 1 33  ? 32.612 -1.046  -8.678  1.00 25.81 ? 36  VAL A N   1 
ATOM   244  C  CA  . VAL A 1 33  ? 31.172 -1.174  -8.836  1.00 22.68 ? 36  VAL A CA  1 
ATOM   245  C  C   . VAL A 1 33  ? 30.484 -0.904  -7.497  1.00 23.62 ? 36  VAL A C   1 
ATOM   246  O  O   . VAL A 1 33  ? 30.888 -1.433  -6.462  1.00 23.50 ? 36  VAL A O   1 
ATOM   247  C  CB  . VAL A 1 33  ? 30.791 -2.595  -9.292  1.00 24.84 ? 36  VAL A CB  1 
ATOM   248  C  CG1 . VAL A 1 33  ? 29.293 -2.692  -9.478  1.00 20.20 ? 36  VAL A CG1 1 
ATOM   249  C  CG2 . VAL A 1 33  ? 31.510 -2.941  -10.581 1.00 23.72 ? 36  VAL A CG2 1 
ATOM   250  N  N   . PHE A 1 34  ? 29.449 -0.073  -7.526  1.00 20.77 ? 37  PHE A N   1 
ATOM   251  C  CA  . PHE A 1 34  ? 28.625 0.162   -6.351  1.00 23.36 ? 37  PHE A CA  1 
ATOM   252  C  C   . PHE A 1 34  ? 27.399 -0.748  -6.406  1.00 23.18 ? 37  PHE A C   1 
ATOM   253  O  O   . PHE A 1 34  ? 26.479 -0.543  -7.204  1.00 21.58 ? 37  PHE A O   1 
ATOM   254  C  CB  . PHE A 1 34  ? 28.204 1.633   -6.302  1.00 24.01 ? 37  PHE A CB  1 
ATOM   255  C  CG  . PHE A 1 34  ? 29.359 2.586   -6.133  1.00 25.25 ? 37  PHE A CG  1 
ATOM   256  C  CD1 . PHE A 1 34  ? 30.023 3.100   -7.239  1.00 26.11 ? 37  PHE A CD1 1 
ATOM   257  C  CD2 . PHE A 1 34  ? 29.769 2.979   -4.869  1.00 24.96 ? 37  PHE A CD2 1 
ATOM   258  C  CE1 . PHE A 1 34  ? 31.065 3.986   -7.089  1.00 26.19 ? 37  PHE A CE1 1 
ATOM   259  C  CE2 . PHE A 1 34  ? 30.814 3.863   -4.710  1.00 25.62 ? 37  PHE A CE2 1 
ATOM   260  C  CZ  . PHE A 1 34  ? 31.463 4.370   -5.822  1.00 28.24 ? 37  PHE A CZ  1 
ATOM   261  N  N   . ASP A 1 35  ? 27.402 -1.755  -5.543  1.00 20.95 ? 38  ASP A N   1 
ATOM   262  C  CA  . ASP A 1 35  ? 26.587 -2.937  -5.741  1.00 20.53 ? 38  ASP A CA  1 
ATOM   263  C  C   . ASP A 1 35  ? 25.603 -3.118  -4.589  1.00 19.18 ? 38  ASP A C   1 
ATOM   264  O  O   . ASP A 1 35  ? 26.002 -3.478  -3.480  1.00 21.51 ? 38  ASP A O   1 
ATOM   265  C  CB  . ASP A 1 35  ? 27.506 -4.164  -5.852  1.00 21.50 ? 38  ASP A CB  1 
ATOM   266  C  CG  . ASP A 1 35  ? 26.733 -5.472  -5.960  1.00 23.97 ? 38  ASP A CG  1 
ATOM   267  O  OD1 . ASP A 1 35  ? 25.642 -5.481  -6.569  1.00 25.23 ? 38  ASP A OD1 1 
ATOM   268  O  OD2 . ASP A 1 35  ? 27.220 -6.496  -5.438  1.00 22.68 ? 38  ASP A OD2 1 
ATOM   269  N  N   . THR A 1 36  ? 24.324 -2.867  -4.846  1.00 18.04 ? 39  THR A N   1 
ATOM   270  C  CA  . THR A 1 36  ? 23.318 -3.010  -3.799  1.00 20.15 ? 39  THR A CA  1 
ATOM   271  C  C   . THR A 1 36  ? 23.023 -4.480  -3.489  1.00 20.61 ? 39  THR A C   1 
ATOM   272  O  O   . THR A 1 36  ? 22.385 -4.800  -2.486  1.00 20.00 ? 39  THR A O   1 
ATOM   273  C  CB  . THR A 1 36  ? 21.997 -2.282  -4.165  1.00 21.15 ? 39  THR A CB  1 
ATOM   274  O  OG1 . THR A 1 36  ? 21.581 -2.653  -5.485  1.00 21.37 ? 39  THR A OG1 1 
ATOM   275  C  CG2 . THR A 1 36  ? 22.189 -0.762  -4.098  1.00 21.30 ? 39  THR A CG2 1 
ATOM   276  N  N   . GLY A 1 37  ? 23.504 -5.375  -4.344  1.00 22.00 ? 40  GLY A N   1 
ATOM   277  C  CA  . GLY A 1 37  ? 23.295 -6.793  -4.104  1.00 20.47 ? 40  GLY A CA  1 
ATOM   278  C  C   . GLY A 1 37  ? 24.331 -7.422  -3.190  1.00 20.37 ? 40  GLY A C   1 
ATOM   279  O  O   . GLY A 1 37  ? 24.236 -8.606  -2.858  1.00 22.08 ? 40  GLY A O   1 
ATOM   280  N  N   . SER A 1 38  ? 25.331 -6.648  -2.783  1.00 19.91 ? 41  SER A N   1 
ATOM   281  C  CA  . SER A 1 38  ? 26.318 -7.156  -1.844  1.00 18.19 ? 41  SER A CA  1 
ATOM   282  C  C   . SER A 1 38  ? 26.750 -6.056  -0.893  1.00 20.26 ? 41  SER A C   1 
ATOM   283  O  O   . SER A 1 38  ? 26.348 -4.899  -1.048  1.00 17.52 ? 41  SER A O   1 
ATOM   284  C  CB  . SER A 1 38  ? 27.526 -7.734  -2.588  1.00 18.23 ? 41  SER A CB  1 
ATOM   285  O  OG  . SER A 1 38  ? 28.244 -6.727  -3.273  1.00 20.29 ? 41  SER A OG  1 
ATOM   286  N  N   . SER A 1 39  ? 27.560 -6.416  0.097   1.00 20.52 ? 42  SER A N   1 
ATOM   287  C  CA  . SER A 1 39  ? 27.754 -5.545  1.250   1.00 22.52 ? 42  SER A CA  1 
ATOM   288  C  C   . SER A 1 39  ? 29.207 -5.380  1.674   1.00 22.50 ? 42  SER A C   1 
ATOM   289  O  O   . SER A 1 39  ? 29.494 -4.678  2.640   1.00 21.21 ? 42  SER A O   1 
ATOM   290  C  CB  . SER A 1 39  ? 26.938 -6.064  2.435   1.00 23.65 ? 42  SER A CB  1 
ATOM   291  O  OG  . SER A 1 39  ? 25.553 -5.976  2.162   1.00 24.80 ? 42  SER A OG  1 
ATOM   292  N  N   . ASN A 1 40  ? 30.128 -6.028  0.967   1.00 21.80 ? 43  ASN A N   1 
ATOM   293  C  CA  . ASN A 1 40  ? 31.539 -5.856  1.283   1.00 20.68 ? 43  ASN A CA  1 
ATOM   294  C  C   . ASN A 1 40  ? 32.239 -4.893  0.331   1.00 20.02 ? 43  ASN A C   1 
ATOM   295  O  O   . ASN A 1 40  ? 31.883 -4.797  -0.847  1.00 21.65 ? 43  ASN A O   1 
ATOM   296  C  CB  . ASN A 1 40  ? 32.249 -7.213  1.285   1.00 21.71 ? 43  ASN A CB  1 
ATOM   297  C  CG  . ASN A 1 40  ? 31.840 -8.077  2.466   1.00 20.03 ? 43  ASN A CG  1 
ATOM   298  O  OD1 . ASN A 1 40  ? 30.769 -8.683  2.466   1.00 23.70 ? 43  ASN A OD1 1 
ATOM   299  N  ND2 . ASN A 1 40  ? 32.687 -8.128  3.483   1.00 19.61 ? 43  ASN A ND2 1 
ATOM   300  N  N   . VAL A 1 41  ? 33.223 -4.171  0.864   1.00 19.22 ? 44  VAL A N   1 
ATOM   301  C  CA  . VAL A 1 41  ? 34.165 -3.398  0.051   1.00 18.02 ? 44  VAL A CA  1 
ATOM   302  C  C   . VAL A 1 41  ? 35.466 -4.165  -0.149  1.00 18.04 ? 44  VAL A C   1 
ATOM   303  O  O   . VAL A 1 41  ? 36.016 -4.731  0.792   1.00 17.94 ? 44  VAL A O   1 
ATOM   304  C  CB  . VAL A 1 41  ? 34.505 -2.052  0.711   1.00 17.46 ? 44  VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 41  ? 35.577 -1.324  -0.094  1.00 18.08 ? 44  VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 41  ? 33.256 -1.205  0.821   1.00 12.69 ? 44  VAL A CG2 1 
ATOM   307  N  N   . TRP A 1 42  ? 35.954 -4.190  -1.383  1.00 19.62 ? 45  TRP A N   1 
ATOM   308  C  CA  . TRP A 1 42  ? 37.249 -4.805  -1.655  1.00 21.63 ? 45  TRP A CA  1 
ATOM   309  C  C   . TRP A 1 42  ? 37.909 -4.240  -2.905  1.00 21.14 ? 45  TRP A C   1 
ATOM   310  O  O   . TRP A 1 42  ? 37.232 -3.785  -3.829  1.00 22.27 ? 45  TRP A O   1 
ATOM   311  C  CB  . TRP A 1 42  ? 37.107 -6.332  -1.773  1.00 19.40 ? 45  TRP A CB  1 
ATOM   312  C  CG  . TRP A 1 42  ? 36.320 -6.817  -2.962  1.00 20.77 ? 45  TRP A CG  1 
ATOM   313  C  CD1 . TRP A 1 42  ? 34.993 -7.135  -2.993  1.00 20.49 ? 45  TRP A CD1 1 
ATOM   314  C  CD2 . TRP A 1 42  ? 36.830 -7.100  -4.274  1.00 20.86 ? 45  TRP A CD2 1 
ATOM   315  N  NE1 . TRP A 1 42  ? 34.647 -7.604  -4.238  1.00 18.92 ? 45  TRP A NE1 1 
ATOM   316  C  CE2 . TRP A 1 42  ? 35.754 -7.594  -5.044  1.00 21.31 ? 45  TRP A CE2 1 
ATOM   317  C  CE3 . TRP A 1 42  ? 38.091 -6.985  -4.872  1.00 21.26 ? 45  TRP A CE3 1 
ATOM   318  C  CZ2 . TRP A 1 42  ? 35.899 -7.975  -6.383  1.00 19.21 ? 45  TRP A CZ2 1 
ATOM   319  C  CZ3 . TRP A 1 42  ? 38.238 -7.364  -6.204  1.00 21.98 ? 45  TRP A CZ3 1 
ATOM   320  C  CH2 . TRP A 1 42  ? 37.145 -7.854  -6.943  1.00 20.38 ? 45  TRP A CH2 1 
ATOM   321  N  N   . VAL A 1 43  ? 39.240 -4.257  -2.912  1.00 22.91 ? 46  VAL A N   1 
ATOM   322  C  CA  . VAL A 1 43  ? 40.015 -3.976  -4.114  1.00 21.67 ? 46  VAL A CA  1 
ATOM   323  C  C   . VAL A 1 43  ? 41.219 -4.912  -4.199  1.00 20.90 ? 46  VAL A C   1 
ATOM   324  O  O   . VAL A 1 43  ? 41.638 -5.490  -3.201  1.00 23.26 ? 46  VAL A O   1 
ATOM   325  C  CB  . VAL A 1 43  ? 40.526 -2.524  -4.123  1.00 20.07 ? 46  VAL A CB  1 
ATOM   326  C  CG1 . VAL A 1 43  ? 39.360 -1.563  -4.219  1.00 21.66 ? 46  VAL A CG1 1 
ATOM   327  C  CG2 . VAL A 1 43  ? 41.349 -2.258  -2.868  1.00 20.74 ? 46  VAL A CG2 1 
ATOM   328  N  N   . PRO A 1 44  ? 41.797 -5.067  -5.396  1.00 21.25 ? 47  PRO A N   1 
ATOM   329  C  CA  . PRO A 1 44  ? 42.974 -5.939  -5.525  1.00 23.73 ? 47  PRO A CA  1 
ATOM   330  C  C   . PRO A 1 44  ? 44.155 -5.420  -4.705  1.00 25.68 ? 47  PRO A C   1 
ATOM   331  O  O   . PRO A 1 44  ? 44.379 -4.211  -4.624  1.00 24.70 ? 47  PRO A O   1 
ATOM   332  C  CB  . PRO A 1 44  ? 43.278 -5.933  -7.029  1.00 21.87 ? 47  PRO A CB  1 
ATOM   333  C  CG  . PRO A 1 44  ? 42.004 -5.467  -7.682  1.00 20.14 ? 47  PRO A CG  1 
ATOM   334  C  CD  . PRO A 1 44  ? 41.369 -4.516  -6.694  1.00 20.70 ? 47  PRO A CD  1 
ATOM   335  N  N   . SER A 1 45  ? 44.901 -6.344  -4.100  1.00 25.48 ? 48  SER A N   1 
ATOM   336  C  CA  . SER A 1 45  ? 46.016 -6.008  -3.217  1.00 24.93 ? 48  SER A CA  1 
ATOM   337  C  C   . SER A 1 45  ? 47.359 -6.057  -3.954  1.00 25.31 ? 48  SER A C   1 
ATOM   338  O  O   . SER A 1 45  ? 47.522 -6.824  -4.903  1.00 22.93 ? 48  SER A O   1 
ATOM   339  C  CB  . SER A 1 45  ? 46.048 -6.984  -2.040  1.00 26.20 ? 48  SER A CB  1 
ATOM   340  O  OG  . SER A 1 45  ? 47.126 -6.697  -1.172  1.00 26.28 ? 48  SER A OG  1 
ATOM   341  N  N   . SER A 1 46  ? 48.318 -5.241  -3.517  1.00 23.71 ? 49  SER A N   1 
ATOM   342  C  CA  . SER A 1 46  ? 49.688 -5.340  -4.027  1.00 25.18 ? 49  SER A CA  1 
ATOM   343  C  C   . SER A 1 46  ? 50.307 -6.698  -3.680  1.00 24.81 ? 49  SER A C   1 
ATOM   344  O  O   . SER A 1 46  ? 51.317 -7.102  -4.260  1.00 27.50 ? 49  SER A O   1 
ATOM   345  C  CB  . SER A 1 46  ? 50.560 -4.218  -3.449  1.00 23.77 ? 49  SER A CB  1 
ATOM   346  O  OG  . SER A 1 46  ? 50.684 -4.334  -2.039  1.00 27.85 ? 49  SER A OG  1 
ATOM   347  N  N   . LYS A 1 47  ? 49.704 -7.402  -2.733  1.00 24.50 ? 50  LYS A N   1 
ATOM   348  C  CA  . LYS A 1 47  ? 50.203 -8.715  -2.352  1.00 26.83 ? 50  LYS A CA  1 
ATOM   349  C  C   . LYS A 1 47  ? 49.575 -9.834  -3.194  1.00 29.26 ? 50  LYS A C   1 
ATOM   350  O  O   . LYS A 1 47  ? 49.880 -11.018 -3.007  1.00 25.55 ? 50  LYS A O   1 
ATOM   351  C  CB  . LYS A 1 47  ? 49.954 -8.955  -0.858  1.00 29.40 ? 50  LYS A CB  1 
ATOM   352  C  CG  . LYS A 1 47  ? 50.898 -8.167  0.053   1.00 28.54 ? 50  LYS A CG  1 
ATOM   353  C  CD  . LYS A 1 47  ? 50.139 -7.304  1.033   1.00 31.92 ? 50  LYS A CD  1 
ATOM   354  C  CE  . LYS A 1 47  ? 51.086 -6.541  1.958   1.00 36.08 ? 50  LYS A CE  1 
ATOM   355  N  NZ  . LYS A 1 47  ? 52.031 -7.455  2.683   1.00 34.30 ? 50  LYS A NZ  1 
ATOM   356  N  N   . CYS A 1 48  ? 48.696 -9.459  -4.121  1.00 28.33 ? 51  CYS A N   1 
ATOM   357  C  CA  . CYS A 1 48  ? 48.161 -10.432 -5.055  1.00 29.36 ? 51  CYS A CA  1 
ATOM   358  C  C   . CYS A 1 48  ? 49.227 -10.821 -6.071  1.00 30.00 ? 51  CYS A C   1 
ATOM   359  O  O   . CYS A 1 48  ? 49.827 -9.964  -6.718  1.00 29.62 ? 51  CYS A O   1 
ATOM   360  C  CB  . CYS A 1 48  ? 46.954 -9.879  -5.800  1.00 29.04 ? 51  CYS A CB  1 
ATOM   361  S  SG  . CYS A 1 48  ? 46.166 -11.165 -6.798  1.00 30.01 ? 51  CYS A SG  1 
ATOM   362  N  N   . SER A 1 49  ? 49.452 -12.121 -6.212  1.00 29.29 ? 52  SER A N   1 
ATOM   363  C  CA  . SER A 1 49  ? 50.473 -12.605 -7.124  1.00 29.99 ? 52  SER A CA  1 
ATOM   364  C  C   . SER A 1 49  ? 50.129 -12.301 -8.577  1.00 29.20 ? 52  SER A C   1 
ATOM   365  O  O   . SER A 1 49  ? 48.983 -12.449 -9.003  1.00 27.20 ? 52  SER A O   1 
ATOM   366  C  CB  . SER A 1 49  ? 50.656 -14.107 -6.952  1.00 31.32 ? 52  SER A CB  1 
ATOM   367  O  OG  . SER A 1 49  ? 51.498 -14.611 -7.970  1.00 35.28 ? 52  SER A OG  1 
ATOM   368  N  N   . ARG A 1 50  ? 51.135 -11.880 -9.336  1.00 28.95 ? 53  ARG A N   1 
ATOM   369  C  CA  . ARG A 1 50  ? 50.988 -11.684 -10.773 1.00 28.22 ? 53  ARG A CA  1 
ATOM   370  C  C   . ARG A 1 50  ? 50.672 -13.006 -11.464 1.00 27.83 ? 53  ARG A C   1 
ATOM   371  O  O   . ARG A 1 50  ? 50.410 -13.046 -12.661 1.00 27.95 ? 53  ARG A O   1 
ATOM   372  C  CB  . ARG A 1 50  ? 52.268 -11.067 -11.352 1.00 28.84 ? 53  ARG A CB  1 
ATOM   373  C  CG  . ARG A 1 50  ? 52.542 -9.664  -10.820 1.00 29.94 ? 53  ARG A CG  1 
ATOM   374  C  CD  . ARG A 1 50  ? 53.854 -9.085  -11.321 1.00 31.55 ? 53  ARG A CD  1 
ATOM   375  N  NE  . ARG A 1 50  ? 53.791 -8.677  -12.725 1.00 31.53 ? 53  ARG A NE  1 
ATOM   376  C  CZ  . ARG A 1 50  ? 53.124 -7.620  -13.173 1.00 32.60 ? 53  ARG A CZ  1 
ATOM   377  N  NH1 . ARG A 1 50  ? 52.446 -6.850  -12.334 1.00 33.49 ? 53  ARG A NH1 1 
ATOM   378  N  NH2 . ARG A 1 50  ? 53.145 -7.323  -14.462 1.00 33.83 ? 53  ARG A NH2 1 
ATOM   379  N  N   . LEU A 1 51  ? 50.694 -14.088 -10.697 1.00 28.64 ? 54  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 51  ? 50.214 -15.380 -11.171 1.00 29.79 ? 54  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 51  ? 48.728 -15.252 -11.523 1.00 31.17 ? 54  LEU A C   1 
ATOM   382  O  O   . LEU A 1 51  ? 48.206 -15.969 -12.385 1.00 29.65 ? 54  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 51  ? 50.397 -16.421 -10.071 1.00 35.27 ? 54  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 51  ? 50.544 -17.893 -10.452 1.00 40.49 ? 54  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 51  ? 51.676 -18.057 -11.458 1.00 41.10 ? 54  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 51  ? 50.824 -18.706 -9.196  1.00 39.85 ? 54  LEU A CD2 1 
ATOM   387  N  N   . TYR A 1 52  ? 48.047 -14.338 -10.839 1.00 27.27 ? 55  TYR A N   1 
ATOM   388  C  CA  . TYR A 1 52  ? 46.703 -13.958 -11.235 1.00 27.85 ? 55  TYR A CA  1 
ATOM   389  C  C   . TYR A 1 52  ? 46.768 -12.820 -12.241 1.00 29.03 ? 55  TYR A C   1 
ATOM   390  O  O   . TYR A 1 52  ? 47.165 -11.700 -11.913 1.00 29.96 ? 55  TYR A O   1 
ATOM   391  C  CB  . TYR A 1 52  ? 45.888 -13.535 -10.011 1.00 27.49 ? 55  TYR A CB  1 
ATOM   392  C  CG  . TYR A 1 52  ? 45.659 -14.671 -9.040  1.00 28.97 ? 55  TYR A CG  1 
ATOM   393  C  CD1 . TYR A 1 52  ? 44.678 -15.624 -9.280  1.00 28.93 ? 55  TYR A CD1 1 
ATOM   394  C  CD2 . TYR A 1 52  ? 46.434 -14.802 -7.894  1.00 28.26 ? 55  TYR A CD2 1 
ATOM   395  C  CE1 . TYR A 1 52  ? 44.475 -16.673 -8.411  1.00 30.39 ? 55  TYR A CE1 1 
ATOM   396  C  CE2 . TYR A 1 52  ? 46.239 -15.855 -7.018  1.00 31.31 ? 55  TYR A CE2 1 
ATOM   397  C  CZ  . TYR A 1 52  ? 45.258 -16.788 -7.284  1.00 31.73 ? 55  TYR A CZ  1 
ATOM   398  O  OH  . TYR A 1 52  ? 45.071 -17.856 -6.435  1.00 35.90 ? 55  TYR A OH  1 
ATOM   399  N  N   . THR A 1 53  ? 46.366 -13.117 -13.469 1.00 27.94 ? 56  THR A N   1 
ATOM   400  C  CA  . THR A 1 53  ? 46.413 -12.145 -14.548 1.00 28.05 ? 56  THR A CA  1 
ATOM   401  C  C   . THR A 1 53  ? 45.526 -10.944 -14.242 1.00 26.65 ? 56  THR A C   1 
ATOM   402  O  O   . THR A 1 53  ? 45.839 -9.819  -14.637 1.00 26.91 ? 56  THR A O   1 
ATOM   403  C  CB  . THR A 1 53  ? 45.973 -12.791 -15.883 1.00 29.58 ? 56  THR A CB  1 
ATOM   404  O  OG1 . THR A 1 53  ? 46.830 -13.901 -16.179 1.00 32.09 ? 56  THR A OG1 1 
ATOM   405  C  CG2 . THR A 1 53  ? 46.070 -11.795 -17.016 1.00 31.93 ? 56  THR A CG2 1 
ATOM   406  N  N   . ALA A 1 54  ? 44.424 -11.170 -13.532 1.00 23.99 ? 57  ALA A N   1 
ATOM   407  C  CA  . ALA A 1 54  ? 43.547 -10.057 -13.179 1.00 25.79 ? 57  ALA A CA  1 
ATOM   408  C  C   . ALA A 1 54  ? 44.297 -9.047  -12.313 1.00 23.58 ? 57  ALA A C   1 
ATOM   409  O  O   . ALA A 1 54  ? 43.988 -7.865  -12.324 1.00 25.40 ? 57  ALA A O   1 
ATOM   410  C  CB  . ALA A 1 54  ? 42.293 -10.564 -12.439 1.00 23.59 ? 57  ALA A CB  1 
ATOM   411  N  N   . CYS A 1 55  ? 45.287 -9.515  -11.567 1.00 25.23 ? 58  CYS A N   1 
ATOM   412  C  CA  . CYS A 1 55  ? 46.082 -8.616  -10.740 1.00 27.86 ? 58  CYS A CA  1 
ATOM   413  C  C   . CYS A 1 55  ? 47.274 -8.013  -11.456 1.00 29.77 ? 58  CYS A C   1 
ATOM   414  O  O   . CYS A 1 55  ? 47.974 -7.172  -10.896 1.00 34.36 ? 58  CYS A O   1 
ATOM   415  C  CB  . CYS A 1 55  ? 46.555 -9.340  -9.492  1.00 28.30 ? 58  CYS A CB  1 
ATOM   416  S  SG  . CYS A 1 55  ? 45.171 -9.719  -8.439  1.00 29.30 ? 58  CYS A SG  1 
ATOM   417  N  N   . VAL A 1 56  ? 47.516 -8.450  -12.687 1.00 30.54 ? 59  VAL A N   1 
ATOM   418  C  CA  . VAL A 1 56  ? 48.436 -7.738  -13.569 1.00 30.67 ? 59  VAL A CA  1 
ATOM   419  C  C   . VAL A 1 56  ? 47.735 -6.559  -14.251 1.00 29.39 ? 59  VAL A C   1 
ATOM   420  O  O   . VAL A 1 56  ? 48.323 -5.500  -14.446 1.00 26.76 ? 59  VAL A O   1 
ATOM   421  C  CB  . VAL A 1 56  ? 49.007 -8.677  -14.657 1.00 30.58 ? 59  VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1 56  ? 49.891 -7.885  -15.619 1.00 29.17 ? 59  VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1 56  ? 49.803 -9.812  -13.999 1.00 30.15 ? 59  VAL A CG2 1 
ATOM   424  N  N   . TYR A 1 57  ? 46.473 -6.747  -14.611 1.00 32.39 ? 60  TYR A N   1 
ATOM   425  C  CA  . TYR A 1 57  ? 45.772 -5.758  -15.422 1.00 35.37 ? 60  TYR A CA  1 
ATOM   426  C  C   . TYR A 1 57  ? 44.818 -4.842  -14.648 1.00 32.80 ? 60  TYR A C   1 
ATOM   427  O  O   . TYR A 1 57  ? 44.089 -4.065  -15.249 1.00 35.96 ? 60  TYR A O   1 
ATOM   428  C  CB  . TYR A 1 57  ? 45.016 -6.460  -16.557 1.00 39.17 ? 60  TYR A CB  1 
ATOM   429  C  CG  . TYR A 1 57  ? 45.919 -6.993  -17.658 1.00 44.69 ? 60  TYR A CG  1 
ATOM   430  C  CD1 . TYR A 1 57  ? 46.419 -8.292  -17.612 1.00 46.72 ? 60  TYR A CD1 1 
ATOM   431  C  CD2 . TYR A 1 57  ? 46.255 -6.200  -18.754 1.00 46.64 ? 60  TYR A CD2 1 
ATOM   432  C  CE1 . TYR A 1 57  ? 47.223 -8.787  -18.629 1.00 47.63 ? 60  TYR A CE1 1 
ATOM   433  C  CE2 . TYR A 1 57  ? 47.055 -6.686  -19.776 1.00 47.70 ? 60  TYR A CE2 1 
ATOM   434  C  CZ  . TYR A 1 57  ? 47.535 -7.980  -19.708 1.00 48.78 ? 60  TYR A CZ  1 
ATOM   435  O  OH  . TYR A 1 57  ? 48.319 -8.471  -20.729 1.00 49.79 ? 60  TYR A OH  1 
ATOM   436  N  N   . HIS A 1 58  ? 44.820 -4.928  -13.320 1.00 32.78 ? 61  HIS A N   1 
ATOM   437  C  CA  . HIS A 1 58  ? 44.048 -3.990  -12.498 1.00 30.71 ? 61  HIS A CA  1 
ATOM   438  C  C   . HIS A 1 58  ? 44.894 -3.280  -11.438 1.00 31.25 ? 61  HIS A C   1 
ATOM   439  O  O   . HIS A 1 58  ? 45.961 -3.755  -11.063 1.00 30.54 ? 61  HIS A O   1 
ATOM   440  C  CB  . HIS A 1 58  ? 42.883 -4.713  -11.806 1.00 28.52 ? 61  HIS A CB  1 
ATOM   441  C  CG  . HIS A 1 58  ? 41.794 -5.134  -12.740 1.00 26.39 ? 61  HIS A CG  1 
ATOM   442  N  ND1 . HIS A 1 58  ? 41.515 -6.455  -13.007 1.00 25.76 ? 61  HIS A ND1 1 
ATOM   443  C  CD2 . HIS A 1 58  ? 40.931 -4.409  -13.490 1.00 25.24 ? 61  HIS A CD2 1 
ATOM   444  C  CE1 . HIS A 1 58  ? 40.527 -6.526  -13.883 1.00 25.55 ? 61  HIS A CE1 1 
ATOM   445  N  NE2 . HIS A 1 58  ? 40.156 -5.298  -14.192 1.00 26.38 ? 61  HIS A NE2 1 
ATOM   446  N  N   . LYS A 1 59  ? 44.400 -2.144  -10.952 1.00 30.74 ? 62  LYS A N   1 
ATOM   447  C  CA  . LYS A 1 59  ? 45.084 -1.398  -9.904  1.00 31.34 ? 62  LYS A CA  1 
ATOM   448  C  C   . LYS A 1 59  ? 45.153 -2.177  -8.593  1.00 32.07 ? 62  LYS A C   1 
ATOM   449  O  O   . LYS A 1 59  ? 44.172 -2.793  -8.165  1.00 29.30 ? 62  LYS A O   1 
ATOM   450  C  CB  . LYS A 1 59  ? 44.378 -0.067  -9.664  1.00 34.78 ? 62  LYS A CB  1 
ATOM   451  C  CG  . LYS A 1 59  ? 44.753 1.018   -10.662 1.00 38.27 ? 62  LYS A CG  1 
ATOM   452  C  CD  . LYS A 1 59  ? 45.631 2.068   -10.004 1.00 36.59 ? 62  LYS A CD  1 
ATOM   453  C  CE  . LYS A 1 59  ? 44.911 3.406   -9.925  1.00 38.51 ? 62  LYS A CE  1 
ATOM   454  N  NZ  . LYS A 1 59  ? 45.406 4.216   -8.777  1.00 36.27 ? 62  LYS A NZ  1 
ATOM   455  N  N   . LEU A 1 60  ? 46.322 -2.140  -7.959  1.00 29.56 ? 63  LEU A N   1 
ATOM   456  C  CA  . LEU A 1 60  ? 46.532 -2.830  -6.693  1.00 29.13 ? 63  LEU A CA  1 
ATOM   457  C  C   . LEU A 1 60  ? 46.676 -1.808  -5.575  1.00 28.09 ? 63  LEU A C   1 
ATOM   458  O  O   . LEU A 1 60  ? 47.219 -0.723  -5.787  1.00 31.44 ? 63  LEU A O   1 
ATOM   459  C  CB  . LEU A 1 60  ? 47.790 -3.697  -6.776  1.00 29.00 ? 63  LEU A CB  1 
ATOM   460  C  CG  . LEU A 1 60  ? 47.864 -4.595  -8.017  1.00 30.53 ? 63  LEU A CG  1 
ATOM   461  C  CD1 . LEU A 1 60  ? 49.127 -5.470  -7.961  1.00 28.32 ? 63  LEU A CD1 1 
ATOM   462  C  CD2 . LEU A 1 60  ? 46.604 -5.463  -8.091  1.00 25.38 ? 63  LEU A CD2 1 
ATOM   463  N  N   . PHE A 1 61  ? 46.178 -2.144  -4.390  1.00 25.82 ? 64  PHE A N   1 
ATOM   464  C  CA  . PHE A 1 61  ? 46.346 -1.279  -3.230  1.00 25.27 ? 64  PHE A CA  1 
ATOM   465  C  C   . PHE A 1 61  ? 47.631 -1.628  -2.481  1.00 26.03 ? 64  PHE A C   1 
ATOM   466  O  O   . PHE A 1 61  ? 47.867 -2.792  -2.146  1.00 21.64 ? 64  PHE A O   1 
ATOM   467  C  CB  . PHE A 1 61  ? 45.148 -1.406  -2.282  1.00 24.51 ? 64  PHE A CB  1 
ATOM   468  C  CG  . PHE A 1 61  ? 45.313 -0.635  -0.995  1.00 26.71 ? 64  PHE A CG  1 
ATOM   469  C  CD1 . PHE A 1 61  ? 45.187 0.746   -0.975  1.00 23.35 ? 64  PHE A CD1 1 
ATOM   470  C  CD2 . PHE A 1 61  ? 45.603 -1.293  0.194   1.00 25.94 ? 64  PHE A CD2 1 
ATOM   471  C  CE1 . PHE A 1 61  ? 45.347 1.458   0.204   1.00 26.77 ? 64  PHE A CE1 1 
ATOM   472  C  CE2 . PHE A 1 61  ? 45.765 -0.583  1.380   1.00 25.67 ? 64  PHE A CE2 1 
ATOM   473  C  CZ  . PHE A 1 61  ? 45.637 0.790   1.384   1.00 24.28 ? 64  PHE A CZ  1 
ATOM   474  N  N   . ASP A 1 62  ? 48.460 -0.616  -2.233  1.00 26.35 ? 65  ASP A N   1 
ATOM   475  C  CA  . ASP A 1 62  ? 49.738 -0.817  -1.555  1.00 28.20 ? 65  ASP A CA  1 
ATOM   476  C  C   . ASP A 1 62  ? 49.646 -0.229  -0.155  1.00 27.50 ? 65  ASP A C   1 
ATOM   477  O  O   . ASP A 1 62  ? 49.779 0.981   0.028   1.00 29.28 ? 65  ASP A O   1 
ATOM   478  C  CB  . ASP A 1 62  ? 50.865 -0.127  -2.336  1.00 29.11 ? 65  ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 62  ? 52.253 -0.577  -1.894  1.00 30.60 ? 65  ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 62  ? 52.408 -1.023  -0.738  1.00 27.57 ? 65  ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 62  ? 53.195 -0.483  -2.714  1.00 33.10 ? 65  ASP A OD2 1 
ATOM   482  N  N   . ALA A 1 63  ? 49.414 -1.084  0.832   1.00 26.73 ? 66  ALA A N   1 
ATOM   483  C  CA  . ALA A 1 63  ? 49.175 -0.612  2.189   1.00 28.16 ? 66  ALA A CA  1 
ATOM   484  C  C   . ALA A 1 63  ? 50.367 0.211   2.688   1.00 30.30 ? 66  ALA A C   1 
ATOM   485  O  O   . ALA A 1 63  ? 50.200 1.173   3.436   1.00 28.64 ? 66  ALA A O   1 
ATOM   486  C  CB  . ALA A 1 63  ? 48.922 -1.798  3.120   1.00 28.47 ? 66  ALA A CB  1 
ATOM   487  N  N   . SER A 1 64  ? 51.568 -0.159  2.256   1.00 30.76 ? 67  SER A N   1 
ATOM   488  C  CA  . SER A 1 64  ? 52.767 0.472   2.787   1.00 32.92 ? 67  SER A CA  1 
ATOM   489  C  C   . SER A 1 64  ? 52.991 1.860   2.194   1.00 33.33 ? 67  SER A C   1 
ATOM   490  O  O   . SER A 1 64  ? 53.970 2.519   2.518   1.00 34.08 ? 67  SER A O   1 
ATOM   491  C  CB  . SER A 1 64  ? 53.996 -0.413  2.540   1.00 31.29 ? 67  SER A CB  1 
ATOM   492  O  OG  . SER A 1 64  ? 54.412 -0.334  1.190   1.00 32.70 ? 67  SER A OG  1 
ATOM   493  N  N   . ASP A 1 65  ? 52.084 2.308   1.328   1.00 35.23 ? 68  ASP A N   1 
ATOM   494  C  CA  . ASP A 1 65  ? 52.120 3.690   0.842   1.00 34.91 ? 68  ASP A CA  1 
ATOM   495  C  C   . ASP A 1 65  ? 51.118 4.608   1.547   1.00 33.25 ? 68  ASP A C   1 
ATOM   496  O  O   . ASP A 1 65  ? 51.061 5.796   1.253   1.00 31.21 ? 68  ASP A O   1 
ATOM   497  C  CB  . ASP A 1 65  ? 51.865 3.745   -0.669  1.00 35.89 ? 68  ASP A CB  1 
ATOM   498  C  CG  . ASP A 1 65  ? 53.045 3.250   -1.481  1.00 38.43 ? 68  ASP A CG  1 
ATOM   499  O  OD1 . ASP A 1 65  ? 54.180 3.289   -0.967  1.00 41.36 ? 68  ASP A OD1 1 
ATOM   500  O  OD2 . ASP A 1 65  ? 52.840 2.822   -2.636  1.00 41.61 ? 68  ASP A OD2 1 
ATOM   501  N  N   . SER A 1 66  ? 50.326 4.060   2.464   1.00 33.41 ? 69  SER A N   1 
ATOM   502  C  CA  . SER A 1 66  ? 49.328 4.857   3.170   1.00 32.79 ? 69  SER A CA  1 
ATOM   503  C  C   . SER A 1 66  ? 49.650 5.023   4.647   1.00 33.67 ? 69  SER A C   1 
ATOM   504  O  O   . SER A 1 66  ? 49.858 4.040   5.361   1.00 32.83 ? 69  SER A O   1 
ATOM   505  C  CB  . SER A 1 66  ? 47.946 4.221   3.029   1.00 32.96 ? 69  SER A CB  1 
ATOM   506  O  OG  . SER A 1 66  ? 46.990 4.919   3.810   1.00 31.51 ? 69  SER A OG  1 
ATOM   507  N  N   . SER A 1 67  ? 49.667 6.273   5.106   1.00 35.74 ? 70  SER A N   1 
ATOM   508  C  CA  . SER A 1 67  ? 49.974 6.573   6.505   1.00 35.64 ? 70  SER A CA  1 
ATOM   509  C  C   . SER A 1 67  ? 48.762 6.335   7.401   1.00 36.13 ? 70  SER A C   1 
ATOM   510  O  O   . SER A 1 67  ? 48.895 6.161   8.612   1.00 36.10 ? 70  SER A O   1 
ATOM   511  C  CB  . SER A 1 67  ? 50.435 8.024   6.650   1.00 35.41 ? 70  SER A CB  1 
ATOM   512  O  OG  . SER A 1 67  ? 49.403 8.927   6.296   1.00 35.95 ? 70  SER A OG  1 
ATOM   513  N  N   . SER A 1 68  ? 47.578 6.327   6.801   1.00 34.38 ? 71  SER A N   1 
ATOM   514  C  CA  . SER A 1 68  ? 46.358 6.087   7.554   1.00 34.42 ? 71  SER A CA  1 
ATOM   515  C  C   . SER A 1 68  ? 45.999 4.602   7.607   1.00 34.81 ? 71  SER A C   1 
ATOM   516  O  O   . SER A 1 68  ? 45.009 4.223   8.230   1.00 35.97 ? 71  SER A O   1 
ATOM   517  C  CB  . SER A 1 68  ? 45.205 6.885   6.939   1.00 33.37 ? 71  SER A CB  1 
ATOM   518  O  OG  . SER A 1 68  ? 45.161 6.705   5.536   1.00 34.85 ? 71  SER A OG  1 
ATOM   519  N  N   . TYR A 1 69  ? 46.800 3.762   6.951   1.00 34.24 ? 72  TYR A N   1 
ATOM   520  C  CA  . TYR A 1 69  ? 46.517 2.330   6.900   1.00 32.02 ? 72  TYR A CA  1 
ATOM   521  C  C   . TYR A 1 69  ? 46.673 1.662   8.253   1.00 32.62 ? 72  TYR A C   1 
ATOM   522  O  O   . TYR A 1 69  ? 47.634 1.916   8.977   1.00 31.56 ? 72  TYR A O   1 
ATOM   523  C  CB  . TYR A 1 69  ? 47.439 1.636   5.899   1.00 31.38 ? 72  TYR A CB  1 
ATOM   524  C  CG  . TYR A 1 69  ? 47.534 0.142   6.099   1.00 29.22 ? 72  TYR A CG  1 
ATOM   525  C  CD1 . TYR A 1 69  ? 48.603 -0.415  6.789   1.00 30.56 ? 72  TYR A CD1 1 
ATOM   526  C  CD2 . TYR A 1 69  ? 46.575 -0.717  5.570   1.00 30.01 ? 72  TYR A CD2 1 
ATOM   527  C  CE1 . TYR A 1 69  ? 48.723 -1.789  6.944   1.00 30.34 ? 72  TYR A CE1 1 
ATOM   528  C  CE2 . TYR A 1 69  ? 46.684 -2.097  5.719   1.00 28.90 ? 72  TYR A CE2 1 
ATOM   529  C  CZ  . TYR A 1 69  ? 47.765 -2.627  6.404   1.00 31.73 ? 72  TYR A CZ  1 
ATOM   530  O  OH  . TYR A 1 69  ? 47.917 -3.994  6.517   1.00 29.65 ? 72  TYR A OH  1 
ATOM   531  N  N   . LYS A 1 70  ? 45.732 0.792   8.589   1.00 32.57 ? 73  LYS A N   1 
ATOM   532  C  CA  . LYS A 1 70  ? 45.787 0.097   9.864   1.00 33.58 ? 73  LYS A CA  1 
ATOM   533  C  C   . LYS A 1 70  ? 45.570 -1.399  9.676   1.00 32.46 ? 73  LYS A C   1 
ATOM   534  O  O   . LYS A 1 70  ? 44.529 -1.827  9.194   1.00 32.70 ? 73  LYS A O   1 
ATOM   535  C  CB  . LYS A 1 70  ? 44.736 0.678   10.812  1.00 34.17 ? 73  LYS A CB  1 
ATOM   536  C  CG  . LYS A 1 70  ? 44.702 0.033   12.179  1.00 38.04 ? 73  LYS A CG  1 
ATOM   537  C  CD  . LYS A 1 70  ? 43.818 0.827   13.132  1.00 40.84 ? 73  LYS A CD  1 
ATOM   538  C  CE  . LYS A 1 70  ? 43.222 -0.066  14.212  1.00 40.77 ? 73  LYS A CE  1 
ATOM   539  N  NZ  . LYS A 1 70  ? 42.299 -1.072  13.625  1.00 42.21 ? 73  LYS A NZ  1 
ATOM   540  N  N   . HIS A 1 71  ? 46.562 -2.188  10.071  1.00 31.19 ? 74  HIS A N   1 
ATOM   541  C  CA  . HIS A 1 71  ? 46.566 -3.618  9.799   1.00 29.44 ? 74  HIS A CA  1 
ATOM   542  C  C   . HIS A 1 71  ? 45.492 -4.407  10.546  1.00 30.37 ? 74  HIS A C   1 
ATOM   543  O  O   . HIS A 1 71  ? 45.186 -4.130  11.705  1.00 28.49 ? 74  HIS A O   1 
ATOM   544  C  CB  . HIS A 1 71  ? 47.930 -4.209  10.144  1.00 27.57 ? 74  HIS A CB  1 
ATOM   545  C  CG  . HIS A 1 71  ? 48.054 -5.655  9.797   1.00 25.59 ? 74  HIS A CG  1 
ATOM   546  N  ND1 . HIS A 1 71  ? 47.626 -6.660  10.636  1.00 25.14 ? 74  HIS A ND1 1 
ATOM   547  C  CD2 . HIS A 1 71  ? 48.524 -6.265  8.684   1.00 24.20 ? 74  HIS A CD2 1 
ATOM   548  C  CE1 . HIS A 1 71  ? 47.826 -7.828  10.052  1.00 24.35 ? 74  HIS A CE1 1 
ATOM   549  N  NE2 . HIS A 1 71  ? 48.369 -7.615  8.867   1.00 26.57 ? 74  HIS A NE2 1 
ATOM   550  N  N   . ASN A 1 72  ? 44.935 -5.411  9.877   1.00 29.41 ? 75  ASN A N   1 
ATOM   551  C  CA  . ASN A 1 72  ? 44.048 -6.350  10.539  1.00 30.32 ? 75  ASN A CA  1 
ATOM   552  C  C   . ASN A 1 72  ? 44.455 -7.782  10.201  1.00 29.04 ? 75  ASN A C   1 
ATOM   553  O  O   . ASN A 1 72  ? 44.893 -8.529  11.070  1.00 29.02 ? 75  ASN A O   1 
ATOM   554  C  CB  . ASN A 1 72  ? 42.595 -6.101  10.119  1.00 32.61 ? 75  ASN A CB  1 
ATOM   555  C  CG  . ASN A 1 72  ? 41.619 -6.966  10.882  1.00 34.31 ? 75  ASN A CG  1 
ATOM   556  O  OD1 . ASN A 1 72  ? 41.369 -8.106  10.503  1.00 32.71 ? 75  ASN A OD1 1 
ATOM   557  N  ND2 . ASN A 1 72  ? 41.074 -6.431  11.970  1.00 41.05 ? 75  ASN A ND2 1 
ATOM   558  N  N   . GLY A 1 73  ? 44.311 -8.161  8.936   1.00 27.27 ? 76  GLY A N   1 
ATOM   559  C  CA  . GLY A 1 73  ? 44.869 -9.425  8.494   1.00 27.94 ? 76  GLY A CA  1 
ATOM   560  C  C   . GLY A 1 73  ? 43.928 -10.617 8.532   1.00 27.80 ? 76  GLY A C   1 
ATOM   561  O  O   . GLY A 1 73  ? 44.294 -11.713 8.096   1.00 25.42 ? 76  GLY A O   1 
ATOM   562  N  N   . THR A 1 74  ? 42.716 -10.422 9.044   1.00 26.95 ? 77  THR A N   1 
ATOM   563  C  CA  . THR A 1 74  ? 41.761 -11.521 9.094   1.00 27.49 ? 77  THR A CA  1 
ATOM   564  C  C   . THR A 1 74  ? 41.388 -11.929 7.672   1.00 26.71 ? 77  THR A C   1 
ATOM   565  O  O   . THR A 1 74  ? 41.206 -11.084 6.791   1.00 25.71 ? 77  THR A O   1 
ATOM   566  C  CB  . THR A 1 74  ? 40.491 -11.136 9.892   1.00 28.19 ? 77  THR A CB  1 
ATOM   567  O  OG1 . THR A 1 74  ? 40.835 -10.978 11.273  1.00 29.66 ? 77  THR A OG1 1 
ATOM   568  C  CG2 . THR A 1 74  ? 39.432 -12.215 9.786   1.00 28.87 ? 77  THR A CG2 1 
ATOM   569  N  N   . GLU A 1 75  ? 41.299 -13.234 7.456   1.00 25.21 ? 78  GLU A N   1 
ATOM   570  C  CA  . GLU A 1 75  ? 41.042 -13.783 6.135   1.00 28.78 ? 78  GLU A CA  1 
ATOM   571  C  C   . GLU A 1 75  ? 39.620 -13.483 5.680   1.00 27.47 ? 78  GLU A C   1 
ATOM   572  O  O   . GLU A 1 75  ? 38.673 -13.540 6.468   1.00 30.34 ? 78  GLU A O   1 
ATOM   573  C  CB  . GLU A 1 75  ? 41.278 -15.295 6.153   1.00 32.18 ? 78  GLU A CB  1 
ATOM   574  C  CG  . GLU A 1 75  ? 41.133 -15.979 4.803   1.00 39.76 ? 78  GLU A CG  1 
ATOM   575  C  CD  . GLU A 1 75  ? 41.693 -17.391 4.810   1.00 44.96 ? 78  GLU A CD  1 
ATOM   576  O  OE1 . GLU A 1 75  ? 40.910 -18.348 4.620   1.00 48.38 ? 78  GLU A OE1 1 
ATOM   577  O  OE2 . GLU A 1 75  ? 42.919 -17.546 5.007   1.00 47.73 ? 78  GLU A OE2 1 
ATOM   578  N  N   . LEU A 1 76  ? 39.473 -13.157 4.405   1.00 25.02 ? 79  LEU A N   1 
ATOM   579  C  CA  . LEU A 1 76  ? 38.156 -12.909 3.845   1.00 25.92 ? 79  LEU A CA  1 
ATOM   580  C  C   . LEU A 1 76  ? 37.979 -13.664 2.535   1.00 26.29 ? 79  LEU A C   1 
ATOM   581  O  O   . LEU A 1 76  ? 38.854 -13.637 1.667   1.00 24.92 ? 79  LEU A O   1 
ATOM   582  C  CB  . LEU A 1 76  ? 37.955 -11.414 3.596   1.00 23.38 ? 79  LEU A CB  1 
ATOM   583  C  CG  . LEU A 1 76  ? 36.578 -11.038 3.036   1.00 22.94 ? 79  LEU A CG  1 
ATOM   584  C  CD1 . LEU A 1 76  ? 35.533 -11.075 4.142   1.00 25.63 ? 79  LEU A CD1 1 
ATOM   585  C  CD2 . LEU A 1 76  ? 36.645 -9.664  2.423   1.00 19.99 ? 79  LEU A CD2 1 
ATOM   586  N  N   . THR A 1 77  ? 36.840 -14.328 2.396   1.00 26.96 ? 80  THR A N   1 
ATOM   587  C  CA  . THR A 1 77  ? 36.499 -14.981 1.141   1.00 27.14 ? 80  THR A CA  1 
ATOM   588  C  C   . THR A 1 77  ? 35.095 -14.571 0.704   1.00 27.50 ? 80  THR A C   1 
ATOM   589  O  O   . THR A 1 77  ? 34.137 -14.741 1.455   1.00 28.94 ? 80  THR A O   1 
ATOM   590  C  CB  . THR A 1 77  ? 36.572 -16.509 1.300   1.00 27.97 ? 80  THR A CB  1 
ATOM   591  O  OG1 . THR A 1 77  ? 37.934 -16.892 1.533   1.00 28.95 ? 80  THR A OG1 1 
ATOM   592  C  CG2 . THR A 1 77  ? 36.045 -17.210 0.050   1.00 29.85 ? 80  THR A CG2 1 
ATOM   593  N  N   . LEU A 1 78  ? 34.978 -14.023 -0.503  1.00 25.04 ? 81  LEU A N   1 
ATOM   594  C  CA  . LEU A 1 78  ? 33.684 -13.580 -1.013  1.00 26.48 ? 81  LEU A CA  1 
ATOM   595  C  C   . LEU A 1 78  ? 33.257 -14.391 -2.232  1.00 26.59 ? 81  LEU A C   1 
ATOM   596  O  O   . LEU A 1 78  ? 33.878 -14.327 -3.289  1.00 24.96 ? 81  LEU A O   1 
ATOM   597  C  CB  . LEU A 1 78  ? 33.739 -12.102 -1.386  1.00 23.54 ? 81  LEU A CB  1 
ATOM   598  C  CG  . LEU A 1 78  ? 34.227 -11.182 -0.266  1.00 26.98 ? 81  LEU A CG  1 
ATOM   599  C  CD1 . LEU A 1 78  ? 34.412 -9.765  -0.796  1.00 22.27 ? 81  LEU A CD1 1 
ATOM   600  C  CD2 . LEU A 1 78  ? 33.233 -11.223 0.884   1.00 23.50 ? 81  LEU A CD2 1 
ATOM   601  N  N   . ARG A 1 79  ? 32.180 -15.148 -2.084  1.00 30.64 ? 82  ARG A N   1 
ATOM   602  C  CA  . ARG A 1 79  ? 31.675 -15.936 -3.196  1.00 33.07 ? 82  ARG A CA  1 
ATOM   603  C  C   . ARG A 1 79  ? 30.461 -15.265 -3.828  1.00 34.18 ? 82  ARG A C   1 
ATOM   604  O  O   . ARG A 1 79  ? 29.384 -15.217 -3.230  1.00 35.25 ? 82  ARG A O   1 
ATOM   605  C  CB  . ARG A 1 79  ? 31.310 -17.340 -2.714  1.00 37.26 ? 82  ARG A CB  1 
ATOM   606  C  CG  . ARG A 1 79  ? 32.491 -18.113 -2.126  1.00 42.75 ? 82  ARG A CG  1 
ATOM   607  C  CD  . ARG A 1 79  ? 32.182 -19.602 -2.004  1.00 47.66 ? 82  ARG A CD  1 
ATOM   608  N  NE  . ARG A 1 79  ? 33.386 -20.431 -2.077  1.00 51.08 ? 82  ARG A NE  1 
ATOM   609  C  CZ  . ARG A 1 79  ? 33.814 -21.042 -3.181  1.00 53.41 ? 82  ARG A CZ  1 
ATOM   610  N  NH1 . ARG A 1 79  ? 33.139 -20.920 -4.319  1.00 52.65 ? 82  ARG A NH1 1 
ATOM   611  N  NH2 . ARG A 1 79  ? 34.913 -21.789 -3.146  1.00 53.06 ? 82  ARG A NH2 1 
ATOM   612  N  N   . TYR A 1 80  ? 30.637 -14.731 -5.033  1.00 31.74 ? 83  TYR A N   1 
ATOM   613  C  CA  . TYR A 1 80  ? 29.498 -14.263 -5.809  1.00 32.20 ? 83  TYR A CA  1 
ATOM   614  C  C   . TYR A 1 80  ? 29.101 -15.384 -6.768  1.00 33.39 ? 83  TYR A C   1 
ATOM   615  O  O   . TYR A 1 80  ? 29.857 -16.330 -6.963  1.00 34.82 ? 83  TYR A O   1 
ATOM   616  C  CB  . TYR A 1 80  ? 29.863 -12.999 -6.595  1.00 28.85 ? 83  TYR A CB  1 
ATOM   617  C  CG  . TYR A 1 80  ? 30.434 -11.873 -5.750  1.00 27.14 ? 83  TYR A CG  1 
ATOM   618  C  CD1 . TYR A 1 80  ? 29.605 -10.940 -5.142  1.00 26.56 ? 83  TYR A CD1 1 
ATOM   619  C  CD2 . TYR A 1 80  ? 31.807 -11.735 -5.582  1.00 28.53 ? 83  TYR A CD2 1 
ATOM   620  C  CE1 . TYR A 1 80  ? 30.125 -9.897  -4.391  1.00 24.23 ? 83  TYR A CE1 1 
ATOM   621  C  CE2 . TYR A 1 80  ? 32.344 -10.698 -4.837  1.00 27.04 ? 83  TYR A CE2 1 
ATOM   622  C  CZ  . TYR A 1 80  ? 31.498 -9.779  -4.245  1.00 27.76 ? 83  TYR A CZ  1 
ATOM   623  O  OH  . TYR A 1 80  ? 32.036 -8.730  -3.537  1.00 23.30 ? 83  TYR A OH  1 
ATOM   624  N  N   . SER A 1 81  ? 27.917 -15.284 -7.360  1.00 35.48 ? 84  SER A N   1 
ATOM   625  C  CA  . SER A 1 81  ? 27.466 -16.297 -8.306  1.00 36.78 ? 84  SER A CA  1 
ATOM   626  C  C   . SER A 1 81  ? 28.524 -16.498 -9.385  1.00 36.61 ? 84  SER A C   1 
ATOM   627  O  O   . SER A 1 81  ? 28.809 -17.626 -9.784  1.00 37.47 ? 84  SER A O   1 
ATOM   628  C  CB  . SER A 1 81  ? 26.150 -15.870 -8.962  1.00 37.61 ? 84  SER A CB  1 
ATOM   629  O  OG  . SER A 1 81  ? 25.054 -15.969 -8.066  1.00 45.09 ? 84  SER A OG  1 
ATOM   630  N  N   . THR A 1 82  ? 29.110 -15.391 -9.831  1.00 37.43 ? 85  THR A N   1 
ATOM   631  C  CA  . THR A 1 82  ? 29.978 -15.361 -11.001 1.00 36.66 ? 85  THR A CA  1 
ATOM   632  C  C   . THR A 1 82  ? 31.448 -15.641 -10.690 1.00 35.73 ? 85  THR A C   1 
ATOM   633  O  O   . THR A 1 82  ? 32.297 -15.580 -11.580 1.00 37.39 ? 85  THR A O   1 
ATOM   634  C  CB  . THR A 1 82  ? 29.878 -13.998 -11.696 1.00 39.01 ? 85  THR A CB  1 
ATOM   635  O  OG1 . THR A 1 82  ? 30.777 -13.945 -12.811 1.00 39.42 ? 85  THR A OG1 1 
ATOM   636  C  CG2 . THR A 1 82  ? 30.225 -12.903 -10.725 1.00 40.47 ? 85  THR A CG2 1 
ATOM   637  N  N   . GLY A 1 83  ? 31.756 -15.944 -9.434  1.00 33.51 ? 86  GLY A N   1 
ATOM   638  C  CA  . GLY A 1 83  ? 33.132 -16.255 -9.089  1.00 31.96 ? 86  GLY A CA  1 
ATOM   639  C  C   . GLY A 1 83  ? 33.562 -15.737 -7.728  1.00 30.35 ? 86  GLY A C   1 
ATOM   640  O  O   . GLY A 1 83  ? 32.956 -14.817 -7.182  1.00 31.69 ? 86  GLY A O   1 
ATOM   641  N  N   . THR A 1 84  ? 34.622 -16.332 -7.193  1.00 27.67 ? 87  THR A N   1 
ATOM   642  C  CA  . THR A 1 84  ? 35.070 -16.075 -5.833  1.00 27.15 ? 87  THR A CA  1 
ATOM   643  C  C   . THR A 1 84  ? 36.382 -15.308 -5.772  1.00 25.29 ? 87  THR A C   1 
ATOM   644  O  O   . THR A 1 84  ? 37.300 -15.567 -6.549  1.00 25.19 ? 87  THR A O   1 
ATOM   645  C  CB  . THR A 1 84  ? 35.261 -17.391 -5.063  1.00 28.47 ? 87  THR A CB  1 
ATOM   646  O  OG1 . THR A 1 84  ? 33.989 -18.018 -4.876  1.00 29.09 ? 87  THR A OG1 1 
ATOM   647  C  CG2 . THR A 1 84  ? 35.900 -17.137 -3.715  1.00 27.69 ? 87  THR A CG2 1 
ATOM   648  N  N   . VAL A 1 85  ? 36.464 -14.359 -4.843  1.00 23.94 ? 88  VAL A N   1 
ATOM   649  C  CA  . VAL A 1 85  ? 37.735 -13.756 -4.496  1.00 22.96 ? 88  VAL A CA  1 
ATOM   650  C  C   . VAL A 1 85  ? 38.052 -13.933 -3.017  1.00 24.42 ? 88  VAL A C   1 
ATOM   651  O  O   . VAL A 1 85  ? 37.157 -14.107 -2.184  1.00 25.62 ? 88  VAL A O   1 
ATOM   652  C  CB  . VAL A 1 85  ? 37.766 -12.259 -4.830  1.00 21.47 ? 88  VAL A CB  1 
ATOM   653  C  CG1 . VAL A 1 85  ? 37.575 -12.067 -6.323  1.00 22.65 ? 88  VAL A CG1 1 
ATOM   654  C  CG2 . VAL A 1 85  ? 36.698 -11.525 -4.033  1.00 21.98 ? 88  VAL A CG2 1 
ATOM   655  N  N   . SER A 1 86  ? 39.340 -13.896 -2.699  1.00 24.55 ? 89  SER A N   1 
ATOM   656  C  CA  . SER A 1 86  ? 39.793 -14.091 -1.329  1.00 24.18 ? 89  SER A CA  1 
ATOM   657  C  C   . SER A 1 86  ? 40.961 -13.172 -1.048  1.00 21.37 ? 89  SER A C   1 
ATOM   658  O  O   . SER A 1 86  ? 41.604 -12.681 -1.970  1.00 20.99 ? 89  SER A O   1 
ATOM   659  C  CB  . SER A 1 86  ? 40.223 -15.541 -1.107  1.00 25.73 ? 89  SER A CB  1 
ATOM   660  O  OG  . SER A 1 86  ? 39.100 -16.372 -0.907  1.00 30.97 ? 89  SER A OG  1 
ATOM   661  N  N   . GLY A 1 87  ? 41.220 -12.954 0.236   1.00 21.86 ? 90  GLY A N   1 
ATOM   662  C  CA  . GLY A 1 87  ? 42.293 -12.080 0.670   1.00 22.74 ? 90  GLY A CA  1 
ATOM   663  C  C   . GLY A 1 87  ? 42.163 -11.880 2.170   1.00 23.64 ? 90  GLY A C   1 
ATOM   664  O  O   . GLY A 1 87  ? 41.751 -12.787 2.892   1.00 25.10 ? 90  GLY A O   1 
ATOM   665  N  N   . PHE A 1 88  ? 42.492 -10.687 2.645   1.00 25.91 ? 91  PHE A N   1 
ATOM   666  C  CA  . PHE A 1 88  ? 42.432 -10.398 4.069   1.00 25.38 ? 91  PHE A CA  1 
ATOM   667  C  C   . PHE A 1 88  ? 41.914 -8.983  4.312   1.00 25.30 ? 91  PHE A C   1 
ATOM   668  O  O   . PHE A 1 88  ? 41.943 -8.136  3.425   1.00 25.91 ? 91  PHE A O   1 
ATOM   669  C  CB  . PHE A 1 88  ? 43.821 -10.534 4.680   1.00 22.49 ? 91  PHE A CB  1 
ATOM   670  C  CG  . PHE A 1 88  ? 44.828 -9.627  4.049   1.00 23.44 ? 91  PHE A CG  1 
ATOM   671  C  CD1 . PHE A 1 88  ? 45.100 -8.383  4.599   1.00 23.51 ? 91  PHE A CD1 1 
ATOM   672  C  CD2 . PHE A 1 88  ? 45.460 -9.989  2.873   1.00 22.49 ? 91  PHE A CD2 1 
ATOM   673  C  CE1 . PHE A 1 88  ? 45.978 -7.516  3.984   1.00 22.94 ? 91  PHE A CE1 1 
ATOM   674  C  CE2 . PHE A 1 88  ? 46.339 -9.126  2.252   1.00 23.09 ? 91  PHE A CE2 1 
ATOM   675  C  CZ  . PHE A 1 88  ? 46.599 -7.885  2.808   1.00 21.56 ? 91  PHE A CZ  1 
ATOM   676  N  N   . LEU A 1 89  ? 41.469 -8.729  5.534   1.00 27.34 ? 92  LEU A N   1 
ATOM   677  C  CA  . LEU A 1 89  ? 40.919 -7.434  5.911   1.00 25.34 ? 92  LEU A CA  1 
ATOM   678  C  C   . LEU A 1 89  ? 41.988 -6.406  6.249   1.00 25.27 ? 92  LEU A C   1 
ATOM   679  O  O   . LEU A 1 89  ? 43.008 -6.724  6.862   1.00 25.98 ? 92  LEU A O   1 
ATOM   680  C  CB  . LEU A 1 89  ? 39.984 -7.607  7.098   1.00 25.62 ? 92  LEU A CB  1 
ATOM   681  C  CG  . LEU A 1 89  ? 38.718 -8.394  6.767   1.00 26.40 ? 92  LEU A CG  1 
ATOM   682  C  CD1 . LEU A 1 89  ? 37.837 -8.494  7.994   1.00 28.26 ? 92  LEU A CD1 1 
ATOM   683  C  CD2 . LEU A 1 89  ? 37.987 -7.703  5.640   1.00 26.49 ? 92  LEU A CD2 1 
ATOM   684  N  N   . SER A 1 90  ? 41.738 -5.169  5.829   1.00 25.14 ? 93  SER A N   1 
ATOM   685  C  CA  . SER A 1 90  ? 42.607 -4.034  6.122   1.00 25.21 ? 93  SER A CA  1 
ATOM   686  C  C   . SER A 1 90  ? 41.702 -2.854  6.445   1.00 24.80 ? 93  SER A C   1 
ATOM   687  O  O   . SER A 1 90  ? 40.592 -2.772  5.927   1.00 25.74 ? 93  SER A O   1 
ATOM   688  C  CB  . SER A 1 90  ? 43.464 -3.680  4.903   1.00 23.57 ? 93  SER A CB  1 
ATOM   689  O  OG  . SER A 1 90  ? 44.461 -4.656  4.658   1.00 27.36 ? 93  SER A OG  1 
ATOM   690  N  N   . GLN A 1 91  ? 42.164 -1.945  7.299   1.00 26.15 ? 94  GLN A N   1 
ATOM   691  C  CA  . GLN A 1 91  ? 41.427 -0.705  7.530   1.00 27.81 ? 94  GLN A CA  1 
ATOM   692  C  C   . GLN A 1 91  ? 42.173 0.511   7.000   1.00 27.62 ? 94  GLN A C   1 
ATOM   693  O  O   . GLN A 1 91  ? 43.377 0.630   7.183   1.00 28.43 ? 94  GLN A O   1 
ATOM   694  C  CB  . GLN A 1 91  ? 41.152 -0.508  9.016   1.00 29.48 ? 94  GLN A CB  1 
ATOM   695  C  CG  . GLN A 1 91  ? 40.345 0.751   9.317   1.00 30.38 ? 94  GLN A CG  1 
ATOM   696  C  CD  . GLN A 1 91  ? 40.343 1.095   10.791  1.00 33.68 ? 94  GLN A CD  1 
ATOM   697  O  OE1 . GLN A 1 91  ? 39.558 0.546   11.566  1.00 34.28 ? 94  GLN A OE1 1 
ATOM   698  N  NE2 . GLN A 1 91  ? 41.228 2.006   11.190  1.00 31.05 ? 94  GLN A NE2 1 
ATOM   699  N  N   . ASP A 1 92  ? 41.450 1.415   6.347   1.00 27.50 ? 95  ASP A N   1 
ATOM   700  C  CA  . ASP A 1 92  ? 42.027 2.674   5.895   1.00 28.88 ? 95  ASP A CA  1 
ATOM   701  C  C   . ASP A 1 92  ? 40.916 3.690   5.645   1.00 29.65 ? 95  ASP A C   1 
ATOM   702  O  O   . ASP A 1 92  ? 39.736 3.371   5.749   1.00 29.62 ? 95  ASP A O   1 
ATOM   703  C  CB  . ASP A 1 92  ? 42.835 2.466   4.609   1.00 28.18 ? 95  ASP A CB  1 
ATOM   704  C  CG  . ASP A 1 92  ? 44.032 3.405   4.512   1.00 30.26 ? 95  ASP A CG  1 
ATOM   705  O  OD1 . ASP A 1 92  ? 43.899 4.594   4.878   1.00 28.81 ? 95  ASP A OD1 1 
ATOM   706  O  OD2 . ASP A 1 92  ? 45.108 2.950   4.070   1.00 27.72 ? 95  ASP A OD2 1 
ATOM   707  N  N   . ILE A 1 93  ? 41.303 4.916   5.320   1.00 30.34 ? 96  ILE A N   1 
ATOM   708  C  CA  . ILE A 1 93  ? 40.339 5.956   4.997   1.00 30.50 ? 96  ILE A CA  1 
ATOM   709  C  C   . ILE A 1 93  ? 39.911 5.844   3.542   1.00 29.79 ? 96  ILE A C   1 
ATOM   710  O  O   . ILE A 1 93  ? 40.748 5.737   2.647   1.00 31.26 ? 96  ILE A O   1 
ATOM   711  C  CB  . ILE A 1 93  ? 40.950 7.344   5.238   1.00 32.28 ? 96  ILE A CB  1 
ATOM   712  C  CG1 . ILE A 1 93  ? 41.261 7.504   6.726   1.00 33.89 ? 96  ILE A CG1 1 
ATOM   713  C  CG2 . ILE A 1 93  ? 40.004 8.429   4.755   1.00 33.67 ? 96  ILE A CG2 1 
ATOM   714  C  CD1 . ILE A 1 93  ? 42.255 8.614   7.028   1.00 36.86 ? 96  ILE A CD1 1 
ATOM   715  N  N   . ILE A 1 94  ? 38.604 5.872   3.309   1.00 29.46 ? 97  ILE A N   1 
ATOM   716  C  CA  . ILE A 1 94  ? 38.073 5.812   1.953   1.00 28.04 ? 97  ILE A CA  1 
ATOM   717  C  C   . ILE A 1 94  ? 37.262 7.063   1.622   1.00 29.53 ? 97  ILE A C   1 
ATOM   718  O  O   . ILE A 1 94  ? 36.367 7.447   2.368   1.00 30.49 ? 97  ILE A O   1 
ATOM   719  C  CB  . ILE A 1 94  ? 37.171 4.567   1.764   1.00 25.46 ? 97  ILE A CB  1 
ATOM   720  C  CG1 . ILE A 1 94  ? 38.001 3.298   1.958   1.00 25.37 ? 97  ILE A CG1 1 
ATOM   721  C  CG2 . ILE A 1 94  ? 36.520 4.587   0.382   1.00 19.74 ? 97  ILE A CG2 1 
ATOM   722  C  CD1 . ILE A 1 94  ? 37.233 2.023   1.694   1.00 30.28 ? 97  ILE A CD1 1 
ATOM   723  N  N   . THR A 1 95  ? 37.578 7.697   0.500   1.00 30.22 ? 98  THR A N   1 
ATOM   724  C  CA  . THR A 1 95  ? 36.783 8.824   0.039   1.00 31.50 ? 98  THR A CA  1 
ATOM   725  C  C   . THR A 1 95  ? 35.880 8.395   -1.108  1.00 32.58 ? 98  THR A C   1 
ATOM   726  O  O   . THR A 1 95  ? 36.320 7.724   -2.048  1.00 31.69 ? 98  THR A O   1 
ATOM   727  C  CB  . THR A 1 95  ? 37.669 9.998   -0.432  1.00 34.22 ? 98  THR A CB  1 
ATOM   728  O  OG1 . THR A 1 95  ? 38.472 9.586   -1.547  1.00 36.68 ? 98  THR A OG1 1 
ATOM   729  C  CG2 . THR A 1 95  ? 38.577 10.459  0.697   1.00 33.29 ? 98  THR A CG2 1 
ATOM   730  N  N   . VAL A 1 96  ? 34.611 8.776   -0.997  1.00 31.42 ? 99  VAL A N   1 
ATOM   731  C  CA  . VAL A 1 96  ? 33.619 8.566   -2.038  1.00 32.94 ? 99  VAL A CA  1 
ATOM   732  C  C   . VAL A 1 96  ? 32.848 9.874   -2.186  1.00 33.83 ? 99  VAL A C   1 
ATOM   733  O  O   . VAL A 1 96  ? 32.208 10.328  -1.241  1.00 33.99 ? 99  VAL A O   1 
ATOM   734  C  CB  . VAL A 1 96  ? 32.627 7.456   -1.641  1.00 31.44 ? 99  VAL A CB  1 
ATOM   735  C  CG1 . VAL A 1 96  ? 31.648 7.203   -2.768  1.00 30.28 ? 99  VAL A CG1 1 
ATOM   736  C  CG2 . VAL A 1 96  ? 33.383 6.193   -1.295  1.00 33.78 ? 99  VAL A CG2 1 
ATOM   737  N  N   . GLY A 1 97  ? 32.904 10.477  -3.368  1.00 34.10 ? 100 GLY A N   1 
ATOM   738  C  CA  . GLY A 1 97  ? 32.378 11.822  -3.506  1.00 37.24 ? 100 GLY A CA  1 
ATOM   739  C  C   . GLY A 1 97  ? 33.160 12.770  -2.614  1.00 37.48 ? 100 GLY A C   1 
ATOM   740  O  O   . GLY A 1 97  ? 34.390 12.719  -2.566  1.00 38.65 ? 100 GLY A O   1 
ATOM   741  N  N   . GLY A 1 98  ? 32.455 13.633  -1.895  1.00 38.58 ? 101 GLY A N   1 
ATOM   742  C  CA  . GLY A 1 98  ? 33.134 14.540  -0.987  1.00 38.23 ? 101 GLY A CA  1 
ATOM   743  C  C   . GLY A 1 98  ? 33.300 13.930  0.388   1.00 38.31 ? 101 GLY A C   1 
ATOM   744  O  O   . GLY A 1 98  ? 33.989 14.475  1.247   1.00 38.51 ? 101 GLY A O   1 
ATOM   745  N  N   . ILE A 1 99  ? 32.670 12.781  0.595   1.00 37.27 ? 102 ILE A N   1 
ATOM   746  C  CA  . ILE A 1 99  ? 32.660 12.153  1.904   1.00 35.85 ? 102 ILE A CA  1 
ATOM   747  C  C   . ILE A 1 99  ? 33.916 11.328  2.157   1.00 37.44 ? 102 ILE A C   1 
ATOM   748  O  O   . ILE A 1 99  ? 34.503 10.772  1.232   1.00 39.03 ? 102 ILE A O   1 
ATOM   749  C  CB  . ILE A 1 99  ? 31.428 11.253  2.059   1.00 34.74 ? 102 ILE A CB  1 
ATOM   750  C  CG1 . ILE A 1 99  ? 30.159 12.100  1.953   1.00 32.91 ? 102 ILE A CG1 1 
ATOM   751  C  CG2 . ILE A 1 99  ? 31.481 10.524  3.388   1.00 34.96 ? 102 ILE A CG2 1 
ATOM   752  C  CD1 . ILE A 1 99  ? 28.899 11.341  2.249   1.00 32.89 ? 102 ILE A CD1 1 
ATOM   753  N  N   . THR A 1 100 ? 34.317 11.257  3.421   1.00 37.41 ? 103 THR A N   1 
ATOM   754  C  CA  . THR A 1 100 ? 35.504 10.519  3.823   1.00 38.95 ? 103 THR A CA  1 
ATOM   755  C  C   . THR A 1 100 ? 35.198 9.658   5.045   1.00 38.27 ? 103 THR A C   1 
ATOM   756  O  O   . THR A 1 100 ? 34.822 10.177  6.094   1.00 36.80 ? 103 THR A O   1 
ATOM   757  C  CB  . THR A 1 100 ? 36.656 11.489  4.158   1.00 40.67 ? 103 THR A CB  1 
ATOM   758  O  OG1 . THR A 1 100 ? 37.177 12.044  2.946   1.00 43.83 ? 103 THR A OG1 1 
ATOM   759  C  CG2 . THR A 1 100 ? 37.758 10.779  4.915   1.00 40.09 ? 103 THR A CG2 1 
ATOM   760  N  N   . VAL A 1 101 ? 35.356 8.343   4.909   1.00 37.28 ? 104 VAL A N   1 
ATOM   761  C  CA  . VAL A 1 101 ? 35.034 7.433   6.004   1.00 36.15 ? 104 VAL A CA  1 
ATOM   762  C  C   . VAL A 1 101 ? 36.124 6.395   6.270   1.00 34.43 ? 104 VAL A C   1 
ATOM   763  O  O   . VAL A 1 101 ? 36.755 5.884   5.345   1.00 33.83 ? 104 VAL A O   1 
ATOM   764  C  CB  . VAL A 1 101 ? 33.689 6.706   5.739   1.00 38.23 ? 104 VAL A CB  1 
ATOM   765  C  CG1 . VAL A 1 101 ? 33.771 5.886   4.458   1.00 37.72 ? 104 VAL A CG1 1 
ATOM   766  C  CG2 . VAL A 1 101 ? 33.338 5.822   6.918   1.00 39.60 ? 104 VAL A CG2 1 
ATOM   767  N  N   . THR A 1 102 ? 36.349 6.095   7.543   1.00 32.98 ? 105 THR A N   1 
ATOM   768  C  CA  . THR A 1 102 ? 37.256 5.017   7.909   1.00 33.31 ? 105 THR A CA  1 
ATOM   769  C  C   . THR A 1 102 ? 36.522 3.695   7.745   1.00 32.13 ? 105 THR A C   1 
ATOM   770  O  O   . THR A 1 102 ? 35.515 3.446   8.411   1.00 31.83 ? 105 THR A O   1 
ATOM   771  C  CB  . THR A 1 102 ? 37.746 5.157   9.366   1.00 34.43 ? 105 THR A CB  1 
ATOM   772  O  OG1 . THR A 1 102 ? 38.489 6.375   9.504   1.00 35.63 ? 105 THR A OG1 1 
ATOM   773  C  CG2 . THR A 1 102 ? 38.645 3.982   9.747   1.00 34.76 ? 105 THR A CG2 1 
ATOM   774  N  N   . GLN A 1 103 ? 37.030 2.857   6.846   1.00 30.27 ? 106 GLN A N   1 
ATOM   775  C  CA  . GLN A 1 103 ? 36.315 1.659   6.417   1.00 28.69 ? 106 GLN A CA  1 
ATOM   776  C  C   . GLN A 1 103 ? 37.190 0.410   6.493   1.00 28.72 ? 106 GLN A C   1 
ATOM   777  O  O   . GLN A 1 103 ? 38.370 0.447   6.143   1.00 27.59 ? 106 GLN A O   1 
ATOM   778  C  CB  . GLN A 1 103 ? 35.824 1.831   4.979   1.00 27.64 ? 106 GLN A CB  1 
ATOM   779  C  CG  . GLN A 1 103 ? 35.073 0.617   4.445   1.00 26.64 ? 106 GLN A CG  1 
ATOM   780  C  CD  . GLN A 1 103 ? 33.766 0.395   5.185   1.00 27.76 ? 106 GLN A CD  1 
ATOM   781  O  OE1 . GLN A 1 103 ? 33.112 1.351   5.603   1.00 25.30 ? 106 GLN A OE1 1 
ATOM   782  N  NE2 . GLN A 1 103 ? 33.383 -0.867  5.356   1.00 24.60 ? 106 GLN A NE2 1 
ATOM   783  N  N   . MET A 1 104 ? 36.605 -0.695  6.942   1.00 27.69 ? 107 MET A N   1 
ATOM   784  C  CA  . MET A 1 104 ? 37.262 -1.994  6.834   1.00 29.44 ? 107 MET A CA  1 
ATOM   785  C  C   . MET A 1 104 ? 36.912 -2.612  5.475   1.00 26.53 ? 107 MET A C   1 
ATOM   786  O  O   . MET A 1 104 ? 35.742 -2.664  5.100   1.00 29.41 ? 107 MET A O   1 
ATOM   787  C  CB  . MET A 1 104 ? 36.796 -2.914  7.974   1.00 30.55 ? 107 MET A CB  1 
ATOM   788  C  CG  . MET A 1 104 ? 37.613 -4.185  8.122   1.00 33.68 ? 107 MET A CG  1 
ATOM   789  S  SD  . MET A 1 104 ? 39.263 -3.872  8.804   1.00 39.84 ? 107 MET A SD  1 
ATOM   790  C  CE  . MET A 1 104 ? 38.904 -3.917  10.579  1.00 37.85 ? 107 MET A CE  1 
ATOM   791  N  N   . PHE A 1 105 ? 37.920 -3.071  4.740   1.00 23.71 ? 108 PHE A N   1 
ATOM   792  C  CA  . PHE A 1 105 ? 37.703 -3.625  3.406   1.00 23.86 ? 108 PHE A CA  1 
ATOM   793  C  C   . PHE A 1 105 ? 38.616 -4.814  3.111   1.00 23.87 ? 108 PHE A C   1 
ATOM   794  O  O   . PHE A 1 105 ? 39.574 -5.080  3.841   1.00 24.63 ? 108 PHE A O   1 
ATOM   795  C  CB  . PHE A 1 105 ? 37.925 -2.539  2.342   1.00 20.99 ? 108 PHE A CB  1 
ATOM   796  C  CG  . PHE A 1 105 ? 39.320 -1.973  2.336   1.00 20.37 ? 108 PHE A CG  1 
ATOM   797  C  CD1 . PHE A 1 105 ? 39.711 -1.049  3.289   1.00 20.94 ? 108 PHE A CD1 1 
ATOM   798  C  CD2 . PHE A 1 105 ? 40.246 -2.384  1.392   1.00 22.21 ? 108 PHE A CD2 1 
ATOM   799  C  CE1 . PHE A 1 105 ? 40.999 -0.546  3.306   1.00 20.68 ? 108 PHE A CE1 1 
ATOM   800  C  CE2 . PHE A 1 105 ? 41.541 -1.881  1.402   1.00 23.30 ? 108 PHE A CE2 1 
ATOM   801  C  CZ  . PHE A 1 105 ? 41.916 -0.963  2.360   1.00 18.86 ? 108 PHE A CZ  1 
ATOM   802  N  N   . GLY A 1 106 ? 38.316 -5.525  2.030   1.00 24.12 ? 109 GLY A N   1 
ATOM   803  C  CA  . GLY A 1 106 ? 39.174 -6.617  1.613   1.00 22.68 ? 109 GLY A CA  1 
ATOM   804  C  C   . GLY A 1 106 ? 40.311 -6.188  0.701   1.00 22.72 ? 109 GLY A C   1 
ATOM   805  O  O   . GLY A 1 106 ? 40.105 -5.483  -0.291  1.00 21.06 ? 109 GLY A O   1 
ATOM   806  N  N   . GLU A 1 107 ? 41.524 -6.606  1.045   1.00 20.58 ? 110 GLU A N   1 
ATOM   807  C  CA  . GLU A 1 107 ? 42.615 -6.607  0.082   1.00 21.68 ? 110 GLU A CA  1 
ATOM   808  C  C   . GLU A 1 107 ? 42.605 -7.979  -0.584  1.00 20.82 ? 110 GLU A C   1 
ATOM   809  O  O   . GLU A 1 107 ? 42.895 -8.991  0.055   1.00 20.88 ? 110 GLU A O   1 
ATOM   810  C  CB  . GLU A 1 107 ? 43.961 -6.367  0.786   1.00 21.98 ? 110 GLU A CB  1 
ATOM   811  C  CG  . GLU A 1 107 ? 44.282 -4.899  1.050   1.00 20.17 ? 110 GLU A CG  1 
ATOM   812  C  CD  . GLU A 1 107 ? 45.735 -4.677  1.450   1.00 21.44 ? 110 GLU A CD  1 
ATOM   813  O  OE1 . GLU A 1 107 ? 46.637 -4.944  0.628   1.00 21.57 ? 110 GLU A OE1 1 
ATOM   814  O  OE2 . GLU A 1 107 ? 45.981 -4.231  2.593   1.00 23.99 ? 110 GLU A OE2 1 
ATOM   815  N  N   . VAL A 1 108 ? 42.255 -8.017  -1.861  1.00 20.11 ? 111 VAL A N   1 
ATOM   816  C  CA  . VAL A 1 108 ? 42.128 -9.291  -2.556  1.00 21.51 ? 111 VAL A CA  1 
ATOM   817  C  C   . VAL A 1 108 ? 43.461 -9.783  -3.099  1.00 22.16 ? 111 VAL A C   1 
ATOM   818  O  O   . VAL A 1 108 ? 44.193 -9.039  -3.756  1.00 21.58 ? 111 VAL A O   1 
ATOM   819  C  CB  . VAL A 1 108 ? 41.100 -9.194  -3.696  1.00 21.88 ? 111 VAL A CB  1 
ATOM   820  C  CG1 . VAL A 1 108 ? 41.171 -10.436 -4.589  1.00 21.78 ? 111 VAL A CG1 1 
ATOM   821  C  CG2 . VAL A 1 108 ? 39.704 -9.068  -3.092  1.00 20.12 ? 111 VAL A CG2 1 
ATOM   822  N  N   . THR A 1 109 ? 43.777 -11.041 -2.799  1.00 22.72 ? 112 THR A N   1 
ATOM   823  C  CA  . THR A 1 109 ? 45.041 -11.635 -3.209  1.00 24.42 ? 112 THR A CA  1 
ATOM   824  C  C   . THR A 1 109 ? 44.801 -12.834 -4.117  1.00 25.64 ? 112 THR A C   1 
ATOM   825  O  O   . THR A 1 109 ? 45.746 -13.435 -4.632  1.00 26.02 ? 112 THR A O   1 
ATOM   826  C  CB  . THR A 1 109 ? 45.865 -12.110 -1.988  1.00 24.29 ? 112 THR A CB  1 
ATOM   827  O  OG1 . THR A 1 109 ? 45.068 -12.988 -1.183  1.00 23.85 ? 112 THR A OG1 1 
ATOM   828  C  CG2 . THR A 1 109 ? 46.307 -10.931 -1.149  1.00 23.27 ? 112 THR A CG2 1 
ATOM   829  N  N   . GLU A 1 110 ? 43.539 -13.194 -4.297  1.00 24.66 ? 113 GLU A N   1 
ATOM   830  C  CA  . GLU A 1 110 ? 43.191 -14.267 -5.219  1.00 25.52 ? 113 GLU A CA  1 
ATOM   831  C  C   . GLU A 1 110 ? 41.992 -13.852 -6.060  1.00 26.40 ? 113 GLU A C   1 
ATOM   832  O  O   . GLU A 1 110 ? 40.895 -13.617 -5.544  1.00 27.07 ? 113 GLU A O   1 
ATOM   833  C  CB  . GLU A 1 110 ? 42.895 -15.554 -4.439  1.00 27.61 ? 113 GLU A CB  1 
ATOM   834  C  CG  . GLU A 1 110 ? 44.121 -16.075 -3.666  1.00 30.64 ? 113 GLU A CG  1 
ATOM   835  C  CD  . GLU A 1 110 ? 43.834 -17.323 -2.842  1.00 36.06 ? 113 GLU A CD  1 
ATOM   836  O  OE1 . GLU A 1 110 ? 44.739 -17.756 -2.092  1.00 38.63 ? 113 GLU A OE1 1 
ATOM   837  O  OE2 . GLU A 1 110 ? 42.714 -17.871 -2.941  1.00 34.48 ? 113 GLU A OE2 1 
ATOM   838  N  N   . MET A 1 111 ? 42.214 -13.770 -7.365  1.00 26.59 ? 114 MET A N   1 
ATOM   839  C  CA  . MET A 1 111 ? 41.271 -13.126 -8.271  1.00 25.70 ? 114 MET A CA  1 
ATOM   840  C  C   . MET A 1 111 ? 41.246 -13.881 -9.601  1.00 25.09 ? 114 MET A C   1 
ATOM   841  O  O   . MET A 1 111 ? 42.120 -13.692 -10.434 1.00 25.66 ? 114 MET A O   1 
ATOM   842  C  CB  . MET A 1 111 ? 41.732 -11.690 -8.500  1.00 27.40 ? 114 MET A CB  1 
ATOM   843  C  CG  . MET A 1 111 ? 40.643 -10.686 -8.778  1.00 24.73 ? 114 MET A CG  1 
ATOM   844  S  SD  . MET A 1 111 ? 41.408 -9.057  -8.813  1.00 29.72 ? 114 MET A SD  1 
ATOM   845  C  CE  . MET A 1 111 ? 40.037 -8.089  -9.467  1.00 28.29 ? 114 MET A CE  1 
ATOM   846  N  N   . PRO A 1 112 ? 40.237 -14.743 -9.813  1.00 25.94 ? 115 PRO A N   1 
ATOM   847  C  CA  . PRO A 1 112 ? 40.178 -15.617 -10.994 1.00 24.35 ? 115 PRO A CA  1 
ATOM   848  C  C   . PRO A 1 112 ? 39.996 -14.849 -12.300 1.00 24.47 ? 115 PRO A C   1 
ATOM   849  O  O   . PRO A 1 112 ? 39.306 -13.828 -12.346 1.00 23.18 ? 115 PRO A O   1 
ATOM   850  C  CB  . PRO A 1 112 ? 38.993 -16.529 -10.706 1.00 24.17 ? 115 PRO A CB  1 
ATOM   851  C  CG  . PRO A 1 112 ? 38.109 -15.703 -9.821  1.00 25.31 ? 115 PRO A CG  1 
ATOM   852  C  CD  . PRO A 1 112 ? 39.039 -14.888 -8.966  1.00 25.69 ? 115 PRO A CD  1 
ATOM   853  N  N   . ALA A 1 113 ? 40.606 -15.357 -13.364 1.00 24.58 ? 116 ALA A N   1 
ATOM   854  C  CA  . ALA A 1 113 ? 40.505 -14.729 -14.674 1.00 26.85 ? 116 ALA A CA  1 
ATOM   855  C  C   . ALA A 1 113 ? 39.052 -14.619 -15.143 1.00 26.67 ? 116 ALA A C   1 
ATOM   856  O  O   . ALA A 1 113 ? 38.663 -13.626 -15.769 1.00 25.89 ? 116 ALA A O   1 
ATOM   857  C  CB  . ALA A 1 113 ? 41.334 -15.516 -15.691 1.00 25.77 ? 116 ALA A CB  1 
ATOM   858  N  N   . LEU A 1 114 ? 38.257 -15.640 -14.846 1.00 27.73 ? 117 LEU A N   1 
ATOM   859  C  CA  . LEU A 1 114 ? 36.817 -15.568 -15.050 1.00 28.86 ? 117 LEU A CA  1 
ATOM   860  C  C   . LEU A 1 114 ? 36.183 -15.256 -13.704 1.00 29.66 ? 117 LEU A C   1 
ATOM   861  O  O   . LEU A 1 114 ? 36.272 -16.055 -12.774 1.00 31.36 ? 117 LEU A O   1 
ATOM   862  C  CB  . LEU A 1 114 ? 36.274 -16.901 -15.570 1.00 32.13 ? 117 LEU A CB  1 
ATOM   863  C  CG  . LEU A 1 114 ? 34.744 -17.034 -15.680 1.00 34.88 ? 117 LEU A CG  1 
ATOM   864  C  CD1 . LEU A 1 114 ? 34.212 -16.108 -16.758 1.00 35.93 ? 117 LEU A CD1 1 
ATOM   865  C  CD2 . LEU A 1 114 ? 34.369 -18.474 -15.999 1.00 35.87 ? 117 LEU A CD2 1 
ATOM   866  N  N   . PRO A 1 115 ? 35.505 -14.104 -13.589 1.00 28.82 ? 118 PRO A N   1 
ATOM   867  C  CA  . PRO A 1 115 ? 35.175 -13.166 -14.661 1.00 28.98 ? 118 PRO A CA  1 
ATOM   868  C  C   . PRO A 1 115 ? 36.095 -11.942 -14.788 1.00 28.58 ? 118 PRO A C   1 
ATOM   869  O  O   . PRO A 1 115 ? 35.917 -11.127 -15.695 1.00 29.39 ? 118 PRO A O   1 
ATOM   870  C  CB  . PRO A 1 115 ? 33.755 -12.750 -14.309 1.00 28.24 ? 118 PRO A CB  1 
ATOM   871  C  CG  . PRO A 1 115 ? 33.788 -12.703 -12.812 1.00 29.81 ? 118 PRO A CG  1 
ATOM   872  C  CD  . PRO A 1 115 ? 34.805 -13.738 -12.346 1.00 30.26 ? 118 PRO A CD  1 
ATOM   873  N  N   . PHE A 1 116 ? 37.056 -11.790 -13.881 1.00 26.48 ? 119 PHE A N   1 
ATOM   874  C  CA  . PHE A 1 116 ? 37.670 -10.477 -13.678 1.00 24.82 ? 119 PHE A CA  1 
ATOM   875  C  C   . PHE A 1 116 ? 38.584 -9.959  -14.782 1.00 24.19 ? 119 PHE A C   1 
ATOM   876  O  O   . PHE A 1 116 ? 38.817 -8.758  -14.875 1.00 21.53 ? 119 PHE A O   1 
ATOM   877  C  CB  . PHE A 1 116 ? 38.388 -10.441 -12.321 1.00 23.00 ? 119 PHE A CB  1 
ATOM   878  C  CG  . PHE A 1 116 ? 37.440 -10.525 -11.156 1.00 21.72 ? 119 PHE A CG  1 
ATOM   879  C  CD1 . PHE A 1 116 ? 36.709 -9.413  -10.763 1.00 22.50 ? 119 PHE A CD1 1 
ATOM   880  C  CD2 . PHE A 1 116 ? 37.214 -11.734 -10.508 1.00 22.02 ? 119 PHE A CD2 1 
ATOM   881  C  CE1 . PHE A 1 116 ? 35.759 -9.504  -9.744  1.00 20.38 ? 119 PHE A CE1 1 
ATOM   882  C  CE2 . PHE A 1 116 ? 36.271 -11.836 -9.493  1.00 19.59 ? 119 PHE A CE2 1 
ATOM   883  C  CZ  . PHE A 1 116 ? 35.542 -10.724 -9.112  1.00 22.37 ? 119 PHE A CZ  1 
ATOM   884  N  N   . MET A 1 117 ? 39.088 -10.840 -15.639 1.00 23.17 ? 120 MET A N   1 
ATOM   885  C  CA  . MET A 1 117 ? 39.795 -10.354 -16.819 1.00 23.13 ? 120 MET A CA  1 
ATOM   886  C  C   . MET A 1 117 ? 38.840 -9.676  -17.797 1.00 24.22 ? 120 MET A C   1 
ATOM   887  O  O   . MET A 1 117 ? 39.273 -9.103  -18.793 1.00 24.65 ? 120 MET A O   1 
ATOM   888  C  CB  . MET A 1 117 ? 40.556 -11.496 -17.507 1.00 21.23 ? 120 MET A CB  1 
ATOM   889  C  CG  . MET A 1 117 ? 41.892 -11.812 -16.828 1.00 20.86 ? 120 MET A CG  1 
ATOM   890  S  SD  . MET A 1 117 ? 43.035 -10.400 -16.891 1.00 25.52 ? 120 MET A SD  1 
ATOM   891  C  CE  . MET A 1 117 ? 43.480 -10.421 -18.650 1.00 24.89 ? 120 MET A CE  1 
ATOM   892  N  N   . LEU A 1 118 ? 37.542 -9.727  -17.502 1.00 24.12 ? 121 LEU A N   1 
ATOM   893  C  CA  . LEU A 1 118 ? 36.554 -8.992  -18.291 1.00 24.39 ? 121 LEU A CA  1 
ATOM   894  C  C   . LEU A 1 118 ? 36.097 -7.713  -17.586 1.00 23.63 ? 121 LEU A C   1 
ATOM   895  O  O   . LEU A 1 118 ? 35.321 -6.943  -18.148 1.00 22.73 ? 121 LEU A O   1 
ATOM   896  C  CB  . LEU A 1 118 ? 35.323 -9.862  -18.579 1.00 24.81 ? 121 LEU A CB  1 
ATOM   897  C  CG  . LEU A 1 118 ? 35.491 -11.193 -19.316 1.00 28.19 ? 121 LEU A CG  1 
ATOM   898  C  CD1 . LEU A 1 118 ? 34.133 -11.835 -19.483 1.00 29.12 ? 121 LEU A CD1 1 
ATOM   899  C  CD2 . LEU A 1 118 ? 36.142 -10.977 -20.672 1.00 28.72 ? 121 LEU A CD2 1 
ATOM   900  N  N   . ALA A 1 119 ? 36.562 -7.492  -16.358 1.00 21.36 ? 122 ALA A N   1 
ATOM   901  C  CA  . ALA A 1 119 ? 36.118 -6.335  -15.578 1.00 23.35 ? 122 ALA A CA  1 
ATOM   902  C  C   . ALA A 1 119 ? 36.829 -5.055  -16.008 1.00 23.65 ? 122 ALA A C   1 
ATOM   903  O  O   . ALA A 1 119 ? 38.057 -5.022  -16.106 1.00 24.14 ? 122 ALA A O   1 
ATOM   904  C  CB  . ALA A 1 119 ? 36.354 -6.582  -14.090 1.00 21.34 ? 122 ALA A CB  1 
ATOM   905  N  N   . GLU A 1 120 ? 36.055 -4.003  -16.266 1.00 23.44 ? 123 GLU A N   1 
ATOM   906  C  CA  . GLU A 1 120 ? 36.630 -2.696  -16.575 1.00 24.93 ? 123 GLU A CA  1 
ATOM   907  C  C   . GLU A 1 120 ? 36.902 -1.908  -15.301 1.00 24.84 ? 123 GLU A C   1 
ATOM   908  O  O   . GLU A 1 120 ? 37.383 -0.776  -15.352 1.00 26.88 ? 123 GLU A O   1 
ATOM   909  C  CB  . GLU A 1 120 ? 35.684 -1.898  -17.474 1.00 27.76 ? 123 GLU A CB  1 
ATOM   910  C  CG  . GLU A 1 120 ? 35.500 -2.482  -18.864 1.00 30.97 ? 123 GLU A CG  1 
ATOM   911  C  CD  . GLU A 1 120 ? 36.623 -2.087  -19.796 1.00 32.41 ? 123 GLU A CD  1 
ATOM   912  O  OE1 . GLU A 1 120 ? 36.889 -0.873  -19.908 1.00 37.17 ? 123 GLU A OE1 1 
ATOM   913  O  OE2 . GLU A 1 120 ? 37.240 -2.981  -20.412 1.00 33.05 ? 123 GLU A OE2 1 
ATOM   914  N  N   . PHE A 1 121 ? 36.569 -2.507  -14.162 1.00 22.05 ? 124 PHE A N   1 
ATOM   915  C  CA  . PHE A 1 121 ? 36.717 -1.873  -12.853 1.00 21.70 ? 124 PHE A CA  1 
ATOM   916  C  C   . PHE A 1 121 ? 37.681 -2.726  -12.031 1.00 22.08 ? 124 PHE A C   1 
ATOM   917  O  O   . PHE A 1 121 ? 37.989 -3.857  -12.413 1.00 20.75 ? 124 PHE A O   1 
ATOM   918  C  CB  . PHE A 1 121 ? 35.359 -1.811  -12.145 1.00 21.28 ? 124 PHE A CB  1 
ATOM   919  C  CG  . PHE A 1 121 ? 34.615 -3.124  -12.163 1.00 22.66 ? 124 PHE A CG  1 
ATOM   920  C  CD1 . PHE A 1 121 ? 33.772 -3.441  -13.219 1.00 19.41 ? 124 PHE A CD1 1 
ATOM   921  C  CD2 . PHE A 1 121 ? 34.806 -4.057  -11.158 1.00 20.22 ? 124 PHE A CD2 1 
ATOM   922  C  CE1 . PHE A 1 121 ? 33.142 -4.668  -13.274 1.00 22.51 ? 124 PHE A CE1 1 
ATOM   923  C  CE2 . PHE A 1 121 ? 34.182 -5.291  -11.201 1.00 20.90 ? 124 PHE A CE2 1 
ATOM   924  C  CZ  . PHE A 1 121 ? 33.350 -5.600  -12.261 1.00 22.79 ? 124 PHE A CZ  1 
ATOM   925  N  N   . ASP A 1 122 ? 38.155 -2.191  -10.909 1.00 21.50 ? 125 ASP A N   1 
ATOM   926  C  CA  . ASP A 1 122 ? 39.112 -2.916  -10.073 1.00 22.32 ? 125 ASP A CA  1 
ATOM   927  C  C   . ASP A 1 122 ? 38.430 -3.679  -8.929  1.00 20.59 ? 125 ASP A C   1 
ATOM   928  O  O   . ASP A 1 122 ? 38.783 -4.820  -8.643  1.00 22.91 ? 125 ASP A O   1 
ATOM   929  C  CB  . ASP A 1 122 ? 40.147 -1.949  -9.485  1.00 23.03 ? 125 ASP A CB  1 
ATOM   930  C  CG  . ASP A 1 122 ? 40.828 -1.095  -10.549 1.00 23.06 ? 125 ASP A CG  1 
ATOM   931  O  OD1 . ASP A 1 122 ? 41.501 -1.665  -11.432 1.00 24.33 ? 125 ASP A OD1 1 
ATOM   932  O  OD2 . ASP A 1 122 ? 40.683 0.146   -10.496 1.00 20.54 ? 125 ASP A OD2 1 
ATOM   933  N  N   . GLY A 1 123 ? 37.471 -3.040  -8.269  1.00 21.02 ? 126 GLY A N   1 
ATOM   934  C  CA  . GLY A 1 123 ? 36.878 -3.623  -7.072  1.00 20.52 ? 126 GLY A CA  1 
ATOM   935  C  C   . GLY A 1 123 ? 35.384 -3.364  -6.953  1.00 21.25 ? 126 GLY A C   1 
ATOM   936  O  O   . GLY A 1 123 ? 34.739 -2.936  -7.913  1.00 22.71 ? 126 GLY A O   1 
ATOM   937  N  N   . VAL A 1 124 ? 34.814 -3.635  -5.784  1.00 20.53 ? 127 VAL A N   1 
ATOM   938  C  CA  . VAL A 1 124 ? 33.426 -3.299  -5.569  1.00 20.76 ? 127 VAL A CA  1 
ATOM   939  C  C   . VAL A 1 124 ? 33.168 -2.650  -4.215  1.00 21.33 ? 127 VAL A C   1 
ATOM   940  O  O   . VAL A 1 124 ? 33.832 -2.936  -3.224  1.00 20.20 ? 127 VAL A O   1 
ATOM   941  C  CB  . VAL A 1 124 ? 32.485 -4.533  -5.730  1.00 24.01 ? 127 VAL A CB  1 
ATOM   942  C  CG1 . VAL A 1 124 ? 33.266 -5.742  -6.212  1.00 21.65 ? 127 VAL A CG1 1 
ATOM   943  C  CG2 . VAL A 1 124 ? 31.746 -4.816  -4.427  1.00 23.19 ? 127 VAL A CG2 1 
ATOM   944  N  N   . VAL A 1 125 ? 32.195 -1.753  -4.199  1.00 19.84 ? 128 VAL A N   1 
ATOM   945  C  CA  . VAL A 1 125 ? 31.706 -1.187  -2.960  1.00 20.36 ? 128 VAL A CA  1 
ATOM   946  C  C   . VAL A 1 125 ? 30.278 -1.657  -2.766  1.00 19.72 ? 128 VAL A C   1 
ATOM   947  O  O   . VAL A 1 125 ? 29.365 -1.175  -3.438  1.00 19.58 ? 128 VAL A O   1 
ATOM   948  C  CB  . VAL A 1 125 ? 31.737 0.340   -3.018  1.00 20.24 ? 128 VAL A CB  1 
ATOM   949  C  CG1 . VAL A 1 125 ? 31.053 0.924   -1.797  1.00 22.15 ? 128 VAL A CG1 1 
ATOM   950  C  CG2 . VAL A 1 125 ? 33.163 0.806   -3.101  1.00 18.99 ? 128 VAL A CG2 1 
ATOM   951  N  N   . GLY A 1 126 ? 30.094 -2.612  -1.857  1.00 20.91 ? 129 GLY A N   1 
ATOM   952  C  CA  . GLY A 1 126 ? 28.767 -3.155  -1.616  1.00 21.43 ? 129 GLY A CA  1 
ATOM   953  C  C   . GLY A 1 126 ? 27.878 -2.155  -0.896  1.00 23.33 ? 129 GLY A C   1 
ATOM   954  O  O   . GLY A 1 126 ? 28.243 -1.637  0.152   1.00 24.50 ? 129 GLY A O   1 
ATOM   955  N  N   . MET A 1 127 ? 26.708 -1.885  -1.467  1.00 23.74 ? 130 MET A N   1 
ATOM   956  C  CA  . MET A 1 127 ? 25.770 -0.926  -0.900  1.00 23.27 ? 130 MET A CA  1 
ATOM   957  C  C   . MET A 1 127 ? 24.625 -1.638  -0.181  1.00 23.65 ? 130 MET A C   1 
ATOM   958  O  O   . MET A 1 127 ? 23.619 -1.021  0.164   1.00 24.51 ? 130 MET A O   1 
ATOM   959  C  CB  . MET A 1 127 ? 25.208 -0.034  -2.006  1.00 21.59 ? 130 MET A CB  1 
ATOM   960  C  CG  . MET A 1 127 ? 26.273 0.778   -2.729  1.00 26.14 ? 130 MET A CG  1 
ATOM   961  S  SD  . MET A 1 127 ? 27.178 1.885   -1.628  1.00 30.07 ? 130 MET A SD  1 
ATOM   962  C  CE  . MET A 1 127 ? 25.957 3.167   -1.365  1.00 27.57 ? 130 MET A CE  1 
ATOM   963  N  N   . GLY A 1 128 ? 24.782 -2.942  0.031   1.00 24.58 ? 131 GLY A N   1 
ATOM   964  C  CA  . GLY A 1 128 ? 23.783 -3.702  0.764   1.00 23.34 ? 131 GLY A CA  1 
ATOM   965  C  C   . GLY A 1 128 ? 23.878 -3.524  2.273   1.00 24.03 ? 131 GLY A C   1 
ATOM   966  O  O   . GLY A 1 128 ? 24.655 -2.698  2.764   1.00 23.25 ? 131 GLY A O   1 
ATOM   967  N  N   . PHE A 1 129 ? 23.090 -4.316  2.999   1.00 21.89 ? 132 PHE A N   1 
ATOM   968  C  CA  . PHE A 1 129 ? 22.960 -4.213  4.449   1.00 23.22 ? 132 PHE A CA  1 
ATOM   969  C  C   . PHE A 1 129 ? 24.008 -5.073  5.151   1.00 24.42 ? 132 PHE A C   1 
ATOM   970  O  O   . PHE A 1 129 ? 24.546 -6.019  4.568   1.00 23.29 ? 132 PHE A O   1 
ATOM   971  C  CB  . PHE A 1 129 ? 21.582 -4.700  4.901   1.00 22.02 ? 132 PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 129 ? 20.428 -3.877  4.394   1.00 26.84 ? 132 PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 129 ? 20.038 -3.941  3.060   1.00 24.92 ? 132 PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 129 ? 19.674 -3.105  5.273   1.00 24.57 ? 132 PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 129 ? 18.909 -3.256  2.617   1.00 26.42 ? 132 PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 129 ? 18.550 -2.423  4.836   1.00 25.24 ? 132 PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 129 ? 18.164 -2.499  3.508   1.00 26.61 ? 132 PHE A CZ  1 
ATOM   978  N  N   . ILE A 1 130 ? 24.265 -4.765  6.416   1.00 24.36 ? 133 ILE A N   1 
ATOM   979  C  CA  . ILE A 1 130 ? 25.250 -5.513  7.187   1.00 28.07 ? 133 ILE A CA  1 
ATOM   980  C  C   . ILE A 1 130 ? 24.842 -6.984  7.303   1.00 29.19 ? 133 ILE A C   1 
ATOM   981  O  O   . ILE A 1 130 ? 25.687 -7.855  7.500   1.00 31.37 ? 133 ILE A O   1 
ATOM   982  C  CB  . ILE A 1 130 ? 25.414 -4.921  8.606   1.00 27.42 ? 133 ILE A CB  1 
ATOM   983  C  CG1 . ILE A 1 130 ? 26.650 -5.518  9.285   1.00 29.80 ? 133 ILE A CG1 1 
ATOM   984  C  CG2 . ILE A 1 130 ? 24.171 -5.212  9.440   1.00 28.33 ? 133 ILE A CG2 1 
ATOM   985  C  CD1 . ILE A 1 130 ? 27.126 -4.720  10.501  1.00 29.90 ? 133 ILE A CD1 1 
ATOM   986  N  N   . GLU A 1 131 ? 23.547 -7.257  7.175   1.00 29.28 ? 134 GLU A N   1 
ATOM   987  C  CA  . GLU A 1 131 ? 23.050 -8.624  7.219   1.00 30.73 ? 134 GLU A CA  1 
ATOM   988  C  C   . GLU A 1 131 ? 23.691 -9.499  6.130   1.00 30.78 ? 134 GLU A C   1 
ATOM   989  O  O   . GLU A 1 131 ? 23.830 -10.704 6.304   1.00 31.56 ? 134 GLU A O   1 
ATOM   990  C  CB  . GLU A 1 131 ? 21.519 -8.639  7.068   1.00 32.61 ? 134 GLU A CB  1 
ATOM   991  C  CG  . GLU A 1 131 ? 20.730 -8.332  8.351   1.00 33.62 ? 134 GLU A CG  1 
ATOM   992  C  CD  . GLU A 1 131 ? 20.519 -6.842  8.601   1.00 36.23 ? 134 GLU A CD  1 
ATOM   993  O  OE1 . GLU A 1 131 ? 21.262 -6.018  8.019   1.00 32.32 ? 134 GLU A OE1 1 
ATOM   994  O  OE2 . GLU A 1 131 ? 19.602 -6.499  9.386   1.00 35.76 ? 134 GLU A OE2 1 
ATOM   995  N  N   . GLN A 1 132 ? 24.086 -8.895  5.014   1.00 29.77 ? 135 GLN A N   1 
ATOM   996  C  CA  . GLN A 1 132 ? 24.679 -9.652  3.914   1.00 30.50 ? 135 GLN A CA  1 
ATOM   997  C  C   . GLN A 1 132 ? 26.201 -9.563  3.910   1.00 29.85 ? 135 GLN A C   1 
ATOM   998  O  O   . GLN A 1 132 ? 26.867 -10.182 3.077   1.00 28.48 ? 135 GLN A O   1 
ATOM   999  C  CB  . GLN A 1 132 ? 24.146 -9.147  2.568   1.00 33.41 ? 135 GLN A CB  1 
ATOM   1000 C  CG  . GLN A 1 132 ? 22.627 -9.005  2.506   1.00 37.45 ? 135 GLN A CG  1 
ATOM   1001 C  CD  . GLN A 1 132 ? 22.176 -8.028  1.428   1.00 40.78 ? 135 GLN A CD  1 
ATOM   1002 O  OE1 . GLN A 1 132 ? 21.894 -8.426  0.292   1.00 43.97 ? 135 GLN A OE1 1 
ATOM   1003 N  NE2 . GLN A 1 132 ? 22.107 -6.742  1.777   1.00 37.16 ? 135 GLN A NE2 1 
ATOM   1004 N  N   . ALA A 1 133 ? 26.758 -8.782  4.829   1.00 28.06 ? 136 ALA A N   1 
ATOM   1005 C  CA  . ALA A 1 133 ? 28.204 -8.602  4.857   1.00 28.57 ? 136 ALA A CA  1 
ATOM   1006 C  C   . ALA A 1 133 ? 28.882 -9.883  5.325   1.00 27.76 ? 136 ALA A C   1 
ATOM   1007 O  O   . ALA A 1 133 ? 28.550 -10.421 6.377   1.00 30.43 ? 136 ALA A O   1 
ATOM   1008 C  CB  . ALA A 1 133 ? 28.575 -7.448  5.774   1.00 24.14 ? 136 ALA A CB  1 
ATOM   1009 N  N   . ILE A 1 134 ? 29.827 -10.377 4.535   1.00 27.28 ? 137 ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 134 ? 30.644 -11.499 4.966   1.00 28.68 ? 137 ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 134 ? 31.625 -11.013 6.032   1.00 29.83 ? 137 ILE A C   1 
ATOM   1012 O  O   . ILE A 1 134 ? 32.195 -9.927  5.911   1.00 30.26 ? 137 ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 134 ? 31.435 -12.096 3.789   1.00 27.35 ? 137 ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 134 ? 30.474 -12.544 2.687   1.00 26.46 ? 137 ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 134 ? 32.277 -13.265 4.268   1.00 26.82 ? 137 ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 134 ? 29.346 -13.439 3.172   1.00 27.18 ? 137 ILE A CD1 1 
ATOM   1017 N  N   . GLY A 1 135 ? 31.812 -11.812 7.081   1.00 32.44 ? 138 GLY A N   1 
ATOM   1018 C  CA  . GLY A 1 135 ? 32.723 -11.431 8.151   1.00 34.56 ? 138 GLY A CA  1 
ATOM   1019 C  C   . GLY A 1 135 ? 32.122 -10.375 9.061   1.00 37.38 ? 138 GLY A C   1 
ATOM   1020 O  O   . GLY A 1 135 ? 32.809 -9.801  9.906   1.00 39.78 ? 138 GLY A O   1 
ATOM   1021 N  N   . ARG A 1 136 ? 30.829 -10.129 8.885   1.00 37.27 ? 139 ARG A N   1 
ATOM   1022 C  CA  . ARG A 1 136 ? 30.135 -9.011  9.516   1.00 38.17 ? 139 ARG A CA  1 
ATOM   1023 C  C   . ARG A 1 136 ? 30.954 -7.728  9.602   1.00 35.81 ? 139 ARG A C   1 
ATOM   1024 O  O   . ARG A 1 136 ? 30.955 -7.045  10.625  1.00 36.39 ? 139 ARG A O   1 
ATOM   1025 C  CB  . ARG A 1 136 ? 29.629 -9.400  10.909  1.00 41.75 ? 139 ARG A CB  1 
ATOM   1026 C  CG  . ARG A 1 136 ? 30.698 -9.829  11.892  1.00 47.03 ? 139 ARG A CG  1 
ATOM   1027 C  CD  . ARG A 1 136 ? 30.119 -9.928  13.298  1.00 52.10 ? 139 ARG A CD  1 
ATOM   1028 N  NE  . ARG A 1 136 ? 30.958 -10.741 14.172  1.00 54.84 ? 139 ARG A NE  1 
ATOM   1029 C  CZ  . ARG A 1 136 ? 30.876 -12.065 14.259  1.00 56.53 ? 139 ARG A CZ  1 
ATOM   1030 N  NH1 . ARG A 1 136 ? 29.989 -12.727 13.525  1.00 54.87 ? 139 ARG A NH1 1 
ATOM   1031 N  NH2 . ARG A 1 136 ? 31.688 -12.727 15.077  1.00 57.43 ? 139 ARG A NH2 1 
ATOM   1032 N  N   . VAL A 1 137 ? 31.642 -7.396  8.519   1.00 31.30 ? 140 VAL A N   1 
ATOM   1033 C  CA  . VAL A 1 137 ? 32.260 -6.085  8.407   1.00 30.28 ? 140 VAL A CA  1 
ATOM   1034 C  C   . VAL A 1 137 ? 31.164 -5.046  8.194   1.00 28.45 ? 140 VAL A C   1 
ATOM   1035 O  O   . VAL A 1 137 ? 30.264 -5.246  7.373   1.00 25.79 ? 140 VAL A O   1 
ATOM   1036 C  CB  . VAL A 1 137 ? 33.242 -6.031  7.218   1.00 29.62 ? 140 VAL A CB  1 
ATOM   1037 C  CG1 . VAL A 1 137 ? 33.800 -4.625  7.065   1.00 29.30 ? 140 VAL A CG1 1 
ATOM   1038 C  CG2 . VAL A 1 137 ? 34.353 -7.032  7.429   1.00 31.19 ? 140 VAL A CG2 1 
ATOM   1039 N  N   . THR A 1 138 ? 31.236 -3.945  8.938   1.00 27.51 ? 141 THR A N   1 
ATOM   1040 C  CA  . THR A 1 138 ? 30.244 -2.885  8.817   1.00 28.07 ? 141 THR A CA  1 
ATOM   1041 C  C   . THR A 1 138 ? 30.333 -2.261  7.434   1.00 27.47 ? 141 THR A C   1 
ATOM   1042 O  O   . THR A 1 138 ? 31.367 -1.723  7.053   1.00 27.57 ? 141 THR A O   1 
ATOM   1043 C  CB  . THR A 1 138 ? 30.464 -1.774  9.863   1.00 29.21 ? 141 THR A CB  1 
ATOM   1044 O  OG1 . THR A 1 138 ? 30.520 -2.356  11.170  1.00 28.44 ? 141 THR A OG1 1 
ATOM   1045 C  CG2 . THR A 1 138 ? 29.311 -0.760  9.814   1.00 26.76 ? 141 THR A CG2 1 
ATOM   1046 N  N   . PRO A 1 139 ? 29.243 -2.333  6.664   1.00 27.16 ? 142 PRO A N   1 
ATOM   1047 C  CA  . PRO A 1 139 ? 29.209 -1.762  5.313   1.00 27.37 ? 142 PRO A CA  1 
ATOM   1048 C  C   . PRO A 1 139 ? 29.535 -0.278  5.318   1.00 27.24 ? 142 PRO A C   1 
ATOM   1049 O  O   . PRO A 1 139 ? 29.318 0.416   6.313   1.00 27.25 ? 142 PRO A O   1 
ATOM   1050 C  CB  . PRO A 1 139 ? 27.781 -2.021  4.840   1.00 27.09 ? 142 PRO A CB  1 
ATOM   1051 C  CG  . PRO A 1 139 ? 27.316 -3.178  5.673   1.00 30.63 ? 142 PRO A CG  1 
ATOM   1052 C  CD  . PRO A 1 139 ? 27.985 -3.015  7.009   1.00 27.02 ? 142 PRO A CD  1 
ATOM   1053 N  N   . ILE A 1 140 ? 30.046 0.207   4.194   1.00 26.08 ? 143 ILE A N   1 
ATOM   1054 C  CA  . ILE A 1 140 ? 30.483 1.580   4.114   1.00 27.02 ? 143 ILE A CA  1 
ATOM   1055 C  C   . ILE A 1 140 ? 29.328 2.574   4.301   1.00 27.39 ? 143 ILE A C   1 
ATOM   1056 O  O   . ILE A 1 140 ? 29.501 3.589   4.965   1.00 27.82 ? 143 ILE A O   1 
ATOM   1057 C  CB  . ILE A 1 140 ? 31.240 1.837   2.775   1.00 25.95 ? 143 ILE A CB  1 
ATOM   1058 C  CG1 . ILE A 1 140 ? 31.758 3.276   2.735   1.00 27.12 ? 143 ILE A CG1 1 
ATOM   1059 C  CG2 . ILE A 1 140 ? 30.342 1.525   1.591   1.00 25.71 ? 143 ILE A CG2 1 
ATOM   1060 C  CD1 . ILE A 1 140 ? 32.933 3.489   1.787   1.00 24.50 ? 143 ILE A CD1 1 
ATOM   1061 N  N   . PHE A 1 141 ? 28.147 2.288   3.757   1.00 28.42 ? 144 PHE A N   1 
ATOM   1062 C  CA  . PHE A 1 141 ? 27.048 3.237   3.914   1.00 30.37 ? 144 PHE A CA  1 
ATOM   1063 C  C   . PHE A 1 141 ? 26.607 3.338   5.368   1.00 31.63 ? 144 PHE A C   1 
ATOM   1064 O  O   . PHE A 1 141 ? 26.163 4.393   5.809   1.00 31.71 ? 144 PHE A O   1 
ATOM   1065 C  CB  . PHE A 1 141 ? 25.838 2.871   3.042   1.00 29.83 ? 144 PHE A CB  1 
ATOM   1066 C  CG  . PHE A 1 141 ? 24.848 4.003   2.890   1.00 27.18 ? 144 PHE A CG  1 
ATOM   1067 C  CD1 . PHE A 1 141 ? 25.180 5.132   2.160   1.00 26.75 ? 144 PHE A CD1 1 
ATOM   1068 C  CD2 . PHE A 1 141 ? 23.613 3.959   3.512   1.00 27.15 ? 144 PHE A CD2 1 
ATOM   1069 C  CE1 . PHE A 1 141 ? 24.301 6.197   2.058   1.00 28.31 ? 144 PHE A CE1 1 
ATOM   1070 C  CE2 . PHE A 1 141 ? 22.730 5.019   3.413   1.00 26.46 ? 144 PHE A CE2 1 
ATOM   1071 C  CZ  . PHE A 1 141 ? 23.073 6.138   2.688   1.00 27.37 ? 144 PHE A CZ  1 
ATOM   1072 N  N   . ASP A 1 142 ? 26.733 2.236   6.103   1.00 33.08 ? 145 ASP A N   1 
ATOM   1073 C  CA  . ASP A 1 142 ? 26.450 2.226   7.534   1.00 33.67 ? 145 ASP A CA  1 
ATOM   1074 C  C   . ASP A 1 142 ? 27.417 3.142   8.268   1.00 33.91 ? 145 ASP A C   1 
ATOM   1075 O  O   . ASP A 1 142 ? 27.013 3.896   9.156   1.00 33.40 ? 145 ASP A O   1 
ATOM   1076 C  CB  . ASP A 1 142 ? 26.573 0.808   8.102   1.00 36.87 ? 145 ASP A CB  1 
ATOM   1077 C  CG  . ASP A 1 142 ? 25.428 -0.094  7.684   1.00 37.82 ? 145 ASP A CG  1 
ATOM   1078 O  OD1 . ASP A 1 142 ? 24.973 0.005   6.526   1.00 42.93 ? 145 ASP A OD1 1 
ATOM   1079 O  OD2 . ASP A 1 142 ? 24.982 -0.905  8.516   1.00 39.72 ? 145 ASP A OD2 1 
ATOM   1080 N  N   . ASN A 1 143 ? 28.695 3.079   7.896   1.00 32.72 ? 146 ASN A N   1 
ATOM   1081 C  CA  . ASN A 1 143 ? 29.698 3.964   8.479   1.00 33.58 ? 146 ASN A CA  1 
ATOM   1082 C  C   . ASN A 1 143 ? 29.462 5.423   8.109   1.00 33.24 ? 146 ASN A C   1 
ATOM   1083 O  O   . ASN A 1 143 ? 29.746 6.323   8.901   1.00 35.03 ? 146 ASN A O   1 
ATOM   1084 C  CB  . ASN A 1 143 ? 31.107 3.551   8.047   1.00 33.23 ? 146 ASN A CB  1 
ATOM   1085 C  CG  . ASN A 1 143 ? 31.655 2.394   8.866   1.00 32.04 ? 146 ASN A CG  1 
ATOM   1086 O  OD1 . ASN A 1 143 ? 31.363 2.264   10.055  1.00 32.18 ? 146 ASN A OD1 1 
ATOM   1087 N  ND2 . ASN A 1 143 ? 32.451 1.547   8.230   1.00 30.16 ? 146 ASN A ND2 1 
ATOM   1088 N  N   . ILE A 1 144 ? 28.944 5.666   6.911   1.00 33.74 ? 147 ILE A N   1 
ATOM   1089 C  CA  . ILE A 1 144 ? 28.630 7.029   6.504   1.00 34.72 ? 147 ILE A CA  1 
ATOM   1090 C  C   . ILE A 1 144 ? 27.424 7.582   7.259   1.00 35.88 ? 147 ILE A C   1 
ATOM   1091 O  O   . ILE A 1 144 ? 27.450 8.720   7.724   1.00 38.70 ? 147 ILE A O   1 
ATOM   1092 C  CB  . ILE A 1 144 ? 28.357 7.120   4.992   1.00 33.73 ? 147 ILE A CB  1 
ATOM   1093 C  CG1 . ILE A 1 144 ? 29.636 6.804   4.214   1.00 32.00 ? 147 ILE A CG1 1 
ATOM   1094 C  CG2 . ILE A 1 144 ? 27.858 8.511   4.641   1.00 33.52 ? 147 ILE A CG2 1 
ATOM   1095 C  CD1 . ILE A 1 144 ? 29.489 6.946   2.720   1.00 34.03 ? 147 ILE A CD1 1 
ATOM   1096 N  N   . ILE A 1 145 ? 26.374 6.779   7.390   1.00 36.58 ? 148 ILE A N   1 
ATOM   1097 C  CA  . ILE A 1 145 ? 25.233 7.166   8.211   1.00 38.21 ? 148 ILE A CA  1 
ATOM   1098 C  C   . ILE A 1 145 ? 25.690 7.526   9.625   1.00 39.97 ? 148 ILE A C   1 
ATOM   1099 O  O   . ILE A 1 145 ? 25.202 8.488   10.213  1.00 39.93 ? 148 ILE A O   1 
ATOM   1100 C  CB  . ILE A 1 145 ? 24.186 6.027   8.301   1.00 38.54 ? 148 ILE A CB  1 
ATOM   1101 C  CG1 . ILE A 1 145 ? 23.484 5.855   6.952   1.00 38.85 ? 148 ILE A CG1 1 
ATOM   1102 C  CG2 . ILE A 1 145 ? 23.177 6.325   9.406   1.00 37.77 ? 148 ILE A CG2 1 
ATOM   1103 C  CD1 . ILE A 1 145 ? 22.396 4.797   6.959   1.00 36.47 ? 148 ILE A CD1 1 
ATOM   1104 N  N   . SER A 1 146 ? 26.633 6.754   10.161  1.00 40.73 ? 149 SER A N   1 
ATOM   1105 C  CA  . SER A 1 146 ? 27.143 6.991   11.505  1.00 41.87 ? 149 SER A CA  1 
ATOM   1106 C  C   . SER A 1 146 ? 27.754 8.373   11.638  1.00 43.32 ? 149 SER A C   1 
ATOM   1107 O  O   . SER A 1 146 ? 27.805 8.924   12.735  1.00 44.44 ? 149 SER A O   1 
ATOM   1108 C  CB  . SER A 1 146 ? 28.199 5.946   11.885  1.00 40.18 ? 149 SER A CB  1 
ATOM   1109 O  OG  . SER A 1 146 ? 27.596 4.759   12.366  1.00 41.25 ? 149 SER A OG  1 
ATOM   1110 N  N   . GLN A 1 147 ? 28.224 8.930   10.528  1.00 44.31 ? 150 GLN A N   1 
ATOM   1111 C  CA  . GLN A 1 147 ? 28.865 10.241  10.559  1.00 46.64 ? 150 GLN A CA  1 
ATOM   1112 C  C   . GLN A 1 147 ? 27.853 11.359  10.815  1.00 47.17 ? 150 GLN A C   1 
ATOM   1113 O  O   . GLN A 1 147 ? 28.196 12.408  11.358  1.00 47.43 ? 150 GLN A O   1 
ATOM   1114 C  CB  . GLN A 1 147 ? 29.609 10.510  9.243   1.00 46.58 ? 150 GLN A CB  1 
ATOM   1115 C  CG  . GLN A 1 147 ? 30.877 9.682   9.055   1.00 47.69 ? 150 GLN A CG  1 
ATOM   1116 C  CD  . GLN A 1 147 ? 31.814 10.262  8.002   1.00 48.19 ? 150 GLN A CD  1 
ATOM   1117 O  OE1 . GLN A 1 147 ? 32.908 9.745   7.778   1.00 49.51 ? 150 GLN A OE1 1 
ATOM   1118 N  NE2 . GLN A 1 147 ? 31.389 11.341  7.354   1.00 49.41 ? 150 GLN A NE2 1 
ATOM   1119 N  N   . GLY A 1 148 ? 26.606 11.131  10.421  1.00 48.42 ? 151 GLY A N   1 
ATOM   1120 C  CA  . GLY A 1 148 ? 25.581 12.143  10.607  1.00 49.58 ? 151 GLY A CA  1 
ATOM   1121 C  C   . GLY A 1 148 ? 25.806 13.376  9.749   1.00 49.38 ? 151 GLY A C   1 
ATOM   1122 O  O   . GLY A 1 148 ? 25.526 14.499  10.173  1.00 50.44 ? 151 GLY A O   1 
ATOM   1123 N  N   . VAL A 1 149 ? 26.317 13.171  8.540   1.00 47.92 ? 152 VAL A N   1 
ATOM   1124 C  CA  . VAL A 1 149 ? 26.560 14.272  7.618   1.00 46.91 ? 152 VAL A CA  1 
ATOM   1125 C  C   . VAL A 1 149 ? 25.482 14.342  6.534   1.00 46.16 ? 152 VAL A C   1 
ATOM   1126 O  O   . VAL A 1 149 ? 25.283 15.387  5.910   1.00 46.29 ? 152 VAL A O   1 
ATOM   1127 C  CB  . VAL A 1 149 ? 27.942 14.128  6.945   1.00 47.19 ? 152 VAL A CB  1 
ATOM   1128 C  CG1 . VAL A 1 149 ? 29.037 14.188  7.994   1.00 48.43 ? 152 VAL A CG1 1 
ATOM   1129 C  CG2 . VAL A 1 149 ? 28.017 12.809  6.191   1.00 46.82 ? 152 VAL A CG2 1 
ATOM   1130 N  N   . LEU A 1 150 ? 24.784 13.229  6.321   1.00 44.35 ? 153 LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 150 ? 23.831 13.114  5.221   1.00 43.35 ? 153 LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 150 ? 22.514 13.838  5.500   1.00 43.01 ? 153 LEU A C   1 
ATOM   1133 O  O   . LEU A 1 150 ? 21.933 13.698  6.577   1.00 42.84 ? 153 LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 150 ? 23.541 11.637  4.927   1.00 42.76 ? 153 LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 150 ? 24.698 10.782  4.403   1.00 42.79 ? 153 LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 150 ? 24.260 9.331   4.328   1.00 42.39 ? 153 LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 150 ? 25.142 11.283  3.035   1.00 41.43 ? 153 LEU A CD2 1 
ATOM   1138 N  N   . LYS A 1 151 ? 22.046 14.599  4.515   1.00 42.29 ? 154 LYS A N   1 
ATOM   1139 C  CA  . LYS A 1 151 ? 20.741 15.247  4.589   1.00 42.56 ? 154 LYS A CA  1 
ATOM   1140 C  C   . LYS A 1 151 ? 19.653 14.211  4.863   1.00 41.95 ? 154 LYS A C   1 
ATOM   1141 O  O   . LYS A 1 151 ? 18.774 14.418  5.702   1.00 39.79 ? 154 LYS A O   1 
ATOM   1142 C  CB  . LYS A 1 151 ? 20.443 15.973  3.273   1.00 44.12 ? 154 LYS A CB  1 
ATOM   1143 C  CG  . LYS A 1 151 ? 19.064 16.609  3.207   1.00 46.82 ? 154 LYS A CG  1 
ATOM   1144 C  CD  . LYS A 1 151 ? 18.922 17.502  1.982   1.00 50.38 ? 154 LYS A CD  1 
ATOM   1145 C  CE  . LYS A 1 151 ? 19.034 16.705  0.689   1.00 53.00 ? 154 LYS A CE  1 
ATOM   1146 N  NZ  . LYS A 1 151 ? 19.060 17.590  -0.517  1.00 54.20 ? 154 LYS A NZ  1 
ATOM   1147 N  N   . GLU A 1 152 ? 19.723 13.095  4.145   1.00 41.33 ? 155 GLU A N   1 
ATOM   1148 C  CA  . GLU A 1 152 ? 18.812 11.980  4.363   1.00 40.62 ? 155 GLU A CA  1 
ATOM   1149 C  C   . GLU A 1 152 ? 19.569 10.660  4.249   1.00 39.11 ? 155 GLU A C   1 
ATOM   1150 O  O   . GLU A 1 152 ? 20.553 10.559  3.506   1.00 39.27 ? 155 GLU A O   1 
ATOM   1151 C  CB  . GLU A 1 152 ? 17.677 12.021  3.337   1.00 43.08 ? 155 GLU A CB  1 
ATOM   1152 C  CG  . GLU A 1 152 ? 16.821 13.267  3.427   1.00 48.84 ? 155 GLU A CG  1 
ATOM   1153 C  CD  . GLU A 1 152 ? 16.158 13.412  4.785   1.00 52.45 ? 155 GLU A CD  1 
ATOM   1154 O  OE1 . GLU A 1 152 ? 16.032 12.390  5.496   1.00 54.84 ? 155 GLU A OE1 1 
ATOM   1155 O  OE2 . GLU A 1 152 ? 15.763 14.545  5.143   1.00 54.05 ? 155 GLU A OE2 1 
ATOM   1156 N  N   . ASP A 1 153 ? 19.112 9.654   4.988   1.00 34.75 ? 156 ASP A N   1 
ATOM   1157 C  CA  . ASP A 1 153 ? 19.755 8.353   4.965   1.00 34.00 ? 156 ASP A CA  1 
ATOM   1158 C  C   . ASP A 1 153 ? 19.247 7.532   3.793   1.00 33.14 ? 156 ASP A C   1 
ATOM   1159 O  O   . ASP A 1 153 ? 18.614 6.488   3.966   1.00 31.66 ? 156 ASP A O   1 
ATOM   1160 C  CB  . ASP A 1 153 ? 19.519 7.630   6.289   1.00 35.53 ? 156 ASP A CB  1 
ATOM   1161 C  CG  . ASP A 1 153 ? 20.303 8.257   7.427   1.00 35.84 ? 156 ASP A CG  1 
ATOM   1162 O  OD1 . ASP A 1 153 ? 21.115 9.171   7.158   1.00 36.69 ? 156 ASP A OD1 1 
ATOM   1163 O  OD2 . ASP A 1 153 ? 20.118 7.842   8.583   1.00 34.86 ? 156 ASP A OD2 1 
ATOM   1164 N  N   . VAL A 1 154 ? 19.531 8.042   2.598   1.00 30.27 ? 157 VAL A N   1 
ATOM   1165 C  CA  . VAL A 1 154 ? 19.173 7.396   1.343   1.00 30.99 ? 157 VAL A CA  1 
ATOM   1166 C  C   . VAL A 1 154 ? 20.348 7.551   0.383   1.00 28.53 ? 157 VAL A C   1 
ATOM   1167 O  O   . VAL A 1 154 ? 21.200 8.424   0.570   1.00 30.00 ? 157 VAL A O   1 
ATOM   1168 C  CB  . VAL A 1 154 ? 17.935 8.068   0.690   1.00 29.72 ? 157 VAL A CB  1 
ATOM   1169 C  CG1 . VAL A 1 154 ? 16.741 8.011   1.633   1.00 31.81 ? 157 VAL A CG1 1 
ATOM   1170 C  CG2 . VAL A 1 154 ? 18.262 9.506   0.335   1.00 31.70 ? 157 VAL A CG2 1 
ATOM   1171 N  N   . PHE A 1 155 ? 20.395 6.706   -0.638  1.00 25.54 ? 158 PHE A N   1 
ATOM   1172 C  CA  . PHE A 1 155 ? 21.271 6.951   -1.778  1.00 25.58 ? 158 PHE A CA  1 
ATOM   1173 C  C   . PHE A 1 155 ? 20.557 6.567   -3.060  1.00 24.09 ? 158 PHE A C   1 
ATOM   1174 O  O   . PHE A 1 155 ? 19.621 5.765   -3.032  1.00 26.93 ? 158 PHE A O   1 
ATOM   1175 C  CB  . PHE A 1 155 ? 22.593 6.179   -1.634  1.00 25.49 ? 158 PHE A CB  1 
ATOM   1176 C  CG  . PHE A 1 155 ? 22.426 4.695   -1.484  1.00 23.09 ? 158 PHE A CG  1 
ATOM   1177 C  CD1 . PHE A 1 155 ? 22.302 3.882   -2.601  1.00 20.60 ? 158 PHE A CD1 1 
ATOM   1178 C  CD2 . PHE A 1 155 ? 22.405 4.113   -0.227  1.00 21.14 ? 158 PHE A CD2 1 
ATOM   1179 C  CE1 . PHE A 1 155 ? 22.160 2.508   -2.471  1.00 22.77 ? 158 PHE A CE1 1 
ATOM   1180 C  CE2 . PHE A 1 155 ? 22.262 2.737   -0.087  1.00 24.91 ? 158 PHE A CE2 1 
ATOM   1181 C  CZ  . PHE A 1 155 ? 22.139 1.932   -1.216  1.00 21.88 ? 158 PHE A CZ  1 
ATOM   1182 N  N   . SER A 1 156 ? 20.969 7.149   -4.183  1.00 23.31 ? 159 SER A N   1 
ATOM   1183 C  CA  . SER A 1 156 ? 20.238 6.938   -5.433  1.00 24.48 ? 159 SER A CA  1 
ATOM   1184 C  C   . SER A 1 156 ? 21.119 6.733   -6.656  1.00 24.29 ? 159 SER A C   1 
ATOM   1185 O  O   . SER A 1 156 ? 22.251 7.226   -6.714  1.00 24.81 ? 159 SER A O   1 
ATOM   1186 C  CB  . SER A 1 156 ? 19.292 8.114   -5.685  1.00 25.49 ? 159 SER A CB  1 
ATOM   1187 O  OG  . SER A 1 156 ? 20.009 9.335   -5.737  1.00 26.64 ? 159 SER A OG  1 
ATOM   1188 N  N   . PHE A 1 157 ? 20.589 6.007   -7.636  1.00 24.70 ? 160 PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 157 ? 21.328 5.690   -8.853  1.00 25.67 ? 160 PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 157 ? 20.681 6.253   -10.109 1.00 26.81 ? 160 PHE A C   1 
ATOM   1191 O  O   . PHE A 1 157 ? 19.485 6.085   -10.341 1.00 26.33 ? 160 PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 157 ? 21.458 4.176   -9.026  1.00 24.98 ? 160 PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 157 ? 22.530 3.558   -8.183  1.00 25.09 ? 160 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 157 ? 22.443 3.582   -6.800  1.00 23.08 ? 160 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 157 ? 23.626 2.936   -8.778  1.00 26.00 ? 160 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 157 ? 23.430 2.997   -6.018  1.00 25.12 ? 160 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 157 ? 24.617 2.347   -8.001  1.00 26.06 ? 160 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 157 ? 24.518 2.379   -6.620  1.00 24.38 ? 160 PHE A CZ  1 
ATOM   1199 N  N   . TYR A 1 158 ? 21.493 6.910   -10.925 1.00 27.88 ? 161 TYR A N   1 
ATOM   1200 C  CA  . TYR A 1 158 ? 21.122 7.200   -12.299 1.00 27.66 ? 161 TYR A CA  1 
ATOM   1201 C  C   . TYR A 1 158 ? 22.093 6.456   -13.211 1.00 27.22 ? 161 TYR A C   1 
ATOM   1202 O  O   . TYR A 1 158 ? 23.308 6.633   -13.117 1.00 27.45 ? 161 TYR A O   1 
ATOM   1203 C  CB  . TYR A 1 158 ? 21.193 8.709   -12.540 1.00 30.35 ? 161 TYR A CB  1 
ATOM   1204 C  CG  . TYR A 1 158 ? 21.074 9.111   -13.988 1.00 31.82 ? 161 TYR A CG  1 
ATOM   1205 C  CD1 . TYR A 1 158 ? 19.911 8.856   -14.706 1.00 32.39 ? 161 TYR A CD1 1 
ATOM   1206 C  CD2 . TYR A 1 158 ? 22.133 9.722   -14.645 1.00 31.95 ? 161 TYR A CD2 1 
ATOM   1207 C  CE1 . TYR A 1 158 ? 19.813 9.189   -16.039 1.00 35.30 ? 161 TYR A CE1 1 
ATOM   1208 C  CE2 . TYR A 1 158 ? 22.042 10.063  -15.974 1.00 32.84 ? 161 TYR A CE2 1 
ATOM   1209 C  CZ  . TYR A 1 158 ? 20.883 9.791   -16.667 1.00 32.32 ? 161 TYR A CZ  1 
ATOM   1210 O  OH  . TYR A 1 158 ? 20.803 10.096  -17.999 1.00 35.70 ? 161 TYR A OH  1 
ATOM   1211 N  N   . TYR A 1 159 ? 21.557 5.589   -14.060 1.00 25.99 ? 162 TYR A N   1 
ATOM   1212 C  CA  . TYR A 1 159 ? 22.352 4.937   -15.089 1.00 27.62 ? 162 TYR A CA  1 
ATOM   1213 C  C   . TYR A 1 159 ? 21.865 5.519   -16.402 1.00 29.09 ? 162 TYR A C   1 
ATOM   1214 O  O   . TYR A 1 159 ? 20.661 5.601   -16.631 1.00 28.28 ? 162 TYR A O   1 
ATOM   1215 C  CB  . TYR A 1 159 ? 22.123 3.420   -15.083 1.00 26.71 ? 162 TYR A CB  1 
ATOM   1216 C  CG  . TYR A 1 159 ? 22.886 2.637   -14.026 1.00 24.78 ? 162 TYR A CG  1 
ATOM   1217 C  CD1 . TYR A 1 159 ? 23.828 3.251   -13.212 1.00 21.58 ? 162 TYR A CD1 1 
ATOM   1218 C  CD2 . TYR A 1 159 ? 22.687 1.264   -13.878 1.00 24.19 ? 162 TYR A CD2 1 
ATOM   1219 C  CE1 . TYR A 1 159 ? 24.554 2.523   -12.286 1.00 23.80 ? 162 TYR A CE1 1 
ATOM   1220 C  CE2 . TYR A 1 159 ? 23.404 0.528   -12.954 1.00 21.33 ? 162 TYR A CE2 1 
ATOM   1221 C  CZ  . TYR A 1 159 ? 24.335 1.156   -12.161 1.00 23.42 ? 162 TYR A CZ  1 
ATOM   1222 O  OH  . TYR A 1 159 ? 25.045 0.419   -11.236 1.00 23.20 ? 162 TYR A OH  1 
ATOM   1223 N  N   . ASN A 1 160 ? 22.795 5.936   -17.257 1.00 31.56 ? 163 ASN A N   1 
ATOM   1224 C  CA  . ASN A 1 160 ? 22.427 6.544   -18.530 1.00 33.40 ? 163 ASN A CA  1 
ATOM   1225 C  C   . ASN A 1 160 ? 22.601 5.547   -19.668 1.00 35.07 ? 163 ASN A C   1 
ATOM   1226 O  O   . ASN A 1 160 ? 23.293 4.538   -19.525 1.00 35.62 ? 163 ASN A O   1 
ATOM   1227 C  CB  . ASN A 1 160 ? 23.290 7.782   -18.793 1.00 34.74 ? 163 ASN A CB  1 
ATOM   1228 C  CG  . ASN A 1 160 ? 22.733 8.665   -19.904 1.00 34.53 ? 163 ASN A CG  1 
ATOM   1229 O  OD1 . ASN A 1 160 ? 21.685 8.374   -20.480 1.00 33.28 ? 163 ASN A OD1 1 
ATOM   1230 N  ND2 . ASN A 1 160 ? 23.437 9.750   -20.204 1.00 34.07 ? 163 ASN A ND2 1 
ATOM   1231 N  N   . ARG A 1 161 ? 21.962 5.829   -20.799 1.00 38.58 ? 164 ARG A N   1 
ATOM   1232 C  CA  . ARG A 1 161 ? 22.219 5.076   -22.020 1.00 42.03 ? 164 ARG A CA  1 
ATOM   1233 C  C   . ARG A 1 161 ? 23.559 5.533   -22.585 1.00 42.90 ? 164 ARG A C   1 
ATOM   1234 O  O   . ARG A 1 161 ? 23.949 6.688   -22.411 1.00 41.27 ? 164 ARG A O   1 
ATOM   1235 C  CB  . ARG A 1 161 ? 21.108 5.324   -23.040 1.00 45.09 ? 164 ARG A CB  1 
ATOM   1236 C  CG  . ARG A 1 161 ? 19.727 4.871   -22.575 1.00 51.44 ? 164 ARG A CG  1 
ATOM   1237 C  CD  . ARG A 1 161 ? 18.670 5.941   -22.847 1.00 54.65 ? 164 ARG A CD  1 
ATOM   1238 N  NE  . ARG A 1 161 ? 17.312 5.402   -22.820 1.00 58.74 ? 164 ARG A NE  1 
ATOM   1239 C  CZ  . ARG A 1 161 ? 16.212 6.151   -22.797 1.00 61.33 ? 164 ARG A CZ  1 
ATOM   1240 N  NH1 . ARG A 1 161 ? 16.305 7.477   -22.796 1.00 60.28 ? 164 ARG A NH1 1 
ATOM   1241 N  NH2 . ARG A 1 161 ? 15.016 5.576   -22.777 1.00 62.45 ? 164 ARG A NH2 1 
ATOM   1242 N  N   . ASP A 1 162 ? 24.260 4.620   -23.250 1.00 45.07 ? 165 ASP A N   1 
ATOM   1243 C  CA  . ASP A 1 162 ? 25.608 4.879   -23.744 1.00 47.58 ? 165 ASP A CA  1 
ATOM   1244 C  C   . ASP A 1 162 ? 25.527 5.787   -24.966 1.00 49.44 ? 165 ASP A C   1 
ATOM   1245 O  O   . ASP A 1 162 ? 24.741 5.540   -25.881 1.00 49.11 ? 165 ASP A O   1 
ATOM   1246 C  CB  . ASP A 1 162 ? 26.281 3.554   -24.113 1.00 48.12 ? 165 ASP A CB  1 
ATOM   1247 C  CG  . ASP A 1 162 ? 27.772 3.697   -24.354 1.00 50.01 ? 165 ASP A CG  1 
ATOM   1248 O  OD1 . ASP A 1 162 ? 28.390 4.618   -23.775 1.00 47.55 ? 165 ASP A OD1 1 
ATOM   1249 O  OD2 . ASP A 1 162 ? 28.322 2.877   -25.123 1.00 49.37 ? 165 ASP A OD2 1 
ATOM   1250 N  N   . SER A 1 163 ? 26.331 6.845   -24.973 1.00 52.42 ? 166 SER A N   1 
ATOM   1251 C  CA  . SER A 1 163 ? 26.305 7.797   -26.076 1.00 55.91 ? 166 SER A CA  1 
ATOM   1252 C  C   . SER A 1 163 ? 27.701 8.080   -26.606 1.00 57.65 ? 166 SER A C   1 
ATOM   1253 O  O   . SER A 1 163 ? 28.614 8.407   -25.848 1.00 56.96 ? 166 SER A O   1 
ATOM   1254 C  CB  . SER A 1 163 ? 25.650 9.110   -25.636 1.00 56.89 ? 166 SER A CB  1 
ATOM   1255 O  OG  . SER A 1 163 ? 25.630 10.049  -26.700 1.00 58.86 ? 166 SER A OG  1 
ATOM   1256 N  N   . GLU A 1 164 ? 27.848 7.959   -27.920 1.00 59.97 ? 167 GLU A N   1 
ATOM   1257 C  CA  . GLU A 1 164 ? 29.117 8.199   -28.596 1.00 62.37 ? 167 GLU A CA  1 
ATOM   1258 C  C   . GLU A 1 164 ? 29.772 9.518   -28.171 1.00 63.58 ? 167 GLU A C   1 
ATOM   1259 O  O   . GLU A 1 164 ? 30.983 9.697   -28.320 1.00 62.95 ? 167 GLU A O   1 
ATOM   1260 C  CB  . GLU A 1 164 ? 28.891 8.202   -30.108 1.00 64.10 ? 167 GLU A CB  1 
ATOM   1261 C  CG  . GLU A 1 164 ? 30.115 8.564   -30.925 1.00 67.00 ? 167 GLU A CG  1 
ATOM   1262 C  CD  . GLU A 1 164 ? 29.802 8.705   -32.402 1.00 68.38 ? 167 GLU A CD  1 
ATOM   1263 O  OE1 . GLU A 1 164 ? 29.772 9.854   -32.895 1.00 69.20 ? 167 GLU A OE1 1 
ATOM   1264 O  OE2 . GLU A 1 164 ? 29.586 7.670   -33.067 1.00 69.49 ? 167 GLU A OE2 1 
ATOM   1265 N  N   . ASN A 1 165 ? 28.968 10.433  -27.635 1.00 63.94 ? 168 ASN A N   1 
ATOM   1266 C  CA  . ASN A 1 165 ? 29.427 11.789  -27.354 1.00 64.57 ? 168 ASN A CA  1 
ATOM   1267 C  C   . ASN A 1 165 ? 30.413 11.862  -26.190 1.00 64.81 ? 168 ASN A C   1 
ATOM   1268 O  O   . ASN A 1 165 ? 30.289 11.134  -25.205 1.00 65.11 ? 168 ASN A O   1 
ATOM   1269 C  CB  . ASN A 1 165 ? 28.225 12.696  -27.081 1.00 65.57 ? 168 ASN A CB  1 
ATOM   1270 C  CG  . ASN A 1 165 ? 27.288 12.795  -28.276 1.00 66.88 ? 168 ASN A CG  1 
ATOM   1271 O  OD1 . ASN A 1 165 ? 27.324 11.958  -29.182 1.00 67.59 ? 168 ASN A OD1 1 
ATOM   1272 N  ND2 . ASN A 1 165 ? 26.444 13.824  -28.285 1.00 66.45 ? 168 ASN A ND2 1 
ATOM   1273 N  N   . SER A 1 166 ? 31.386 12.762  -26.314 1.00 65.12 ? 169 SER A N   1 
ATOM   1274 C  CA  . SER A 1 166 ? 32.504 12.852  -25.376 1.00 64.91 ? 169 SER A CA  1 
ATOM   1275 C  C   . SER A 1 166 ? 32.086 13.191  -23.944 1.00 64.35 ? 169 SER A C   1 
ATOM   1276 O  O   . SER A 1 166 ? 32.520 12.537  -22.992 1.00 63.93 ? 169 SER A O   1 
ATOM   1277 C  CB  . SER A 1 166 ? 33.512 13.895  -25.866 1.00 64.64 ? 169 SER A CB  1 
ATOM   1278 O  OG  . SER A 1 166 ? 34.537 14.092  -24.908 1.00 64.84 ? 169 SER A OG  1 
ATOM   1279 N  N   . GLN A 1 167 ? 31.257 14.220  -23.792 1.00 63.18 ? 170 GLN A N   1 
ATOM   1280 C  CA  . GLN A 1 167 ? 30.715 14.563  -22.482 1.00 61.49 ? 170 GLN A CA  1 
ATOM   1281 C  C   . GLN A 1 167 ? 29.831 13.416  -22.017 1.00 58.97 ? 170 GLN A C   1 
ATOM   1282 O  O   . GLN A 1 167 ? 30.333 12.385  -21.571 1.00 60.16 ? 170 GLN A O   1 
ATOM   1283 C  CB  . GLN A 1 167 ? 29.897 15.856  -22.563 1.00 63.18 ? 170 GLN A CB  1 
ATOM   1284 C  CG  . GLN A 1 167 ? 30.706 17.087  -22.965 1.00 65.74 ? 170 GLN A CG  1 
ATOM   1285 C  CD  . GLN A 1 167 ? 31.767 17.459  -21.938 1.00 67.41 ? 170 GLN A CD  1 
ATOM   1286 O  OE1 . GLN A 1 167 ? 31.564 18.353  -21.112 1.00 68.51 ? 170 GLN A OE1 1 
ATOM   1287 N  NE2 . GLN A 1 167 ? 32.906 16.772  -21.986 1.00 67.85 ? 170 GLN A NE2 1 
ATOM   1288 N  N   . SER A 1 168 ? 28.519 13.598  -22.130 1.00 55.47 ? 171 SER A N   1 
ATOM   1289 C  CA  . SER A 1 168 ? 27.552 12.537  -21.855 1.00 53.22 ? 171 SER A CA  1 
ATOM   1290 C  C   . SER A 1 168 ? 27.834 11.790  -20.553 1.00 50.95 ? 171 SER A C   1 
ATOM   1291 O  O   . SER A 1 168 ? 28.711 10.928  -20.497 1.00 51.45 ? 171 SER A O   1 
ATOM   1292 C  CB  . SER A 1 168 ? 27.521 11.539  -23.013 1.00 53.25 ? 171 SER A CB  1 
ATOM   1293 O  OG  . SER A 1 168 ? 26.616 10.482  -22.745 1.00 55.08 ? 171 SER A OG  1 
ATOM   1294 N  N   . LEU A 1 169 ? 27.077 12.117  -19.512 1.00 48.18 ? 172 LEU A N   1 
ATOM   1295 C  CA  . LEU A 1 169 ? 27.232 11.470  -18.213 1.00 45.78 ? 172 LEU A CA  1 
ATOM   1296 C  C   . LEU A 1 169 ? 26.803 10.005  -18.282 1.00 42.48 ? 172 LEU A C   1 
ATOM   1297 O  O   . LEU A 1 169 ? 25.663 9.704   -18.633 1.00 43.11 ? 172 LEU A O   1 
ATOM   1298 C  CB  . LEU A 1 169 ? 26.389 12.205  -17.173 1.00 46.83 ? 172 LEU A CB  1 
ATOM   1299 C  CG  . LEU A 1 169 ? 26.405 11.658  -15.748 1.00 47.90 ? 172 LEU A CG  1 
ATOM   1300 C  CD1 . LEU A 1 169 ? 27.807 11.754  -15.173 1.00 48.13 ? 172 LEU A CD1 1 
ATOM   1301 C  CD2 . LEU A 1 169 ? 25.418 12.453  -14.901 1.00 49.50 ? 172 LEU A CD2 1 
ATOM   1302 N  N   . GLY A 1 170 ? 27.720 9.100   -17.946 1.00 39.27 ? 173 GLY A N   1 
ATOM   1303 C  CA  . GLY A 1 170 ? 27.430 7.680   -18.038 1.00 35.68 ? 173 GLY A CA  1 
ATOM   1304 C  C   . GLY A 1 170 ? 26.474 7.236   -16.947 1.00 32.62 ? 173 GLY A C   1 
ATOM   1305 O  O   . GLY A 1 170 ? 25.671 6.322   -17.138 1.00 29.56 ? 173 GLY A O   1 
ATOM   1306 N  N   . GLY A 1 171 ? 26.566 7.897   -15.799 1.00 30.24 ? 174 GLY A N   1 
ATOM   1307 C  CA  . GLY A 1 171 ? 25.661 7.625   -14.701 1.00 29.14 ? 174 GLY A CA  1 
ATOM   1308 C  C   . GLY A 1 171 ? 26.049 8.426   -13.478 1.00 28.66 ? 174 GLY A C   1 
ATOM   1309 O  O   . GLY A 1 171 ? 27.102 9.064   -13.455 1.00 30.10 ? 174 GLY A O   1 
ATOM   1310 N  N   . GLN A 1 172 ? 25.202 8.401   -12.457 1.00 28.20 ? 175 GLN A N   1 
ATOM   1311 C  CA  . GLN A 1 172 ? 25.460 9.155   -11.240 1.00 29.06 ? 175 GLN A CA  1 
ATOM   1312 C  C   . GLN A 1 172 ? 24.856 8.498   -10.002 1.00 29.86 ? 175 GLN A C   1 
ATOM   1313 O  O   . GLN A 1 172 ? 23.713 8.030   -10.016 1.00 29.02 ? 175 GLN A O   1 
ATOM   1314 C  CB  . GLN A 1 172 ? 24.909 10.576  -11.372 1.00 30.16 ? 175 GLN A CB  1 
ATOM   1315 C  CG  . GLN A 1 172 ? 25.099 11.433  -10.127 1.00 30.40 ? 175 GLN A CG  1 
ATOM   1316 C  CD  . GLN A 1 172 ? 24.452 12.803  -10.258 1.00 32.85 ? 175 GLN A CD  1 
ATOM   1317 O  OE1 . GLN A 1 172 ? 23.256 12.967  -10.004 1.00 31.76 ? 175 GLN A OE1 1 
ATOM   1318 N  NE2 . GLN A 1 172 ? 25.244 13.796  -10.656 1.00 32.54 ? 175 GLN A NE2 1 
ATOM   1319 N  N   . ILE A 1 173 ? 25.632 8.461   -8.926  1.00 31.18 ? 176 ILE A N   1 
ATOM   1320 C  CA  . ILE A 1 173 ? 25.070 8.141   -7.629  1.00 32.44 ? 176 ILE A CA  1 
ATOM   1321 C  C   . ILE A 1 173 ? 25.079 9.363   -6.732  1.00 31.99 ? 176 ILE A C   1 
ATOM   1322 O  O   . ILE A 1 173 ? 26.019 10.152  -6.746  1.00 32.91 ? 176 ILE A O   1 
ATOM   1323 C  CB  . ILE A 1 173 ? 25.844 7.009   -6.930  1.00 34.42 ? 176 ILE A CB  1 
ATOM   1324 C  CG1 . ILE A 1 173 ? 25.326 6.842   -5.500  1.00 32.88 ? 176 ILE A CG1 1 
ATOM   1325 C  CG2 . ILE A 1 173 ? 27.323 7.318   -6.919  1.00 37.69 ? 176 ILE A CG2 1 
ATOM   1326 C  CD1 . ILE A 1 173 ? 26.113 5.859   -4.681  1.00 37.14 ? 176 ILE A CD1 1 
ATOM   1327 N  N   . VAL A 1 174 ? 24.013 9.519   -5.959  1.00 32.72 ? 177 VAL A N   1 
ATOM   1328 C  CA  . VAL A 1 174 ? 23.961 10.553  -4.942  1.00 30.08 ? 177 VAL A CA  1 
ATOM   1329 C  C   . VAL A 1 174 ? 23.834 9.930   -3.564  1.00 28.49 ? 177 VAL A C   1 
ATOM   1330 O  O   . VAL A 1 174 ? 22.951 9.110   -3.323  1.00 27.36 ? 177 VAL A O   1 
ATOM   1331 C  CB  . VAL A 1 174 ? 22.759 11.482  -5.142  1.00 29.27 ? 177 VAL A CB  1 
ATOM   1332 C  CG1 . VAL A 1 174 ? 22.694 12.477  -3.991  1.00 28.59 ? 177 VAL A CG1 1 
ATOM   1333 C  CG2 . VAL A 1 174 ? 22.871 12.202  -6.481  1.00 27.60 ? 177 VAL A CG2 1 
ATOM   1334 N  N   . LEU A 1 175 ? 24.722 10.331  -2.664  1.00 26.95 ? 178 LEU A N   1 
ATOM   1335 C  CA  . LEU A 1 175 ? 24.628 9.948   -1.267  1.00 27.84 ? 178 LEU A CA  1 
ATOM   1336 C  C   . LEU A 1 175 ? 23.905 11.064  -0.523  1.00 28.64 ? 178 LEU A C   1 
ATOM   1337 O  O   . LEU A 1 175 ? 24.379 12.195  -0.487  1.00 29.43 ? 178 LEU A O   1 
ATOM   1338 C  CB  . LEU A 1 175 ? 26.025 9.772   -0.684  1.00 27.59 ? 178 LEU A CB  1 
ATOM   1339 C  CG  . LEU A 1 175 ? 26.968 8.902   -1.517  1.00 28.98 ? 178 LEU A CG  1 
ATOM   1340 C  CD1 . LEU A 1 175 ? 28.372 8.959   -0.954  1.00 26.83 ? 178 LEU A CD1 1 
ATOM   1341 C  CD2 . LEU A 1 175 ? 26.445 7.480   -1.525  1.00 25.56 ? 178 LEU A CD2 1 
ATOM   1342 N  N   . GLY A 1 176 ? 22.763 10.746  0.070   1.00 28.27 ? 179 GLY A N   1 
ATOM   1343 C  CA  . GLY A 1 176 ? 22.037 11.745  0.824   1.00 27.95 ? 179 GLY A CA  1 
ATOM   1344 C  C   . GLY A 1 176 ? 20.737 12.174  0.175   1.00 27.74 ? 179 GLY A C   1 
ATOM   1345 O  O   . GLY A 1 176 ? 19.958 12.905  0.781   1.00 28.22 ? 179 GLY A O   1 
ATOM   1346 N  N   . GLY A 1 177 ? 20.493 11.726  -1.051  1.00 28.91 ? 180 GLY A N   1 
ATOM   1347 C  CA  . GLY A 1 177 ? 19.272 12.114  -1.733  1.00 29.60 ? 180 GLY A CA  1 
ATOM   1348 C  C   . GLY A 1 177 ? 19.237 11.706  -3.191  1.00 31.85 ? 180 GLY A C   1 
ATOM   1349 O  O   . GLY A 1 177 ? 19.917 10.761  -3.596  1.00 30.95 ? 180 GLY A O   1 
ATOM   1350 N  N   . SER A 1 178 ? 18.437 12.414  -3.983  1.00 32.29 ? 181 SER A N   1 
ATOM   1351 C  CA  . SER A 1 178 ? 18.298 12.103  -5.398  1.00 33.75 ? 181 SER A CA  1 
ATOM   1352 C  C   . SER A 1 178 ? 18.358 13.376  -6.222  1.00 35.80 ? 181 SER A C   1 
ATOM   1353 O  O   . SER A 1 178 ? 18.007 14.452  -5.738  1.00 37.61 ? 181 SER A O   1 
ATOM   1354 C  CB  . SER A 1 178 ? 16.972 11.392  -5.655  1.00 34.68 ? 181 SER A CB  1 
ATOM   1355 O  OG  . SER A 1 178 ? 16.855 10.233  -4.848  1.00 38.46 ? 181 SER A OG  1 
ATOM   1356 N  N   . ASP A 1 179 ? 18.796 13.248  -7.471  1.00 36.41 ? 182 ASP A N   1 
ATOM   1357 C  CA  . ASP A 1 179 ? 18.989 14.397  -8.339  1.00 37.27 ? 182 ASP A CA  1 
ATOM   1358 C  C   . ASP A 1 179 ? 17.808 14.565  -9.288  1.00 37.97 ? 182 ASP A C   1 
ATOM   1359 O  O   . ASP A 1 179 ? 17.690 13.857  -10.285 1.00 36.32 ? 182 ASP A O   1 
ATOM   1360 C  CB  . ASP A 1 179 ? 20.280 14.232  -9.144  1.00 38.56 ? 182 ASP A CB  1 
ATOM   1361 C  CG  . ASP A 1 179 ? 20.657 15.487  -9.908  1.00 38.58 ? 182 ASP A CG  1 
ATOM   1362 O  OD1 . ASP A 1 179 ? 19.802 16.389  -10.028 1.00 39.62 ? 182 ASP A OD1 1 
ATOM   1363 O  OD2 . ASP A 1 179 ? 21.807 15.575  -10.385 1.00 38.23 ? 182 ASP A OD2 1 
ATOM   1364 N  N   . PRO A 1 180 ? 16.921 15.528  -8.993  1.00 39.59 ? 183 PRO A N   1 
ATOM   1365 C  CA  . PRO A 1 180 ? 15.718 15.741  -9.805  1.00 40.05 ? 183 PRO A CA  1 
ATOM   1366 C  C   . PRO A 1 180 ? 16.024 16.071  -11.268 1.00 40.57 ? 183 PRO A C   1 
ATOM   1367 O  O   . PRO A 1 180 ? 15.132 16.060  -12.113 1.00 40.37 ? 183 PRO A O   1 
ATOM   1368 C  CB  . PRO A 1 180 ? 14.988 16.878  -9.084  1.00 40.17 ? 183 PRO A CB  1 
ATOM   1369 C  CG  . PRO A 1 180 ? 16.047 17.584  -8.304  1.00 40.82 ? 183 PRO A CG  1 
ATOM   1370 C  CD  . PRO A 1 180 ? 17.052 16.525  -7.915  1.00 40.05 ? 183 PRO A CD  1 
ATOM   1371 N  N   . GLN A 1 181 ? 17.287 16.348  -11.569 1.00 41.70 ? 184 GLN A N   1 
ATOM   1372 C  CA  . GLN A 1 181 ? 17.683 16.605  -12.949 1.00 43.46 ? 184 GLN A CA  1 
ATOM   1373 C  C   . GLN A 1 181 ? 17.694 15.331  -13.781 1.00 43.47 ? 184 GLN A C   1 
ATOM   1374 O  O   . GLN A 1 181 ? 17.755 15.385  -15.010 1.00 43.29 ? 184 GLN A O   1 
ATOM   1375 C  CB  . GLN A 1 181 ? 19.064 17.259  -13.001 1.00 45.25 ? 184 GLN A CB  1 
ATOM   1376 C  CG  . GLN A 1 181 ? 19.106 18.623  -12.340 1.00 50.73 ? 184 GLN A CG  1 
ATOM   1377 C  CD  . GLN A 1 181 ? 20.303 19.444  -12.763 1.00 53.69 ? 184 GLN A CD  1 
ATOM   1378 O  OE1 . GLN A 1 181 ? 21.403 18.916  -12.942 1.00 56.26 ? 184 GLN A OE1 1 
ATOM   1379 N  NE2 . GLN A 1 181 ? 20.096 20.748  -12.928 1.00 54.35 ? 184 GLN A NE2 1 
ATOM   1380 N  N   . HIS A 1 182 ? 17.636 14.183  -13.116 1.00 42.15 ? 185 HIS A N   1 
ATOM   1381 C  CA  . HIS A 1 182 ? 17.655 12.918  -13.832 1.00 40.94 ? 185 HIS A CA  1 
ATOM   1382 C  C   . HIS A 1 182 ? 16.460 12.033  -13.520 1.00 40.46 ? 185 HIS A C   1 
ATOM   1383 O  O   . HIS A 1 182 ? 16.495 10.826  -13.749 1.00 39.45 ? 185 HIS A O   1 
ATOM   1384 C  CB  . HIS A 1 182 ? 18.957 12.178  -13.540 1.00 41.13 ? 185 HIS A CB  1 
ATOM   1385 C  CG  . HIS A 1 182 ? 20.171 12.889  -14.048 1.00 39.45 ? 185 HIS A CG  1 
ATOM   1386 N  ND1 . HIS A 1 182 ? 20.454 13.007  -15.392 1.00 38.96 ? 185 HIS A ND1 1 
ATOM   1387 C  CD2 . HIS A 1 182 ? 21.167 13.532  -13.394 1.00 39.34 ? 185 HIS A CD2 1 
ATOM   1388 C  CE1 . HIS A 1 182 ? 21.572 13.692  -15.544 1.00 38.69 ? 185 HIS A CE1 1 
ATOM   1389 N  NE2 . HIS A 1 182 ? 22.026 14.023  -14.348 1.00 39.77 ? 185 HIS A NE2 1 
ATOM   1390 N  N   . TYR A 1 183 ? 15.399 12.635  -12.993 1.00 40.65 ? 186 TYR A N   1 
ATOM   1391 C  CA  . TYR A 1 183 ? 14.109 11.959  -12.949 1.00 40.59 ? 186 TYR A CA  1 
ATOM   1392 C  C   . TYR A 1 183 ? 12.960 12.962  -13.021 1.00 41.14 ? 186 TYR A C   1 
ATOM   1393 O  O   . TYR A 1 183 ? 13.047 14.059  -12.479 1.00 39.72 ? 186 TYR A O   1 
ATOM   1394 C  CB  . TYR A 1 183 ? 13.992 11.110  -11.678 1.00 37.46 ? 186 TYR A CB  1 
ATOM   1395 C  CG  . TYR A 1 183 ? 13.774 11.894  -10.405 1.00 36.53 ? 186 TYR A CG  1 
ATOM   1396 C  CD1 . TYR A 1 183 ? 14.839 12.245  -9.586  1.00 35.80 ? 186 TYR A CD1 1 
ATOM   1397 C  CD2 . TYR A 1 183 ? 12.496 12.259  -10.008 1.00 36.13 ? 186 TYR A CD2 1 
ATOM   1398 C  CE1 . TYR A 1 183 ? 14.634 12.936  -8.404  1.00 35.69 ? 186 TYR A CE1 1 
ATOM   1399 C  CE2 . TYR A 1 183 ? 12.279 12.950  -8.834  1.00 37.06 ? 186 TYR A CE2 1 
ATOM   1400 C  CZ  . TYR A 1 183 ? 13.346 13.284  -8.034  1.00 36.90 ? 186 TYR A CZ  1 
ATOM   1401 O  OH  . TYR A 1 183 ? 13.114 13.947  -6.851  1.00 35.54 ? 186 TYR A OH  1 
ATOM   1402 N  N   . GLU A 1 184 ? 11.885 12.577  -13.697 1.00 42.69 ? 187 GLU A N   1 
ATOM   1403 C  CA  . GLU A 1 184 ? 10.711 13.427  -13.794 1.00 43.11 ? 187 GLU A CA  1 
ATOM   1404 C  C   . GLU A 1 184 ? 9.552  12.878  -12.972 1.00 43.47 ? 187 GLU A C   1 
ATOM   1405 O  O   . GLU A 1 184 ? 9.430  11.667  -12.781 1.00 44.41 ? 187 GLU A O   1 
ATOM   1406 C  CB  . GLU A 1 184 ? 10.299 13.587  -15.260 1.00 45.38 ? 187 GLU A CB  1 
ATOM   1407 C  CG  . GLU A 1 184 ? 10.259 12.296  -16.058 1.00 48.37 ? 187 GLU A CG  1 
ATOM   1408 C  CD  . GLU A 1 184 ? 10.152 12.543  -17.558 1.00 51.42 ? 187 GLU A CD  1 
ATOM   1409 O  OE1 . GLU A 1 184 ? 11.194 12.818  -18.199 1.00 52.08 ? 187 GLU A OE1 1 
ATOM   1410 O  OE2 . GLU A 1 184 ? 9.025  12.463  -18.095 1.00 52.72 ? 187 GLU A OE2 1 
ATOM   1411 N  N   . GLY A 1 185 ? 8.710  13.780  -12.473 1.00 42.53 ? 188 GLY A N   1 
ATOM   1412 C  CA  . GLY A 1 185 ? 7.581  13.366  -11.661 1.00 41.98 ? 188 GLY A CA  1 
ATOM   1413 C  C   . GLY A 1 185 ? 7.984  13.086  -10.226 1.00 41.88 ? 188 GLY A C   1 
ATOM   1414 O  O   . GLY A 1 185 ? 8.962  13.645  -9.728  1.00 42.65 ? 188 GLY A O   1 
ATOM   1415 N  N   . ASN A 1 186 ? 7.231  12.217  -9.562  1.00 41.19 ? 189 ASN A N   1 
ATOM   1416 C  CA  . ASN A 1 186 ? 7.501  11.871  -8.172  1.00 41.29 ? 189 ASN A CA  1 
ATOM   1417 C  C   . ASN A 1 186 ? 7.886  10.409  -8.022  1.00 39.72 ? 189 ASN A C   1 
ATOM   1418 O  O   . ASN A 1 186 ? 7.603  9.584   -8.892  1.00 39.33 ? 189 ASN A O   1 
ATOM   1419 C  CB  . ASN A 1 186 ? 6.274  12.157  -7.306  1.00 40.96 ? 189 ASN A CB  1 
ATOM   1420 C  CG  . ASN A 1 186 ? 5.856  13.611  -7.356  1.00 44.88 ? 189 ASN A CG  1 
ATOM   1421 O  OD1 . ASN A 1 186 ? 6.570  14.496  -6.869  1.00 45.31 ? 189 ASN A OD1 1 
ATOM   1422 N  ND2 . ASN A 1 186 ? 4.695  13.871  -7.951  1.00 43.99 ? 189 ASN A ND2 1 
ATOM   1423 N  N   . PHE A 1 187 ? 8.534  10.097  -6.905  1.00 39.01 ? 190 PHE A N   1 
ATOM   1424 C  CA  . PHE A 1 187 ? 8.894  8.726   -6.586  1.00 35.27 ? 190 PHE A CA  1 
ATOM   1425 C  C   . PHE A 1 187 ? 7.664  7.927   -6.168  1.00 35.93 ? 190 PHE A C   1 
ATOM   1426 O  O   . PHE A 1 187 ? 6.881  8.361   -5.317  1.00 34.69 ? 190 PHE A O   1 
ATOM   1427 C  CB  . PHE A 1 187 ? 9.931  8.703   -5.458  1.00 36.88 ? 190 PHE A CB  1 
ATOM   1428 C  CG  . PHE A 1 187 ? 11.341 8.943   -5.923  1.00 33.85 ? 190 PHE A CG  1 
ATOM   1429 C  CD1 . PHE A 1 187 ? 11.959 8.049   -6.793  1.00 33.00 ? 190 PHE A CD1 1 
ATOM   1430 C  CD2 . PHE A 1 187 ? 12.043 10.066  -5.508  1.00 33.27 ? 190 PHE A CD2 1 
ATOM   1431 C  CE1 . PHE A 1 187 ? 13.251 8.275   -7.243  1.00 31.03 ? 190 PHE A CE1 1 
ATOM   1432 C  CE2 . PHE A 1 187 ? 13.338 10.300  -5.954  1.00 32.47 ? 190 PHE A CE2 1 
ATOM   1433 C  CZ  . PHE A 1 187 ? 13.942 9.403   -6.824  1.00 31.85 ? 190 PHE A CZ  1 
ATOM   1434 N  N   . HIS A 1 188 ? 7.498  6.764   -6.789  1.00 34.26 ? 191 HIS A N   1 
ATOM   1435 C  CA  . HIS A 1 188 ? 6.594  5.733   -6.297  1.00 31.05 ? 191 HIS A CA  1 
ATOM   1436 C  C   . HIS A 1 188 ? 7.409  4.866   -5.341  1.00 31.08 ? 191 HIS A C   1 
ATOM   1437 O  O   . HIS A 1 188 ? 8.425  4.292   -5.737  1.00 29.27 ? 191 HIS A O   1 
ATOM   1438 C  CB  . HIS A 1 188 ? 6.094  4.897   -7.475  1.00 32.12 ? 191 HIS A CB  1 
ATOM   1439 C  CG  . HIS A 1 188 ? 5.286  3.703   -7.077  1.00 33.54 ? 191 HIS A CG  1 
ATOM   1440 N  ND1 . HIS A 1 188 ? 5.227  2.560   -7.845  1.00 34.62 ? 191 HIS A ND1 1 
ATOM   1441 C  CD2 . HIS A 1 188 ? 4.500  3.475   -5.999  1.00 35.13 ? 191 HIS A CD2 1 
ATOM   1442 C  CE1 . HIS A 1 188 ? 4.438  1.678   -7.257  1.00 34.95 ? 191 HIS A CE1 1 
ATOM   1443 N  NE2 . HIS A 1 188 ? 3.984  2.209   -6.136  1.00 36.87 ? 191 HIS A NE2 1 
ATOM   1444 N  N   . TYR A 1 189 ? 6.980  4.787   -4.084  1.00 30.50 ? 192 TYR A N   1 
ATOM   1445 C  CA  . TYR A 1 189 ? 7.739  4.060   -3.073  1.00 31.93 ? 192 TYR A CA  1 
ATOM   1446 C  C   . TYR A 1 189 ? 7.170  2.679   -2.815  1.00 33.46 ? 192 TYR A C   1 
ATOM   1447 O  O   . TYR A 1 189 ? 5.952  2.493   -2.798  1.00 34.28 ? 192 TYR A O   1 
ATOM   1448 C  CB  . TYR A 1 189 ? 7.776  4.838   -1.757  1.00 33.00 ? 192 TYR A CB  1 
ATOM   1449 C  CG  . TYR A 1 189 ? 8.703  6.028   -1.790  1.00 34.35 ? 192 TYR A CG  1 
ATOM   1450 C  CD1 . TYR A 1 189 ? 10.079 5.854   -1.834  1.00 32.65 ? 192 TYR A CD1 1 
ATOM   1451 C  CD2 . TYR A 1 189 ? 8.201  7.328   -1.808  1.00 34.53 ? 192 TYR A CD2 1 
ATOM   1452 C  CE1 . TYR A 1 189 ? 10.933 6.938   -1.900  1.00 35.47 ? 192 TYR A CE1 1 
ATOM   1453 C  CE2 . TYR A 1 189 ? 9.051  8.425   -1.873  1.00 35.10 ? 192 TYR A CE2 1 
ATOM   1454 C  CZ  . TYR A 1 189 ? 10.415 8.223   -1.921  1.00 36.34 ? 192 TYR A CZ  1 
ATOM   1455 O  OH  . TYR A 1 189 ? 11.270 9.300   -1.994  1.00 36.58 ? 192 TYR A OH  1 
ATOM   1456 N  N   . ILE A 1 190 ? 8.064  1.714   -2.612  1.00 31.85 ? 193 ILE A N   1 
ATOM   1457 C  CA  . ILE A 1 190 ? 7.674  0.350   -2.289  1.00 29.57 ? 193 ILE A CA  1 
ATOM   1458 C  C   . ILE A 1 190 ? 8.482  -0.103  -1.074  1.00 31.18 ? 193 ILE A C   1 
ATOM   1459 O  O   . ILE A 1 190 ? 9.700  0.077   -1.034  1.00 30.88 ? 193 ILE A O   1 
ATOM   1460 C  CB  . ILE A 1 190 ? 7.962  -0.590  -3.479  1.00 30.07 ? 193 ILE A CB  1 
ATOM   1461 C  CG1 . ILE A 1 190 ? 7.275  -0.054  -4.734  1.00 29.67 ? 193 ILE A CG1 1 
ATOM   1462 C  CG2 . ILE A 1 190 ? 7.482  -1.992  -3.173  1.00 27.99 ? 193 ILE A CG2 1 
ATOM   1463 C  CD1 . ILE A 1 190 ? 7.873  -0.569  -6.025  1.00 30.54 ? 193 ILE A CD1 1 
ATOM   1464 N  N   . ASN A 1 191 ? 7.807  -0.677  -0.081  1.00 30.86 ? 194 ASN A N   1 
ATOM   1465 C  CA  . ASN A 1 191 ? 8.480  -1.137  1.131   1.00 29.80 ? 194 ASN A CA  1 
ATOM   1466 C  C   . ASN A 1 191 ? 9.304  -2.381  0.837   1.00 28.51 ? 194 ASN A C   1 
ATOM   1467 O  O   . ASN A 1 191 ? 8.918  -3.200  0.008   1.00 29.95 ? 194 ASN A O   1 
ATOM   1468 C  CB  . ASN A 1 191 ? 7.467  -1.498  2.217   1.00 31.01 ? 194 ASN A CB  1 
ATOM   1469 C  CG  . ASN A 1 191 ? 6.692  -0.302  2.727   1.00 32.43 ? 194 ASN A CG  1 
ATOM   1470 O  OD1 . ASN A 1 191 ? 5.542  -0.444  3.135   1.00 32.53 ? 194 ASN A OD1 1 
ATOM   1471 N  ND2 . ASN A 1 191 ? 7.315  0.874   2.720   1.00 28.91 ? 194 ASN A ND2 1 
ATOM   1472 N  N   . LEU A 1 192 ? 10.427 -2.525  1.530   1.00 27.42 ? 195 LEU A N   1 
ATOM   1473 C  CA  . LEU A 1 192 ? 11.197 -3.756  1.468   1.00 28.56 ? 195 LEU A CA  1 
ATOM   1474 C  C   . LEU A 1 192 ? 10.372 -4.868  2.111   1.00 30.70 ? 195 LEU A C   1 
ATOM   1475 O  O   . LEU A 1 192 ? 9.555  -4.612  3.000   1.00 29.99 ? 195 LEU A O   1 
ATOM   1476 C  CB  . LEU A 1 192 ? 12.523 -3.600  2.228   1.00 25.64 ? 195 LEU A CB  1 
ATOM   1477 C  CG  . LEU A 1 192 ? 13.454 -2.461  1.799   1.00 24.94 ? 195 LEU A CG  1 
ATOM   1478 C  CD1 . LEU A 1 192 ? 14.740 -2.504  2.617   1.00 23.85 ? 195 LEU A CD1 1 
ATOM   1479 C  CD2 . LEU A 1 192 ? 13.764 -2.582  0.331   1.00 23.94 ? 195 LEU A CD2 1 
ATOM   1480 N  N   . ILE A 1 193 ? 10.581 -6.101  1.665   1.00 30.45 ? 196 ILE A N   1 
ATOM   1481 C  CA  . ILE A 1 193 ? 9.988  -7.236  2.351   1.00 32.25 ? 196 ILE A CA  1 
ATOM   1482 C  C   . ILE A 1 193 ? 10.504 -7.253  3.785   1.00 32.38 ? 196 ILE A C   1 
ATOM   1483 O  O   . ILE A 1 193 ? 9.735  -7.364  4.738   1.00 34.05 ? 196 ILE A O   1 
ATOM   1484 C  CB  . ILE A 1 193 ? 10.370 -8.552  1.665   1.00 33.65 ? 196 ILE A CB  1 
ATOM   1485 C  CG1 . ILE A 1 193 ? 9.844  -8.550  0.231   1.00 31.97 ? 196 ILE A CG1 1 
ATOM   1486 C  CG2 . ILE A 1 193 ? 9.811  -9.725  2.443   1.00 34.64 ? 196 ILE A CG2 1 
ATOM   1487 C  CD1 . ILE A 1 193 ? 10.382 -9.674  -0.603  1.00 34.98 ? 196 ILE A CD1 1 
ATOM   1488 N  N   . LYS A 1 194 ? 11.815 -7.129  3.931   1.00 31.32 ? 197 LYS A N   1 
ATOM   1489 C  CA  . LYS A 1 194 ? 12.431 -7.012  5.248   1.00 31.22 ? 197 LYS A CA  1 
ATOM   1490 C  C   . LYS A 1 194 ? 13.687 -6.172  5.142   1.00 31.41 ? 197 LYS A C   1 
ATOM   1491 O  O   . LYS A 1 194 ? 14.258 -6.021  4.063   1.00 32.42 ? 197 LYS A O   1 
ATOM   1492 C  CB  . LYS A 1 194 ? 12.794 -8.390  5.807   1.00 29.13 ? 197 LYS A CB  1 
ATOM   1493 C  CG  . LYS A 1 194 ? 13.841 -9.146  4.987   1.00 31.31 ? 197 LYS A CG  1 
ATOM   1494 C  CD  . LYS A 1 194 ? 14.106 -10.537 5.559   1.00 30.96 ? 197 LYS A CD  1 
ATOM   1495 C  CE  . LYS A 1 194 ? 14.981 -11.382 4.629   1.00 31.56 ? 197 LYS A CE  1 
ATOM   1496 N  NZ  . LYS A 1 194 ? 14.290 -11.723 3.349   1.00 31.98 ? 197 LYS A NZ  1 
ATOM   1497 N  N   . THR A 1 195 ? 14.116 -5.622  6.269   1.00 31.80 ? 198 THR A N   1 
ATOM   1498 C  CA  . THR A 1 195 ? 15.405 -4.961  6.335   1.00 31.92 ? 198 THR A CA  1 
ATOM   1499 C  C   . THR A 1 195 ? 16.488 -6.019  6.086   1.00 31.24 ? 198 THR A C   1 
ATOM   1500 O  O   . THR A 1 195 ? 16.298 -7.196  6.396   1.00 30.62 ? 198 THR A O   1 
ATOM   1501 C  CB  . THR A 1 195 ? 15.595 -4.299  7.720   1.00 32.35 ? 198 THR A CB  1 
ATOM   1502 O  OG1 . THR A 1 195 ? 16.782 -3.498  7.716   1.00 34.61 ? 198 THR A OG1 1 
ATOM   1503 C  CG2 . THR A 1 195 ? 15.698 -5.354  8.806   1.00 33.95 ? 198 THR A CG2 1 
ATOM   1504 N  N   . GLY A 1 196 ? 17.611 -5.611  5.505   1.00 31.82 ? 199 GLY A N   1 
ATOM   1505 C  CA  . GLY A 1 196 ? 18.704 -6.548  5.304   1.00 30.55 ? 199 GLY A CA  1 
ATOM   1506 C  C   . GLY A 1 196 ? 18.979 -6.926  3.857   1.00 29.02 ? 199 GLY A C   1 
ATOM   1507 O  O   . GLY A 1 196 ? 20.014 -7.525  3.558   1.00 28.80 ? 199 GLY A O   1 
ATOM   1508 N  N   . VAL A 1 197 ? 18.063 -6.586  2.958   1.00 28.05 ? 200 VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 197 ? 18.246 -6.860  1.535   1.00 27.63 ? 200 VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 197 ? 17.372 -5.938  0.682   1.00 27.95 ? 200 VAL A C   1 
ATOM   1511 O  O   . VAL A 1 197 ? 16.193 -5.748  0.973   1.00 30.03 ? 200 VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 197 ? 17.937 -8.360  1.218   1.00 28.26 ? 200 VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 197 ? 16.595 -8.763  1.803   1.00 29.70 ? 200 VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 197 ? 17.944 -8.598  -0.285  1.00 25.43 ? 200 VAL A CG2 1 
ATOM   1515 N  N   . TRP A 1 198 ? 17.952 -5.347  -0.359  1.00 26.45 ? 201 TRP A N   1 
ATOM   1516 C  CA  . TRP A 1 198 ? 17.196 -4.436  -1.214  1.00 25.58 ? 201 TRP A CA  1 
ATOM   1517 C  C   . TRP A 1 198 ? 16.270 -5.222  -2.135  1.00 25.74 ? 201 TRP A C   1 
ATOM   1518 O  O   . TRP A 1 198 ? 16.496 -5.305  -3.343  1.00 26.45 ? 201 TRP A O   1 
ATOM   1519 C  CB  . TRP A 1 198 ? 18.147 -3.565  -2.042  1.00 24.23 ? 201 TRP A CB  1 
ATOM   1520 C  CG  . TRP A 1 198 ? 18.975 -2.643  -1.205  1.00 26.00 ? 201 TRP A CG  1 
ATOM   1521 C  CD1 . TRP A 1 198 ? 20.320 -2.718  -0.985  1.00 25.19 ? 201 TRP A CD1 1 
ATOM   1522 C  CD2 . TRP A 1 198 ? 18.508 -1.519  -0.450  1.00 27.06 ? 201 TRP A CD2 1 
ATOM   1523 N  NE1 . TRP A 1 198 ? 20.719 -1.712  -0.138  1.00 24.88 ? 201 TRP A NE1 1 
ATOM   1524 C  CE2 . TRP A 1 198 ? 19.625 -0.962  0.205   1.00 25.99 ? 201 TRP A CE2 1 
ATOM   1525 C  CE3 . TRP A 1 198 ? 17.253 -0.930  -0.262  1.00 28.95 ? 201 TRP A CE3 1 
ATOM   1526 C  CZ2 . TRP A 1 198 ? 19.526 0.149   1.032   1.00 25.07 ? 201 TRP A CZ2 1 
ATOM   1527 C  CZ3 . TRP A 1 198 ? 17.156 0.177   0.563   1.00 27.19 ? 201 TRP A CZ3 1 
ATOM   1528 C  CH2 . TRP A 1 198 ? 18.287 0.704   1.199   1.00 26.82 ? 201 TRP A CH2 1 
ATOM   1529 N  N   . GLN A 1 199 ? 15.225 -5.794  -1.548  1.00 24.49 ? 202 GLN A N   1 
ATOM   1530 C  CA  . GLN A 1 199 ? 14.346 -6.724  -2.242  1.00 24.04 ? 202 GLN A CA  1 
ATOM   1531 C  C   . GLN A 1 199 ? 12.884 -6.399  -1.910  1.00 23.17 ? 202 GLN A C   1 
ATOM   1532 O  O   . GLN A 1 199 ? 12.542 -6.113  -0.762  1.00 23.78 ? 202 GLN A O   1 
ATOM   1533 C  CB  . GLN A 1 199 ? 14.678 -8.157  -1.817  1.00 22.52 ? 202 GLN A CB  1 
ATOM   1534 C  CG  . GLN A 1 199 ? 14.007 -9.247  -2.630  1.00 24.70 ? 202 GLN A CG  1 
ATOM   1535 C  CD  . GLN A 1 199 ? 14.515 -10.637 -2.261  1.00 27.92 ? 202 GLN A CD  1 
ATOM   1536 O  OE1 . GLN A 1 199 ? 14.742 -11.484 -3.127  1.00 29.34 ? 202 GLN A OE1 1 
ATOM   1537 N  NE2 . GLN A 1 199 ? 14.698 -10.873 -0.969  1.00 24.82 ? 202 GLN A NE2 1 
ATOM   1538 N  N   . ILE A 1 200 ? 12.030 -6.440  -2.922  1.00 22.78 ? 203 ILE A N   1 
ATOM   1539 C  CA  . ILE A 1 200 ? 10.619 -6.137  -2.741  1.00 23.99 ? 203 ILE A CA  1 
ATOM   1540 C  C   . ILE A 1 200 ? 9.789  -7.234  -3.367  1.00 25.91 ? 203 ILE A C   1 
ATOM   1541 O  O   . ILE A 1 200 ? 10.303 -8.051  -4.130  1.00 26.24 ? 203 ILE A O   1 
ATOM   1542 C  CB  . ILE A 1 200 ? 10.243 -4.807  -3.417  1.00 24.66 ? 203 ILE A CB  1 
ATOM   1543 C  CG1 . ILE A 1 200 ? 10.626 -4.852  -4.896  1.00 25.99 ? 203 ILE A CG1 1 
ATOM   1544 C  CG2 . ILE A 1 200 ? 10.956 -3.656  -2.729  1.00 26.76 ? 203 ILE A CG2 1 
ATOM   1545 C  CD1 . ILE A 1 200 ? 10.565 -3.499  -5.582  1.00 26.60 ? 203 ILE A CD1 1 
ATOM   1546 N  N   . GLN A 1 201 ? 8.499  -7.249  -3.058  1.00 25.83 ? 204 GLN A N   1 
ATOM   1547 C  CA  . GLN A 1 201 ? 7.604  -8.203  -3.700  1.00 27.53 ? 204 GLN A CA  1 
ATOM   1548 C  C   . GLN A 1 201 ? 7.208  -7.761  -5.097  1.00 25.84 ? 204 GLN A C   1 
ATOM   1549 O  O   . GLN A 1 201 ? 7.159  -6.564  -5.398  1.00 25.37 ? 204 GLN A O   1 
ATOM   1550 C  CB  . GLN A 1 201 ? 6.351  -8.416  -2.853  1.00 26.94 ? 204 GLN A CB  1 
ATOM   1551 C  CG  . GLN A 1 201 ? 6.609  -9.212  -1.590  1.00 30.44 ? 204 GLN A CG  1 
ATOM   1552 C  CD  . GLN A 1 201 ? 5.347  -9.865  -1.056  1.00 32.55 ? 204 GLN A CD  1 
ATOM   1553 O  OE1 . GLN A 1 201 ? 4.633  -9.284  -0.233  1.00 31.94 ? 204 GLN A OE1 1 
ATOM   1554 N  NE2 . GLN A 1 201 ? 5.063  -11.077 -1.529  1.00 30.09 ? 204 GLN A NE2 1 
ATOM   1555 N  N   . MET A 1 202 ? 6.932  -8.747  -5.943  1.00 26.03 ? 205 MET A N   1 
ATOM   1556 C  CA  . MET A 1 202 ? 6.486  -8.518  -7.310  1.00 26.21 ? 205 MET A CA  1 
ATOM   1557 C  C   . MET A 1 202 ? 5.241  -9.354  -7.582  1.00 27.48 ? 205 MET A C   1 
ATOM   1558 O  O   . MET A 1 202 ? 5.222  -10.555 -7.320  1.00 27.07 ? 205 MET A O   1 
ATOM   1559 C  CB  . MET A 1 202 ? 7.602  -8.904  -8.285  1.00 26.58 ? 205 MET A CB  1 
ATOM   1560 C  CG  . MET A 1 202 ? 7.257  -8.717  -9.749  1.00 25.44 ? 205 MET A CG  1 
ATOM   1561 S  SD  . MET A 1 202 ? 8.706  -8.196  -10.700 1.00 25.98 ? 205 MET A SD  1 
ATOM   1562 C  CE  . MET A 1 202 ? 9.582  -9.757  -10.889 1.00 24.13 ? 205 MET A CE  1 
ATOM   1563 N  N   . LYS A 1 203 ? 4.203  -8.725  -8.121  1.00 29.61 ? 206 LYS A N   1 
ATOM   1564 C  CA  . LYS A 1 203 ? 2.911  -9.386  -8.248  1.00 31.17 ? 206 LYS A CA  1 
ATOM   1565 C  C   . LYS A 1 203 ? 2.787  -10.102 -9.580  1.00 31.64 ? 206 LYS A C   1 
ATOM   1566 O  O   . LYS A 1 203 ? 1.935  -10.978 -9.742  1.00 33.60 ? 206 LYS A O   1 
ATOM   1567 C  CB  . LYS A 1 203 ? 1.773  -8.377  -8.086  1.00 31.35 ? 206 LYS A CB  1 
ATOM   1568 C  CG  . LYS A 1 203 ? 1.804  -7.615  -6.761  1.00 37.66 ? 206 LYS A CG  1 
ATOM   1569 C  CD  . LYS A 1 203 ? 3.150  -6.904  -6.574  1.00 39.32 ? 206 LYS A CD  1 
ATOM   1570 C  CE  . LYS A 1 203 ? 3.149  -5.881  -5.442  1.00 38.56 ? 206 LYS A CE  1 
ATOM   1571 N  NZ  . LYS A 1 203 ? 4.514  -5.294  -5.240  1.00 33.99 ? 206 LYS A NZ  1 
ATOM   1572 N  N   . GLY A 1 204 ? 3.639  -9.739  -10.533 1.00 30.22 ? 207 GLY A N   1 
ATOM   1573 C  CA  . GLY A 1 204 ? 3.662  -10.461 -11.791 1.00 29.35 ? 207 GLY A CA  1 
ATOM   1574 C  C   . GLY A 1 204 ? 4.573  -9.849  -12.838 1.00 29.57 ? 207 GLY A C   1 
ATOM   1575 O  O   . GLY A 1 204 ? 5.044  -8.724  -12.688 1.00 29.02 ? 207 GLY A O   1 
ATOM   1576 N  N   . VAL A 1 205 ? 4.819  -10.603 -13.903 1.00 29.30 ? 208 VAL A N   1 
ATOM   1577 C  CA  . VAL A 1 205 ? 5.627  -10.128 -15.018 1.00 29.11 ? 208 VAL A CA  1 
ATOM   1578 C  C   . VAL A 1 205 ? 4.893  -10.412 -16.318 1.00 30.07 ? 208 VAL A C   1 
ATOM   1579 O  O   . VAL A 1 205 ? 4.605  -11.563 -16.631 1.00 28.63 ? 208 VAL A O   1 
ATOM   1580 C  CB  . VAL A 1 205 ? 7.004  -10.836 -15.065 1.00 29.03 ? 208 VAL A CB  1 
ATOM   1581 C  CG1 . VAL A 1 205 ? 7.803  -10.345 -16.274 1.00 25.97 ? 208 VAL A CG1 1 
ATOM   1582 C  CG2 . VAL A 1 205 ? 7.768  -10.574 -13.773 1.00 25.44 ? 208 VAL A CG2 1 
ATOM   1583 N  N   . SER A 1 206 ? 4.598  -9.360  -17.074 1.00 30.89 ? 209 SER A N   1 
ATOM   1584 C  CA  . SER A 1 206 ? 3.780  -9.491  -18.275 1.00 33.83 ? 209 SER A CA  1 
ATOM   1585 C  C   . SER A 1 206 ? 4.613  -9.407  -19.552 1.00 35.20 ? 209 SER A C   1 
ATOM   1586 O  O   . SER A 1 206 ? 5.492  -8.553  -19.681 1.00 34.47 ? 209 SER A O   1 
ATOM   1587 C  CB  . SER A 1 206 ? 2.708  -8.402  -18.291 1.00 33.02 ? 209 SER A CB  1 
ATOM   1588 O  OG  . SER A 1 206 ? 1.973  -8.400  -17.078 1.00 35.36 ? 209 SER A OG  1 
ATOM   1589 N  N   . VAL A 1 207 ? 4.334  -10.313 -20.486 1.00 37.74 ? 210 VAL A N   1 
ATOM   1590 C  CA  . VAL A 1 207 ? 4.865  -10.230 -21.841 1.00 41.11 ? 210 VAL A CA  1 
ATOM   1591 C  C   . VAL A 1 207 ? 3.727  -9.914  -22.809 1.00 44.64 ? 210 VAL A C   1 
ATOM   1592 O  O   . VAL A 1 207 ? 2.785  -10.696 -22.951 1.00 46.37 ? 210 VAL A O   1 
ATOM   1593 C  CB  . VAL A 1 207 ? 5.499  -11.554 -22.271 1.00 42.14 ? 210 VAL A CB  1 
ATOM   1594 C  CG1 . VAL A 1 207 ? 6.094  -11.410 -23.664 1.00 42.45 ? 210 VAL A CG1 1 
ATOM   1595 C  CG2 . VAL A 1 207 ? 6.553  -11.973 -21.267 1.00 41.92 ? 210 VAL A CG2 1 
ATOM   1596 N  N   . GLY A 1 208 ? 3.813  -8.771  -23.478 1.00 47.40 ? 211 GLY A N   1 
ATOM   1597 C  CA  . GLY A 1 208 ? 2.683  -8.313  -24.260 1.00 50.99 ? 211 GLY A CA  1 
ATOM   1598 C  C   . GLY A 1 208 ? 1.532  -7.964  -23.337 1.00 54.32 ? 211 GLY A C   1 
ATOM   1599 O  O   . GLY A 1 208 ? 1.678  -7.132  -22.440 1.00 55.78 ? 211 GLY A O   1 
ATOM   1600 N  N   . SER A 1 209 ? 0.384  -8.597  -23.549 1.00 56.94 ? 212 SER A N   1 
ATOM   1601 C  CA  . SER A 1 209 ? -0.779 -8.348  -22.703 1.00 59.49 ? 212 SER A CA  1 
ATOM   1602 C  C   . SER A 1 209 ? -0.937 -9.440  -21.647 1.00 60.64 ? 212 SER A C   1 
ATOM   1603 O  O   . SER A 1 209 ? -1.306 -9.157  -20.506 1.00 61.07 ? 212 SER A O   1 
ATOM   1604 C  CB  . SER A 1 209 ? -2.052 -8.256  -23.555 1.00 59.79 ? 212 SER A CB  1 
ATOM   1605 O  OG  . SER A 1 209 ? -2.257 -9.438  -24.312 1.00 60.66 ? 212 SER A OG  1 
ATOM   1606 N  N   . SER A 1 210 ? -0.647 -10.684 -22.029 1.00 61.19 ? 213 SER A N   1 
ATOM   1607 C  CA  . SER A 1 210 ? -0.814 -11.816 -21.121 1.00 60.02 ? 213 SER A CA  1 
ATOM   1608 C  C   . SER A 1 210 ? 0.149  -11.722 -19.936 1.00 60.68 ? 213 SER A C   1 
ATOM   1609 O  O   . SER A 1 210 ? 1.369  -11.817 -20.103 1.00 60.05 ? 213 SER A O   1 
ATOM   1610 C  CB  . SER A 1 210 ? -0.590 -13.143 -21.867 1.00 59.85 ? 213 SER A CB  1 
ATOM   1611 O  OG  . SER A 1 210 ? 0.788  -13.442 -22.027 1.00 56.12 ? 213 SER A OG  1 
ATOM   1612 N  N   . THR A 1 211 ? -0.406 -11.528 -18.741 1.00 60.20 ? 214 THR A N   1 
ATOM   1613 C  CA  . THR A 1 211 ? 0.375  -11.645 -17.515 1.00 59.80 ? 214 THR A CA  1 
ATOM   1614 C  C   . THR A 1 211 ? 0.805  -13.097 -17.370 1.00 57.91 ? 214 THR A C   1 
ATOM   1615 O  O   . THR A 1 211 ? 0.069  -13.929 -16.844 1.00 57.11 ? 214 THR A O   1 
ATOM   1616 C  CB  . THR A 1 211 ? -0.448 -11.240 -16.279 1.00 61.10 ? 214 THR A CB  1 
ATOM   1617 O  OG1 . THR A 1 211 ? -0.831 -9.863  -16.391 1.00 60.24 ? 214 THR A OG1 1 
ATOM   1618 C  CG2 . THR A 1 211 ? 0.374  -11.436 -15.006 1.00 62.11 ? 214 THR A CG2 1 
ATOM   1619 N  N   . LEU A 1 212 ? 2.013  -13.385 -17.839 1.00 55.49 ? 215 LEU A N   1 
ATOM   1620 C  CA  . LEU A 1 212 ? 2.406  -14.741 -18.181 1.00 52.81 ? 215 LEU A CA  1 
ATOM   1621 C  C   . LEU A 1 212 ? 3.222  -15.400 -17.073 1.00 49.53 ? 215 LEU A C   1 
ATOM   1622 O  O   . LEU A 1 212 ? 3.146  -16.607 -16.865 1.00 49.38 ? 215 LEU A O   1 
ATOM   1623 C  CB  . LEU A 1 212 ? 3.220  -14.716 -19.479 1.00 55.08 ? 215 LEU A CB  1 
ATOM   1624 C  CG  . LEU A 1 212 ? 3.490  -16.046 -20.182 1.00 56.98 ? 215 LEU A CG  1 
ATOM   1625 C  CD1 . LEU A 1 212 ? 2.164  -16.678 -20.592 1.00 58.08 ? 215 LEU A CD1 1 
ATOM   1626 C  CD2 . LEU A 1 212 ? 4.379  -15.815 -21.399 1.00 57.07 ? 215 LEU A CD2 1 
ATOM   1627 N  N   . LEU A 1 213 ? 4.009  -14.602 -16.366 1.00 45.28 ? 216 LEU A N   1 
ATOM   1628 C  CA  . LEU A 1 213 ? 4.975  -15.140 -15.421 1.00 41.30 ? 216 LEU A CA  1 
ATOM   1629 C  C   . LEU A 1 213 ? 4.696  -14.611 -14.024 1.00 37.04 ? 216 LEU A C   1 
ATOM   1630 O  O   . LEU A 1 213 ? 4.042  -13.584 -13.870 1.00 34.42 ? 216 LEU A O   1 
ATOM   1631 C  CB  . LEU A 1 213 ? 6.391  -14.752 -15.859 1.00 41.31 ? 216 LEU A CB  1 
ATOM   1632 C  CG  . LEU A 1 213 ? 6.851  -15.361 -17.187 1.00 41.89 ? 216 LEU A CG  1 
ATOM   1633 C  CD1 . LEU A 1 213 ? 8.150  -14.724 -17.634 1.00 43.52 ? 216 LEU A CD1 1 
ATOM   1634 C  CD2 . LEU A 1 213 ? 7.027  -16.869 -17.018 1.00 43.84 ? 216 LEU A CD2 1 
ATOM   1635 N  N   . CYS A 1 214 ? 5.182  -15.318 -13.009 1.00 34.22 ? 217 CYS A N   1 
ATOM   1636 C  CA  . CYS A 1 214 ? 5.130  -14.803 -11.647 1.00 33.71 ? 217 CYS A CA  1 
ATOM   1637 C  C   . CYS A 1 214 ? 3.674  -14.541 -11.285 1.00 33.08 ? 217 CYS A C   1 
ATOM   1638 O  O   . CYS A 1 214 ? 3.355  -13.721 -10.421 1.00 31.90 ? 217 CYS A O   1 
ATOM   1639 C  CB  . CYS A 1 214 ? 5.955  -13.514 -11.567 1.00 34.79 ? 217 CYS A CB  1 
ATOM   1640 S  SG  . CYS A 1 214 ? 5.822  -12.604 -10.026 1.00 35.15 ? 217 CYS A SG  1 
ATOM   1641 N  N   . GLU A 1 215 ? 2.791  -15.260 -11.966 1.00 31.98 ? 218 GLU A N   1 
ATOM   1642 C  CA  . GLU A 1 215 ? 1.366  -15.009 -11.899 1.00 32.23 ? 218 GLU A CA  1 
ATOM   1643 C  C   . GLU A 1 215 ? 0.856  -14.898 -10.468 1.00 30.88 ? 218 GLU A C   1 
ATOM   1644 O  O   . GLU A 1 215 ? -0.098 -14.175 -10.202 1.00 29.53 ? 218 GLU A O   1 
ATOM   1645 C  CB  . GLU A 1 215 ? 0.612  -16.118 -12.637 1.00 34.80 ? 218 GLU A CB  1 
ATOM   1646 C  CG  . GLU A 1 215 ? 0.769  -17.503 -12.020 1.00 39.98 ? 218 GLU A CG  1 
ATOM   1647 C  CD  . GLU A 1 215 ? 2.224  -17.910 -11.824 1.00 44.71 ? 218 GLU A CD  1 
ATOM   1648 O  OE1 . GLU A 1 215 ? 3.008  -17.847 -12.801 1.00 46.38 ? 218 GLU A OE1 1 
ATOM   1649 O  OE2 . GLU A 1 215 ? 2.585  -18.292 -10.688 1.00 46.54 ? 218 GLU A OE2 1 
ATOM   1650 N  N   . ASP A 1 216 ? 1.491  -15.610 -9.546  1.00 29.93 ? 219 ASP A N   1 
ATOM   1651 C  CA  . ASP A 1 216 ? 1.041  -15.604 -8.160  1.00 30.93 ? 219 ASP A CA  1 
ATOM   1652 C  C   . ASP A 1 216 ? 2.100  -15.064 -7.205  1.00 29.61 ? 219 ASP A C   1 
ATOM   1653 O  O   . ASP A 1 216 ? 2.216  -15.529 -6.074  1.00 28.06 ? 219 ASP A O   1 
ATOM   1654 C  CB  . ASP A 1 216 ? 0.631  -17.013 -7.730  1.00 32.23 ? 219 ASP A CB  1 
ATOM   1655 C  CG  . ASP A 1 216 ? -0.344 -17.004 -6.566  1.00 36.16 ? 219 ASP A CG  1 
ATOM   1656 O  OD1 . ASP A 1 216 ? -1.117 -16.032 -6.436  1.00 37.13 ? 219 ASP A OD1 1 
ATOM   1657 O  OD2 . ASP A 1 216 ? -0.339 -17.969 -5.775  1.00 38.71 ? 219 ASP A OD2 1 
ATOM   1658 N  N   . GLY A 1 217 ? 2.869  -14.085 -7.670  1.00 29.12 ? 220 GLY A N   1 
ATOM   1659 C  CA  . GLY A 1 217 ? 3.824  -13.412 -6.810  1.00 28.01 ? 220 GLY A CA  1 
ATOM   1660 C  C   . GLY A 1 217 ? 5.234  -13.959 -6.949  1.00 28.18 ? 220 GLY A C   1 
ATOM   1661 O  O   . GLY A 1 217 ? 5.430  -15.116 -7.318  1.00 27.95 ? 220 GLY A O   1 
ATOM   1662 N  N   . CYS A 1 218 ? 6.218  -13.115 -6.661  1.00 27.16 ? 221 CYS A N   1 
ATOM   1663 C  CA  . CYS A 1 218 ? 7.606  -13.543 -6.577  1.00 28.05 ? 221 CYS A CA  1 
ATOM   1664 C  C   . CYS A 1 218 ? 8.430  -12.377 -6.051  1.00 26.63 ? 221 CYS A C   1 
ATOM   1665 O  O   . CYS A 1 218 ? 7.877  -11.327 -5.735  1.00 26.05 ? 221 CYS A O   1 
ATOM   1666 C  CB  . CYS A 1 218 ? 8.116  -13.966 -7.951  1.00 30.31 ? 221 CYS A CB  1 
ATOM   1667 S  SG  . CYS A 1 218 ? 8.275  -12.603 -9.115  1.00 38.78 ? 221 CYS A SG  1 
ATOM   1668 N  N   . LEU A 1 219 ? 9.745  -12.561 -5.951  1.00 23.93 ? 222 LEU A N   1 
ATOM   1669 C  CA  . LEU A 1 219 ? 10.609 -11.546 -5.362  1.00 24.93 ? 222 LEU A CA  1 
ATOM   1670 C  C   . LEU A 1 219 ? 11.382 -10.783 -6.434  1.00 23.85 ? 222 LEU A C   1 
ATOM   1671 O  O   . LEU A 1 219 ? 11.619 -11.293 -7.525  1.00 21.97 ? 222 LEU A O   1 
ATOM   1672 C  CB  . LEU A 1 219 ? 11.596 -12.188 -4.386  1.00 26.50 ? 222 LEU A CB  1 
ATOM   1673 C  CG  . LEU A 1 219 ? 10.957 -13.062 -3.306  1.00 29.79 ? 222 LEU A CG  1 
ATOM   1674 C  CD1 . LEU A 1 219 ? 11.967 -13.339 -2.205  1.00 28.77 ? 222 LEU A CD1 1 
ATOM   1675 C  CD2 . LEU A 1 219 ? 9.736  -12.352 -2.740  1.00 29.28 ? 222 LEU A CD2 1 
ATOM   1676 N  N   . ALA A 1 220 ? 11.774 -9.559  -6.111  1.00 25.02 ? 223 ALA A N   1 
ATOM   1677 C  CA  . ALA A 1 220 ? 12.572 -8.756  -7.024  1.00 25.87 ? 223 ALA A CA  1 
ATOM   1678 C  C   . ALA A 1 220 ? 13.708 -8.077  -6.271  1.00 28.01 ? 223 ALA A C   1 
ATOM   1679 O  O   . ALA A 1 220 ? 13.483 -7.220  -5.411  1.00 28.88 ? 223 ALA A O   1 
ATOM   1680 C  CB  . ALA A 1 220 ? 11.695 -7.715  -7.702  1.00 26.50 ? 223 ALA A CB  1 
ATOM   1681 N  N   . LEU A 1 221 ? 14.938 -8.466  -6.588  1.00 27.96 ? 224 LEU A N   1 
ATOM   1682 C  CA  . LEU A 1 221 ? 16.092 -7.812  -5.995  1.00 27.07 ? 224 LEU A CA  1 
ATOM   1683 C  C   . LEU A 1 221 ? 16.447 -6.621  -6.876  1.00 25.46 ? 224 LEU A C   1 
ATOM   1684 O  O   . LEU A 1 221 ? 16.571 -6.760  -8.089  1.00 28.35 ? 224 LEU A O   1 
ATOM   1685 C  CB  . LEU A 1 221 ? 17.272 -8.787  -5.921  1.00 29.48 ? 224 LEU A CB  1 
ATOM   1686 C  CG  . LEU A 1 221 ? 18.560 -8.283  -5.260  1.00 30.86 ? 224 LEU A CG  1 
ATOM   1687 C  CD1 . LEU A 1 221 ? 18.291 -7.998  -3.789  1.00 26.22 ? 224 LEU A CD1 1 
ATOM   1688 C  CD2 . LEU A 1 221 ? 19.670 -9.334  -5.418  1.00 28.99 ? 224 LEU A CD2 1 
ATOM   1689 N  N   . VAL A 1 222 ? 16.596 -5.446  -6.278  1.00 24.40 ? 225 VAL A N   1 
ATOM   1690 C  CA  . VAL A 1 222 ? 16.905 -4.258  -7.065  1.00 23.32 ? 225 VAL A CA  1 
ATOM   1691 C  C   . VAL A 1 222 ? 18.411 -4.069  -7.025  1.00 21.81 ? 225 VAL A C   1 
ATOM   1692 O  O   . VAL A 1 222 ? 18.955 -3.529  -6.071  1.00 20.96 ? 225 VAL A O   1 
ATOM   1693 C  CB  . VAL A 1 222 ? 16.193 -3.009  -6.508  1.00 22.57 ? 225 VAL A CB  1 
ATOM   1694 C  CG1 . VAL A 1 222 ? 16.534 -1.792  -7.361  1.00 24.06 ? 225 VAL A CG1 1 
ATOM   1695 C  CG2 . VAL A 1 222 ? 14.681 -3.244  -6.498  1.00 22.50 ? 225 VAL A CG2 1 
ATOM   1696 N  N   . ASP A 1 223 ? 19.078 -4.556  -8.065  1.00 20.45 ? 226 ASP A N   1 
ATOM   1697 C  CA  . ASP A 1 223 ? 20.499 -4.840  -7.966  1.00 22.13 ? 226 ASP A CA  1 
ATOM   1698 C  C   . ASP A 1 223 ? 21.328 -4.007  -8.919  1.00 19.30 ? 226 ASP A C   1 
ATOM   1699 O  O   . ASP A 1 223 ? 21.344 -4.251  -10.123 1.00 18.96 ? 226 ASP A O   1 
ATOM   1700 C  CB  . ASP A 1 223 ? 20.764 -6.317  -8.231  1.00 20.05 ? 226 ASP A CB  1 
ATOM   1701 C  CG  . ASP A 1 223 ? 22.143 -6.736  -7.791  1.00 19.79 ? 226 ASP A CG  1 
ATOM   1702 O  OD1 . ASP A 1 223 ? 23.041 -5.864  -7.706  1.00 20.42 ? 226 ASP A OD1 1 
ATOM   1703 O  OD2 . ASP A 1 223 ? 22.325 -7.933  -7.521  1.00 23.88 ? 226 ASP A OD2 1 
ATOM   1704 N  N   . THR A 1 224 ? 22.034 -3.035  -8.364  1.00 18.85 ? 227 THR A N   1 
ATOM   1705 C  CA  . THR A 1 224 ? 22.776 -2.100  -9.182  1.00 21.15 ? 227 THR A CA  1 
ATOM   1706 C  C   . THR A 1 224 ? 24.052 -2.728  -9.734  1.00 22.35 ? 227 THR A C   1 
ATOM   1707 O  O   . THR A 1 224 ? 24.609 -2.243  -10.718 1.00 23.03 ? 227 THR A O   1 
ATOM   1708 C  CB  . THR A 1 224 ? 23.103 -0.814  -8.393  1.00 19.59 ? 227 THR A CB  1 
ATOM   1709 O  OG1 . THR A 1 224 ? 23.878 -1.137  -7.234  1.00 21.16 ? 227 THR A OG1 1 
ATOM   1710 C  CG2 . THR A 1 224 ? 21.805 -0.118  -7.961  1.00 21.03 ? 227 THR A CG2 1 
ATOM   1711 N  N   . GLY A 1 225 ? 24.500 -3.819  -9.123  1.00 20.93 ? 228 GLY A N   1 
ATOM   1712 C  CA  . GLY A 1 225 ? 25.662 -4.522  -9.642  1.00 21.58 ? 228 GLY A CA  1 
ATOM   1713 C  C   . GLY A 1 225 ? 25.332 -5.483  -10.775 1.00 21.94 ? 228 GLY A C   1 
ATOM   1714 O  O   . GLY A 1 225 ? 26.232 -6.023  -11.425 1.00 24.03 ? 228 GLY A O   1 
ATOM   1715 N  N   . ALA A 1 226 ? 24.043 -5.698  -11.018 1.00 21.05 ? 229 ALA A N   1 
ATOM   1716 C  CA  . ALA A 1 226 ? 23.597 -6.548  -12.121 1.00 21.74 ? 229 ALA A CA  1 
ATOM   1717 C  C   . ALA A 1 226 ? 23.513 -5.751  -13.419 1.00 22.09 ? 229 ALA A C   1 
ATOM   1718 O  O   . ALA A 1 226 ? 23.021 -4.626  -13.426 1.00 24.06 ? 229 ALA A O   1 
ATOM   1719 C  CB  . ALA A 1 226 ? 22.234 -7.144  -11.797 1.00 20.32 ? 229 ALA A CB  1 
ATOM   1720 N  N   . SER A 1 227 ? 23.987 -6.339  -14.514 1.00 23.30 ? 230 SER A N   1 
ATOM   1721 C  CA  . SER A 1 227 ? 23.963 -5.673  -15.814 1.00 22.57 ? 230 SER A CA  1 
ATOM   1722 C  C   . SER A 1 227 ? 22.636 -5.873  -16.535 1.00 22.74 ? 230 SER A C   1 
ATOM   1723 O  O   . SER A 1 227 ? 22.075 -4.935  -17.103 1.00 21.48 ? 230 SER A O   1 
ATOM   1724 C  CB  . SER A 1 227 ? 25.099 -6.197  -16.689 1.00 23.88 ? 230 SER A CB  1 
ATOM   1725 O  OG  . SER A 1 227 ? 26.350 -5.971  -16.062 1.00 25.35 ? 230 SER A OG  1 
ATOM   1726 N  N   . TYR A 1 228 ? 22.149 -7.108  -16.516 1.00 23.62 ? 231 TYR A N   1 
ATOM   1727 C  CA  . TYR A 1 228 ? 20.887 -7.455  -17.149 1.00 23.77 ? 231 TYR A CA  1 
ATOM   1728 C  C   . TYR A 1 228 ? 19.818 -7.686  -16.094 1.00 24.15 ? 231 TYR A C   1 
ATOM   1729 O  O   . TYR A 1 228 ? 20.110 -7.788  -14.903 1.00 28.44 ? 231 TYR A O   1 
ATOM   1730 C  CB  . TYR A 1 228 ? 21.042 -8.736  -17.967 1.00 22.12 ? 231 TYR A CB  1 
ATOM   1731 C  CG  . TYR A 1 228 ? 21.974 -8.631  -19.148 1.00 25.90 ? 231 TYR A CG  1 
ATOM   1732 C  CD1 . TYR A 1 228 ? 22.381 -9.768  -19.829 1.00 22.89 ? 231 TYR A CD1 1 
ATOM   1733 C  CD2 . TYR A 1 228 ? 22.437 -7.394  -19.593 1.00 25.67 ? 231 TYR A CD2 1 
ATOM   1734 C  CE1 . TYR A 1 228 ? 23.219 -9.685  -20.923 1.00 25.56 ? 231 TYR A CE1 1 
ATOM   1735 C  CE2 . TYR A 1 228 ? 23.282 -7.301  -20.686 1.00 24.50 ? 231 TYR A CE2 1 
ATOM   1736 C  CZ  . TYR A 1 228 ? 23.667 -8.449  -21.345 1.00 25.21 ? 231 TYR A CZ  1 
ATOM   1737 O  OH  . TYR A 1 228 ? 24.503 -8.369  -22.431 1.00 23.90 ? 231 TYR A OH  1 
ATOM   1738 N  N   . ILE A 1 229 ? 18.573 -7.782  -16.535 1.00 24.13 ? 232 ILE A N   1 
ATOM   1739 C  CA  . ILE A 1 229 ? 17.526 -8.319  -15.687 1.00 22.65 ? 232 ILE A CA  1 
ATOM   1740 C  C   . ILE A 1 229 ? 17.704 -9.827  -15.644 1.00 21.23 ? 232 ILE A C   1 
ATOM   1741 O  O   . ILE A 1 229 ? 17.927 -10.462 -16.677 1.00 20.17 ? 232 ILE A O   1 
ATOM   1742 C  CB  . ILE A 1 229 ? 16.137 -8.017  -16.258 1.00 23.25 ? 232 ILE A CB  1 
ATOM   1743 C  CG1 . ILE A 1 229 ? 15.890 -6.504  -16.267 1.00 24.28 ? 232 ILE A CG1 1 
ATOM   1744 C  CG2 . ILE A 1 229 ? 15.081 -8.739  -15.447 1.00 20.89 ? 232 ILE A CG2 1 
ATOM   1745 C  CD1 . ILE A 1 229 ? 14.654 -6.105  -17.040 1.00 24.84 ? 232 ILE A CD1 1 
ATOM   1746 N  N   . SER A 1 230 ? 17.607 -10.409 -14.456 1.00 20.04 ? 233 SER A N   1 
ATOM   1747 C  CA  . SER A 1 230 ? 17.644 -11.858 -14.366 1.00 20.91 ? 233 SER A CA  1 
ATOM   1748 C  C   . SER A 1 230 ? 16.364 -12.412 -13.769 1.00 20.51 ? 233 SER A C   1 
ATOM   1749 O  O   . SER A 1 230 ? 15.741 -11.788 -12.914 1.00 17.95 ? 233 SER A O   1 
ATOM   1750 C  CB  . SER A 1 230 ? 18.848 -12.320 -13.533 1.00 19.19 ? 233 SER A CB  1 
ATOM   1751 O  OG  . SER A 1 230 ? 18.679 -11.968 -12.181 1.00 20.38 ? 233 SER A OG  1 
ATOM   1752 N  N   . GLY A 1 231 ? 15.974 -13.584 -14.255 1.00 21.28 ? 234 GLY A N   1 
ATOM   1753 C  CA  . GLY A 1 231 ? 14.948 -14.364 -13.598 1.00 22.50 ? 234 GLY A CA  1 
ATOM   1754 C  C   . GLY A 1 231 ? 15.443 -15.792 -13.462 1.00 24.06 ? 234 GLY A C   1 
ATOM   1755 O  O   . GLY A 1 231 ? 16.550 -16.117 -13.909 1.00 20.25 ? 234 GLY A O   1 
ATOM   1756 N  N   . SER A 1 232 ? 14.633 -16.646 -12.847 1.00 25.32 ? 235 SER A N   1 
ATOM   1757 C  CA  . SER A 1 232 ? 14.983 -18.055 -12.705 1.00 27.91 ? 235 SER A CA  1 
ATOM   1758 C  C   . SER A 1 232 ? 14.987 -18.689 -14.092 1.00 29.34 ? 235 SER A C   1 
ATOM   1759 O  O   . SER A 1 232 ? 14.294 -18.223 -14.998 1.00 30.43 ? 235 SER A O   1 
ATOM   1760 C  CB  . SER A 1 232 ? 13.949 -18.772 -11.836 1.00 28.08 ? 235 SER A CB  1 
ATOM   1761 O  OG  . SER A 1 232 ? 12.751 -18.986 -12.573 1.00 28.84 ? 235 SER A OG  1 
ATOM   1762 N  N   . THR A 1 233 ? 15.749 -19.763 -14.255 1.00 29.91 ? 236 THR A N   1 
ATOM   1763 C  CA  . THR A 1 233 ? 15.769 -20.465 -15.527 1.00 31.90 ? 236 THR A CA  1 
ATOM   1764 C  C   . THR A 1 233 ? 14.356 -20.725 -16.039 1.00 32.17 ? 236 THR A C   1 
ATOM   1765 O  O   . THR A 1 233 ? 14.052 -20.449 -17.199 1.00 34.07 ? 236 THR A O   1 
ATOM   1766 C  CB  . THR A 1 233 ? 16.484 -21.810 -15.421 1.00 30.42 ? 236 THR A CB  1 
ATOM   1767 O  OG1 . THR A 1 233 ? 17.814 -21.605 -14.934 1.00 31.95 ? 236 THR A OG1 1 
ATOM   1768 C  CG2 . THR A 1 233 ? 16.547 -22.475 -16.792 1.00 29.80 ? 236 THR A CG2 1 
ATOM   1769 N  N   . SER A 1 234 ? 13.487 -21.244 -15.176 1.00 32.31 ? 237 SER A N   1 
ATOM   1770 C  CA  . SER A 1 234 ? 12.171 -21.676 -15.633 1.00 31.92 ? 237 SER A CA  1 
ATOM   1771 C  C   . SER A 1 234 ? 11.304 -20.484 -16.036 1.00 30.37 ? 237 SER A C   1 
ATOM   1772 O  O   . SER A 1 234 ? 10.544 -20.565 -17.001 1.00 29.23 ? 237 SER A O   1 
ATOM   1773 C  CB  . SER A 1 234 ? 11.462 -22.510 -14.553 1.00 32.85 ? 237 SER A CB  1 
ATOM   1774 O  OG  . SER A 1 234 ? 10.937 -21.689 -13.528 1.00 37.20 ? 237 SER A OG  1 
ATOM   1775 N  N   . SER A 1 235 ? 11.424 -19.377 -15.311 1.00 28.78 ? 238 SER A N   1 
ATOM   1776 C  CA  . SER A 1 235 ? 10.747 -18.148 -15.717 1.00 30.46 ? 238 SER A CA  1 
ATOM   1777 C  C   . SER A 1 235 ? 11.312 -17.671 -17.046 1.00 29.58 ? 238 SER A C   1 
ATOM   1778 O  O   . SER A 1 235 ? 10.564 -17.359 -17.974 1.00 29.26 ? 238 SER A O   1 
ATOM   1779 C  CB  . SER A 1 235 ? 10.941 -17.045 -14.673 1.00 31.83 ? 238 SER A CB  1 
ATOM   1780 O  OG  . SER A 1 235 ? 10.129 -17.259 -13.535 1.00 34.46 ? 238 SER A OG  1 
ATOM   1781 N  N   . ILE A 1 236 ? 12.637 -17.619 -17.131 1.00 28.25 ? 239 ILE A N   1 
ATOM   1782 C  CA  . ILE A 1 236 ? 13.297 -17.056 -18.300 1.00 27.13 ? 239 ILE A CA  1 
ATOM   1783 C  C   . ILE A 1 236 ? 13.031 -17.900 -19.534 1.00 28.44 ? 239 ILE A C   1 
ATOM   1784 O  O   . ILE A 1 236 ? 12.814 -17.362 -20.623 1.00 26.22 ? 239 ILE A O   1 
ATOM   1785 C  CB  . ILE A 1 236 ? 14.821 -16.931 -18.075 1.00 27.69 ? 239 ILE A CB  1 
ATOM   1786 C  CG1 . ILE A 1 236 ? 15.091 -15.860 -17.015 1.00 27.19 ? 239 ILE A CG1 1 
ATOM   1787 C  CG2 . ILE A 1 236 ? 15.530 -16.587 -19.381 1.00 26.75 ? 239 ILE A CG2 1 
ATOM   1788 C  CD1 . ILE A 1 236 ? 14.293 -14.608 -17.202 1.00 23.60 ? 239 ILE A CD1 1 
ATOM   1789 N  N   . GLU A 1 237 ? 13.030 -19.221 -19.361 1.00 29.63 ? 240 GLU A N   1 
ATOM   1790 C  CA  . GLU A 1 237 ? 12.727 -20.125 -20.466 1.00 31.65 ? 240 GLU A CA  1 
ATOM   1791 C  C   . GLU A 1 237 ? 11.397 -19.738 -21.088 1.00 32.19 ? 240 GLU A C   1 
ATOM   1792 O  O   . GLU A 1 237 ? 11.296 -19.610 -22.308 1.00 30.71 ? 240 GLU A O   1 
ATOM   1793 C  CB  . GLU A 1 237 ? 12.659 -21.577 -19.988 1.00 32.16 ? 240 GLU A CB  1 
ATOM   1794 C  CG  . GLU A 1 237 ? 14.007 -22.190 -19.659 1.00 38.21 ? 240 GLU A CG  1 
ATOM   1795 C  CD  . GLU A 1 237 ? 13.905 -23.669 -19.327 1.00 40.21 ? 240 GLU A CD  1 
ATOM   1796 O  OE1 . GLU A 1 237 ? 14.947 -24.356 -19.317 1.00 41.69 ? 240 GLU A OE1 1 
ATOM   1797 O  OE2 . GLU A 1 237 ? 12.778 -24.144 -19.078 1.00 41.74 ? 240 GLU A OE2 1 
ATOM   1798 N  N   . LYS A 1 238 ? 10.386 -19.534 -20.244 1.00 33.20 ? 241 LYS A N   1 
ATOM   1799 C  CA  . LYS A 1 238 ? 9.047  -19.198 -20.719 1.00 33.82 ? 241 LYS A CA  1 
ATOM   1800 C  C   . LYS A 1 238 ? 9.074  -17.846 -21.420 1.00 33.67 ? 241 LYS A C   1 
ATOM   1801 O  O   . LYS A 1 238 ? 8.569  -17.695 -22.537 1.00 30.79 ? 241 LYS A O   1 
ATOM   1802 C  CB  . LYS A 1 238 ? 8.059  -19.127 -19.548 1.00 36.32 ? 241 LYS A CB  1 
ATOM   1803 C  CG  . LYS A 1 238 ? 7.881  -20.424 -18.770 1.00 39.23 ? 241 LYS A CG  1 
ATOM   1804 C  CD  . LYS A 1 238 ? 6.836  -20.240 -17.677 1.00 43.02 ? 241 LYS A CD  1 
ATOM   1805 C  CE  . LYS A 1 238 ? 6.676  -21.489 -16.817 1.00 44.44 ? 241 LYS A CE  1 
ATOM   1806 N  NZ  . LYS A 1 238 ? 7.888  -21.754 -15.991 1.00 47.74 ? 241 LYS A NZ  1 
ATOM   1807 N  N   . LEU A 1 239 ? 9.668  -16.866 -20.747 1.00 31.97 ? 242 LEU A N   1 
ATOM   1808 C  CA  . LEU A 1 239 ? 9.760  -15.521 -21.280 1.00 30.92 ? 242 LEU A CA  1 
ATOM   1809 C  C   . LEU A 1 239 ? 10.402 -15.548 -22.660 1.00 30.62 ? 242 LEU A C   1 
ATOM   1810 O  O   . LEU A 1 239 ? 9.836  -15.031 -23.628 1.00 29.11 ? 242 LEU A O   1 
ATOM   1811 C  CB  . LEU A 1 239 ? 10.568 -14.631 -20.327 1.00 30.33 ? 242 LEU A CB  1 
ATOM   1812 C  CG  . LEU A 1 239 ? 10.727 -13.164 -20.733 1.00 31.89 ? 242 LEU A CG  1 
ATOM   1813 C  CD1 . LEU A 1 239 ? 10.861 -12.271 -19.498 1.00 31.62 ? 242 LEU A CD1 1 
ATOM   1814 C  CD2 . LEU A 1 239 ? 11.945 -13.035 -21.621 1.00 31.22 ? 242 LEU A CD2 1 
ATOM   1815 N  N   . MET A 1 240 ? 11.572 -16.169 -22.756 1.00 29.78 ? 243 MET A N   1 
ATOM   1816 C  CA  . MET A 1 240 ? 12.276 -16.239 -24.025 1.00 29.15 ? 243 MET A CA  1 
ATOM   1817 C  C   . MET A 1 240 ? 11.476 -16.993 -25.078 1.00 29.96 ? 243 MET A C   1 
ATOM   1818 O  O   . MET A 1 240 ? 11.522 -16.657 -26.258 1.00 28.33 ? 243 MET A O   1 
ATOM   1819 C  CB  . MET A 1 240 ? 13.635 -16.900 -23.835 1.00 27.33 ? 243 MET A CB  1 
ATOM   1820 C  CG  . MET A 1 240 ? 14.572 -16.068 -22.998 1.00 26.21 ? 243 MET A CG  1 
ATOM   1821 S  SD  . MET A 1 240 ? 14.929 -14.499 -23.793 1.00 28.00 ? 243 MET A SD  1 
ATOM   1822 C  CE  . MET A 1 240 ? 15.631 -13.568 -22.417 1.00 25.24 ? 243 MET A CE  1 
ATOM   1823 N  N   . GLU A 1 241 ? 10.738 -18.010 -24.655 1.00 31.65 ? 244 GLU A N   1 
ATOM   1824 C  CA  . GLU A 1 241 ? 9.882  -18.733 -25.586 1.00 34.33 ? 244 GLU A CA  1 
ATOM   1825 C  C   . GLU A 1 241 ? 8.790  -17.812 -26.124 1.00 33.47 ? 244 GLU A C   1 
ATOM   1826 O  O   . GLU A 1 241 ? 8.453  -17.854 -27.306 1.00 32.91 ? 244 GLU A O   1 
ATOM   1827 C  CB  . GLU A 1 241 ? 9.243  -19.938 -24.903 1.00 36.08 ? 244 GLU A CB  1 
ATOM   1828 C  CG  . GLU A 1 241 ? 8.417  -20.782 -25.841 1.00 42.40 ? 244 GLU A CG  1 
ATOM   1829 C  CD  . GLU A 1 241 ? 7.713  -21.915 -25.126 1.00 46.75 ? 244 GLU A CD  1 
ATOM   1830 O  OE1 . GLU A 1 241 ? 8.159  -23.075 -25.273 1.00 48.79 ? 244 GLU A OE1 1 
ATOM   1831 O  OE2 . GLU A 1 241 ? 6.717  -21.643 -24.418 1.00 47.84 ? 244 GLU A OE2 1 
ATOM   1832 N  N   . ALA A 1 242 ? 8.238  -16.974 -25.257 1.00 32.79 ? 245 ALA A N   1 
ATOM   1833 C  CA  . ALA A 1 242 ? 7.212  -16.046 -25.694 1.00 33.73 ? 245 ALA A CA  1 
ATOM   1834 C  C   . ALA A 1 242 ? 7.772  -15.131 -26.787 1.00 35.40 ? 245 ALA A C   1 
ATOM   1835 O  O   . ALA A 1 242 ? 7.079  -14.830 -27.765 1.00 35.32 ? 245 ALA A O   1 
ATOM   1836 C  CB  . ALA A 1 242 ? 6.716  -15.227 -24.518 1.00 31.77 ? 245 ALA A CB  1 
ATOM   1837 N  N   . LEU A 1 243 ? 9.029  -14.711 -26.628 1.00 33.53 ? 246 LEU A N   1 
ATOM   1838 C  CA  . LEU A 1 243 ? 9.645  -13.724 -27.517 1.00 32.52 ? 246 LEU A CA  1 
ATOM   1839 C  C   . LEU A 1 243 ? 10.249 -14.331 -28.786 1.00 34.12 ? 246 LEU A C   1 
ATOM   1840 O  O   . LEU A 1 243 ? 10.680 -13.601 -29.686 1.00 35.96 ? 246 LEU A O   1 
ATOM   1841 C  CB  . LEU A 1 243 ? 10.737 -12.958 -26.769 1.00 33.13 ? 246 LEU A CB  1 
ATOM   1842 C  CG  . LEU A 1 243 ? 10.348 -12.233 -25.478 1.00 33.17 ? 246 LEU A CG  1 
ATOM   1843 C  CD1 . LEU A 1 243 ? 11.606 -11.804 -24.732 1.00 34.37 ? 246 LEU A CD1 1 
ATOM   1844 C  CD2 . LEU A 1 243 ? 9.494  -11.025 -25.807 1.00 35.63 ? 246 LEU A CD2 1 
ATOM   1845 N  N   . GLY A 1 244 ? 10.295 -15.659 -28.849 1.00 32.56 ? 247 GLY A N   1 
ATOM   1846 C  CA  . GLY A 1 244 ? 10.928 -16.329 -29.972 1.00 33.16 ? 247 GLY A CA  1 
ATOM   1847 C  C   . GLY A 1 244 ? 12.443 -16.291 -29.892 1.00 34.44 ? 247 GLY A C   1 
ATOM   1848 O  O   . GLY A 1 244 ? 13.132 -16.544 -30.883 1.00 34.70 ? 247 GLY A O   1 
ATOM   1849 N  N   . ALA A 1 245 ? 12.965 -15.978 -28.708 1.00 35.07 ? 248 ALA A N   1 
ATOM   1850 C  CA  . ALA A 1 245 ? 14.396 -15.762 -28.530 1.00 35.10 ? 248 ALA A CA  1 
ATOM   1851 C  C   . ALA A 1 245 ? 15.141 -17.088 -28.491 1.00 35.75 ? 248 ALA A C   1 
ATOM   1852 O  O   . ALA A 1 245 ? 14.589 -18.108 -28.091 1.00 36.98 ? 248 ALA A O   1 
ATOM   1853 C  CB  . ALA A 1 245 ? 14.645 -14.987 -27.251 1.00 35.74 ? 248 ALA A CB  1 
ATOM   1854 N  N   . LYS A 1 246 ? 16.397 -17.069 -28.918 1.00 35.23 ? 249 LYS A N   1 
ATOM   1855 C  CA  . LYS A 1 246 ? 17.189 -18.284 -28.980 1.00 36.54 ? 249 LYS A CA  1 
ATOM   1856 C  C   . LYS A 1 246 ? 18.311 -18.266 -27.959 1.00 35.36 ? 249 LYS A C   1 
ATOM   1857 O  O   . LYS A 1 246 ? 18.949 -17.236 -27.731 1.00 33.67 ? 249 LYS A O   1 
ATOM   1858 C  CB  . LYS A 1 246 ? 17.764 -18.470 -30.385 1.00 39.28 ? 249 LYS A CB  1 
ATOM   1859 C  CG  . LYS A 1 246 ? 16.694 -18.555 -31.463 1.00 45.41 ? 249 LYS A CG  1 
ATOM   1860 C  CD  . LYS A 1 246 ? 15.653 -19.620 -31.131 1.00 47.04 ? 249 LYS A CD  1 
ATOM   1861 C  CE  . LYS A 1 246 ? 14.417 -19.477 -32.020 1.00 50.37 ? 249 LYS A CE  1 
ATOM   1862 N  NZ  . LYS A 1 246 ? 13.405 -20.555 -31.790 1.00 49.61 ? 249 LYS A NZ  1 
ATOM   1863 N  N   . LYS A 1 247 ? 18.547 -19.418 -27.346 1.00 34.28 ? 250 LYS A N   1 
ATOM   1864 C  CA  . LYS A 1 247 ? 19.557 -19.532 -26.311 1.00 34.74 ? 250 LYS A CA  1 
ATOM   1865 C  C   . LYS A 1 247 ? 20.926 -19.818 -26.920 1.00 34.93 ? 250 LYS A C   1 
ATOM   1866 O  O   . LYS A 1 247 ? 21.136 -20.867 -27.533 1.00 33.97 ? 250 LYS A O   1 
ATOM   1867 C  CB  . LYS A 1 247 ? 19.168 -20.646 -25.341 1.00 36.17 ? 250 LYS A CB  1 
ATOM   1868 C  CG  . LYS A 1 247 ? 20.232 -21.001 -24.335 1.00 38.85 ? 250 LYS A CG  1 
ATOM   1869 C  CD  . LYS A 1 247 ? 20.535 -19.835 -23.419 1.00 41.80 ? 250 LYS A CD  1 
ATOM   1870 C  CE  . LYS A 1 247 ? 21.043 -20.350 -22.086 1.00 45.27 ? 250 LYS A CE  1 
ATOM   1871 N  NZ  . LYS A 1 247 ? 20.347 -21.624 -21.728 1.00 45.61 ? 250 LYS A NZ  1 
ATOM   1872 N  N   . ARG A 1 248 ? 21.846 -18.870 -26.758 1.00 34.44 ? 251 ARG A N   1 
ATOM   1873 C  CA  . ARG A 1 248 ? 23.250 -19.060 -27.118 1.00 35.56 ? 251 ARG A CA  1 
ATOM   1874 C  C   . ARG A 1 248 ? 24.035 -19.452 -25.865 1.00 35.20 ? 251 ARG A C   1 
ATOM   1875 O  O   . ARG A 1 248 ? 23.455 -19.653 -24.798 1.00 35.85 ? 251 ARG A O   1 
ATOM   1876 C  CB  . ARG A 1 248 ? 23.841 -17.767 -27.691 1.00 35.88 ? 251 ARG A CB  1 
ATOM   1877 C  CG  . ARG A 1 248 ? 23.257 -17.308 -29.019 1.00 38.41 ? 251 ARG A CG  1 
ATOM   1878 C  CD  . ARG A 1 248 ? 24.372 -17.090 -30.036 1.00 37.64 ? 251 ARG A CD  1 
ATOM   1879 N  NE  . ARG A 1 248 ? 24.505 -15.702 -30.483 1.00 41.64 ? 251 ARG A NE  1 
ATOM   1880 C  CZ  . ARG A 1 248 ? 25.052 -14.724 -29.767 1.00 40.64 ? 251 ARG A CZ  1 
ATOM   1881 N  NH1 . ARG A 1 248 ? 25.518 -14.962 -28.551 1.00 41.13 ? 251 ARG A NH1 1 
ATOM   1882 N  NH2 . ARG A 1 248 ? 25.156 -13.507 -30.275 1.00 39.92 ? 251 ARG A NH2 1 
ATOM   1883 N  N   . LEU A 1 249 ? 25.356 -19.539 -25.989 1.00 35.02 ? 252 LEU A N   1 
ATOM   1884 C  CA  . LEU A 1 249 ? 26.203 -19.921 -24.860 1.00 35.13 ? 252 LEU A CA  1 
ATOM   1885 C  C   . LEU A 1 249 ? 26.225 -18.903 -23.710 1.00 34.60 ? 252 LEU A C   1 
ATOM   1886 O  O   . LEU A 1 249 ? 26.138 -19.281 -22.545 1.00 35.33 ? 252 LEU A O   1 
ATOM   1887 C  CB  . LEU A 1 249 ? 27.631 -20.165 -25.340 1.00 34.82 ? 252 LEU A CB  1 
ATOM   1888 C  CG  . LEU A 1 249 ? 28.636 -20.505 -24.239 1.00 34.75 ? 252 LEU A CG  1 
ATOM   1889 C  CD1 . LEU A 1 249 ? 28.371 -21.917 -23.727 1.00 32.16 ? 252 LEU A CD1 1 
ATOM   1890 C  CD2 . LEU A 1 249 ? 30.056 -20.380 -24.790 1.00 34.50 ? 252 LEU A CD2 1 
ATOM   1891 N  N   . PHE A 1 250 ? 26.349 -17.619 -24.030 1.00 34.50 ? 253 PHE A N   1 
ATOM   1892 C  CA  . PHE A 1 250 ? 26.443 -16.586 -22.995 1.00 36.03 ? 253 PHE A CA  1 
ATOM   1893 C  C   . PHE A 1 250 ? 25.228 -15.661 -22.901 1.00 35.42 ? 253 PHE A C   1 
ATOM   1894 O  O   . PHE A 1 250 ? 25.113 -14.896 -21.945 1.00 36.04 ? 253 PHE A O   1 
ATOM   1895 C  CB  . PHE A 1 250 ? 27.683 -15.717 -23.211 1.00 37.51 ? 253 PHE A CB  1 
ATOM   1896 C  CG  . PHE A 1 250 ? 28.970 -16.477 -23.185 1.00 41.32 ? 253 PHE A CG  1 
ATOM   1897 C  CD1 . PHE A 1 250 ? 29.223 -17.403 -22.188 1.00 44.44 ? 253 PHE A CD1 1 
ATOM   1898 C  CD2 . PHE A 1 250 ? 29.939 -16.248 -24.145 1.00 43.25 ? 253 PHE A CD2 1 
ATOM   1899 C  CE1 . PHE A 1 250 ? 30.425 -18.089 -22.148 1.00 45.67 ? 253 PHE A CE1 1 
ATOM   1900 C  CE2 . PHE A 1 250 ? 31.144 -16.927 -24.113 1.00 45.54 ? 253 PHE A CE2 1 
ATOM   1901 C  CZ  . PHE A 1 250 ? 31.387 -17.851 -23.111 1.00 45.94 ? 253 PHE A CZ  1 
ATOM   1902 N  N   . ASP A 1 251 ? 24.338 -15.705 -23.889 1.00 35.36 ? 254 ASP A N   1 
ATOM   1903 C  CA  . ASP A 1 251 ? 23.201 -14.784 -23.908 1.00 33.84 ? 254 ASP A CA  1 
ATOM   1904 C  C   . ASP A 1 251 ? 21.977 -15.351 -24.616 1.00 32.37 ? 254 ASP A C   1 
ATOM   1905 O  O   . ASP A 1 251 ? 21.981 -16.492 -25.065 1.00 32.67 ? 254 ASP A O   1 
ATOM   1906 C  CB  . ASP A 1 251 ? 23.602 -13.468 -24.582 1.00 35.52 ? 254 ASP A CB  1 
ATOM   1907 C  CG  . ASP A 1 251 ? 24.056 -13.666 -26.010 1.00 37.56 ? 254 ASP A CG  1 
ATOM   1908 O  OD1 . ASP A 1 251 ? 24.148 -14.835 -26.440 1.00 39.29 ? 254 ASP A OD1 1 
ATOM   1909 O  OD2 . ASP A 1 251 ? 24.321 -12.663 -26.703 1.00 37.69 ? 254 ASP A OD2 1 
ATOM   1910 N  N   . TYR A 1 252 ? 20.928 -14.538 -24.698 1.00 30.22 ? 255 TYR A N   1 
ATOM   1911 C  CA  . TYR A 1 252 ? 19.780 -14.818 -25.548 1.00 28.99 ? 255 TYR A CA  1 
ATOM   1912 C  C   . TYR A 1 252 ? 19.727 -13.805 -26.692 1.00 29.63 ? 255 TYR A C   1 
ATOM   1913 O  O   . TYR A 1 252 ? 19.962 -12.610 -26.486 1.00 26.00 ? 255 TYR A O   1 
ATOM   1914 C  CB  . TYR A 1 252 ? 18.483 -14.740 -24.736 1.00 30.18 ? 255 TYR A CB  1 
ATOM   1915 C  CG  . TYR A 1 252 ? 18.190 -15.982 -23.927 1.00 32.92 ? 255 TYR A CG  1 
ATOM   1916 C  CD1 . TYR A 1 252 ? 17.409 -17.005 -24.451 1.00 33.90 ? 255 TYR A CD1 1 
ATOM   1917 C  CD2 . TYR A 1 252 ? 18.701 -16.137 -22.643 1.00 34.51 ? 255 TYR A CD2 1 
ATOM   1918 C  CE1 . TYR A 1 252 ? 17.142 -18.149 -23.716 1.00 35.47 ? 255 TYR A CE1 1 
ATOM   1919 C  CE2 . TYR A 1 252 ? 18.441 -17.279 -21.901 1.00 35.81 ? 255 TYR A CE2 1 
ATOM   1920 C  CZ  . TYR A 1 252 ? 17.659 -18.278 -22.442 1.00 36.07 ? 255 TYR A CZ  1 
ATOM   1921 O  OH  . TYR A 1 252 ? 17.371 -19.404 -21.697 1.00 41.64 ? 255 TYR A OH  1 
ATOM   1922 N  N   . VAL A 1 253 ? 19.411 -14.288 -27.892 1.00 29.47 ? 256 VAL A N   1 
ATOM   1923 C  CA  . VAL A 1 253 ? 19.343 -13.429 -29.068 1.00 29.46 ? 256 VAL A CA  1 
ATOM   1924 C  C   . VAL A 1 253 ? 18.021 -13.533 -29.822 1.00 30.89 ? 256 VAL A C   1 
ATOM   1925 O  O   . VAL A 1 253 ? 17.287 -14.519 -29.702 1.00 30.60 ? 256 VAL A O   1 
ATOM   1926 C  CB  . VAL A 1 253 ? 20.479 -13.744 -30.058 1.00 28.70 ? 256 VAL A CB  1 
ATOM   1927 C  CG1 . VAL A 1 253 ? 21.814 -13.392 -29.429 1.00 28.34 ? 256 VAL A CG1 1 
ATOM   1928 C  CG2 . VAL A 1 253 ? 20.433 -15.222 -30.458 1.00 24.70 ? 256 VAL A CG2 1 
ATOM   1929 N  N   . VAL A 1 254 ? 17.725 -12.491 -30.592 1.00 31.23 ? 257 VAL A N   1 
ATOM   1930 C  CA  . VAL A 1 254 ? 16.681 -12.536 -31.606 1.00 31.27 ? 257 VAL A CA  1 
ATOM   1931 C  C   . VAL A 1 254 ? 17.306 -12.042 -32.903 1.00 30.75 ? 257 VAL A C   1 
ATOM   1932 O  O   . VAL A 1 254 ? 18.356 -11.405 -32.889 1.00 30.09 ? 257 VAL A O   1 
ATOM   1933 C  CB  . VAL A 1 254 ? 15.497 -11.612 -31.251 1.00 31.00 ? 257 VAL A CB  1 
ATOM   1934 C  CG1 . VAL A 1 254 ? 14.869 -12.038 -29.923 1.00 30.30 ? 257 VAL A CG1 1 
ATOM   1935 C  CG2 . VAL A 1 254 ? 15.975 -10.178 -31.169 1.00 30.11 ? 257 VAL A CG2 1 
ATOM   1936 N  N   . LYS A 1 255 ? 16.669 -12.344 -34.025 1.00 30.79 ? 258 LYS A N   1 
ATOM   1937 C  CA  . LYS A 1 255 ? 17.016 -11.688 -35.277 1.00 31.36 ? 258 LYS A CA  1 
ATOM   1938 C  C   . LYS A 1 255 ? 16.846 -10.186 -35.081 1.00 31.01 ? 258 LYS A C   1 
ATOM   1939 O  O   . LYS A 1 255 ? 15.793 -9.725  -34.646 1.00 28.23 ? 258 LYS A O   1 
ATOM   1940 C  CB  . LYS A 1 255 ? 16.092 -12.166 -36.394 1.00 33.14 ? 258 LYS A CB  1 
ATOM   1941 C  CG  . LYS A 1 255 ? 16.085 -13.669 -36.580 1.00 35.09 ? 258 LYS A CG  1 
ATOM   1942 C  CD  . LYS A 1 255 ? 17.439 -14.170 -37.032 1.00 40.21 ? 258 LYS A CD  1 
ATOM   1943 C  CE  . LYS A 1 255 ? 17.383 -15.651 -37.394 1.00 43.29 ? 258 LYS A CE  1 
ATOM   1944 N  NZ  . LYS A 1 255 ? 18.710 -16.148 -37.873 1.00 45.64 ? 258 LYS A NZ  1 
ATOM   1945 N  N   . CYS A 1 256 ? 17.892 -9.430  -35.404 1.00 32.27 ? 259 CYS A N   1 
ATOM   1946 C  CA  . CYS A 1 256 ? 17.902 -7.988  -35.194 1.00 32.83 ? 259 CYS A CA  1 
ATOM   1947 C  C   . CYS A 1 256 ? 16.698 -7.320  -35.831 1.00 33.37 ? 259 CYS A C   1 
ATOM   1948 O  O   . CYS A 1 256 ? 16.123 -6.391  -35.266 1.00 33.87 ? 259 CYS A O   1 
ATOM   1949 C  CB  . CYS A 1 256 ? 19.174 -7.387  -35.783 1.00 33.53 ? 259 CYS A CB  1 
ATOM   1950 S  SG  . CYS A 1 256 ? 20.670 -8.238  -35.253 1.00 36.75 ? 259 CYS A SG  1 
ATOM   1951 N  N   . ASN A 1 257 ? 16.314 -7.798  -37.008 1.00 33.66 ? 260 ASN A N   1 
ATOM   1952 C  CA  . ASN A 1 257 ? 15.273 -7.136  -37.778 1.00 35.35 ? 260 ASN A CA  1 
ATOM   1953 C  C   . ASN A 1 257 ? 13.904 -7.234  -37.113 1.00 36.82 ? 260 ASN A C   1 
ATOM   1954 O  O   . ASN A 1 257 ? 13.024 -6.422  -37.389 1.00 36.99 ? 260 ASN A O   1 
ATOM   1955 C  CB  . ASN A 1 257 ? 15.205 -7.719  -39.193 1.00 36.45 ? 260 ASN A CB  1 
ATOM   1956 C  CG  . ASN A 1 257 ? 14.624 -9.117  -39.225 1.00 38.22 ? 260 ASN A CG  1 
ATOM   1957 O  OD1 . ASN A 1 257 ? 15.155 -10.049 -38.608 1.00 38.41 ? 260 ASN A OD1 1 
ATOM   1958 N  ND2 . ASN A 1 257 ? 13.523 -9.274  -39.950 1.00 38.71 ? 260 ASN A ND2 1 
ATOM   1959 N  N   . GLU A 1 258 ? 13.719 -8.216  -36.234 1.00 37.45 ? 261 GLU A N   1 
ATOM   1960 C  CA  . GLU A 1 258 ? 12.449 -8.330  -35.527 1.00 38.46 ? 261 GLU A CA  1 
ATOM   1961 C  C   . GLU A 1 258 ? 12.450 -7.814  -34.088 1.00 35.80 ? 261 GLU A C   1 
ATOM   1962 O  O   . GLU A 1 258 ? 11.393 -7.700  -33.466 1.00 34.80 ? 261 GLU A O   1 
ATOM   1963 C  CB  . GLU A 1 258 ? 11.942 -9.776  -35.564 1.00 40.99 ? 261 GLU A CB  1 
ATOM   1964 C  CG  . GLU A 1 258 ? 13.006 -10.837 -35.488 1.00 44.97 ? 261 GLU A CG  1 
ATOM   1965 C  CD  . GLU A 1 258 ? 12.442 -12.221 -35.745 1.00 48.62 ? 261 GLU A CD  1 
ATOM   1966 O  OE1 . GLU A 1 258 ? 11.217 -12.405 -35.570 1.00 51.16 ? 261 GLU A OE1 1 
ATOM   1967 O  OE2 . GLU A 1 258 ? 13.218 -13.124 -36.121 1.00 51.08 ? 261 GLU A OE2 1 
ATOM   1968 N  N   . GLY A 1 259 ? 13.624 -7.489  -33.562 1.00 36.03 ? 262 GLY A N   1 
ATOM   1969 C  CA  . GLY A 1 259 ? 13.690 -6.945  -32.214 1.00 34.69 ? 262 GLY A CA  1 
ATOM   1970 C  C   . GLY A 1 259 ? 12.679 -5.841  -31.938 1.00 34.74 ? 262 GLY A C   1 
ATOM   1971 O  O   . GLY A 1 259 ? 11.953 -5.895  -30.942 1.00 34.68 ? 262 GLY A O   1 
ATOM   1972 N  N   . PRO A 1 260 ? 12.598 -4.825  -32.811 1.00 34.18 ? 263 PRO A N   1 
ATOM   1973 C  CA  . PRO A 1 260 ? 11.699 -3.681  -32.620 1.00 33.89 ? 263 PRO A CA  1 
ATOM   1974 C  C   . PRO A 1 260 ? 10.220 -4.032  -32.432 1.00 34.16 ? 263 PRO A C   1 
ATOM   1975 O  O   . PRO A 1 260 ? 9.512  -3.356  -31.681 1.00 33.84 ? 263 PRO A O   1 
ATOM   1976 C  CB  . PRO A 1 260 ? 11.932 -2.830  -33.868 1.00 35.80 ? 263 PRO A CB  1 
ATOM   1977 C  CG  . PRO A 1 260 ? 13.328 -3.174  -34.286 1.00 36.88 ? 263 PRO A CG  1 
ATOM   1978 C  CD  . PRO A 1 260 ? 13.468 -4.643  -33.987 1.00 35.10 ? 263 PRO A CD  1 
ATOM   1979 N  N   . THR A 1 261 ? 9.746  -5.075  -33.107 1.00 34.43 ? 264 THR A N   1 
ATOM   1980 C  CA  . THR A 1 261 ? 8.344  -5.453  -32.976 1.00 35.83 ? 264 THR A CA  1 
ATOM   1981 C  C   . THR A 1 261 ? 8.076  -6.533  -31.923 1.00 35.66 ? 264 THR A C   1 
ATOM   1982 O  O   . THR A 1 261 ? 6.961  -7.045  -31.831 1.00 36.62 ? 264 THR A O   1 
ATOM   1983 C  CB  . THR A 1 261 ? 7.744  -5.912  -34.331 1.00 37.04 ? 264 THR A CB  1 
ATOM   1984 O  OG1 . THR A 1 261 ? 8.548  -6.954  -34.892 1.00 34.70 ? 264 THR A OG1 1 
ATOM   1985 C  CG2 . THR A 1 261 ? 7.671  -4.736  -35.308 1.00 37.23 ? 264 THR A CG2 1 
ATOM   1986 N  N   . LEU A 1 262 ? 9.089  -6.871  -31.127 1.00 34.30 ? 265 LEU A N   1 
ATOM   1987 C  CA  . LEU A 1 262 ? 8.880  -7.735  -29.962 1.00 32.34 ? 265 LEU A CA  1 
ATOM   1988 C  C   . LEU A 1 262 ? 8.017  -7.016  -28.938 1.00 31.47 ? 265 LEU A C   1 
ATOM   1989 O  O   . LEU A 1 262 ? 8.017  -5.787  -28.865 1.00 29.93 ? 265 LEU A O   1 
ATOM   1990 C  CB  . LEU A 1 262 ? 10.211 -8.114  -29.309 1.00 30.79 ? 265 LEU A CB  1 
ATOM   1991 C  CG  . LEU A 1 262 ? 11.134 -9.001  -30.136 1.00 30.79 ? 265 LEU A CG  1 
ATOM   1992 C  CD1 . LEU A 1 262 ? 12.387 -9.328  -29.334 1.00 31.15 ? 265 LEU A CD1 1 
ATOM   1993 C  CD2 . LEU A 1 262 ? 10.391 -10.267 -30.529 1.00 32.55 ? 265 LEU A CD2 1 
ATOM   1994 N  N   . PRO A 1 263 ? 7.275  -7.784  -28.122 1.00 31.17 ? 266 PRO A N   1 
ATOM   1995 C  CA  . PRO A 1 263 ? 6.323  -7.254  -27.141 1.00 30.19 ? 266 PRO A CA  1 
ATOM   1996 C  C   . PRO A 1 263 ? 6.971  -6.517  -25.976 1.00 30.87 ? 266 PRO A C   1 
ATOM   1997 O  O   . PRO A 1 263 ? 8.147  -6.728  -25.666 1.00 29.43 ? 266 PRO A O   1 
ATOM   1998 C  CB  . PRO A 1 263 ? 5.564  -8.491  -26.671 1.00 31.85 ? 266 PRO A CB  1 
ATOM   1999 C  CG  . PRO A 1 263 ? 6.516  -9.611  -26.882 1.00 33.64 ? 266 PRO A CG  1 
ATOM   2000 C  CD  . PRO A 1 263 ? 7.326  -9.256  -28.101 1.00 31.89 ? 266 PRO A CD  1 
ATOM   2001 N  N   . ASP A 1 264 ? 6.188  -5.656  -25.334 1.00 29.05 ? 267 ASP A N   1 
ATOM   2002 C  CA  . ASP A 1 264 ? 6.587  -5.026  -24.084 1.00 30.71 ? 267 ASP A CA  1 
ATOM   2003 C  C   . ASP A 1 264 ? 6.679  -6.075  -22.989 1.00 31.22 ? 267 ASP A C   1 
ATOM   2004 O  O   . ASP A 1 264 ? 6.024  -7.121  -23.052 1.00 30.33 ? 267 ASP A O   1 
ATOM   2005 C  CB  . ASP A 1 264 ? 5.572  -3.960  -23.655 1.00 30.23 ? 267 ASP A CB  1 
ATOM   2006 C  CG  . ASP A 1 264 ? 5.642  -2.704  -24.502 1.00 31.50 ? 267 ASP A CG  1 
ATOM   2007 O  OD1 . ASP A 1 264 ? 6.599  -2.567  -25.290 1.00 31.57 ? 267 ASP A OD1 1 
ATOM   2008 O  OD2 . ASP A 1 264 ? 4.738  -1.850  -24.376 1.00 32.21 ? 267 ASP A OD2 1 
ATOM   2009 N  N   . ILE A 1 265 ? 7.494  -5.781  -21.983 1.00 30.42 ? 268 ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 265 ? 7.592  -6.617  -20.799 1.00 30.00 ? 268 ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 265 ? 7.366  -5.731  -19.580 1.00 29.06 ? 268 ILE A C   1 
ATOM   2012 O  O   . ILE A 1 265 ? 8.089  -4.760  -19.364 1.00 27.21 ? 268 ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 265 ? 8.981  -7.281  -20.725 1.00 31.14 ? 268 ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 265 ? 9.213  -8.116  -21.990 1.00 31.19 ? 268 ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 265 ? 9.084  -8.157  -19.481 1.00 31.42 ? 268 ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 265 ? 10.598 -8.709  -22.094 1.00 30.66 ? 268 ILE A CD1 1 
ATOM   2017 N  N   . SER A 1 266 ? 6.350  -6.047  -18.790 1.00 27.50 ? 269 SER A N   1 
ATOM   2018 C  CA  . SER A 1 266 ? 6.027  -5.201  -17.652 1.00 28.94 ? 269 SER A CA  1 
ATOM   2019 C  C   . SER A 1 266 ? 6.237  -5.930  -16.336 1.00 28.69 ? 269 SER A C   1 
ATOM   2020 O  O   . SER A 1 266 ? 5.878  -7.099  -16.190 1.00 27.26 ? 269 SER A O   1 
ATOM   2021 C  CB  . SER A 1 266 ? 4.581  -4.710  -17.751 1.00 29.73 ? 269 SER A CB  1 
ATOM   2022 O  OG  . SER A 1 266 ? 4.334  -4.133  -19.024 1.00 34.72 ? 269 SER A OG  1 
ATOM   2023 N  N   . PHE A 1 267 ? 6.828  -5.225  -15.382 1.00 28.63 ? 270 PHE A N   1 
ATOM   2024 C  CA  . PHE A 1 267 ? 7.045  -5.769  -14.057 1.00 28.55 ? 270 PHE A CA  1 
ATOM   2025 C  C   . PHE A 1 267 ? 6.084  -5.081  -13.103 1.00 29.48 ? 270 PHE A C   1 
ATOM   2026 O  O   . PHE A 1 267 ? 6.072  -3.857  -13.002 1.00 26.85 ? 270 PHE A O   1 
ATOM   2027 C  CB  . PHE A 1 267 ? 8.497  -5.541  -13.638 1.00 27.03 ? 270 PHE A CB  1 
ATOM   2028 C  CG  . PHE A 1 267 ? 9.494  -6.184  -14.565 1.00 28.09 ? 270 PHE A CG  1 
ATOM   2029 C  CD1 . PHE A 1 267 ? 9.873  -7.508  -14.388 1.00 27.05 ? 270 PHE A CD1 1 
ATOM   2030 C  CD2 . PHE A 1 267 ? 10.010 -5.485  -15.645 1.00 28.18 ? 270 PHE A CD2 1 
ATOM   2031 C  CE1 . PHE A 1 267 ? 10.745 -8.128  -15.272 1.00 27.13 ? 270 PHE A CE1 1 
ATOM   2032 C  CE2 . PHE A 1 267 ? 10.883 -6.098  -16.535 1.00 29.35 ? 270 PHE A CE2 1 
ATOM   2033 C  CZ  . PHE A 1 267 ? 11.251 -7.422  -16.350 1.00 25.94 ? 270 PHE A CZ  1 
ATOM   2034 N  N   . HIS A 1 268 ? 5.266  -5.870  -12.413 1.00 30.90 ? 271 HIS A N   1 
ATOM   2035 C  CA  . HIS A 1 268 ? 4.196  -5.303  -11.602 1.00 33.00 ? 271 HIS A CA  1 
ATOM   2036 C  C   . HIS A 1 268 ? 4.671  -5.085  -10.173 1.00 30.91 ? 271 HIS A C   1 
ATOM   2037 O  O   . HIS A 1 268 ? 4.744  -6.022  -9.374  1.00 29.69 ? 271 HIS A O   1 
ATOM   2038 C  CB  . HIS A 1 268 ? 2.965  -6.218  -11.620 1.00 35.00 ? 271 HIS A CB  1 
ATOM   2039 C  CG  . HIS A 1 268 ? 1.687  -5.507  -11.301 1.00 42.20 ? 271 HIS A CG  1 
ATOM   2040 N  ND1 . HIS A 1 268 ? 1.041  -5.637  -10.089 1.00 42.71 ? 271 HIS A ND1 1 
ATOM   2041 C  CD2 . HIS A 1 268 ? 0.956  -4.622  -12.023 1.00 43.33 ? 271 HIS A CD2 1 
ATOM   2042 C  CE1 . HIS A 1 268 ? -0.030 -4.862  -10.077 1.00 43.67 ? 271 HIS A CE1 1 
ATOM   2043 N  NE2 . HIS A 1 268 ? -0.104 -4.236  -11.238 1.00 44.61 ? 271 HIS A NE2 1 
ATOM   2044 N  N   . LEU A 1 269 ? 4.989  -3.837  -9.857  1.00 29.57 ? 272 LEU A N   1 
ATOM   2045 C  CA  . LEU A 1 269 ? 5.648  -3.510  -8.601  1.00 30.77 ? 272 LEU A CA  1 
ATOM   2046 C  C   . LEU A 1 269 ? 4.855  -2.458  -7.828  1.00 32.44 ? 272 LEU A C   1 
ATOM   2047 O  O   . LEU A 1 269 ? 4.569  -1.377  -8.349  1.00 30.78 ? 272 LEU A O   1 
ATOM   2048 C  CB  . LEU A 1 269 ? 7.050  -2.974  -8.884  1.00 29.84 ? 272 LEU A CB  1 
ATOM   2049 C  CG  . LEU A 1 269 ? 7.968  -3.841  -9.745  1.00 30.52 ? 272 LEU A CG  1 
ATOM   2050 C  CD1 . LEU A 1 269 ? 9.200  -3.032  -10.145 1.00 27.81 ? 272 LEU A CD1 1 
ATOM   2051 C  CD2 . LEU A 1 269 ? 8.366  -5.095  -8.968  1.00 27.76 ? 272 LEU A CD2 1 
ATOM   2052 N  N   . GLY A 1 270 ? 4.509  -2.770  -6.582  1.00 32.58 ? 273 GLY A N   1 
ATOM   2053 C  CA  . GLY A 1 270 ? 3.871  -1.785  -5.729  1.00 33.52 ? 273 GLY A CA  1 
ATOM   2054 C  C   . GLY A 1 270 ? 2.575  -1.259  -6.318  1.00 36.41 ? 273 GLY A C   1 
ATOM   2055 O  O   . GLY A 1 270 ? 2.244  -0.080  -6.148  1.00 34.57 ? 273 GLY A O   1 
ATOM   2056 N  N   . GLY A 1 271 ? 1.851  -2.130  -7.020  1.00 35.63 ? 274 GLY A N   1 
ATOM   2057 C  CA  . GLY A 1 271 ? 0.554  -1.762  -7.558  1.00 37.53 ? 274 GLY A CA  1 
ATOM   2058 C  C   . GLY A 1 271 ? 0.610  -1.079  -8.914  1.00 39.98 ? 274 GLY A C   1 
ATOM   2059 O  O   . GLY A 1 271 ? -0.421 -0.690  -9.467  1.00 39.17 ? 274 GLY A O   1 
ATOM   2060 N  N   . LYS A 1 272 ? 1.814  -0.932  -9.457  1.00 39.54 ? 275 LYS A N   1 
ATOM   2061 C  CA  . LYS A 1 272 ? 2.001  -0.200  -10.701 1.00 40.16 ? 275 LYS A CA  1 
ATOM   2062 C  C   . LYS A 1 272 ? 2.747  -1.063  -11.721 1.00 39.04 ? 275 LYS A C   1 
ATOM   2063 O  O   . LYS A 1 272 ? 3.443  -2.014  -11.365 1.00 37.58 ? 275 LYS A O   1 
ATOM   2064 C  CB  . LYS A 1 272 ? 2.769  1.094   -10.416 1.00 42.44 ? 275 LYS A CB  1 
ATOM   2065 C  CG  . LYS A 1 272 ? 3.032  1.974   -11.624 1.00 47.34 ? 275 LYS A CG  1 
ATOM   2066 C  CD  . LYS A 1 272 ? 3.662  3.303   -11.195 1.00 50.94 ? 275 LYS A CD  1 
ATOM   2067 C  CE  . LYS A 1 272 ? 4.082  4.159   -12.390 1.00 53.01 ? 275 LYS A CE  1 
ATOM   2068 N  NZ  . LYS A 1 272 ? 5.374  3.719   -13.000 1.00 54.69 ? 275 LYS A NZ  1 
ATOM   2069 N  N   . GLU A 1 273 ? 2.573  -0.738  -12.994 1.00 37.88 ? 276 GLU A N   1 
ATOM   2070 C  CA  . GLU A 1 273 ? 3.141  -1.523  -14.079 1.00 36.40 ? 276 GLU A CA  1 
ATOM   2071 C  C   . GLU A 1 273 ? 4.385  -0.818  -14.590 1.00 34.38 ? 276 GLU A C   1 
ATOM   2072 O  O   . GLU A 1 273 ? 4.292  0.282   -15.128 1.00 33.58 ? 276 GLU A O   1 
ATOM   2073 C  CB  . GLU A 1 273 ? 2.131  -1.644  -15.214 1.00 39.03 ? 276 GLU A CB  1 
ATOM   2074 C  CG  . GLU A 1 273 ? 1.590  -3.037  -15.441 1.00 44.68 ? 276 GLU A CG  1 
ATOM   2075 C  CD  . GLU A 1 273 ? 1.110  -3.223  -16.862 1.00 48.09 ? 276 GLU A CD  1 
ATOM   2076 O  OE1 . GLU A 1 273 ? 1.154  -4.365  -17.370 1.00 49.69 ? 276 GLU A OE1 1 
ATOM   2077 O  OE2 . GLU A 1 273 ? 0.692  -2.217  -17.476 1.00 50.52 ? 276 GLU A OE2 1 
ATOM   2078 N  N   . TYR A 1 274 ? 5.545  -1.443  -14.415 1.00 31.16 ? 277 TYR A N   1 
ATOM   2079 C  CA  . TYR A 1 274 ? 6.792  -0.878  -14.923 1.00 28.40 ? 277 TYR A CA  1 
ATOM   2080 C  C   . TYR A 1 274 ? 7.167  -1.554  -16.218 1.00 28.38 ? 277 TYR A C   1 
ATOM   2081 O  O   . TYR A 1 274 ? 7.493  -2.743  -16.254 1.00 28.85 ? 277 TYR A O   1 
ATOM   2082 C  CB  . TYR A 1 274 ? 7.918  -1.052  -13.906 1.00 28.34 ? 277 TYR A CB  1 
ATOM   2083 C  CG  . TYR A 1 274 ? 7.790  -0.118  -12.733 1.00 27.44 ? 277 TYR A CG  1 
ATOM   2084 C  CD1 . TYR A 1 274 ? 8.527  1.054   -12.674 1.00 25.89 ? 277 TYR A CD1 1 
ATOM   2085 C  CD2 . TYR A 1 274 ? 6.906  -0.395  -11.696 1.00 27.32 ? 277 TYR A CD2 1 
ATOM   2086 C  CE1 . TYR A 1 274 ? 8.387  1.928   -11.617 1.00 27.73 ? 277 TYR A CE1 1 
ATOM   2087 C  CE2 . TYR A 1 274 ? 6.761  0.473   -10.631 1.00 24.44 ? 277 TYR A CE2 1 
ATOM   2088 C  CZ  . TYR A 1 274 ? 7.502  1.631   -10.597 1.00 25.00 ? 277 TYR A CZ  1 
ATOM   2089 O  OH  . TYR A 1 274 ? 7.359  2.502   -9.545  1.00 26.09 ? 277 TYR A OH  1 
ATOM   2090 N  N   . THR A 1 275 ? 7.115  -0.788  -17.292 1.00 26.65 ? 278 THR A N   1 
ATOM   2091 C  CA  . THR A 1 275 ? 7.205  -1.375  -18.606 1.00 25.13 ? 278 THR A CA  1 
ATOM   2092 C  C   . THR A 1 275 ? 8.515  -1.050  -19.294 1.00 25.20 ? 278 THR A C   1 
ATOM   2093 O  O   . THR A 1 275 ? 9.017  0.069   -19.220 1.00 24.64 ? 278 THR A O   1 
ATOM   2094 C  CB  . THR A 1 275 ? 6.029  -0.917  -19.470 1.00 24.74 ? 278 THR A CB  1 
ATOM   2095 O  OG1 . THR A 1 275 ? 4.828  -1.507  -18.958 1.00 25.54 ? 278 THR A OG1 1 
ATOM   2096 C  CG2 . THR A 1 275 ? 6.233  -1.329  -20.922 1.00 23.86 ? 278 THR A CG2 1 
ATOM   2097 N  N   . LEU A 1 276 ? 9.078  -2.061  -19.938 1.00 26.14 ? 279 LEU A N   1 
ATOM   2098 C  CA  . LEU A 1 276 ? 10.230 -1.873  -20.799 1.00 27.52 ? 279 LEU A CA  1 
ATOM   2099 C  C   . LEU A 1 276 ? 9.809  -2.323  -22.186 1.00 27.17 ? 279 LEU A C   1 
ATOM   2100 O  O   . LEU A 1 276 ? 9.233  -3.401  -22.343 1.00 28.68 ? 279 LEU A O   1 
ATOM   2101 C  CB  . LEU A 1 276 ? 11.398 -2.727  -20.316 1.00 28.93 ? 279 LEU A CB  1 
ATOM   2102 C  CG  . LEU A 1 276 ? 11.910 -2.535  -18.887 1.00 28.21 ? 279 LEU A CG  1 
ATOM   2103 C  CD1 . LEU A 1 276 ? 13.035 -3.516  -18.635 1.00 29.60 ? 279 LEU A CD1 1 
ATOM   2104 C  CD2 . LEU A 1 276 ? 12.408 -1.115  -18.683 1.00 28.84 ? 279 LEU A CD2 1 
ATOM   2105 N  N   . THR A 1 277 ? 10.081 -1.496  -23.190 1.00 25.88 ? 280 THR A N   1 
ATOM   2106 C  CA  . THR A 1 277 ? 9.830  -1.886  -24.570 1.00 25.99 ? 280 THR A CA  1 
ATOM   2107 C  C   . THR A 1 277 ? 11.046 -2.616  -25.122 1.00 25.60 ? 280 THR A C   1 
ATOM   2108 O  O   . THR A 1 277 ? 12.112 -2.595  -24.521 1.00 26.32 ? 280 THR A O   1 
ATOM   2109 C  CB  . THR A 1 277 ? 9.576  -0.668  -25.465 1.00 28.49 ? 280 THR A CB  1 
ATOM   2110 O  OG1 . THR A 1 277 ? 10.774 0.114   -25.543 1.00 29.44 ? 280 THR A OG1 1 
ATOM   2111 C  CG2 . THR A 1 277 ? 8.439  0.191   -24.901 1.00 27.06 ? 280 THR A CG2 1 
ATOM   2112 N  N   . SER A 1 278 ? 10.878 -3.264  -26.270 1.00 27.10 ? 281 SER A N   1 
ATOM   2113 C  CA  . SER A 1 278 ? 11.972 -3.983  -26.900 1.00 26.94 ? 281 SER A CA  1 
ATOM   2114 C  C   . SER A 1 278 ? 13.134 -3.042  -27.221 1.00 27.59 ? 281 SER A C   1 
ATOM   2115 O  O   . SER A 1 278 ? 14.278 -3.474  -27.340 1.00 27.63 ? 281 SER A O   1 
ATOM   2116 C  CB  . SER A 1 278 ? 11.482 -4.690  -28.175 1.00 26.94 ? 281 SER A CB  1 
ATOM   2117 O  OG  . SER A 1 278 ? 11.058 -3.768  -29.171 1.00 28.15 ? 281 SER A OG  1 
ATOM   2118 N  N   . ALA A 1 279 ? 12.844 -1.754  -27.353 1.00 26.77 ? 282 ALA A N   1 
ATOM   2119 C  CA  . ALA A 1 279 ? 13.906 -0.772  -27.511 1.00 28.55 ? 282 ALA A CA  1 
ATOM   2120 C  C   . ALA A 1 279 ? 14.685 -0.645  -26.200 1.00 28.65 ? 282 ALA A C   1 
ATOM   2121 O  O   . ALA A 1 279 ? 15.865 -0.298  -26.197 1.00 30.10 ? 282 ALA A O   1 
ATOM   2122 C  CB  . ALA A 1 279 ? 13.320 0.580   -27.915 1.00 29.13 ? 282 ALA A CB  1 
ATOM   2123 N  N   . ASP A 1 280 ? 14.019 -0.935  -25.088 1.00 25.50 ? 283 ASP A N   1 
ATOM   2124 C  CA  . ASP A 1 280 ? 14.669 -0.931  -23.779 1.00 24.81 ? 283 ASP A CA  1 
ATOM   2125 C  C   . ASP A 1 280 ? 15.551 -2.154  -23.528 1.00 23.34 ? 283 ASP A C   1 
ATOM   2126 O  O   . ASP A 1 280 ? 16.528 -2.075  -22.784 1.00 23.91 ? 283 ASP A O   1 
ATOM   2127 C  CB  . ASP A 1 280 ? 13.620 -0.860  -22.667 1.00 24.53 ? 283 ASP A CB  1 
ATOM   2128 C  CG  . ASP A 1 280 ? 12.914 0.477   -22.612 1.00 25.43 ? 283 ASP A CG  1 
ATOM   2129 O  OD1 . ASP A 1 280 ? 13.536 1.483   -22.999 1.00 23.79 ? 283 ASP A OD1 1 
ATOM   2130 O  OD2 . ASP A 1 280 ? 11.742 0.522   -22.172 1.00 24.10 ? 283 ASP A OD2 1 
ATOM   2131 N  N   . TYR A 1 281 ? 15.202 -3.292  -24.117 1.00 24.29 ? 284 TYR A N   1 
ATOM   2132 C  CA  . TYR A 1 281 ? 15.881 -4.530  -23.743 1.00 24.49 ? 284 TYR A CA  1 
ATOM   2133 C  C   . TYR A 1 281 ? 16.571 -5.305  -24.872 1.00 24.02 ? 284 TYR A C   1 
ATOM   2134 O  O   . TYR A 1 281 ? 17.184 -6.341  -24.628 1.00 23.09 ? 284 TYR A O   1 
ATOM   2135 C  CB  . TYR A 1 281 ? 14.916 -5.446  -22.966 1.00 23.11 ? 284 TYR A CB  1 
ATOM   2136 C  CG  . TYR A 1 281 ? 13.721 -5.971  -23.733 1.00 22.25 ? 284 TYR A CG  1 
ATOM   2137 C  CD1 . TYR A 1 281 ? 13.862 -7.008  -24.638 1.00 24.72 ? 284 TYR A CD1 1 
ATOM   2138 C  CD2 . TYR A 1 281 ? 12.445 -5.454  -23.524 1.00 25.05 ? 284 TYR A CD2 1 
ATOM   2139 C  CE1 . TYR A 1 281 ? 12.779 -7.522  -25.316 1.00 26.09 ? 284 TYR A CE1 1 
ATOM   2140 C  CE2 . TYR A 1 281 ? 11.336 -5.967  -24.208 1.00 25.99 ? 284 TYR A CE2 1 
ATOM   2141 C  CZ  . TYR A 1 281 ? 11.518 -7.003  -25.103 1.00 25.93 ? 284 TYR A CZ  1 
ATOM   2142 O  OH  . TYR A 1 281 ? 10.460 -7.527  -25.810 1.00 22.67 ? 284 TYR A OH  1 
ATOM   2143 N  N   . VAL A 1 282 ? 16.495 -4.807  -26.103 1.00 24.68 ? 285 VAL A N   1 
ATOM   2144 C  CA  . VAL A 1 282 ? 17.288 -5.395  -27.183 1.00 25.65 ? 285 VAL A CA  1 
ATOM   2145 C  C   . VAL A 1 282 ? 18.498 -4.521  -27.518 1.00 26.54 ? 285 VAL A C   1 
ATOM   2146 O  O   . VAL A 1 282 ? 18.369 -3.307  -27.670 1.00 27.93 ? 285 VAL A O   1 
ATOM   2147 C  CB  . VAL A 1 282 ? 16.440 -5.589  -28.456 1.00 27.17 ? 285 VAL A CB  1 
ATOM   2148 C  CG1 . VAL A 1 282 ? 17.291 -6.186  -29.565 1.00 26.09 ? 285 VAL A CG1 1 
ATOM   2149 C  CG2 . VAL A 1 282 ? 15.261 -6.498  -28.159 1.00 27.44 ? 285 VAL A CG2 1 
ATOM   2150 N  N   . PHE A 1 283 ? 19.678 -5.127  -27.609 1.00 25.82 ? 286 PHE A N   1 
ATOM   2151 C  CA  . PHE A 1 283 ? 20.861 -4.382  -28.043 1.00 25.45 ? 286 PHE A CA  1 
ATOM   2152 C  C   . PHE A 1 283 ? 20.857 -4.389  -29.568 1.00 25.76 ? 286 PHE A C   1 
ATOM   2153 O  O   . PHE A 1 283 ? 21.257 -5.359  -30.197 1.00 22.95 ? 286 PHE A O   1 
ATOM   2154 C  CB  . PHE A 1 283 ? 22.159 -5.037  -27.545 1.00 26.03 ? 286 PHE A CB  1 
ATOM   2155 C  CG  . PHE A 1 283 ? 22.402 -4.888  -26.065 1.00 26.87 ? 286 PHE A CG  1 
ATOM   2156 C  CD1 . PHE A 1 283 ? 22.799 -3.672  -25.529 1.00 25.07 ? 286 PHE A CD1 1 
ATOM   2157 C  CD2 . PHE A 1 283 ? 22.283 -5.978  -25.218 1.00 26.41 ? 286 PHE A CD2 1 
ATOM   2158 C  CE1 . PHE A 1 283 ? 23.073 -3.553  -24.178 1.00 28.31 ? 286 PHE A CE1 1 
ATOM   2159 C  CE2 . PHE A 1 283 ? 22.557 -5.863  -23.857 1.00 28.14 ? 286 PHE A CE2 1 
ATOM   2160 C  CZ  . PHE A 1 283 ? 22.952 -4.652  -23.339 1.00 28.25 ? 286 PHE A CZ  1 
ATOM   2161 N  N   . GLN A 1 284 ? 20.401 -3.303  -30.164 1.00 27.26 ? 287 GLN A N   1 
ATOM   2162 C  CA  . GLN A 1 284 ? 20.177 -3.308  -31.594 1.00 30.20 ? 287 GLN A CA  1 
ATOM   2163 C  C   . GLN A 1 284 ? 21.435 -2.841  -32.348 1.00 32.99 ? 287 GLN A C   1 
ATOM   2164 O  O   . GLN A 1 284 ? 21.540 -1.685  -32.757 1.00 32.95 ? 287 GLN A O   1 
ATOM   2165 C  CB  . GLN A 1 284 ? 18.974 -2.421  -31.905 1.00 30.73 ? 287 GLN A CB  1 
ATOM   2166 C  CG  . GLN A 1 284 ? 18.204 -2.840  -33.125 1.00 32.22 ? 287 GLN A CG  1 
ATOM   2167 C  CD  . GLN A 1 284 ? 17.311 -4.055  -32.911 1.00 30.02 ? 287 GLN A CD  1 
ATOM   2168 O  OE1 . GLN A 1 284 ? 16.415 -4.059  -32.063 1.00 29.63 ? 287 GLN A OE1 1 
ATOM   2169 N  NE2 . GLN A 1 284 ? 17.550 -5.092  -33.697 1.00 28.69 ? 287 GLN A NE2 1 
ATOM   2170 N  N   . GLU A 1 285 ? 22.391 -3.752  -32.520 1.00 34.10 ? 288 GLU A N   1 
ATOM   2171 C  CA  . GLU A 1 285 ? 23.617 -3.446  -33.254 1.00 38.24 ? 288 GLU A CA  1 
ATOM   2172 C  C   . GLU A 1 285 ? 23.323 -3.124  -34.714 1.00 36.32 ? 288 GLU A C   1 
ATOM   2173 O  O   . GLU A 1 285 ? 23.982 -2.284  -35.321 1.00 37.50 ? 288 GLU A O   1 
ATOM   2174 C  CB  . GLU A 1 285 ? 24.589 -4.620  -33.188 1.00 40.19 ? 288 GLU A CB  1 
ATOM   2175 C  CG  . GLU A 1 285 ? 25.432 -4.647  -31.935 1.00 47.18 ? 288 GLU A CG  1 
ATOM   2176 C  CD  . GLU A 1 285 ? 26.555 -5.662  -32.025 1.00 51.14 ? 288 GLU A CD  1 
ATOM   2177 O  OE1 . GLU A 1 285 ? 26.523 -6.659  -31.267 1.00 52.14 ? 288 GLU A OE1 1 
ATOM   2178 O  OE2 . GLU A 1 285 ? 27.466 -5.461  -32.860 1.00 53.22 ? 288 GLU A OE2 1 
ATOM   2179 N  N   . SER A 1 286 ? 22.332 -3.806  -35.267 1.00 35.00 ? 289 SER A N   1 
ATOM   2180 C  CA  . SER A 1 286 ? 21.823 -3.494  -36.590 1.00 33.86 ? 289 SER A CA  1 
ATOM   2181 C  C   . SER A 1 286 ? 20.362 -3.918  -36.618 1.00 33.63 ? 289 SER A C   1 
ATOM   2182 O  O   . SER A 1 286 ? 19.817 -4.351  -35.596 1.00 31.37 ? 289 SER A O   1 
ATOM   2183 C  CB  . SER A 1 286 ? 22.590 -4.277  -37.652 1.00 34.08 ? 289 SER A CB  1 
ATOM   2184 O  OG  . SER A 1 286 ? 22.119 -5.615  -37.714 1.00 35.44 ? 289 SER A OG  1 
ATOM   2185 N  N   . TYR A 1 287 ? 19.740 -3.805  -37.789 1.00 30.95 ? 290 TYR A N   1 
ATOM   2186 C  CA  . TYR A 1 287 ? 18.383 -4.290  -37.987 1.00 31.64 ? 290 TYR A CA  1 
ATOM   2187 C  C   . TYR A 1 287 ? 18.331 -5.303  -39.115 1.00 31.70 ? 290 TYR A C   1 
ATOM   2188 O  O   . TYR A 1 287 ? 17.284 -5.510  -39.726 1.00 32.48 ? 290 TYR A O   1 
ATOM   2189 C  CB  . TYR A 1 287 ? 17.435 -3.123  -38.289 1.00 30.33 ? 290 TYR A CB  1 
ATOM   2190 C  CG  . TYR A 1 287 ? 17.304 -2.157  -37.137 1.00 29.72 ? 290 TYR A CG  1 
ATOM   2191 C  CD1 . TYR A 1 287 ? 16.421 -2.409  -36.095 1.00 31.42 ? 290 TYR A CD1 1 
ATOM   2192 C  CD2 . TYR A 1 287 ? 18.095 -1.022  -37.064 1.00 30.10 ? 290 TYR A CD2 1 
ATOM   2193 C  CE1 . TYR A 1 287 ? 16.332 -1.564  -35.014 1.00 29.08 ? 290 TYR A CE1 1 
ATOM   2194 C  CE2 . TYR A 1 287 ? 18.015 -0.167  -35.978 1.00 29.65 ? 290 TYR A CE2 1 
ATOM   2195 C  CZ  . TYR A 1 287 ? 17.134 -0.446  -34.955 1.00 30.04 ? 290 TYR A CZ  1 
ATOM   2196 O  OH  . TYR A 1 287 ? 17.077 0.375   -33.848 1.00 31.02 ? 290 TYR A OH  1 
ATOM   2197 N  N   . SER A 1 288 ? 19.466 -5.930  -39.395 1.00 31.40 ? 291 SER A N   1 
ATOM   2198 C  CA  . SER A 1 288 ? 19.526 -6.951  -40.431 1.00 33.03 ? 291 SER A CA  1 
ATOM   2199 C  C   . SER A 1 288 ? 18.879 -8.261  -39.994 1.00 35.99 ? 291 SER A C   1 
ATOM   2200 O  O   . SER A 1 288 ? 19.021 -8.682  -38.846 1.00 35.47 ? 291 SER A O   1 
ATOM   2201 C  CB  . SER A 1 288 ? 20.977 -7.219  -40.823 1.00 34.58 ? 291 SER A CB  1 
ATOM   2202 O  OG  . SER A 1 288 ? 21.055 -8.356  -41.664 1.00 36.88 ? 291 SER A OG  1 
ATOM   2203 N  N   . SER A 1 289 ? 18.182 -8.915  -40.921 1.00 38.45 ? 292 SER A N   1 
ATOM   2204 C  CA  . SER A 1 289 ? 17.564 -10.204 -40.632 1.00 40.06 ? 292 SER A CA  1 
ATOM   2205 C  C   . SER A 1 289 ? 18.610 -11.315 -40.633 1.00 40.39 ? 292 SER A C   1 
ATOM   2206 O  O   . SER A 1 289 ? 18.314 -12.459 -40.297 1.00 43.44 ? 292 SER A O   1 
ATOM   2207 C  CB  . SER A 1 289 ? 16.474 -10.517 -41.662 1.00 40.51 ? 292 SER A CB  1 
ATOM   2208 O  OG  . SER A 1 289 ? 17.030 -10.720 -42.951 1.00 43.21 ? 292 SER A OG  1 
ATOM   2209 N  N   . LYS A 1 290 ? 19.836 -10.969 -41.005 1.00 40.46 ? 293 LYS A N   1 
ATOM   2210 C  CA  . LYS A 1 290 ? 20.912 -11.948 -41.104 1.00 41.68 ? 293 LYS A CA  1 
ATOM   2211 C  C   . LYS A 1 290 ? 21.858 -11.911 -39.902 1.00 40.52 ? 293 LYS A C   1 
ATOM   2212 O  O   . LYS A 1 290 ? 22.817 -12.682 -39.831 1.00 41.69 ? 293 LYS A O   1 
ATOM   2213 C  CB  . LYS A 1 290 ? 21.701 -11.721 -42.399 1.00 43.69 ? 293 LYS A CB  1 
ATOM   2214 C  CG  . LYS A 1 290 ? 20.888 -11.969 -43.670 1.00 45.63 ? 293 LYS A CG  1 
ATOM   2215 C  CD  . LYS A 1 290 ? 21.660 -11.562 -44.924 1.00 50.79 ? 293 LYS A CD  1 
ATOM   2216 C  CE  . LYS A 1 290 ? 20.925 -11.974 -46.201 1.00 53.24 ? 293 LYS A CE  1 
ATOM   2217 N  NZ  . LYS A 1 290 ? 19.549 -11.393 -46.290 1.00 54.78 ? 293 LYS A NZ  1 
ATOM   2218 N  N   . LYS A 1 291 ? 21.586 -11.012 -38.963 1.00 38.52 ? 294 LYS A N   1 
ATOM   2219 C  CA  . LYS A 1 291 ? 22.385 -10.900 -37.748 1.00 38.02 ? 294 LYS A CA  1 
ATOM   2220 C  C   . LYS A 1 291 ? 21.529 -11.184 -36.524 1.00 36.07 ? 294 LYS A C   1 
ATOM   2221 O  O   . LYS A 1 291 ? 20.303 -11.058 -36.563 1.00 36.16 ? 294 LYS A O   1 
ATOM   2222 C  CB  . LYS A 1 291 ? 22.988 -9.499  -37.631 1.00 38.30 ? 294 LYS A CB  1 
ATOM   2223 C  CG  . LYS A 1 291 ? 23.970 -9.147  -38.739 1.00 40.85 ? 294 LYS A CG  1 
ATOM   2224 C  CD  . LYS A 1 291 ? 25.178 -10.069 -38.718 1.00 44.27 ? 294 LYS A CD  1 
ATOM   2225 C  CE  . LYS A 1 291 ? 26.315 -9.522  -39.584 1.00 47.14 ? 294 LYS A CE  1 
ATOM   2226 N  NZ  . LYS A 1 291 ? 27.404 -10.528 -39.800 1.00 46.73 ? 294 LYS A NZ  1 
ATOM   2227 N  N   . LEU A 1 292 ? 22.183 -11.565 -35.435 1.00 33.98 ? 295 LEU A N   1 
ATOM   2228 C  CA  . LEU A 1 292 ? 21.482 -11.837 -34.188 1.00 33.57 ? 295 LEU A CA  1 
ATOM   2229 C  C   . LEU A 1 292 ? 21.793 -10.782 -33.131 1.00 30.96 ? 295 LEU A C   1 
ATOM   2230 O  O   . LEU A 1 292 ? 22.949 -10.424 -32.920 1.00 31.25 ? 295 LEU A O   1 
ATOM   2231 C  CB  . LEU A 1 292 ? 21.871 -13.223 -33.675 1.00 34.44 ? 295 LEU A CB  1 
ATOM   2232 C  CG  . LEU A 1 292 ? 21.400 -14.342 -34.600 1.00 35.94 ? 295 LEU A CG  1 
ATOM   2233 C  CD1 . LEU A 1 292 ? 22.137 -15.639 -34.286 1.00 37.15 ? 295 LEU A CD1 1 
ATOM   2234 C  CD2 . LEU A 1 292 ? 19.902 -14.508 -34.436 1.00 36.03 ? 295 LEU A CD2 1 
ATOM   2235 N  N   . CYS A 1 293 ? 20.754 -10.292 -32.468 1.00 29.03 ? 296 CYS A N   1 
ATOM   2236 C  CA  . CYS A 1 293 ? 20.907 -9.253  -31.456 1.00 28.50 ? 296 CYS A CA  1 
ATOM   2237 C  C   . CYS A 1 293 ? 20.614 -9.761  -30.043 1.00 28.68 ? 296 CYS A C   1 
ATOM   2238 O  O   . CYS A 1 293 ? 19.651 -10.501 -29.823 1.00 28.08 ? 296 CYS A O   1 
ATOM   2239 C  CB  . CYS A 1 293 ? 19.988 -8.073  -31.783 1.00 26.72 ? 296 CYS A CB  1 
ATOM   2240 S  SG  . CYS A 1 293 ? 20.693 -6.906  -32.990 1.00 35.76 ? 296 CYS A SG  1 
ATOM   2241 N  N   . THR A 1 294 ? 21.448 -9.329  -29.096 1.00 29.16 ? 297 THR A N   1 
ATOM   2242 C  CA  . THR A 1 294 ? 21.404 -9.764  -27.694 1.00 28.46 ? 297 THR A CA  1 
ATOM   2243 C  C   . THR A 1 294 ? 20.327 -9.040  -26.880 1.00 27.71 ? 297 THR A C   1 
ATOM   2244 O  O   . THR A 1 294 ? 20.167 -7.819  -26.999 1.00 26.36 ? 297 THR A O   1 
ATOM   2245 C  CB  . THR A 1 294 ? 22.775 -9.507  -27.005 1.00 29.07 ? 297 THR A CB  1 
ATOM   2246 O  OG1 . THR A 1 294 ? 23.784 -10.299 -27.635 1.00 29.04 ? 297 THR A OG1 1 
ATOM   2247 C  CG2 . THR A 1 294 ? 22.718 -9.843  -25.530 1.00 27.27 ? 297 THR A CG2 1 
ATOM   2248 N  N   . LEU A 1 295 ? 19.604 -9.795  -26.052 1.00 25.60 ? 298 LEU A N   1 
ATOM   2249 C  CA  . LEU A 1 295 ? 18.681 -9.212  -25.079 1.00 25.90 ? 298 LEU A CA  1 
ATOM   2250 C  C   . LEU A 1 295 ? 19.379 -8.950  -23.740 1.00 24.84 ? 298 LEU A C   1 
ATOM   2251 O  O   . LEU A 1 295 ? 20.176 -9.762  -23.277 1.00 21.30 ? 298 LEU A O   1 
ATOM   2252 C  CB  . LEU A 1 295 ? 17.491 -10.142 -24.836 1.00 27.28 ? 298 LEU A CB  1 
ATOM   2253 C  CG  . LEU A 1 295 ? 16.612 -10.565 -26.011 1.00 30.15 ? 298 LEU A CG  1 
ATOM   2254 C  CD1 . LEU A 1 295 ? 15.568 -11.562 -25.522 1.00 31.03 ? 298 LEU A CD1 1 
ATOM   2255 C  CD2 . LEU A 1 295 ? 15.934 -9.354  -26.617 1.00 31.98 ? 298 LEU A CD2 1 
ATOM   2256 N  N   . ALA A 1 296 ? 19.072 -7.817  -23.115 1.00 23.65 ? 299 ALA A N   1 
ATOM   2257 C  CA  . ALA A 1 296 ? 19.663 -7.492  -21.824 1.00 23.69 ? 299 ALA A CA  1 
ATOM   2258 C  C   . ALA A 1 296 ? 18.876 -8.180  -20.707 1.00 22.52 ? 299 ALA A C   1 
ATOM   2259 O  O   . ALA A 1 296 ? 18.538 -7.572  -19.700 1.00 20.55 ? 299 ALA A O   1 
ATOM   2260 C  CB  . ALA A 1 296 ? 19.676 -5.993  -21.612 1.00 20.81 ? 299 ALA A CB  1 
ATOM   2261 N  N   . ILE A 1 297 ? 18.590 -9.458  -20.908 1.00 23.56 ? 300 ILE A N   1 
ATOM   2262 C  CA  . ILE A 1 297 ? 17.844 -10.246 -19.939 1.00 25.42 ? 300 ILE A CA  1 
ATOM   2263 C  C   . ILE A 1 297 ? 18.432 -11.652 -19.985 1.00 25.44 ? 300 ILE A C   1 
ATOM   2264 O  O   . ILE A 1 297 ? 18.763 -12.143 -21.060 1.00 27.13 ? 300 ILE A O   1 
ATOM   2265 C  CB  . ILE A 1 297 ? 16.340 -10.307 -20.315 1.00 25.80 ? 300 ILE A CB  1 
ATOM   2266 C  CG1 . ILE A 1 297 ? 15.763 -8.885  -20.399 1.00 25.59 ? 300 ILE A CG1 1 
ATOM   2267 C  CG2 . ILE A 1 297 ? 15.569 -11.145 -19.297 1.00 22.15 ? 300 ILE A CG2 1 
ATOM   2268 C  CD1 . ILE A 1 297 ? 14.272 -8.834  -20.771 1.00 25.23 ? 300 ILE A CD1 1 
ATOM   2269 N  N   . HIS A 1 298 ? 18.584 -12.290 -18.828 1.00 24.83 ? 301 HIS A N   1 
ATOM   2270 C  CA  . HIS A 1 298 ? 19.087 -13.659 -18.798 1.00 26.36 ? 301 HIS A CA  1 
ATOM   2271 C  C   . HIS A 1 298 ? 18.624 -14.417 -17.558 1.00 26.96 ? 301 HIS A C   1 
ATOM   2272 O  O   . HIS A 1 298 ? 17.896 -13.888 -16.723 1.00 25.89 ? 301 HIS A O   1 
ATOM   2273 C  CB  . HIS A 1 298 ? 20.621 -13.676 -18.871 1.00 26.28 ? 301 HIS A CB  1 
ATOM   2274 C  CG  . HIS A 1 298 ? 21.302 -13.119 -17.654 1.00 26.74 ? 301 HIS A CG  1 
ATOM   2275 N  ND1 . HIS A 1 298 ? 22.594 -13.456 -17.307 1.00 27.46 ? 301 HIS A ND1 1 
ATOM   2276 C  CD2 . HIS A 1 298 ? 20.869 -12.263 -16.696 1.00 27.54 ? 301 HIS A CD2 1 
ATOM   2277 C  CE1 . HIS A 1 298 ? 22.926 -12.837 -16.186 1.00 25.44 ? 301 HIS A CE1 1 
ATOM   2278 N  NE2 . HIS A 1 298 ? 21.897 -12.106 -15.795 1.00 26.12 ? 301 HIS A NE2 1 
ATOM   2279 N  N   . ALA A 1 299 ? 19.044 -15.666 -17.453 1.00 26.33 ? 302 ALA A N   1 
ATOM   2280 C  CA  . ALA A 1 299 ? 18.649 -16.488 -16.327 1.00 27.62 ? 302 ALA A CA  1 
ATOM   2281 C  C   . ALA A 1 299 ? 19.744 -16.486 -15.265 1.00 28.71 ? 302 ALA A C   1 
ATOM   2282 O  O   . ALA A 1 299 ? 20.932 -16.567 -15.581 1.00 29.52 ? 302 ALA A O   1 
ATOM   2283 C  CB  . ALA A 1 299 ? 18.373 -17.909 -16.799 1.00 27.21 ? 302 ALA A CB  1 
ATOM   2284 N  N   . MET A 1 300 ? 19.335 -16.385 -14.007 1.00 28.50 ? 303 MET A N   1 
ATOM   2285 C  CA  . MET A 1 300 ? 20.248 -16.517 -12.882 1.00 29.62 ? 303 MET A CA  1 
ATOM   2286 C  C   . MET A 1 300 ? 19.497 -17.139 -11.711 1.00 29.30 ? 303 MET A C   1 
ATOM   2287 O  O   . MET A 1 300 ? 18.584 -16.529 -11.156 1.00 28.50 ? 303 MET A O   1 
ATOM   2288 C  CB  . MET A 1 300 ? 20.785 -15.145 -12.469 1.00 30.65 ? 303 MET A CB  1 
ATOM   2289 C  CG  . MET A 1 300 ? 21.894 -15.211 -11.439 1.00 37.20 ? 303 MET A CG  1 
ATOM   2290 S  SD  . MET A 1 300 ? 23.490 -14.770 -12.145 1.00 47.33 ? 303 MET A SD  1 
ATOM   2291 C  CE  . MET A 1 300 ? 23.544 -13.030 -11.759 1.00 40.18 ? 303 MET A CE  1 
ATOM   2292 N  N   . ASP A 1 301 ? 19.876 -18.355 -11.337 1.00 29.20 ? 304 ASP A N   1 
ATOM   2293 C  CA  . ASP A 1 301 ? 19.232 -19.022 -10.219 1.00 29.04 ? 304 ASP A CA  1 
ATOM   2294 C  C   . ASP A 1 301 ? 19.946 -18.672 -8.924  1.00 29.35 ? 304 ASP A C   1 
ATOM   2295 O  O   . ASP A 1 301 ? 21.012 -19.192 -8.618  1.00 29.35 ? 304 ASP A O   1 
ATOM   2296 C  CB  . ASP A 1 301 ? 19.225 -20.532 -10.441 1.00 29.94 ? 304 ASP A CB  1 
ATOM   2297 C  CG  . ASP A 1 301 ? 18.314 -20.942 -11.578 1.00 30.46 ? 304 ASP A CG  1 
ATOM   2298 O  OD1 . ASP A 1 301 ? 17.114 -20.598 -11.529 1.00 29.68 ? 304 ASP A OD1 1 
ATOM   2299 O  OD2 . ASP A 1 301 ? 18.796 -21.601 -12.522 1.00 32.90 ? 304 ASP A OD2 1 
ATOM   2300 N  N   . ILE A 1 302 ? 19.340 -17.767 -8.172  1.00 29.81 ? 305 ILE A N   1 
ATOM   2301 C  CA  . ILE A 1 302 ? 19.924 -17.280 -6.939  1.00 29.12 ? 305 ILE A CA  1 
ATOM   2302 C  C   . ILE A 1 302 ? 19.397 -18.137 -5.795  1.00 29.37 ? 305 ILE A C   1 
ATOM   2303 O  O   . ILE A 1 302 ? 18.190 -18.285 -5.618  1.00 28.20 ? 305 ILE A O   1 
ATOM   2304 C  CB  . ILE A 1 302 ? 19.560 -15.793 -6.742  1.00 27.50 ? 305 ILE A CB  1 
ATOM   2305 C  CG1 . ILE A 1 302 ? 20.152 -14.978 -7.902  1.00 26.57 ? 305 ILE A CG1 1 
ATOM   2306 C  CG2 . ILE A 1 302 ? 20.082 -15.293 -5.403  1.00 27.20 ? 305 ILE A CG2 1 
ATOM   2307 C  CD1 . ILE A 1 302 ? 19.561 -13.601 -8.065  1.00 21.90 ? 305 ILE A CD1 1 
ATOM   2308 N  N   . PRO A 1 303 ? 20.310 -18.753 -5.031  1.00 31.39 ? 306 PRO A N   1 
ATOM   2309 C  CA  . PRO A 1 303 ? 19.956 -19.716 -3.986  1.00 31.22 ? 306 PRO A CA  1 
ATOM   2310 C  C   . PRO A 1 303 ? 19.306 -19.027 -2.803  1.00 32.31 ? 306 PRO A C   1 
ATOM   2311 O  O   . PRO A 1 303 ? 19.512 -17.837 -2.576  1.00 30.18 ? 306 PRO A O   1 
ATOM   2312 C  CB  . PRO A 1 303 ? 21.295 -20.343 -3.596  1.00 32.03 ? 306 PRO A CB  1 
ATOM   2313 C  CG  . PRO A 1 303 ? 22.221 -20.020 -4.723  1.00 32.21 ? 306 PRO A CG  1 
ATOM   2314 C  CD  . PRO A 1 303 ? 21.766 -18.684 -5.230  1.00 31.10 ? 306 PRO A CD  1 
ATOM   2315 N  N   . PRO A 1 304 ? 18.513 -19.776 -2.026  1.00 33.77 ? 307 PRO A N   1 
ATOM   2316 C  CA  . PRO A 1 304 ? 18.051 -19.270 -0.731  1.00 35.37 ? 307 PRO A CA  1 
ATOM   2317 C  C   . PRO A 1 304 ? 19.261 -18.957 0.138   1.00 36.20 ? 307 PRO A C   1 
ATOM   2318 O  O   . PRO A 1 304 ? 20.341 -19.490 -0.082  1.00 40.26 ? 307 PRO A O   1 
ATOM   2319 C  CB  . PRO A 1 304 ? 17.216 -20.420 -0.169  1.00 34.20 ? 307 PRO A CB  1 
ATOM   2320 C  CG  . PRO A 1 304 ? 16.796 -21.208 -1.386  1.00 35.22 ? 307 PRO A CG  1 
ATOM   2321 C  CD  . PRO A 1 304 ? 17.961 -21.104 -2.336  1.00 33.93 ? 307 PRO A CD  1 
ATOM   2322 N  N   . PRO A 1 305 ? 19.099 -18.077 1.132   1.00 37.10 ? 308 PRO A N   1 
ATOM   2323 C  CA  . PRO A 1 305 ? 17.842 -17.419 1.507   1.00 37.61 ? 308 PRO A CA  1 
ATOM   2324 C  C   . PRO A 1 305 ? 17.349 -16.357 0.515   1.00 36.28 ? 308 PRO A C   1 
ATOM   2325 O  O   . PRO A 1 305 ? 16.148 -16.153 0.376   1.00 35.10 ? 308 PRO A O   1 
ATOM   2326 C  CB  . PRO A 1 305 ? 18.153 -16.817 2.873   1.00 37.72 ? 308 PRO A CB  1 
ATOM   2327 C  CG  . PRO A 1 305 ? 19.625 -16.562 2.831   1.00 36.68 ? 308 PRO A CG  1 
ATOM   2328 C  CD  . PRO A 1 305 ? 20.213 -17.678 2.008   1.00 37.26 ? 308 PRO A CD  1 
ATOM   2329 N  N   . THR A 1 306 ? 18.273 -15.688 -0.169  1.00 34.85 ? 309 THR A N   1 
ATOM   2330 C  CA  . THR A 1 306 ? 17.927 -14.557 -1.031  1.00 34.02 ? 309 THR A CA  1 
ATOM   2331 C  C   . THR A 1 306 ? 17.022 -14.927 -2.198  1.00 32.40 ? 309 THR A C   1 
ATOM   2332 O  O   . THR A 1 306 ? 16.034 -14.246 -2.459  1.00 34.48 ? 309 THR A O   1 
ATOM   2333 C  CB  . THR A 1 306 ? 19.174 -13.897 -1.629  1.00 34.66 ? 309 THR A CB  1 
ATOM   2334 O  OG1 . THR A 1 306 ? 20.044 -13.470 -0.578  1.00 34.83 ? 309 THR A OG1 1 
ATOM   2335 C  CG2 . THR A 1 306 ? 18.780 -12.699 -2.464  1.00 33.52 ? 309 THR A CG2 1 
ATOM   2336 N  N   . GLY A 1 307 ? 17.375 -15.990 -2.914  1.00 30.95 ? 310 GLY A N   1 
ATOM   2337 C  CA  . GLY A 1 307 ? 16.548 -16.457 -4.009  1.00 29.94 ? 310 GLY A CA  1 
ATOM   2338 C  C   . GLY A 1 307 ? 15.625 -17.570 -3.554  1.00 31.55 ? 310 GLY A C   1 
ATOM   2339 O  O   . GLY A 1 307 ? 15.657 -17.952 -2.386  1.00 33.98 ? 310 GLY A O   1 
ATOM   2340 N  N   . PRO A 1 308 ? 14.786 -18.112 -4.447  1.00 30.04 ? 311 PRO A N   1 
ATOM   2341 C  CA  . PRO A 1 308 ? 14.659 -17.702 -5.850  1.00 29.66 ? 311 PRO A CA  1 
ATOM   2342 C  C   . PRO A 1 308 ? 14.166 -16.265 -5.967  1.00 28.46 ? 311 PRO A C   1 
ATOM   2343 O  O   . PRO A 1 308 ? 13.289 -15.840 -5.221  1.00 28.52 ? 311 PRO A O   1 
ATOM   2344 C  CB  . PRO A 1 308 ? 13.645 -18.691 -6.427  1.00 28.70 ? 311 PRO A CB  1 
ATOM   2345 C  CG  . PRO A 1 308 ? 13.655 -19.844 -5.484  1.00 30.82 ? 311 PRO A CG  1 
ATOM   2346 C  CD  . PRO A 1 308 ? 13.925 -19.264 -4.137  1.00 31.42 ? 311 PRO A CD  1 
ATOM   2347 N  N   . THR A 1 309 ? 14.728 -15.520 -6.909  1.00 27.46 ? 312 THR A N   1 
ATOM   2348 C  CA  . THR A 1 309 ? 14.354 -14.128 -7.080  1.00 26.21 ? 312 THR A CA  1 
ATOM   2349 C  C   . THR A 1 309 ? 14.734 -13.627 -8.463  1.00 26.30 ? 312 THR A C   1 
ATOM   2350 O  O   . THR A 1 309 ? 15.707 -14.091 -9.058  1.00 27.30 ? 312 THR A O   1 
ATOM   2351 C  CB  . THR A 1 309 ? 15.046 -13.236 -6.021  1.00 25.26 ? 312 THR A CB  1 
ATOM   2352 O  OG1 . THR A 1 309 ? 14.526 -11.903 -6.095  1.00 21.41 ? 312 THR A OG1 1 
ATOM   2353 C  CG2 . THR A 1 309 ? 16.555 -13.207 -6.257  1.00 22.00 ? 312 THR A CG2 1 
ATOM   2354 N  N   . TRP A 1 310 ? 13.954 -12.683 -8.976  1.00 25.29 ? 313 TRP A N   1 
ATOM   2355 C  CA  . TRP A 1 310 ? 14.380 -11.894 -10.119 1.00 23.83 ? 313 TRP A CA  1 
ATOM   2356 C  C   . TRP A 1 310 ? 15.400 -10.886 -9.609  1.00 23.18 ? 313 TRP A C   1 
ATOM   2357 O  O   . TRP A 1 310 ? 15.446 -10.590 -8.415  1.00 19.85 ? 313 TRP A O   1 
ATOM   2358 C  CB  . TRP A 1 310 ? 13.194 -11.141 -10.735 1.00 24.77 ? 313 TRP A CB  1 
ATOM   2359 C  CG  . TRP A 1 310 ? 12.170 -12.011 -11.408 1.00 24.37 ? 313 TRP A CG  1 
ATOM   2360 C  CD1 . TRP A 1 310 ? 11.228 -12.786 -10.799 1.00 26.20 ? 313 TRP A CD1 1 
ATOM   2361 C  CD2 . TRP A 1 310 ? 11.962 -12.166 -12.824 1.00 26.22 ? 313 TRP A CD2 1 
ATOM   2362 N  NE1 . TRP A 1 310 ? 10.446 -13.413 -11.741 1.00 25.74 ? 313 TRP A NE1 1 
ATOM   2363 C  CE2 . TRP A 1 310 ? 10.877 -13.049 -12.992 1.00 25.86 ? 313 TRP A CE2 1 
ATOM   2364 C  CE3 . TRP A 1 310 ? 12.587 -11.642 -13.962 1.00 27.49 ? 313 TRP A CE3 1 
ATOM   2365 C  CZ2 . TRP A 1 310 ? 10.403 -13.424 -14.253 1.00 25.62 ? 313 TRP A CZ2 1 
ATOM   2366 C  CZ3 . TRP A 1 310 ? 12.116 -12.013 -15.213 1.00 24.42 ? 313 TRP A CZ3 1 
ATOM   2367 C  CH2 . TRP A 1 310 ? 11.034 -12.896 -15.347 1.00 25.69 ? 313 TRP A CH2 1 
ATOM   2368 N  N   . ALA A 1 311 ? 16.222 -10.360 -10.509 1.00 21.33 ? 314 ALA A N   1 
ATOM   2369 C  CA  . ALA A 1 311 ? 17.063 -9.231  -10.150 1.00 22.62 ? 314 ALA A CA  1 
ATOM   2370 C  C   . ALA A 1 311 ? 16.823 -8.124  -11.162 1.00 22.18 ? 314 ALA A C   1 
ATOM   2371 O  O   . ALA A 1 311 ? 16.920 -8.351  -12.368 1.00 21.62 ? 314 ALA A O   1 
ATOM   2372 C  CB  . ALA A 1 311 ? 18.545 -9.640  -10.148 1.00 21.83 ? 314 ALA A CB  1 
ATOM   2373 N  N   . LEU A 1 312 ? 16.500 -6.937  -10.668 1.00 20.63 ? 315 LEU A N   1 
ATOM   2374 C  CA  . LEU A 1 312 ? 16.312 -5.789  -11.542 1.00 22.67 ? 315 LEU A CA  1 
ATOM   2375 C  C   . LEU A 1 312 ? 17.638 -5.029  -11.668 1.00 20.82 ? 315 LEU A C   1 
ATOM   2376 O  O   . LEU A 1 312 ? 17.999 -4.252  -10.791 1.00 20.71 ? 315 LEU A O   1 
ATOM   2377 C  CB  . LEU A 1 312 ? 15.216 -4.879  -10.973 1.00 23.29 ? 315 LEU A CB  1 
ATOM   2378 C  CG  . LEU A 1 312 ? 13.876 -5.602  -10.782 1.00 22.83 ? 315 LEU A CG  1 
ATOM   2379 C  CD1 . LEU A 1 312 ? 12.794 -4.621  -10.364 1.00 23.51 ? 315 LEU A CD1 1 
ATOM   2380 C  CD2 . LEU A 1 312 ? 13.494 -6.292  -12.064 1.00 23.84 ? 315 LEU A CD2 1 
ATOM   2381 N  N   . GLY A 1 313 ? 18.355 -5.277  -12.761 1.00 18.33 ? 316 GLY A N   1 
ATOM   2382 C  CA  . GLY A 1 313 ? 19.661 -4.675  -12.958 1.00 20.59 ? 316 GLY A CA  1 
ATOM   2383 C  C   . GLY A 1 313 ? 19.629 -3.414  -13.811 1.00 22.89 ? 316 GLY A C   1 
ATOM   2384 O  O   . GLY A 1 313 ? 18.635 -2.690  -13.825 1.00 22.75 ? 316 GLY A O   1 
ATOM   2385 N  N   . ALA A 1 314 ? 20.720 -3.146  -14.524 1.00 22.83 ? 317 ALA A N   1 
ATOM   2386 C  CA  . ALA A 1 314 ? 20.880 -1.871  -15.211 1.00 21.95 ? 317 ALA A CA  1 
ATOM   2387 C  C   . ALA A 1 314 ? 19.867 -1.703  -16.338 1.00 20.65 ? 317 ALA A C   1 
ATOM   2388 O  O   . ALA A 1 314 ? 19.474 -0.588  -16.655 1.00 20.62 ? 317 ALA A O   1 
ATOM   2389 C  CB  . ALA A 1 314 ? 22.293 -1.744  -15.757 1.00 17.48 ? 317 ALA A CB  1 
ATOM   2390 N  N   . THR A 1 315 ? 19.461 -2.810  -16.947 1.00 20.07 ? 318 THR A N   1 
ATOM   2391 C  CA  . THR A 1 315 ? 18.438 -2.767  -17.974 1.00 20.16 ? 318 THR A CA  1 
ATOM   2392 C  C   . THR A 1 315 ? 17.197 -2.050  -17.434 1.00 22.48 ? 318 THR A C   1 
ATOM   2393 O  O   . THR A 1 315 ? 16.497 -1.353  -18.171 1.00 21.78 ? 318 THR A O   1 
ATOM   2394 C  CB  . THR A 1 315 ? 18.041 -4.179  -18.416 1.00 19.35 ? 318 THR A CB  1 
ATOM   2395 O  OG1 . THR A 1 315 ? 19.209 -4.886  -18.856 1.00 21.86 ? 318 THR A OG1 1 
ATOM   2396 C  CG2 . THR A 1 315 ? 17.032 -4.114  -19.560 1.00 16.60 ? 318 THR A CG2 1 
ATOM   2397 N  N   . PHE A 1 316 ? 16.931 -2.213  -16.141 1.00 21.98 ? 319 PHE A N   1 
ATOM   2398 C  CA  . PHE A 1 316 ? 15.720 -1.663  -15.533 1.00 22.89 ? 319 PHE A CA  1 
ATOM   2399 C  C   . PHE A 1 316 ? 15.987 -0.270  -14.949 1.00 24.93 ? 319 PHE A C   1 
ATOM   2400 O  O   . PHE A 1 316 ? 15.169 0.651   -15.075 1.00 24.83 ? 319 PHE A O   1 
ATOM   2401 C  CB  . PHE A 1 316 ? 15.218 -2.625  -14.440 1.00 23.60 ? 319 PHE A CB  1 
ATOM   2402 C  CG  . PHE A 1 316 ? 13.935 -2.194  -13.775 1.00 23.06 ? 319 PHE A CG  1 
ATOM   2403 C  CD1 . PHE A 1 316 ? 13.947 -1.272  -12.748 1.00 21.76 ? 319 PHE A CD1 1 
ATOM   2404 C  CD2 . PHE A 1 316 ? 12.723 -2.753  -14.150 1.00 23.78 ? 319 PHE A CD2 1 
ATOM   2405 C  CE1 . PHE A 1 316 ? 12.773 -0.913  -12.099 1.00 23.98 ? 319 PHE A CE1 1 
ATOM   2406 C  CE2 . PHE A 1 316 ? 11.541 -2.401  -13.506 1.00 22.21 ? 319 PHE A CE2 1 
ATOM   2407 C  CZ  . PHE A 1 316 ? 11.566 -1.483  -12.482 1.00 21.87 ? 319 PHE A CZ  1 
ATOM   2408 N  N   . ILE A 1 317 ? 17.148 -0.116  -14.326 1.00 24.79 ? 320 ILE A N   1 
ATOM   2409 C  CA  . ILE A 1 317 ? 17.488 1.118   -13.638 1.00 25.61 ? 320 ILE A CA  1 
ATOM   2410 C  C   . ILE A 1 317 ? 17.740 2.259   -14.631 1.00 25.58 ? 320 ILE A C   1 
ATOM   2411 O  O   . ILE A 1 317 ? 17.574 3.428   -14.291 1.00 23.52 ? 320 ILE A O   1 
ATOM   2412 C  CB  . ILE A 1 317 ? 18.733 0.896   -12.738 1.00 25.75 ? 320 ILE A CB  1 
ATOM   2413 C  CG1 . ILE A 1 317 ? 18.389 -0.131  -11.655 1.00 26.26 ? 320 ILE A CG1 1 
ATOM   2414 C  CG2 . ILE A 1 317 ? 19.198 2.198   -12.118 1.00 22.98 ? 320 ILE A CG2 1 
ATOM   2415 C  CD1 . ILE A 1 317 ? 19.575 -0.527  -10.781 1.00 27.68 ? 320 ILE A CD1 1 
ATOM   2416 N  N   . ARG A 1 318 ? 18.129 1.912   -15.856 1.00 26.90 ? 321 ARG A N   1 
ATOM   2417 C  CA  . ARG A 1 318 ? 18.297 2.910   -16.913 1.00 28.74 ? 321 ARG A CA  1 
ATOM   2418 C  C   . ARG A 1 318 ? 16.997 3.672   -17.147 1.00 29.34 ? 321 ARG A C   1 
ATOM   2419 O  O   . ARG A 1 318 ? 16.996 4.891   -17.283 1.00 29.25 ? 321 ARG A O   1 
ATOM   2420 C  CB  . ARG A 1 318 ? 18.720 2.249   -18.224 1.00 26.51 ? 321 ARG A CB  1 
ATOM   2421 C  CG  . ARG A 1 318 ? 20.221 2.105   -18.385 1.00 29.35 ? 321 ARG A CG  1 
ATOM   2422 C  CD  . ARG A 1 318 ? 20.592 1.802   -19.825 1.00 27.98 ? 321 ARG A CD  1 
ATOM   2423 N  NE  . ARG A 1 318 ? 20.220 0.452   -20.239 1.00 26.50 ? 321 ARG A NE  1 
ATOM   2424 C  CZ  . ARG A 1 318 ? 21.029 -0.599  -20.167 1.00 27.37 ? 321 ARG A CZ  1 
ATOM   2425 N  NH1 . ARG A 1 318 ? 22.258 -0.457  -19.680 1.00 25.09 ? 321 ARG A NH1 1 
ATOM   2426 N  NH2 . ARG A 1 318 ? 20.630 -1.780  -20.623 1.00 23.76 ? 321 ARG A NH2 1 
ATOM   2427 N  N   . LYS A 1 319 ? 15.891 2.941   -17.200 1.00 29.13 ? 322 LYS A N   1 
ATOM   2428 C  CA  . LYS A 1 319 ? 14.597 3.566   -17.395 1.00 28.92 ? 322 LYS A CA  1 
ATOM   2429 C  C   . LYS A 1 319 ? 14.064 4.222   -16.128 1.00 28.57 ? 322 LYS A C   1 
ATOM   2430 O  O   . LYS A 1 319 ? 13.444 5.277   -16.192 1.00 30.04 ? 322 LYS A O   1 
ATOM   2431 C  CB  . LYS A 1 319 ? 13.589 2.542   -17.906 1.00 27.65 ? 322 LYS A CB  1 
ATOM   2432 C  CG  . LYS A 1 319 ? 12.224 3.141   -18.201 1.00 28.26 ? 322 LYS A CG  1 
ATOM   2433 C  CD  . LYS A 1 319 ? 11.699 2.654   -19.529 1.00 26.84 ? 322 LYS A CD  1 
ATOM   2434 C  CE  . LYS A 1 319 ? 10.273 3.084   -19.743 1.00 28.11 ? 322 LYS A CE  1 
ATOM   2435 N  NZ  . LYS A 1 319 ? 9.742  2.432   -20.960 1.00 29.08 ? 322 LYS A NZ  1 
ATOM   2436 N  N   . PHE A 1 320 ? 14.300 3.597   -14.979 1.00 29.11 ? 323 PHE A N   1 
ATOM   2437 C  CA  . PHE A 1 320 ? 13.744 4.092   -13.724 1.00 27.81 ? 323 PHE A CA  1 
ATOM   2438 C  C   . PHE A 1 320 ? 14.824 4.467   -12.704 1.00 29.10 ? 323 PHE A C   1 
ATOM   2439 O  O   . PHE A 1 320 ? 15.441 3.601   -12.077 1.00 27.77 ? 323 PHE A O   1 
ATOM   2440 C  CB  . PHE A 1 320 ? 12.788 3.044   -13.136 1.00 26.36 ? 323 PHE A CB  1 
ATOM   2441 C  CG  . PHE A 1 320 ? 11.668 2.659   -14.073 1.00 25.78 ? 323 PHE A CG  1 
ATOM   2442 C  CD1 . PHE A 1 320 ? 10.615 3.536   -14.318 1.00 25.39 ? 323 PHE A CD1 1 
ATOM   2443 C  CD2 . PHE A 1 320 ? 11.699 1.456   -14.755 1.00 23.68 ? 323 PHE A CD2 1 
ATOM   2444 C  CE1 . PHE A 1 320 ? 9.623  3.223   -15.228 1.00 21.25 ? 323 PHE A CE1 1 
ATOM   2445 C  CE2 . PHE A 1 320 ? 10.701 1.137   -15.670 1.00 25.81 ? 323 PHE A CE2 1 
ATOM   2446 C  CZ  . PHE A 1 320 ? 9.665  2.026   -15.904 1.00 25.19 ? 323 PHE A CZ  1 
ATOM   2447 N  N   . TYR A 1 321 ? 15.050 5.768   -12.558 1.00 26.42 ? 324 TYR A N   1 
ATOM   2448 C  CA  . TYR A 1 321 ? 15.917 6.302   -11.514 1.00 27.43 ? 324 TYR A CA  1 
ATOM   2449 C  C   . TYR A 1 321 ? 15.525 5.665   -10.181 1.00 27.78 ? 324 TYR A C   1 
ATOM   2450 O  O   . TYR A 1 321 ? 14.341 5.590   -9.845  1.00 30.44 ? 324 TYR A O   1 
ATOM   2451 C  CB  . TYR A 1 321 ? 15.748 7.826   -11.447 1.00 26.21 ? 324 TYR A CB  1 
ATOM   2452 C  CG  . TYR A 1 321 ? 16.708 8.547   -10.527 1.00 27.61 ? 324 TYR A CG  1 
ATOM   2453 C  CD1 . TYR A 1 321 ? 16.539 8.515   -9.150  1.00 28.31 ? 324 TYR A CD1 1 
ATOM   2454 C  CD2 . TYR A 1 321 ? 17.765 9.295   -11.041 1.00 28.49 ? 324 TYR A CD2 1 
ATOM   2455 C  CE1 . TYR A 1 321 ? 17.389 9.207   -8.306  1.00 26.94 ? 324 TYR A CE1 1 
ATOM   2456 C  CE2 . TYR A 1 321 ? 18.623 9.989   -10.203 1.00 29.87 ? 324 TYR A CE2 1 
ATOM   2457 C  CZ  . TYR A 1 321 ? 18.429 9.941   -8.836  1.00 29.12 ? 324 TYR A CZ  1 
ATOM   2458 O  OH  . TYR A 1 321 ? 19.283 10.615  -7.993  1.00 27.84 ? 324 TYR A OH  1 
ATOM   2459 N  N   . THR A 1 322 ? 16.506 5.200   -9.420  1.00 25.92 ? 325 THR A N   1 
ATOM   2460 C  CA  . THR A 1 322 ? 16.191 4.399   -8.246  1.00 26.25 ? 325 THR A CA  1 
ATOM   2461 C  C   . THR A 1 322 ? 16.748 4.990   -6.955  1.00 24.40 ? 325 THR A C   1 
ATOM   2462 O  O   . THR A 1 322 ? 17.935 5.273   -6.851  1.00 26.75 ? 325 THR A O   1 
ATOM   2463 C  CB  . THR A 1 322 ? 16.702 2.955   -8.430  1.00 25.52 ? 325 THR A CB  1 
ATOM   2464 O  OG1 . THR A 1 322 ? 16.129 2.405   -9.622  1.00 28.16 ? 325 THR A OG1 1 
ATOM   2465 C  CG2 . THR A 1 322 ? 16.310 2.083   -7.244  1.00 21.40 ? 325 THR A CG2 1 
ATOM   2466 N  N   . GLU A 1 323 ? 15.871 5.186   -5.975  1.00 26.41 ? 326 GLU A N   1 
ATOM   2467 C  CA  . GLU A 1 323 ? 16.281 5.689   -4.666  1.00 26.99 ? 326 GLU A CA  1 
ATOM   2468 C  C   . GLU A 1 323 ? 16.197 4.601   -3.594  1.00 27.54 ? 326 GLU A C   1 
ATOM   2469 O  O   . GLU A 1 323 ? 15.119 4.058   -3.340  1.00 30.14 ? 326 GLU A O   1 
ATOM   2470 C  CB  . GLU A 1 323 ? 15.400 6.866   -4.245  1.00 26.91 ? 326 GLU A CB  1 
ATOM   2471 C  CG  . GLU A 1 323 ? 15.677 7.333   -2.821  1.00 29.59 ? 326 GLU A CG  1 
ATOM   2472 C  CD  . GLU A 1 323 ? 14.889 8.575   -2.435  1.00 31.96 ? 326 GLU A CD  1 
ATOM   2473 O  OE1 . GLU A 1 323 ? 13.920 8.453   -1.656  1.00 34.44 ? 326 GLU A OE1 1 
ATOM   2474 O  OE2 . GLU A 1 323 ? 15.240 9.674   -2.905  1.00 33.67 ? 326 GLU A OE2 1 
ATOM   2475 N  N   . PHE A 1 324 ? 17.321 4.301   -2.953  1.00 24.57 ? 327 PHE A N   1 
ATOM   2476 C  CA  . PHE A 1 324 ? 17.344 3.312   -1.878  1.00 26.28 ? 327 PHE A CA  1 
ATOM   2477 C  C   . PHE A 1 324 ? 17.281 3.998   -0.518  1.00 25.38 ? 327 PHE A C   1 
ATOM   2478 O  O   . PHE A 1 324 ? 18.212 4.694   -0.122  1.00 27.60 ? 327 PHE A O   1 
ATOM   2479 C  CB  . PHE A 1 324 ? 18.619 2.464   -1.973  1.00 26.54 ? 327 PHE A CB  1 
ATOM   2480 C  CG  . PHE A 1 324 ? 18.784 1.770   -3.294  1.00 27.16 ? 327 PHE A CG  1 
ATOM   2481 C  CD1 . PHE A 1 324 ? 18.362 0.456   -3.463  1.00 26.60 ? 327 PHE A CD1 1 
ATOM   2482 C  CD2 . PHE A 1 324 ? 19.345 2.435   -4.376  1.00 24.78 ? 327 PHE A CD2 1 
ATOM   2483 C  CE1 . PHE A 1 324 ? 18.496 -0.178  -4.687  1.00 24.12 ? 327 PHE A CE1 1 
ATOM   2484 C  CE2 . PHE A 1 324 ? 19.481 1.806   -5.602  1.00 22.68 ? 327 PHE A CE2 1 
ATOM   2485 C  CZ  . PHE A 1 324 ? 19.056 0.497   -5.758  1.00 22.67 ? 327 PHE A CZ  1 
ATOM   2486 N  N   . ASP A 1 325 ? 16.181 3.796   0.198   1.00 26.11 ? 328 ASP A N   1 
ATOM   2487 C  CA  . ASP A 1 325 ? 15.907 4.560   1.411   1.00 26.06 ? 328 ASP A CA  1 
ATOM   2488 C  C   . ASP A 1 325 ? 16.111 3.707   2.659   1.00 27.37 ? 328 ASP A C   1 
ATOM   2489 O  O   . ASP A 1 325 ? 15.289 2.829   2.969   1.00 23.07 ? 328 ASP A O   1 
ATOM   2490 C  CB  . ASP A 1 325 ? 14.467 5.092   1.371   1.00 27.63 ? 328 ASP A CB  1 
ATOM   2491 C  CG  . ASP A 1 325 ? 14.085 5.886   2.621   1.00 28.91 ? 328 ASP A CG  1 
ATOM   2492 O  OD1 . ASP A 1 325 ? 14.835 5.862   3.629   1.00 29.61 ? 328 ASP A OD1 1 
ATOM   2493 O  OD2 . ASP A 1 325 ? 13.019 6.542   2.581   1.00 26.70 ? 328 ASP A OD2 1 
ATOM   2494 N  N   . ARG A 1 326 ? 17.196 3.978   3.380   1.00 27.09 ? 329 ARG A N   1 
ATOM   2495 C  CA  . ARG A 1 326 ? 17.548 3.163   4.534   1.00 30.60 ? 329 ARG A CA  1 
ATOM   2496 C  C   . ARG A 1 326 ? 16.754 3.552   5.766   1.00 30.74 ? 329 ARG A C   1 
ATOM   2497 O  O   . ARG A 1 326 ? 16.534 2.727   6.646   1.00 33.97 ? 329 ARG A O   1 
ATOM   2498 C  CB  . ARG A 1 326 ? 19.049 3.263   4.833   1.00 30.53 ? 329 ARG A CB  1 
ATOM   2499 C  CG  . ARG A 1 326 ? 19.922 2.339   3.989   1.00 30.37 ? 329 ARG A CG  1 
ATOM   2500 C  CD  . ARG A 1 326 ? 19.700 0.865   4.342   1.00 29.05 ? 329 ARG A CD  1 
ATOM   2501 N  NE  . ARG A 1 326 ? 19.935 0.585   5.758   1.00 31.86 ? 329 ARG A NE  1 
ATOM   2502 C  CZ  . ARG A 1 326 ? 21.137 0.530   6.326   1.00 32.05 ? 329 ARG A CZ  1 
ATOM   2503 N  NH1 . ARG A 1 326 ? 22.234 0.732   5.602   1.00 31.68 ? 329 ARG A NH1 1 
ATOM   2504 N  NH2 . ARG A 1 326 ? 21.242 0.280   7.622   1.00 29.54 ? 329 ARG A NH2 1 
ATOM   2505 N  N   . ARG A 1 327 ? 16.318 4.804   5.833   1.00 33.36 ? 330 ARG A N   1 
ATOM   2506 C  CA  . ARG A 1 327 ? 15.557 5.257   6.991   1.00 33.50 ? 330 ARG A CA  1 
ATOM   2507 C  C   . ARG A 1 327 ? 14.200 4.583   7.031   1.00 31.86 ? 330 ARG A C   1 
ATOM   2508 O  O   . ARG A 1 327 ? 13.739 4.179   8.090   1.00 32.22 ? 330 ARG A O   1 
ATOM   2509 C  CB  . ARG A 1 327 ? 15.356 6.774   6.972   1.00 35.13 ? 330 ARG A CB  1 
ATOM   2510 C  CG  . ARG A 1 327 ? 14.354 7.234   8.025   1.00 39.76 ? 330 ARG A CG  1 
ATOM   2511 C  CD  . ARG A 1 327 ? 14.204 8.741   8.080   1.00 43.22 ? 330 ARG A CD  1 
ATOM   2512 N  NE  . ARG A 1 327 ? 15.434 9.400   8.504   1.00 48.76 ? 330 ARG A NE  1 
ATOM   2513 C  CZ  . ARG A 1 327 ? 16.049 9.169   9.660   1.00 50.19 ? 330 ARG A CZ  1 
ATOM   2514 N  NH1 . ARG A 1 327 ? 15.545 8.288   10.517  1.00 50.57 ? 330 ARG A NH1 1 
ATOM   2515 N  NH2 . ARG A 1 327 ? 17.173 9.814   9.952   1.00 49.01 ? 330 ARG A NH2 1 
ATOM   2516 N  N   . ASN A 1 328 ? 13.565 4.450   5.871   1.00 31.68 ? 331 ASN A N   1 
ATOM   2517 C  CA  . ASN A 1 328 ? 12.199 3.949   5.816   1.00 31.71 ? 331 ASN A CA  1 
ATOM   2518 C  C   . ASN A 1 328 ? 12.105 2.522   5.273   1.00 32.59 ? 331 ASN A C   1 
ATOM   2519 O  O   . ASN A 1 328 ? 11.016 1.974   5.141   1.00 31.86 ? 331 ASN A O   1 
ATOM   2520 C  CB  . ASN A 1 328 ? 11.337 4.901   4.981   1.00 31.97 ? 331 ASN A CB  1 
ATOM   2521 C  CG  . ASN A 1 328 ? 11.288 6.304   5.569   1.00 34.79 ? 331 ASN A CG  1 
ATOM   2522 O  OD1 . ASN A 1 328 ? 11.909 7.234   5.055   1.00 34.16 ? 331 ASN A OD1 1 
ATOM   2523 N  ND2 . ASN A 1 328 ? 10.553 6.456   6.660   1.00 33.99 ? 331 ASN A ND2 1 
ATOM   2524 N  N   . ASN A 1 329 ? 13.255 1.920   4.978   1.00 33.51 ? 332 ASN A N   1 
ATOM   2525 C  CA  . ASN A 1 329 ? 13.293 0.573   4.415   1.00 31.31 ? 332 ASN A CA  1 
ATOM   2526 C  C   . ASN A 1 329 ? 12.368 0.457   3.221   1.00 29.35 ? 332 ASN A C   1 
ATOM   2527 O  O   . ASN A 1 329 ? 11.458 -0.373  3.193   1.00 29.81 ? 332 ASN A O   1 
ATOM   2528 C  CB  . ASN A 1 329 ? 12.910 -0.458  5.469   1.00 32.52 ? 332 ASN A CB  1 
ATOM   2529 C  CG  . ASN A 1 329 ? 14.028 -0.716  6.456   1.00 35.35 ? 332 ASN A CG  1 
ATOM   2530 O  OD1 . ASN A 1 329 ? 15.066 -1.285  6.105   1.00 37.18 ? 332 ASN A OD1 1 
ATOM   2531 N  ND2 . ASN A 1 329 ? 13.829 -0.294  7.695   1.00 34.04 ? 332 ASN A ND2 1 
ATOM   2532 N  N   . ARG A 1 330 ? 12.611 1.307   2.233   1.00 29.04 ? 333 ARG A N   1 
ATOM   2533 C  CA  . ARG A 1 330 ? 11.829 1.305   1.013   1.00 26.82 ? 333 ARG A CA  1 
ATOM   2534 C  C   . ARG A 1 330 ? 12.685 1.698   -0.181  1.00 26.10 ? 333 ARG A C   1 
ATOM   2535 O  O   . ARG A 1 330 ? 13.784 2.231   -0.036  1.00 27.47 ? 333 ARG A O   1 
ATOM   2536 C  CB  . ARG A 1 330 ? 10.649 2.268   1.147   1.00 27.74 ? 333 ARG A CB  1 
ATOM   2537 C  CG  . ARG A 1 330 ? 11.068 3.698   1.390   1.00 30.56 ? 333 ARG A CG  1 
ATOM   2538 C  CD  . ARG A 1 330 ? 9.878  4.603   1.656   1.00 29.06 ? 333 ARG A CD  1 
ATOM   2539 N  NE  . ARG A 1 330 ? 10.280 6.004   1.602   1.00 29.54 ? 333 ARG A NE  1 
ATOM   2540 C  CZ  . ARG A 1 330 ? 9.428  7.021   1.577   1.00 30.18 ? 333 ARG A CZ  1 
ATOM   2541 N  NH1 . ARG A 1 330 ? 8.123  6.793   1.614   1.00 32.58 ? 333 ARG A NH1 1 
ATOM   2542 N  NH2 . ARG A 1 330 ? 9.880  8.263   1.478   1.00 30.48 ? 333 ARG A NH2 1 
ATOM   2543 N  N   . ILE A 1 331 ? 12.168 1.417   -1.366  1.00 24.97 ? 334 ILE A N   1 
ATOM   2544 C  CA  . ILE A 1 331 ? 12.828 1.769   -2.604  1.00 25.20 ? 334 ILE A CA  1 
ATOM   2545 C  C   . ILE A 1 331 ? 11.864 2.638   -3.405  1.00 27.11 ? 334 ILE A C   1 
ATOM   2546 O  O   . ILE A 1 331 ? 10.668 2.344   -3.482  1.00 28.53 ? 334 ILE A O   1 
ATOM   2547 C  CB  . ILE A 1 331 ? 13.179 0.499   -3.419  1.00 24.96 ? 334 ILE A CB  1 
ATOM   2548 C  CG1 . ILE A 1 331 ? 14.268 -0.299  -2.699  1.00 25.95 ? 334 ILE A CG1 1 
ATOM   2549 C  CG2 . ILE A 1 331 ? 13.634 0.876   -4.818  1.00 24.40 ? 334 ILE A CG2 1 
ATOM   2550 C  CD1 . ILE A 1 331 ? 14.670 -1.560  -3.426  1.00 27.14 ? 334 ILE A CD1 1 
ATOM   2551 N  N   . GLY A 1 332 ? 12.385 3.713   -3.984  1.00 26.47 ? 335 GLY A N   1 
ATOM   2552 C  CA  . GLY A 1 332 ? 11.562 4.571   -4.812  1.00 28.59 ? 335 GLY A CA  1 
ATOM   2553 C  C   . GLY A 1 332 ? 11.966 4.521   -6.268  1.00 29.29 ? 335 GLY A C   1 
ATOM   2554 O  O   . GLY A 1 332 ? 13.158 4.500   -6.597  1.00 29.85 ? 335 GLY A O   1 
ATOM   2555 N  N   . PHE A 1 333 ? 10.972 4.493   -7.150  1.00 29.71 ? 336 PHE A N   1 
ATOM   2556 C  CA  . PHE A 1 333 ? 11.235 4.557   -8.579  1.00 30.69 ? 336 PHE A CA  1 
ATOM   2557 C  C   . PHE A 1 333 ? 10.623 5.816   -9.163  1.00 32.47 ? 336 PHE A C   1 
ATOM   2558 O  O   . PHE A 1 333 ? 9.484  6.168   -8.846  1.00 32.51 ? 336 PHE A O   1 
ATOM   2559 C  CB  . PHE A 1 333 ? 10.653 3.334   -9.291  1.00 30.63 ? 336 PHE A CB  1 
ATOM   2560 C  CG  . PHE A 1 333 ? 11.323 2.043   -8.924  1.00 30.62 ? 336 PHE A CG  1 
ATOM   2561 C  CD1 . PHE A 1 333 ? 12.691 1.875   -9.121  1.00 31.82 ? 336 PHE A CD1 1 
ATOM   2562 C  CD2 . PHE A 1 333 ? 10.590 0.999   -8.382  1.00 30.94 ? 336 PHE A CD2 1 
ATOM   2563 C  CE1 . PHE A 1 333 ? 13.322 0.681   -8.782  1.00 31.82 ? 336 PHE A CE1 1 
ATOM   2564 C  CE2 . PHE A 1 333 ? 11.207 -0.202  -8.039  1.00 32.51 ? 336 PHE A CE2 1 
ATOM   2565 C  CZ  . PHE A 1 333 ? 12.580 -0.361  -8.240  1.00 31.49 ? 336 PHE A CZ  1 
ATOM   2566 N  N   . ALA A 1 334 ? 11.390 6.495   -10.009 1.00 32.51 ? 337 ALA A N   1 
ATOM   2567 C  CA  . ALA A 1 334 ? 10.877 7.601   -10.809 1.00 32.87 ? 337 ALA A CA  1 
ATOM   2568 C  C   . ALA A 1 334 ? 11.465 7.503   -12.213 1.00 33.60 ? 337 ALA A C   1 
ATOM   2569 O  O   . ALA A 1 334 ? 12.597 7.055   -12.383 1.00 34.61 ? 337 ALA A O   1 
ATOM   2570 C  CB  . ALA A 1 334 ? 11.259 8.933   -10.164 1.00 30.72 ? 337 ALA A CB  1 
ATOM   2571 N  N   . LEU A 1 335 ? 10.699 7.913   -13.219 1.00 33.15 ? 338 LEU A N   1 
ATOM   2572 C  CA  . LEU A 1 335 ? 11.167 7.870   -14.601 1.00 33.47 ? 338 LEU A CA  1 
ATOM   2573 C  C   . LEU A 1 335 ? 12.506 8.579   -14.745 1.00 33.62 ? 338 LEU A C   1 
ATOM   2574 O  O   . LEU A 1 335 ? 12.669 9.703   -14.277 1.00 34.70 ? 338 LEU A O   1 
ATOM   2575 C  CB  . LEU A 1 335 ? 10.154 8.541   -15.521 1.00 34.50 ? 338 LEU A CB  1 
ATOM   2576 C  CG  . LEU A 1 335 ? 9.300  7.644   -16.407 1.00 35.16 ? 338 LEU A CG  1 
ATOM   2577 C  CD1 . LEU A 1 335 ? 8.441  8.526   -17.304 1.00 37.04 ? 338 LEU A CD1 1 
ATOM   2578 C  CD2 . LEU A 1 335 ? 10.188 6.732   -17.246 1.00 36.66 ? 338 LEU A CD2 1 
ATOM   2579 N  N   . ALA A 1 336 ? 13.462 7.929   -15.400 1.00 31.94 ? 339 ALA A N   1 
ATOM   2580 C  CA  . ALA A 1 336 ? 14.783 8.518   -15.562 1.00 33.03 ? 339 ALA A CA  1 
ATOM   2581 C  C   . ALA A 1 336 ? 14.823 9.480   -16.752 1.00 32.83 ? 339 ALA A C   1 
ATOM   2582 O  O   . ALA A 1 336 ? 14.010 9.388   -17.666 1.00 32.89 ? 339 ALA A O   1 
ATOM   2583 C  CB  . ALA A 1 336 ? 15.836 7.417   -15.738 1.00 30.72 ? 339 ALA A CB  1 
ATOM   2584 N  N   . ARG A 1 337 ? 15.779 10.400  -16.723 1.00 33.24 ? 340 ARG A N   1 
ATOM   2585 C  CA  . ARG A 1 337 ? 16.020 11.303  -17.841 1.00 36.59 ? 340 ARG A CA  1 
ATOM   2586 C  C   . ARG A 1 337 ? 17.386 11.973  -17.675 1.00 37.30 ? 340 ARG A C   1 
ATOM   2587 O  O   . ARG A 1 337 ? 17.924 12.471  -18.686 1.00 38.00 ? 340 ARG A O   1 
ATOM   2588 C  CB  . ARG A 1 337 ? 14.931 12.371  -17.904 1.00 37.85 ? 340 ARG A CB  1 
ATOM   2589 C  CG  . ARG A 1 337 ? 15.013 13.382  -16.781 1.00 40.93 ? 340 ARG A CG  1 
ATOM   2590 C  CD  . ARG A 1 337 ? 13.944 14.443  -16.936 1.00 45.85 ? 340 ARG A CD  1 
ATOM   2591 N  NE  . ARG A 1 337 ? 14.462 15.773  -16.641 1.00 49.70 ? 340 ARG A NE  1 
ATOM   2592 C  CZ  . ARG A 1 337 ? 14.405 16.344  -15.444 1.00 51.60 ? 340 ARG A CZ  1 
ATOM   2593 N  NH1 . ARG A 1 337 ? 13.851 15.700  -14.427 1.00 53.38 ? 340 ARG A NH1 1 
ATOM   2594 N  NH2 . ARG A 1 337 ? 14.901 17.560  -15.266 1.00 52.18 ? 340 ARG A NH2 1 
ATOM   2595 O  OXT . ARG A 1 337 ? 17.899 12.004  -16.531 1.00 36.78 ? 340 ARG A OXT 1 
ATOM   2596 N  N   . GLY B 1 1   ? 57.160 -41.846 -46.040 1.00 65.48 ? 4   GLY B N   1 
ATOM   2597 C  CA  . GLY B 1 1   ? 56.528 -42.115 -44.719 1.00 65.70 ? 4   GLY B CA  1 
ATOM   2598 C  C   . GLY B 1 1   ? 57.552 -42.254 -43.609 1.00 66.17 ? 4   GLY B C   1 
ATOM   2599 O  O   . GLY B 1 1   ? 58.558 -41.539 -43.588 1.00 67.19 ? 4   GLY B O   1 
ATOM   2600 N  N   . ASN B 1 2   ? 57.286 -43.167 -42.681 1.00 65.90 ? 5   ASN B N   1 
ATOM   2601 C  CA  . ASN B 1 2   ? 58.227 -43.499 -41.615 1.00 66.32 ? 5   ASN B CA  1 
ATOM   2602 C  C   . ASN B 1 2   ? 58.219 -42.496 -40.461 1.00 65.89 ? 5   ASN B C   1 
ATOM   2603 O  O   . ASN B 1 2   ? 58.500 -42.864 -39.318 1.00 65.89 ? 5   ASN B O   1 
ATOM   2604 C  CB  . ASN B 1 2   ? 59.648 -43.619 -42.180 1.00 67.32 ? 5   ASN B CB  1 
ATOM   2605 C  CG  . ASN B 1 2   ? 60.634 -44.198 -41.178 1.00 69.15 ? 5   ASN B CG  1 
ATOM   2606 O  OD1 . ASN B 1 2   ? 60.260 -44.964 -40.286 1.00 70.26 ? 5   ASN B OD1 1 
ATOM   2607 N  ND2 . ASN B 1 2   ? 61.902 -43.835 -41.323 1.00 69.36 ? 5   ASN B ND2 1 
ATOM   2608 N  N   . THR B 1 3   ? 57.895 -41.236 -40.749 1.00 64.84 ? 6   THR B N   1 
ATOM   2609 C  CA  . THR B 1 3   ? 58.047 -40.182 -39.749 1.00 63.57 ? 6   THR B CA  1 
ATOM   2610 C  C   . THR B 1 3   ? 56.823 -39.955 -38.862 1.00 62.44 ? 6   THR B C   1 
ATOM   2611 O  O   . THR B 1 3   ? 55.675 -40.119 -39.284 1.00 61.35 ? 6   THR B O   1 
ATOM   2612 C  CB  . THR B 1 3   ? 58.435 -38.829 -40.394 1.00 63.48 ? 6   THR B CB  1 
ATOM   2613 O  OG1 . THR B 1 3   ? 57.354 -38.344 -41.199 1.00 63.58 ? 6   THR B OG1 1 
ATOM   2614 C  CG2 . THR B 1 3   ? 59.674 -38.994 -41.260 1.00 63.94 ? 6   THR B CG2 1 
ATOM   2615 N  N   . THR B 1 4   ? 57.101 -39.578 -37.619 1.00 61.04 ? 7   THR B N   1 
ATOM   2616 C  CA  . THR B 1 4   ? 56.084 -39.244 -36.635 1.00 59.48 ? 7   THR B CA  1 
ATOM   2617 C  C   . THR B 1 4   ? 56.521 -37.985 -35.904 1.00 58.35 ? 7   THR B C   1 
ATOM   2618 O  O   . THR B 1 4   ? 57.671 -37.872 -35.490 1.00 58.78 ? 7   THR B O   1 
ATOM   2619 C  CB  . THR B 1 4   ? 55.925 -40.366 -35.607 1.00 59.72 ? 7   THR B CB  1 
ATOM   2620 O  OG1 . THR B 1 4   ? 55.357 -41.517 -36.243 1.00 61.70 ? 7   THR B OG1 1 
ATOM   2621 C  CG2 . THR B 1 4   ? 55.037 -39.918 -34.469 1.00 60.80 ? 7   THR B CG2 1 
ATOM   2622 N  N   . SER B 1 5   ? 55.607 -37.036 -35.744 1.00 57.01 ? 8   SER B N   1 
ATOM   2623 C  CA  . SER B 1 5   ? 55.936 -35.794 -35.057 1.00 54.34 ? 8   SER B CA  1 
ATOM   2624 C  C   . SER B 1 5   ? 55.152 -35.672 -33.750 1.00 52.68 ? 8   SER B C   1 
ATOM   2625 O  O   . SER B 1 5   ? 54.016 -36.135 -33.645 1.00 51.28 ? 8   SER B O   1 
ATOM   2626 C  CB  . SER B 1 5   ? 55.633 -34.601 -35.965 1.00 55.46 ? 8   SER B CB  1 
ATOM   2627 O  OG  . SER B 1 5   ? 56.390 -33.466 -35.580 1.00 55.89 ? 8   SER B OG  1 
ATOM   2628 N  N   . SER B 1 6   ? 55.767 -35.046 -32.757 1.00 50.56 ? 9   SER B N   1 
ATOM   2629 C  CA  . SER B 1 6   ? 55.156 -34.913 -31.442 1.00 49.73 ? 9   SER B CA  1 
ATOM   2630 C  C   . SER B 1 6   ? 55.028 -33.446 -31.024 1.00 48.59 ? 9   SER B C   1 
ATOM   2631 O  O   . SER B 1 6   ? 55.914 -32.630 -31.293 1.00 47.14 ? 9   SER B O   1 
ATOM   2632 C  CB  . SER B 1 6   ? 55.989 -35.675 -30.411 1.00 49.96 ? 9   SER B CB  1 
ATOM   2633 O  OG  . SER B 1 6   ? 55.421 -35.580 -29.121 1.00 52.42 ? 9   SER B OG  1 
ATOM   2634 N  N   . VAL B 1 7   ? 53.919 -33.111 -30.370 1.00 46.58 ? 10  VAL B N   1 
ATOM   2635 C  CA  . VAL B 1 7   ? 53.734 -31.770 -29.830 1.00 45.33 ? 10  VAL B CA  1 
ATOM   2636 C  C   . VAL B 1 7   ? 53.312 -31.820 -28.371 1.00 44.12 ? 10  VAL B C   1 
ATOM   2637 O  O   . VAL B 1 7   ? 52.183 -32.194 -28.058 1.00 44.80 ? 10  VAL B O   1 
ATOM   2638 C  CB  . VAL B 1 7   ? 52.661 -30.987 -30.610 1.00 45.86 ? 10  VAL B CB  1 
ATOM   2639 C  CG1 . VAL B 1 7   ? 52.459 -29.622 -29.971 1.00 46.44 ? 10  VAL B CG1 1 
ATOM   2640 C  CG2 . VAL B 1 7   ? 53.078 -30.830 -32.064 1.00 47.49 ? 10  VAL B CG2 1 
ATOM   2641 N  N   . ILE B 1 8   ? 54.218 -31.435 -27.481 1.00 42.79 ? 11  ILE B N   1 
ATOM   2642 C  CA  . ILE B 1 8   ? 53.910 -31.382 -26.059 1.00 41.89 ? 11  ILE B CA  1 
ATOM   2643 C  C   . ILE B 1 8   ? 52.837 -30.330 -25.808 1.00 39.48 ? 11  ILE B C   1 
ATOM   2644 O  O   . ILE B 1 8   ? 52.878 -29.250 -26.395 1.00 39.10 ? 11  ILE B O   1 
ATOM   2645 C  CB  . ILE B 1 8   ? 55.160 -31.023 -25.230 1.00 44.07 ? 11  ILE B CB  1 
ATOM   2646 C  CG1 . ILE B 1 8   ? 56.235 -32.100 -25.409 1.00 47.08 ? 11  ILE B CG1 1 
ATOM   2647 C  CG2 . ILE B 1 8   ? 54.792 -30.883 -23.761 1.00 43.64 ? 11  ILE B CG2 1 
ATOM   2648 C  CD1 . ILE B 1 8   ? 57.093 -31.931 -26.667 1.00 50.80 ? 11  ILE B CD1 1 
ATOM   2649 N  N   . LEU B 1 9   ? 51.872 -30.650 -24.949 1.00 37.20 ? 12  LEU B N   1 
ATOM   2650 C  CA  . LEU B 1 9   ? 50.791 -29.713 -24.642 1.00 36.20 ? 12  LEU B CA  1 
ATOM   2651 C  C   . LEU B 1 9   ? 50.826 -29.190 -23.199 1.00 35.19 ? 12  LEU B C   1 
ATOM   2652 O  O   . LEU B 1 9   ? 51.272 -29.882 -22.280 1.00 35.37 ? 12  LEU B O   1 
ATOM   2653 C  CB  . LEU B 1 9   ? 49.429 -30.364 -24.915 1.00 34.22 ? 12  LEU B CB  1 
ATOM   2654 C  CG  . LEU B 1 9   ? 49.085 -30.761 -26.357 1.00 34.72 ? 12  LEU B CG  1 
ATOM   2655 C  CD1 . LEU B 1 9   ? 47.614 -31.142 -26.451 1.00 33.75 ? 12  LEU B CD1 1 
ATOM   2656 C  CD2 . LEU B 1 9   ? 49.378 -29.601 -27.295 1.00 34.54 ? 12  LEU B CD2 1 
ATOM   2657 N  N   . THR B 1 10  ? 50.347 -27.963 -23.009 1.00 36.04 ? 13  THR B N   1 
ATOM   2658 C  CA  . THR B 1 10  ? 50.178 -27.401 -21.666 1.00 36.38 ? 13  THR B CA  1 
ATOM   2659 C  C   . THR B 1 10  ? 48.746 -27.583 -21.174 1.00 34.71 ? 13  THR B C   1 
ATOM   2660 O  O   . THR B 1 10  ? 47.799 -27.354 -21.920 1.00 35.30 ? 13  THR B O   1 
ATOM   2661 C  CB  . THR B 1 10  ? 50.488 -25.887 -21.630 1.00 35.96 ? 13  THR B CB  1 
ATOM   2662 O  OG1 . THR B 1 10  ? 51.829 -25.656 -22.075 1.00 34.14 ? 13  THR B OG1 1 
ATOM   2663 C  CG2 . THR B 1 10  ? 50.325 -25.350 -20.202 1.00 37.29 ? 13  THR B CG2 1 
ATOM   2664 N  N   . ASN B 1 11  ? 48.598 -27.987 -19.915 1.00 33.73 ? 14  ASN B N   1 
ATOM   2665 C  CA  . ASN B 1 11  ? 47.285 -28.114 -19.296 1.00 32.13 ? 14  ASN B CA  1 
ATOM   2666 C  C   . ASN B 1 11  ? 47.017 -26.964 -18.328 1.00 32.30 ? 14  ASN B C   1 
ATOM   2667 O  O   . ASN B 1 11  ? 47.610 -26.886 -17.256 1.00 31.98 ? 14  ASN B O   1 
ATOM   2668 C  CB  . ASN B 1 11  ? 47.183 -29.447 -18.550 1.00 31.42 ? 14  ASN B CB  1 
ATOM   2669 C  CG  . ASN B 1 11  ? 45.883 -29.584 -17.775 1.00 30.05 ? 14  ASN B CG  1 
ATOM   2670 O  OD1 . ASN B 1 11  ? 45.117 -28.629 -17.650 1.00 29.57 ? 14  ASN B OD1 1 
ATOM   2671 N  ND2 . ASN B 1 11  ? 45.627 -30.779 -17.254 1.00 28.40 ? 14  ASN B ND2 1 
ATOM   2672 N  N   . TYR B 1 12  ? 46.107 -26.078 -18.703 1.00 31.88 ? 15  TYR B N   1 
ATOM   2673 C  CA  . TYR B 1 12  ? 45.695 -25.014 -17.805 1.00 32.01 ? 15  TYR B CA  1 
ATOM   2674 C  C   . TYR B 1 12  ? 44.404 -25.398 -17.083 1.00 29.71 ? 15  TYR B C   1 
ATOM   2675 O  O   . TYR B 1 12  ? 43.347 -25.526 -17.701 1.00 28.76 ? 15  TYR B O   1 
ATOM   2676 C  CB  . TYR B 1 12  ? 45.502 -23.715 -18.593 1.00 31.82 ? 15  TYR B CB  1 
ATOM   2677 C  CG  . TYR B 1 12  ? 45.013 -22.546 -17.769 1.00 34.63 ? 15  TYR B CG  1 
ATOM   2678 C  CD1 . TYR B 1 12  ? 45.891 -21.809 -16.980 1.00 36.82 ? 15  TYR B CD1 1 
ATOM   2679 C  CD2 . TYR B 1 12  ? 43.677 -22.167 -17.794 1.00 35.99 ? 15  TYR B CD2 1 
ATOM   2680 C  CE1 . TYR B 1 12  ? 45.447 -20.722 -16.237 1.00 36.89 ? 15  TYR B CE1 1 
ATOM   2681 C  CE2 . TYR B 1 12  ? 43.223 -21.083 -17.054 1.00 38.54 ? 15  TYR B CE2 1 
ATOM   2682 C  CZ  . TYR B 1 12  ? 44.114 -20.366 -16.278 1.00 37.81 ? 15  TYR B CZ  1 
ATOM   2683 O  OH  . TYR B 1 12  ? 43.667 -19.292 -15.542 1.00 40.31 ? 15  TYR B OH  1 
ATOM   2684 N  N   . MET B 1 13  ? 44.515 -25.596 -15.772 1.00 31.10 ? 16  MET B N   1 
ATOM   2685 C  CA  . MET B 1 13  ? 43.363 -25.786 -14.887 1.00 33.69 ? 16  MET B CA  1 
ATOM   2686 C  C   . MET B 1 13  ? 42.447 -26.934 -15.307 1.00 33.46 ? 16  MET B C   1 
ATOM   2687 O  O   . MET B 1 13  ? 41.288 -26.997 -14.889 1.00 32.67 ? 16  MET B O   1 
ATOM   2688 C  CB  . MET B 1 13  ? 42.549 -24.492 -14.798 1.00 36.02 ? 16  MET B CB  1 
ATOM   2689 C  CG  . MET B 1 13  ? 43.323 -23.292 -14.258 1.00 40.67 ? 16  MET B CG  1 
ATOM   2690 S  SD  . MET B 1 13  ? 42.243 -21.892 -13.817 1.00 46.26 ? 16  MET B SD  1 
ATOM   2691 C  CE  . MET B 1 13  ? 41.202 -22.660 -12.521 1.00 40.99 ? 16  MET B CE  1 
ATOM   2692 N  N   . ASP B 1 14  ? 42.977 -27.834 -16.132 1.00 32.65 ? 17  ASP B N   1 
ATOM   2693 C  CA  . ASP B 1 14  ? 42.220 -28.961 -16.672 1.00 32.66 ? 17  ASP B CA  1 
ATOM   2694 C  C   . ASP B 1 14  ? 41.073 -28.516 -17.567 1.00 32.31 ? 17  ASP B C   1 
ATOM   2695 O  O   . ASP B 1 14  ? 40.142 -29.280 -17.824 1.00 32.02 ? 17  ASP B O   1 
ATOM   2696 C  CB  . ASP B 1 14  ? 41.674 -29.837 -15.545 1.00 35.37 ? 17  ASP B CB  1 
ATOM   2697 C  CG  . ASP B 1 14  ? 42.763 -30.586 -14.819 1.00 38.27 ? 17  ASP B CG  1 
ATOM   2698 O  OD1 . ASP B 1 14  ? 43.588 -31.243 -15.493 1.00 40.70 ? 17  ASP B OD1 1 
ATOM   2699 O  OD2 . ASP B 1 14  ? 42.799 -30.514 -13.575 1.00 41.34 ? 17  ASP B OD2 1 
ATOM   2700 N  N   . THR B 1 15  ? 41.136 -27.275 -18.034 1.00 31.27 ? 18  THR B N   1 
ATOM   2701 C  CA  . THR B 1 15  ? 40.124 -26.772 -18.944 1.00 30.82 ? 18  THR B CA  1 
ATOM   2702 C  C   . THR B 1 15  ? 40.734 -26.316 -20.266 1.00 29.34 ? 18  THR B C   1 
ATOM   2703 O  O   . THR B 1 15  ? 40.118 -26.464 -21.318 1.00 32.47 ? 18  THR B O   1 
ATOM   2704 C  CB  . THR B 1 15  ? 39.339 -25.602 -18.315 1.00 29.87 ? 18  THR B CB  1 
ATOM   2705 O  OG1 . THR B 1 15  ? 40.240 -24.544 -18.000 1.00 32.25 ? 18  THR B OG1 1 
ATOM   2706 C  CG2 . THR B 1 15  ? 38.650 -26.047 -17.037 1.00 32.91 ? 18  THR B CG2 1 
ATOM   2707 N  N   . GLN B 1 16  ? 41.943 -25.767 -20.222 1.00 28.29 ? 19  GLN B N   1 
ATOM   2708 C  CA  . GLN B 1 16  ? 42.580 -25.286 -21.444 1.00 26.85 ? 19  GLN B CA  1 
ATOM   2709 C  C   . GLN B 1 16  ? 43.829 -26.089 -21.779 1.00 27.84 ? 19  GLN B C   1 
ATOM   2710 O  O   . GLN B 1 16  ? 44.793 -26.107 -21.006 1.00 28.66 ? 19  GLN B O   1 
ATOM   2711 C  CB  . GLN B 1 16  ? 42.919 -23.804 -21.306 1.00 27.48 ? 19  GLN B CB  1 
ATOM   2712 C  CG  . GLN B 1 16  ? 41.703 -22.958 -20.940 1.00 28.26 ? 19  GLN B CG  1 
ATOM   2713 C  CD  . GLN B 1 16  ? 41.932 -21.480 -21.165 1.00 30.49 ? 19  GLN B CD  1 
ATOM   2714 O  OE1 . GLN B 1 16  ? 42.799 -21.087 -21.948 1.00 30.85 ? 19  GLN B OE1 1 
ATOM   2715 N  NE2 . GLN B 1 16  ? 41.156 -20.650 -20.477 1.00 29.64 ? 19  GLN B NE2 1 
ATOM   2716 N  N   . TYR B 1 17  ? 43.789 -26.773 -22.923 1.00 26.02 ? 20  TYR B N   1 
ATOM   2717 C  CA  . TYR B 1 17  ? 44.920 -27.570 -23.400 1.00 28.56 ? 20  TYR B CA  1 
ATOM   2718 C  C   . TYR B 1 17  ? 45.383 -26.988 -24.731 1.00 29.18 ? 20  TYR B C   1 
ATOM   2719 O  O   . TYR B 1 17  ? 44.588 -26.860 -25.660 1.00 30.08 ? 20  TYR B O   1 
ATOM   2720 C  CB  . TYR B 1 17  ? 44.507 -29.039 -23.610 1.00 27.39 ? 20  TYR B CB  1 
ATOM   2721 C  CG  . TYR B 1 17  ? 44.185 -29.814 -22.341 1.00 27.83 ? 20  TYR B CG  1 
ATOM   2722 C  CD1 . TYR B 1 17  ? 45.116 -30.679 -21.778 1.00 26.16 ? 20  TYR B CD1 1 
ATOM   2723 C  CD2 . TYR B 1 17  ? 42.948 -29.690 -21.717 1.00 26.97 ? 20  TYR B CD2 1 
ATOM   2724 C  CE1 . TYR B 1 17  ? 44.828 -31.398 -20.635 1.00 25.63 ? 20  TYR B CE1 1 
ATOM   2725 C  CE2 . TYR B 1 17  ? 42.646 -30.407 -20.568 1.00 25.72 ? 20  TYR B CE2 1 
ATOM   2726 C  CZ  . TYR B 1 17  ? 43.591 -31.261 -20.032 1.00 29.32 ? 20  TYR B CZ  1 
ATOM   2727 O  OH  . TYR B 1 17  ? 43.297 -31.998 -18.900 1.00 28.88 ? 20  TYR B OH  1 
ATOM   2728 N  N   . TYR B 1 18  ? 46.663 -26.635 -24.821 1.00 30.71 ? 21  TYR B N   1 
ATOM   2729 C  CA  . TYR B 1 18  ? 47.202 -26.022 -26.033 1.00 32.32 ? 21  TYR B CA  1 
ATOM   2730 C  C   . TYR B 1 18  ? 48.689 -26.304 -26.198 1.00 32.52 ? 21  TYR B C   1 
ATOM   2731 O  O   . TYR B 1 18  ? 49.376 -26.661 -25.241 1.00 32.83 ? 21  TYR B O   1 
ATOM   2732 C  CB  . TYR B 1 18  ? 46.976 -24.506 -26.022 1.00 31.24 ? 21  TYR B CB  1 
ATOM   2733 C  CG  . TYR B 1 18  ? 47.509 -23.815 -24.783 1.00 33.93 ? 21  TYR B CG  1 
ATOM   2734 C  CD1 . TYR B 1 18  ? 46.686 -23.587 -23.689 1.00 34.90 ? 21  TYR B CD1 1 
ATOM   2735 C  CD2 . TYR B 1 18  ? 48.834 -23.401 -24.705 1.00 33.91 ? 21  TYR B CD2 1 
ATOM   2736 C  CE1 . TYR B 1 18  ? 47.166 -22.964 -22.553 1.00 35.24 ? 21  TYR B CE1 1 
ATOM   2737 C  CE2 . TYR B 1 18  ? 49.323 -22.779 -23.571 1.00 36.30 ? 21  TYR B CE2 1 
ATOM   2738 C  CZ  . TYR B 1 18  ? 48.481 -22.562 -22.498 1.00 36.22 ? 21  TYR B CZ  1 
ATOM   2739 O  OH  . TYR B 1 18  ? 48.948 -21.928 -21.366 1.00 39.20 ? 21  TYR B OH  1 
ATOM   2740 N  N   . GLY B 1 19  ? 49.170 -26.141 -27.428 1.00 34.09 ? 22  GLY B N   1 
ATOM   2741 C  CA  . GLY B 1 19  ? 50.564 -26.395 -27.738 1.00 34.81 ? 22  GLY B CA  1 
ATOM   2742 C  C   . GLY B 1 19  ? 51.138 -25.325 -28.649 1.00 36.21 ? 22  GLY B C   1 
ATOM   2743 O  O   . GLY B 1 19  ? 50.448 -24.378 -29.020 1.00 34.66 ? 22  GLY B O   1 
ATOM   2744 N  N   . GLU B 1 20  ? 52.405 -25.477 -29.015 1.00 38.64 ? 23  GLU B N   1 
ATOM   2745 C  CA  . GLU B 1 20  ? 53.124 -24.426 -29.723 1.00 41.62 ? 23  GLU B CA  1 
ATOM   2746 C  C   . GLU B 1 20  ? 53.361 -24.776 -31.184 1.00 41.27 ? 23  GLU B C   1 
ATOM   2747 O  O   . GLU B 1 20  ? 53.800 -25.877 -31.502 1.00 41.16 ? 23  GLU B O   1 
ATOM   2748 C  CB  . GLU B 1 20  ? 54.467 -24.166 -29.031 1.00 44.49 ? 23  GLU B CB  1 
ATOM   2749 C  CG  . GLU B 1 20  ? 55.359 -23.149 -29.726 1.00 48.59 ? 23  GLU B CG  1 
ATOM   2750 C  CD  . GLU B 1 20  ? 56.724 -23.038 -29.069 1.00 51.80 ? 23  GLU B CD  1 
ATOM   2751 O  OE1 . GLU B 1 20  ? 56.785 -23.037 -27.817 1.00 51.27 ? 23  GLU B OE1 1 
ATOM   2752 O  OE2 . GLU B 1 20  ? 57.734 -22.955 -29.803 1.00 52.77 ? 23  GLU B OE2 1 
ATOM   2753 N  N   . ILE B 1 21  ? 53.058 -23.830 -32.067 1.00 43.68 ? 24  ILE B N   1 
ATOM   2754 C  CA  . ILE B 1 21  ? 53.487 -23.906 -33.459 1.00 43.93 ? 24  ILE B CA  1 
ATOM   2755 C  C   . ILE B 1 21  ? 54.451 -22.761 -33.777 1.00 45.49 ? 24  ILE B C   1 
ATOM   2756 O  O   . ILE B 1 21  ? 54.537 -21.778 -33.033 1.00 46.02 ? 24  ILE B O   1 
ATOM   2757 C  CB  . ILE B 1 21  ? 52.290 -23.825 -34.430 1.00 42.34 ? 24  ILE B CB  1 
ATOM   2758 C  CG1 . ILE B 1 21  ? 51.583 -22.478 -34.287 1.00 41.70 ? 24  ILE B CG1 1 
ATOM   2759 C  CG2 . ILE B 1 21  ? 51.321 -24.952 -34.148 1.00 41.99 ? 24  ILE B CG2 1 
ATOM   2760 C  CD1 . ILE B 1 21  ? 50.452 -22.279 -35.289 1.00 39.78 ? 24  ILE B CD1 1 
ATOM   2761 N  N   . GLY B 1 22  ? 55.181 -22.897 -34.877 1.00 46.51 ? 25  GLY B N   1 
ATOM   2762 C  CA  . GLY B 1 22  ? 56.078 -21.835 -35.298 1.00 46.36 ? 25  GLY B CA  1 
ATOM   2763 C  C   . GLY B 1 22  ? 55.704 -21.314 -36.670 1.00 46.88 ? 25  GLY B C   1 
ATOM   2764 O  O   . GLY B 1 22  ? 55.597 -22.083 -37.627 1.00 46.91 ? 25  GLY B O   1 
ATOM   2765 N  N   . ILE B 1 23  ? 55.495 -20.007 -36.774 1.00 47.71 ? 26  ILE B N   1 
ATOM   2766 C  CA  . ILE B 1 23  ? 55.133 -19.419 -38.052 1.00 49.06 ? 26  ILE B CA  1 
ATOM   2767 C  C   . ILE B 1 23  ? 56.204 -18.460 -38.566 1.00 49.97 ? 26  ILE B C   1 
ATOM   2768 O  O   . ILE B 1 23  ? 56.637 -17.550 -37.855 1.00 47.90 ? 26  ILE B O   1 
ATOM   2769 C  CB  . ILE B 1 23  ? 53.793 -18.658 -37.969 1.00 49.40 ? 26  ILE B CB  1 
ATOM   2770 C  CG1 . ILE B 1 23  ? 52.679 -19.593 -37.488 1.00 51.46 ? 26  ILE B CG1 1 
ATOM   2771 C  CG2 . ILE B 1 23  ? 53.428 -18.115 -39.337 1.00 49.81 ? 26  ILE B CG2 1 
ATOM   2772 C  CD1 . ILE B 1 23  ? 51.295 -18.955 -37.500 1.00 50.91 ? 26  ILE B CD1 1 
ATOM   2773 N  N   . GLY B 1 24  ? 56.628 -18.677 -39.807 1.00 51.35 ? 27  GLY B N   1 
ATOM   2774 C  CA  . GLY B 1 24  ? 57.464 -17.703 -40.485 1.00 53.39 ? 27  GLY B CA  1 
ATOM   2775 C  C   . GLY B 1 24  ? 58.954 -17.950 -40.363 1.00 53.90 ? 27  GLY B C   1 
ATOM   2776 O  O   . GLY B 1 24  ? 59.389 -18.893 -39.703 1.00 53.23 ? 27  GLY B O   1 
ATOM   2777 N  N   . THR B 1 25  ? 59.737 -17.093 -41.014 1.00 54.75 ? 28  THR B N   1 
ATOM   2778 C  CA  . THR B 1 25  ? 61.191 -17.152 -40.926 1.00 54.06 ? 28  THR B CA  1 
ATOM   2779 C  C   . THR B 1 25  ? 61.721 -15.764 -40.568 1.00 53.88 ? 28  THR B C   1 
ATOM   2780 O  O   . THR B 1 25  ? 61.526 -14.802 -41.313 1.00 53.36 ? 28  THR B O   1 
ATOM   2781 C  CB  . THR B 1 25  ? 61.810 -17.593 -42.267 1.00 54.65 ? 28  THR B CB  1 
ATOM   2782 O  OG1 . THR B 1 25  ? 61.146 -18.772 -42.735 1.00 54.84 ? 28  THR B OG1 1 
ATOM   2783 C  CG2 . THR B 1 25  ? 63.294 -17.896 -42.094 1.00 55.37 ? 28  THR B CG2 1 
ATOM   2784 N  N   . PRO B 1 26  ? 62.379 -15.642 -39.406 1.00 53.38 ? 29  PRO B N   1 
ATOM   2785 C  CA  . PRO B 1 26  ? 62.494 -16.739 -38.438 1.00 53.59 ? 29  PRO B CA  1 
ATOM   2786 C  C   . PRO B 1 26  ? 61.132 -17.045 -37.806 1.00 53.17 ? 29  PRO B C   1 
ATOM   2787 O  O   . PRO B 1 26  ? 60.251 -16.186 -37.772 1.00 53.44 ? 29  PRO B O   1 
ATOM   2788 C  CB  . PRO B 1 26  ? 63.507 -16.214 -37.422 1.00 53.11 ? 29  PRO B CB  1 
ATOM   2789 C  CG  . PRO B 1 26  ? 63.374 -14.722 -37.501 1.00 52.65 ? 29  PRO B CG  1 
ATOM   2790 C  CD  . PRO B 1 26  ? 63.034 -14.408 -38.932 1.00 52.43 ? 29  PRO B CD  1 
ATOM   2791 N  N   . PRO B 1 27  ? 60.940 -18.281 -37.319 1.00 53.64 ? 30  PRO B N   1 
ATOM   2792 C  CA  . PRO B 1 27  ? 59.641 -18.731 -36.795 1.00 52.90 ? 30  PRO B CA  1 
ATOM   2793 C  C   . PRO B 1 27  ? 59.197 -17.991 -35.537 1.00 52.36 ? 30  PRO B C   1 
ATOM   2794 O  O   . PRO B 1 27  ? 59.916 -17.965 -34.538 1.00 53.54 ? 30  PRO B O   1 
ATOM   2795 C  CB  . PRO B 1 27  ? 59.853 -20.222 -36.527 1.00 53.58 ? 30  PRO B CB  1 
ATOM   2796 C  CG  . PRO B 1 27  ? 61.023 -20.601 -37.398 1.00 54.90 ? 30  PRO B CG  1 
ATOM   2797 C  CD  . PRO B 1 27  ? 61.907 -19.388 -37.410 1.00 53.78 ? 30  PRO B CD  1 
ATOM   2798 N  N   . GLN B 1 28  ? 58.009 -17.394 -35.597 1.00 50.82 ? 31  GLN B N   1 
ATOM   2799 C  CA  . GLN B 1 28  ? 57.392 -16.757 -34.434 1.00 49.18 ? 31  GLN B CA  1 
ATOM   2800 C  C   . GLN B 1 28  ? 56.466 -17.758 -33.733 1.00 47.33 ? 31  GLN B C   1 
ATOM   2801 O  O   . GLN B 1 28  ? 55.536 -18.279 -34.345 1.00 46.02 ? 31  GLN B O   1 
ATOM   2802 C  CB  . GLN B 1 28  ? 56.590 -15.532 -34.883 1.00 48.75 ? 31  GLN B CB  1 
ATOM   2803 C  CG  . GLN B 1 28  ? 57.392 -14.549 -35.714 1.00 49.65 ? 31  GLN B CG  1 
ATOM   2804 C  CD  . GLN B 1 28  ? 56.544 -13.421 -36.279 1.00 51.04 ? 31  GLN B CD  1 
ATOM   2805 O  OE1 . GLN B 1 28  ? 56.037 -12.577 -35.538 1.00 50.64 ? 31  GLN B OE1 1 
ATOM   2806 N  NE2 . GLN B 1 28  ? 56.390 -13.401 -37.598 1.00 51.09 ? 31  GLN B NE2 1 
ATOM   2807 N  N   . THR B 1 29  ? 56.722 -18.023 -32.455 1.00 45.90 ? 32  THR B N   1 
ATOM   2808 C  CA  . THR B 1 29  ? 56.019 -19.091 -31.745 1.00 44.86 ? 32  THR B CA  1 
ATOM   2809 C  C   . THR B 1 29  ? 54.660 -18.649 -31.205 1.00 44.54 ? 32  THR B C   1 
ATOM   2810 O  O   . THR B 1 29  ? 54.528 -17.564 -30.633 1.00 45.51 ? 32  THR B O   1 
ATOM   2811 C  CB  . THR B 1 29  ? 56.841 -19.616 -30.558 1.00 44.81 ? 32  THR B CB  1 
ATOM   2812 O  OG1 . THR B 1 29  ? 56.967 -18.584 -29.573 1.00 45.74 ? 32  THR B OG1 1 
ATOM   2813 C  CG2 . THR B 1 29  ? 58.222 -20.049 -31.015 1.00 43.74 ? 32  THR B CG2 1 
ATOM   2814 N  N   . PHE B 1 30  ? 53.654 -19.504 -31.377 1.00 43.57 ? 33  PHE B N   1 
ATOM   2815 C  CA  . PHE B 1 30  ? 52.316 -19.221 -30.863 1.00 40.97 ? 33  PHE B CA  1 
ATOM   2816 C  C   . PHE B 1 30  ? 51.758 -20.355 -30.012 1.00 39.67 ? 33  PHE B C   1 
ATOM   2817 O  O   . PHE B 1 30  ? 52.054 -21.530 -30.238 1.00 39.43 ? 33  PHE B O   1 
ATOM   2818 C  CB  . PHE B 1 30  ? 51.358 -18.933 -32.018 1.00 41.11 ? 33  PHE B CB  1 
ATOM   2819 C  CG  . PHE B 1 30  ? 51.681 -17.674 -32.763 1.00 42.06 ? 33  PHE B CG  1 
ATOM   2820 C  CD1 . PHE B 1 30  ? 51.103 -16.470 -32.398 1.00 43.17 ? 33  PHE B CD1 1 
ATOM   2821 C  CD2 . PHE B 1 30  ? 52.585 -17.686 -33.810 1.00 42.55 ? 33  PHE B CD2 1 
ATOM   2822 C  CE1 . PHE B 1 30  ? 51.427 -15.298 -33.069 1.00 43.63 ? 33  PHE B CE1 1 
ATOM   2823 C  CE2 . PHE B 1 30  ? 52.911 -16.523 -34.481 1.00 41.26 ? 33  PHE B CE2 1 
ATOM   2824 C  CZ  . PHE B 1 30  ? 52.332 -15.329 -34.109 1.00 42.13 ? 33  PHE B CZ  1 
ATOM   2825 N  N   . LYS B 1 31  ? 50.955 -19.991 -29.020 1.00 38.44 ? 34  LYS B N   1 
ATOM   2826 C  CA  . LYS B 1 31  ? 50.176 -20.976 -28.285 1.00 39.16 ? 34  LYS B CA  1 
ATOM   2827 C  C   . LYS B 1 31  ? 48.859 -21.176 -29.037 1.00 37.63 ? 34  LYS B C   1 
ATOM   2828 O  O   . LYS B 1 31  ? 48.127 -20.215 -29.287 1.00 37.86 ? 34  LYS B O   1 
ATOM   2829 C  CB  . LYS B 1 31  ? 49.921 -20.480 -26.858 1.00 39.02 ? 34  LYS B CB  1 
ATOM   2830 C  CG  . LYS B 1 31  ? 51.200 -20.262 -26.051 1.00 42.06 ? 34  LYS B CG  1 
ATOM   2831 C  CD  . LYS B 1 31  ? 50.946 -19.419 -24.805 1.00 44.41 ? 34  LYS B CD  1 
ATOM   2832 C  CE  . LYS B 1 31  ? 52.246 -19.063 -24.099 1.00 45.91 ? 34  LYS B CE  1 
ATOM   2833 N  NZ  . LYS B 1 31  ? 52.050 -17.972 -23.101 1.00 47.52 ? 34  LYS B NZ  1 
ATOM   2834 N  N   . VAL B 1 32  ? 48.568 -22.414 -29.422 1.00 35.54 ? 35  VAL B N   1 
ATOM   2835 C  CA  . VAL B 1 32  ? 47.366 -22.680 -30.208 1.00 35.51 ? 35  VAL B CA  1 
ATOM   2836 C  C   . VAL B 1 32  ? 46.588 -23.883 -29.698 1.00 34.14 ? 35  VAL B C   1 
ATOM   2837 O  O   . VAL B 1 32  ? 47.161 -24.804 -29.103 1.00 31.50 ? 35  VAL B O   1 
ATOM   2838 C  CB  . VAL B 1 32  ? 47.704 -22.916 -31.692 1.00 35.76 ? 35  VAL B CB  1 
ATOM   2839 C  CG1 . VAL B 1 32  ? 48.310 -21.657 -32.292 1.00 36.65 ? 35  VAL B CG1 1 
ATOM   2840 C  CG2 . VAL B 1 32  ? 48.667 -24.090 -31.823 1.00 34.57 ? 35  VAL B CG2 1 
ATOM   2841 N  N   . VAL B 1 33  ? 45.276 -23.851 -29.934 1.00 33.79 ? 36  VAL B N   1 
ATOM   2842 C  CA  . VAL B 1 33  ? 44.396 -24.977 -29.635 1.00 33.29 ? 36  VAL B CA  1 
ATOM   2843 C  C   . VAL B 1 33  ? 44.324 -25.880 -30.859 1.00 33.11 ? 36  VAL B C   1 
ATOM   2844 O  O   . VAL B 1 33  ? 43.990 -25.434 -31.962 1.00 31.91 ? 36  VAL B O   1 
ATOM   2845 C  CB  . VAL B 1 33  ? 42.946 -24.516 -29.299 1.00 32.76 ? 36  VAL B CB  1 
ATOM   2846 C  CG1 . VAL B 1 33  ? 42.044 -25.729 -29.139 1.00 31.50 ? 36  VAL B CG1 1 
ATOM   2847 C  CG2 . VAL B 1 33  ? 42.928 -23.693 -28.021 1.00 32.23 ? 36  VAL B CG2 1 
ATOM   2848 N  N   . PHE B 1 34  ? 44.642 -27.152 -30.662 1.00 31.57 ? 37  PHE B N   1 
ATOM   2849 C  CA  . PHE B 1 34  ? 44.481 -28.126 -31.726 1.00 30.25 ? 37  PHE B CA  1 
ATOM   2850 C  C   . PHE B 1 34  ? 43.070 -28.704 -31.606 1.00 29.16 ? 37  PHE B C   1 
ATOM   2851 O  O   . PHE B 1 34  ? 42.783 -29.524 -30.728 1.00 27.98 ? 37  PHE B O   1 
ATOM   2852 C  CB  . PHE B 1 34  ? 45.563 -29.211 -31.602 1.00 30.51 ? 37  PHE B CB  1 
ATOM   2853 C  CG  . PHE B 1 34  ? 46.980 -28.689 -31.799 1.00 32.78 ? 37  PHE B CG  1 
ATOM   2854 C  CD1 . PHE B 1 34  ? 47.774 -28.353 -30.709 1.00 32.23 ? 37  PHE B CD1 1 
ATOM   2855 C  CD2 . PHE B 1 34  ? 47.510 -28.534 -33.074 1.00 30.01 ? 37  PHE B CD2 1 
ATOM   2856 C  CE1 . PHE B 1 34  ? 49.067 -27.877 -30.885 1.00 33.41 ? 37  PHE B CE1 1 
ATOM   2857 C  CE2 . PHE B 1 34  ? 48.803 -28.056 -33.260 1.00 30.64 ? 37  PHE B CE2 1 
ATOM   2858 C  CZ  . PHE B 1 34  ? 49.582 -27.728 -32.166 1.00 32.24 ? 37  PHE B CZ  1 
ATOM   2859 N  N   . ASP B 1 35  ? 42.195 -28.257 -32.501 1.00 28.51 ? 38  ASP B N   1 
ATOM   2860 C  CA  . ASP B 1 35  ? 40.754 -28.431 -32.361 1.00 28.18 ? 38  ASP B CA  1 
ATOM   2861 C  C   . ASP B 1 35  ? 40.165 -29.312 -33.463 1.00 28.86 ? 38  ASP B C   1 
ATOM   2862 O  O   . ASP B 1 35  ? 39.991 -28.855 -34.600 1.00 27.70 ? 38  ASP B O   1 
ATOM   2863 C  CB  . ASP B 1 35  ? 40.089 -27.045 -32.386 1.00 30.15 ? 38  ASP B CB  1 
ATOM   2864 C  CG  . ASP B 1 35  ? 38.578 -27.110 -32.352 1.00 30.17 ? 38  ASP B CG  1 
ATOM   2865 O  OD1 . ASP B 1 35  ? 38.028 -28.141 -31.909 1.00 29.30 ? 38  ASP B OD1 1 
ATOM   2866 O  OD2 . ASP B 1 35  ? 37.937 -26.117 -32.773 1.00 29.33 ? 38  ASP B OD2 1 
ATOM   2867 N  N   . THR B 1 36  ? 39.845 -30.566 -33.128 1.00 28.28 ? 39  THR B N   1 
ATOM   2868 C  CA  . THR B 1 36  ? 39.190 -31.466 -34.085 1.00 28.77 ? 39  THR B CA  1 
ATOM   2869 C  C   . THR B 1 36  ? 37.764 -31.030 -34.413 1.00 29.89 ? 39  THR B C   1 
ATOM   2870 O  O   . THR B 1 36  ? 37.156 -31.539 -35.359 1.00 32.30 ? 39  THR B O   1 
ATOM   2871 C  CB  . THR B 1 36  ? 39.125 -32.939 -33.582 1.00 28.08 ? 39  THR B CB  1 
ATOM   2872 O  OG1 . THR B 1 36  ? 38.477 -32.990 -32.303 1.00 26.90 ? 39  THR B OG1 1 
ATOM   2873 C  CG2 . THR B 1 36  ? 40.528 -33.539 -33.478 1.00 28.12 ? 39  THR B CG2 1 
ATOM   2874 N  N   . GLY B 1 37  ? 37.231 -30.092 -33.638 1.00 28.02 ? 40  GLY B N   1 
ATOM   2875 C  CA  . GLY B 1 37  ? 35.908 -29.566 -33.929 1.00 30.12 ? 40  GLY B CA  1 
ATOM   2876 C  C   . GLY B 1 37  ? 35.826 -28.476 -34.996 1.00 30.62 ? 40  GLY B C   1 
ATOM   2877 O  O   . GLY B 1 37  ? 34.731 -28.087 -35.388 1.00 29.52 ? 40  GLY B O   1 
ATOM   2878 N  N   . SER B 1 38  ? 36.966 -27.973 -35.464 1.00 32.10 ? 41  SER B N   1 
ATOM   2879 C  CA  . SER B 1 38  ? 36.980 -27.030 -36.583 1.00 33.66 ? 41  SER B CA  1 
ATOM   2880 C  C   . SER B 1 38  ? 38.186 -27.268 -37.486 1.00 34.55 ? 41  SER B C   1 
ATOM   2881 O  O   . SER B 1 38  ? 39.009 -28.142 -37.210 1.00 32.03 ? 41  SER B O   1 
ATOM   2882 C  CB  . SER B 1 38  ? 36.993 -25.584 -36.073 1.00 34.12 ? 41  SER B CB  1 
ATOM   2883 O  OG  . SER B 1 38  ? 38.177 -25.291 -35.356 1.00 35.96 ? 41  SER B OG  1 
ATOM   2884 N  N   . SER B 1 39  ? 38.295 -26.479 -38.555 1.00 36.35 ? 42  SER B N   1 
ATOM   2885 C  CA  . SER B 1 39  ? 39.203 -26.811 -39.648 1.00 38.84 ? 42  SER B CA  1 
ATOM   2886 C  C   . SER B 1 39  ? 40.113 -25.693 -40.160 1.00 38.95 ? 42  SER B C   1 
ATOM   2887 O  O   . SER B 1 39  ? 40.820 -25.883 -41.153 1.00 40.23 ? 42  SER B O   1 
ATOM   2888 C  CB  . SER B 1 39  ? 38.403 -27.375 -40.822 1.00 38.81 ? 42  SER B CB  1 
ATOM   2889 O  OG  . SER B 1 39  ? 37.753 -28.574 -40.447 1.00 38.79 ? 42  SER B OG  1 
ATOM   2890 N  N   . ASN B 1 40  ? 40.104 -24.541 -39.495 1.00 37.93 ? 43  ASN B N   1 
ATOM   2891 C  CA  . ASN B 1 40  ? 40.924 -23.412 -39.925 1.00 37.96 ? 43  ASN B CA  1 
ATOM   2892 C  C   . ASN B 1 40  ? 42.070 -23.110 -38.973 1.00 38.86 ? 43  ASN B C   1 
ATOM   2893 O  O   . ASN B 1 40  ? 41.991 -23.389 -37.775 1.00 39.15 ? 43  ASN B O   1 
ATOM   2894 C  CB  . ASN B 1 40  ? 40.063 -22.159 -40.088 1.00 36.98 ? 43  ASN B CB  1 
ATOM   2895 C  CG  . ASN B 1 40  ? 39.113 -22.262 -41.257 1.00 37.59 ? 43  ASN B CG  1 
ATOM   2896 O  OD1 . ASN B 1 40  ? 38.279 -23.162 -41.313 1.00 38.29 ? 43  ASN B OD1 1 
ATOM   2897 N  ND2 . ASN B 1 40  ? 39.240 -21.344 -42.207 1.00 37.41 ? 43  ASN B ND2 1 
ATOM   2898 N  N   . VAL B 1 41  ? 43.141 -22.541 -39.518 1.00 38.55 ? 44  VAL B N   1 
ATOM   2899 C  CA  . VAL B 1 41  ? 44.246 -22.060 -38.702 1.00 38.05 ? 44  VAL B CA  1 
ATOM   2900 C  C   . VAL B 1 41  ? 44.211 -20.540 -38.610 1.00 38.10 ? 44  VAL B C   1 
ATOM   2901 O  O   . VAL B 1 41  ? 43.972 -19.855 -39.605 1.00 37.22 ? 44  VAL B O   1 
ATOM   2902 C  CB  . VAL B 1 41  ? 45.606 -22.491 -39.288 1.00 38.55 ? 44  VAL B CB  1 
ATOM   2903 C  CG1 . VAL B 1 41  ? 46.738 -21.927 -38.441 1.00 38.86 ? 44  VAL B CG1 1 
ATOM   2904 C  CG2 . VAL B 1 41  ? 45.693 -24.004 -39.330 1.00 38.85 ? 44  VAL B CG2 1 
ATOM   2905 N  N   . TRP B 1 42  ? 44.437 -20.016 -37.409 1.00 38.74 ? 45  TRP B N   1 
ATOM   2906 C  CA  . TRP B 1 42  ? 44.545 -18.577 -37.220 1.00 39.23 ? 45  TRP B CA  1 
ATOM   2907 C  C   . TRP B 1 42  ? 45.336 -18.191 -35.972 1.00 41.01 ? 45  TRP B C   1 
ATOM   2908 O  O   . TRP B 1 42  ? 45.319 -18.893 -34.957 1.00 39.39 ? 45  TRP B O   1 
ATOM   2909 C  CB  . TRP B 1 42  ? 43.155 -17.934 -37.171 1.00 37.83 ? 45  TRP B CB  1 
ATOM   2910 C  CG  . TRP B 1 42  ? 42.338 -18.252 -35.939 1.00 39.58 ? 45  TRP B CG  1 
ATOM   2911 C  CD1 . TRP B 1 42  ? 41.346 -19.186 -35.832 1.00 39.21 ? 45  TRP B CD1 1 
ATOM   2912 C  CD2 . TRP B 1 42  ? 42.382 -17.571 -34.675 1.00 39.56 ? 45  TRP B CD2 1 
ATOM   2913 N  NE1 . TRP B 1 42  ? 40.766 -19.123 -34.588 1.00 39.81 ? 45  TRP B NE1 1 
ATOM   2914 C  CE2 . TRP B 1 42  ? 41.383 -18.141 -33.858 1.00 39.72 ? 45  TRP B CE2 1 
ATOM   2915 C  CE3 . TRP B 1 42  ? 43.166 -16.536 -34.157 1.00 36.65 ? 45  TRP B CE3 1 
ATOM   2916 C  CZ2 . TRP B 1 42  ? 41.146 -17.707 -32.552 1.00 38.39 ? 45  TRP B CZ2 1 
ATOM   2917 C  CZ3 . TRP B 1 42  ? 42.928 -16.107 -32.861 1.00 39.25 ? 45  TRP B CZ3 1 
ATOM   2918 C  CH2 . TRP B 1 42  ? 41.927 -16.692 -32.074 1.00 36.38 ? 45  TRP B CH2 1 
ATOM   2919 N  N   . VAL B 1 43  ? 46.043 -17.069 -36.071 1.00 41.47 ? 46  VAL B N   1 
ATOM   2920 C  CA  . VAL B 1 43  ? 46.690 -16.451 -34.924 1.00 43.72 ? 46  VAL B CA  1 
ATOM   2921 C  C   . VAL B 1 43  ? 46.379 -14.961 -34.940 1.00 44.76 ? 46  VAL B C   1 
ATOM   2922 O  O   . VAL B 1 43  ? 45.977 -14.416 -35.965 1.00 46.80 ? 46  VAL B O   1 
ATOM   2923 C  CB  . VAL B 1 43  ? 48.225 -16.658 -34.960 1.00 43.65 ? 46  VAL B CB  1 
ATOM   2924 C  CG1 . VAL B 1 43  ? 48.556 -18.124 -34.729 1.00 40.83 ? 46  VAL B CG1 1 
ATOM   2925 C  CG2 . VAL B 1 43  ? 48.783 -16.191 -36.305 1.00 44.19 ? 46  VAL B CG2 1 
ATOM   2926 N  N   . PRO B 1 44  ? 46.546 -14.285 -33.798 1.00 45.58 ? 47  PRO B N   1 
ATOM   2927 C  CA  . PRO B 1 44  ? 46.357 -12.831 -33.760 1.00 47.22 ? 47  PRO B CA  1 
ATOM   2928 C  C   . PRO B 1 44  ? 47.318 -12.133 -34.727 1.00 48.70 ? 47  PRO B C   1 
ATOM   2929 O  O   . PRO B 1 44  ? 48.452 -12.576 -34.917 1.00 49.49 ? 47  PRO B O   1 
ATOM   2930 C  CB  . PRO B 1 44  ? 46.644 -12.471 -32.300 1.00 46.24 ? 47  PRO B CB  1 
ATOM   2931 C  CG  . PRO B 1 44  ? 46.395 -13.735 -31.546 1.00 45.24 ? 47  PRO B CG  1 
ATOM   2932 C  CD  . PRO B 1 44  ? 46.839 -14.837 -32.465 1.00 45.26 ? 47  PRO B CD  1 
ATOM   2933 N  N   . SER B 1 45  ? 46.859 -11.048 -35.340 1.00 49.92 ? 48  SER B N   1 
ATOM   2934 C  CA  . SER B 1 45  ? 47.685 -10.311 -36.292 1.00 51.05 ? 48  SER B CA  1 
ATOM   2935 C  C   . SER B 1 45  ? 48.358 -9.104  -35.651 1.00 51.86 ? 48  SER B C   1 
ATOM   2936 O  O   . SER B 1 45  ? 47.818 -8.502  -34.721 1.00 52.18 ? 48  SER B O   1 
ATOM   2937 C  CB  . SER B 1 45  ? 46.838 -9.838  -37.474 1.00 50.38 ? 48  SER B CB  1 
ATOM   2938 O  OG  . SER B 1 45  ? 47.620 -9.064  -38.368 1.00 49.88 ? 48  SER B OG  1 
ATOM   2939 N  N   . SER B 1 46  ? 49.535 -8.748  -36.158 1.00 52.69 ? 49  SER B N   1 
ATOM   2940 C  CA  . SER B 1 46  ? 50.180 -7.496  -35.775 1.00 53.49 ? 49  SER B CA  1 
ATOM   2941 C  C   . SER B 1 46  ? 49.313 -6.323  -36.228 1.00 54.46 ? 49  SER B C   1 
ATOM   2942 O  O   . SER B 1 46  ? 49.396 -5.224  -35.678 1.00 53.12 ? 49  SER B O   1 
ATOM   2943 C  CB  . SER B 1 46  ? 51.565 -7.391  -36.419 1.00 52.89 ? 49  SER B CB  1 
ATOM   2944 O  OG  . SER B 1 46  ? 51.477 -7.441  -37.832 1.00 53.37 ? 49  SER B OG  1 
ATOM   2945 N  N   . LYS B 1 47  ? 48.477 -6.576  -37.230 1.00 56.41 ? 50  LYS B N   1 
ATOM   2946 C  CA  . LYS B 1 47  ? 47.616 -5.550  -37.805 1.00 58.85 ? 50  LYS B CA  1 
ATOM   2947 C  C   . LYS B 1 47  ? 46.292 -5.432  -37.056 1.00 60.33 ? 50  LYS B C   1 
ATOM   2948 O  O   . LYS B 1 47  ? 45.340 -4.837  -37.560 1.00 60.11 ? 50  LYS B O   1 
ATOM   2949 C  CB  . LYS B 1 47  ? 47.343 -5.859  -39.282 1.00 60.83 ? 50  LYS B CB  1 
ATOM   2950 C  CG  . LYS B 1 47  ? 48.578 -5.802  -40.187 1.00 62.85 ? 50  LYS B CG  1 
ATOM   2951 C  CD  . LYS B 1 47  ? 49.380 -7.102  -40.134 1.00 64.59 ? 50  LYS B CD  1 
ATOM   2952 C  CE  . LYS B 1 47  ? 50.718 -6.974  -40.863 1.00 64.85 ? 50  LYS B CE  1 
ATOM   2953 N  NZ  . LYS B 1 47  ? 50.566 -6.779  -42.332 1.00 63.67 ? 50  LYS B NZ  1 
ATOM   2954 N  N   . CYS B 1 48  ? 46.232 -6.006  -35.857 1.00 61.76 ? 51  CYS B N   1 
ATOM   2955 C  CA  . CYS B 1 48  ? 45.009 -5.976  -35.057 1.00 62.55 ? 51  CYS B CA  1 
ATOM   2956 C  C   . CYS B 1 48  ? 45.035 -4.838  -34.041 1.00 62.20 ? 51  CYS B C   1 
ATOM   2957 O  O   . CYS B 1 48  ? 45.972 -4.722  -33.253 1.00 61.86 ? 51  CYS B O   1 
ATOM   2958 C  CB  . CYS B 1 48  ? 44.824 -7.305  -34.324 1.00 62.81 ? 51  CYS B CB  1 
ATOM   2959 S  SG  . CYS B 1 48  ? 43.292 -7.399  -33.385 1.00 64.52 ? 51  CYS B SG  1 
ATOM   2960 N  N   . SER B 1 49  ? 43.993 -4.011  -34.052 1.00 61.54 ? 52  SER B N   1 
ATOM   2961 C  CA  . SER B 1 49  ? 43.989 -2.776  -33.270 1.00 61.48 ? 52  SER B CA  1 
ATOM   2962 C  C   . SER B 1 49  ? 44.222 -2.991  -31.777 1.00 61.50 ? 52  SER B C   1 
ATOM   2963 O  O   . SER B 1 49  ? 43.831 -4.016  -31.215 1.00 62.18 ? 52  SER B O   1 
ATOM   2964 C  CB  . SER B 1 49  ? 42.667 -2.033  -33.461 1.00 60.12 ? 52  SER B CB  1 
ATOM   2965 O  OG  . SER B 1 49  ? 42.581 -0.938  -32.568 1.00 60.51 ? 52  SER B OG  1 
ATOM   2966 N  N   . ARG B 1 50  ? 44.855 -2.011  -31.137 1.00 60.68 ? 53  ARG B N   1 
ATOM   2967 C  CA  . ARG B 1 50  ? 44.994 -2.005  -29.685 1.00 60.34 ? 53  ARG B CA  1 
ATOM   2968 C  C   . ARG B 1 50  ? 43.620 -1.787  -29.050 1.00 60.14 ? 53  ARG B C   1 
ATOM   2969 O  O   . ARG B 1 50  ? 43.469 -1.845  -27.826 1.00 59.56 ? 53  ARG B O   1 
ATOM   2970 C  CB  . ARG B 1 50  ? 45.955 -0.900  -29.253 1.00 59.97 ? 53  ARG B CB  1 
ATOM   2971 N  N   . LEU B 1 51  ? 42.629 -1.529  -29.899 1.00 58.69 ? 54  LEU B N   1 
ATOM   2972 C  CA  . LEU B 1 51  ? 41.247 -1.372  -29.465 1.00 58.96 ? 54  LEU B CA  1 
ATOM   2973 C  C   . LEU B 1 51  ? 40.755 -2.680  -28.838 1.00 58.21 ? 54  LEU B C   1 
ATOM   2974 O  O   . LEU B 1 51  ? 39.862 -2.680  -27.990 1.00 58.70 ? 54  LEU B O   1 
ATOM   2975 C  CB  . LEU B 1 51  ? 40.367 -1.012  -30.666 1.00 59.35 ? 54  LEU B CB  1 
ATOM   2976 C  CG  . LEU B 1 51  ? 39.220 -0.021  -30.460 1.00 59.90 ? 54  LEU B CG  1 
ATOM   2977 C  CD1 . LEU B 1 51  ? 39.781 1.394   -30.362 1.00 59.05 ? 54  LEU B CD1 1 
ATOM   2978 C  CD2 . LEU B 1 51  ? 38.238 -0.123  -31.623 1.00 60.32 ? 54  LEU B CD2 1 
ATOM   2979 N  N   . TYR B 1 52  ? 41.341 -3.792  -29.272 1.00 56.74 ? 55  TYR B N   1 
ATOM   2980 C  CA  . TYR B 1 52  ? 41.021 -5.104  -28.724 1.00 54.01 ? 55  TYR B CA  1 
ATOM   2981 C  C   . TYR B 1 52  ? 42.110 -5.516  -27.745 1.00 53.76 ? 55  TYR B C   1 
ATOM   2982 O  O   . TYR B 1 52  ? 43.192 -5.935  -28.152 1.00 53.21 ? 55  TYR B O   1 
ATOM   2983 C  CB  . TYR B 1 52  ? 40.929 -6.137  -29.848 1.00 52.60 ? 55  TYR B CB  1 
ATOM   2984 C  CG  . TYR B 1 52  ? 39.793 -5.901  -30.815 1.00 50.66 ? 55  TYR B CG  1 
ATOM   2985 C  CD1 . TYR B 1 52  ? 38.506 -6.326  -30.519 1.00 50.43 ? 55  TYR B CD1 1 
ATOM   2986 C  CD2 . TYR B 1 52  ? 40.007 -5.262  -32.031 1.00 51.06 ? 55  TYR B CD2 1 
ATOM   2987 C  CE1 . TYR B 1 52  ? 37.463 -6.124  -31.405 1.00 49.30 ? 55  TYR B CE1 1 
ATOM   2988 C  CE2 . TYR B 1 52  ? 38.968 -5.053  -32.923 1.00 48.69 ? 55  TYR B CE2 1 
ATOM   2989 C  CZ  . TYR B 1 52  ? 37.700 -5.486  -32.604 1.00 48.54 ? 55  TYR B CZ  1 
ATOM   2990 O  OH  . TYR B 1 52  ? 36.660 -5.281  -33.480 1.00 48.55 ? 55  TYR B OH  1 
ATOM   2991 N  N   . THR B 1 53  ? 41.822 -5.397  -26.455 1.00 53.68 ? 56  THR B N   1 
ATOM   2992 C  CA  . THR B 1 53  ? 42.815 -5.680  -25.431 1.00 54.09 ? 56  THR B CA  1 
ATOM   2993 C  C   . THR B 1 53  ? 43.291 -7.131  -25.528 1.00 54.27 ? 56  THR B C   1 
ATOM   2994 O  O   . THR B 1 53  ? 44.350 -7.485  -25.007 1.00 53.30 ? 56  THR B O   1 
ATOM   2995 C  CB  . THR B 1 53  ? 42.246 -5.411  -24.019 1.00 53.85 ? 56  THR B CB  1 
ATOM   2996 O  OG1 . THR B 1 53  ? 41.152 -6.296  -23.760 1.00 57.11 ? 56  THR B OG1 1 
ATOM   2997 C  CG2 . THR B 1 53  ? 41.743 -3.981  -23.920 1.00 55.28 ? 56  THR B CG2 1 
ATOM   2998 N  N   . ALA B 1 54  ? 42.510 -7.963  -26.211 1.00 53.94 ? 57  ALA B N   1 
ATOM   2999 C  CA  . ALA B 1 54  ? 42.900 -9.346  -26.458 1.00 54.10 ? 57  ALA B CA  1 
ATOM   3000 C  C   . ALA B 1 54  ? 44.254 -9.402  -27.162 1.00 54.60 ? 57  ALA B C   1 
ATOM   3001 O  O   . ALA B 1 54  ? 44.977 -10.397 -27.071 1.00 54.19 ? 57  ALA B O   1 
ATOM   3002 C  CB  . ALA B 1 54  ? 41.843 -10.041 -27.303 1.00 53.74 ? 57  ALA B CB  1 
ATOM   3003 N  N   . CYS B 1 55  ? 44.598 -8.326  -27.861 1.00 55.75 ? 58  CYS B N   1 
ATOM   3004 C  CA  . CYS B 1 55  ? 45.834 -8.290  -28.633 1.00 56.50 ? 58  CYS B CA  1 
ATOM   3005 C  C   . CYS B 1 55  ? 47.009 -7.739  -27.836 1.00 57.47 ? 58  CYS B C   1 
ATOM   3006 O  O   . CYS B 1 55  ? 48.163 -7.987  -28.178 1.00 58.44 ? 58  CYS B O   1 
ATOM   3007 C  CB  . CYS B 1 55  ? 45.628 -7.466  -29.898 1.00 56.16 ? 58  CYS B CB  1 
ATOM   3008 S  SG  . CYS B 1 55  ? 44.289 -8.099  -30.925 1.00 55.10 ? 58  CYS B SG  1 
ATOM   3009 N  N   . VAL B 1 56  ? 46.718 -6.996  -26.773 1.00 58.36 ? 59  VAL B N   1 
ATOM   3010 C  CA  . VAL B 1 56  ? 47.761 -6.584  -25.839 1.00 59.82 ? 59  VAL B CA  1 
ATOM   3011 C  C   . VAL B 1 56  ? 48.045 -7.736  -24.883 1.00 60.28 ? 59  VAL B C   1 
ATOM   3012 O  O   . VAL B 1 56  ? 49.006 -7.697  -24.113 1.00 61.66 ? 59  VAL B O   1 
ATOM   3013 C  CB  . VAL B 1 56  ? 47.336 -5.360  -24.997 1.00 60.32 ? 59  VAL B CB  1 
ATOM   3014 C  CG1 . VAL B 1 56  ? 46.785 -4.268  -25.900 1.00 61.34 ? 59  VAL B CG1 1 
ATOM   3015 C  CG2 . VAL B 1 56  ? 46.313 -5.776  -23.953 1.00 62.30 ? 59  VAL B CG2 1 
ATOM   3016 N  N   . TYR B 1 57  ? 47.200 -8.761  -24.934 1.00 59.35 ? 60  TYR B N   1 
ATOM   3017 C  CA  . TYR B 1 57  ? 47.307 -9.882  -24.012 1.00 58.22 ? 60  TYR B CA  1 
ATOM   3018 C  C   . TYR B 1 57  ? 48.015 -11.070 -24.663 1.00 56.71 ? 60  TYR B C   1 
ATOM   3019 O  O   . TYR B 1 57  ? 48.560 -11.926 -23.971 1.00 56.39 ? 60  TYR B O   1 
ATOM   3020 C  CB  . TYR B 1 57  ? 45.905 -10.290 -23.532 1.00 58.69 ? 60  TYR B CB  1 
ATOM   3021 C  CG  . TYR B 1 57  ? 45.890 -11.332 -22.431 1.00 59.89 ? 60  TYR B CG  1 
ATOM   3022 C  CD1 . TYR B 1 57  ? 46.738 -11.227 -21.334 1.00 60.50 ? 60  TYR B CD1 1 
ATOM   3023 C  CD2 . TYR B 1 57  ? 45.037 -12.429 -22.495 1.00 59.84 ? 60  TYR B CD2 1 
ATOM   3024 C  CE1 . TYR B 1 57  ? 46.741 -12.189 -20.331 1.00 60.42 ? 60  TYR B CE1 1 
ATOM   3025 C  CE2 . TYR B 1 57  ? 45.033 -13.395 -21.497 1.00 60.14 ? 60  TYR B CE2 1 
ATOM   3026 C  CZ  . TYR B 1 57  ? 45.888 -13.270 -20.420 1.00 60.10 ? 60  TYR B CZ  1 
ATOM   3027 O  OH  . TYR B 1 57  ? 45.902 -14.233 -19.433 1.00 60.09 ? 60  TYR B OH  1 
ATOM   3028 N  N   . HIS B 1 58  ? 48.013 -11.118 -25.992 1.00 55.94 ? 61  HIS B N   1 
ATOM   3029 C  CA  . HIS B 1 58  ? 48.547 -12.274 -26.713 1.00 55.14 ? 61  HIS B CA  1 
ATOM   3030 C  C   . HIS B 1 58  ? 49.655 -11.917 -27.702 1.00 54.94 ? 61  HIS B C   1 
ATOM   3031 O  O   . HIS B 1 58  ? 49.835 -10.754 -28.048 1.00 55.34 ? 61  HIS B O   1 
ATOM   3032 C  CB  . HIS B 1 58  ? 47.419 -12.990 -27.458 1.00 53.64 ? 61  HIS B CB  1 
ATOM   3033 C  CG  . HIS B 1 58  ? 46.328 -13.490 -26.565 1.00 52.80 ? 61  HIS B CG  1 
ATOM   3034 N  ND1 . HIS B 1 58  ? 45.034 -13.019 -26.634 1.00 53.05 ? 61  HIS B ND1 1 
ATOM   3035 C  CD2 . HIS B 1 58  ? 46.338 -14.419 -25.581 1.00 52.57 ? 61  HIS B CD2 1 
ATOM   3036 C  CE1 . HIS B 1 58  ? 44.295 -13.637 -25.730 1.00 51.68 ? 61  HIS B CE1 1 
ATOM   3037 N  NE2 . HIS B 1 58  ? 45.062 -14.491 -25.078 1.00 51.42 ? 61  HIS B NE2 1 
ATOM   3038 N  N   . LYS B 1 59  ? 50.395 -12.928 -28.152 1.00 54.77 ? 62  LYS B N   1 
ATOM   3039 C  CA  . LYS B 1 59  ? 51.407 -12.741 -29.189 1.00 55.10 ? 62  LYS B CA  1 
ATOM   3040 C  C   . LYS B 1 59  ? 50.734 -12.403 -30.511 1.00 55.05 ? 62  LYS B C   1 
ATOM   3041 O  O   . LYS B 1 59  ? 49.685 -12.951 -30.837 1.00 55.40 ? 62  LYS B O   1 
ATOM   3042 C  CB  . LYS B 1 59  ? 52.243 -14.014 -29.362 1.00 55.31 ? 62  LYS B CB  1 
ATOM   3043 C  CG  . LYS B 1 59  ? 53.363 -14.190 -28.348 1.00 56.76 ? 62  LYS B CG  1 
ATOM   3044 C  CD  . LYS B 1 59  ? 54.659 -13.544 -28.830 1.00 57.08 ? 62  LYS B CD  1 
ATOM   3045 C  CE  . LYS B 1 59  ? 55.245 -14.277 -30.035 1.00 57.29 ? 62  LYS B CE  1 
ATOM   3046 N  NZ  . LYS B 1 59  ? 56.186 -15.366 -29.639 1.00 55.35 ? 62  LYS B NZ  1 
ATOM   3047 N  N   . LEU B 1 60  ? 51.341 -11.500 -31.273 1.00 55.13 ? 63  LEU B N   1 
ATOM   3048 C  CA  . LEU B 1 60  ? 50.810 -11.123 -32.579 1.00 55.01 ? 63  LEU B CA  1 
ATOM   3049 C  C   . LEU B 1 60  ? 51.775 -11.548 -33.681 1.00 55.05 ? 63  LEU B C   1 
ATOM   3050 O  O   . LEU B 1 60  ? 52.989 -11.566 -33.478 1.00 54.48 ? 63  LEU B O   1 
ATOM   3051 C  CB  . LEU B 1 60  ? 50.591 -9.611  -32.646 1.00 54.42 ? 63  LEU B CB  1 
ATOM   3052 C  CG  . LEU B 1 60  ? 49.778 -8.972  -31.517 1.00 54.61 ? 63  LEU B CG  1 
ATOM   3053 C  CD1 . LEU B 1 60  ? 49.673 -7.472  -31.755 1.00 52.87 ? 63  LEU B CD1 1 
ATOM   3054 C  CD2 . LEU B 1 60  ? 48.395 -9.602  -31.452 1.00 53.85 ? 63  LEU B CD2 1 
ATOM   3055 N  N   . PHE B 1 61  ? 51.234 -11.896 -34.844 1.00 55.18 ? 64  PHE B N   1 
ATOM   3056 C  CA  . PHE B 1 61  ? 52.066 -12.314 -35.965 1.00 55.40 ? 64  PHE B CA  1 
ATOM   3057 C  C   . PHE B 1 61  ? 52.370 -11.138 -36.884 1.00 55.81 ? 64  PHE B C   1 
ATOM   3058 O  O   . PHE B 1 61  ? 51.460 -10.513 -37.437 1.00 54.39 ? 64  PHE B O   1 
ATOM   3059 C  CB  . PHE B 1 61  ? 51.377 -13.425 -36.763 1.00 54.23 ? 64  PHE B CB  1 
ATOM   3060 C  CG  . PHE B 1 61  ? 52.108 -13.812 -38.019 1.00 53.86 ? 64  PHE B CG  1 
ATOM   3061 C  CD1 . PHE B 1 61  ? 53.291 -14.534 -37.956 1.00 53.87 ? 64  PHE B CD1 1 
ATOM   3062 C  CD2 . PHE B 1 61  ? 51.611 -13.458 -39.265 1.00 53.95 ? 64  PHE B CD2 1 
ATOM   3063 C  CE1 . PHE B 1 61  ? 53.964 -14.897 -39.110 1.00 53.06 ? 64  PHE B CE1 1 
ATOM   3064 C  CE2 . PHE B 1 61  ? 52.279 -13.818 -40.424 1.00 54.21 ? 64  PHE B CE2 1 
ATOM   3065 C  CZ  . PHE B 1 61  ? 53.457 -14.539 -40.345 1.00 53.22 ? 64  PHE B CZ  1 
ATOM   3066 N  N   . ASP B 1 62  ? 53.658 -10.847 -37.042 1.00 56.42 ? 65  ASP B N   1 
ATOM   3067 C  CA  . ASP B 1 62  ? 54.099 -9.740  -37.881 1.00 57.67 ? 65  ASP B CA  1 
ATOM   3068 C  C   . ASP B 1 62  ? 54.510 -10.255 -39.256 1.00 58.62 ? 65  ASP B C   1 
ATOM   3069 O  O   . ASP B 1 62  ? 55.490 -10.989 -39.388 1.00 59.05 ? 65  ASP B O   1 
ATOM   3070 C  CB  . ASP B 1 62  ? 55.279 -9.023  -37.223 1.00 56.26 ? 65  ASP B CB  1 
ATOM   3071 C  CG  . ASP B 1 62  ? 55.699 -7.776  -37.977 1.00 55.79 ? 65  ASP B CG  1 
ATOM   3072 O  OD1 . ASP B 1 62  ? 56.137 -7.898  -39.141 1.00 56.07 ? 65  ASP B OD1 1 
ATOM   3073 O  OD2 . ASP B 1 62  ? 55.591 -6.674  -37.403 1.00 53.56 ? 65  ASP B OD2 1 
ATOM   3074 N  N   . ALA B 1 63  ? 53.754 -9.860  -40.276 1.00 59.18 ? 66  ALA B N   1 
ATOM   3075 C  CA  . ALA B 1 63  ? 54.011 -10.297 -41.643 1.00 60.10 ? 66  ALA B CA  1 
ATOM   3076 C  C   . ALA B 1 63  ? 55.420 -9.924  -42.112 1.00 60.95 ? 66  ALA B C   1 
ATOM   3077 O  O   . ALA B 1 63  ? 56.076 -10.691 -42.820 1.00 61.73 ? 66  ALA B O   1 
ATOM   3078 C  CB  . ALA B 1 63  ? 52.975 -9.689  -42.577 1.00 59.38 ? 66  ALA B CB  1 
ATOM   3079 N  N   . SER B 1 64  ? 55.885 -8.746  -41.714 1.00 60.85 ? 67  SER B N   1 
ATOM   3080 C  CA  . SER B 1 64  ? 57.133 -8.211  -42.242 1.00 61.09 ? 67  SER B CA  1 
ATOM   3081 C  C   . SER B 1 64  ? 58.341 -8.537  -41.372 1.00 61.53 ? 67  SER B C   1 
ATOM   3082 O  O   . SER B 1 64  ? 59.363 -7.852  -41.431 1.00 61.24 ? 67  SER B O   1 
ATOM   3083 C  CB  . SER B 1 64  ? 57.013 -6.700  -42.416 1.00 60.86 ? 67  SER B CB  1 
ATOM   3084 O  OG  . SER B 1 64  ? 55.936 -6.393  -43.280 1.00 62.29 ? 67  SER B OG  1 
ATOM   3085 N  N   . ASP B 1 65  ? 58.220 -9.581  -40.559 1.00 61.58 ? 68  ASP B N   1 
ATOM   3086 C  CA  . ASP B 1 65  ? 59.374 -10.131 -39.859 1.00 61.58 ? 68  ASP B CA  1 
ATOM   3087 C  C   . ASP B 1 65  ? 59.674 -11.529 -40.380 1.00 61.11 ? 68  ASP B C   1 
ATOM   3088 O  O   . ASP B 1 65  ? 60.669 -12.142 -40.000 1.00 61.89 ? 68  ASP B O   1 
ATOM   3089 C  CB  . ASP B 1 65  ? 59.122 -10.179 -38.350 1.00 62.83 ? 68  ASP B CB  1 
ATOM   3090 C  CG  . ASP B 1 65  ? 59.157 -8.804  -37.709 1.00 63.93 ? 68  ASP B CG  1 
ATOM   3091 O  OD1 . ASP B 1 65  ? 59.278 -7.808  -38.451 1.00 65.63 ? 68  ASP B OD1 1 
ATOM   3092 O  OD2 . ASP B 1 65  ? 59.067 -8.718  -36.464 1.00 64.54 ? 68  ASP B OD2 1 
ATOM   3093 N  N   . SER B 1 66  ? 58.803 -12.031 -41.249 1.00 60.78 ? 69  SER B N   1 
ATOM   3094 C  CA  . SER B 1 66  ? 59.030 -13.315 -41.905 1.00 60.77 ? 69  SER B CA  1 
ATOM   3095 C  C   . SER B 1 66  ? 59.452 -13.121 -43.354 1.00 60.27 ? 69  SER B C   1 
ATOM   3096 O  O   . SER B 1 66  ? 58.807 -12.389 -44.105 1.00 59.31 ? 69  SER B O   1 
ATOM   3097 C  CB  . SER B 1 66  ? 57.765 -14.172 -41.865 1.00 60.43 ? 69  SER B CB  1 
ATOM   3098 O  OG  . SER B 1 66  ? 57.886 -15.281 -42.742 1.00 59.84 ? 69  SER B OG  1 
ATOM   3099 N  N   . SER B 1 67  ? 60.533 -13.789 -43.743 1.00 60.61 ? 70  SER B N   1 
ATOM   3100 C  CA  . SER B 1 67  ? 61.030 -13.713 -45.112 1.00 60.80 ? 70  SER B CA  1 
ATOM   3101 C  C   . SER B 1 67  ? 60.197 -14.610 -46.019 1.00 60.92 ? 70  SER B C   1 
ATOM   3102 O  O   . SER B 1 67  ? 60.131 -14.397 -47.229 1.00 60.53 ? 70  SER B O   1 
ATOM   3103 C  CB  . SER B 1 67  ? 62.498 -14.148 -45.170 1.00 61.13 ? 70  SER B CB  1 
ATOM   3104 O  OG  . SER B 1 67  ? 62.644 -15.515 -44.816 1.00 61.80 ? 70  SER B OG  1 
ATOM   3105 N  N   . SER B 1 68  ? 59.561 -15.614 -45.422 1.00 61.01 ? 71  SER B N   1 
ATOM   3106 C  CA  . SER B 1 68  ? 58.779 -16.588 -46.176 1.00 60.97 ? 71  SER B CA  1 
ATOM   3107 C  C   . SER B 1 68  ? 57.309 -16.189 -46.299 1.00 61.35 ? 71  SER B C   1 
ATOM   3108 O  O   . SER B 1 68  ? 56.541 -16.835 -47.009 1.00 60.96 ? 71  SER B O   1 
ATOM   3109 C  CB  . SER B 1 68  ? 58.901 -17.970 -45.524 1.00 60.46 ? 71  SER B CB  1 
ATOM   3110 O  OG  . SER B 1 68  ? 59.242 -17.864 -44.152 1.00 59.10 ? 71  SER B OG  1 
ATOM   3111 N  N   . TYR B 1 69  ? 56.926 -15.118 -45.609 1.00 61.96 ? 72  TYR B N   1 
ATOM   3112 C  CA  . TYR B 1 69  ? 55.566 -14.593 -45.687 1.00 63.00 ? 72  TYR B CA  1 
ATOM   3113 C  C   . TYR B 1 69  ? 55.144 -14.341 -47.129 1.00 63.28 ? 72  TYR B C   1 
ATOM   3114 O  O   . TYR B 1 69  ? 55.933 -13.859 -47.939 1.00 63.89 ? 72  TYR B O   1 
ATOM   3115 C  CB  . TYR B 1 69  ? 55.465 -13.286 -44.893 1.00 63.89 ? 72  TYR B CB  1 
ATOM   3116 C  CG  . TYR B 1 69  ? 54.138 -12.570 -45.036 1.00 65.07 ? 72  TYR B CG  1 
ATOM   3117 C  CD1 . TYR B 1 69  ? 53.975 -11.544 -45.958 1.00 66.52 ? 72  TYR B CD1 1 
ATOM   3118 C  CD2 . TYR B 1 69  ? 53.053 -12.910 -44.238 1.00 65.56 ? 72  TYR B CD2 1 
ATOM   3119 C  CE1 . TYR B 1 69  ? 52.767 -10.874 -46.080 1.00 67.34 ? 72  TYR B CE1 1 
ATOM   3120 C  CE2 . TYR B 1 69  ? 51.844 -12.249 -44.352 1.00 66.28 ? 72  TYR B CE2 1 
ATOM   3121 C  CZ  . TYR B 1 69  ? 51.706 -11.231 -45.272 1.00 67.73 ? 72  TYR B CZ  1 
ATOM   3122 O  OH  . TYR B 1 69  ? 50.508 -10.560 -45.372 1.00 68.77 ? 72  TYR B OH  1 
ATOM   3123 N  N   . LYS B 1 70  ? 53.894 -14.670 -47.443 1.00 63.81 ? 73  LYS B N   1 
ATOM   3124 C  CA  . LYS B 1 70  ? 53.323 -14.368 -48.752 1.00 63.90 ? 73  LYS B CA  1 
ATOM   3125 C  C   . LYS B 1 70  ? 51.882 -13.885 -48.628 1.00 63.69 ? 73  LYS B C   1 
ATOM   3126 O  O   . LYS B 1 70  ? 50.949 -14.685 -48.584 1.00 62.82 ? 73  LYS B O   1 
ATOM   3127 C  CB  . LYS B 1 70  ? 53.371 -15.604 -49.654 1.00 65.16 ? 73  LYS B CB  1 
ATOM   3128 C  CG  . LYS B 1 70  ? 54.773 -16.008 -50.086 1.00 67.55 ? 73  LYS B CG  1 
ATOM   3129 C  CD  . LYS B 1 70  ? 54.740 -17.178 -51.066 1.00 67.60 ? 73  LYS B CD  1 
ATOM   3130 C  CE  . LYS B 1 70  ? 56.076 -17.338 -51.783 1.00 68.26 ? 73  LYS B CE  1 
ATOM   3131 N  NZ  . LYS B 1 70  ? 57.222 -17.440 -50.833 1.00 67.42 ? 73  LYS B NZ  1 
ATOM   3132 N  N   . HIS B 1 71  ? 51.716 -12.568 -48.580 1.00 63.67 ? 74  HIS B N   1 
ATOM   3133 C  CA  . HIS B 1 71  ? 50.402 -11.933 -48.504 1.00 64.31 ? 74  HIS B CA  1 
ATOM   3134 C  C   . HIS B 1 71  ? 49.360 -12.608 -49.402 1.00 64.29 ? 74  HIS B C   1 
ATOM   3135 O  O   . HIS B 1 71  ? 49.687 -13.105 -50.477 1.00 64.25 ? 74  HIS B O   1 
ATOM   3136 C  CB  . HIS B 1 71  ? 50.551 -10.452 -48.879 1.00 63.42 ? 74  HIS B CB  1 
ATOM   3137 C  CG  . HIS B 1 71  ? 49.267 -9.778  -49.257 1.00 63.34 ? 74  HIS B CG  1 
ATOM   3138 N  ND1 . HIS B 1 71  ? 48.721 -8.752  -48.515 1.00 62.85 ? 74  HIS B ND1 1 
ATOM   3139 C  CD2 . HIS B 1 71  ? 48.439 -9.960  -50.314 1.00 62.27 ? 74  HIS B CD2 1 
ATOM   3140 C  CE1 . HIS B 1 71  ? 47.613 -8.332  -49.099 1.00 62.55 ? 74  HIS B CE1 1 
ATOM   3141 N  NE2 . HIS B 1 71  ? 47.419 -9.048  -50.192 1.00 62.53 ? 74  HIS B NE2 1 
ATOM   3142 N  N   . ASN B 1 72  ? 48.108 -12.629 -48.947 1.00 64.99 ? 75  ASN B N   1 
ATOM   3143 C  CA  . ASN B 1 72  ? 46.974 -12.975 -49.805 1.00 65.90 ? 75  ASN B CA  1 
ATOM   3144 C  C   . ASN B 1 72  ? 45.818 -11.998 -49.594 1.00 65.12 ? 75  ASN B C   1 
ATOM   3145 O  O   . ASN B 1 72  ? 45.178 -11.565 -50.553 1.00 65.71 ? 75  ASN B O   1 
ATOM   3146 C  CB  . ASN B 1 72  ? 46.493 -14.405 -49.532 1.00 67.80 ? 75  ASN B CB  1 
ATOM   3147 C  CG  . ASN B 1 72  ? 45.241 -14.764 -50.326 1.00 70.15 ? 75  ASN B CG  1 
ATOM   3148 O  OD1 . ASN B 1 72  ? 44.170 -14.212 -50.081 1.00 68.72 ? 75  ASN B OD1 1 
ATOM   3149 N  ND2 . ASN B 1 72  ? 45.376 -15.685 -51.278 1.00 73.57 ? 75  ASN B ND2 1 
ATOM   3150 N  N   . GLY B 1 73  ? 45.546 -11.662 -48.336 1.00 63.55 ? 76  GLY B N   1 
ATOM   3151 C  CA  . GLY B 1 73  ? 44.649 -10.556 -48.043 1.00 61.17 ? 76  GLY B CA  1 
ATOM   3152 C  C   . GLY B 1 73  ? 43.160 -10.851 -48.081 1.00 59.66 ? 76  GLY B C   1 
ATOM   3153 O  O   . GLY B 1 73  ? 42.351 -9.988  -47.744 1.00 59.38 ? 76  GLY B O   1 
ATOM   3154 N  N   . THR B 1 74  ? 42.786 -12.060 -48.489 1.00 59.48 ? 77  THR B N   1 
ATOM   3155 C  CA  . THR B 1 74  ? 41.374 -12.433 -48.544 1.00 59.32 ? 77  THR B CA  1 
ATOM   3156 C  C   . THR B 1 74  ? 40.756 -12.394 -47.146 1.00 59.01 ? 77  THR B C   1 
ATOM   3157 O  O   . THR B 1 74  ? 41.363 -12.843 -46.174 1.00 57.91 ? 77  THR B O   1 
ATOM   3158 C  CB  . THR B 1 74  ? 41.187 -13.849 -49.125 1.00 59.61 ? 77  THR B CB  1 
ATOM   3159 O  OG1 . THR B 1 74  ? 41.761 -13.915 -50.437 1.00 59.56 ? 77  THR B OG1 1 
ATOM   3160 C  CG2 . THR B 1 74  ? 39.707 -14.188 -49.214 1.00 60.47 ? 77  THR B CG2 1 
ATOM   3161 N  N   . GLU B 1 75  ? 39.544 -11.860 -47.051 1.00 58.92 ? 78  GLU B N   1 
ATOM   3162 C  CA  . GLU B 1 75  ? 38.947 -11.568 -45.752 1.00 59.12 ? 78  GLU B CA  1 
ATOM   3163 C  C   . GLU B 1 75  ? 38.103 -12.727 -45.226 1.00 58.44 ? 78  GLU B C   1 
ATOM   3164 O  O   . GLU B 1 75  ? 37.393 -13.388 -45.984 1.00 59.22 ? 78  GLU B O   1 
ATOM   3165 C  CB  . GLU B 1 75  ? 38.104 -10.296 -45.851 1.00 59.57 ? 78  GLU B CB  1 
ATOM   3166 C  CG  . GLU B 1 75  ? 38.872 -9.121  -46.443 1.00 61.58 ? 78  GLU B CG  1 
ATOM   3167 C  CD  . GLU B 1 75  ? 38.224 -7.778  -46.154 1.00 62.39 ? 78  GLU B CD  1 
ATOM   3168 O  OE1 . GLU B 1 75  ? 36.979 -7.677  -46.240 1.00 63.43 ? 78  GLU B OE1 1 
ATOM   3169 O  OE2 . GLU B 1 75  ? 38.966 -6.823  -45.843 1.00 62.26 ? 78  GLU B OE2 1 
ATOM   3170 N  N   . LEU B 1 76  ? 38.182 -12.962 -43.918 1.00 57.51 ? 79  LEU B N   1 
ATOM   3171 C  CA  . LEU B 1 76  ? 37.686 -14.203 -43.327 1.00 56.05 ? 79  LEU B CA  1 
ATOM   3172 C  C   . LEU B 1 76  ? 36.878 -13.991 -42.037 1.00 54.99 ? 79  LEU B C   1 
ATOM   3173 O  O   . LEU B 1 76  ? 37.264 -13.197 -41.175 1.00 54.83 ? 79  LEU B O   1 
ATOM   3174 C  CB  . LEU B 1 76  ? 38.874 -15.130 -43.046 1.00 55.20 ? 79  LEU B CB  1 
ATOM   3175 C  CG  . LEU B 1 76  ? 38.600 -16.489 -42.400 1.00 55.29 ? 79  LEU B CG  1 
ATOM   3176 C  CD1 . LEU B 1 76  ? 37.768 -17.357 -43.337 1.00 56.14 ? 79  LEU B CD1 1 
ATOM   3177 C  CD2 . LEU B 1 76  ? 39.921 -17.164 -42.084 1.00 54.92 ? 79  LEU B CD2 1 
ATOM   3178 N  N   . THR B 1 77  ? 35.762 -14.709 -41.910 1.00 53.00 ? 80  THR B N   1 
ATOM   3179 C  CA  . THR B 1 77  ? 34.986 -14.722 -40.669 1.00 52.40 ? 80  THR B CA  1 
ATOM   3180 C  C   . THR B 1 77  ? 34.771 -16.132 -40.110 1.00 51.04 ? 80  THR B C   1 
ATOM   3181 O  O   . THR B 1 77  ? 34.131 -16.973 -40.742 1.00 52.26 ? 80  THR B O   1 
ATOM   3182 C  CB  . THR B 1 77  ? 33.604 -14.069 -40.863 1.00 52.19 ? 80  THR B CB  1 
ATOM   3183 O  OG1 . THR B 1 77  ? 33.765 -12.662 -41.075 1.00 54.34 ? 80  THR B OG1 1 
ATOM   3184 C  CG2 . THR B 1 77  ? 32.733 -14.293 -39.640 1.00 51.74 ? 80  THR B CG2 1 
ATOM   3185 N  N   . LEU B 1 78  ? 35.304 -16.379 -38.916 1.00 49.48 ? 81  LEU B N   1 
ATOM   3186 C  CA  . LEU B 1 78  ? 35.094 -17.648 -38.223 1.00 47.21 ? 81  LEU B CA  1 
ATOM   3187 C  C   . LEU B 1 78  ? 34.149 -17.448 -37.042 1.00 46.53 ? 81  LEU B C   1 
ATOM   3188 O  O   . LEU B 1 78  ? 34.436 -16.662 -36.142 1.00 46.99 ? 81  LEU B O   1 
ATOM   3189 C  CB  . LEU B 1 78  ? 36.428 -18.199 -37.710 1.00 45.70 ? 81  LEU B CB  1 
ATOM   3190 C  CG  . LEU B 1 78  ? 37.528 -18.470 -38.737 1.00 44.08 ? 81  LEU B CG  1 
ATOM   3191 C  CD1 . LEU B 1 78  ? 38.800 -18.890 -38.016 1.00 44.58 ? 81  LEU B CD1 1 
ATOM   3192 C  CD2 . LEU B 1 78  ? 37.075 -19.553 -39.708 1.00 44.67 ? 81  LEU B CD2 1 
ATOM   3193 N  N   . ARG B 1 79  ? 33.025 -18.156 -37.041 1.00 46.36 ? 82  ARG B N   1 
ATOM   3194 C  CA  . ARG B 1 79  ? 32.132 -18.132 -35.892 1.00 47.63 ? 82  ARG B CA  1 
ATOM   3195 C  C   . ARG B 1 79  ? 32.203 -19.432 -35.092 1.00 46.32 ? 82  ARG B C   1 
ATOM   3196 O  O   . ARG B 1 79  ? 31.892 -20.512 -35.601 1.00 47.42 ? 82  ARG B O   1 
ATOM   3197 C  CB  . ARG B 1 79  ? 30.687 -17.878 -36.337 1.00 51.63 ? 82  ARG B CB  1 
ATOM   3198 C  CG  . ARG B 1 79  ? 30.436 -16.463 -36.854 1.00 56.82 ? 82  ARG B CG  1 
ATOM   3199 C  CD  . ARG B 1 79  ? 28.941 -16.131 -36.950 1.00 61.41 ? 82  ARG B CD  1 
ATOM   3200 N  NE  . ARG B 1 79  ? 28.399 -15.567 -35.710 1.00 65.65 ? 82  ARG B NE  1 
ATOM   3201 C  CZ  . ARG B 1 79  ? 28.450 -14.276 -35.383 1.00 67.96 ? 82  ARG B CZ  1 
ATOM   3202 N  NH1 . ARG B 1 79  ? 29.021 -13.401 -36.203 1.00 68.26 ? 82  ARG B NH1 1 
ATOM   3203 N  NH2 . ARG B 1 79  ? 27.926 -13.854 -34.236 1.00 67.97 ? 82  ARG B NH2 1 
ATOM   3204 N  N   . TYR B 1 80  ? 32.616 -19.320 -33.834 1.00 42.76 ? 83  TYR B N   1 
ATOM   3205 C  CA  . TYR B 1 80  ? 32.527 -20.440 -32.907 1.00 40.67 ? 83  TYR B CA  1 
ATOM   3206 C  C   . TYR B 1 80  ? 31.381 -20.223 -31.930 1.00 39.87 ? 83  TYR B C   1 
ATOM   3207 O  O   . TYR B 1 80  ? 30.767 -19.153 -31.900 1.00 38.90 ? 83  TYR B O   1 
ATOM   3208 C  CB  . TYR B 1 80  ? 33.827 -20.595 -32.123 1.00 38.16 ? 83  TYR B CB  1 
ATOM   3209 C  CG  . TYR B 1 80  ? 35.044 -20.726 -32.994 1.00 38.33 ? 83  TYR B CG  1 
ATOM   3210 C  CD1 . TYR B 1 80  ? 35.333 -21.920 -33.637 1.00 37.53 ? 83  TYR B CD1 1 
ATOM   3211 C  CD2 . TYR B 1 80  ? 35.919 -19.660 -33.160 1.00 37.31 ? 83  TYR B CD2 1 
ATOM   3212 C  CE1 . TYR B 1 80  ? 36.459 -22.050 -34.419 1.00 37.87 ? 83  TYR B CE1 1 
ATOM   3213 C  CE2 . TYR B 1 80  ? 37.049 -19.780 -33.940 1.00 37.80 ? 83  TYR B CE2 1 
ATOM   3214 C  CZ  . TYR B 1 80  ? 37.314 -20.977 -34.566 1.00 36.56 ? 83  TYR B CZ  1 
ATOM   3215 O  OH  . TYR B 1 80  ? 38.441 -21.105 -35.337 1.00 35.30 ? 83  TYR B OH  1 
ATOM   3216 N  N   . SER B 1 81  ? 31.102 -21.246 -31.130 1.00 39.49 ? 84  SER B N   1 
ATOM   3217 C  CA  . SER B 1 81  ? 30.057 -21.174 -30.117 1.00 39.78 ? 84  SER B CA  1 
ATOM   3218 C  C   . SER B 1 81  ? 30.248 -19.961 -29.212 1.00 38.43 ? 84  SER B C   1 
ATOM   3219 O  O   . SER B 1 81  ? 29.276 -19.343 -28.793 1.00 37.54 ? 84  SER B O   1 
ATOM   3220 C  CB  . SER B 1 81  ? 30.069 -22.441 -29.265 1.00 41.39 ? 84  SER B CB  1 
ATOM   3221 O  OG  . SER B 1 81  ? 31.306 -22.555 -28.584 1.00 43.30 ? 84  SER B OG  1 
ATOM   3222 N  N   . THR B 1 82  ? 31.500 -19.627 -28.911 1.00 39.69 ? 85  THR B N   1 
ATOM   3223 C  CA  . THR B 1 82  ? 31.796 -18.450 -28.094 1.00 41.81 ? 85  THR B CA  1 
ATOM   3224 C  C   . THR B 1 82  ? 31.760 -17.159 -28.894 1.00 42.99 ? 85  THR B C   1 
ATOM   3225 O  O   . THR B 1 82  ? 32.000 -16.081 -28.353 1.00 43.34 ? 85  THR B O   1 
ATOM   3226 C  CB  . THR B 1 82  ? 33.172 -18.538 -27.447 1.00 41.67 ? 85  THR B CB  1 
ATOM   3227 O  OG1 . THR B 1 82  ? 34.155 -18.798 -28.456 1.00 41.81 ? 85  THR B OG1 1 
ATOM   3228 C  CG2 . THR B 1 82  ? 33.196 -19.626 -26.408 1.00 40.89 ? 85  THR B CG2 1 
ATOM   3229 N  N   . GLY B 1 83  ? 31.465 -17.266 -30.182 1.00 43.05 ? 86  GLY B N   1 
ATOM   3230 C  CA  . GLY B 1 83  ? 31.384 -16.073 -30.999 1.00 44.10 ? 86  GLY B CA  1 
ATOM   3231 C  C   . GLY B 1 83  ? 32.498 -15.991 -32.022 1.00 43.87 ? 86  GLY B C   1 
ATOM   3232 O  O   . GLY B 1 83  ? 33.137 -16.997 -32.347 1.00 42.70 ? 86  GLY B O   1 
ATOM   3233 N  N   . THR B 1 84  ? 32.742 -14.777 -32.507 1.00 42.79 ? 87  THR B N   1 
ATOM   3234 C  CA  . THR B 1 84  ? 33.387 -14.574 -33.797 1.00 41.37 ? 87  THR B CA  1 
ATOM   3235 C  C   . THR B 1 84  ? 34.725 -13.856 -33.724 1.00 40.74 ? 87  THR B C   1 
ATOM   3236 O  O   . THR B 1 84  ? 34.897 -12.912 -32.953 1.00 41.37 ? 87  THR B O   1 
ATOM   3237 C  CB  . THR B 1 84  ? 32.470 -13.770 -34.721 1.00 40.61 ? 87  THR B CB  1 
ATOM   3238 O  OG1 . THR B 1 84  ? 31.222 -14.459 -34.862 1.00 41.03 ? 87  THR B OG1 1 
ATOM   3239 C  CG2 . THR B 1 84  ? 33.114 -13.588 -36.085 1.00 40.60 ? 87  THR B CG2 1 
ATOM   3240 N  N   . VAL B 1 85  ? 35.672 -14.318 -34.535 1.00 40.55 ? 88  VAL B N   1 
ATOM   3241 C  CA  . VAL B 1 85  ? 36.854 -13.530 -34.880 1.00 41.61 ? 88  VAL B CA  1 
ATOM   3242 C  C   . VAL B 1 85  ? 36.886 -13.290 -36.388 1.00 41.57 ? 88  VAL B C   1 
ATOM   3243 O  O   . VAL B 1 85  ? 36.235 -14.001 -37.155 1.00 41.79 ? 88  VAL B O   1 
ATOM   3244 C  CB  . VAL B 1 85  ? 38.164 -14.243 -34.483 1.00 40.55 ? 88  VAL B CB  1 
ATOM   3245 C  CG1 . VAL B 1 85  ? 38.245 -14.389 -32.982 1.00 40.63 ? 88  VAL B CG1 1 
ATOM   3246 C  CG2 . VAL B 1 85  ? 38.244 -15.596 -35.164 1.00 39.50 ? 88  VAL B CG2 1 
ATOM   3247 N  N   . SER B 1 86  ? 37.643 -12.290 -36.815 1.00 42.53 ? 89  SER B N   1 
ATOM   3248 C  CA  . SER B 1 86  ? 37.781 -12.022 -38.238 1.00 43.12 ? 89  SER B CA  1 
ATOM   3249 C  C   . SER B 1 86  ? 39.116 -11.373 -38.578 1.00 43.60 ? 89  SER B C   1 
ATOM   3250 O  O   . SER B 1 86  ? 39.864 -10.944 -37.699 1.00 43.00 ? 89  SER B O   1 
ATOM   3251 C  CB  . SER B 1 86  ? 36.635 -11.131 -38.714 1.00 43.47 ? 89  SER B CB  1 
ATOM   3252 O  OG  . SER B 1 86  ? 36.634 -9.904  -38.014 1.00 44.68 ? 89  SER B OG  1 
ATOM   3253 N  N   . GLY B 1 87  ? 39.406 -11.310 -39.870 1.00 45.29 ? 90  GLY B N   1 
ATOM   3254 C  CA  . GLY B 1 87  ? 40.658 -10.745 -40.326 1.00 46.88 ? 90  GLY B CA  1 
ATOM   3255 C  C   . GLY B 1 87  ? 40.901 -11.120 -41.772 1.00 48.04 ? 90  GLY B C   1 
ATOM   3256 O  O   . GLY B 1 87  ? 39.958 -11.271 -42.551 1.00 47.60 ? 90  GLY B O   1 
ATOM   3257 N  N   . PHE B 1 88  ? 42.169 -11.275 -42.133 1.00 49.21 ? 91  PHE B N   1 
ATOM   3258 C  CA  . PHE B 1 88  ? 42.537 -11.586 -43.509 1.00 50.05 ? 91  PHE B CA  1 
ATOM   3259 C  C   . PHE B 1 88  ? 43.455 -12.807 -43.567 1.00 50.55 ? 91  PHE B C   1 
ATOM   3260 O  O   . PHE B 1 88  ? 44.084 -13.170 -42.571 1.00 51.03 ? 91  PHE B O   1 
ATOM   3261 C  CB  . PHE B 1 88  ? 43.224 -10.375 -44.149 1.00 46.14 ? 91  PHE B CB  1 
ATOM   3262 C  CG  . PHE B 1 88  ? 44.441 -9.912  -43.407 1.00 45.73 ? 91  PHE B CG  1 
ATOM   3263 C  CD1 . PHE B 1 88  ? 45.704 -10.346 -43.782 1.00 44.08 ? 91  PHE B CD1 1 
ATOM   3264 C  CD2 . PHE B 1 88  ? 44.326 -9.051  -42.327 1.00 44.31 ? 91  PHE B CD2 1 
ATOM   3265 C  CE1 . PHE B 1 88  ? 46.830 -9.931  -43.093 1.00 44.34 ? 91  PHE B CE1 1 
ATOM   3266 C  CE2 . PHE B 1 88  ? 45.448 -8.634  -41.635 1.00 45.07 ? 91  PHE B CE2 1 
ATOM   3267 C  CZ  . PHE B 1 88  ? 46.702 -9.075  -42.018 1.00 44.50 ? 91  PHE B CZ  1 
ATOM   3268 N  N   . LEU B 1 89  ? 43.525 -13.437 -44.735 1.00 50.61 ? 92  LEU B N   1 
ATOM   3269 C  CA  . LEU B 1 89  ? 44.347 -14.626 -44.917 1.00 52.48 ? 92  LEU B CA  1 
ATOM   3270 C  C   . LEU B 1 89  ? 45.789 -14.295 -45.292 1.00 53.48 ? 92  LEU B C   1 
ATOM   3271 O  O   . LEU B 1 89  ? 46.057 -13.284 -45.941 1.00 54.40 ? 92  LEU B O   1 
ATOM   3272 C  CB  . LEU B 1 89  ? 43.725 -15.526 -45.984 1.00 51.49 ? 92  LEU B CB  1 
ATOM   3273 C  CG  . LEU B 1 89  ? 42.459 -16.245 -45.516 1.00 52.42 ? 92  LEU B CG  1 
ATOM   3274 C  CD1 . LEU B 1 89  ? 41.802 -16.967 -46.683 1.00 52.57 ? 92  LEU B CD1 1 
ATOM   3275 C  CD2 . LEU B 1 89  ? 42.826 -17.225 -44.403 1.00 51.36 ? 92  LEU B CD2 1 
ATOM   3276 N  N   . SER B 1 90  ? 46.713 -15.148 -44.864 1.00 53.95 ? 93  SER B N   1 
ATOM   3277 C  CA  . SER B 1 90  ? 48.120 -15.018 -45.228 1.00 54.57 ? 93  SER B CA  1 
ATOM   3278 C  C   . SER B 1 90  ? 48.690 -16.393 -45.538 1.00 54.70 ? 93  SER B C   1 
ATOM   3279 O  O   . SER B 1 90  ? 47.977 -17.395 -45.471 1.00 55.58 ? 93  SER B O   1 
ATOM   3280 C  CB  . SER B 1 90  ? 48.921 -14.375 -44.089 1.00 55.03 ? 93  SER B CB  1 
ATOM   3281 O  OG  . SER B 1 90  ? 48.630 -12.994 -43.960 1.00 53.92 ? 93  SER B OG  1 
ATOM   3282 N  N   . GLN B 1 91  ? 49.972 -16.436 -45.889 1.00 53.58 ? 94  GLN B N   1 
ATOM   3283 C  CA  . GLN B 1 91  ? 50.656 -17.699 -46.116 1.00 53.35 ? 94  GLN B CA  1 
ATOM   3284 C  C   . GLN B 1 91  ? 52.087 -17.665 -45.593 1.00 53.15 ? 94  GLN B C   1 
ATOM   3285 O  O   . GLN B 1 91  ? 52.833 -16.719 -45.855 1.00 52.82 ? 94  GLN B O   1 
ATOM   3286 C  CB  . GLN B 1 91  ? 50.668 -18.037 -47.607 1.00 54.82 ? 94  GLN B CB  1 
ATOM   3287 C  CG  . GLN B 1 91  ? 51.436 -19.308 -47.933 1.00 56.87 ? 94  GLN B CG  1 
ATOM   3288 C  CD  . GLN B 1 91  ? 51.506 -19.587 -49.420 1.00 58.51 ? 94  GLN B CD  1 
ATOM   3289 O  OE1 . GLN B 1 91  ? 50.513 -19.976 -50.039 1.00 59.21 ? 94  GLN B OE1 1 
ATOM   3290 N  NE2 . GLN B 1 91  ? 52.685 -19.390 -50.004 1.00 59.07 ? 94  GLN B NE2 1 
ATOM   3291 N  N   . ASP B 1 92  ? 52.469 -18.705 -44.860 1.00 52.62 ? 95  ASP B N   1 
ATOM   3292 C  CA  . ASP B 1 92  ? 53.808 -18.777 -44.290 1.00 53.19 ? 95  ASP B CA  1 
ATOM   3293 C  C   . ASP B 1 92  ? 54.134 -20.193 -43.810 1.00 52.74 ? 95  ASP B C   1 
ATOM   3294 O  O   . ASP B 1 92  ? 53.245 -21.022 -43.608 1.00 53.27 ? 95  ASP B O   1 
ATOM   3295 C  CB  . ASP B 1 92  ? 53.932 -17.785 -43.125 1.00 53.08 ? 95  ASP B CB  1 
ATOM   3296 C  CG  . ASP B 1 92  ? 55.367 -17.346 -42.872 1.00 52.34 ? 95  ASP B CG  1 
ATOM   3297 O  OD1 . ASP B 1 92  ? 56.295 -18.153 -43.074 1.00 52.35 ? 95  ASP B OD1 1 
ATOM   3298 O  OD2 . ASP B 1 92  ? 55.568 -16.184 -42.468 1.00 50.95 ? 95  ASP B OD2 1 
ATOM   3299 N  N   . ILE B 1 93  ? 55.420 -20.463 -43.637 1.00 52.81 ? 96  ILE B N   1 
ATOM   3300 C  CA  . ILE B 1 93  ? 55.875 -21.750 -43.132 1.00 51.90 ? 96  ILE B CA  1 
ATOM   3301 C  C   . ILE B 1 93  ? 55.416 -21.942 -41.692 1.00 49.23 ? 96  ILE B C   1 
ATOM   3302 O  O   . ILE B 1 93  ? 55.612 -21.071 -40.847 1.00 48.15 ? 96  ILE B O   1 
ATOM   3303 C  CB  . ILE B 1 93  ? 57.414 -21.848 -43.176 1.00 53.39 ? 96  ILE B CB  1 
ATOM   3304 C  CG1 . ILE B 1 93  ? 57.901 -21.796 -44.625 1.00 54.64 ? 96  ILE B CG1 1 
ATOM   3305 C  CG2 . ILE B 1 93  ? 57.874 -23.125 -42.504 1.00 55.74 ? 96  ILE B CG2 1 
ATOM   3306 C  CD1 . ILE B 1 93  ? 59.411 -21.819 -44.762 1.00 55.41 ? 96  ILE B CD1 1 
ATOM   3307 N  N   . ILE B 1 94  ? 54.804 -23.089 -41.422 1.00 47.14 ? 97  ILE B N   1 
ATOM   3308 C  CA  . ILE B 1 94  ? 54.351 -23.413 -40.079 1.00 43.95 ? 97  ILE B CA  1 
ATOM   3309 C  C   . ILE B 1 94  ? 54.948 -24.736 -39.631 1.00 43.02 ? 97  ILE B C   1 
ATOM   3310 O  O   . ILE B 1 94  ? 54.817 -25.750 -40.314 1.00 42.34 ? 97  ILE B O   1 
ATOM   3311 C  CB  . ILE B 1 94  ? 52.815 -23.506 -40.023 1.00 43.23 ? 97  ILE B CB  1 
ATOM   3312 C  CG1 . ILE B 1 94  ? 52.207 -22.173 -40.455 1.00 41.88 ? 97  ILE B CG1 1 
ATOM   3313 C  CG2 . ILE B 1 94  ? 52.362 -23.848 -38.616 1.00 42.48 ? 97  ILE B CG2 1 
ATOM   3314 C  CD1 . ILE B 1 94  ? 50.731 -22.046 -40.140 1.00 44.17 ? 97  ILE B CD1 1 
ATOM   3315 N  N   . THR B 1 95  ? 55.613 -24.721 -38.483 1.00 44.11 ? 98  THR B N   1 
ATOM   3316 C  CA  . THR B 1 95  ? 56.228 -25.928 -37.957 1.00 44.70 ? 98  THR B CA  1 
ATOM   3317 C  C   . THR B 1 95  ? 55.419 -26.467 -36.782 1.00 44.89 ? 98  THR B C   1 
ATOM   3318 O  O   . THR B 1 95  ? 55.138 -25.749 -35.825 1.00 45.67 ? 98  THR B O   1 
ATOM   3319 C  CB  . THR B 1 95  ? 57.682 -25.664 -37.499 1.00 47.06 ? 98  THR B CB  1 
ATOM   3320 O  OG1 . THR B 1 95  ? 57.685 -24.819 -36.341 1.00 50.83 ? 98  THR B OG1 1 
ATOM   3321 C  CG2 . THR B 1 95  ? 58.470 -24.980 -38.613 1.00 47.57 ? 98  THR B CG2 1 
ATOM   3322 N  N   . VAL B 1 96  ? 55.031 -27.733 -36.874 1.00 45.08 ? 99  VAL B N   1 
ATOM   3323 C  CA  . VAL B 1 96  ? 54.341 -28.406 -35.784 1.00 45.13 ? 99  VAL B CA  1 
ATOM   3324 C  C   . VAL B 1 96  ? 55.161 -29.628 -35.386 1.00 45.76 ? 99  VAL B C   1 
ATOM   3325 O  O   . VAL B 1 96  ? 55.220 -30.617 -36.120 1.00 46.03 ? 99  VAL B O   1 
ATOM   3326 C  CB  . VAL B 1 96  ? 52.932 -28.865 -36.217 1.00 45.47 ? 99  VAL B CB  1 
ATOM   3327 C  CG1 . VAL B 1 96  ? 52.167 -29.394 -35.020 1.00 45.10 ? 99  VAL B CG1 1 
ATOM   3328 C  CG2 . VAL B 1 96  ? 52.187 -27.714 -36.867 1.00 46.51 ? 99  VAL B CG2 1 
ATOM   3329 N  N   . GLY B 1 97  ? 55.800 -29.560 -34.225 1.00 46.25 ? 100 GLY B N   1 
ATOM   3330 C  CA  . GLY B 1 97  ? 56.736 -30.602 -33.854 1.00 47.55 ? 100 GLY B CA  1 
ATOM   3331 C  C   . GLY B 1 97  ? 57.911 -30.610 -34.814 1.00 48.72 ? 100 GLY B C   1 
ATOM   3332 O  O   . GLY B 1 97  ? 58.471 -29.558 -35.131 1.00 49.13 ? 100 GLY B O   1 
ATOM   3333 N  N   . GLY B 1 98  ? 58.283 -31.793 -35.286 1.00 49.24 ? 101 GLY B N   1 
ATOM   3334 C  CA  . GLY B 1 98  ? 59.336 -31.886 -36.280 1.00 49.73 ? 101 GLY B CA  1 
ATOM   3335 C  C   . GLY B 1 98  ? 58.883 -31.533 -37.687 1.00 49.33 ? 101 GLY B C   1 
ATOM   3336 O  O   . GLY B 1 98  ? 59.705 -31.404 -38.591 1.00 49.16 ? 101 GLY B O   1 
ATOM   3337 N  N   . ILE B 1 99  ? 57.578 -31.370 -37.881 1.00 48.37 ? 102 ILE B N   1 
ATOM   3338 C  CA  . ILE B 1 99  ? 57.039 -31.146 -39.217 1.00 48.42 ? 102 ILE B CA  1 
ATOM   3339 C  C   . ILE B 1 99  ? 56.962 -29.670 -39.593 1.00 48.96 ? 102 ILE B C   1 
ATOM   3340 O  O   . ILE B 1 99  ? 56.574 -28.828 -38.780 1.00 48.51 ? 102 ILE B O   1 
ATOM   3341 C  CB  . ILE B 1 99  ? 55.629 -31.762 -39.362 1.00 48.33 ? 102 ILE B CB  1 
ATOM   3342 C  CG1 . ILE B 1 99  ? 55.717 -33.287 -39.289 1.00 47.89 ? 102 ILE B CG1 1 
ATOM   3343 C  CG2 . ILE B 1 99  ? 55.002 -31.334 -40.678 1.00 47.93 ? 102 ILE B CG2 1 
ATOM   3344 C  CD1 . ILE B 1 99  ? 54.394 -33.979 -39.497 1.00 46.03 ? 102 ILE B CD1 1 
ATOM   3345 N  N   . THR B 1 100 ? 57.338 -29.370 -40.834 1.00 48.73 ? 103 THR B N   1 
ATOM   3346 C  CA  . THR B 1 100 ? 57.188 -28.031 -41.398 1.00 48.73 ? 103 THR B CA  1 
ATOM   3347 C  C   . THR B 1 100 ? 56.304 -28.072 -42.635 1.00 48.23 ? 103 THR B C   1 
ATOM   3348 O  O   . THR B 1 100 ? 56.581 -28.811 -43.576 1.00 48.56 ? 103 THR B O   1 
ATOM   3349 C  CB  . THR B 1 100 ? 58.552 -27.436 -41.803 1.00 49.25 ? 103 THR B CB  1 
ATOM   3350 O  OG1 . THR B 1 100 ? 59.260 -27.005 -40.634 1.00 49.86 ? 103 THR B OG1 1 
ATOM   3351 C  CG2 . THR B 1 100 ? 58.361 -26.267 -42.749 1.00 50.09 ? 103 THR B CG2 1 
ATOM   3352 N  N   . VAL B 1 101 ? 55.244 -27.273 -42.641 1.00 48.26 ? 104 VAL B N   1 
ATOM   3353 C  CA  . VAL B 1 101 ? 54.335 -27.245 -43.781 1.00 48.89 ? 104 VAL B CA  1 
ATOM   3354 C  C   . VAL B 1 101 ? 54.037 -25.816 -44.219 1.00 48.74 ? 104 VAL B C   1 
ATOM   3355 O  O   . VAL B 1 101 ? 54.110 -24.879 -43.419 1.00 48.21 ? 104 VAL B O   1 
ATOM   3356 C  CB  . VAL B 1 101 ? 52.996 -27.967 -43.453 1.00 49.41 ? 104 VAL B CB  1 
ATOM   3357 C  CG1 . VAL B 1 101 ? 52.265 -27.237 -42.339 1.00 49.55 ? 104 VAL B CG1 1 
ATOM   3358 C  CG2 . VAL B 1 101 ? 52.123 -28.045 -44.696 1.00 48.06 ? 104 VAL B CG2 1 
ATOM   3359 N  N   . THR B 1 102 ? 53.707 -25.657 -45.497 1.00 48.99 ? 105 THR B N   1 
ATOM   3360 C  CA  . THR B 1 102 ? 53.302 -24.360 -46.029 1.00 49.62 ? 105 THR B CA  1 
ATOM   3361 C  C   . THR B 1 102 ? 51.787 -24.213 -45.965 1.00 49.31 ? 105 THR B C   1 
ATOM   3362 O  O   . THR B 1 102 ? 51.054 -24.974 -46.600 1.00 49.22 ? 105 THR B O   1 
ATOM   3363 C  CB  . THR B 1 102 ? 53.751 -24.197 -47.489 1.00 50.71 ? 105 THR B CB  1 
ATOM   3364 O  OG1 . THR B 1 102 ? 55.177 -24.331 -47.562 1.00 50.12 ? 105 THR B OG1 1 
ATOM   3365 C  CG2 . THR B 1 102 ? 53.332 -22.827 -48.025 1.00 49.94 ? 105 THR B CG2 1 
ATOM   3366 N  N   . GLN B 1 103 ? 51.323 -23.228 -45.202 1.00 48.35 ? 106 GLN B N   1 
ATOM   3367 C  CA  . GLN B 1 103 ? 49.916 -23.160 -44.822 1.00 46.73 ? 106 GLN B CA  1 
ATOM   3368 C  C   . GLN B 1 103 ? 49.307 -21.785 -45.048 1.00 47.38 ? 106 GLN B C   1 
ATOM   3369 O  O   . GLN B 1 103 ? 49.941 -20.765 -44.768 1.00 47.64 ? 106 GLN B O   1 
ATOM   3370 C  CB  . GLN B 1 103 ? 49.762 -23.532 -43.346 1.00 46.45 ? 106 GLN B CB  1 
ATOM   3371 C  CG  . GLN B 1 103 ? 48.323 -23.609 -42.889 1.00 43.76 ? 106 GLN B CG  1 
ATOM   3372 C  CD  . GLN B 1 103 ? 47.599 -24.766 -43.533 1.00 42.92 ? 106 GLN B CD  1 
ATOM   3373 O  OE1 . GLN B 1 103 ? 48.129 -25.874 -43.601 1.00 43.48 ? 106 GLN B OE1 1 
ATOM   3374 N  NE2 . GLN B 1 103 ? 46.385 -24.518 -44.014 1.00 41.32 ? 106 GLN B NE2 1 
ATOM   3375 N  N   . MET B 1 104 ? 48.073 -21.760 -45.542 1.00 47.44 ? 107 MET B N   1 
ATOM   3376 C  CA  . MET B 1 104 ? 47.288 -20.529 -45.581 1.00 48.02 ? 107 MET B CA  1 
ATOM   3377 C  C   . MET B 1 104 ? 46.490 -20.393 -44.292 1.00 48.18 ? 107 MET B C   1 
ATOM   3378 O  O   . MET B 1 104 ? 45.497 -21.091 -44.094 1.00 48.12 ? 107 MET B O   1 
ATOM   3379 C  CB  . MET B 1 104 ? 46.328 -20.539 -46.773 1.00 50.60 ? 107 MET B CB  1 
ATOM   3380 C  CG  . MET B 1 104 ? 46.833 -19.780 -47.992 1.00 54.09 ? 107 MET B CG  1 
ATOM   3381 S  SD  . MET B 1 104 ? 46.366 -18.033 -47.980 1.00 60.64 ? 107 MET B SD  1 
ATOM   3382 C  CE  . MET B 1 104 ? 44.609 -18.144 -48.390 1.00 57.01 ? 107 MET B CE  1 
ATOM   3383 N  N   . PHE B 1 105 ? 46.928 -19.496 -43.417 1.00 47.46 ? 108 PHE B N   1 
ATOM   3384 C  CA  . PHE B 1 105 ? 46.255 -19.284 -42.142 1.00 46.95 ? 108 PHE B CA  1 
ATOM   3385 C  C   . PHE B 1 105 ? 45.652 -17.887 -42.077 1.00 46.44 ? 108 PHE B C   1 
ATOM   3386 O  O   . PHE B 1 105 ? 45.987 -17.013 -42.880 1.00 45.72 ? 108 PHE B O   1 
ATOM   3387 C  CB  . PHE B 1 105 ? 47.239 -19.473 -40.981 1.00 48.12 ? 108 PHE B CB  1 
ATOM   3388 C  CG  . PHE B 1 105 ? 48.269 -18.380 -40.867 1.00 47.57 ? 108 PHE B CG  1 
ATOM   3389 C  CD1 . PHE B 1 105 ? 49.432 -18.422 -41.617 1.00 48.21 ? 108 PHE B CD1 1 
ATOM   3390 C  CD2 . PHE B 1 105 ? 48.076 -17.314 -40.002 1.00 47.75 ? 108 PHE B CD2 1 
ATOM   3391 C  CE1 . PHE B 1 105 ? 50.382 -17.426 -41.506 1.00 46.55 ? 108 PHE B CE1 1 
ATOM   3392 C  CE2 . PHE B 1 105 ? 49.022 -16.316 -39.888 1.00 46.81 ? 108 PHE B CE2 1 
ATOM   3393 C  CZ  . PHE B 1 105 ? 50.177 -16.374 -40.641 1.00 46.71 ? 108 PHE B CZ  1 
ATOM   3394 N  N   . GLY B 1 106 ? 44.763 -17.680 -41.113 1.00 45.87 ? 109 GLY B N   1 
ATOM   3395 C  CA  . GLY B 1 106 ? 44.155 -16.375 -40.945 1.00 45.62 ? 109 GLY B CA  1 
ATOM   3396 C  C   . GLY B 1 106 ? 44.870 -15.528 -39.915 1.00 45.54 ? 109 GLY B C   1 
ATOM   3397 O  O   . GLY B 1 106 ? 45.164 -15.992 -38.816 1.00 44.48 ? 109 GLY B O   1 
ATOM   3398 N  N   . GLU B 1 107 ? 45.163 -14.283 -40.278 1.00 46.81 ? 110 GLU B N   1 
ATOM   3399 C  CA  . GLU B 1 107 ? 45.625 -13.290 -39.315 1.00 47.20 ? 110 GLU B CA  1 
ATOM   3400 C  C   . GLU B 1 107 ? 44.409 -12.546 -38.786 1.00 47.13 ? 110 GLU B C   1 
ATOM   3401 O  O   . GLU B 1 107 ? 43.816 -11.728 -39.489 1.00 48.63 ? 110 GLU B O   1 
ATOM   3402 C  CB  . GLU B 1 107 ? 46.591 -12.293 -39.972 1.00 48.41 ? 110 GLU B CB  1 
ATOM   3403 C  CG  . GLU B 1 107 ? 48.009 -12.816 -40.177 1.00 50.20 ? 110 GLU B CG  1 
ATOM   3404 C  CD  . GLU B 1 107 ? 48.984 -11.721 -40.595 1.00 51.78 ? 110 GLU B CD  1 
ATOM   3405 O  OE1 . GLU B 1 107 ? 48.891 -10.594 -40.058 1.00 51.54 ? 110 GLU B OE1 1 
ATOM   3406 O  OE2 . GLU B 1 107 ? 49.844 -11.988 -41.463 1.00 52.10 ? 110 GLU B OE2 1 
ATOM   3407 N  N   . VAL B 1 108 ? 44.037 -12.838 -37.546 1.00 46.61 ? 111 VAL B N   1 
ATOM   3408 C  CA  . VAL B 1 108 ? 42.854 -12.235 -36.951 1.00 45.83 ? 111 VAL B CA  1 
ATOM   3409 C  C   . VAL B 1 108 ? 43.137 -10.807 -36.510 1.00 45.18 ? 111 VAL B C   1 
ATOM   3410 O  O   . VAL B 1 108 ? 44.141 -10.534 -35.846 1.00 45.83 ? 111 VAL B O   1 
ATOM   3411 C  CB  . VAL B 1 108 ? 42.362 -13.057 -35.737 1.00 44.21 ? 111 VAL B CB  1 
ATOM   3412 C  CG1 . VAL B 1 108 ? 41.185 -12.363 -35.072 1.00 44.30 ? 111 VAL B CG1 1 
ATOM   3413 C  CG2 . VAL B 1 108 ? 41.960 -14.441 -36.193 1.00 42.66 ? 111 VAL B CG2 1 
ATOM   3414 N  N   . THR B 1 109 ? 42.243 -9.903  -36.891 1.00 44.74 ? 112 THR B N   1 
ATOM   3415 C  CA  . THR B 1 109 ? 42.385 -8.492  -36.566 1.00 46.64 ? 112 THR B CA  1 
ATOM   3416 C  C   . THR B 1 109 ? 41.268 -8.003  -35.646 1.00 46.58 ? 112 THR B C   1 
ATOM   3417 O  O   . THR B 1 109 ? 41.207 -6.822  -35.308 1.00 46.67 ? 112 THR B O   1 
ATOM   3418 C  CB  . THR B 1 109 ? 42.392 -7.634  -37.847 1.00 46.88 ? 112 THR B CB  1 
ATOM   3419 O  OG1 . THR B 1 109 ? 41.193 -7.876  -38.596 1.00 44.73 ? 112 THR B OG1 1 
ATOM   3420 C  CG2 . THR B 1 109 ? 43.606 -7.977  -38.704 1.00 45.68 ? 112 THR B CG2 1 
ATOM   3421 N  N   . GLU B 1 110 ? 40.385 -8.910  -35.245 1.00 46.22 ? 113 GLU B N   1 
ATOM   3422 C  CA  . GLU B 1 110 ? 39.336 -8.566  -34.294 1.00 47.75 ? 113 GLU B CA  1 
ATOM   3423 C  C   . GLU B 1 110 ? 39.071 -9.728  -33.334 1.00 46.84 ? 113 GLU B C   1 
ATOM   3424 O  O   . GLU B 1 110 ? 38.611 -10.794 -33.748 1.00 47.39 ? 113 GLU B O   1 
ATOM   3425 C  CB  . GLU B 1 110 ? 38.060 -8.172  -35.053 1.00 48.61 ? 113 GLU B CB  1 
ATOM   3426 C  CG  . GLU B 1 110 ? 38.294 -7.023  -36.041 1.00 52.14 ? 113 GLU B CG  1 
ATOM   3427 C  CD  . GLU B 1 110 ? 37.052 -6.613  -36.818 1.00 54.42 ? 113 GLU B CD  1 
ATOM   3428 O  OE1 . GLU B 1 110 ? 36.915 -5.405  -37.120 1.00 55.77 ? 113 GLU B OE1 1 
ATOM   3429 O  OE2 . GLU B 1 110 ? 36.218 -7.487  -37.132 1.00 54.69 ? 113 GLU B OE2 1 
ATOM   3430 N  N   . MET B 1 111 ? 39.386 -9.511  -32.058 1.00 45.85 ? 114 MET B N   1 
ATOM   3431 C  CA  . MET B 1 111 ? 39.247 -10.525 -31.013 1.00 45.26 ? 114 MET B CA  1 
ATOM   3432 C  C   . MET B 1 111 ? 38.445 -9.968  -29.837 1.00 43.89 ? 114 MET B C   1 
ATOM   3433 O  O   . MET B 1 111 ? 38.990 -9.255  -28.990 1.00 44.40 ? 114 MET B O   1 
ATOM   3434 C  CB  . MET B 1 111 ? 40.623 -10.953 -30.488 1.00 45.60 ? 114 MET B CB  1 
ATOM   3435 C  CG  . MET B 1 111 ? 41.505 -11.702 -31.470 1.00 45.28 ? 114 MET B CG  1 
ATOM   3436 S  SD  . MET B 1 111 ? 43.089 -12.172 -30.707 1.00 49.07 ? 114 MET B SD  1 
ATOM   3437 C  CE  . MET B 1 111 ? 42.665 -13.749 -29.962 1.00 47.36 ? 114 MET B CE  1 
ATOM   3438 N  N   . PRO B 1 112 ? 37.149 -10.301 -29.757 1.00 42.40 ? 115 PRO B N   1 
ATOM   3439 C  CA  . PRO B 1 112 ? 36.313 -9.853  -28.635 1.00 41.12 ? 115 PRO B CA  1 
ATOM   3440 C  C   . PRO B 1 112 ? 36.901 -10.260 -27.283 1.00 40.74 ? 115 PRO B C   1 
ATOM   3441 O  O   . PRO B 1 112 ? 37.384 -11.383 -27.124 1.00 39.36 ? 115 PRO B O   1 
ATOM   3442 C  CB  . PRO B 1 112 ? 34.970 -10.531 -28.888 1.00 39.53 ? 115 PRO B CB  1 
ATOM   3443 C  CG  . PRO B 1 112 ? 34.964 -10.804 -30.361 1.00 42.32 ? 115 PRO B CG  1 
ATOM   3444 C  CD  . PRO B 1 112 ? 36.388 -11.123 -30.713 1.00 42.65 ? 115 PRO B CD  1 
ATOM   3445 N  N   . ALA B 1 113 ? 36.852 -9.342  -26.320 1.00 38.74 ? 116 ALA B N   1 
ATOM   3446 C  CA  . ALA B 1 113 ? 37.388 -9.591  -24.987 1.00 38.13 ? 116 ALA B CA  1 
ATOM   3447 C  C   . ALA B 1 113 ? 36.757 -10.839 -24.375 1.00 37.46 ? 116 ALA B C   1 
ATOM   3448 O  O   . ALA B 1 113 ? 37.444 -11.668 -23.774 1.00 35.99 ? 116 ALA B O   1 
ATOM   3449 C  CB  . ALA B 1 113 ? 37.134 -8.386  -24.096 1.00 38.08 ? 116 ALA B CB  1 
ATOM   3450 N  N   . LEU B 1 114 ? 35.444 -10.960 -24.528 1.00 36.10 ? 117 LEU B N   1 
ATOM   3451 C  CA  . LEU B 1 114 ? 34.761 -12.216 -24.254 1.00 36.32 ? 117 LEU B CA  1 
ATOM   3452 C  C   . LEU B 1 114 ? 34.713 -12.952 -25.589 1.00 36.57 ? 117 LEU B C   1 
ATOM   3453 O  O   . LEU B 1 114 ? 34.017 -12.517 -26.506 1.00 36.14 ? 117 LEU B O   1 
ATOM   3454 C  CB  . LEU B 1 114 ? 33.334 -11.938 -23.769 1.00 35.37 ? 117 LEU B CB  1 
ATOM   3455 C  CG  . LEU B 1 114 ? 32.618 -12.956 -22.873 1.00 35.77 ? 117 LEU B CG  1 
ATOM   3456 C  CD1 . LEU B 1 114 ? 31.155 -13.010 -23.280 1.00 36.26 ? 117 LEU B CD1 1 
ATOM   3457 C  CD2 . LEU B 1 114 ? 33.238 -14.332 -22.994 1.00 37.29 ? 117 LEU B CD2 1 
ATOM   3458 N  N   . PRO B 1 115 ? 35.418 -14.091 -25.715 1.00 36.63 ? 118 PRO B N   1 
ATOM   3459 C  CA  . PRO B 1 115 ? 36.090 -14.922 -24.708 1.00 34.70 ? 118 PRO B CA  1 
ATOM   3460 C  C   . PRO B 1 115 ? 37.598 -14.748 -24.545 1.00 33.76 ? 118 PRO B C   1 
ATOM   3461 O  O   . PRO B 1 115 ? 38.198 -15.340 -23.645 1.00 33.55 ? 118 PRO B O   1 
ATOM   3462 C  CB  . PRO B 1 115 ? 35.765 -16.334 -25.170 1.00 37.87 ? 118 PRO B CB  1 
ATOM   3463 C  CG  . PRO B 1 115 ? 35.818 -16.211 -26.675 1.00 37.05 ? 118 PRO B CG  1 
ATOM   3464 C  CD  . PRO B 1 115 ? 35.383 -14.781 -27.019 1.00 36.25 ? 118 PRO B CD  1 
ATOM   3465 N  N   . PHE B 1 116 ? 38.227 -13.980 -25.423 1.00 30.78 ? 119 PHE B N   1 
ATOM   3466 C  CA  . PHE B 1 116 ? 39.658 -14.147 -25.610 1.00 31.24 ? 119 PHE B CA  1 
ATOM   3467 C  C   . PHE B 1 116 ? 40.545 -13.543 -24.530 1.00 30.21 ? 119 PHE B C   1 
ATOM   3468 O  O   . PHE B 1 116 ? 41.721 -13.875 -24.434 1.00 30.91 ? 119 PHE B O   1 
ATOM   3469 C  CB  . PHE B 1 116 ? 40.045 -13.647 -27.003 1.00 33.36 ? 119 PHE B CB  1 
ATOM   3470 C  CG  . PHE B 1 116 ? 39.466 -14.490 -28.099 1.00 35.14 ? 119 PHE B CG  1 
ATOM   3471 C  CD1 . PHE B 1 116 ? 39.962 -15.766 -28.338 1.00 34.39 ? 119 PHE B CD1 1 
ATOM   3472 C  CD2 . PHE B 1 116 ? 38.356 -14.062 -28.810 1.00 35.39 ? 119 PHE B CD2 1 
ATOM   3473 C  CE1 . PHE B 1 116 ? 39.351 -16.608 -29.260 1.00 33.83 ? 119 PHE B CE1 1 
ATOM   3474 C  CE2 . PHE B 1 116 ? 37.742 -14.900 -29.731 1.00 35.39 ? 119 PHE B CE2 1 
ATOM   3475 C  CZ  . PHE B 1 116 ? 38.241 -16.175 -29.953 1.00 33.31 ? 119 PHE B CZ  1 
ATOM   3476 N  N   . MET B 1 117 ? 39.985 -12.681 -23.693 1.00 31.31 ? 120 MET B N   1 
ATOM   3477 C  CA  . MET B 1 117 ? 40.727 -12.217 -22.529 1.00 31.71 ? 120 MET B CA  1 
ATOM   3478 C  C   . MET B 1 117 ? 40.797 -13.325 -21.486 1.00 31.44 ? 120 MET B C   1 
ATOM   3479 O  O   . MET B 1 117 ? 41.534 -13.222 -20.503 1.00 30.33 ? 120 MET B O   1 
ATOM   3480 C  CB  . MET B 1 117 ? 40.070 -10.972 -21.936 1.00 33.59 ? 120 MET B CB  1 
ATOM   3481 C  CG  . MET B 1 117 ? 40.293 -9.718  -22.764 1.00 34.82 ? 120 MET B CG  1 
ATOM   3482 S  SD  . MET B 1 117 ? 42.045 -9.307  -22.922 1.00 39.71 ? 120 MET B SD  1 
ATOM   3483 C  CE  . MET B 1 117 ? 42.430 -8.773  -21.286 1.00 36.45 ? 120 MET B CE  1 
ATOM   3484 N  N   . LEU B 1 118 ? 40.038 -14.394 -21.719 1.00 30.61 ? 121 LEU B N   1 
ATOM   3485 C  CA  . LEU B 1 118 ? 40.045 -15.547 -20.826 1.00 31.49 ? 121 LEU B CA  1 
ATOM   3486 C  C   . LEU B 1 118 ? 41.022 -16.635 -21.293 1.00 34.24 ? 121 LEU B C   1 
ATOM   3487 O  O   . LEU B 1 118 ? 41.315 -17.570 -20.549 1.00 35.74 ? 121 LEU B O   1 
ATOM   3488 C  CB  . LEU B 1 118 ? 38.626 -16.125 -20.705 1.00 30.00 ? 121 LEU B CB  1 
ATOM   3489 C  CG  . LEU B 1 118 ? 37.542 -15.116 -20.294 1.00 28.27 ? 121 LEU B CG  1 
ATOM   3490 C  CD1 . LEU B 1 118 ? 36.194 -15.799 -20.132 1.00 26.49 ? 121 LEU B CD1 1 
ATOM   3491 C  CD2 . LEU B 1 118 ? 37.947 -14.440 -19.002 1.00 25.99 ? 121 LEU B CD2 1 
ATOM   3492 N  N   . ALA B 1 119 ? 41.540 -16.503 -22.514 1.00 33.07 ? 122 ALA B N   1 
ATOM   3493 C  CA  . ALA B 1 119 ? 42.353 -17.560 -23.115 1.00 33.06 ? 122 ALA B CA  1 
ATOM   3494 C  C   . ALA B 1 119 ? 43.831 -17.522 -22.731 1.00 33.26 ? 122 ALA B C   1 
ATOM   3495 O  O   . ALA B 1 119 ? 44.472 -16.471 -22.771 1.00 34.31 ? 122 ALA B O   1 
ATOM   3496 C  CB  . ALA B 1 119 ? 42.216 -17.516 -24.629 1.00 31.84 ? 122 ALA B CB  1 
ATOM   3497 N  N   . GLU B 1 120 ? 44.372 -18.680 -22.365 1.00 34.32 ? 123 GLU B N   1 
ATOM   3498 C  CA  . GLU B 1 120 ? 45.799 -18.798 -22.079 1.00 34.84 ? 123 GLU B CA  1 
ATOM   3499 C  C   . GLU B 1 120 ? 46.577 -18.972 -23.373 1.00 34.46 ? 123 GLU B C   1 
ATOM   3500 O  O   . GLU B 1 120 ? 47.802 -18.870 -23.389 1.00 35.87 ? 123 GLU B O   1 
ATOM   3501 C  CB  . GLU B 1 120 ? 46.069 -19.995 -21.168 1.00 36.77 ? 123 GLU B CB  1 
ATOM   3502 C  CG  . GLU B 1 120 ? 45.466 -19.863 -19.787 1.00 40.45 ? 123 GLU B CG  1 
ATOM   3503 C  CD  . GLU B 1 120 ? 46.168 -18.814 -18.950 1.00 42.03 ? 123 GLU B CD  1 
ATOM   3504 O  OE1 . GLU B 1 120 ? 47.415 -18.780 -18.972 1.00 43.33 ? 123 GLU B OE1 1 
ATOM   3505 O  OE2 . GLU B 1 120 ? 45.472 -18.026 -18.272 1.00 44.87 ? 123 GLU B OE2 1 
ATOM   3506 N  N   . PHE B 1 121 ? 45.857 -19.233 -24.455 1.00 33.29 ? 124 PHE B N   1 
ATOM   3507 C  CA  . PHE B 1 121 ? 46.476 -19.491 -25.752 1.00 33.93 ? 124 PHE B CA  1 
ATOM   3508 C  C   . PHE B 1 121 ? 46.292 -18.282 -26.660 1.00 34.99 ? 124 PHE B C   1 
ATOM   3509 O  O   . PHE B 1 121 ? 45.535 -17.366 -26.331 1.00 34.23 ? 124 PHE B O   1 
ATOM   3510 C  CB  . PHE B 1 121 ? 45.830 -20.708 -26.401 1.00 33.44 ? 124 PHE B CB  1 
ATOM   3511 C  CG  . PHE B 1 121 ? 44.340 -20.596 -26.527 1.00 34.08 ? 124 PHE B CG  1 
ATOM   3512 C  CD1 . PHE B 1 121 ? 43.511 -21.003 -25.491 1.00 32.78 ? 124 PHE B CD1 1 
ATOM   3513 C  CD2 . PHE B 1 121 ? 43.767 -20.073 -27.675 1.00 33.01 ? 124 PHE B CD2 1 
ATOM   3514 C  CE1 . PHE B 1 121 ? 42.143 -20.889 -25.602 1.00 34.24 ? 124 PHE B CE1 1 
ATOM   3515 C  CE2 . PHE B 1 121 ? 42.397 -19.959 -27.788 1.00 33.87 ? 124 PHE B CE2 1 
ATOM   3516 C  CZ  . PHE B 1 121 ? 41.584 -20.366 -26.753 1.00 32.57 ? 124 PHE B CZ  1 
ATOM   3517 N  N   . ASP B 1 122 ? 46.976 -18.289 -27.802 1.00 34.83 ? 125 ASP B N   1 
ATOM   3518 C  CA  . ASP B 1 122 ? 46.901 -17.182 -28.749 1.00 36.23 ? 125 ASP B CA  1 
ATOM   3519 C  C   . ASP B 1 122 ? 45.895 -17.462 -29.862 1.00 35.63 ? 125 ASP B C   1 
ATOM   3520 O  O   . ASP B 1 122 ? 45.026 -16.637 -30.139 1.00 35.99 ? 125 ASP B O   1 
ATOM   3521 C  CB  . ASP B 1 122 ? 48.284 -16.908 -29.357 1.00 36.94 ? 125 ASP B CB  1 
ATOM   3522 C  CG  . ASP B 1 122 ? 49.351 -16.661 -28.300 1.00 39.03 ? 125 ASP B CG  1 
ATOM   3523 O  OD1 . ASP B 1 122 ? 49.249 -15.657 -27.562 1.00 39.51 ? 125 ASP B OD1 1 
ATOM   3524 O  OD2 . ASP B 1 122 ? 50.294 -17.478 -28.205 1.00 39.48 ? 125 ASP B OD2 1 
ATOM   3525 N  N   . GLY B 1 123 ? 46.014 -18.631 -30.492 1.00 35.58 ? 126 GLY B N   1 
ATOM   3526 C  CA  . GLY B 1 123 ? 45.159 -18.956 -31.625 1.00 35.10 ? 126 GLY B CA  1 
ATOM   3527 C  C   . GLY B 1 123 ? 44.733 -20.414 -31.746 1.00 35.78 ? 126 GLY B C   1 
ATOM   3528 O  O   . GLY B 1 123 ? 44.820 -21.188 -30.791 1.00 35.05 ? 126 GLY B O   1 
ATOM   3529 N  N   . VAL B 1 124 ? 44.272 -20.781 -32.941 1.00 36.21 ? 127 VAL B N   1 
ATOM   3530 C  CA  . VAL B 1 124 ? 43.639 -22.074 -33.186 1.00 34.81 ? 127 VAL B CA  1 
ATOM   3531 C  C   . VAL B 1 124 ? 44.218 -22.796 -34.402 1.00 35.43 ? 127 VAL B C   1 
ATOM   3532 O  O   . VAL B 1 124 ? 44.322 -22.215 -35.484 1.00 35.29 ? 127 VAL B O   1 
ATOM   3533 C  CB  . VAL B 1 124 ? 42.130 -21.915 -33.446 1.00 33.94 ? 127 VAL B CB  1 
ATOM   3534 C  CG1 . VAL B 1 124 ? 41.522 -23.269 -33.782 1.00 34.35 ? 127 VAL B CG1 1 
ATOM   3535 C  CG2 . VAL B 1 124 ? 41.449 -21.300 -32.236 1.00 33.53 ? 127 VAL B CG2 1 
ATOM   3536 N  N   . VAL B 1 125 ? 44.571 -24.066 -34.229 1.00 33.36 ? 128 VAL B N   1 
ATOM   3537 C  CA  . VAL B 1 125 ? 44.879 -24.930 -35.362 1.00 32.39 ? 128 VAL B CA  1 
ATOM   3538 C  C   . VAL B 1 125 ? 43.794 -25.986 -35.517 1.00 32.23 ? 128 VAL B C   1 
ATOM   3539 O  O   . VAL B 1 125 ? 43.704 -26.915 -34.711 1.00 31.70 ? 128 VAL B O   1 
ATOM   3540 C  CB  . VAL B 1 125 ? 46.230 -25.644 -35.179 1.00 32.24 ? 128 VAL B CB  1 
ATOM   3541 C  CG1 . VAL B 1 125 ? 46.436 -26.650 -36.308 1.00 29.86 ? 128 VAL B CG1 1 
ATOM   3542 C  CG2 . VAL B 1 125 ? 47.364 -24.623 -35.162 1.00 28.70 ? 128 VAL B CG2 1 
ATOM   3543 N  N   . GLY B 1 126 ? 42.970 -25.839 -36.550 1.00 32.94 ? 129 GLY B N   1 
ATOM   3544 C  CA  . GLY B 1 126 ? 41.877 -26.775 -36.756 1.00 32.72 ? 129 GLY B CA  1 
ATOM   3545 C  C   . GLY B 1 126 ? 42.342 -28.089 -37.357 1.00 33.41 ? 129 GLY B C   1 
ATOM   3546 O  O   . GLY B 1 126 ? 43.137 -28.095 -38.291 1.00 32.30 ? 129 GLY B O   1 
ATOM   3547 N  N   . MET B 1 127 ? 41.844 -29.203 -36.823 1.00 33.17 ? 130 MET B N   1 
ATOM   3548 C  CA  . MET B 1 127 ? 42.248 -30.521 -37.294 1.00 33.54 ? 130 MET B CA  1 
ATOM   3549 C  C   . MET B 1 127 ? 41.109 -31.273 -37.972 1.00 32.87 ? 130 MET B C   1 
ATOM   3550 O  O   . MET B 1 127 ? 41.185 -32.484 -38.146 1.00 34.57 ? 130 MET B O   1 
ATOM   3551 C  CB  . MET B 1 127 ? 42.781 -31.361 -36.130 1.00 33.43 ? 130 MET B CB  1 
ATOM   3552 C  CG  . MET B 1 127 ? 43.921 -30.712 -35.368 1.00 36.37 ? 130 MET B CG  1 
ATOM   3553 S  SD  . MET B 1 127 ? 45.463 -30.622 -36.303 1.00 35.98 ? 130 MET B SD  1 
ATOM   3554 C  CE  . MET B 1 127 ? 46.015 -32.335 -36.234 1.00 36.69 ? 130 MET B CE  1 
ATOM   3555 N  N   . GLY B 1 128 ? 40.057 -30.553 -38.345 1.00 34.26 ? 131 GLY B N   1 
ATOM   3556 C  CA  . GLY B 1 128 ? 38.917 -31.174 -39.001 1.00 33.98 ? 131 GLY B CA  1 
ATOM   3557 C  C   . GLY B 1 128 ? 39.084 -31.264 -40.509 1.00 35.01 ? 131 GLY B C   1 
ATOM   3558 O  O   . GLY B 1 128 ? 40.174 -31.022 -41.034 1.00 35.94 ? 131 GLY B O   1 
ATOM   3559 N  N   . PHE B 1 129 ? 38.008 -31.609 -41.210 1.00 34.98 ? 132 PHE B N   1 
ATOM   3560 C  CA  . PHE B 1 129 ? 38.079 -31.860 -42.648 1.00 37.39 ? 132 PHE B CA  1 
ATOM   3561 C  C   . PHE B 1 129 ? 37.855 -30.575 -43.443 1.00 39.03 ? 132 PHE B C   1 
ATOM   3562 O  O   . PHE B 1 129 ? 37.299 -29.606 -42.926 1.00 39.14 ? 132 PHE B O   1 
ATOM   3563 C  CB  . PHE B 1 129 ? 37.029 -32.896 -43.065 1.00 36.55 ? 132 PHE B CB  1 
ATOM   3564 C  CG  . PHE B 1 129 ? 37.231 -34.263 -42.458 1.00 35.73 ? 132 PHE B CG  1 
ATOM   3565 C  CD1 . PHE B 1 129 ? 36.964 -34.493 -41.117 1.00 35.94 ? 132 PHE B CD1 1 
ATOM   3566 C  CD2 . PHE B 1 129 ? 37.646 -35.327 -43.242 1.00 36.14 ? 132 PHE B CD2 1 
ATOM   3567 C  CE1 . PHE B 1 129 ? 37.106 -35.757 -40.571 1.00 34.74 ? 132 PHE B CE1 1 
ATOM   3568 C  CE2 . PHE B 1 129 ? 37.790 -36.596 -42.702 1.00 34.95 ? 132 PHE B CE2 1 
ATOM   3569 C  CZ  . PHE B 1 129 ? 37.519 -36.811 -41.364 1.00 34.99 ? 132 PHE B CZ  1 
ATOM   3570 N  N   . ILE B 1 130 ? 38.282 -30.572 -44.703 1.00 40.60 ? 133 ILE B N   1 
ATOM   3571 C  CA  . ILE B 1 130 ? 38.101 -29.407 -45.560 1.00 42.33 ? 133 ILE B CA  1 
ATOM   3572 C  C   . ILE B 1 130 ? 36.615 -29.086 -45.707 1.00 42.50 ? 133 ILE B C   1 
ATOM   3573 O  O   . ILE B 1 130 ? 36.238 -27.955 -46.010 1.00 42.86 ? 133 ILE B O   1 
ATOM   3574 C  CB  . ILE B 1 130 ? 38.695 -29.638 -46.969 1.00 44.49 ? 133 ILE B CB  1 
ATOM   3575 C  CG1 . ILE B 1 130 ? 38.632 -28.334 -47.777 1.00 45.04 ? 133 ILE B CG1 1 
ATOM   3576 C  CG2 . ILE B 1 130 ? 37.911 -30.727 -47.694 1.00 43.52 ? 133 ILE B CG2 1 
ATOM   3577 C  CD1 . ILE B 1 130 ? 39.400 -28.375 -49.087 1.00 46.22 ? 133 ILE B CD1 1 
ATOM   3578 N  N   . GLU B 1 131 ? 35.773 -30.087 -45.487 1.00 42.90 ? 134 GLU B N   1 
ATOM   3579 C  CA  . GLU B 1 131 ? 34.331 -29.883 -45.531 1.00 44.17 ? 134 GLU B CA  1 
ATOM   3580 C  C   . GLU B 1 131 ? 33.861 -28.869 -44.486 1.00 44.97 ? 134 GLU B C   1 
ATOM   3581 O  O   . GLU B 1 131 ? 32.770 -28.317 -44.599 1.00 45.34 ? 134 GLU B O   1 
ATOM   3582 C  CB  . GLU B 1 131 ? 33.603 -31.212 -45.319 1.00 44.15 ? 134 GLU B CB  1 
ATOM   3583 C  CG  . GLU B 1 131 ? 33.559 -32.106 -46.547 1.00 45.84 ? 134 GLU B CG  1 
ATOM   3584 C  CD  . GLU B 1 131 ? 34.691 -33.118 -46.593 1.00 47.59 ? 134 GLU B CD  1 
ATOM   3585 O  OE1 . GLU B 1 131 ? 35.649 -33.001 -45.798 1.00 47.33 ? 134 GLU B OE1 1 
ATOM   3586 O  OE2 . GLU B 1 131 ? 34.621 -34.039 -47.433 1.00 48.98 ? 134 GLU B OE2 1 
ATOM   3587 N  N   . GLN B 1 132 ? 34.686 -28.625 -43.471 1.00 45.59 ? 135 GLN B N   1 
ATOM   3588 C  CA  . GLN B 1 132 ? 34.316 -27.717 -42.392 1.00 46.17 ? 135 GLN B CA  1 
ATOM   3589 C  C   . GLN B 1 132 ? 35.122 -26.431 -42.455 1.00 47.00 ? 135 GLN B C   1 
ATOM   3590 O  O   . GLN B 1 132 ? 34.855 -25.481 -41.717 1.00 46.90 ? 135 GLN B O   1 
ATOM   3591 C  CB  . GLN B 1 132 ? 34.545 -28.383 -41.036 1.00 48.08 ? 135 GLN B CB  1 
ATOM   3592 C  CG  . GLN B 1 132 ? 33.737 -29.643 -40.826 1.00 50.37 ? 135 GLN B CG  1 
ATOM   3593 C  CD  . GLN B 1 132 ? 32.249 -29.393 -40.904 1.00 51.90 ? 135 GLN B CD  1 
ATOM   3594 O  OE1 . GLN B 1 132 ? 31.649 -29.472 -41.978 1.00 51.97 ? 135 GLN B OE1 1 
ATOM   3595 N  NE2 . GLN B 1 132 ? 31.640 -29.093 -39.760 1.00 52.17 ? 135 GLN B NE2 1 
ATOM   3596 N  N   . ALA B 1 133 ? 36.120 -26.404 -43.328 1.00 47.45 ? 136 ALA B N   1 
ATOM   3597 C  CA  . ALA B 1 133 ? 36.960 -25.227 -43.453 1.00 47.42 ? 136 ALA B CA  1 
ATOM   3598 C  C   . ALA B 1 133 ? 36.129 -24.051 -43.945 1.00 47.96 ? 136 ALA B C   1 
ATOM   3599 O  O   . ALA B 1 133 ? 35.276 -24.202 -44.816 1.00 46.41 ? 136 ALA B O   1 
ATOM   3600 C  CB  . ALA B 1 133 ? 38.097 -25.502 -44.410 1.00 48.42 ? 136 ALA B CB  1 
ATOM   3601 N  N   . ILE B 1 134 ? 36.375 -22.880 -43.369 1.00 49.88 ? 137 ILE B N   1 
ATOM   3602 C  CA  . ILE B 1 134 ? 35.749 -21.652 -43.842 1.00 51.90 ? 137 ILE B CA  1 
ATOM   3603 C  C   . ILE B 1 134 ? 36.586 -21.054 -44.968 1.00 53.14 ? 137 ILE B C   1 
ATOM   3604 O  O   . ILE B 1 134 ? 37.816 -21.050 -44.903 1.00 53.65 ? 137 ILE B O   1 
ATOM   3605 C  CB  . ILE B 1 134 ? 35.617 -20.623 -42.702 1.00 50.49 ? 137 ILE B CB  1 
ATOM   3606 C  CG1 . ILE B 1 134 ? 34.705 -21.180 -41.615 1.00 49.29 ? 137 ILE B CG1 1 
ATOM   3607 C  CG2 . ILE B 1 134 ? 35.036 -19.322 -43.232 1.00 51.86 ? 137 ILE B CG2 1 
ATOM   3608 C  CD1 . ILE B 1 134 ? 33.322 -21.477 -42.108 1.00 47.66 ? 137 ILE B CD1 1 
ATOM   3609 N  N   . GLY B 1 135 ? 35.918 -20.556 -46.003 1.00 54.88 ? 138 GLY B N   1 
ATOM   3610 C  CA  . GLY B 1 135 ? 36.639 -20.056 -47.161 1.00 56.98 ? 138 GLY B CA  1 
ATOM   3611 C  C   . GLY B 1 135 ? 37.304 -21.188 -47.922 1.00 58.58 ? 138 GLY B C   1 
ATOM   3612 O  O   . GLY B 1 135 ? 38.063 -20.959 -48.864 1.00 58.72 ? 138 GLY B O   1 
ATOM   3613 N  N   . ARG B 1 136 ? 37.024 -22.417 -47.498 1.00 59.72 ? 139 ARG B N   1 
ATOM   3614 C  CA  . ARG B 1 136 ? 37.517 -23.609 -48.179 1.00 60.91 ? 139 ARG B CA  1 
ATOM   3615 C  C   . ARG B 1 136 ? 39.045 -23.703 -48.182 1.00 59.57 ? 139 ARG B C   1 
ATOM   3616 O  O   . ARG B 1 136 ? 39.638 -24.366 -49.037 1.00 58.86 ? 139 ARG B O   1 
ATOM   3617 C  CB  . ARG B 1 136 ? 36.984 -23.647 -49.613 1.00 63.46 ? 139 ARG B CB  1 
ATOM   3618 C  CG  . ARG B 1 136 ? 37.164 -24.987 -50.302 1.00 67.02 ? 139 ARG B CG  1 
ATOM   3619 C  CD  . ARG B 1 136 ? 36.251 -25.110 -51.508 1.00 70.44 ? 139 ARG B CD  1 
ATOM   3620 N  NE  . ARG B 1 136 ? 36.391 -23.983 -52.429 1.00 71.65 ? 139 ARG B NE  1 
ATOM   3621 C  CZ  . ARG B 1 136 ? 35.903 -23.969 -53.666 1.00 73.64 ? 139 ARG B CZ  1 
ATOM   3622 N  NH1 . ARG B 1 136 ? 35.244 -25.025 -54.133 1.00 73.66 ? 139 ARG B NH1 1 
ATOM   3623 N  NH2 . ARG B 1 136 ? 36.068 -22.900 -54.436 1.00 74.58 ? 139 ARG B NH2 1 
ATOM   3624 N  N   . VAL B 1 137 ? 39.681 -23.043 -47.221 1.00 57.56 ? 140 VAL B N   1 
ATOM   3625 C  CA  . VAL B 1 137 ? 41.119 -23.188 -47.033 1.00 56.41 ? 140 VAL B CA  1 
ATOM   3626 C  C   . VAL B 1 137 ? 41.466 -24.649 -46.735 1.00 55.01 ? 140 VAL B C   1 
ATOM   3627 O  O   . VAL B 1 137 ? 40.779 -25.317 -45.963 1.00 55.51 ? 140 VAL B O   1 
ATOM   3628 C  CB  . VAL B 1 137 ? 41.623 -22.310 -45.860 1.00 56.69 ? 140 VAL B CB  1 
ATOM   3629 C  CG1 . VAL B 1 137 ? 43.118 -22.519 -45.657 1.00 56.56 ? 140 VAL B CG1 1 
ATOM   3630 C  CG2 . VAL B 1 137 ? 41.325 -20.841 -46.139 1.00 57.07 ? 140 VAL B CG2 1 
ATOM   3631 N  N   . THR B 1 138 ? 42.532 -25.144 -47.350 1.00 52.86 ? 141 THR B N   1 
ATOM   3632 C  CA  . THR B 1 138 ? 42.981 -26.500 -47.080 1.00 51.57 ? 141 THR B CA  1 
ATOM   3633 C  C   . THR B 1 138 ? 43.471 -26.603 -45.641 1.00 49.98 ? 141 THR B C   1 
ATOM   3634 O  O   . THR B 1 138 ? 44.337 -25.837 -45.212 1.00 49.91 ? 141 THR B O   1 
ATOM   3635 C  CB  . THR B 1 138 ? 44.122 -26.906 -48.023 1.00 52.72 ? 141 THR B CB  1 
ATOM   3636 O  OG1 . THR B 1 138 ? 43.646 -26.897 -49.374 1.00 54.11 ? 141 THR B OG1 1 
ATOM   3637 C  CG2 . THR B 1 138 ? 44.635 -28.295 -47.674 1.00 52.52 ? 141 THR B CG2 1 
ATOM   3638 N  N   . PRO B 1 139 ? 42.909 -27.549 -44.872 1.00 47.29 ? 142 PRO B N   1 
ATOM   3639 C  CA  . PRO B 1 139 ? 43.291 -27.740 -43.470 1.00 44.18 ? 142 PRO B CA  1 
ATOM   3640 C  C   . PRO B 1 139 ? 44.736 -28.194 -43.376 1.00 42.27 ? 142 PRO B C   1 
ATOM   3641 O  O   . PRO B 1 139 ? 45.247 -28.854 -44.278 1.00 42.91 ? 142 PRO B O   1 
ATOM   3642 C  CB  . PRO B 1 139 ? 42.322 -28.812 -42.972 1.00 45.83 ? 142 PRO B CB  1 
ATOM   3643 C  CG  . PRO B 1 139 ? 41.177 -28.770 -43.929 1.00 45.24 ? 142 PRO B CG  1 
ATOM   3644 C  CD  . PRO B 1 139 ? 41.789 -28.424 -45.254 1.00 46.99 ? 142 PRO B CD  1 
ATOM   3645 N  N   . ILE B 1 140 ? 45.393 -27.844 -42.280 1.00 40.19 ? 143 ILE B N   1 
ATOM   3646 C  CA  . ILE B 1 140 ? 46.818 -28.084 -42.152 1.00 39.05 ? 143 ILE B CA  1 
ATOM   3647 C  C   . ILE B 1 140 ? 47.152 -29.575 -42.271 1.00 39.42 ? 143 ILE B C   1 
ATOM   3648 O  O   . ILE B 1 140 ? 48.223 -29.937 -42.765 1.00 38.09 ? 143 ILE B O   1 
ATOM   3649 C  CB  . ILE B 1 140 ? 47.353 -27.534 -40.804 1.00 38.27 ? 143 ILE B CB  1 
ATOM   3650 C  CG1 . ILE B 1 140 ? 48.882 -27.570 -40.790 1.00 38.46 ? 143 ILE B CG1 1 
ATOM   3651 C  CG2 . ILE B 1 140 ? 46.812 -28.364 -39.645 1.00 37.08 ? 143 ILE B CG2 1 
ATOM   3652 C  CD1 . ILE B 1 140 ? 49.497 -27.013 -39.516 1.00 38.78 ? 143 ILE B CD1 1 
ATOM   3653 N  N   . PHE B 1 141 ? 46.242 -30.445 -41.835 1.00 38.93 ? 144 PHE B N   1 
ATOM   3654 C  CA  . PHE B 1 141 ? 46.544 -31.874 -41.838 1.00 39.88 ? 144 PHE B CA  1 
ATOM   3655 C  C   . PHE B 1 141 ? 46.395 -32.490 -43.224 1.00 41.34 ? 144 PHE B C   1 
ATOM   3656 O  O   . PHE B 1 141 ? 47.101 -33.436 -43.562 1.00 41.80 ? 144 PHE B O   1 
ATOM   3657 C  CB  . PHE B 1 141 ? 45.660 -32.632 -40.848 1.00 38.21 ? 144 PHE B CB  1 
ATOM   3658 C  CG  . PHE B 1 141 ? 46.203 -33.990 -40.478 1.00 34.87 ? 144 PHE B CG  1 
ATOM   3659 C  CD1 . PHE B 1 141 ? 47.222 -34.112 -39.546 1.00 34.71 ? 144 PHE B CD1 1 
ATOM   3660 C  CD2 . PHE B 1 141 ? 45.701 -35.140 -41.063 1.00 34.07 ? 144 PHE B CD2 1 
ATOM   3661 C  CE1 . PHE B 1 141 ? 47.728 -35.357 -39.206 1.00 37.30 ? 144 PHE B CE1 1 
ATOM   3662 C  CE2 . PHE B 1 141 ? 46.202 -36.385 -40.728 1.00 34.12 ? 144 PHE B CE2 1 
ATOM   3663 C  CZ  . PHE B 1 141 ? 47.214 -36.498 -39.801 1.00 34.14 ? 144 PHE B CZ  1 
ATOM   3664 N  N   . ASP B 1 142 ? 45.486 -31.953 -44.029 1.00 43.46 ? 145 ASP B N   1 
ATOM   3665 C  CA  . ASP B 1 142 ? 45.397 -32.357 -45.428 1.00 46.17 ? 145 ASP B CA  1 
ATOM   3666 C  C   . ASP B 1 142 ? 46.701 -32.046 -46.167 1.00 46.83 ? 145 ASP B C   1 
ATOM   3667 O  O   . ASP B 1 142 ? 47.110 -32.792 -47.058 1.00 47.27 ? 145 ASP B O   1 
ATOM   3668 C  CB  . ASP B 1 142 ? 44.227 -31.650 -46.122 1.00 46.94 ? 145 ASP B CB  1 
ATOM   3669 C  CG  . ASP B 1 142 ? 42.879 -32.213 -45.712 1.00 50.14 ? 145 ASP B CG  1 
ATOM   3670 O  OD1 . ASP B 1 142 ? 42.727 -32.615 -44.539 1.00 49.14 ? 145 ASP B OD1 1 
ATOM   3671 O  OD2 . ASP B 1 142 ? 41.966 -32.255 -46.566 1.00 52.72 ? 145 ASP B OD2 1 
ATOM   3672 N  N   . ASN B 1 143 ? 47.357 -30.951 -45.795 1.00 46.18 ? 146 ASN B N   1 
ATOM   3673 C  CA  . ASN B 1 143 ? 48.613 -30.581 -46.434 1.00 46.26 ? 146 ASN B CA  1 
ATOM   3674 C  C   . ASN B 1 143 ? 49.772 -31.410 -45.905 1.00 47.35 ? 146 ASN B C   1 
ATOM   3675 O  O   . ASN B 1 143 ? 50.699 -31.741 -46.648 1.00 46.73 ? 146 ASN B O   1 
ATOM   3676 C  CB  . ASN B 1 143 ? 48.911 -29.099 -46.219 1.00 45.96 ? 146 ASN B CB  1 
ATOM   3677 C  CG  . ASN B 1 143 ? 48.159 -28.213 -47.184 1.00 45.81 ? 146 ASN B CG  1 
ATOM   3678 O  OD1 . ASN B 1 143 ? 47.664 -28.678 -48.207 1.00 45.12 ? 146 ASN B OD1 1 
ATOM   3679 N  ND2 . ASN B 1 143 ? 48.067 -26.926 -46.863 1.00 46.48 ? 146 ASN B ND2 1 
ATOM   3680 N  N   . ILE B 1 144 ? 49.728 -31.746 -44.621 1.00 47.09 ? 147 ILE B N   1 
ATOM   3681 C  CA  . ILE B 1 144 ? 50.757 -32.602 -44.055 1.00 46.68 ? 147 ILE B CA  1 
ATOM   3682 C  C   . ILE B 1 144 ? 50.687 -33.975 -44.706 1.00 47.86 ? 147 ILE B C   1 
ATOM   3683 O  O   . ILE B 1 144 ? 51.714 -34.609 -44.964 1.00 48.51 ? 147 ILE B O   1 
ATOM   3684 C  CB  . ILE B 1 144 ? 50.593 -32.744 -42.534 1.00 46.37 ? 147 ILE B CB  1 
ATOM   3685 C  CG1 . ILE B 1 144 ? 50.973 -31.425 -41.851 1.00 47.26 ? 147 ILE B CG1 1 
ATOM   3686 C  CG2 . ILE B 1 144 ? 51.448 -33.887 -42.022 1.00 45.21 ? 147 ILE B CG2 1 
ATOM   3687 C  CD1 . ILE B 1 144 ? 50.890 -31.460 -40.338 1.00 44.11 ? 147 ILE B CD1 1 
ATOM   3688 N  N   . ILE B 1 145 ? 49.470 -34.427 -44.986 1.00 48.45 ? 148 ILE B N   1 
ATOM   3689 C  CA  . ILE B 1 145 ? 49.274 -35.690 -45.682 1.00 48.74 ? 148 ILE B CA  1 
ATOM   3690 C  C   . ILE B 1 145 ? 49.926 -35.643 -47.061 1.00 49.70 ? 148 ILE B C   1 
ATOM   3691 O  O   . ILE B 1 145 ? 50.589 -36.595 -47.470 1.00 47.86 ? 148 ILE B O   1 
ATOM   3692 C  CB  . ILE B 1 145 ? 47.765 -36.014 -45.827 1.00 49.38 ? 148 ILE B CB  1 
ATOM   3693 C  CG1 . ILE B 1 145 ? 47.188 -36.389 -44.456 1.00 47.54 ? 148 ILE B CG1 1 
ATOM   3694 C  CG2 . ILE B 1 145 ? 47.556 -37.126 -46.849 1.00 45.98 ? 148 ILE B CG2 1 
ATOM   3695 C  CD1 . ILE B 1 145 ? 45.734 -36.807 -44.488 1.00 48.35 ? 148 ILE B CD1 1 
ATOM   3696 N  N   . SER B 1 146 ? 49.753 -34.521 -47.758 1.00 50.44 ? 149 SER B N   1 
ATOM   3697 C  CA  . SER B 1 146 ? 50.304 -34.342 -49.100 1.00 51.62 ? 149 SER B CA  1 
ATOM   3698 C  C   . SER B 1 146 ? 51.825 -34.476 -49.167 1.00 50.64 ? 149 SER B C   1 
ATOM   3699 O  O   . SER B 1 146 ? 52.369 -34.851 -50.203 1.00 51.56 ? 149 SER B O   1 
ATOM   3700 C  CB  . SER B 1 146 ? 49.899 -32.976 -49.663 1.00 51.76 ? 149 SER B CB  1 
ATOM   3701 O  OG  . SER B 1 146 ? 48.496 -32.891 -49.828 1.00 52.72 ? 149 SER B OG  1 
ATOM   3702 N  N   . GLN B 1 147 ? 52.513 -34.169 -48.072 1.00 49.75 ? 150 GLN B N   1 
ATOM   3703 C  CA  . GLN B 1 147 ? 53.967 -34.283 -48.051 1.00 49.49 ? 150 GLN B CA  1 
ATOM   3704 C  C   . GLN B 1 147 ? 54.421 -35.741 -48.056 1.00 49.17 ? 150 GLN B C   1 
ATOM   3705 O  O   . GLN B 1 147 ? 55.602 -36.031 -48.254 1.00 49.91 ? 150 GLN B O   1 
ATOM   3706 C  CB  . GLN B 1 147 ? 54.544 -33.563 -46.826 1.00 49.31 ? 150 GLN B CB  1 
ATOM   3707 C  CG  . GLN B 1 147 ? 54.263 -32.069 -46.818 1.00 50.11 ? 150 GLN B CG  1 
ATOM   3708 C  CD  . GLN B 1 147 ? 55.096 -31.307 -45.803 1.00 50.57 ? 150 GLN B CD  1 
ATOM   3709 O  OE1 . GLN B 1 147 ? 55.070 -30.075 -45.768 1.00 51.45 ? 150 GLN B OE1 1 
ATOM   3710 N  NE2 . GLN B 1 147 ? 55.841 -32.032 -44.974 1.00 50.72 ? 150 GLN B NE2 1 
ATOM   3711 N  N   . GLY B 1 148 ? 53.480 -36.653 -47.833 1.00 48.00 ? 151 GLY B N   1 
ATOM   3712 C  CA  . GLY B 1 148 ? 53.806 -38.067 -47.816 1.00 45.73 ? 151 GLY B CA  1 
ATOM   3713 C  C   . GLY B 1 148 ? 54.868 -38.457 -46.802 1.00 45.80 ? 151 GLY B C   1 
ATOM   3714 O  O   . GLY B 1 148 ? 55.628 -39.401 -47.030 1.00 44.19 ? 151 GLY B O   1 
ATOM   3715 N  N   . VAL B 1 149 ? 54.926 -37.748 -45.678 1.00 44.42 ? 152 VAL B N   1 
ATOM   3716 C  CA  . VAL B 1 149 ? 55.946 -38.022 -44.670 1.00 44.75 ? 152 VAL B CA  1 
ATOM   3717 C  C   . VAL B 1 149 ? 55.451 -38.902 -43.524 1.00 44.09 ? 152 VAL B C   1 
ATOM   3718 O  O   . VAL B 1 149 ? 56.210 -39.695 -42.966 1.00 43.87 ? 152 VAL B O   1 
ATOM   3719 C  CB  . VAL B 1 149 ? 56.499 -36.718 -44.068 1.00 45.38 ? 152 VAL B CB  1 
ATOM   3720 C  CG1 . VAL B 1 149 ? 57.066 -35.842 -45.167 1.00 46.54 ? 152 VAL B CG1 1 
ATOM   3721 C  CG2 . VAL B 1 149 ? 55.400 -35.987 -43.311 1.00 48.43 ? 152 VAL B CG2 1 
ATOM   3722 N  N   . LEU B 1 150 ? 54.178 -38.763 -43.175 1.00 43.12 ? 153 LEU B N   1 
ATOM   3723 C  CA  . LEU B 1 150 ? 53.632 -39.437 -42.004 1.00 41.96 ? 153 LEU B CA  1 
ATOM   3724 C  C   . LEU B 1 150 ? 53.723 -40.954 -42.128 1.00 40.92 ? 153 LEU B C   1 
ATOM   3725 O  O   . LEU B 1 150 ? 53.467 -41.515 -43.189 1.00 40.50 ? 153 LEU B O   1 
ATOM   3726 C  CB  . LEU B 1 150 ? 52.168 -39.039 -41.808 1.00 42.42 ? 153 LEU B CB  1 
ATOM   3727 C  CG  . LEU B 1 150 ? 51.857 -37.549 -41.665 1.00 42.51 ? 153 LEU B CG  1 
ATOM   3728 C  CD1 . LEU B 1 150 ? 50.355 -37.336 -41.771 1.00 42.19 ? 153 LEU B CD1 1 
ATOM   3729 C  CD2 . LEU B 1 150 ? 52.387 -37.030 -40.343 1.00 41.00 ? 153 LEU B CD2 1 
ATOM   3730 N  N   . LYS B 1 151 ? 54.077 -41.615 -41.033 1.00 39.90 ? 154 LYS B N   1 
ATOM   3731 C  CA  . LYS B 1 151 ? 54.041 -43.072 -40.983 1.00 40.15 ? 154 LYS B CA  1 
ATOM   3732 C  C   . LYS B 1 151 ? 52.630 -43.586 -41.280 1.00 40.49 ? 154 LYS B C   1 
ATOM   3733 O  O   . LYS B 1 151 ? 52.457 -44.551 -42.027 1.00 39.13 ? 154 LYS B O   1 
ATOM   3734 C  CB  . LYS B 1 151 ? 54.492 -43.561 -39.606 1.00 39.69 ? 154 LYS B CB  1 
ATOM   3735 C  CG  . LYS B 1 151 ? 54.325 -45.057 -39.396 1.00 43.21 ? 154 LYS B CG  1 
ATOM   3736 C  CD  . LYS B 1 151 ? 54.994 -45.528 -38.110 1.00 44.99 ? 154 LYS B CD  1 
ATOM   3737 C  CE  . LYS B 1 151 ? 54.522 -46.929 -37.727 1.00 48.28 ? 154 LYS B CE  1 
ATOM   3738 N  NZ  . LYS B 1 151 ? 55.356 -47.542 -36.644 1.00 49.27 ? 154 LYS B NZ  1 
ATOM   3739 N  N   . GLU B 1 152 ? 51.629 -42.940 -40.685 1.00 39.65 ? 155 GLU B N   1 
ATOM   3740 C  CA  . GLU B 1 152 ? 50.228 -43.212 -40.999 1.00 38.03 ? 155 GLU B CA  1 
ATOM   3741 C  C   . GLU B 1 152 ? 49.429 -41.917 -40.945 1.00 36.61 ? 155 GLU B C   1 
ATOM   3742 O  O   . GLU B 1 152 ? 49.751 -41.008 -40.174 1.00 35.14 ? 155 GLU B O   1 
ATOM   3743 C  CB  . GLU B 1 152 ? 49.637 -44.216 -40.007 1.00 39.19 ? 155 GLU B CB  1 
ATOM   3744 C  CG  . GLU B 1 152 ? 50.232 -45.607 -40.094 1.00 43.58 ? 155 GLU B CG  1 
ATOM   3745 C  CD  . GLU B 1 152 ? 50.034 -46.239 -41.461 1.00 48.07 ? 155 GLU B CD  1 
ATOM   3746 O  OE1 . GLU B 1 152 ? 50.603 -47.326 -41.710 1.00 49.06 ? 155 GLU B OE1 1 
ATOM   3747 O  OE2 . GLU B 1 152 ? 49.308 -45.646 -42.287 1.00 50.14 ? 155 GLU B OE2 1 
ATOM   3748 N  N   . ASP B 1 153 ? 48.388 -41.835 -41.764 1.00 34.13 ? 156 ASP B N   1 
ATOM   3749 C  CA  . ASP B 1 153 ? 47.566 -40.637 -41.822 1.00 34.68 ? 156 ASP B CA  1 
ATOM   3750 C  C   . ASP B 1 153 ? 46.620 -40.568 -40.633 1.00 34.37 ? 156 ASP B C   1 
ATOM   3751 O  O   . ASP B 1 153 ? 45.408 -40.460 -40.802 1.00 32.12 ? 156 ASP B O   1 
ATOM   3752 C  CB  . ASP B 1 153 ? 46.756 -40.608 -43.116 1.00 36.47 ? 156 ASP B CB  1 
ATOM   3753 C  CG  . ASP B 1 153 ? 47.620 -40.398 -44.340 1.00 36.45 ? 156 ASP B CG  1 
ATOM   3754 O  OD1 . ASP B 1 153 ? 48.751 -39.886 -44.179 1.00 33.30 ? 156 ASP B OD1 1 
ATOM   3755 O  OD2 . ASP B 1 153 ? 47.162 -40.742 -45.457 1.00 34.35 ? 156 ASP B OD2 1 
ATOM   3756 N  N   . VAL B 1 154 ? 47.183 -40.644 -39.432 1.00 35.10 ? 157 VAL B N   1 
ATOM   3757 C  CA  . VAL B 1 154 ? 46.421 -40.406 -38.216 1.00 34.89 ? 157 VAL B CA  1 
ATOM   3758 C  C   . VAL B 1 154 ? 47.075 -39.288 -37.414 1.00 34.83 ? 157 VAL B C   1 
ATOM   3759 O  O   . VAL B 1 154 ? 48.197 -38.865 -37.706 1.00 34.69 ? 157 VAL B O   1 
ATOM   3760 C  CB  . VAL B 1 154 ? 46.382 -41.653 -37.323 1.00 35.36 ? 157 VAL B CB  1 
ATOM   3761 C  CG1 . VAL B 1 154 ? 45.935 -42.862 -38.130 1.00 35.83 ? 157 VAL B CG1 1 
ATOM   3762 C  CG2 . VAL B 1 154 ? 47.748 -41.880 -36.706 1.00 35.68 ? 157 VAL B CG2 1 
ATOM   3763 N  N   . PHE B 1 155 ? 46.359 -38.807 -36.407 1.00 34.65 ? 158 PHE B N   1 
ATOM   3764 C  CA  . PHE B 1 155 ? 46.981 -38.078 -35.316 1.00 31.78 ? 158 PHE B CA  1 
ATOM   3765 C  C   . PHE B 1 155 ? 46.306 -38.477 -34.016 1.00 32.14 ? 158 PHE B C   1 
ATOM   3766 O  O   . PHE B 1 155 ? 45.211 -39.037 -34.025 1.00 30.34 ? 158 PHE B O   1 
ATOM   3767 C  CB  . PHE B 1 155 ? 46.873 -36.571 -35.549 1.00 32.19 ? 158 PHE B CB  1 
ATOM   3768 C  CG  . PHE B 1 155 ? 45.484 -36.095 -35.842 1.00 30.22 ? 158 PHE B CG  1 
ATOM   3769 C  CD1 . PHE B 1 155 ? 44.650 -35.669 -34.815 1.00 28.53 ? 158 PHE B CD1 1 
ATOM   3770 C  CD2 . PHE B 1 155 ? 45.020 -36.037 -37.143 1.00 28.83 ? 158 PHE B CD2 1 
ATOM   3771 C  CE1 . PHE B 1 155 ? 43.383 -35.192 -35.087 1.00 26.31 ? 158 PHE B CE1 1 
ATOM   3772 C  CE2 . PHE B 1 155 ? 43.755 -35.561 -37.421 1.00 26.48 ? 158 PHE B CE2 1 
ATOM   3773 C  CZ  . PHE B 1 155 ? 42.933 -35.136 -36.388 1.00 26.73 ? 158 PHE B CZ  1 
ATOM   3774 N  N   . SER B 1 156 ? 46.968 -38.195 -32.900 1.00 30.29 ? 159 SER B N   1 
ATOM   3775 C  CA  . SER B 1 156 ? 46.575 -38.754 -31.615 1.00 31.15 ? 159 SER B CA  1 
ATOM   3776 C  C   . SER B 1 156 ? 46.562 -37.690 -30.517 1.00 30.13 ? 159 SER B C   1 
ATOM   3777 O  O   . SER B 1 156 ? 47.358 -36.748 -30.548 1.00 29.87 ? 159 SER B O   1 
ATOM   3778 C  CB  . SER B 1 156 ? 47.547 -39.869 -31.230 1.00 30.18 ? 159 SER B CB  1 
ATOM   3779 O  OG  . SER B 1 156 ? 46.839 -41.056 -30.945 1.00 37.03 ? 159 SER B OG  1 
ATOM   3780 N  N   . PHE B 1 157 ? 45.667 -37.848 -29.546 1.00 28.45 ? 160 PHE B N   1 
ATOM   3781 C  CA  . PHE B 1 157 ? 45.592 -36.916 -28.420 1.00 29.27 ? 160 PHE B CA  1 
ATOM   3782 C  C   . PHE B 1 157 ? 45.703 -37.607 -27.068 1.00 28.99 ? 160 PHE B C   1 
ATOM   3783 O  O   . PHE B 1 157 ? 44.924 -38.509 -26.756 1.00 28.78 ? 160 PHE B O   1 
ATOM   3784 C  CB  . PHE B 1 157 ? 44.281 -36.131 -28.462 1.00 29.76 ? 160 PHE B CB  1 
ATOM   3785 C  CG  . PHE B 1 157 ? 44.319 -34.936 -29.363 1.00 28.27 ? 160 PHE B CG  1 
ATOM   3786 C  CD1 . PHE B 1 157 ? 44.283 -35.086 -30.736 1.00 28.16 ? 160 PHE B CD1 1 
ATOM   3787 C  CD2 . PHE B 1 157 ? 44.372 -33.659 -28.832 1.00 28.95 ? 160 PHE B CD2 1 
ATOM   3788 C  CE1 . PHE B 1 157 ? 44.299 -33.984 -31.566 1.00 29.64 ? 160 PHE B CE1 1 
ATOM   3789 C  CE2 . PHE B 1 157 ? 44.388 -32.551 -29.654 1.00 28.07 ? 160 PHE B CE2 1 
ATOM   3790 C  CZ  . PHE B 1 157 ? 44.351 -32.713 -31.025 1.00 29.51 ? 160 PHE B CZ  1 
ATOM   3791 N  N   . TYR B 1 158 ? 46.680 -37.176 -26.273 1.00 27.11 ? 161 TYR B N   1 
ATOM   3792 C  CA  . TYR B 1 158 ? 46.699 -37.460 -24.843 1.00 28.38 ? 161 TYR B CA  1 
ATOM   3793 C  C   . TYR B 1 158 ? 46.466 -36.179 -24.032 1.00 27.14 ? 161 TYR B C   1 
ATOM   3794 O  O   . TYR B 1 158 ? 47.101 -35.163 -24.278 1.00 28.08 ? 161 TYR B O   1 
ATOM   3795 C  CB  . TYR B 1 158 ? 48.038 -38.091 -24.454 1.00 27.82 ? 161 TYR B CB  1 
ATOM   3796 C  CG  . TYR B 1 158 ? 48.260 -38.206 -22.963 1.00 29.22 ? 161 TYR B CG  1 
ATOM   3797 C  CD1 . TYR B 1 158 ? 47.444 -39.011 -22.178 1.00 30.96 ? 161 TYR B CD1 1 
ATOM   3798 C  CD2 . TYR B 1 158 ? 49.290 -37.513 -22.342 1.00 31.87 ? 161 TYR B CD2 1 
ATOM   3799 C  CE1 . TYR B 1 158 ? 47.648 -39.123 -20.818 1.00 31.43 ? 161 TYR B CE1 1 
ATOM   3800 C  CE2 . TYR B 1 158 ? 49.506 -37.621 -20.981 1.00 33.12 ? 161 TYR B CE2 1 
ATOM   3801 C  CZ  . TYR B 1 158 ? 48.684 -38.428 -20.225 1.00 34.47 ? 161 TYR B CZ  1 
ATOM   3802 O  OH  . TYR B 1 158 ? 48.916 -38.557 -18.875 1.00 36.86 ? 161 TYR B OH  1 
ATOM   3803 N  N   . TYR B 1 159 ? 45.543 -36.227 -23.076 1.00 27.20 ? 162 TYR B N   1 
ATOM   3804 C  CA  . TYR B 1 159 ? 45.334 -35.109 -22.153 1.00 27.88 ? 162 TYR B CA  1 
ATOM   3805 C  C   . TYR B 1 159 ? 45.561 -35.601 -20.727 1.00 28.73 ? 162 TYR B C   1 
ATOM   3806 O  O   . TYR B 1 159 ? 44.842 -36.480 -20.253 1.00 26.84 ? 162 TYR B O   1 
ATOM   3807 C  CB  . TYR B 1 159 ? 43.902 -34.560 -22.260 1.00 26.02 ? 162 TYR B CB  1 
ATOM   3808 C  CG  . TYR B 1 159 ? 43.633 -33.635 -23.429 1.00 23.54 ? 162 TYR B CG  1 
ATOM   3809 C  CD1 . TYR B 1 159 ? 44.670 -33.114 -24.194 1.00 24.89 ? 162 TYR B CD1 1 
ATOM   3810 C  CD2 . TYR B 1 159 ? 42.337 -33.255 -23.745 1.00 22.80 ? 162 TYR B CD2 1 
ATOM   3811 C  CE1 . TYR B 1 159 ? 44.421 -32.240 -25.238 1.00 20.79 ? 162 TYR B CE1 1 
ATOM   3812 C  CE2 . TYR B 1 159 ? 42.079 -32.381 -24.783 1.00 21.91 ? 162 TYR B CE2 1 
ATOM   3813 C  CZ  . TYR B 1 159 ? 43.126 -31.876 -25.526 1.00 22.22 ? 162 TYR B CZ  1 
ATOM   3814 O  OH  . TYR B 1 159 ? 42.868 -30.993 -26.545 1.00 24.78 ? 162 TYR B OH  1 
ATOM   3815 N  N   . ASN B 1 160 ? 46.554 -35.026 -20.050 1.00 30.54 ? 163 ASN B N   1 
ATOM   3816 C  CA  . ASN B 1 160 ? 46.862 -35.384 -18.667 1.00 33.64 ? 163 ASN B CA  1 
ATOM   3817 C  C   . ASN B 1 160 ? 45.952 -34.616 -17.709 1.00 36.07 ? 163 ASN B C   1 
ATOM   3818 O  O   . ASN B 1 160 ? 45.255 -33.689 -18.119 1.00 35.56 ? 163 ASN B O   1 
ATOM   3819 C  CB  . ASN B 1 160 ? 48.333 -35.058 -18.352 1.00 31.71 ? 163 ASN B CB  1 
ATOM   3820 C  CG  . ASN B 1 160 ? 48.846 -35.775 -17.108 1.00 30.59 ? 163 ASN B CG  1 
ATOM   3821 O  OD1 . ASN B 1 160 ? 48.111 -36.517 -16.453 1.00 28.66 ? 163 ASN B OD1 1 
ATOM   3822 N  ND2 . ASN B 1 160 ? 50.117 -35.555 -16.779 1.00 25.84 ? 163 ASN B ND2 1 
ATOM   3823 N  N   . ARG B 1 161 ? 45.954 -35.025 -16.440 1.00 40.27 ? 164 ARG B N   1 
ATOM   3824 C  CA  . ARG B 1 161 ? 45.373 -34.235 -15.354 1.00 45.21 ? 164 ARG B CA  1 
ATOM   3825 C  C   . ARG B 1 161 ? 46.542 -33.671 -14.542 1.00 47.67 ? 164 ARG B C   1 
ATOM   3826 O  O   . ARG B 1 161 ? 47.427 -34.421 -14.135 1.00 48.52 ? 164 ARG B O   1 
ATOM   3827 C  CB  . ARG B 1 161 ? 44.516 -35.126 -14.447 1.00 46.06 ? 164 ARG B CB  1 
ATOM   3828 C  CG  . ARG B 1 161 ? 43.668 -36.161 -15.184 1.00 49.58 ? 164 ARG B CG  1 
ATOM   3829 C  CD  . ARG B 1 161 ? 43.107 -37.212 -14.220 1.00 51.69 ? 164 ARG B CD  1 
ATOM   3830 N  NE  . ARG B 1 161 ? 42.343 -38.250 -14.908 1.00 51.98 ? 164 ARG B NE  1 
ATOM   3831 C  CZ  . ARG B 1 161 ? 42.819 -39.455 -15.210 1.00 54.21 ? 164 ARG B CZ  1 
ATOM   3832 N  NH1 . ARG B 1 161 ? 44.066 -39.775 -14.880 1.00 53.53 ? 164 ARG B NH1 1 
ATOM   3833 N  NH2 . ARG B 1 161 ? 42.054 -40.341 -15.844 1.00 51.36 ? 164 ARG B NH2 1 
ATOM   3834 N  N   . ASP B 1 162 ? 46.560 -32.362 -14.305 1.00 50.57 ? 165 ASP B N   1 
ATOM   3835 C  CA  . ASP B 1 162 ? 47.653 -31.767 -13.533 1.00 52.70 ? 165 ASP B CA  1 
ATOM   3836 C  C   . ASP B 1 162 ? 47.269 -31.605 -12.070 1.00 53.15 ? 165 ASP B C   1 
ATOM   3837 O  O   . ASP B 1 162 ? 46.904 -32.575 -11.405 1.00 52.95 ? 165 ASP B O   1 
ATOM   3838 C  CB  . ASP B 1 162 ? 48.053 -30.407 -14.111 1.00 54.28 ? 165 ASP B CB  1 
ATOM   3839 C  CG  . ASP B 1 162 ? 46.934 -29.392 -14.034 1.00 56.28 ? 165 ASP B CG  1 
ATOM   3840 O  OD1 . ASP B 1 162 ? 47.220 -28.175 -14.008 1.00 57.59 ? 165 ASP B OD1 1 
ATOM   3841 O  OD2 . ASP B 1 162 ? 45.763 -29.815 -13.999 1.00 58.95 ? 165 ASP B OD2 1 
ATOM   3842 N  N   . SER B 1 168 ? 53.088 -34.739 -15.072 1.00 48.80 ? 171 SER B N   1 
ATOM   3843 C  CA  . SER B 1 168 ? 53.170 -33.286 -15.152 1.00 47.93 ? 171 SER B CA  1 
ATOM   3844 C  C   . SER B 1 168 ? 53.603 -32.821 -16.543 1.00 45.76 ? 171 SER B C   1 
ATOM   3845 O  O   . SER B 1 168 ? 53.888 -31.645 -16.754 1.00 47.03 ? 171 SER B O   1 
ATOM   3846 C  CB  . SER B 1 168 ? 54.137 -32.748 -14.091 1.00 49.46 ? 171 SER B CB  1 
ATOM   3847 O  OG  . SER B 1 168 ? 55.417 -33.349 -14.202 1.00 51.85 ? 171 SER B OG  1 
ATOM   3848 N  N   . LEU B 1 169 ? 53.664 -33.755 -17.486 1.00 43.68 ? 172 LEU B N   1 
ATOM   3849 C  CA  . LEU B 1 169 ? 53.417 -33.425 -18.885 1.00 41.05 ? 172 LEU B CA  1 
ATOM   3850 C  C   . LEU B 1 169 ? 51.928 -33.103 -19.005 1.00 40.02 ? 172 LEU B C   1 
ATOM   3851 O  O   . LEU B 1 169 ? 51.087 -33.876 -18.555 1.00 38.96 ? 172 LEU B O   1 
ATOM   3852 C  CB  . LEU B 1 169 ? 53.752 -34.619 -19.780 1.00 43.34 ? 172 LEU B CB  1 
ATOM   3853 C  CG  . LEU B 1 169 ? 53.086 -34.616 -21.157 1.00 42.91 ? 172 LEU B CG  1 
ATOM   3854 C  CD1 . LEU B 1 169 ? 53.748 -33.576 -22.037 1.00 43.37 ? 172 LEU B CD1 1 
ATOM   3855 C  CD2 . LEU B 1 169 ? 53.188 -35.998 -21.785 1.00 43.62 ? 172 LEU B CD2 1 
ATOM   3856 N  N   . GLY B 1 170 ? 51.600 -31.965 -19.603 1.00 38.15 ? 173 GLY B N   1 
ATOM   3857 C  CA  . GLY B 1 170 ? 50.219 -31.524 -19.602 1.00 36.86 ? 173 GLY B CA  1 
ATOM   3858 C  C   . GLY B 1 170 ? 49.368 -32.284 -20.598 1.00 36.76 ? 173 GLY B C   1 
ATOM   3859 O  O   . GLY B 1 170 ? 48.202 -32.603 -20.330 1.00 34.00 ? 173 GLY B O   1 
ATOM   3860 N  N   . GLY B 1 171 ? 49.966 -32.572 -21.749 1.00 35.05 ? 174 GLY B N   1 
ATOM   3861 C  CA  . GLY B 1 171 ? 49.269 -33.270 -22.811 1.00 35.22 ? 174 GLY B CA  1 
ATOM   3862 C  C   . GLY B 1 171 ? 50.230 -33.578 -23.940 1.00 34.71 ? 174 GLY B C   1 
ATOM   3863 O  O   . GLY B 1 171 ? 51.390 -33.157 -23.910 1.00 34.72 ? 174 GLY B O   1 
ATOM   3864 N  N   . GLN B 1 172 ? 49.759 -34.313 -24.940 1.00 34.72 ? 175 GLN B N   1 
ATOM   3865 C  CA  . GLN B 1 172 ? 50.585 -34.599 -26.107 1.00 33.43 ? 175 GLN B CA  1 
ATOM   3866 C  C   . GLN B 1 172 ? 49.748 -34.936 -27.325 1.00 32.69 ? 175 GLN B C   1 
ATOM   3867 O  O   . GLN B 1 172 ? 48.789 -35.708 -27.245 1.00 33.14 ? 175 GLN B O   1 
ATOM   3868 C  CB  . GLN B 1 172 ? 51.535 -35.759 -25.806 1.00 32.52 ? 175 GLN B CB  1 
ATOM   3869 C  CG  . GLN B 1 172 ? 52.380 -36.186 -26.984 1.00 35.43 ? 175 GLN B CG  1 
ATOM   3870 C  CD  . GLN B 1 172 ? 53.360 -37.276 -26.613 1.00 38.57 ? 175 GLN B CD  1 
ATOM   3871 O  OE1 . GLN B 1 172 ? 53.019 -38.463 -26.610 1.00 38.72 ? 175 GLN B OE1 1 
ATOM   3872 N  NE2 . GLN B 1 172 ? 54.588 -36.881 -26.288 1.00 39.44 ? 175 GLN B NE2 1 
ATOM   3873 N  N   . ILE B 1 173 ? 50.115 -34.347 -28.453 1.00 31.60 ? 176 ILE B N   1 
ATOM   3874 C  CA  . ILE B 1 173 ? 49.571 -34.757 -29.735 1.00 32.19 ? 176 ILE B CA  1 
ATOM   3875 C  C   . ILE B 1 173 ? 50.642 -35.487 -30.525 1.00 32.82 ? 176 ILE B C   1 
ATOM   3876 O  O   . ILE B 1 173 ? 51.800 -35.050 -30.575 1.00 31.07 ? 176 ILE B O   1 
ATOM   3877 C  CB  . ILE B 1 173 ? 49.108 -33.555 -30.564 1.00 33.38 ? 176 ILE B CB  1 
ATOM   3878 C  CG1 . ILE B 1 173 ? 47.978 -32.841 -29.835 1.00 36.75 ? 176 ILE B CG1 1 
ATOM   3879 C  CG2 . ILE B 1 173 ? 48.642 -34.018 -31.944 1.00 32.04 ? 176 ILE B CG2 1 
ATOM   3880 C  CD1 . ILE B 1 173 ? 47.526 -31.604 -30.524 1.00 40.83 ? 176 ILE B CD1 1 
ATOM   3881 N  N   . VAL B 1 174 ? 50.254 -36.600 -31.138 1.00 31.81 ? 177 VAL B N   1 
ATOM   3882 C  CA  . VAL B 1 174 ? 51.131 -37.292 -32.062 1.00 31.66 ? 177 VAL B CA  1 
ATOM   3883 C  C   . VAL B 1 174 ? 50.582 -37.180 -33.468 1.00 32.61 ? 177 VAL B C   1 
ATOM   3884 O  O   . VAL B 1 174 ? 49.414 -37.478 -33.717 1.00 32.42 ? 177 VAL B O   1 
ATOM   3885 C  CB  . VAL B 1 174 ? 51.265 -38.779 -31.711 1.00 32.45 ? 177 VAL B CB  1 
ATOM   3886 C  CG1 . VAL B 1 174 ? 52.153 -39.469 -32.741 1.00 29.38 ? 177 VAL B CG1 1 
ATOM   3887 C  CG2 . VAL B 1 174 ? 51.853 -38.933 -30.313 1.00 29.57 ? 177 VAL B CG2 1 
ATOM   3888 N  N   . LEU B 1 175 ? 51.430 -36.739 -34.387 1.00 33.51 ? 178 LEU B N   1 
ATOM   3889 C  CA  . LEU B 1 175 ? 51.081 -36.751 -35.801 1.00 34.47 ? 178 LEU B CA  1 
ATOM   3890 C  C   . LEU B 1 175 ? 51.725 -37.954 -36.481 1.00 33.77 ? 178 LEU B C   1 
ATOM   3891 O  O   . LEU B 1 175 ? 52.948 -38.105 -36.463 1.00 34.00 ? 178 LEU B O   1 
ATOM   3892 C  CB  . LEU B 1 175 ? 51.556 -35.471 -36.479 1.00 33.28 ? 178 LEU B CB  1 
ATOM   3893 C  CG  . LEU B 1 175 ? 50.950 -34.170 -35.959 1.00 36.05 ? 178 LEU B CG  1 
ATOM   3894 C  CD1 . LEU B 1 175 ? 51.252 -33.055 -36.953 1.00 33.31 ? 178 LEU B CD1 1 
ATOM   3895 C  CD2 . LEU B 1 175 ? 49.450 -34.328 -35.770 1.00 32.80 ? 178 LEU B CD2 1 
ATOM   3896 N  N   . GLY B 1 176 ? 50.899 -38.803 -37.080 1.00 31.86 ? 179 GLY B N   1 
ATOM   3897 C  CA  . GLY B 1 176 ? 51.422 -39.950 -37.793 1.00 32.59 ? 179 GLY B CA  1 
ATOM   3898 C  C   . GLY B 1 176 ? 51.253 -41.256 -37.045 1.00 33.27 ? 179 GLY B C   1 
ATOM   3899 O  O   . GLY B 1 176 ? 51.512 -42.332 -37.596 1.00 34.30 ? 179 GLY B O   1 
ATOM   3900 N  N   . GLY B 1 177 ? 50.814 -41.173 -35.792 1.00 32.10 ? 180 GLY B N   1 
ATOM   3901 C  CA  . GLY B 1 177 ? 50.622 -42.376 -35.000 1.00 30.40 ? 180 GLY B CA  1 
ATOM   3902 C  C   . GLY B 1 177 ? 50.022 -42.102 -33.634 1.00 30.28 ? 180 GLY B C   1 
ATOM   3903 O  O   . GLY B 1 177 ? 49.372 -41.074 -33.428 1.00 28.69 ? 180 GLY B O   1 
ATOM   3904 N  N   . SER B 1 178 ? 50.231 -43.038 -32.711 1.00 29.51 ? 181 SER B N   1 
ATOM   3905 C  CA  . SER B 1 178 ? 49.850 -42.878 -31.315 1.00 31.75 ? 181 SER B CA  1 
ATOM   3906 C  C   . SER B 1 178 ? 51.026 -43.256 -30.424 1.00 32.99 ? 181 SER B C   1 
ATOM   3907 O  O   . SER B 1 178 ? 51.887 -44.040 -30.823 1.00 35.10 ? 181 SER B O   1 
ATOM   3908 C  CB  . SER B 1 178 ? 48.654 -43.777 -30.982 1.00 31.06 ? 181 SER B CB  1 
ATOM   3909 O  OG  . SER B 1 178 ? 47.506 -43.382 -31.709 1.00 31.54 ? 181 SER B OG  1 
ATOM   3910 N  N   . ASP B 1 179 ? 51.053 -42.708 -29.213 1.00 34.11 ? 182 ASP B N   1 
ATOM   3911 C  CA  . ASP B 1 179 ? 52.115 -42.995 -28.255 1.00 32.65 ? 182 ASP B CA  1 
ATOM   3912 C  C   . ASP B 1 179 ? 51.696 -44.062 -27.239 1.00 34.59 ? 182 ASP B C   1 
ATOM   3913 O  O   . ASP B 1 179 ? 50.892 -43.805 -26.339 1.00 33.12 ? 182 ASP B O   1 
ATOM   3914 C  CB  . ASP B 1 179 ? 52.503 -41.707 -27.526 1.00 34.35 ? 182 ASP B CB  1 
ATOM   3915 C  CG  . ASP B 1 179 ? 53.683 -41.894 -26.593 1.00 33.72 ? 182 ASP B CG  1 
ATOM   3916 O  OD1 . ASP B 1 179 ? 54.000 -43.052 -26.242 1.00 31.54 ? 182 ASP B OD1 1 
ATOM   3917 O  OD2 . ASP B 1 179 ? 54.292 -40.872 -26.211 1.00 35.54 ? 182 ASP B OD2 1 
ATOM   3918 N  N   . PRO B 1 180 ? 52.257 -45.275 -27.360 1.00 35.99 ? 183 PRO B N   1 
ATOM   3919 C  CA  . PRO B 1 180 ? 51.873 -46.398 -26.500 1.00 37.18 ? 183 PRO B CA  1 
ATOM   3920 C  C   . PRO B 1 180 ? 52.220 -46.137 -25.036 1.00 38.79 ? 183 PRO B C   1 
ATOM   3921 O  O   . PRO B 1 180 ? 51.734 -46.822 -24.142 1.00 37.95 ? 183 PRO B O   1 
ATOM   3922 C  CB  . PRO B 1 180 ? 52.651 -47.578 -27.077 1.00 37.08 ? 183 PRO B CB  1 
ATOM   3923 C  CG  . PRO B 1 180 ? 53.830 -46.952 -27.740 1.00 37.59 ? 183 PRO B CG  1 
ATOM   3924 C  CD  . PRO B 1 180 ? 53.360 -45.630 -28.272 1.00 36.90 ? 183 PRO B CD  1 
ATOM   3925 N  N   . GLN B 1 181 ? 53.063 -45.138 -24.798 1.00 39.90 ? 184 GLN B N   1 
ATOM   3926 C  CA  . GLN B 1 181 ? 53.420 -44.769 -23.435 1.00 43.11 ? 184 GLN B CA  1 
ATOM   3927 C  C   . GLN B 1 181 ? 52.262 -44.103 -22.694 1.00 43.32 ? 184 GLN B C   1 
ATOM   3928 O  O   . GLN B 1 181 ? 52.305 -43.966 -21.468 1.00 42.69 ? 184 GLN B O   1 
ATOM   3929 C  CB  . GLN B 1 181 ? 54.629 -43.830 -23.435 1.00 44.58 ? 184 GLN B CB  1 
ATOM   3930 C  CG  . GLN B 1 181 ? 55.971 -44.542 -23.514 1.00 50.52 ? 184 GLN B CG  1 
ATOM   3931 C  CD  . GLN B 1 181 ? 56.273 -45.352 -22.263 1.00 53.82 ? 184 GLN B CD  1 
ATOM   3932 O  OE1 . GLN B 1 181 ? 56.003 -46.556 -22.204 1.00 54.96 ? 184 GLN B OE1 1 
ATOM   3933 N  NE2 . GLN B 1 181 ? 56.835 -44.692 -21.255 1.00 54.40 ? 184 GLN B NE2 1 
ATOM   3934 N  N   . HIS B 1 182 ? 51.236 -43.683 -23.432 1.00 42.04 ? 185 HIS B N   1 
ATOM   3935 C  CA  . HIS B 1 182 ? 50.146 -42.918 -22.829 1.00 41.59 ? 185 HIS B CA  1 
ATOM   3936 C  C   . HIS B 1 182 ? 48.779 -43.576 -22.926 1.00 40.81 ? 185 HIS B C   1 
ATOM   3937 O  O   . HIS B 1 182 ? 47.753 -42.957 -22.616 1.00 38.79 ? 185 HIS B O   1 
ATOM   3938 C  CB  . HIS B 1 182 ? 50.092 -41.514 -23.432 1.00 41.34 ? 185 HIS B CB  1 
ATOM   3939 C  CG  . HIS B 1 182 ? 51.155 -40.604 -22.904 1.00 43.28 ? 185 HIS B CG  1 
ATOM   3940 N  ND1 . HIS B 1 182 ? 51.339 -40.385 -21.555 1.00 43.62 ? 185 HIS B ND1 1 
ATOM   3941 C  CD2 . HIS B 1 182 ? 52.106 -39.878 -23.537 1.00 43.53 ? 185 HIS B CD2 1 
ATOM   3942 C  CE1 . HIS B 1 182 ? 52.361 -39.566 -21.381 1.00 43.05 ? 185 HIS B CE1 1 
ATOM   3943 N  NE2 . HIS B 1 182 ? 52.844 -39.244 -22.567 1.00 45.43 ? 185 HIS B NE2 1 
ATOM   3944 N  N   . TYR B 1 183 ? 48.764 -44.830 -23.357 1.00 40.03 ? 186 TYR B N   1 
ATOM   3945 C  CA  . TYR B 1 183 ? 47.582 -45.660 -23.197 1.00 40.71 ? 186 TYR B CA  1 
ATOM   3946 C  C   . TYR B 1 183 ? 47.979 -47.097 -22.888 1.00 40.66 ? 186 TYR B C   1 
ATOM   3947 O  O   . TYR B 1 183 ? 49.145 -47.474 -23.019 1.00 41.57 ? 186 TYR B O   1 
ATOM   3948 C  CB  . TYR B 1 183 ? 46.709 -45.608 -24.455 1.00 39.92 ? 186 TYR B CB  1 
ATOM   3949 C  CG  . TYR B 1 183 ? 47.347 -46.207 -25.685 1.00 39.88 ? 186 TYR B CG  1 
ATOM   3950 C  CD1 . TYR B 1 183 ? 48.080 -45.419 -26.568 1.00 38.66 ? 186 TYR B CD1 1 
ATOM   3951 C  CD2 . TYR B 1 183 ? 47.214 -47.561 -25.967 1.00 38.97 ? 186 TYR B CD2 1 
ATOM   3952 C  CE1 . TYR B 1 183 ? 48.667 -45.967 -27.700 1.00 40.29 ? 186 TYR B CE1 1 
ATOM   3953 C  CE2 . TYR B 1 183 ? 47.796 -48.118 -27.097 1.00 41.28 ? 186 TYR B CE2 1 
ATOM   3954 C  CZ  . TYR B 1 183 ? 48.520 -47.316 -27.956 1.00 39.72 ? 186 TYR B CZ  1 
ATOM   3955 O  OH  . TYR B 1 183 ? 49.097 -47.868 -29.070 1.00 43.60 ? 186 TYR B OH  1 
ATOM   3956 N  N   . GLU B 1 184 ? 47.004 -47.887 -22.459 1.00 39.68 ? 187 GLU B N   1 
ATOM   3957 C  CA  . GLU B 1 184 ? 47.228 -49.293 -22.168 1.00 41.21 ? 187 GLU B CA  1 
ATOM   3958 C  C   . GLU B 1 184 ? 46.182 -50.126 -22.898 1.00 40.50 ? 187 GLU B C   1 
ATOM   3959 O  O   . GLU B 1 184 ? 45.132 -49.611 -23.287 1.00 40.64 ? 187 GLU B O   1 
ATOM   3960 C  CB  . GLU B 1 184 ? 47.130 -49.542 -20.662 1.00 41.91 ? 187 GLU B CB  1 
ATOM   3961 C  CG  . GLU B 1 184 ? 45.728 -49.408 -20.092 1.00 44.96 ? 187 GLU B CG  1 
ATOM   3962 C  CD  . GLU B 1 184 ? 45.716 -49.479 -18.578 1.00 46.71 ? 187 GLU B CD  1 
ATOM   3963 O  OE1 . GLU B 1 184 ? 44.780 -50.080 -18.012 1.00 47.35 ? 187 GLU B OE1 1 
ATOM   3964 O  OE2 . GLU B 1 184 ? 46.649 -48.931 -17.953 1.00 50.87 ? 187 GLU B OE2 1 
ATOM   3965 N  N   . GLY B 1 185 ? 46.470 -51.410 -23.084 1.00 39.62 ? 188 GLY B N   1 
ATOM   3966 C  CA  . GLY B 1 185 ? 45.546 -52.268 -23.806 1.00 37.78 ? 188 GLY B CA  1 
ATOM   3967 C  C   . GLY B 1 185 ? 45.503 -51.927 -25.284 1.00 36.09 ? 188 GLY B C   1 
ATOM   3968 O  O   . GLY B 1 185 ? 46.480 -51.425 -25.835 1.00 33.42 ? 188 GLY B O   1 
ATOM   3969 N  N   . ASN B 1 186 ? 44.371 -52.194 -25.929 1.00 34.91 ? 189 ASN B N   1 
ATOM   3970 C  CA  . ASN B 1 186 ? 44.241 -51.940 -27.358 1.00 34.70 ? 189 ASN B CA  1 
ATOM   3971 C  C   . ASN B 1 186 ? 43.160 -50.927 -27.675 1.00 34.72 ? 189 ASN B C   1 
ATOM   3972 O  O   . ASN B 1 186 ? 42.235 -50.722 -26.894 1.00 35.61 ? 189 ASN B O   1 
ATOM   3973 C  CB  . ASN B 1 186 ? 43.951 -53.245 -28.100 1.00 34.57 ? 189 ASN B CB  1 
ATOM   3974 C  CG  . ASN B 1 186 ? 45.093 -54.228 -27.997 1.00 34.69 ? 189 ASN B CG  1 
ATOM   3975 O  OD1 . ASN B 1 186 ? 46.240 -53.892 -28.290 1.00 33.37 ? 189 ASN B OD1 1 
ATOM   3976 N  ND2 . ASN B 1 186 ? 44.790 -55.446 -27.568 1.00 35.78 ? 189 ASN B ND2 1 
ATOM   3977 N  N   . PHE B 1 187 ? 43.286 -50.295 -28.835 1.00 34.23 ? 190 PHE B N   1 
ATOM   3978 C  CA  . PHE B 1 187 ? 42.273 -49.375 -29.319 1.00 34.07 ? 190 PHE B CA  1 
ATOM   3979 C  C   . PHE B 1 187 ? 40.960 -50.073 -29.666 1.00 34.51 ? 190 PHE B C   1 
ATOM   3980 O  O   . PHE B 1 187 ? 40.945 -51.177 -30.208 1.00 34.52 ? 190 PHE B O   1 
ATOM   3981 C  CB  . PHE B 1 187 ? 42.788 -48.631 -30.550 1.00 32.76 ? 190 PHE B CB  1 
ATOM   3982 C  CG  . PHE B 1 187 ? 43.706 -47.488 -30.226 1.00 34.37 ? 190 PHE B CG  1 
ATOM   3983 C  CD1 . PHE B 1 187 ? 43.199 -46.296 -29.724 1.00 29.99 ? 190 PHE B CD1 1 
ATOM   3984 C  CD2 . PHE B 1 187 ? 45.074 -47.597 -30.438 1.00 32.82 ? 190 PHE B CD2 1 
ATOM   3985 C  CE1 . PHE B 1 187 ? 44.037 -45.235 -29.443 1.00 31.82 ? 190 PHE B CE1 1 
ATOM   3986 C  CE2 . PHE B 1 187 ? 45.920 -46.537 -30.159 1.00 34.05 ? 190 PHE B CE2 1 
ATOM   3987 C  CZ  . PHE B 1 187 ? 45.404 -45.354 -29.662 1.00 33.10 ? 190 PHE B CZ  1 
ATOM   3988 N  N   . HIS B 1 188 ? 39.855 -49.415 -29.343 1.00 33.72 ? 191 HIS B N   1 
ATOM   3989 C  CA  . HIS B 1 188 ? 38.552 -49.835 -29.828 1.00 32.69 ? 191 HIS B CA  1 
ATOM   3990 C  C   . HIS B 1 188 ? 38.147 -48.881 -30.947 1.00 31.95 ? 191 HIS B C   1 
ATOM   3991 O  O   . HIS B 1 188 ? 37.929 -47.696 -30.709 1.00 32.06 ? 191 HIS B O   1 
ATOM   3992 C  CB  . HIS B 1 188 ? 37.534 -49.787 -28.686 1.00 31.94 ? 191 HIS B CB  1 
ATOM   3993 C  CG  . HIS B 1 188 ? 36.122 -50.022 -29.123 1.00 34.48 ? 191 HIS B CG  1 
ATOM   3994 N  ND1 . HIS B 1 188 ? 35.060 -49.292 -28.630 1.00 34.70 ? 191 HIS B ND1 1 
ATOM   3995 C  CD2 . HIS B 1 188 ? 35.597 -50.901 -30.009 1.00 32.33 ? 191 HIS B CD2 1 
ATOM   3996 C  CE1 . HIS B 1 188 ? 33.942 -49.713 -29.193 1.00 35.69 ? 191 HIS B CE1 1 
ATOM   3997 N  NE2 . HIS B 1 188 ? 34.240 -50.689 -30.034 1.00 35.12 ? 191 HIS B NE2 1 
ATOM   3998 N  N   . TYR B 1 189 ? 38.055 -49.393 -32.170 1.00 32.44 ? 192 TYR B N   1 
ATOM   3999 C  CA  . TYR B 1 189 ? 37.796 -48.539 -33.322 1.00 31.69 ? 192 TYR B CA  1 
ATOM   4000 C  C   . TYR B 1 189 ? 36.317 -48.425 -33.671 1.00 32.56 ? 192 TYR B C   1 
ATOM   4001 O  O   . TYR B 1 189 ? 35.562 -49.390 -33.550 1.00 33.05 ? 192 TYR B O   1 
ATOM   4002 C  CB  . TYR B 1 189 ? 38.590 -49.036 -34.530 1.00 31.01 ? 192 TYR B CB  1 
ATOM   4003 C  CG  . TYR B 1 189 ? 40.054 -48.697 -34.429 1.00 30.74 ? 192 TYR B CG  1 
ATOM   4004 C  CD1 . TYR B 1 189 ? 40.495 -47.394 -34.622 1.00 30.32 ? 192 TYR B CD1 1 
ATOM   4005 C  CD2 . TYR B 1 189 ? 40.991 -49.667 -34.099 1.00 30.92 ? 192 TYR B CD2 1 
ATOM   4006 C  CE1 . TYR B 1 189 ? 41.832 -47.062 -34.484 1.00 30.48 ? 192 TYR B CE1 1 
ATOM   4007 C  CE2 . TYR B 1 189 ? 42.330 -49.347 -33.960 1.00 31.15 ? 192 TYR B CE2 1 
ATOM   4008 C  CZ  . TYR B 1 189 ? 42.744 -48.043 -34.151 1.00 31.32 ? 192 TYR B CZ  1 
ATOM   4009 O  OH  . TYR B 1 189 ? 44.070 -47.713 -33.990 1.00 30.76 ? 192 TYR B OH  1 
ATOM   4010 N  N   . ILE B 1 190 ? 35.918 -47.229 -34.098 1.00 30.69 ? 193 ILE B N   1 
ATOM   4011 C  CA  . ILE B 1 190 ? 34.517 -46.909 -34.353 1.00 29.65 ? 193 ILE B CA  1 
ATOM   4012 C  C   . ILE B 1 190 ? 34.408 -46.068 -35.620 1.00 30.32 ? 193 ILE B C   1 
ATOM   4013 O  O   . ILE B 1 190 ? 35.161 -45.114 -35.806 1.00 30.81 ? 193 ILE B O   1 
ATOM   4014 C  CB  . ILE B 1 190 ? 33.910 -46.119 -33.167 1.00 27.53 ? 193 ILE B CB  1 
ATOM   4015 C  CG1 . ILE B 1 190 ? 33.932 -46.987 -31.908 1.00 28.76 ? 193 ILE B CG1 1 
ATOM   4016 C  CG2 . ILE B 1 190 ? 32.485 -45.689 -33.491 1.00 25.03 ? 193 ILE B CG2 1 
ATOM   4017 C  CD1 . ILE B 1 190 ? 33.805 -46.209 -30.610 1.00 29.13 ? 193 ILE B CD1 1 
ATOM   4018 N  N   . ASN B 1 191 ? 33.472 -46.421 -36.493 1.00 32.10 ? 194 ASN B N   1 
ATOM   4019 C  CA  . ASN B 1 191 ? 33.300 -45.697 -37.748 1.00 34.13 ? 194 ASN B CA  1 
ATOM   4020 C  C   . ASN B 1 191 ? 32.898 -44.260 -37.504 1.00 33.93 ? 194 ASN B C   1 
ATOM   4021 O  O   . ASN B 1 191 ? 32.270 -43.955 -36.499 1.00 34.08 ? 194 ASN B O   1 
ATOM   4022 C  CB  . ASN B 1 191 ? 32.224 -46.360 -38.609 1.00 36.35 ? 194 ASN B CB  1 
ATOM   4023 C  CG  . ASN B 1 191 ? 32.775 -47.473 -39.459 1.00 37.74 ? 194 ASN B CG  1 
ATOM   4024 O  OD1 . ASN B 1 191 ? 32.333 -48.614 -39.366 1.00 39.98 ? 194 ASN B OD1 1 
ATOM   4025 N  ND2 . ASN B 1 191 ? 33.751 -47.146 -40.299 1.00 39.56 ? 194 ASN B ND2 1 
ATOM   4026 N  N   . LEU B 1 192 ? 33.262 -43.380 -38.431 1.00 33.43 ? 195 LEU B N   1 
ATOM   4027 C  CA  . LEU B 1 192 ? 32.646 -42.066 -38.496 1.00 33.91 ? 195 LEU B CA  1 
ATOM   4028 C  C   . LEU B 1 192 ? 31.297 -42.220 -39.195 1.00 36.96 ? 195 LEU B C   1 
ATOM   4029 O  O   . LEU B 1 192 ? 31.169 -43.009 -40.131 1.00 33.01 ? 195 LEU B O   1 
ATOM   4030 C  CB  . LEU B 1 192 ? 33.529 -41.094 -39.281 1.00 32.10 ? 195 LEU B CB  1 
ATOM   4031 C  CG  . LEU B 1 192 ? 34.938 -40.835 -38.742 1.00 31.73 ? 195 LEU B CG  1 
ATOM   4032 C  CD1 . LEU B 1 192 ? 35.632 -39.849 -39.657 1.00 29.04 ? 195 LEU B CD1 1 
ATOM   4033 C  CD2 . LEU B 1 192 ? 34.875 -40.294 -37.312 1.00 30.34 ? 195 LEU B CD2 1 
ATOM   4034 N  N   . ILE B 1 193 ? 30.299 -41.472 -38.732 1.00 39.40 ? 196 ILE B N   1 
ATOM   4035 C  CA  . ILE B 1 193 ? 28.967 -41.488 -39.334 1.00 45.12 ? 196 ILE B CA  1 
ATOM   4036 C  C   . ILE B 1 193 ? 29.020 -41.089 -40.801 1.00 47.80 ? 196 ILE B C   1 
ATOM   4037 O  O   . ILE B 1 193 ? 28.847 -41.923 -41.692 1.00 48.91 ? 196 ILE B O   1 
ATOM   4038 C  CB  . ILE B 1 193 ? 28.030 -40.507 -38.629 1.00 47.00 ? 196 ILE B CB  1 
ATOM   4039 C  CG1 . ILE B 1 193 ? 27.809 -40.945 -37.183 1.00 47.74 ? 196 ILE B CG1 1 
ATOM   4040 C  CG2 . ILE B 1 193 ? 26.719 -40.413 -39.389 1.00 47.62 ? 196 ILE B CG2 1 
ATOM   4041 C  CD1 . ILE B 1 193 ? 27.392 -39.812 -36.279 1.00 48.85 ? 196 ILE B CD1 1 
ATOM   4042 N  N   . LYS B 1 194 ? 29.249 -39.803 -41.045 1.00 49.75 ? 197 LYS B N   1 
ATOM   4043 C  CA  . LYS B 1 194 ? 29.543 -39.334 -42.389 1.00 51.44 ? 197 LYS B CA  1 
ATOM   4044 C  C   . LYS B 1 194 ? 30.950 -38.765 -42.411 1.00 52.01 ? 197 LYS B C   1 
ATOM   4045 O  O   . LYS B 1 194 ? 31.532 -38.485 -41.365 1.00 51.08 ? 197 LYS B O   1 
ATOM   4046 C  CB  . LYS B 1 194 ? 28.536 -38.268 -42.822 1.00 54.22 ? 197 LYS B CB  1 
ATOM   4047 C  CG  . LYS B 1 194 ? 28.549 -37.001 -41.993 1.00 56.14 ? 197 LYS B CG  1 
ATOM   4048 C  CD  . LYS B 1 194 ? 27.702 -35.925 -42.659 1.00 58.26 ? 197 LYS B CD  1 
ATOM   4049 C  CE  . LYS B 1 194 ? 27.720 -34.625 -41.871 1.00 58.44 ? 197 LYS B CE  1 
ATOM   4050 N  NZ  . LYS B 1 194 ? 27.097 -34.792 -40.530 1.00 59.39 ? 197 LYS B NZ  1 
ATOM   4051 N  N   . THR B 1 195 ? 31.514 -38.609 -43.600 1.00 52.25 ? 198 THR B N   1 
ATOM   4052 C  CA  . THR B 1 195 ? 32.860 -38.066 -43.693 1.00 51.37 ? 198 THR B CA  1 
ATOM   4053 C  C   . THR B 1 195 ? 32.765 -36.550 -43.604 1.00 48.32 ? 198 THR B C   1 
ATOM   4054 O  O   . THR B 1 195 ? 31.681 -35.991 -43.731 1.00 48.64 ? 198 THR B O   1 
ATOM   4055 C  CB  . THR B 1 195 ? 33.546 -38.492 -45.016 1.00 53.21 ? 198 THR B CB  1 
ATOM   4056 O  OG1 . THR B 1 195 ? 34.862 -37.927 -45.079 1.00 53.09 ? 198 THR B OG1 1 
ATOM   4057 C  CG2 . THR B 1 195 ? 32.721 -38.040 -46.218 1.00 54.98 ? 198 THR B CG2 1 
ATOM   4058 N  N   . GLY B 1 196 ? 33.891 -35.889 -43.360 1.00 46.02 ? 199 GLY B N   1 
ATOM   4059 C  CA  . GLY B 1 196 ? 33.874 -34.444 -43.231 1.00 42.31 ? 199 GLY B CA  1 
ATOM   4060 C  C   . GLY B 1 196 ? 33.748 -33.936 -41.804 1.00 39.44 ? 199 GLY B C   1 
ATOM   4061 O  O   . GLY B 1 196 ? 33.824 -32.733 -41.567 1.00 39.95 ? 199 GLY B O   1 
ATOM   4062 N  N   . VAL B 1 197 ? 33.554 -34.841 -40.851 1.00 38.05 ? 200 VAL B N   1 
ATOM   4063 C  CA  . VAL B 1 197 ? 33.444 -34.458 -39.445 1.00 36.64 ? 200 VAL B CA  1 
ATOM   4064 C  C   . VAL B 1 197 ? 33.803 -35.615 -38.506 1.00 33.55 ? 200 VAL B C   1 
ATOM   4065 O  O   . VAL B 1 197 ? 33.455 -36.761 -38.766 1.00 31.23 ? 200 VAL B O   1 
ATOM   4066 C  CB  . VAL B 1 197 ? 32.016 -33.940 -39.130 1.00 37.68 ? 200 VAL B CB  1 
ATOM   4067 C  CG1 . VAL B 1 197 ? 30.980 -34.913 -39.653 1.00 38.76 ? 200 VAL B CG1 1 
ATOM   4068 C  CG2 . VAL B 1 197 ? 31.850 -33.748 -37.635 1.00 37.40 ? 200 VAL B CG2 1 
ATOM   4069 N  N   . TRP B 1 198 ? 34.527 -35.312 -37.430 1.00 30.93 ? 201 TRP B N   1 
ATOM   4070 C  CA  . TRP B 1 198 ? 34.938 -36.334 -36.468 1.00 30.39 ? 201 TRP B CA  1 
ATOM   4071 C  C   . TRP B 1 198 ? 33.787 -36.602 -35.505 1.00 30.80 ? 201 TRP B C   1 
ATOM   4072 O  O   . TRP B 1 198 ? 33.822 -36.207 -34.336 1.00 28.82 ? 201 TRP B O   1 
ATOM   4073 C  CB  . TRP B 1 198 ? 36.173 -35.879 -35.683 1.00 28.74 ? 201 TRP B CB  1 
ATOM   4074 C  CG  . TRP B 1 198 ? 37.396 -35.668 -36.535 1.00 31.55 ? 201 TRP B CG  1 
ATOM   4075 C  CD1 . TRP B 1 198 ? 37.982 -34.473 -36.845 1.00 29.86 ? 201 TRP B CD1 1 
ATOM   4076 C  CD2 . TRP B 1 198 ? 38.182 -36.680 -37.181 1.00 29.17 ? 201 TRP B CD2 1 
ATOM   4077 N  NE1 . TRP B 1 198 ? 39.081 -34.678 -37.640 1.00 31.30 ? 201 TRP B NE1 1 
ATOM   4078 C  CE2 . TRP B 1 198 ? 39.226 -36.023 -37.864 1.00 30.76 ? 201 TRP B CE2 1 
ATOM   4079 C  CE3 . TRP B 1 198 ? 38.104 -38.077 -37.249 1.00 29.45 ? 201 TRP B CE3 1 
ATOM   4080 C  CZ2 . TRP B 1 198 ? 40.186 -36.715 -38.608 1.00 29.81 ? 201 TRP B CZ2 1 
ATOM   4081 C  CZ3 . TRP B 1 198 ? 39.057 -38.765 -37.985 1.00 29.96 ? 201 TRP B CZ3 1 
ATOM   4082 C  CH2 . TRP B 1 198 ? 40.085 -38.082 -38.655 1.00 29.85 ? 201 TRP B CH2 1 
ATOM   4083 N  N   . GLN B 1 199 ? 32.765 -37.271 -36.023 1.00 30.30 ? 202 GLN B N   1 
ATOM   4084 C  CA  . GLN B 1 199 ? 31.533 -37.502 -35.295 1.00 32.41 ? 202 GLN B CA  1 
ATOM   4085 C  C   . GLN B 1 199 ? 31.190 -38.976 -35.400 1.00 32.43 ? 202 GLN B C   1 
ATOM   4086 O  O   . GLN B 1 199 ? 31.311 -39.570 -36.470 1.00 34.38 ? 202 GLN B O   1 
ATOM   4087 C  CB  . GLN B 1 199 ? 30.418 -36.658 -35.907 1.00 32.42 ? 202 GLN B CB  1 
ATOM   4088 C  CG  . GLN B 1 199 ? 29.127 -36.639 -35.112 1.00 35.58 ? 202 GLN B CG  1 
ATOM   4089 C  CD  . GLN B 1 199 ? 28.191 -35.540 -35.585 1.00 37.26 ? 202 GLN B CD  1 
ATOM   4090 O  OE1 . GLN B 1 199 ? 27.743 -34.700 -34.800 1.00 34.73 ? 202 GLN B OE1 1 
ATOM   4091 N  NE2 . GLN B 1 199 ? 27.899 -35.536 -36.879 1.00 37.88 ? 202 GLN B NE2 1 
ATOM   4092 N  N   . ILE B 1 200 ? 30.774 -39.568 -34.287 1.00 32.99 ? 203 ILE B N   1 
ATOM   4093 C  CA  . ILE B 1 200 ? 30.391 -40.975 -34.275 1.00 33.07 ? 203 ILE B CA  1 
ATOM   4094 C  C   . ILE B 1 200 ? 28.993 -41.165 -33.718 1.00 33.57 ? 203 ILE B C   1 
ATOM   4095 O  O   . ILE B 1 200 ? 28.438 -40.276 -33.071 1.00 32.67 ? 203 ILE B O   1 
ATOM   4096 C  CB  . ILE B 1 200 ? 31.361 -41.825 -33.426 1.00 32.68 ? 203 ILE B CB  1 
ATOM   4097 C  CG1 . ILE B 1 200 ? 31.462 -41.240 -32.013 1.00 32.68 ? 203 ILE B CG1 1 
ATOM   4098 C  CG2 . ILE B 1 200 ? 32.719 -41.899 -34.107 1.00 31.69 ? 203 ILE B CG2 1 
ATOM   4099 C  CD1 . ILE B 1 200 ? 32.349 -42.040 -31.070 1.00 30.01 ? 203 ILE B CD1 1 
ATOM   4100 N  N   . GLN B 1 201 ? 28.433 -42.339 -33.976 1.00 35.77 ? 204 GLN B N   1 
ATOM   4101 C  CA  . GLN B 1 201 ? 27.111 -42.699 -33.483 1.00 37.19 ? 204 GLN B CA  1 
ATOM   4102 C  C   . GLN B 1 201 ? 27.193 -43.070 -32.002 1.00 36.82 ? 204 GLN B C   1 
ATOM   4103 O  O   . GLN B 1 201 ? 28.115 -43.772 -31.579 1.00 35.88 ? 204 GLN B O   1 
ATOM   4104 C  CB  . GLN B 1 201 ? 26.569 -43.886 -34.285 1.00 38.91 ? 204 GLN B CB  1 
ATOM   4105 C  CG  . GLN B 1 201 ? 25.116 -44.218 -34.003 1.00 44.55 ? 204 GLN B CG  1 
ATOM   4106 C  CD  . GLN B 1 201 ? 24.170 -43.229 -34.657 1.00 47.09 ? 204 GLN B CD  1 
ATOM   4107 O  OE1 . GLN B 1 201 ? 24.308 -42.916 -35.841 1.00 48.76 ? 204 GLN B OE1 1 
ATOM   4108 N  NE2 . GLN B 1 201 ? 23.207 -42.727 -33.887 1.00 48.98 ? 204 GLN B NE2 1 
ATOM   4109 N  N   . MET B 1 202 ? 26.232 -42.594 -31.216 1.00 35.84 ? 205 MET B N   1 
ATOM   4110 C  CA  . MET B 1 202 ? 26.125 -42.999 -29.818 1.00 36.02 ? 205 MET B CA  1 
ATOM   4111 C  C   . MET B 1 202 ? 24.776 -43.674 -29.607 1.00 35.58 ? 205 MET B C   1 
ATOM   4112 O  O   . MET B 1 202 ? 23.768 -43.235 -30.151 1.00 35.15 ? 205 MET B O   1 
ATOM   4113 C  CB  . MET B 1 202 ? 26.259 -41.778 -28.902 1.00 34.28 ? 205 MET B CB  1 
ATOM   4114 C  CG  . MET B 1 202 ? 26.365 -42.106 -27.412 1.00 33.45 ? 205 MET B CG  1 
ATOM   4115 S  SD  . MET B 1 202 ? 27.241 -40.812 -26.462 1.00 31.73 ? 205 MET B SD  1 
ATOM   4116 C  CE  . MET B 1 202 ? 26.260 -39.404 -26.800 1.00 28.57 ? 205 MET B CE  1 
ATOM   4117 N  N   . LYS B 1 203 ? 24.760 -44.748 -28.828 1.00 37.13 ? 206 LYS B N   1 
ATOM   4118 C  CA  . LYS B 1 203 ? 23.542 -45.529 -28.657 1.00 38.12 ? 206 LYS B CA  1 
ATOM   4119 C  C   . LYS B 1 203 ? 23.005 -45.502 -27.233 1.00 36.77 ? 206 LYS B C   1 
ATOM   4120 O  O   . LYS B 1 203 ? 22.192 -46.340 -26.857 1.00 37.98 ? 206 LYS B O   1 
ATOM   4121 C  CB  . LYS B 1 203 ? 23.775 -46.983 -29.091 1.00 40.65 ? 206 LYS B CB  1 
ATOM   4122 C  CG  . LYS B 1 203 ? 23.865 -47.173 -30.600 1.00 44.03 ? 206 LYS B CG  1 
ATOM   4123 C  CD  . LYS B 1 203 ? 23.447 -48.581 -31.015 1.00 47.27 ? 206 LYS B CD  1 
ATOM   4124 C  CE  . LYS B 1 203 ? 24.572 -49.592 -30.811 1.00 50.38 ? 206 LYS B CE  1 
ATOM   4125 N  NZ  . LYS B 1 203 ? 24.183 -50.976 -31.215 1.00 52.21 ? 206 LYS B NZ  1 
ATOM   4126 N  N   . GLY B 1 204 ? 23.450 -44.541 -26.434 1.00 35.18 ? 207 GLY B N   1 
ATOM   4127 C  CA  . GLY B 1 204 ? 22.872 -44.405 -25.114 1.00 32.00 ? 207 GLY B CA  1 
ATOM   4128 C  C   . GLY B 1 204 ? 23.769 -43.716 -24.114 1.00 30.91 ? 207 GLY B C   1 
ATOM   4129 O  O   . GLY B 1 204 ? 24.986 -43.894 -24.111 1.00 30.75 ? 207 GLY B O   1 
ATOM   4130 N  N   . VAL B 1 205 ? 23.152 -42.914 -23.262 1.00 30.04 ? 208 VAL B N   1 
ATOM   4131 C  CA  . VAL B 1 205 ? 23.858 -42.277 -22.163 1.00 29.45 ? 208 VAL B CA  1 
ATOM   4132 C  C   . VAL B 1 205 ? 23.202 -42.733 -20.871 1.00 29.40 ? 208 VAL B C   1 
ATOM   4133 O  O   . VAL B 1 205 ? 21.989 -42.578 -20.689 1.00 29.90 ? 208 VAL B O   1 
ATOM   4134 C  CB  . VAL B 1 205 ? 23.782 -40.751 -22.271 1.00 27.42 ? 208 VAL B CB  1 
ATOM   4135 C  CG1 . VAL B 1 205 ? 24.519 -40.105 -21.106 1.00 28.12 ? 208 VAL B CG1 1 
ATOM   4136 C  CG2 . VAL B 1 205 ? 24.377 -40.310 -23.592 1.00 25.92 ? 208 VAL B CG2 1 
ATOM   4137 N  N   . SER B 1 206 ? 24.004 -43.315 -19.988 1.00 27.97 ? 209 SER B N   1 
ATOM   4138 C  CA  . SER B 1 206 ? 23.481 -43.928 -18.778 1.00 29.29 ? 209 SER B CA  1 
ATOM   4139 C  C   . SER B 1 206 ? 23.992 -43.223 -17.525 1.00 27.44 ? 209 SER B C   1 
ATOM   4140 O  O   . SER B 1 206 ? 25.148 -42.815 -17.461 1.00 25.03 ? 209 SER B O   1 
ATOM   4141 C  CB  . SER B 1 206 ? 23.884 -45.404 -18.731 1.00 29.33 ? 209 SER B CB  1 
ATOM   4142 O  OG  . SER B 1 206 ? 23.366 -46.096 -19.850 1.00 34.23 ? 209 SER B OG  1 
ATOM   4143 N  N   . VAL B 1 207 ? 23.122 -43.084 -16.534 1.00 27.04 ? 210 VAL B N   1 
ATOM   4144 C  CA  . VAL B 1 207 ? 23.541 -42.633 -15.210 1.00 27.99 ? 210 VAL B CA  1 
ATOM   4145 C  C   . VAL B 1 207 ? 23.416 -43.841 -14.296 1.00 27.67 ? 210 VAL B C   1 
ATOM   4146 O  O   . VAL B 1 207 ? 22.338 -44.407 -14.169 1.00 26.94 ? 210 VAL B O   1 
ATOM   4147 C  CB  . VAL B 1 207 ? 22.630 -41.510 -14.680 1.00 27.55 ? 210 VAL B CB  1 
ATOM   4148 C  CG1 . VAL B 1 207 ? 23.032 -41.140 -13.276 1.00 28.97 ? 210 VAL B CG1 1 
ATOM   4149 C  CG2 . VAL B 1 207 ? 22.718 -40.299 -15.584 1.00 29.77 ? 210 VAL B CG2 1 
ATOM   4150 N  N   . GLY B 1 208 ? 24.510 -44.244 -13.665 1.00 27.16 ? 211 GLY B N   1 
ATOM   4151 C  CA  . GLY B 1 208 ? 24.503 -45.542 -13.015 1.00 29.90 ? 211 GLY B CA  1 
ATOM   4152 C  C   . GLY B 1 208 ? 24.096 -46.607 -14.021 1.00 31.36 ? 211 GLY B C   1 
ATOM   4153 O  O   . GLY B 1 208 ? 24.640 -46.672 -15.124 1.00 33.01 ? 211 GLY B O   1 
ATOM   4154 N  N   . SER B 1 209 ? 23.130 -47.442 -13.662 1.00 32.38 ? 212 SER B N   1 
ATOM   4155 C  CA  . SER B 1 209 ? 22.700 -48.508 -14.564 1.00 34.28 ? 212 SER B CA  1 
ATOM   4156 C  C   . SER B 1 209 ? 21.554 -48.076 -15.473 1.00 34.10 ? 212 SER B C   1 
ATOM   4157 O  O   . SER B 1 209 ? 21.196 -48.787 -16.405 1.00 36.11 ? 212 SER B O   1 
ATOM   4158 C  CB  . SER B 1 209 ? 22.278 -49.748 -13.766 1.00 36.50 ? 212 SER B CB  1 
ATOM   4159 O  OG  . SER B 1 209 ? 21.198 -49.458 -12.892 1.00 37.75 ? 212 SER B OG  1 
ATOM   4160 N  N   . SER B 1 210 ? 20.986 -46.906 -15.210 1.00 33.87 ? 213 SER B N   1 
ATOM   4161 C  CA  . SER B 1 210 ? 19.789 -46.474 -15.924 1.00 35.33 ? 213 SER B CA  1 
ATOM   4162 C  C   . SER B 1 210 ? 20.134 -45.664 -17.164 1.00 35.80 ? 213 SER B C   1 
ATOM   4163 O  O   . SER B 1 210 ? 20.736 -44.594 -17.066 1.00 34.63 ? 213 SER B O   1 
ATOM   4164 C  CB  . SER B 1 210 ? 18.911 -45.633 -14.999 1.00 35.00 ? 213 SER B CB  1 
ATOM   4165 O  OG  . SER B 1 210 ? 18.953 -46.147 -13.678 1.00 37.80 ? 213 SER B OG  1 
ATOM   4166 N  N   . THR B 1 211 ? 19.750 -46.169 -18.332 1.00 35.83 ? 214 THR B N   1 
ATOM   4167 C  CA  . THR B 1 211 ? 19.916 -45.407 -19.562 1.00 37.33 ? 214 THR B CA  1 
ATOM   4168 C  C   . THR B 1 211 ? 18.768 -44.412 -19.613 1.00 37.86 ? 214 THR B C   1 
ATOM   4169 O  O   . THR B 1 211 ? 17.606 -44.807 -19.637 1.00 38.83 ? 214 THR B O   1 
ATOM   4170 C  CB  . THR B 1 211 ? 19.852 -46.321 -20.814 1.00 40.41 ? 214 THR B CB  1 
ATOM   4171 O  OG1 . THR B 1 211 ? 20.898 -47.301 -20.753 1.00 40.12 ? 214 THR B OG1 1 
ATOM   4172 C  CG2 . THR B 1 211 ? 20.012 -45.496 -22.090 1.00 40.53 ? 214 THR B CG2 1 
ATOM   4173 N  N   . LEU B 1 212 ? 19.081 -43.123 -19.611 1.00 37.43 ? 215 LEU B N   1 
ATOM   4174 C  CA  . LEU B 1 212 ? 18.027 -42.124 -19.527 1.00 39.69 ? 215 LEU B CA  1 
ATOM   4175 C  C   . LEU B 1 212 ? 17.951 -41.229 -20.757 1.00 39.02 ? 215 LEU B C   1 
ATOM   4176 O  O   . LEU B 1 212 ? 16.972 -40.503 -20.946 1.00 39.52 ? 215 LEU B O   1 
ATOM   4177 C  CB  . LEU B 1 212 ? 18.207 -41.266 -18.269 1.00 41.02 ? 215 LEU B CB  1 
ATOM   4178 C  CG  . LEU B 1 212 ? 19.089 -40.020 -18.359 1.00 40.93 ? 215 LEU B CG  1 
ATOM   4179 C  CD1 . LEU B 1 212 ? 19.082 -39.311 -17.016 1.00 43.13 ? 215 LEU B CD1 1 
ATOM   4180 C  CD2 . LEU B 1 212 ? 20.507 -40.404 -18.757 1.00 42.84 ? 215 LEU B CD2 1 
ATOM   4181 N  N   . LEU B 1 213 ? 18.980 -41.279 -21.592 1.00 38.02 ? 216 LEU B N   1 
ATOM   4182 C  CA  . LEU B 1 213 ? 19.026 -40.434 -22.780 1.00 39.32 ? 216 LEU B CA  1 
ATOM   4183 C  C   . LEU B 1 213 ? 19.556 -41.211 -23.984 1.00 40.56 ? 216 LEU B C   1 
ATOM   4184 O  O   . LEU B 1 213 ? 20.247 -42.225 -23.831 1.00 39.20 ? 216 LEU B O   1 
ATOM   4185 C  CB  . LEU B 1 213 ? 19.920 -39.216 -22.520 1.00 38.45 ? 216 LEU B CB  1 
ATOM   4186 C  CG  . LEU B 1 213 ? 19.526 -38.296 -21.359 1.00 37.25 ? 216 LEU B CG  1 
ATOM   4187 C  CD1 . LEU B 1 213 ? 20.767 -37.623 -20.790 1.00 37.57 ? 216 LEU B CD1 1 
ATOM   4188 C  CD2 . LEU B 1 213 ? 18.513 -37.266 -21.836 1.00 36.62 ? 216 LEU B CD2 1 
ATOM   4189 N  N   . CYS B 1 214 ? 19.224 -40.732 -25.180 1.00 41.47 ? 217 CYS B N   1 
ATOM   4190 C  CA  . CYS B 1 214 ? 19.824 -41.254 -26.404 1.00 43.10 ? 217 CYS B CA  1 
ATOM   4191 C  C   . CYS B 1 214 ? 19.465 -42.728 -26.623 1.00 44.39 ? 217 CYS B C   1 
ATOM   4192 O  O   . CYS B 1 214 ? 20.139 -43.443 -27.365 1.00 44.61 ? 217 CYS B O   1 
ATOM   4193 C  CB  . CYS B 1 214 ? 21.347 -41.074 -26.340 1.00 43.14 ? 217 CYS B CB  1 
ATOM   4194 S  SG  . CYS B 1 214 ? 22.250 -41.547 -27.837 1.00 42.97 ? 217 CYS B SG  1 
ATOM   4195 N  N   . GLU B 1 215 ? 18.394 -43.175 -25.972 1.00 46.49 ? 218 GLU B N   1 
ATOM   4196 C  CA  . GLU B 1 215 ? 17.933 -44.554 -26.095 1.00 47.05 ? 218 GLU B CA  1 
ATOM   4197 C  C   . GLU B 1 215 ? 17.758 -44.954 -27.560 1.00 47.03 ? 218 GLU B C   1 
ATOM   4198 O  O   . GLU B 1 215 ? 18.092 -46.075 -27.955 1.00 46.15 ? 218 GLU B O   1 
ATOM   4199 C  CB  . GLU B 1 215 ? 16.602 -44.729 -25.358 1.00 49.78 ? 218 GLU B CB  1 
ATOM   4200 C  CG  . GLU B 1 215 ? 16.622 -44.284 -23.899 1.00 53.11 ? 218 GLU B CG  1 
ATOM   4201 C  CD  . GLU B 1 215 ? 16.066 -42.878 -23.699 1.00 55.08 ? 218 GLU B CD  1 
ATOM   4202 O  OE1 . GLU B 1 215 ? 16.634 -41.917 -24.269 1.00 52.83 ? 218 GLU B OE1 1 
ATOM   4203 O  OE2 . GLU B 1 215 ? 15.058 -42.738 -22.969 1.00 55.82 ? 218 GLU B OE2 1 
ATOM   4204 N  N   . ASP B 1 216 ? 17.232 -44.033 -28.361 1.00 46.19 ? 219 ASP B N   1 
ATOM   4205 C  CA  . ASP B 1 216 ? 17.056 -44.267 -29.791 1.00 46.41 ? 219 ASP B CA  1 
ATOM   4206 C  C   . ASP B 1 216 ? 18.289 -43.858 -30.599 1.00 45.76 ? 219 ASP B C   1 
ATOM   4207 O  O   . ASP B 1 216 ? 18.287 -43.926 -31.827 1.00 45.04 ? 219 ASP B O   1 
ATOM   4208 C  CB  . ASP B 1 216 ? 15.828 -43.505 -30.299 1.00 48.61 ? 219 ASP B CB  1 
ATOM   4209 C  CG  . ASP B 1 216 ? 14.528 -44.058 -29.743 1.00 50.94 ? 219 ASP B CG  1 
ATOM   4210 O  OD1 . ASP B 1 216 ? 14.439 -45.294 -29.565 1.00 50.35 ? 219 ASP B OD1 1 
ATOM   4211 O  OD2 . ASP B 1 216 ? 13.598 -43.259 -29.484 1.00 51.34 ? 219 ASP B OD2 1 
ATOM   4212 N  N   . GLY B 1 217 ? 19.338 -43.427 -29.905 1.00 45.39 ? 220 GLY B N   1 
ATOM   4213 C  CA  . GLY B 1 217 ? 20.580 -43.086 -30.574 1.00 43.88 ? 220 GLY B CA  1 
ATOM   4214 C  C   . GLY B 1 217 ? 20.740 -41.595 -30.796 1.00 43.02 ? 220 GLY B C   1 
ATOM   4215 O  O   . GLY B 1 217 ? 19.762 -40.851 -30.801 1.00 43.39 ? 220 GLY B O   1 
ATOM   4216 N  N   . CYS B 1 218 ? 21.981 -41.160 -30.973 1.00 41.51 ? 221 CYS B N   1 
ATOM   4217 C  CA  . CYS B 1 218 ? 22.270 -39.774 -31.308 1.00 40.26 ? 221 CYS B CA  1 
ATOM   4218 C  C   . CYS B 1 218 ? 23.736 -39.663 -31.707 1.00 37.69 ? 221 CYS B C   1 
ATOM   4219 O  O   . CYS B 1 218 ? 24.421 -40.677 -31.829 1.00 38.12 ? 221 CYS B O   1 
ATOM   4220 C  CB  . CYS B 1 218 ? 21.970 -38.865 -30.113 1.00 42.73 ? 221 CYS B CB  1 
ATOM   4221 S  SG  . CYS B 1 218 ? 23.027 -39.116 -28.678 1.00 48.71 ? 221 CYS B SG  1 
ATOM   4222 N  N   . LEU B 1 219 ? 24.213 -38.441 -31.914 1.00 33.63 ? 222 LEU B N   1 
ATOM   4223 C  CA  . LEU B 1 219 ? 25.570 -38.230 -32.399 1.00 30.96 ? 222 LEU B CA  1 
ATOM   4224 C  C   . LEU B 1 219 ? 26.532 -37.739 -31.311 1.00 30.85 ? 222 LEU B C   1 
ATOM   4225 O  O   . LEU B 1 219 ? 26.145 -37.022 -30.393 1.00 31.00 ? 222 LEU B O   1 
ATOM   4226 C  CB  . LEU B 1 219 ? 25.553 -37.230 -33.558 1.00 29.84 ? 222 LEU B CB  1 
ATOM   4227 C  CG  . LEU B 1 219 ? 24.426 -37.435 -34.575 1.00 29.54 ? 222 LEU B CG  1 
ATOM   4228 C  CD1 . LEU B 1 219 ? 24.627 -36.510 -35.754 1.00 28.01 ? 222 LEU B CD1 1 
ATOM   4229 C  CD2 . LEU B 1 219 ? 24.414 -38.881 -35.034 1.00 29.45 ? 222 LEU B CD2 1 
ATOM   4230 N  N   . ALA B 1 220 ? 27.795 -38.132 -31.427 1.00 30.20 ? 223 ALA B N   1 
ATOM   4231 C  CA  . ALA B 1 220 ? 28.835 -37.625 -30.548 1.00 27.81 ? 223 ALA B CA  1 
ATOM   4232 C  C   . ALA B 1 220 ? 29.961 -37.059 -31.392 1.00 27.93 ? 223 ALA B C   1 
ATOM   4233 O  O   . ALA B 1 220 ? 30.619 -37.792 -32.136 1.00 29.16 ? 223 ALA B O   1 
ATOM   4234 C  CB  . ALA B 1 220 ? 29.366 -38.748 -29.653 1.00 25.42 ? 223 ALA B CB  1 
ATOM   4235 N  N   . LEU B 1 221 ? 30.176 -35.752 -31.283 1.00 27.72 ? 224 LEU B N   1 
ATOM   4236 C  CA  . LEU B 1 221 ? 31.366 -35.128 -31.851 1.00 29.37 ? 224 LEU B CA  1 
ATOM   4237 C  C   . LEU B 1 221 ? 32.506 -35.365 -30.867 1.00 29.32 ? 224 LEU B C   1 
ATOM   4238 O  O   . LEU B 1 221 ? 32.372 -35.072 -29.680 1.00 30.88 ? 224 LEU B O   1 
ATOM   4239 C  CB  . LEU B 1 221 ? 31.141 -33.623 -32.026 1.00 30.56 ? 224 LEU B CB  1 
ATOM   4240 C  CG  . LEU B 1 221 ? 32.115 -32.860 -32.932 1.00 33.30 ? 224 LEU B CG  1 
ATOM   4241 C  CD1 . LEU B 1 221 ? 32.067 -33.433 -34.343 1.00 30.99 ? 224 LEU B CD1 1 
ATOM   4242 C  CD2 . LEU B 1 221 ? 31.737 -31.378 -32.947 1.00 32.21 ? 224 LEU B CD2 1 
ATOM   4243 N  N   . VAL B 1 222 ? 33.613 -35.916 -31.350 1.00 26.99 ? 225 VAL B N   1 
ATOM   4244 C  CA  . VAL B 1 222 ? 34.789 -36.112 -30.508 1.00 26.35 ? 225 VAL B CA  1 
ATOM   4245 C  C   . VAL B 1 222 ? 35.716 -34.919 -30.686 1.00 27.64 ? 225 VAL B C   1 
ATOM   4246 O  O   . VAL B 1 222 ? 36.518 -34.879 -31.625 1.00 26.64 ? 225 VAL B O   1 
ATOM   4247 C  CB  . VAL B 1 222 ? 35.559 -37.376 -30.900 1.00 25.22 ? 225 VAL B CB  1 
ATOM   4248 C  CG1 . VAL B 1 222 ? 36.766 -37.540 -29.990 1.00 24.13 ? 225 VAL B CG1 1 
ATOM   4249 C  CG2 . VAL B 1 222 ? 34.639 -38.596 -30.821 1.00 25.11 ? 225 VAL B CG2 1 
ATOM   4250 N  N   . ASP B 1 223 ? 35.606 -33.959 -29.771 1.00 27.97 ? 226 ASP B N   1 
ATOM   4251 C  CA  . ASP B 1 223 ? 36.076 -32.601 -30.014 1.00 27.17 ? 226 ASP B CA  1 
ATOM   4252 C  C   . ASP B 1 223 ? 37.184 -32.186 -29.046 1.00 27.51 ? 226 ASP B C   1 
ATOM   4253 O  O   . ASP B 1 223 ? 36.917 -31.814 -27.897 1.00 24.95 ? 226 ASP B O   1 
ATOM   4254 C  CB  . ASP B 1 223 ? 34.898 -31.631 -29.900 1.00 27.39 ? 226 ASP B CB  1 
ATOM   4255 C  CG  . ASP B 1 223 ? 35.232 -30.242 -30.409 1.00 25.57 ? 226 ASP B CG  1 
ATOM   4256 O  OD1 . ASP B 1 223 ? 36.422 -29.879 -30.432 1.00 28.19 ? 226 ASP B OD1 1 
ATOM   4257 O  OD2 . ASP B 1 223 ? 34.299 -29.512 -30.785 1.00 28.04 ? 226 ASP B OD2 1 
ATOM   4258 N  N   . THR B 1 224 ? 38.425 -32.228 -29.526 1.00 25.48 ? 227 THR B N   1 
ATOM   4259 C  CA  . THR B 1 224 ? 39.579 -31.997 -28.668 1.00 25.91 ? 227 THR B CA  1 
ATOM   4260 C  C   . THR B 1 224 ? 39.651 -30.546 -28.204 1.00 25.35 ? 227 THR B C   1 
ATOM   4261 O  O   . THR B 1 224 ? 40.360 -30.228 -27.254 1.00 25.99 ? 227 THR B O   1 
ATOM   4262 C  CB  . THR B 1 224 ? 40.899 -32.361 -29.392 1.00 25.22 ? 227 THR B CB  1 
ATOM   4263 O  OG1 . THR B 1 224 ? 41.071 -31.518 -30.540 1.00 24.69 ? 227 THR B OG1 1 
ATOM   4264 C  CG2 . THR B 1 224 ? 40.872 -33.815 -29.835 1.00 23.06 ? 227 THR B CG2 1 
ATOM   4265 N  N   . GLY B 1 225 ? 38.907 -29.674 -28.876 1.00 25.53 ? 228 GLY B N   1 
ATOM   4266 C  CA  . GLY B 1 225 ? 38.912 -28.268 -28.513 1.00 26.56 ? 228 GLY B CA  1 
ATOM   4267 C  C   . GLY B 1 225 ? 37.882 -27.918 -27.450 1.00 28.37 ? 228 GLY B C   1 
ATOM   4268 O  O   . GLY B 1 225 ? 37.913 -26.815 -26.893 1.00 27.56 ? 228 GLY B O   1 
ATOM   4269 N  N   . ALA B 1 226 ? 36.967 -28.848 -27.177 1.00 27.14 ? 229 ALA B N   1 
ATOM   4270 C  CA  . ALA B 1 226 ? 35.956 -28.666 -26.135 1.00 26.96 ? 229 ALA B CA  1 
ATOM   4271 C  C   . ALA B 1 226 ? 36.583 -29.038 -24.802 1.00 26.37 ? 229 ALA B C   1 
ATOM   4272 O  O   . ALA B 1 226 ? 37.273 -30.052 -24.704 1.00 26.89 ? 229 ALA B O   1 
ATOM   4273 C  CB  . ALA B 1 226 ? 34.743 -29.558 -26.403 1.00 24.41 ? 229 ALA B CB  1 
ATOM   4274 N  N   . SER B 1 227 ? 36.349 -28.218 -23.780 1.00 24.29 ? 230 SER B N   1 
ATOM   4275 C  CA  . SER B 1 227 ? 36.926 -28.485 -22.468 1.00 24.19 ? 230 SER B CA  1 
ATOM   4276 C  C   . SER B 1 227 ? 36.034 -29.442 -21.692 1.00 22.78 ? 230 SER B C   1 
ATOM   4277 O  O   . SER B 1 227 ? 36.520 -30.292 -20.957 1.00 23.97 ? 230 SER B O   1 
ATOM   4278 C  CB  . SER B 1 227 ? 37.096 -27.184 -21.674 1.00 23.75 ? 230 SER B CB  1 
ATOM   4279 O  OG  . SER B 1 227 ? 37.931 -26.267 -22.367 1.00 25.89 ? 230 SER B OG  1 
ATOM   4280 N  N   . TYR B 1 228 ? 34.725 -29.296 -21.856 1.00 22.48 ? 231 TYR B N   1 
ATOM   4281 C  CA  . TYR B 1 228 ? 33.775 -30.149 -21.148 1.00 23.50 ? 231 TYR B CA  1 
ATOM   4282 C  C   . TYR B 1 228 ? 33.087 -31.092 -22.115 1.00 23.38 ? 231 TYR B C   1 
ATOM   4283 O  O   . TYR B 1 228 ? 33.097 -30.878 -23.323 1.00 27.01 ? 231 TYR B O   1 
ATOM   4284 C  CB  . TYR B 1 228 ? 32.696 -29.314 -20.459 1.00 23.14 ? 231 TYR B CB  1 
ATOM   4285 C  CG  . TYR B 1 228 ? 33.170 -28.433 -19.326 1.00 23.93 ? 231 TYR B CG  1 
ATOM   4286 C  CD1 . TYR B 1 228 ? 32.308 -27.502 -18.748 1.00 23.48 ? 231 TYR B CD1 1 
ATOM   4287 C  CD2 . TYR B 1 228 ? 34.456 -28.528 -18.830 1.00 21.53 ? 231 TYR B CD2 1 
ATOM   4288 C  CE1 . TYR B 1 228 ? 32.713 -26.695 -17.714 1.00 22.30 ? 231 TYR B CE1 1 
ATOM   4289 C  CE2 . TYR B 1 228 ? 34.878 -27.713 -17.788 1.00 25.17 ? 231 TYR B CE2 1 
ATOM   4290 C  CZ  . TYR B 1 228 ? 33.993 -26.799 -17.237 1.00 27.05 ? 231 TYR B CZ  1 
ATOM   4291 O  OH  . TYR B 1 228 ? 34.382 -25.991 -16.198 1.00 29.80 ? 231 TYR B OH  1 
ATOM   4292 N  N   . ILE B 1 229 ? 32.475 -32.135 -21.578 1.00 24.56 ? 232 ILE B N   1 
ATOM   4293 C  CA  . ILE B 1 229 ? 31.476 -32.863 -22.333 1.00 21.34 ? 232 ILE B CA  1 
ATOM   4294 C  C   . ILE B 1 229 ? 30.255 -31.977 -22.508 1.00 22.60 ? 232 ILE B C   1 
ATOM   4295 O  O   . ILE B 1 229 ? 29.827 -31.285 -21.581 1.00 20.89 ? 232 ILE B O   1 
ATOM   4296 C  CB  . ILE B 1 229 ? 31.059 -34.155 -21.621 1.00 19.87 ? 232 ILE B CB  1 
ATOM   4297 C  CG1 . ILE B 1 229 ? 32.170 -35.198 -21.765 1.00 18.35 ? 232 ILE B CG1 1 
ATOM   4298 C  CG2 . ILE B 1 229 ? 29.714 -34.639 -22.182 1.00 19.24 ? 232 ILE B CG2 1 
ATOM   4299 C  CD1 . ILE B 1 229 ? 32.022 -36.396 -20.865 1.00 20.74 ? 232 ILE B CD1 1 
ATOM   4300 N  N   . SER B 1 230 ? 29.693 -32.016 -23.708 1.00 23.30 ? 233 SER B N   1 
ATOM   4301 C  CA  . SER B 1 230 ? 28.586 -31.148 -24.057 1.00 24.37 ? 233 SER B CA  1 
ATOM   4302 C  C   . SER B 1 230 ? 27.386 -31.974 -24.486 1.00 24.39 ? 233 SER B C   1 
ATOM   4303 O  O   . SER B 1 230 ? 27.535 -32.987 -25.167 1.00 21.71 ? 233 SER B O   1 
ATOM   4304 C  CB  . SER B 1 230 ? 28.998 -30.223 -25.196 1.00 23.77 ? 233 SER B CB  1 
ATOM   4305 O  OG  . SER B 1 230 ? 28.273 -29.021 -25.121 1.00 30.43 ? 233 SER B OG  1 
ATOM   4306 N  N   . GLY B 1 231 ? 26.202 -31.537 -24.071 1.00 23.78 ? 234 GLY B N   1 
ATOM   4307 C  CA  . GLY B 1 231 ? 24.976 -32.113 -24.579 1.00 24.54 ? 234 GLY B CA  1 
ATOM   4308 C  C   . GLY B 1 231 ? 23.983 -31.000 -24.860 1.00 26.46 ? 234 GLY B C   1 
ATOM   4309 O  O   . GLY B 1 231 ? 24.219 -29.851 -24.472 1.00 27.48 ? 234 GLY B O   1 
ATOM   4310 N  N   . SER B 1 232 ? 22.882 -31.331 -25.530 1.00 25.43 ? 235 SER B N   1 
ATOM   4311 C  CA  . SER B 1 232 ? 21.847 -30.348 -25.821 1.00 27.49 ? 235 SER B CA  1 
ATOM   4312 C  C   . SER B 1 232 ? 21.293 -29.882 -24.488 1.00 29.77 ? 235 SER B C   1 
ATOM   4313 O  O   . SER B 1 232 ? 21.394 -30.600 -23.493 1.00 30.58 ? 235 SER B O   1 
ATOM   4314 C  CB  . SER B 1 232 ? 20.719 -30.969 -26.639 1.00 26.10 ? 235 SER B CB  1 
ATOM   4315 O  OG  . SER B 1 232 ? 19.885 -31.769 -25.816 1.00 29.70 ? 235 SER B OG  1 
ATOM   4316 N  N   . THR B 1 233 ? 20.707 -28.689 -24.468 1.00 29.17 ? 236 THR B N   1 
ATOM   4317 C  CA  . THR B 1 233 ? 20.149 -28.146 -23.235 1.00 30.05 ? 236 THR B CA  1 
ATOM   4318 C  C   . THR B 1 233 ? 19.180 -29.116 -22.568 1.00 29.00 ? 236 THR B C   1 
ATOM   4319 O  O   . THR B 1 233 ? 19.249 -29.339 -21.357 1.00 30.15 ? 236 THR B O   1 
ATOM   4320 C  CB  . THR B 1 233 ? 19.414 -26.821 -23.494 1.00 31.27 ? 236 THR B CB  1 
ATOM   4321 O  OG1 . THR B 1 233 ? 20.345 -25.854 -23.998 1.00 32.73 ? 236 THR B OG1 1 
ATOM   4322 C  CG2 . THR B 1 233 ? 18.791 -26.298 -22.204 1.00 32.04 ? 236 THR B CG2 1 
ATOM   4323 N  N   . SER B 1 234 ? 18.286 -29.706 -23.351 1.00 28.57 ? 237 SER B N   1 
ATOM   4324 C  CA  . SER B 1 234 ? 17.259 -30.567 -22.775 1.00 32.26 ? 237 SER B CA  1 
ATOM   4325 C  C   . SER B 1 234 ? 17.854 -31.864 -22.232 1.00 30.76 ? 237 SER B C   1 
ATOM   4326 O  O   . SER B 1 234 ? 17.407 -32.364 -21.200 1.00 28.93 ? 237 SER B O   1 
ATOM   4327 C  CB  . SER B 1 234 ? 16.176 -30.883 -23.811 1.00 33.20 ? 237 SER B CB  1 
ATOM   4328 O  OG  . SER B 1 234 ? 16.748 -31.461 -24.973 1.00 39.49 ? 237 SER B OG  1 
ATOM   4329 N  N   . SER B 1 235 ? 18.862 -32.401 -22.919 1.00 29.70 ? 238 SER B N   1 
ATOM   4330 C  CA  . SER B 1 235 ? 19.525 -33.623 -22.464 1.00 30.38 ? 238 SER B CA  1 
ATOM   4331 C  C   . SER B 1 235 ? 20.261 -33.362 -21.161 1.00 27.39 ? 238 SER B C   1 
ATOM   4332 O  O   . SER B 1 235 ? 20.125 -34.116 -20.199 1.00 27.88 ? 238 SER B O   1 
ATOM   4333 C  CB  . SER B 1 235 ? 20.529 -34.127 -23.512 1.00 31.51 ? 238 SER B CB  1 
ATOM   4334 O  OG  . SER B 1 235 ? 19.866 -34.667 -24.642 1.00 35.94 ? 238 SER B OG  1 
ATOM   4335 N  N   . ILE B 1 236 ? 21.045 -32.288 -21.149 1.00 27.27 ? 239 ILE B N   1 
ATOM   4336 C  CA  . ILE B 1 236 ? 21.796 -31.887 -19.970 1.00 27.72 ? 239 ILE B CA  1 
ATOM   4337 C  C   . ILE B 1 236 ? 20.860 -31.574 -18.813 1.00 28.18 ? 239 ILE B C   1 
ATOM   4338 O  O   . ILE B 1 236 ? 21.190 -31.805 -17.654 1.00 27.81 ? 239 ILE B O   1 
ATOM   4339 C  CB  . ILE B 1 236 ? 22.664 -30.652 -20.273 1.00 25.97 ? 239 ILE B CB  1 
ATOM   4340 C  CG1 . ILE B 1 236 ? 23.761 -31.037 -21.270 1.00 27.50 ? 239 ILE B CG1 1 
ATOM   4341 C  CG2 . ILE B 1 236 ? 23.266 -30.102 -18.998 1.00 27.79 ? 239 ILE B CG2 1 
ATOM   4342 C  CD1 . ILE B 1 236 ? 24.490 -32.314 -20.902 1.00 25.85 ? 239 ILE B CD1 1 
ATOM   4343 N  N   . GLU B 1 237 ? 19.679 -31.064 -19.139 1.00 30.48 ? 240 GLU B N   1 
ATOM   4344 C  CA  . GLU B 1 237 ? 18.695 -30.704 -18.124 1.00 33.09 ? 240 GLU B CA  1 
ATOM   4345 C  C   . GLU B 1 237 ? 18.242 -31.952 -17.361 1.00 32.14 ? 240 GLU B C   1 
ATOM   4346 O  O   . GLU B 1 237 ? 18.205 -31.960 -16.130 1.00 30.64 ? 240 GLU B O   1 
ATOM   4347 C  CB  . GLU B 1 237 ? 17.500 -30.020 -18.797 1.00 35.67 ? 240 GLU B CB  1 
ATOM   4348 C  CG  . GLU B 1 237 ? 16.561 -29.293 -17.861 1.00 39.86 ? 240 GLU B CG  1 
ATOM   4349 C  CD  . GLU B 1 237 ? 15.462 -28.557 -18.617 1.00 44.67 ? 240 GLU B CD  1 
ATOM   4350 O  OE1 . GLU B 1 237 ? 15.781 -27.579 -19.338 1.00 44.29 ? 240 GLU B OE1 1 
ATOM   4351 O  OE2 . GLU B 1 237 ? 14.282 -28.959 -18.494 1.00 44.97 ? 240 GLU B OE2 1 
ATOM   4352 N  N   . LYS B 1 238 ? 17.914 -33.007 -18.100 1.00 30.59 ? 241 LYS B N   1 
ATOM   4353 C  CA  . LYS B 1 238 ? 17.609 -34.295 -17.500 1.00 31.50 ? 241 LYS B CA  1 
ATOM   4354 C  C   . LYS B 1 238 ? 18.821 -34.896 -16.776 1.00 30.41 ? 241 LYS B C   1 
ATOM   4355 O  O   . LYS B 1 238 ? 18.707 -35.379 -15.646 1.00 29.58 ? 241 LYS B O   1 
ATOM   4356 C  CB  . LYS B 1 238 ? 17.121 -35.270 -18.575 1.00 34.73 ? 241 LYS B CB  1 
ATOM   4357 C  CG  . LYS B 1 238 ? 15.707 -35.010 -19.059 1.00 39.31 ? 241 LYS B CG  1 
ATOM   4358 C  CD  . LYS B 1 238 ? 14.700 -35.209 -17.934 1.00 42.86 ? 241 LYS B CD  1 
ATOM   4359 C  CE  . LYS B 1 238 ? 13.527 -34.236 -18.047 1.00 44.79 ? 241 LYS B CE  1 
ATOM   4360 N  NZ  . LYS B 1 238 ? 12.606 -34.573 -19.176 1.00 45.13 ? 241 LYS B NZ  1 
ATOM   4361 N  N   . LEU B 1 239 ? 19.979 -34.867 -17.426 1.00 28.49 ? 242 LEU B N   1 
ATOM   4362 C  CA  . LEU B 1 239 ? 21.171 -35.457 -16.836 1.00 25.79 ? 242 LEU B CA  1 
ATOM   4363 C  C   . LEU B 1 239 ? 21.480 -34.818 -15.485 1.00 25.71 ? 242 LEU B C   1 
ATOM   4364 O  O   . LEU B 1 239 ? 21.784 -35.511 -14.512 1.00 25.56 ? 242 LEU B O   1 
ATOM   4365 C  CB  . LEU B 1 239 ? 22.375 -35.285 -17.769 1.00 24.25 ? 242 LEU B CB  1 
ATOM   4366 C  CG  . LEU B 1 239 ? 23.670 -35.790 -17.125 1.00 25.03 ? 242 LEU B CG  1 
ATOM   4367 C  CD1 . LEU B 1 239 ? 23.462 -37.244 -16.741 1.00 22.70 ? 242 LEU B CD1 1 
ATOM   4368 C  CD2 . LEU B 1 239 ? 24.864 -35.644 -18.075 1.00 23.82 ? 242 LEU B CD2 1 
ATOM   4369 N  N   . MET B 1 240 ? 21.401 -33.493 -15.428 1.00 25.06 ? 243 MET B N   1 
ATOM   4370 C  CA  . MET B 1 240 ? 21.735 -32.770 -14.216 1.00 24.92 ? 243 MET B CA  1 
ATOM   4371 C  C   . MET B 1 240 ? 20.686 -32.986 -13.141 1.00 26.63 ? 243 MET B C   1 
ATOM   4372 O  O   . MET B 1 240 ? 21.002 -32.997 -11.950 1.00 26.16 ? 243 MET B O   1 
ATOM   4373 C  CB  . MET B 1 240 ? 21.894 -31.274 -14.518 1.00 27.24 ? 243 MET B CB  1 
ATOM   4374 C  CG  . MET B 1 240 ? 23.181 -30.931 -15.272 1.00 25.78 ? 243 MET B CG  1 
ATOM   4375 S  SD  . MET B 1 240 ? 24.689 -31.432 -14.377 1.00 27.88 ? 243 MET B SD  1 
ATOM   4376 C  CE  . MET B 1 240 ? 25.960 -31.088 -15.601 1.00 25.37 ? 243 MET B CE  1 
ATOM   4377 N  N   . GLU B 1 241 ? 19.437 -33.176 -13.556 1.00 27.26 ? 244 GLU B N   1 
ATOM   4378 C  CA  . GLU B 1 241 ? 18.384 -33.520 -12.610 1.00 27.25 ? 244 GLU B CA  1 
ATOM   4379 C  C   . GLU B 1 241 ? 18.695 -34.845 -11.918 1.00 27.59 ? 244 GLU B C   1 
ATOM   4380 O  O   . GLU B 1 241 ? 18.517 -34.974 -10.703 1.00 26.42 ? 244 GLU B O   1 
ATOM   4381 C  CB  . GLU B 1 241 ? 17.033 -33.616 -13.323 1.00 30.99 ? 244 GLU B CB  1 
ATOM   4382 C  CG  . GLU B 1 241 ? 15.933 -34.206 -12.460 1.00 35.56 ? 244 GLU B CG  1 
ATOM   4383 C  CD  . GLU B 1 241 ? 14.565 -34.161 -13.122 1.00 41.55 ? 244 GLU B CD  1 
ATOM   4384 O  OE1 . GLU B 1 241 ? 13.819 -33.183 -12.885 1.00 43.44 ? 244 GLU B OE1 1 
ATOM   4385 O  OE2 . GLU B 1 241 ? 14.233 -35.106 -13.871 1.00 41.90 ? 244 GLU B OE2 1 
ATOM   4386 N  N   . ALA B 1 242 ? 19.162 -35.827 -12.688 1.00 24.08 ? 245 ALA B N   1 
ATOM   4387 C  CA  . ALA B 1 242 ? 19.526 -37.124 -12.122 1.00 25.05 ? 245 ALA B CA  1 
ATOM   4388 C  C   . ALA B 1 242 ? 20.672 -36.982 -11.130 1.00 24.96 ? 245 ALA B C   1 
ATOM   4389 O  O   . ALA B 1 242 ? 20.750 -37.723 -10.152 1.00 26.97 ? 245 ALA B O   1 
ATOM   4390 C  CB  . ALA B 1 242 ? 19.923 -38.105 -13.239 1.00 23.63 ? 245 ALA B CB  1 
ATOM   4391 N  N   . LEU B 1 243 ? 21.568 -36.033 -11.391 1.00 25.09 ? 246 LEU B N   1 
ATOM   4392 C  CA  . LEU B 1 243 ? 22.738 -35.832 -10.546 1.00 22.88 ? 246 LEU B CA  1 
ATOM   4393 C  C   . LEU B 1 243 ? 22.450 -34.890 -9.374  1.00 24.19 ? 246 LEU B C   1 
ATOM   4394 O  O   . LEU B 1 243 ? 23.282 -34.736 -8.484  1.00 24.76 ? 246 LEU B O   1 
ATOM   4395 C  CB  . LEU B 1 243 ? 23.897 -35.272 -11.374 1.00 22.23 ? 246 LEU B CB  1 
ATOM   4396 C  CG  . LEU B 1 243 ? 24.425 -36.108 -12.544 1.00 24.39 ? 246 LEU B CG  1 
ATOM   4397 C  CD1 . LEU B 1 243 ? 25.627 -35.401 -13.165 1.00 18.86 ? 246 LEU B CD1 1 
ATOM   4398 C  CD2 . LEU B 1 243 ? 24.811 -37.517 -12.059 1.00 21.48 ? 246 LEU B CD2 1 
ATOM   4399 N  N   . GLY B 1 244 ? 21.280 -34.258 -9.379  1.00 23.14 ? 247 GLY B N   1 
ATOM   4400 C  CA  . GLY B 1 244 ? 20.955 -33.312 -8.322  1.00 24.93 ? 247 GLY B CA  1 
ATOM   4401 C  C   . GLY B 1 244 ? 21.824 -32.063 -8.346  1.00 25.48 ? 247 GLY B C   1 
ATOM   4402 O  O   . GLY B 1 244 ? 21.964 -31.368 -7.335  1.00 27.07 ? 247 GLY B O   1 
ATOM   4403 N  N   . ALA B 1 245 ? 22.414 -31.780 -9.501  1.00 25.42 ? 248 ALA B N   1 
ATOM   4404 C  CA  . ALA B 1 245 ? 23.251 -30.607 -9.666  1.00 26.37 ? 248 ALA B CA  1 
ATOM   4405 C  C   . ALA B 1 245 ? 22.387 -29.358 -9.834  1.00 27.79 ? 248 ALA B C   1 
ATOM   4406 O  O   . ALA B 1 245 ? 21.230 -29.433 -10.249 1.00 27.75 ? 248 ALA B O   1 
ATOM   4407 C  CB  . ALA B 1 245 ? 24.174 -30.790 -10.877 1.00 26.05 ? 248 ALA B CB  1 
ATOM   4408 N  N   . LYS B 1 246 ? 22.952 -28.213 -9.479  1.00 28.90 ? 249 LYS B N   1 
ATOM   4409 C  CA  . LYS B 1 246 ? 22.269 -26.931 -9.620  1.00 28.84 ? 249 LYS B CA  1 
ATOM   4410 C  C   . LYS B 1 246 ? 22.941 -26.094 -10.713 1.00 27.53 ? 249 LYS B C   1 
ATOM   4411 O  O   . LYS B 1 246 ? 24.153 -26.146 -10.899 1.00 27.90 ? 249 LYS B O   1 
ATOM   4412 C  CB  . LYS B 1 246 ? 22.308 -26.167 -8.293  1.00 29.68 ? 249 LYS B CB  1 
ATOM   4413 C  CG  . LYS B 1 246 ? 21.041 -26.283 -7.459  1.00 36.95 ? 249 LYS B CG  1 
ATOM   4414 C  CD  . LYS B 1 246 ? 20.620 -27.729 -7.268  1.00 38.33 ? 249 LYS B CD  1 
ATOM   4415 C  CE  . LYS B 1 246 ? 19.340 -27.818 -6.446  1.00 40.55 ? 249 LYS B CE  1 
ATOM   4416 N  NZ  . LYS B 1 246 ? 19.460 -27.057 -5.165  1.00 40.61 ? 249 LYS B NZ  1 
ATOM   4417 N  N   . LYS B 1 247 ? 22.146 -25.322 -11.433 1.00 28.03 ? 250 LYS B N   1 
ATOM   4418 C  CA  . LYS B 1 247 ? 22.681 -24.457 -12.467 1.00 29.35 ? 250 LYS B CA  1 
ATOM   4419 C  C   . LYS B 1 247 ? 23.111 -23.137 -11.841 1.00 31.09 ? 250 LYS B C   1 
ATOM   4420 O  O   . LYS B 1 247 ? 22.381 -22.554 -11.040 1.00 30.81 ? 250 LYS B O   1 
ATOM   4421 C  CB  . LYS B 1 247 ? 21.618 -24.213 -13.541 1.00 30.56 ? 250 LYS B CB  1 
ATOM   4422 C  CG  . LYS B 1 247 ? 22.087 -23.370 -14.708 1.00 32.45 ? 250 LYS B CG  1 
ATOM   4423 C  CD  . LYS B 1 247 ? 23.275 -24.017 -15.399 1.00 38.45 ? 250 LYS B CD  1 
ATOM   4424 C  CE  . LYS B 1 247 ? 23.690 -23.208 -16.618 1.00 40.62 ? 250 LYS B CE  1 
ATOM   4425 N  NZ  . LYS B 1 247 ? 22.505 -22.883 -17.469 1.00 42.78 ? 250 LYS B NZ  1 
ATOM   4426 N  N   . ARG B 1 248 ? 24.313 -22.686 -12.186 1.00 32.71 ? 251 ARG B N   1 
ATOM   4427 C  CA  . ARG B 1 248 ? 24.724 -21.320 -11.908 1.00 33.84 ? 251 ARG B CA  1 
ATOM   4428 C  C   . ARG B 1 248 ? 24.947 -20.591 -13.225 1.00 35.67 ? 251 ARG B C   1 
ATOM   4429 O  O   . ARG B 1 248 ? 24.645 -21.123 -14.300 1.00 36.09 ? 251 ARG B O   1 
ATOM   4430 C  CB  . ARG B 1 248 ? 26.006 -21.297 -11.079 1.00 34.20 ? 251 ARG B CB  1 
ATOM   4431 C  CG  . ARG B 1 248 ? 25.844 -21.867 -9.684  1.00 35.25 ? 251 ARG B CG  1 
ATOM   4432 C  CD  . ARG B 1 248 ? 26.950 -21.385 -8.765  1.00 38.50 ? 251 ARG B CD  1 
ATOM   4433 N  NE  . ARG B 1 248 ? 28.284 -21.687 -9.280  1.00 41.45 ? 251 ARG B NE  1 
ATOM   4434 C  CZ  . ARG B 1 248 ? 29.405 -21.502 -8.590  1.00 42.59 ? 251 ARG B CZ  1 
ATOM   4435 N  NH1 . ARG B 1 248 ? 29.349 -21.014 -7.357  1.00 42.89 ? 251 ARG B NH1 1 
ATOM   4436 N  NH2 . ARG B 1 248 ? 30.580 -21.808 -9.125  1.00 41.28 ? 251 ARG B NH2 1 
ATOM   4437 N  N   . LEU B 1 249 ? 25.479 -19.378 -13.150 1.00 34.86 ? 252 LEU B N   1 
ATOM   4438 C  CA  . LEU B 1 249 ? 25.647 -18.573 -14.350 1.00 37.08 ? 252 LEU B CA  1 
ATOM   4439 C  C   . LEU B 1 249 ? 26.542 -19.253 -15.370 1.00 36.80 ? 252 LEU B C   1 
ATOM   4440 O  O   . LEU B 1 249 ? 26.218 -19.305 -16.550 1.00 38.88 ? 252 LEU B O   1 
ATOM   4441 C  CB  . LEU B 1 249 ? 26.236 -17.202 -14.013 1.00 37.88 ? 252 LEU B CB  1 
ATOM   4442 C  CG  . LEU B 1 249 ? 26.429 -16.325 -15.253 1.00 40.65 ? 252 LEU B CG  1 
ATOM   4443 C  CD1 . LEU B 1 249 ? 25.110 -16.258 -16.022 1.00 42.17 ? 252 LEU B CD1 1 
ATOM   4444 C  CD2 . LEU B 1 249 ? 26.894 -14.934 -14.857 1.00 41.48 ? 252 LEU B CD2 1 
ATOM   4445 N  N   . PHE B 1 250 ? 27.675 -19.770 -14.916 1.00 38.40 ? 253 PHE B N   1 
ATOM   4446 C  CA  . PHE B 1 250 ? 28.679 -20.286 -15.836 1.00 38.72 ? 253 PHE B CA  1 
ATOM   4447 C  C   . PHE B 1 250 ? 28.800 -21.812 -15.844 1.00 39.35 ? 253 PHE B C   1 
ATOM   4448 O  O   . PHE B 1 250 ? 29.639 -22.364 -16.563 1.00 39.71 ? 253 PHE B O   1 
ATOM   4449 C  CB  . PHE B 1 250 ? 30.044 -19.667 -15.518 1.00 38.32 ? 253 PHE B CB  1 
ATOM   4450 C  CG  . PHE B 1 250 ? 30.091 -18.170 -15.694 1.00 40.51 ? 253 PHE B CG  1 
ATOM   4451 C  CD1 . PHE B 1 250 ? 29.478 -17.561 -16.783 1.00 40.37 ? 253 PHE B CD1 1 
ATOM   4452 C  CD2 . PHE B 1 250 ? 30.762 -17.369 -14.776 1.00 40.10 ? 253 PHE B CD2 1 
ATOM   4453 C  CE1 . PHE B 1 250 ? 29.535 -16.181 -16.951 1.00 39.75 ? 253 PHE B CE1 1 
ATOM   4454 C  CE2 . PHE B 1 250 ? 30.823 -15.992 -14.939 1.00 38.78 ? 253 PHE B CE2 1 
ATOM   4455 C  CZ  . PHE B 1 250 ? 30.208 -15.397 -16.027 1.00 39.69 ? 253 PHE B CZ  1 
ATOM   4456 N  N   . ASP B 1 251 ? 27.973 -22.500 -15.061 1.00 37.30 ? 254 ASP B N   1 
ATOM   4457 C  CA  . ASP B 1 251 ? 28.171 -23.935 -14.892 1.00 34.70 ? 254 ASP B CA  1 
ATOM   4458 C  C   . ASP B 1 251 ? 27.136 -24.635 -14.023 1.00 31.88 ? 254 ASP B C   1 
ATOM   4459 O  O   . ASP B 1 251 ? 26.206 -24.021 -13.503 1.00 33.51 ? 254 ASP B O   1 
ATOM   4460 C  CB  . ASP B 1 251 ? 29.573 -24.189 -14.324 1.00 36.96 ? 254 ASP B CB  1 
ATOM   4461 C  CG  . ASP B 1 251 ? 29.860 -23.368 -13.072 1.00 40.05 ? 254 ASP B CG  1 
ATOM   4462 O  OD1 . ASP B 1 251 ? 28.940 -22.682 -12.570 1.00 42.76 ? 254 ASP B OD1 1 
ATOM   4463 O  OD2 . ASP B 1 251 ? 31.010 -23.409 -12.586 1.00 42.31 ? 254 ASP B OD2 1 
ATOM   4464 N  N   . TYR B 1 252 ? 27.303 -25.943 -13.883 1.00 30.19 ? 255 TYR B N   1 
ATOM   4465 C  CA  . TYR B 1 252 ? 26.507 -26.729 -12.956 1.00 27.43 ? 255 TYR B CA  1 
ATOM   4466 C  C   . TYR B 1 252 ? 27.385 -27.104 -11.765 1.00 24.23 ? 255 TYR B C   1 
ATOM   4467 O  O   . TYR B 1 252 ? 28.574 -27.326 -11.926 1.00 21.99 ? 255 TYR B O   1 
ATOM   4468 C  CB  . TYR B 1 252 ? 26.002 -27.992 -13.650 1.00 29.18 ? 255 TYR B CB  1 
ATOM   4469 C  CG  . TYR B 1 252 ? 24.801 -27.780 -14.542 1.00 30.89 ? 255 TYR B CG  1 
ATOM   4470 C  CD1 . TYR B 1 252 ? 23.516 -27.765 -14.012 1.00 32.10 ? 255 TYR B CD1 1 
ATOM   4471 C  CD2 . TYR B 1 252 ? 24.944 -27.640 -15.918 1.00 32.36 ? 255 TYR B CD2 1 
ATOM   4472 C  CE1 . TYR B 1 252 ? 22.405 -27.623 -14.828 1.00 33.17 ? 255 TYR B CE1 1 
ATOM   4473 C  CE2 . TYR B 1 252 ? 23.838 -27.495 -16.744 1.00 33.03 ? 255 TYR B CE2 1 
ATOM   4474 C  CZ  . TYR B 1 252 ? 22.573 -27.491 -16.191 1.00 33.81 ? 255 TYR B CZ  1 
ATOM   4475 O  OH  . TYR B 1 252 ? 21.466 -27.372 -17.000 1.00 35.32 ? 255 TYR B OH  1 
ATOM   4476 N  N   . VAL B 1 253 ? 26.795 -27.164 -10.576 1.00 24.02 ? 256 VAL B N   1 
ATOM   4477 C  CA  . VAL B 1 253 ? 27.527 -27.545 -9.372  1.00 25.57 ? 256 VAL B CA  1 
ATOM   4478 C  C   . VAL B 1 253 ? 26.766 -28.534 -8.490  1.00 25.87 ? 256 VAL B C   1 
ATOM   4479 O  O   . VAL B 1 253 ? 25.537 -28.646 -8.560  1.00 27.31 ? 256 VAL B O   1 
ATOM   4480 C  CB  . VAL B 1 253 ? 27.869 -26.307 -8.503  1.00 27.63 ? 256 VAL B CB  1 
ATOM   4481 C  CG1 . VAL B 1 253 ? 28.886 -25.436 -9.210  1.00 29.52 ? 256 VAL B CG1 1 
ATOM   4482 C  CG2 . VAL B 1 253 ? 26.604 -25.505 -8.228  1.00 29.30 ? 256 VAL B CG2 1 
ATOM   4483 N  N   . VAL B 1 254 ? 27.517 -29.248 -7.659  1.00 26.17 ? 257 VAL B N   1 
ATOM   4484 C  CA  . VAL B 1 254 ? 26.948 -30.001 -6.554  1.00 26.59 ? 257 VAL B CA  1 
ATOM   4485 C  C   . VAL B 1 254 ? 27.680 -29.576 -5.287  1.00 27.19 ? 257 VAL B C   1 
ATOM   4486 O  O   . VAL B 1 254 ? 28.782 -29.030 -5.358  1.00 25.77 ? 257 VAL B O   1 
ATOM   4487 C  CB  . VAL B 1 254 ? 27.124 -31.522 -6.768  1.00 26.86 ? 257 VAL B CB  1 
ATOM   4488 C  CG1 . VAL B 1 254 ? 26.391 -31.951 -8.035  1.00 27.46 ? 257 VAL B CG1 1 
ATOM   4489 C  CG2 . VAL B 1 254 ? 28.604 -31.871 -6.870  1.00 26.79 ? 257 VAL B CG2 1 
ATOM   4490 N  N   . LYS B 1 255 ? 27.067 -29.806 -4.130  1.00 26.63 ? 258 LYS B N   1 
ATOM   4491 C  CA  . LYS B 1 255 ? 27.763 -29.608 -2.866  1.00 26.77 ? 258 LYS B CA  1 
ATOM   4492 C  C   . LYS B 1 255 ? 28.997 -30.501 -2.923  1.00 27.04 ? 258 LYS B C   1 
ATOM   4493 O  O   . LYS B 1 255 ? 28.909 -31.653 -3.348  1.00 24.94 ? 258 LYS B O   1 
ATOM   4494 C  CB  . LYS B 1 255 ? 26.864 -30.025 -1.701  1.00 30.56 ? 258 LYS B CB  1 
ATOM   4495 C  CG  . LYS B 1 255 ? 25.459 -29.456 -1.776  1.00 33.48 ? 258 LYS B CG  1 
ATOM   4496 C  CD  . LYS B 1 255 ? 24.665 -29.742 -0.517  1.00 36.74 ? 258 LYS B CD  1 
ATOM   4497 C  CE  . LYS B 1 255 ? 25.229 -28.976 0.667   1.00 41.15 ? 258 LYS B CE  1 
ATOM   4498 N  NZ  . LYS B 1 255 ? 24.337 -29.053 1.860   1.00 43.50 ? 258 LYS B NZ  1 
ATOM   4499 N  N   . CYS B 1 256 ? 30.145 -29.973 -2.514  1.00 27.66 ? 259 CYS B N   1 
ATOM   4500 C  CA  . CYS B 1 256 ? 31.409 -30.670 -2.735  1.00 28.80 ? 259 CYS B CA  1 
ATOM   4501 C  C   . CYS B 1 256 ? 31.473 -32.012 -2.016  1.00 29.82 ? 259 CYS B C   1 
ATOM   4502 O  O   . CYS B 1 256 ? 32.083 -32.959 -2.507  1.00 29.44 ? 259 CYS B O   1 
ATOM   4503 C  CB  . CYS B 1 256 ? 32.580 -29.797 -2.292  1.00 28.45 ? 259 CYS B CB  1 
ATOM   4504 S  SG  . CYS B 1 256 ? 32.773 -28.289 -3.255  1.00 28.72 ? 259 CYS B SG  1 
ATOM   4505 N  N   . ASN B 1 257 ? 30.837 -32.099 -0.855  1.00 30.08 ? 260 ASN B N   1 
ATOM   4506 C  CA  . ASN B 1 257 ? 30.903 -33.318 -0.067  1.00 28.88 ? 260 ASN B CA  1 
ATOM   4507 C  C   . ASN B 1 257 ? 30.082 -34.422 -0.728  1.00 30.02 ? 260 ASN B C   1 
ATOM   4508 O  O   . ASN B 1 257 ? 30.239 -35.597 -0.402  1.00 29.70 ? 260 ASN B O   1 
ATOM   4509 C  CB  . ASN B 1 257 ? 30.366 -33.060 1.339   1.00 29.15 ? 260 ASN B CB  1 
ATOM   4510 C  CG  . ASN B 1 257 ? 28.878 -32.798 1.342   1.00 27.28 ? 260 ASN B CG  1 
ATOM   4511 O  OD1 . ASN B 1 257 ? 28.390 -31.965 0.584   1.00 28.73 ? 260 ASN B OD1 1 
ATOM   4512 N  ND2 . ASN B 1 257 ? 28.148 -33.517 2.180   1.00 26.91 ? 260 ASN B ND2 1 
ATOM   4513 N  N   . GLU B 1 258 ? 29.198 -34.046 -1.650  1.00 30.53 ? 261 GLU B N   1 
ATOM   4514 C  CA  . GLU B 1 258 ? 28.298 -35.021 -2.269  1.00 30.57 ? 261 GLU B CA  1 
ATOM   4515 C  C   . GLU B 1 258 ? 28.873 -35.600 -3.566  1.00 29.33 ? 261 GLU B C   1 
ATOM   4516 O  O   . GLU B 1 258 ? 28.421 -36.641 -4.050  1.00 25.93 ? 261 GLU B O   1 
ATOM   4517 C  CB  . GLU B 1 258 ? 26.934 -34.374 -2.524  1.00 33.68 ? 261 GLU B CB  1 
ATOM   4518 C  CG  . GLU B 1 258 ? 26.379 -33.684 -1.275  1.00 40.32 ? 261 GLU B CG  1 
ATOM   4519 C  CD  . GLU B 1 258 ? 24.860 -33.613 -1.237  1.00 43.15 ? 261 GLU B CD  1 
ATOM   4520 O  OE1 . GLU B 1 258 ? 24.271 -32.822 -2.008  1.00 43.92 ? 261 GLU B OE1 1 
ATOM   4521 O  OE2 . GLU B 1 258 ? 24.257 -34.344 -0.423  1.00 44.08 ? 261 GLU B OE2 1 
ATOM   4522 N  N   . GLY B 1 259 ? 29.888 -34.927 -4.103  1.00 27.88 ? 262 GLY B N   1 
ATOM   4523 C  CA  . GLY B 1 259 ? 30.500 -35.345 -5.350  1.00 26.21 ? 262 GLY B CA  1 
ATOM   4524 C  C   . GLY B 1 259 ? 30.935 -36.797 -5.410  1.00 26.59 ? 262 GLY B C   1 
ATOM   4525 O  O   . GLY B 1 259 ? 30.562 -37.505 -6.341  1.00 25.13 ? 262 GLY B O   1 
ATOM   4526 N  N   . PRO B 1 260 ? 31.720 -37.273 -4.431  1.00 25.75 ? 263 PRO B N   1 
ATOM   4527 C  CA  . PRO B 1 260 ? 32.291 -38.625 -4.460  1.00 26.85 ? 263 PRO B CA  1 
ATOM   4528 C  C   . PRO B 1 260 ? 31.268 -39.754 -4.583  1.00 28.17 ? 263 PRO B C   1 
ATOM   4529 O  O   . PRO B 1 260 ? 31.592 -40.835 -5.072  1.00 28.71 ? 263 PRO B O   1 
ATOM   4530 C  CB  . PRO B 1 260 ? 33.087 -38.715 -3.158  1.00 26.35 ? 263 PRO B CB  1 
ATOM   4531 C  CG  . PRO B 1 260 ? 33.420 -37.290 -2.833  1.00 26.88 ? 263 PRO B CG  1 
ATOM   4532 C  CD  . PRO B 1 260 ? 32.223 -36.492 -3.286  1.00 27.01 ? 263 PRO B CD  1 
ATOM   4533 N  N   . THR B 1 261 ? 30.038 -39.521 -4.151  1.00 28.46 ? 264 THR B N   1 
ATOM   4534 C  CA  . THR B 1 261 ? 29.037 -40.569 -4.302  1.00 29.27 ? 264 THR B CA  1 
ATOM   4535 C  C   . THR B 1 261 ? 27.969 -40.302 -5.362  1.00 27.03 ? 264 THR B C   1 
ATOM   4536 O  O   . THR B 1 261 ? 26.934 -40.964 -5.375  1.00 26.21 ? 264 THR B O   1 
ATOM   4537 C  CB  . THR B 1 261 ? 28.348 -40.894 -2.961  1.00 29.36 ? 264 THR B CB  1 
ATOM   4538 O  OG1 . THR B 1 261 ? 27.868 -39.685 -2.360  1.00 29.09 ? 264 THR B OG1 1 
ATOM   4539 C  CG2 . THR B 1 261 ? 29.328 -41.609 -2.022  1.00 29.11 ? 264 THR B CG2 1 
ATOM   4540 N  N   . LEU B 1 262 ? 28.220 -39.350 -6.256  1.00 24.26 ? 265 LEU B N   1 
ATOM   4541 C  CA  . LEU B 1 262 ? 27.397 -39.241 -7.459  1.00 24.74 ? 265 LEU B CA  1 
ATOM   4542 C  C   . LEU B 1 262 ? 27.572 -40.519 -8.259  1.00 22.31 ? 265 LEU B C   1 
ATOM   4543 O  O   . LEU B 1 262 ? 28.588 -41.191 -8.140  1.00 22.80 ? 265 LEU B O   1 
ATOM   4544 C  CB  . LEU B 1 262 ? 27.831 -38.050 -8.315  1.00 25.07 ? 265 LEU B CB  1 
ATOM   4545 C  CG  . LEU B 1 262 ? 27.667 -36.654 -7.716  1.00 25.58 ? 265 LEU B CG  1 
ATOM   4546 C  CD1 . LEU B 1 262 ? 27.962 -35.619 -8.787  1.00 26.74 ? 265 LEU B CD1 1 
ATOM   4547 C  CD2 . LEU B 1 262 ? 26.255 -36.481 -7.175  1.00 26.44 ? 265 LEU B CD2 1 
ATOM   4548 N  N   . PRO B 1 263 ? 26.576 -40.880 -9.078  1.00 22.83 ? 266 PRO B N   1 
ATOM   4549 C  CA  . PRO B 1 263 ? 26.629 -42.106 -9.886  1.00 21.81 ? 266 PRO B CA  1 
ATOM   4550 C  C   . PRO B 1 263 ? 27.527 -41.997 -11.121 1.00 23.04 ? 266 PRO B C   1 
ATOM   4551 O  O   . PRO B 1 263 ? 27.734 -40.910 -11.655 1.00 22.44 ? 266 PRO B O   1 
ATOM   4552 C  CB  . PRO B 1 263 ? 25.173 -42.345 -10.266 1.00 22.02 ? 266 PRO B CB  1 
ATOM   4553 C  CG  . PRO B 1 263 ? 24.575 -40.976 -10.293 1.00 22.49 ? 266 PRO B CG  1 
ATOM   4554 C  CD  . PRO B 1 263 ? 25.283 -40.189 -9.206  1.00 22.38 ? 266 PRO B CD  1 
ATOM   4555 N  N   . ASP B 1 264 ? 28.054 -43.132 -11.577 1.00 23.90 ? 267 ASP B N   1 
ATOM   4556 C  CA  . ASP B 1 264 ? 28.792 -43.167 -12.835 1.00 23.66 ? 267 ASP B CA  1 
ATOM   4557 C  C   . ASP B 1 264 ? 27.952 -42.617 -13.984 1.00 23.37 ? 267 ASP B C   1 
ATOM   4558 O  O   . ASP B 1 264 ? 26.726 -42.691 -13.959 1.00 23.51 ? 267 ASP B O   1 
ATOM   4559 C  CB  . ASP B 1 264 ? 29.207 -44.593 -13.168 1.00 26.00 ? 267 ASP B CB  1 
ATOM   4560 C  CG  . ASP B 1 264 ? 30.247 -45.124 -12.225 1.00 27.00 ? 267 ASP B CG  1 
ATOM   4561 O  OD1 . ASP B 1 264 ? 30.731 -44.338 -11.387 1.00 27.87 ? 267 ASP B OD1 1 
ATOM   4562 O  OD2 . ASP B 1 264 ? 30.583 -46.325 -12.326 1.00 30.15 ? 267 ASP B OD2 1 
ATOM   4563 N  N   . ILE B 1 265 ? 28.622 -42.064 -14.988 1.00 23.09 ? 268 ILE B N   1 
ATOM   4564 C  CA  . ILE B 1 265 ? 27.971 -41.710 -16.250 1.00 24.58 ? 268 ILE B CA  1 
ATOM   4565 C  C   . ILE B 1 265 ? 28.597 -42.535 -17.384 1.00 25.41 ? 268 ILE B C   1 
ATOM   4566 O  O   . ILE B 1 265 ? 29.823 -42.658 -17.461 1.00 24.82 ? 268 ILE B O   1 
ATOM   4567 C  CB  . ILE B 1 265 ? 28.148 -40.212 -16.564 1.00 24.77 ? 268 ILE B CB  1 
ATOM   4568 C  CG1 . ILE B 1 265 ? 27.550 -39.375 -15.434 1.00 26.30 ? 268 ILE B CG1 1 
ATOM   4569 C  CG2 . ILE B 1 265 ? 27.465 -39.869 -17.891 1.00 26.52 ? 268 ILE B CG2 1 
ATOM   4570 C  CD1 . ILE B 1 265 ? 27.582 -37.872 -15.695 1.00 27.78 ? 268 ILE B CD1 1 
ATOM   4571 N  N   . SER B 1 266 ? 27.764 -43.100 -18.254 1.00 25.20 ? 269 SER B N   1 
ATOM   4572 C  CA  . SER B 1 266 ? 28.265 -43.978 -19.315 1.00 27.54 ? 269 SER B CA  1 
ATOM   4573 C  C   . SER B 1 266 ? 27.779 -43.624 -20.716 1.00 27.44 ? 269 SER B C   1 
ATOM   4574 O  O   . SER B 1 266 ? 26.597 -43.348 -20.929 1.00 29.08 ? 269 SER B O   1 
ATOM   4575 C  CB  . SER B 1 266 ? 27.899 -45.432 -19.010 1.00 26.77 ? 269 SER B CB  1 
ATOM   4576 O  OG  . SER B 1 266 ? 28.721 -45.931 -17.969 1.00 32.24 ? 269 SER B OG  1 
ATOM   4577 N  N   . PHE B 1 267 ? 28.705 -43.649 -21.669 1.00 26.93 ? 270 PHE B N   1 
ATOM   4578 C  CA  . PHE B 1 267 ? 28.378 -43.405 -23.063 1.00 27.43 ? 270 PHE B CA  1 
ATOM   4579 C  C   . PHE B 1 267 ? 28.544 -44.685 -23.881 1.00 29.11 ? 270 PHE B C   1 
ATOM   4580 O  O   . PHE B 1 267 ? 29.605 -45.313 -23.880 1.00 29.16 ? 270 PHE B O   1 
ATOM   4581 C  CB  . PHE B 1 267 ? 29.277 -42.300 -23.617 1.00 25.98 ? 270 PHE B CB  1 
ATOM   4582 C  CG  . PHE B 1 267 ? 29.282 -41.060 -22.778 1.00 26.92 ? 270 PHE B CG  1 
ATOM   4583 C  CD1 . PHE B 1 267 ? 28.418 -40.013 -23.058 1.00 28.07 ? 270 PHE B CD1 1 
ATOM   4584 C  CD2 . PHE B 1 267 ? 30.110 -40.962 -21.672 1.00 26.96 ? 270 PHE B CD2 1 
ATOM   4585 C  CE1 . PHE B 1 267 ? 28.375 -38.888 -22.242 1.00 26.66 ? 270 PHE B CE1 1 
ATOM   4586 C  CE2 . PHE B 1 267 ? 30.074 -39.843 -20.853 1.00 27.89 ? 270 PHE B CE2 1 
ATOM   4587 C  CZ  . PHE B 1 267 ? 29.202 -38.806 -21.139 1.00 25.21 ? 270 PHE B CZ  1 
ATOM   4588 N  N   . HIS B 1 268 ? 27.486 -45.070 -24.580 1.00 30.53 ? 271 HIS B N   1 
ATOM   4589 C  CA  . HIS B 1 268 ? 27.513 -46.292 -25.366 1.00 31.94 ? 271 HIS B CA  1 
ATOM   4590 C  C   . HIS B 1 268 ? 28.037 -45.973 -26.764 1.00 30.14 ? 271 HIS B C   1 
ATOM   4591 O  O   . HIS B 1 268 ? 27.346 -45.346 -27.571 1.00 29.26 ? 271 HIS B O   1 
ATOM   4592 C  CB  . HIS B 1 268 ? 26.107 -46.890 -25.448 1.00 35.45 ? 271 HIS B CB  1 
ATOM   4593 C  CG  . HIS B 1 268 ? 26.088 -48.323 -25.876 1.00 42.49 ? 271 HIS B CG  1 
ATOM   4594 N  ND1 . HIS B 1 268 ? 26.680 -49.327 -25.139 1.00 44.66 ? 271 HIS B ND1 1 
ATOM   4595 C  CD2 . HIS B 1 268 ? 25.547 -48.923 -26.963 1.00 44.36 ? 271 HIS B CD2 1 
ATOM   4596 C  CE1 . HIS B 1 268 ? 26.504 -50.484 -25.754 1.00 45.11 ? 271 HIS B CE1 1 
ATOM   4597 N  NE2 . HIS B 1 268 ? 25.819 -50.267 -26.863 1.00 45.06 ? 271 HIS B NE2 1 
ATOM   4598 N  N   . LEU B 1 269 ? 29.269 -46.393 -27.033 1.00 27.83 ? 272 LEU B N   1 
ATOM   4599 C  CA  . LEU B 1 269 ? 29.900 -46.129 -28.319 1.00 30.13 ? 272 LEU B CA  1 
ATOM   4600 C  C   . LEU B 1 269 ? 30.468 -47.421 -28.906 1.00 30.85 ? 272 LEU B C   1 
ATOM   4601 O  O   . LEU B 1 269 ? 31.141 -48.188 -28.211 1.00 29.75 ? 272 LEU B O   1 
ATOM   4602 C  CB  . LEU B 1 269 ? 31.019 -45.102 -28.151 1.00 30.04 ? 272 LEU B CB  1 
ATOM   4603 C  CG  . LEU B 1 269 ? 30.663 -43.839 -27.357 1.00 31.14 ? 272 LEU B CG  1 
ATOM   4604 C  CD1 . LEU B 1 269 ? 31.939 -43.061 -27.020 1.00 29.61 ? 272 LEU B CD1 1 
ATOM   4605 C  CD2 . LEU B 1 269 ? 29.708 -42.981 -28.164 1.00 28.93 ? 272 LEU B CD2 1 
ATOM   4606 N  N   . GLY B 1 270 ? 30.186 -47.662 -30.184 1.00 30.98 ? 273 GLY B N   1 
ATOM   4607 C  CA  . GLY B 1 270 ? 30.690 -48.858 -30.833 1.00 32.60 ? 273 GLY B CA  1 
ATOM   4608 C  C   . GLY B 1 270 ? 30.375 -50.124 -30.058 1.00 33.06 ? 273 GLY B C   1 
ATOM   4609 O  O   . GLY B 1 270 ? 31.185 -51.051 -30.015 1.00 32.75 ? 273 GLY B O   1 
ATOM   4610 N  N   . GLY B 1 271 ? 29.204 -50.155 -29.427 1.00 33.51 ? 274 GLY B N   1 
ATOM   4611 C  CA  . GLY B 1 271 ? 28.776 -51.340 -28.706 1.00 34.16 ? 274 GLY B CA  1 
ATOM   4612 C  C   . GLY B 1 271 ? 29.392 -51.547 -27.330 1.00 36.15 ? 274 GLY B C   1 
ATOM   4613 O  O   . GLY B 1 271 ? 29.156 -52.583 -26.704 1.00 36.99 ? 274 GLY B O   1 
ATOM   4614 N  N   . LYS B 1 272 ? 30.179 -50.583 -26.852 1.00 35.48 ? 275 LYS B N   1 
ATOM   4615 C  CA  . LYS B 1 272 ? 30.819 -50.702 -25.537 1.00 35.46 ? 275 LYS B CA  1 
ATOM   4616 C  C   . LYS B 1 272 ? 30.494 -49.512 -24.634 1.00 33.85 ? 275 LYS B C   1 
ATOM   4617 O  O   . LYS B 1 272 ? 30.192 -48.425 -25.114 1.00 34.62 ? 275 LYS B O   1 
ATOM   4618 C  CB  . LYS B 1 272 ? 32.336 -50.822 -25.695 1.00 37.67 ? 275 LYS B CB  1 
ATOM   4619 C  CG  . LYS B 1 272 ? 32.781 -51.991 -26.555 1.00 39.37 ? 275 LYS B CG  1 
ATOM   4620 C  CD  . LYS B 1 272 ? 34.295 -52.080 -26.611 1.00 42.13 ? 275 LYS B CD  1 
ATOM   4621 C  CE  . LYS B 1 272 ? 34.746 -53.256 -27.460 1.00 44.98 ? 275 LYS B CE  1 
ATOM   4622 N  NZ  . LYS B 1 272 ? 36.135 -53.672 -27.114 1.00 47.19 ? 275 LYS B NZ  1 
ATOM   4623 N  N   . GLU B 1 273 ? 30.562 -49.724 -23.325 1.00 32.92 ? 276 GLU B N   1 
ATOM   4624 C  CA  . GLU B 1 273 ? 30.222 -48.678 -22.368 1.00 32.17 ? 276 GLU B CA  1 
ATOM   4625 C  C   . GLU B 1 273 ? 31.467 -47.918 -21.921 1.00 30.88 ? 276 GLU B C   1 
ATOM   4626 O  O   . GLU B 1 273 ? 32.365 -48.482 -21.306 1.00 29.58 ? 276 GLU B O   1 
ATOM   4627 C  CB  . GLU B 1 273 ? 29.522 -49.281 -21.146 1.00 34.54 ? 276 GLU B CB  1 
ATOM   4628 C  CG  . GLU B 1 273 ? 28.129 -49.830 -21.431 1.00 37.04 ? 276 GLU B CG  1 
ATOM   4629 C  CD  . GLU B 1 273 ? 27.141 -48.735 -21.820 1.00 41.51 ? 276 GLU B CD  1 
ATOM   4630 O  OE1 . GLU B 1 273 ? 27.524 -47.546 -21.759 1.00 41.48 ? 276 GLU B OE1 1 
ATOM   4631 O  OE2 . GLU B 1 273 ? 25.987 -49.057 -22.186 1.00 41.49 ? 276 GLU B OE2 1 
ATOM   4632 N  N   . TYR B 1 274 ? 31.515 -46.631 -22.239 1.00 28.37 ? 277 TYR B N   1 
ATOM   4633 C  CA  . TYR B 1 274 ? 32.601 -45.778 -21.781 1.00 27.11 ? 277 TYR B CA  1 
ATOM   4634 C  C   . TYR B 1 274 ? 32.133 -45.001 -20.559 1.00 27.14 ? 277 TYR B C   1 
ATOM   4635 O  O   . TYR B 1 274 ? 31.235 -44.160 -20.641 1.00 25.90 ? 277 TYR B O   1 
ATOM   4636 C  CB  . TYR B 1 274 ? 33.024 -44.819 -22.898 1.00 27.36 ? 277 TYR B CB  1 
ATOM   4637 C  CG  . TYR B 1 274 ? 33.803 -45.492 -24.010 1.00 28.47 ? 277 TYR B CG  1 
ATOM   4638 C  CD1 . TYR B 1 274 ? 35.182 -45.354 -24.096 1.00 29.92 ? 277 TYR B CD1 1 
ATOM   4639 C  CD2 . TYR B 1 274 ? 33.160 -46.266 -24.973 1.00 27.68 ? 277 TYR B CD2 1 
ATOM   4640 C  CE1 . TYR B 1 274 ? 35.902 -45.963 -25.106 1.00 27.62 ? 277 TYR B CE1 1 
ATOM   4641 C  CE2 . TYR B 1 274 ? 33.875 -46.878 -25.991 1.00 29.19 ? 277 TYR B CE2 1 
ATOM   4642 C  CZ  . TYR B 1 274 ? 35.243 -46.719 -26.052 1.00 27.66 ? 277 TYR B CZ  1 
ATOM   4643 O  OH  . TYR B 1 274 ? 35.960 -47.288 -27.077 1.00 27.70 ? 277 TYR B OH  1 
ATOM   4644 N  N   . THR B 1 275 ? 32.745 -45.297 -19.421 1.00 25.41 ? 278 THR B N   1 
ATOM   4645 C  CA  . THR B 1 275 ? 32.205 -44.868 -18.150 1.00 25.73 ? 278 THR B CA  1 
ATOM   4646 C  C   . THR B 1 275 ? 33.109 -43.853 -17.465 1.00 23.71 ? 278 THR B C   1 
ATOM   4647 O  O   . THR B 1 275 ? 34.319 -44.039 -17.396 1.00 22.17 ? 278 THR B O   1 
ATOM   4648 C  CB  . THR B 1 275 ? 31.998 -46.076 -17.226 1.00 26.21 ? 278 THR B CB  1 
ATOM   4649 O  OG1 . THR B 1 275 ? 31.147 -47.028 -17.882 1.00 26.64 ? 278 THR B OG1 1 
ATOM   4650 C  CG2 . THR B 1 275 ? 31.350 -45.643 -15.918 1.00 28.13 ? 278 THR B CG2 1 
ATOM   4651 N  N   . LEU B 1 276 ? 32.510 -42.775 -16.971 1.00 23.20 ? 279 LEU B N   1 
ATOM   4652 C  CA  . LEU B 1 276 ? 33.218 -41.812 -16.131 1.00 24.36 ? 279 LEU B CA  1 
ATOM   4653 C  C   . LEU B 1 276 ? 32.622 -41.844 -14.733 1.00 26.22 ? 279 LEU B C   1 
ATOM   4654 O  O   . LEU B 1 276 ? 31.405 -41.711 -14.568 1.00 26.63 ? 279 LEU B O   1 
ATOM   4655 C  CB  . LEU B 1 276 ? 33.079 -40.402 -16.703 1.00 23.98 ? 279 LEU B CB  1 
ATOM   4656 C  CG  . LEU B 1 276 ? 33.602 -40.207 -18.131 1.00 28.30 ? 279 LEU B CG  1 
ATOM   4657 C  CD1 . LEU B 1 276 ? 33.250 -38.808 -18.607 1.00 29.27 ? 279 LEU B CD1 1 
ATOM   4658 C  CD2 . LEU B 1 276 ? 35.103 -40.429 -18.171 1.00 26.18 ? 279 LEU B CD2 1 
ATOM   4659 N  N   . THR B 1 277 ? 33.466 -42.020 -13.723 1.00 25.07 ? 280 THR B N   1 
ATOM   4660 C  CA  . THR B 1 277 ? 32.982 -41.933 -12.345 1.00 25.20 ? 280 THR B CA  1 
ATOM   4661 C  C   . THR B 1 277 ? 32.918 -40.462 -11.952 1.00 24.22 ? 280 THR B C   1 
ATOM   4662 O  O   . THR B 1 277 ? 33.441 -39.611 -12.664 1.00 22.14 ? 280 THR B O   1 
ATOM   4663 C  CB  . THR B 1 277 ? 33.916 -42.653 -11.356 1.00 25.65 ? 280 THR B CB  1 
ATOM   4664 O  OG1 . THR B 1 277 ? 35.192 -41.999 -11.338 1.00 29.87 ? 280 THR B OG1 1 
ATOM   4665 C  CG2 . THR B 1 277 ? 34.096 -44.113 -11.764 1.00 28.74 ? 280 THR B CG2 1 
ATOM   4666 N  N   . SER B 1 278 ? 32.276 -40.166 -10.825 1.00 24.08 ? 281 SER B N   1 
ATOM   4667 C  CA  . SER B 1 278 ? 32.192 -38.789 -10.351 1.00 25.49 ? 281 SER B CA  1 
ATOM   4668 C  C   . SER B 1 278 ? 33.580 -38.174 -10.204 1.00 24.82 ? 281 SER B C   1 
ATOM   4669 O  O   . SER B 1 278 ? 33.750 -36.965 -10.352 1.00 25.93 ? 281 SER B O   1 
ATOM   4670 C  CB  . SER B 1 278 ? 31.448 -38.726 -9.012  1.00 25.50 ? 281 SER B CB  1 
ATOM   4671 O  OG  . SER B 1 278 ? 32.130 -39.453 -8.005  1.00 29.63 ? 281 SER B OG  1 
ATOM   4672 N  N   . ALA B 1 279 ? 34.581 -38.999 -9.919  1.00 25.82 ? 282 ALA B N   1 
ATOM   4673 C  CA  . ALA B 1 279 ? 35.936 -38.478 -9.775  1.00 25.20 ? 282 ALA B CA  1 
ATOM   4674 C  C   . ALA B 1 279 ? 36.455 -37.983 -11.124 1.00 24.30 ? 282 ALA B C   1 
ATOM   4675 O  O   . ALA B 1 279 ? 37.381 -37.180 -11.183 1.00 20.93 ? 282 ALA B O   1 
ATOM   4676 C  CB  . ALA B 1 279 ? 36.868 -39.555 -9.213  1.00 27.65 ? 282 ALA B CB  1 
ATOM   4677 N  N   . ASP B 1 280 ? 35.851 -38.462 -12.208 1.00 23.93 ? 283 ASP B N   1 
ATOM   4678 C  CA  . ASP B 1 280 ? 36.264 -38.046 -13.547 1.00 25.08 ? 283 ASP B CA  1 
ATOM   4679 C  C   . ASP B 1 280 ? 35.578 -36.780 -14.032 1.00 24.99 ? 283 ASP B C   1 
ATOM   4680 O  O   . ASP B 1 280 ? 36.100 -36.095 -14.914 1.00 24.81 ? 283 ASP B O   1 
ATOM   4681 C  CB  . ASP B 1 280 ? 35.998 -39.158 -14.567 1.00 25.57 ? 283 ASP B CB  1 
ATOM   4682 C  CG  . ASP B 1 280 ? 36.795 -40.410 -14.285 1.00 26.38 ? 283 ASP B CG  1 
ATOM   4683 O  OD1 . ASP B 1 280 ? 38.022 -40.308 -14.051 1.00 25.72 ? 283 ASP B OD1 1 
ATOM   4684 O  OD2 . ASP B 1 280 ? 36.190 -41.499 -14.299 1.00 29.53 ? 283 ASP B OD2 1 
ATOM   4685 N  N   . TYR B 1 281 ? 34.406 -36.464 -13.490 1.00 24.03 ? 284 TYR B N   1 
ATOM   4686 C  CA  . TYR B 1 281 ? 33.678 -35.321 -14.022 1.00 23.43 ? 284 TYR B CA  1 
ATOM   4687 C  C   . TYR B 1 281 ? 33.313 -34.232 -13.011 1.00 24.99 ? 284 TYR B C   1 
ATOM   4688 O  O   . TYR B 1 281 ? 32.690 -33.235 -13.372 1.00 23.24 ? 284 TYR B O   1 
ATOM   4689 C  CB  . TYR B 1 281 ? 32.424 -35.791 -14.762 1.00 24.21 ? 284 TYR B CB  1 
ATOM   4690 C  CG  . TYR B 1 281 ? 31.363 -36.430 -13.891 1.00 26.63 ? 284 TYR B CG  1 
ATOM   4691 C  CD1 . TYR B 1 281 ? 30.539 -35.652 -13.086 1.00 24.44 ? 284 TYR B CD1 1 
ATOM   4692 C  CD2 . TYR B 1 281 ? 31.146 -37.807 -13.916 1.00 24.56 ? 284 TYR B CD2 1 
ATOM   4693 C  CE1 . TYR B 1 281 ? 29.525 -36.222 -12.340 1.00 25.23 ? 284 TYR B CE1 1 
ATOM   4694 C  CE2 . TYR B 1 281 ? 30.132 -38.386 -13.168 1.00 23.88 ? 284 TYR B CE2 1 
ATOM   4695 C  CZ  . TYR B 1 281 ? 29.321 -37.585 -12.385 1.00 23.92 ? 284 TYR B CZ  1 
ATOM   4696 O  OH  . TYR B 1 281 ? 28.276 -38.127 -11.670 1.00 21.69 ? 284 TYR B OH  1 
ATOM   4697 N  N   . VAL B 1 282 ? 33.710 -34.411 -11.756 1.00 24.16 ? 285 VAL B N   1 
ATOM   4698 C  CA  . VAL B 1 282 ? 33.553 -33.353 -10.758 1.00 25.88 ? 285 VAL B CA  1 
ATOM   4699 C  C   . VAL B 1 282 ? 34.894 -32.722 -10.382 1.00 25.60 ? 285 VAL B C   1 
ATOM   4700 O  O   . VAL B 1 282 ? 35.806 -33.406 -9.917  1.00 26.88 ? 285 VAL B O   1 
ATOM   4701 C  CB  . VAL B 1 282 ? 32.908 -33.886 -9.459  1.00 24.25 ? 285 VAL B CB  1 
ATOM   4702 C  CG1 . VAL B 1 282 ? 32.739 -32.745 -8.461  1.00 24.05 ? 285 VAL B CG1 1 
ATOM   4703 C  CG2 . VAL B 1 282 ? 31.574 -34.548 -9.763  1.00 22.99 ? 285 VAL B CG2 1 
ATOM   4704 N  N   . PHE B 1 283 ? 35.016 -31.415 -10.570 1.00 26.67 ? 286 PHE B N   1 
ATOM   4705 C  CA  . PHE B 1 283 ? 36.194 -30.714 -10.080 1.00 27.68 ? 286 PHE B CA  1 
ATOM   4706 C  C   . PHE B 1 283 ? 36.109 -30.636 -8.562  1.00 27.90 ? 286 PHE B C   1 
ATOM   4707 O  O   . PHE B 1 283 ? 35.428 -29.764 -8.016  1.00 30.74 ? 286 PHE B O   1 
ATOM   4708 C  CB  . PHE B 1 283 ? 36.266 -29.302 -10.658 1.00 27.61 ? 286 PHE B CB  1 
ATOM   4709 C  CG  . PHE B 1 283 ? 36.552 -29.259 -12.126 1.00 27.68 ? 286 PHE B CG  1 
ATOM   4710 C  CD1 . PHE B 1 283 ? 37.832 -29.484 -12.602 1.00 30.08 ? 286 PHE B CD1 1 
ATOM   4711 C  CD2 . PHE B 1 283 ? 35.544 -28.975 -13.034 1.00 29.63 ? 286 PHE B CD2 1 
ATOM   4712 C  CE1 . PHE B 1 283 ? 38.108 -29.424 -13.970 1.00 31.48 ? 286 PHE B CE1 1 
ATOM   4713 C  CE2 . PHE B 1 283 ? 35.809 -28.914 -14.393 1.00 30.55 ? 286 PHE B CE2 1 
ATOM   4714 C  CZ  . PHE B 1 283 ? 37.098 -29.139 -14.862 1.00 28.45 ? 286 PHE B CZ  1 
ATOM   4715 N  N   . GLN B 1 284 ? 36.791 -31.550 -7.882  1.00 25.65 ? 287 GLN B N   1 
ATOM   4716 C  CA  . GLN B 1 284 ? 36.752 -31.588 -6.422  1.00 27.55 ? 287 GLN B CA  1 
ATOM   4717 C  C   . GLN B 1 284 ? 37.862 -30.707 -5.851  1.00 28.20 ? 287 GLN B C   1 
ATOM   4718 O  O   . GLN B 1 284 ? 38.926 -31.196 -5.469  1.00 28.81 ? 287 GLN B O   1 
ATOM   4719 C  CB  . GLN B 1 284 ? 36.918 -33.033 -5.918  1.00 25.64 ? 287 GLN B CB  1 
ATOM   4720 C  CG  . GLN B 1 284 ? 35.796 -33.988 -6.342  1.00 24.22 ? 287 GLN B CG  1 
ATOM   4721 C  CD  . GLN B 1 284 ? 34.531 -33.849 -5.496  1.00 21.12 ? 287 GLN B CD  1 
ATOM   4722 O  OE1 . GLN B 1 284 ? 33.517 -34.467 -5.790  1.00 21.74 ? 287 GLN B OE1 1 
ATOM   4723 N  NE2 . GLN B 1 284 ? 34.592 -33.038 -4.444  1.00 20.80 ? 287 GLN B NE2 1 
ATOM   4724 N  N   . GLU B 1 285 ? 37.609 -29.403 -5.807  1.00 29.92 ? 288 GLU B N   1 
ATOM   4725 C  CA  . GLU B 1 285 ? 38.569 -28.455 -5.261  1.00 32.54 ? 288 GLU B CA  1 
ATOM   4726 C  C   . GLU B 1 285 ? 38.585 -28.586 -3.746  1.00 31.32 ? 288 GLU B C   1 
ATOM   4727 O  O   . GLU B 1 285 ? 39.584 -28.291 -3.098  1.00 30.77 ? 288 GLU B O   1 
ATOM   4728 C  CB  . GLU B 1 285 ? 38.183 -27.027 -5.646  1.00 37.67 ? 288 GLU B CB  1 
ATOM   4729 C  CG  . GLU B 1 285 ? 39.132 -26.381 -6.632  1.00 45.07 ? 288 GLU B CG  1 
ATOM   4730 C  CD  . GLU B 1 285 ? 39.254 -27.173 -7.917  1.00 49.92 ? 288 GLU B CD  1 
ATOM   4731 O  OE1 . GLU B 1 285 ? 38.508 -26.860 -8.870  1.00 52.97 ? 288 GLU B OE1 1 
ATOM   4732 O  OE2 . GLU B 1 285 ? 40.091 -28.105 -7.975  1.00 50.79 ? 288 GLU B OE2 1 
ATOM   4733 N  N   . SER B 1 286 ? 37.458 -29.018 -3.194  1.00 30.34 ? 289 SER B N   1 
ATOM   4734 C  CA  . SER B 1 286 ? 37.376 -29.390 -1.789  1.00 29.39 ? 289 SER B CA  1 
ATOM   4735 C  C   . SER B 1 286 ? 36.288 -30.441 -1.650  1.00 29.34 ? 289 SER B C   1 
ATOM   4736 O  O   . SER B 1 286 ? 35.655 -30.830 -2.634  1.00 28.93 ? 289 SER B O   1 
ATOM   4737 C  CB  . SER B 1 286 ? 37.026 -28.180 -0.921  1.00 28.94 ? 289 SER B CB  1 
ATOM   4738 O  OG  . SER B 1 286 ? 35.630 -27.964 -0.902  1.00 31.38 ? 289 SER B OG  1 
ATOM   4739 N  N   . TYR B 1 287 ? 36.073 -30.899 -0.425  1.00 28.12 ? 290 TYR B N   1 
ATOM   4740 C  CA  . TYR B 1 287 ? 35.053 -31.898 -0.158  1.00 28.45 ? 290 TYR B CA  1 
ATOM   4741 C  C   . TYR B 1 287 ? 34.116 -31.405 0.936   1.00 29.40 ? 290 TYR B C   1 
ATOM   4742 O  O   . TYR B 1 287 ? 33.280 -32.152 1.439   1.00 30.66 ? 290 TYR B O   1 
ATOM   4743 C  CB  . TYR B 1 287 ? 35.714 -33.211 0.254   1.00 26.55 ? 290 TYR B CB  1 
ATOM   4744 C  CG  . TYR B 1 287 ? 36.510 -33.850 -0.858  1.00 27.19 ? 290 TYR B CG  1 
ATOM   4745 C  CD1 . TYR B 1 287 ? 35.882 -34.632 -1.819  1.00 26.22 ? 290 TYR B CD1 1 
ATOM   4746 C  CD2 . TYR B 1 287 ? 37.887 -33.671 -0.953  1.00 27.64 ? 290 TYR B CD2 1 
ATOM   4747 C  CE1 . TYR B 1 287 ? 36.594 -35.218 -2.838  1.00 27.74 ? 290 TYR B CE1 1 
ATOM   4748 C  CE2 . TYR B 1 287 ? 38.610 -34.257 -1.977  1.00 28.41 ? 290 TYR B CE2 1 
ATOM   4749 C  CZ  . TYR B 1 287 ? 37.953 -35.031 -2.915  1.00 26.85 ? 290 TYR B CZ  1 
ATOM   4750 O  OH  . TYR B 1 287 ? 38.651 -35.638 -3.931  1.00 30.74 ? 290 TYR B OH  1 
ATOM   4751 N  N   . SER B 1 288 ? 34.255 -30.136 1.294   1.00 30.45 ? 291 SER B N   1 
ATOM   4752 C  CA  . SER B 1 288 ? 33.393 -29.541 2.307   1.00 32.23 ? 291 SER B CA  1 
ATOM   4753 C  C   . SER B 1 288 ? 31.970 -29.348 1.814   1.00 32.61 ? 291 SER B C   1 
ATOM   4754 O  O   . SER B 1 288 ? 31.742 -28.908 0.682   1.00 30.75 ? 291 SER B O   1 
ATOM   4755 C  CB  . SER B 1 288 ? 33.938 -28.189 2.759   1.00 31.66 ? 291 SER B CB  1 
ATOM   4756 O  OG  . SER B 1 288 ? 32.927 -27.476 3.449   1.00 36.30 ? 291 SER B OG  1 
ATOM   4757 N  N   . SER B 1 289 ? 31.016 -29.671 2.683   1.00 33.17 ? 292 SER B N   1 
ATOM   4758 C  CA  . SER B 1 289 ? 29.603 -29.465 2.397   1.00 35.71 ? 292 SER B CA  1 
ATOM   4759 C  C   . SER B 1 289 ? 29.296 -27.979 2.243   1.00 36.10 ? 292 SER B C   1 
ATOM   4760 O  O   . SER B 1 289 ? 28.231 -27.603 1.762   1.00 36.47 ? 292 SER B O   1 
ATOM   4761 C  CB  . SER B 1 289 ? 28.748 -30.056 3.523   1.00 37.19 ? 292 SER B CB  1 
ATOM   4762 O  OG  . SER B 1 289 ? 29.144 -29.550 4.788   1.00 38.78 ? 292 SER B OG  1 
ATOM   4763 N  N   . LYS B 1 290 ? 30.242 -27.140 2.644   1.00 36.69 ? 293 LYS B N   1 
ATOM   4764 C  CA  . LYS B 1 290 ? 30.043 -25.696 2.627   1.00 37.85 ? 293 LYS B CA  1 
ATOM   4765 C  C   . LYS B 1 290 ? 30.403 -25.093 1.275   1.00 36.52 ? 293 LYS B C   1 
ATOM   4766 O  O   . LYS B 1 290 ? 30.125 -23.924 1.013   1.00 37.22 ? 293 LYS B O   1 
ATOM   4767 C  CB  . LYS B 1 290 ? 30.895 -25.045 3.719   1.00 40.43 ? 293 LYS B CB  1 
ATOM   4768 C  CG  . LYS B 1 290 ? 30.566 -25.523 5.125   1.00 43.19 ? 293 LYS B CG  1 
ATOM   4769 C  CD  . LYS B 1 290 ? 29.233 -24.965 5.587   1.00 47.53 ? 293 LYS B CD  1 
ATOM   4770 C  CE  . LYS B 1 290 ? 29.255 -23.434 5.612   1.00 48.97 ? 293 LYS B CE  1 
ATOM   4771 N  NZ  . LYS B 1 290 ? 27.976 -22.864 6.126   1.00 49.89 ? 293 LYS B NZ  1 
ATOM   4772 N  N   . LYS B 1 291 ? 31.033 -25.893 0.423   1.00 35.97 ? 294 LYS B N   1 
ATOM   4773 C  CA  . LYS B 1 291 ? 31.484 -25.422 -0.881  1.00 34.23 ? 294 LYS B CA  1 
ATOM   4774 C  C   . LYS B 1 291 ? 30.700 -26.087 -2.010  1.00 32.61 ? 294 LYS B C   1 
ATOM   4775 O  O   . LYS B 1 291 ? 30.111 -27.162 -1.835  1.00 28.95 ? 294 LYS B O   1 
ATOM   4776 C  CB  . LYS B 1 291 ? 32.977 -25.711 -1.068  1.00 37.64 ? 294 LYS B CB  1 
ATOM   4777 C  CG  . LYS B 1 291 ? 33.875 -25.207 0.060   1.00 42.82 ? 294 LYS B CG  1 
ATOM   4778 C  CD  . LYS B 1 291 ? 34.039 -23.694 0.024   1.00 45.07 ? 294 LYS B CD  1 
ATOM   4779 C  CE  . LYS B 1 291 ? 34.973 -23.214 1.133   1.00 47.66 ? 294 LYS B CE  1 
ATOM   4780 N  NZ  . LYS B 1 291 ? 36.318 -23.854 1.050   1.00 49.06 ? 294 LYS B NZ  1 
ATOM   4781 N  N   . LEU B 1 292 ? 30.708 -25.437 -3.168  1.00 30.51 ? 295 LEU B N   1 
ATOM   4782 C  CA  . LEU B 1 292 ? 30.061 -25.958 -4.363  1.00 31.28 ? 295 LEU B CA  1 
ATOM   4783 C  C   . LEU B 1 292 ? 31.129 -26.388 -5.361  1.00 29.82 ? 295 LEU B C   1 
ATOM   4784 O  O   . LEU B 1 292 ? 32.124 -25.693 -5.536  1.00 29.49 ? 295 LEU B O   1 
ATOM   4785 C  CB  . LEU B 1 292 ? 29.179 -24.879 -4.991  1.00 30.57 ? 295 LEU B CB  1 
ATOM   4786 C  CG  . LEU B 1 292 ? 28.028 -24.419 -4.099  1.00 32.55 ? 295 LEU B CG  1 
ATOM   4787 C  CD1 . LEU B 1 292 ? 27.260 -23.290 -4.772  1.00 33.08 ? 295 LEU B CD1 1 
ATOM   4788 C  CD2 . LEU B 1 292 ? 27.119 -25.602 -3.822  1.00 34.24 ? 295 LEU B CD2 1 
ATOM   4789 N  N   . CYS B 1 293 ? 30.914 -27.528 -6.011  1.00 28.95 ? 296 CYS B N   1 
ATOM   4790 C  CA  . CYS B 1 293 ? 31.877 -28.059 -6.972  1.00 28.88 ? 296 CYS B CA  1 
ATOM   4791 C  C   . CYS B 1 293 ? 31.322 -28.188 -8.391  1.00 27.76 ? 296 CYS B C   1 
ATOM   4792 O  O   . CYS B 1 293 ? 30.232 -28.730 -8.604  1.00 25.74 ? 296 CYS B O   1 
ATOM   4793 C  CB  . CYS B 1 293 ? 32.384 -29.423 -6.502  1.00 29.53 ? 296 CYS B CB  1 
ATOM   4794 S  SG  . CYS B 1 293 ? 33.821 -29.332 -5.425  1.00 35.96 ? 296 CYS B SG  1 
ATOM   4795 N  N   . THR B 1 294 ? 32.099 -27.699 -9.355  1.00 25.43 ? 297 THR B N   1 
ATOM   4796 C  CA  . THR B 1 294 ? 31.676 -27.655 -10.750 1.00 26.38 ? 297 THR B CA  1 
ATOM   4797 C  C   . THR B 1 294 ? 31.790 -29.021 -11.397 1.00 24.55 ? 297 THR B C   1 
ATOM   4798 O  O   . THR B 1 294 ? 32.708 -29.780 -11.090 1.00 23.59 ? 297 THR B O   1 
ATOM   4799 C  CB  . THR B 1 294 ? 32.541 -26.664 -11.565 1.00 28.55 ? 297 THR B CB  1 
ATOM   4800 O  OG1 . THR B 1 294 ? 32.466 -25.362 -10.970 1.00 27.64 ? 297 THR B OG1 1 
ATOM   4801 C  CG2 . THR B 1 294 ? 32.045 -26.579 -13.008 1.00 27.94 ? 297 THR B CG2 1 
ATOM   4802 N  N   . LEU B 1 295 ? 30.848 -29.328 -12.287 1.00 24.77 ? 298 LEU B N   1 
ATOM   4803 C  CA  . LEU B 1 295 ? 30.946 -30.509 -13.141 1.00 24.55 ? 298 LEU B CA  1 
ATOM   4804 C  C   . LEU B 1 295 ? 31.538 -30.105 -14.489 1.00 24.23 ? 298 LEU B C   1 
ATOM   4805 O  O   . LEU B 1 295 ? 31.265 -29.024 -14.996 1.00 27.74 ? 298 LEU B O   1 
ATOM   4806 C  CB  . LEU B 1 295 ? 29.562 -31.139 -13.366 1.00 23.99 ? 298 LEU B CB  1 
ATOM   4807 C  CG  . LEU B 1 295 ? 28.736 -31.590 -12.154 1.00 26.69 ? 298 LEU B CG  1 
ATOM   4808 C  CD1 . LEU B 1 295 ? 27.511 -32.362 -12.617 1.00 25.47 ? 298 LEU B CD1 1 
ATOM   4809 C  CD2 . LEU B 1 295 ? 29.583 -32.465 -11.260 1.00 30.65 ? 298 LEU B CD2 1 
ATOM   4810 N  N   . ALA B 1 296 ? 32.346 -30.975 -15.072 1.00 22.56 ? 299 ALA B N   1 
ATOM   4811 C  CA  . ALA B 1 296 ? 32.972 -30.679 -16.354 1.00 22.64 ? 299 ALA B CA  1 
ATOM   4812 C  C   . ALA B 1 296 ? 32.064 -31.151 -17.484 1.00 22.06 ? 299 ALA B C   1 
ATOM   4813 O  O   . ALA B 1 296 ? 32.489 -31.861 -18.401 1.00 21.06 ? 299 ALA B O   1 
ATOM   4814 C  CB  . ALA B 1 296 ? 34.340 -31.359 -16.433 1.00 21.05 ? 299 ALA B CB  1 
ATOM   4815 N  N   . ILE B 1 297 ? 30.805 -30.741 -17.388 1.00 22.24 ? 300 ILE B N   1 
ATOM   4816 C  CA  . ILE B 1 297 ? 29.751 -31.102 -18.330 1.00 24.27 ? 300 ILE B CA  1 
ATOM   4817 C  C   . ILE B 1 297 ? 28.823 -29.898 -18.387 1.00 25.62 ? 300 ILE B C   1 
ATOM   4818 O  O   . ILE B 1 297 ? 28.506 -29.318 -17.352 1.00 26.92 ? 300 ILE B O   1 
ATOM   4819 C  CB  . ILE B 1 297 ? 28.923 -32.295 -17.820 1.00 22.86 ? 300 ILE B CB  1 
ATOM   4820 C  CG1 . ILE B 1 297 ? 29.829 -33.502 -17.612 1.00 26.48 ? 300 ILE B CG1 1 
ATOM   4821 C  CG2 . ILE B 1 297 ? 27.790 -32.614 -18.809 1.00 24.34 ? 300 ILE B CG2 1 
ATOM   4822 C  CD1 . ILE B 1 297 ? 29.157 -34.659 -16.915 1.00 25.24 ? 300 ILE B CD1 1 
ATOM   4823 N  N   . HIS B 1 298 ? 28.386 -29.516 -19.582 1.00 28.20 ? 301 HIS B N   1 
ATOM   4824 C  CA  . HIS B 1 298 ? 27.428 -28.424 -19.704 1.00 27.43 ? 301 HIS B CA  1 
ATOM   4825 C  C   . HIS B 1 298 ? 26.586 -28.576 -20.954 1.00 28.73 ? 301 HIS B C   1 
ATOM   4826 O  O   . HIS B 1 298 ? 26.779 -29.508 -21.743 1.00 28.70 ? 301 HIS B O   1 
ATOM   4827 C  CB  . HIS B 1 298 ? 28.148 -27.069 -19.734 1.00 29.27 ? 301 HIS B CB  1 
ATOM   4828 C  CG  . HIS B 1 298 ? 28.922 -26.818 -20.990 1.00 30.49 ? 301 HIS B CG  1 
ATOM   4829 N  ND1 . HIS B 1 298 ? 29.141 -25.552 -21.489 1.00 32.50 ? 301 HIS B ND1 1 
ATOM   4830 C  CD2 . HIS B 1 298 ? 29.543 -27.669 -21.841 1.00 30.40 ? 301 HIS B CD2 1 
ATOM   4831 C  CE1 . HIS B 1 298 ? 29.867 -25.634 -22.590 1.00 32.43 ? 301 HIS B CE1 1 
ATOM   4832 N  NE2 . HIS B 1 298 ? 30.124 -26.908 -22.825 1.00 29.22 ? 301 HIS B NE2 1 
ATOM   4833 N  N   . ALA B 1 299 ? 25.648 -27.652 -21.124 1.00 27.81 ? 302 ALA B N   1 
ATOM   4834 C  CA  . ALA B 1 299 ? 24.760 -27.669 -22.267 1.00 29.75 ? 302 ALA B CA  1 
ATOM   4835 C  C   . ALA B 1 299 ? 25.362 -26.852 -23.395 1.00 32.01 ? 302 ALA B C   1 
ATOM   4836 O  O   . ALA B 1 299 ? 25.896 -25.766 -23.172 1.00 29.99 ? 302 ALA B O   1 
ATOM   4837 C  CB  . ALA B 1 299 ? 23.402 -27.108 -21.879 1.00 28.02 ? 302 ALA B CB  1 
ATOM   4838 N  N   . MET B 1 300 ? 25.293 -27.399 -24.606 1.00 33.49 ? 303 MET B N   1 
ATOM   4839 C  CA  . MET B 1 300 ? 25.596 -26.638 -25.808 1.00 36.10 ? 303 MET B CA  1 
ATOM   4840 C  C   . MET B 1 300 ? 24.726 -27.117 -26.959 1.00 35.57 ? 303 MET B C   1 
ATOM   4841 O  O   . MET B 1 300 ? 24.720 -28.299 -27.303 1.00 36.45 ? 303 MET B O   1 
ATOM   4842 C  CB  . MET B 1 300 ? 27.072 -26.782 -26.184 1.00 38.74 ? 303 MET B CB  1 
ATOM   4843 C  CG  . MET B 1 300 ? 27.410 -26.189 -27.539 1.00 42.95 ? 303 MET B CG  1 
ATOM   4844 S  SD  . MET B 1 300 ? 28.997 -25.359 -27.534 1.00 49.88 ? 303 MET B SD  1 
ATOM   4845 C  CE  . MET B 1 300 ? 29.124 -24.906 -25.820 1.00 46.25 ? 303 MET B CE  1 
ATOM   4846 N  N   . ASP B 1 301 ? 23.981 -26.196 -27.553 1.00 36.01 ? 304 ASP B N   1 
ATOM   4847 C  CA  . ASP B 1 301 ? 23.133 -26.545 -28.679 1.00 35.47 ? 304 ASP B CA  1 
ATOM   4848 C  C   . ASP B 1 301 ? 23.870 -26.284 -29.981 1.00 36.67 ? 304 ASP B C   1 
ATOM   4849 O  O   . ASP B 1 301 ? 23.921 -25.157 -30.471 1.00 38.45 ? 304 ASP B O   1 
ATOM   4850 C  CB  . ASP B 1 301 ? 21.835 -25.744 -28.612 1.00 32.24 ? 304 ASP B CB  1 
ATOM   4851 C  CG  . ASP B 1 301 ? 20.951 -26.185 -27.464 1.00 31.32 ? 304 ASP B CG  1 
ATOM   4852 O  OD1 . ASP B 1 301 ? 20.603 -27.382 -27.419 1.00 26.34 ? 304 ASP B OD1 1 
ATOM   4853 O  OD2 . ASP B 1 301 ? 20.611 -25.346 -26.604 1.00 33.39 ? 304 ASP B OD2 1 
ATOM   4854 N  N   . ILE B 1 302 ? 24.457 -27.339 -30.531 1.00 35.68 ? 305 ILE B N   1 
ATOM   4855 C  CA  . ILE B 1 302 ? 25.206 -27.227 -31.767 1.00 36.87 ? 305 ILE B CA  1 
ATOM   4856 C  C   . ILE B 1 302 ? 24.258 -27.397 -32.948 1.00 39.02 ? 305 ILE B C   1 
ATOM   4857 O  O   . ILE B 1 302 ? 23.522 -28.378 -33.033 1.00 38.49 ? 305 ILE B O   1 
ATOM   4858 C  CB  . ILE B 1 302 ? 26.313 -28.297 -31.833 1.00 34.60 ? 305 ILE B CB  1 
ATOM   4859 C  CG1 . ILE B 1 302 ? 27.236 -28.149 -30.620 1.00 32.40 ? 305 ILE B CG1 1 
ATOM   4860 C  CG2 . ILE B 1 302 ? 27.094 -28.157 -33.130 1.00 33.89 ? 305 ILE B CG2 1 
ATOM   4861 C  CD1 . ILE B 1 302 ? 28.320 -29.208 -30.523 1.00 32.95 ? 305 ILE B CD1 1 
ATOM   4862 N  N   . PRO B 1 303 ? 24.264 -26.428 -33.874 1.00 41.33 ? 306 PRO B N   1 
ATOM   4863 C  CA  . PRO B 1 303 ? 23.318 -26.392 -34.994 1.00 42.36 ? 306 PRO B CA  1 
ATOM   4864 C  C   . PRO B 1 303 ? 23.656 -27.405 -36.075 1.00 44.02 ? 306 PRO B C   1 
ATOM   4865 O  O   . PRO B 1 303 ? 24.806 -27.826 -36.216 1.00 44.45 ? 306 PRO B O   1 
ATOM   4866 C  CB  . PRO B 1 303 ? 23.430 -24.962 -35.505 1.00 42.84 ? 306 PRO B CB  1 
ATOM   4867 C  CG  . PRO B 1 303 ? 24.836 -24.577 -35.187 1.00 43.70 ? 306 PRO B CG  1 
ATOM   4868 C  CD  . PRO B 1 303 ? 25.184 -25.276 -33.894 1.00 42.04 ? 306 PRO B CD  1 
ATOM   4869 N  N   . PRO B 1 304 ? 22.652 -27.806 -36.863 1.00 44.55 ? 307 PRO B N   1 
ATOM   4870 C  CA  . PRO B 1 304 ? 22.934 -28.542 -38.096 1.00 45.33 ? 307 PRO B CA  1 
ATOM   4871 C  C   . PRO B 1 304 ? 23.862 -27.703 -38.971 1.00 45.67 ? 307 PRO B C   1 
ATOM   4872 O  O   . PRO B 1 304 ? 24.020 -26.501 -38.751 1.00 45.69 ? 307 PRO B O   1 
ATOM   4873 C  CB  . PRO B 1 304 ? 21.556 -28.720 -38.731 1.00 45.54 ? 307 PRO B CB  1 
ATOM   4874 C  CG  . PRO B 1 304 ? 20.595 -28.602 -37.589 1.00 46.31 ? 307 PRO B CG  1 
ATOM   4875 C  CD  . PRO B 1 304 ? 21.210 -27.594 -36.662 1.00 45.69 ? 307 PRO B CD  1 
ATOM   4876 N  N   . PRO B 1 305 ? 24.491 -28.326 -39.973 1.00 46.03 ? 308 PRO B N   1 
ATOM   4877 C  CA  . PRO B 1 305 ? 24.353 -29.747 -40.305 1.00 46.45 ? 308 PRO B CA  1 
ATOM   4878 C  C   . PRO B 1 305 ? 24.980 -30.695 -39.281 1.00 45.90 ? 308 PRO B C   1 
ATOM   4879 O  O   . PRO B 1 305 ? 24.648 -31.876 -39.245 1.00 46.08 ? 308 PRO B O   1 
ATOM   4880 C  CB  . PRO B 1 305 ? 25.028 -29.861 -41.668 1.00 46.25 ? 308 PRO B CB  1 
ATOM   4881 C  CG  . PRO B 1 305 ? 26.017 -28.744 -41.684 1.00 46.28 ? 308 PRO B CG  1 
ATOM   4882 C  CD  . PRO B 1 305 ? 25.388 -27.625 -40.907 1.00 45.96 ? 308 PRO B CD  1 
ATOM   4883 N  N   . THR B 1 306 ? 25.890 -30.179 -38.461 1.00 45.17 ? 309 THR B N   1 
ATOM   4884 C  CA  . THR B 1 306 ? 26.644 -31.023 -37.539 1.00 44.49 ? 309 THR B CA  1 
ATOM   4885 C  C   . THR B 1 306 ? 25.836 -31.472 -36.331 1.00 43.14 ? 309 THR B C   1 
ATOM   4886 O  O   . THR B 1 306 ? 25.867 -32.643 -35.967 1.00 44.04 ? 309 THR B O   1 
ATOM   4887 C  CB  . THR B 1 306 ? 27.913 -30.313 -37.035 1.00 45.48 ? 309 THR B CB  1 
ATOM   4888 O  OG1 . THR B 1 306 ? 28.873 -30.236 -38.097 1.00 47.29 ? 309 THR B OG1 1 
ATOM   4889 C  CG2 . THR B 1 306 ? 28.517 -31.069 -35.867 1.00 46.21 ? 309 THR B CG2 1 
ATOM   4890 N  N   . GLY B 1 307 ? 25.119 -30.539 -35.709 1.00 42.04 ? 310 GLY B N   1 
ATOM   4891 C  CA  . GLY B 1 307 ? 24.275 -30.884 -34.578 1.00 39.92 ? 310 GLY B CA  1 
ATOM   4892 C  C   . GLY B 1 307 ? 22.836 -31.100 -35.006 1.00 38.74 ? 310 GLY B C   1 
ATOM   4893 O  O   . GLY B 1 307 ? 22.546 -31.015 -36.199 1.00 39.03 ? 310 GLY B O   1 
ATOM   4894 N  N   . PRO B 1 308 ? 21.911 -31.384 -34.069 1.00 36.34 ? 311 PRO B N   1 
ATOM   4895 C  CA  . PRO B 1 308 ? 22.167 -31.535 -32.631 1.00 35.13 ? 311 PRO B CA  1 
ATOM   4896 C  C   . PRO B 1 308 ? 23.122 -32.686 -32.367 1.00 33.81 ? 311 PRO B C   1 
ATOM   4897 O  O   . PRO B 1 308 ? 23.045 -33.722 -33.022 1.00 32.15 ? 311 PRO B O   1 
ATOM   4898 C  CB  . PRO B 1 308 ? 20.783 -31.810 -32.039 1.00 35.69 ? 311 PRO B CB  1 
ATOM   4899 C  CG  . PRO B 1 308 ? 19.829 -31.239 -33.034 1.00 37.17 ? 311 PRO B CG  1 
ATOM   4900 C  CD  . PRO B 1 308 ? 20.474 -31.483 -34.374 1.00 36.86 ? 311 PRO B CD  1 
ATOM   4901 N  N   . THR B 1 309 ? 24.030 -32.504 -31.416 1.00 31.92 ? 312 THR B N   1 
ATOM   4902 C  CA  . THR B 1 309 ? 24.999 -33.549 -31.125 1.00 29.42 ? 312 THR B CA  1 
ATOM   4903 C  C   . THR B 1 309 ? 25.589 -33.345 -29.742 1.00 29.52 ? 312 THR B C   1 
ATOM   4904 O  O   . THR B 1 309 ? 25.658 -32.215 -29.249 1.00 29.53 ? 312 THR B O   1 
ATOM   4905 C  CB  . THR B 1 309 ? 26.144 -33.558 -32.173 1.00 27.54 ? 312 THR B CB  1 
ATOM   4906 O  OG1 . THR B 1 309 ? 27.087 -34.592 -31.854 1.00 28.64 ? 312 THR B OG1 1 
ATOM   4907 C  CG2 . THR B 1 309 ? 26.866 -32.219 -32.189 1.00 25.34 ? 312 THR B CG2 1 
ATOM   4908 N  N   . TRP B 1 310 ? 25.996 -34.445 -29.114 1.00 26.83 ? 313 TRP B N   1 
ATOM   4909 C  CA  . TRP B 1 310 ? 26.861 -34.372 -27.953 1.00 26.19 ? 313 TRP B CA  1 
ATOM   4910 C  C   . TRP B 1 310 ? 28.257 -34.031 -28.449 1.00 26.04 ? 313 TRP B C   1 
ATOM   4911 O  O   . TRP B 1 310 ? 28.584 -34.263 -29.612 1.00 26.82 ? 313 TRP B O   1 
ATOM   4912 C  CB  . TRP B 1 310 ? 26.899 -35.716 -27.225 1.00 26.59 ? 313 TRP B CB  1 
ATOM   4913 C  CG  . TRP B 1 310 ? 25.615 -36.102 -26.570 1.00 25.62 ? 313 TRP B CG  1 
ATOM   4914 C  CD1 . TRP B 1 310 ? 24.503 -36.610 -27.177 1.00 27.03 ? 313 TRP B CD1 1 
ATOM   4915 C  CD2 . TRP B 1 310 ? 25.317 -36.043 -25.169 1.00 26.19 ? 313 TRP B CD2 1 
ATOM   4916 N  NE1 . TRP B 1 310 ? 23.531 -36.875 -26.241 1.00 25.32 ? 313 TRP B NE1 1 
ATOM   4917 C  CE2 . TRP B 1 310 ? 24.006 -36.536 -25.000 1.00 26.11 ? 313 TRP B CE2 1 
ATOM   4918 C  CE3 . TRP B 1 310 ? 26.035 -35.625 -24.039 1.00 25.61 ? 313 TRP B CE3 1 
ATOM   4919 C  CZ2 . TRP B 1 310 ? 23.396 -36.622 -23.748 1.00 25.37 ? 313 TRP B CZ2 1 
ATOM   4920 C  CZ3 . TRP B 1 310 ? 25.428 -35.714 -22.798 1.00 26.51 ? 313 TRP B CZ3 1 
ATOM   4921 C  CH2 . TRP B 1 310 ? 24.121 -36.208 -22.663 1.00 22.63 ? 313 TRP B CH2 1 
ATOM   4922 N  N   . ALA B 1 311 ? 29.075 -33.471 -27.570 1.00 25.03 ? 314 ALA B N   1 
ATOM   4923 C  CA  . ALA B 1 311 ? 30.488 -33.316 -27.858 1.00 24.78 ? 314 ALA B CA  1 
ATOM   4924 C  C   . ALA B 1 311 ? 31.281 -33.953 -26.732 1.00 25.48 ? 314 ALA B C   1 
ATOM   4925 O  O   . ALA B 1 311 ? 31.043 -33.671 -25.559 1.00 26.51 ? 314 ALA B O   1 
ATOM   4926 C  CB  . ALA B 1 311 ? 30.845 -31.839 -27.989 1.00 25.31 ? 314 ALA B CB  1 
ATOM   4927 N  N   . LEU B 1 312 ? 32.225 -34.812 -27.093 1.00 23.17 ? 315 LEU B N   1 
ATOM   4928 C  CA  . LEU B 1 312 ? 33.082 -35.455 -26.108 1.00 24.69 ? 315 LEU B CA  1 
ATOM   4929 C  C   . LEU B 1 312 ? 34.424 -34.727 -26.057 1.00 25.41 ? 315 LEU B C   1 
ATOM   4930 O  O   . LEU B 1 312 ? 35.314 -34.981 -26.876 1.00 25.17 ? 315 LEU B O   1 
ATOM   4931 C  CB  . LEU B 1 312 ? 33.289 -36.929 -26.476 1.00 20.88 ? 315 LEU B CB  1 
ATOM   4932 C  CG  . LEU B 1 312 ? 31.990 -37.734 -26.582 1.00 20.20 ? 315 LEU B CG  1 
ATOM   4933 C  CD1 . LEU B 1 312 ? 32.311 -39.191 -26.892 1.00 21.23 ? 315 LEU B CD1 1 
ATOM   4934 C  CD2 . LEU B 1 312 ? 31.207 -37.634 -25.269 1.00 20.14 ? 315 LEU B CD2 1 
ATOM   4935 N  N   . GLY B 1 313 ? 34.549 -33.821 -25.089 1.00 23.76 ? 316 GLY B N   1 
ATOM   4936 C  CA  . GLY B 1 313 ? 35.726 -32.981 -24.986 1.00 22.72 ? 316 GLY B CA  1 
ATOM   4937 C  C   . GLY B 1 313 ? 36.738 -33.490 -23.968 1.00 25.05 ? 316 GLY B C   1 
ATOM   4938 O  O   . GLY B 1 313 ? 36.820 -34.697 -23.706 1.00 24.82 ? 316 GLY B O   1 
ATOM   4939 N  N   . ALA B 1 314 ? 37.506 -32.567 -23.392 1.00 23.36 ? 317 ALA B N   1 
ATOM   4940 C  CA  . ALA B 1 314 ? 38.634 -32.920 -22.534 1.00 24.26 ? 317 ALA B CA  1 
ATOM   4941 C  C   . ALA B 1 314 ? 38.251 -33.845 -21.375 1.00 23.51 ? 317 ALA B C   1 
ATOM   4942 O  O   . ALA B 1 314 ? 39.043 -34.690 -20.964 1.00 23.45 ? 317 ALA B O   1 
ATOM   4943 C  CB  . ALA B 1 314 ? 39.291 -31.652 -21.991 1.00 23.64 ? 317 ALA B CB  1 
ATOM   4944 N  N   . THR B 1 315 ? 37.045 -33.679 -20.845 1.00 23.60 ? 318 THR B N   1 
ATOM   4945 C  CA  . THR B 1 315 ? 36.597 -34.521 -19.743 1.00 24.44 ? 318 THR B CA  1 
ATOM   4946 C  C   . THR B 1 315 ? 36.682 -35.994 -20.147 1.00 25.02 ? 318 THR B C   1 
ATOM   4947 O  O   . THR B 1 315 ? 37.166 -36.834 -19.388 1.00 27.15 ? 318 THR B O   1 
ATOM   4948 C  CB  . THR B 1 315 ? 35.138 -34.219 -19.357 1.00 23.05 ? 318 THR B CB  1 
ATOM   4949 O  OG1 . THR B 1 315 ? 34.972 -32.808 -19.147 1.00 25.02 ? 318 THR B OG1 1 
ATOM   4950 C  CG2 . THR B 1 315 ? 34.772 -34.965 -18.072 1.00 20.93 ? 318 THR B CG2 1 
ATOM   4951 N  N   . PHE B 1 316 ? 36.202 -36.292 -21.350 1.00 23.52 ? 319 PHE B N   1 
ATOM   4952 C  CA  . PHE B 1 316 ? 36.167 -37.657 -21.868 1.00 22.71 ? 319 PHE B CA  1 
ATOM   4953 C  C   . PHE B 1 316 ? 37.577 -38.091 -22.282 1.00 22.49 ? 319 PHE B C   1 
ATOM   4954 O  O   . PHE B 1 316 ? 38.023 -39.189 -21.953 1.00 24.46 ? 319 PHE B O   1 
ATOM   4955 C  CB  . PHE B 1 316 ? 35.204 -37.715 -23.065 1.00 21.47 ? 319 PHE B CB  1 
ATOM   4956 C  CG  . PHE B 1 316 ? 34.983 -39.102 -23.617 1.00 18.23 ? 319 PHE B CG  1 
ATOM   4957 C  CD1 . PHE B 1 316 ? 35.844 -39.635 -24.561 1.00 19.65 ? 319 PHE B CD1 1 
ATOM   4958 C  CD2 . PHE B 1 316 ? 33.909 -39.863 -23.199 1.00 19.96 ? 319 PHE B CD2 1 
ATOM   4959 C  CE1 . PHE B 1 316 ? 35.631 -40.908 -25.074 1.00 22.07 ? 319 PHE B CE1 1 
ATOM   4960 C  CE2 . PHE B 1 316 ? 33.691 -41.136 -23.708 1.00 18.67 ? 319 PHE B CE2 1 
ATOM   4961 C  CZ  . PHE B 1 316 ? 34.551 -41.655 -24.641 1.00 19.46 ? 319 PHE B CZ  1 
ATOM   4962 N  N   . ILE B 1 317 ? 38.279 -37.210 -22.984 1.00 22.28 ? 320 ILE B N   1 
ATOM   4963 C  CA  . ILE B 1 317 ? 39.581 -37.530 -23.558 1.00 24.81 ? 320 ILE B CA  1 
ATOM   4964 C  C   . ILE B 1 317 ? 40.659 -37.773 -22.514 1.00 26.33 ? 320 ILE B C   1 
ATOM   4965 O  O   . ILE B 1 317 ? 41.550 -38.591 -22.731 1.00 26.99 ? 320 ILE B O   1 
ATOM   4966 C  CB  . ILE B 1 317 ? 40.045 -36.407 -24.513 1.00 25.49 ? 320 ILE B CB  1 
ATOM   4967 C  CG1 . ILE B 1 317 ? 39.117 -36.361 -25.725 1.00 22.86 ? 320 ILE B CG1 1 
ATOM   4968 C  CG2 . ILE B 1 317 ? 41.489 -36.627 -24.932 1.00 24.88 ? 320 ILE B CG2 1 
ATOM   4969 C  CD1 . ILE B 1 317 ? 39.290 -35.143 -26.582 1.00 22.66 ? 320 ILE B CD1 1 
ATOM   4970 N  N   . ARG B 1 318 ? 40.574 -37.080 -21.379 1.00 27.73 ? 321 ARG B N   1 
ATOM   4971 C  CA  . ARG B 1 318 ? 41.474 -37.348 -20.251 1.00 27.78 ? 321 ARG B CA  1 
ATOM   4972 C  C   . ARG B 1 318 ? 41.494 -38.831 -19.882 1.00 28.98 ? 321 ARG B C   1 
ATOM   4973 O  O   . ARG B 1 318 ? 42.527 -39.369 -19.479 1.00 27.41 ? 321 ARG B O   1 
ATOM   4974 C  CB  . ARG B 1 318 ? 41.056 -36.547 -19.008 1.00 27.43 ? 321 ARG B CB  1 
ATOM   4975 C  CG  . ARG B 1 318 ? 41.702 -35.174 -18.881 1.00 26.21 ? 321 ARG B CG  1 
ATOM   4976 C  CD  . ARG B 1 318 ? 41.474 -34.568 -17.492 1.00 26.21 ? 321 ARG B CD  1 
ATOM   4977 N  NE  . ARG B 1 318 ? 40.069 -34.221 -17.260 1.00 24.69 ? 321 ARG B NE  1 
ATOM   4978 C  CZ  . ARG B 1 318 ? 39.512 -33.084 -17.660 1.00 23.54 ? 321 ARG B CZ  1 
ATOM   4979 N  NH1 . ARG B 1 318 ? 40.239 -32.183 -18.312 1.00 24.19 ? 321 ARG B NH1 1 
ATOM   4980 N  NH2 . ARG B 1 318 ? 38.231 -32.850 -17.419 1.00 23.19 ? 321 ARG B NH2 1 
ATOM   4981 N  N   . LYS B 1 319 ? 40.348 -39.493 -19.995 1.00 27.85 ? 322 LYS B N   1 
ATOM   4982 C  CA  . LYS B 1 319 ? 40.278 -40.884 -19.582 1.00 27.05 ? 322 LYS B CA  1 
ATOM   4983 C  C   . LYS B 1 319 ? 40.543 -41.830 -20.741 1.00 25.40 ? 322 LYS B C   1 
ATOM   4984 O  O   . LYS B 1 319 ? 41.059 -42.938 -20.552 1.00 26.53 ? 322 LYS B O   1 
ATOM   4985 C  CB  . LYS B 1 319 ? 38.917 -41.203 -18.968 1.00 27.88 ? 322 LYS B CB  1 
ATOM   4986 C  CG  . LYS B 1 319 ? 38.767 -42.672 -18.621 1.00 30.18 ? 322 LYS B CG  1 
ATOM   4987 C  CD  . LYS B 1 319 ? 37.967 -42.853 -17.363 1.00 32.10 ? 322 LYS B CD  1 
ATOM   4988 C  CE  . LYS B 1 319 ? 37.641 -44.313 -17.139 1.00 34.30 ? 322 LYS B CE  1 
ATOM   4989 N  NZ  . LYS B 1 319 ? 36.615 -44.447 -16.071 1.00 40.53 ? 322 LYS B NZ  1 
ATOM   4990 N  N   . PHE B 1 320 ? 40.191 -41.396 -21.943 1.00 21.87 ? 323 PHE B N   1 
ATOM   4991 C  CA  . PHE B 1 320 ? 40.365 -42.245 -23.112 1.00 23.09 ? 323 PHE B CA  1 
ATOM   4992 C  C   . PHE B 1 320 ? 41.228 -41.574 -24.169 1.00 22.28 ? 323 PHE B C   1 
ATOM   4993 O  O   . PHE B 1 320 ? 40.786 -40.668 -24.875 1.00 20.84 ? 323 PHE B O   1 
ATOM   4994 C  CB  . PHE B 1 320 ? 38.998 -42.631 -23.680 1.00 22.05 ? 323 PHE B CB  1 
ATOM   4995 C  CG  . PHE B 1 320 ? 38.119 -43.341 -22.686 1.00 23.00 ? 323 PHE B CG  1 
ATOM   4996 C  CD1 . PHE B 1 320 ? 38.346 -44.669 -22.366 1.00 21.01 ? 323 PHE B CD1 1 
ATOM   4997 C  CD2 . PHE B 1 320 ? 37.092 -42.665 -22.038 1.00 22.55 ? 323 PHE B CD2 1 
ATOM   4998 C  CE1 . PHE B 1 320 ? 37.566 -45.315 -21.412 1.00 20.98 ? 323 PHE B CE1 1 
ATOM   4999 C  CE2 . PHE B 1 320 ? 36.311 -43.301 -21.087 1.00 22.05 ? 323 PHE B CE2 1 
ATOM   5000 C  CZ  . PHE B 1 320 ? 36.547 -44.627 -20.771 1.00 23.14 ? 323 PHE B CZ  1 
ATOM   5001 N  N   . TYR B 1 321 ? 42.477 -42.022 -24.245 1.00 23.68 ? 324 TYR B N   1 
ATOM   5002 C  CA  . TYR B 1 321 ? 43.396 -41.620 -25.300 1.00 24.34 ? 324 TYR B CA  1 
ATOM   5003 C  C   . TYR B 1 321 ? 42.711 -41.848 -26.654 1.00 25.46 ? 324 TYR B C   1 
ATOM   5004 O  O   . TYR B 1 321 ? 42.102 -42.892 -26.877 1.00 26.31 ? 324 TYR B O   1 
ATOM   5005 C  CB  . TYR B 1 321 ? 44.678 -42.456 -25.188 1.00 26.03 ? 324 TYR B CB  1 
ATOM   5006 C  CG  . TYR B 1 321 ? 45.789 -42.063 -26.133 1.00 26.56 ? 324 TYR B CG  1 
ATOM   5007 C  CD1 . TYR B 1 321 ? 45.699 -42.339 -27.493 1.00 27.66 ? 324 TYR B CD1 1 
ATOM   5008 C  CD2 . TYR B 1 321 ? 46.928 -41.411 -25.668 1.00 27.44 ? 324 TYR B CD2 1 
ATOM   5009 C  CE1 . TYR B 1 321 ? 46.710 -41.971 -28.365 1.00 27.71 ? 324 TYR B CE1 1 
ATOM   5010 C  CE2 . TYR B 1 321 ? 47.945 -41.042 -26.532 1.00 27.35 ? 324 TYR B CE2 1 
ATOM   5011 C  CZ  . TYR B 1 321 ? 47.829 -41.321 -27.882 1.00 27.87 ? 324 TYR B CZ  1 
ATOM   5012 O  OH  . TYR B 1 321 ? 48.814 -40.919 -28.762 1.00 26.66 ? 324 TYR B OH  1 
ATOM   5013 N  N   . THR B 1 322 ? 42.819 -40.867 -27.547 1.00 25.58 ? 325 THR B N   1 
ATOM   5014 C  CA  . THR B 1 322 ? 42.003 -40.824 -28.755 1.00 26.37 ? 325 THR B CA  1 
ATOM   5015 C  C   . THR B 1 322 ? 42.826 -40.666 -30.045 1.00 28.19 ? 325 THR B C   1 
ATOM   5016 O  O   . THR B 1 322 ? 43.583 -39.699 -30.209 1.00 28.77 ? 325 THR B O   1 
ATOM   5017 C  CB  . THR B 1 322 ? 40.984 -39.667 -28.673 1.00 25.80 ? 325 THR B CB  1 
ATOM   5018 O  OG1 . THR B 1 322 ? 40.190 -39.815 -27.487 1.00 25.89 ? 325 THR B OG1 1 
ATOM   5019 C  CG2 . THR B 1 322 ? 40.068 -39.672 -29.885 1.00 22.79 ? 325 THR B CG2 1 
ATOM   5020 N  N   . GLU B 1 323 ? 42.664 -41.622 -30.956 1.00 28.89 ? 326 GLU B N   1 
ATOM   5021 C  CA  . GLU B 1 323 ? 43.305 -41.569 -32.267 1.00 27.71 ? 326 GLU B CA  1 
ATOM   5022 C  C   . GLU B 1 323 ? 42.297 -41.219 -33.355 1.00 27.97 ? 326 GLU B C   1 
ATOM   5023 O  O   . GLU B 1 323 ? 41.243 -41.847 -33.465 1.00 25.76 ? 326 GLU B O   1 
ATOM   5024 C  CB  . GLU B 1 323 ? 43.944 -42.917 -32.591 1.00 28.62 ? 326 GLU B CB  1 
ATOM   5025 C  CG  . GLU B 1 323 ? 44.649 -42.961 -33.935 1.00 28.72 ? 326 GLU B CG  1 
ATOM   5026 C  CD  . GLU B 1 323 ? 45.262 -44.318 -34.204 1.00 32.74 ? 326 GLU B CD  1 
ATOM   5027 O  OE1 . GLU B 1 323 ? 44.558 -45.187 -34.767 1.00 30.44 ? 326 GLU B OE1 1 
ATOM   5028 O  OE2 . GLU B 1 323 ? 46.444 -44.517 -33.845 1.00 31.00 ? 326 GLU B OE2 1 
ATOM   5029 N  N   . PHE B 1 324 ? 42.625 -40.209 -34.155 1.00 25.86 ? 327 PHE B N   1 
ATOM   5030 C  CA  . PHE B 1 324 ? 41.790 -39.818 -35.277 1.00 27.16 ? 327 PHE B CA  1 
ATOM   5031 C  C   . PHE B 1 324 ? 42.416 -40.347 -36.580 1.00 28.61 ? 327 PHE B C   1 
ATOM   5032 O  O   . PHE B 1 324 ? 43.527 -39.955 -36.952 1.00 28.72 ? 327 PHE B O   1 
ATOM   5033 C  CB  . PHE B 1 324 ? 41.668 -38.289 -35.319 1.00 27.01 ? 327 PHE B CB  1 
ATOM   5034 C  CG  . PHE B 1 324 ? 41.054 -37.695 -34.074 1.00 27.98 ? 327 PHE B CG  1 
ATOM   5035 C  CD1 . PHE B 1 324 ? 39.701 -37.387 -34.031 1.00 28.32 ? 327 PHE B CD1 1 
ATOM   5036 C  CD2 . PHE B 1 324 ? 41.820 -37.479 -32.937 1.00 30.02 ? 327 PHE B CD2 1 
ATOM   5037 C  CE1 . PHE B 1 324 ? 39.122 -36.880 -32.879 1.00 24.72 ? 327 PHE B CE1 1 
ATOM   5038 C  CE2 . PHE B 1 324 ? 41.242 -36.969 -31.773 1.00 27.36 ? 327 PHE B CE2 1 
ATOM   5039 C  CZ  . PHE B 1 324 ? 39.895 -36.673 -31.751 1.00 27.22 ? 327 PHE B CZ  1 
ATOM   5040 N  N   . ASP B 1 325 ? 41.698 -41.234 -37.265 1.00 29.61 ? 328 ASP B N   1 
ATOM   5041 C  CA  . ASP B 1 325 ? 42.263 -41.982 -38.391 1.00 30.84 ? 328 ASP B CA  1 
ATOM   5042 C  C   . ASP B 1 325 ? 41.668 -41.550 -39.728 1.00 31.46 ? 328 ASP B C   1 
ATOM   5043 O  O   . ASP B 1 325 ? 40.490 -41.781 -39.989 1.00 32.08 ? 328 ASP B O   1 
ATOM   5044 C  CB  . ASP B 1 325 ? 42.021 -43.479 -38.170 1.00 30.56 ? 328 ASP B CB  1 
ATOM   5045 C  CG  . ASP B 1 325 ? 42.632 -44.349 -39.259 1.00 30.62 ? 328 ASP B CG  1 
ATOM   5046 O  OD1 . ASP B 1 325 ? 42.925 -43.836 -40.360 1.00 30.49 ? 328 ASP B OD1 1 
ATOM   5047 O  OD2 . ASP B 1 325 ? 42.816 -45.557 -39.003 1.00 28.48 ? 328 ASP B OD2 1 
ATOM   5048 N  N   . ARG B 1 326 ? 42.487 -40.937 -40.581 1.00 33.08 ? 329 ARG B N   1 
ATOM   5049 C  CA  . ARG B 1 326 ? 42.001 -40.403 -41.853 1.00 33.03 ? 329 ARG B CA  1 
ATOM   5050 C  C   . ARG B 1 326 ? 42.062 -41.437 -42.968 1.00 33.09 ? 329 ARG B C   1 
ATOM   5051 O  O   . ARG B 1 326 ? 41.280 -41.392 -43.917 1.00 33.65 ? 329 ARG B O   1 
ATOM   5052 C  CB  . ARG B 1 326 ? 42.807 -39.167 -42.252 1.00 34.45 ? 329 ARG B CB  1 
ATOM   5053 C  CG  . ARG B 1 326 ? 42.424 -37.916 -41.474 1.00 37.12 ? 329 ARG B CG  1 
ATOM   5054 C  CD  . ARG B 1 326 ? 41.013 -37.473 -41.822 1.00 34.19 ? 329 ARG B CD  1 
ATOM   5055 N  NE  . ARG B 1 326 ? 40.906 -37.134 -43.234 1.00 33.12 ? 329 ARG B NE  1 
ATOM   5056 C  CZ  . ARG B 1 326 ? 41.388 -36.016 -43.763 1.00 37.57 ? 329 ARG B CZ  1 
ATOM   5057 N  NH1 . ARG B 1 326 ? 42.010 -35.130 -42.992 1.00 37.10 ? 329 ARG B NH1 1 
ATOM   5058 N  NH2 . ARG B 1 326 ? 41.253 -35.781 -45.063 1.00 36.44 ? 329 ARG B NH2 1 
ATOM   5059 N  N   . ARG B 1 327 ? 42.991 -42.375 -42.840 1.00 34.36 ? 330 ARG B N   1 
ATOM   5060 C  CA  . ARG B 1 327 ? 43.115 -43.464 -43.797 1.00 33.20 ? 330 ARG B CA  1 
ATOM   5061 C  C   . ARG B 1 327 ? 41.831 -44.289 -43.784 1.00 33.09 ? 330 ARG B C   1 
ATOM   5062 O  O   . ARG B 1 327 ? 41.238 -44.550 -44.835 1.00 30.93 ? 330 ARG B O   1 
ATOM   5063 C  CB  . ARG B 1 327 ? 44.312 -44.341 -43.421 1.00 33.27 ? 330 ARG B CB  1 
ATOM   5064 C  CG  . ARG B 1 327 ? 44.818 -45.242 -44.538 1.00 34.44 ? 330 ARG B CG  1 
ATOM   5065 C  CD  . ARG B 1 327 ? 44.070 -46.552 -44.578 1.00 35.10 ? 330 ARG B CD  1 
ATOM   5066 N  NE  . ARG B 1 327 ? 44.854 -47.605 -45.214 1.00 36.99 ? 330 ARG B NE  1 
ATOM   5067 C  CZ  . ARG B 1 327 ? 44.485 -48.881 -45.260 1.00 37.91 ? 330 ARG B CZ  1 
ATOM   5068 N  NH1 . ARG B 1 327 ? 43.338 -49.263 -44.708 1.00 36.62 ? 330 ARG B NH1 1 
ATOM   5069 N  NH2 . ARG B 1 327 ? 45.267 -49.778 -45.848 1.00 38.26 ? 330 ARG B NH2 1 
ATOM   5070 N  N   . ASN B 1 328 ? 41.402 -44.675 -42.584 1.00 31.78 ? 331 ASN B N   1 
ATOM   5071 C  CA  . ASN B 1 328 ? 40.275 -45.590 -42.412 1.00 32.05 ? 331 ASN B CA  1 
ATOM   5072 C  C   . ASN B 1 328 ? 38.993 -44.879 -41.964 1.00 33.14 ? 331 ASN B C   1 
ATOM   5073 O  O   . ASN B 1 328 ? 38.018 -45.536 -41.594 1.00 32.87 ? 331 ASN B O   1 
ATOM   5074 C  CB  . ASN B 1 328 ? 40.633 -46.676 -41.385 1.00 32.92 ? 331 ASN B CB  1 
ATOM   5075 C  CG  . ASN B 1 328 ? 41.906 -47.433 -41.744 1.00 35.91 ? 331 ASN B CG  1 
ATOM   5076 O  OD1 . ASN B 1 328 ? 42.920 -47.347 -41.040 1.00 32.00 ? 331 ASN B OD1 1 
ATOM   5077 N  ND2 . ASN B 1 328 ? 41.857 -48.185 -42.842 1.00 34.79 ? 331 ASN B ND2 1 
ATOM   5078 N  N   . ASN B 1 329 ? 38.999 -43.546 -41.995 1.00 32.14 ? 332 ASN B N   1 
ATOM   5079 C  CA  . ASN B 1 329 ? 37.875 -42.744 -41.505 1.00 32.27 ? 332 ASN B CA  1 
ATOM   5080 C  C   . ASN B 1 329 ? 37.251 -43.320 -40.236 1.00 30.57 ? 332 ASN B C   1 
ATOM   5081 O  O   . ASN B 1 329 ? 36.106 -43.784 -40.244 1.00 29.99 ? 332 ASN B O   1 
ATOM   5082 C  CB  . ASN B 1 329 ? 36.799 -42.609 -42.590 1.00 34.99 ? 332 ASN B CB  1 
ATOM   5083 C  CG  . ASN B 1 329 ? 37.238 -41.715 -43.741 1.00 37.86 ? 332 ASN B CG  1 
ATOM   5084 O  OD1 . ASN B 1 329 ? 37.109 -40.491 -43.678 1.00 37.71 ? 332 ASN B OD1 1 
ATOM   5085 N  ND2 . ASN B 1 329 ? 37.760 -42.325 -44.799 1.00 39.23 ? 332 ASN B ND2 1 
ATOM   5086 N  N   . ARG B 1 330 ? 38.007 -43.290 -39.145 1.00 28.64 ? 333 ARG B N   1 
ATOM   5087 C  CA  . ARG B 1 330 ? 37.525 -43.823 -37.879 1.00 29.10 ? 333 ARG B CA  1 
ATOM   5088 C  C   . ARG B 1 330 ? 38.216 -43.171 -36.685 1.00 28.96 ? 333 ARG B C   1 
ATOM   5089 O  O   . ARG B 1 330 ? 39.228 -42.476 -36.822 1.00 29.51 ? 333 ARG B O   1 
ATOM   5090 C  CB  . ARG B 1 330 ? 37.750 -45.336 -37.821 1.00 27.50 ? 333 ARG B CB  1 
ATOM   5091 C  CG  . ARG B 1 330 ? 39.222 -45.712 -37.816 1.00 28.31 ? 333 ARG B CG  1 
ATOM   5092 C  CD  . ARG B 1 330 ? 39.435 -47.214 -37.871 1.00 26.44 ? 333 ARG B CD  1 
ATOM   5093 N  NE  . ARG B 1 330 ? 40.853 -47.540 -37.769 1.00 27.12 ? 333 ARG B NE  1 
ATOM   5094 C  CZ  . ARG B 1 330 ? 41.321 -48.772 -37.643 1.00 25.12 ? 333 ARG B CZ  1 
ATOM   5095 N  NH1 . ARG B 1 330 ? 40.482 -49.794 -37.607 1.00 25.40 ? 333 ARG B NH1 1 
ATOM   5096 N  NH2 . ARG B 1 330 ? 42.623 -48.979 -37.534 1.00 30.31 ? 333 ARG B NH2 1 
ATOM   5097 N  N   . ILE B 1 331 ? 37.659 -43.420 -35.506 1.00 28.71 ? 334 ILE B N   1 
ATOM   5098 C  CA  . ILE B 1 331 ? 38.246 -42.968 -34.260 1.00 25.90 ? 334 ILE B CA  1 
ATOM   5099 C  C   . ILE B 1 331 ? 38.497 -44.179 -33.365 1.00 25.75 ? 334 ILE B C   1 
ATOM   5100 O  O   . ILE B 1 331 ? 37.650 -45.059 -33.241 1.00 28.09 ? 334 ILE B O   1 
ATOM   5101 C  CB  . ILE B 1 331 ? 37.293 -41.971 -33.558 1.00 25.41 ? 334 ILE B CB  1 
ATOM   5102 C  CG1 . ILE B 1 331 ? 37.146 -40.729 -34.433 1.00 23.49 ? 334 ILE B CG1 1 
ATOM   5103 C  CG2 . ILE B 1 331 ? 37.810 -41.614 -32.172 1.00 23.24 ? 334 ILE B CG2 1 
ATOM   5104 C  CD1 . ILE B 1 331 ? 36.118 -39.750 -33.955 1.00 22.30 ? 334 ILE B CD1 1 
ATOM   5105 N  N   . GLY B 1 332 ? 39.673 -44.235 -32.757 1.00 26.50 ? 335 GLY B N   1 
ATOM   5106 C  CA  . GLY B 1 332 ? 39.935 -45.285 -31.791 1.00 24.98 ? 335 GLY B CA  1 
ATOM   5107 C  C   . GLY B 1 332 ? 40.072 -44.732 -30.382 1.00 23.94 ? 335 GLY B C   1 
ATOM   5108 O  O   . GLY B 1 332 ? 40.614 -43.651 -30.182 1.00 24.41 ? 335 GLY B O   1 
ATOM   5109 N  N   . PHE B 1 333 ? 39.590 -45.488 -29.407 1.00 25.37 ? 336 PHE B N   1 
ATOM   5110 C  CA  . PHE B 1 333 ? 39.694 -45.113 -28.006 1.00 26.52 ? 336 PHE B CA  1 
ATOM   5111 C  C   . PHE B 1 333 ? 40.464 -46.179 -27.243 1.00 27.18 ? 336 PHE B C   1 
ATOM   5112 O  O   . PHE B 1 333 ? 40.180 -47.371 -27.374 1.00 29.86 ? 336 PHE B O   1 
ATOM   5113 C  CB  . PHE B 1 333 ? 38.300 -44.966 -27.389 1.00 25.14 ? 336 PHE B CB  1 
ATOM   5114 C  CG  . PHE B 1 333 ? 37.532 -43.772 -27.888 1.00 27.34 ? 336 PHE B CG  1 
ATOM   5115 C  CD1 . PHE B 1 333 ? 38.087 -42.501 -27.837 1.00 25.39 ? 336 PHE B CD1 1 
ATOM   5116 C  CD2 . PHE B 1 333 ? 36.243 -43.917 -28.382 1.00 26.65 ? 336 PHE B CD2 1 
ATOM   5117 C  CE1 . PHE B 1 333 ? 37.369 -41.400 -28.268 1.00 26.84 ? 336 PHE B CE1 1 
ATOM   5118 C  CE2 . PHE B 1 333 ? 35.521 -42.816 -28.816 1.00 24.85 ? 336 PHE B CE2 1 
ATOM   5119 C  CZ  . PHE B 1 333 ? 36.083 -41.559 -28.759 1.00 26.12 ? 336 PHE B CZ  1 
ATOM   5120 N  N   . ALA B 1 334 ? 41.437 -45.746 -26.448 1.00 27.40 ? 337 ALA B N   1 
ATOM   5121 C  CA  . ALA B 1 334 ? 42.145 -46.633 -25.532 1.00 26.83 ? 337 ALA B CA  1 
ATOM   5122 C  C   . ALA B 1 334 ? 42.212 -45.977 -24.156 1.00 28.13 ? 337 ALA B C   1 
ATOM   5123 O  O   . ALA B 1 334 ? 42.199 -44.758 -24.052 1.00 28.66 ? 337 ALA B O   1 
ATOM   5124 C  CB  . ALA B 1 334 ? 43.544 -46.900 -26.051 1.00 24.68 ? 337 ALA B CB  1 
ATOM   5125 N  N   . LEU B 1 335 ? 42.279 -46.785 -23.103 1.00 30.71 ? 338 LEU B N   1 
ATOM   5126 C  CA  . LEU B 1 335 ? 42.451 -46.256 -21.755 1.00 31.99 ? 338 LEU B CA  1 
ATOM   5127 C  C   . LEU B 1 335 ? 43.752 -45.473 -21.633 1.00 32.26 ? 338 LEU B C   1 
ATOM   5128 O  O   . LEU B 1 335 ? 44.835 -46.022 -21.846 1.00 33.74 ? 338 LEU B O   1 
ATOM   5129 C  CB  . LEU B 1 335 ? 42.463 -47.390 -20.733 1.00 33.90 ? 338 LEU B CB  1 
ATOM   5130 C  CG  . LEU B 1 335 ? 41.132 -47.874 -20.169 1.00 35.46 ? 338 LEU B CG  1 
ATOM   5131 C  CD1 . LEU B 1 335 ? 41.399 -48.988 -19.171 1.00 38.27 ? 338 LEU B CD1 1 
ATOM   5132 C  CD2 . LEU B 1 335 ? 40.400 -46.717 -19.497 1.00 38.10 ? 338 LEU B CD2 1 
ATOM   5133 N  N   . ALA B 1 336 ? 43.642 -44.198 -21.268 1.00 31.22 ? 339 ALA B N   1 
ATOM   5134 C  CA  . ALA B 1 336 ? 44.811 -43.335 -21.108 1.00 31.82 ? 339 ALA B CA  1 
ATOM   5135 C  C   . ALA B 1 336 ? 45.606 -43.697 -19.862 1.00 30.69 ? 339 ALA B C   1 
ATOM   5136 O  O   . ALA B 1 336 ? 45.046 -44.204 -18.896 1.00 30.78 ? 339 ALA B O   1 
ATOM   5137 C  CB  . ALA B 1 336 ? 44.379 -41.871 -21.039 1.00 30.60 ? 339 ALA B CB  1 
ATOM   5138 N  N   . ARG B 1 337 ? 46.912 -43.442 -19.894 1.00 32.27 ? 340 ARG B N   1 
ATOM   5139 C  CA  . ARG B 1 337 ? 47.746 -43.597 -18.710 1.00 35.88 ? 340 ARG B CA  1 
ATOM   5140 C  C   . ARG B 1 337 ? 48.911 -42.602 -18.676 1.00 37.36 ? 340 ARG B C   1 
ATOM   5141 O  O   . ARG B 1 337 ? 49.077 -41.834 -19.653 1.00 37.74 ? 340 ARG B O   1 
ATOM   5142 C  CB  . ARG B 1 337 ? 48.294 -45.018 -18.636 1.00 36.23 ? 340 ARG B CB  1 
ATOM   5143 C  CG  . ARG B 1 337 ? 49.398 -45.301 -19.626 1.00 39.83 ? 340 ARG B CG  1 
ATOM   5144 C  CD  . ARG B 1 337 ? 49.588 -46.791 -19.806 1.00 45.16 ? 340 ARG B CD  1 
ATOM   5145 N  NE  . ARG B 1 337 ? 50.814 -47.100 -20.529 1.00 48.45 ? 340 ARG B NE  1 
ATOM   5146 C  CZ  . ARG B 1 337 ? 51.968 -47.396 -19.940 1.00 51.28 ? 340 ARG B CZ  1 
ATOM   5147 N  NH1 . ARG B 1 337 ? 52.051 -47.421 -18.615 1.00 52.40 ? 340 ARG B NH1 1 
ATOM   5148 N  NH2 . ARG B 1 337 ? 53.038 -47.671 -20.674 1.00 50.40 ? 340 ARG B NH2 1 
ATOM   5149 O  OXT . ARG B 1 337 ? 49.652 -42.606 -17.665 1.00 36.24 ? 340 ARG B OXT 1 
HETATM 5150 C  C1  . NAG C 2 .   ? 40.598 -7.290  13.036  1.00 46.54 ? 1   NAG C C1  1 
HETATM 5151 C  C2  . NAG C 2 .   ? 41.301 -6.932  14.352  1.00 48.06 ? 1   NAG C C2  1 
HETATM 5152 C  C3  . NAG C 2 .   ? 40.761 -7.799  15.495  1.00 51.71 ? 1   NAG C C3  1 
HETATM 5153 C  C4  . NAG C 2 .   ? 39.227 -7.757  15.553  1.00 53.85 ? 1   NAG C C4  1 
HETATM 5154 C  C5  . NAG C 2 .   ? 38.656 -8.104  14.171  1.00 53.57 ? 1   NAG C C5  1 
HETATM 5155 C  C6  . NAG C 2 .   ? 37.132 -8.066  14.094  1.00 54.57 ? 1   NAG C C6  1 
HETATM 5156 C  C7  . NAG C 2 .   ? 43.596 -6.258  14.694  1.00 46.44 ? 1   NAG C C7  1 
HETATM 5157 C  C8  . NAG C 2 .   ? 44.968 -6.772  15.086  1.00 46.70 ? 1   NAG C C8  1 
HETATM 5158 N  N2  . NAG C 2 .   ? 42.729 -7.144  14.210  1.00 48.13 ? 1   NAG C N2  1 
HETATM 5159 O  O3  . NAG C 2 .   ? 41.298 -7.348  16.730  1.00 51.26 ? 1   NAG C O3  1 
HETATM 5160 O  O4  . NAG C 2 .   ? 38.763 -8.716  16.527  1.00 59.48 ? 1   NAG C O4  1 
HETATM 5161 O  O5  . NAG C 2 .   ? 39.172 -7.185  13.182  1.00 48.39 ? 1   NAG C O5  1 
HETATM 5162 O  O6  . NAG C 2 .   ? 36.613 -6.787  14.435  1.00 56.82 ? 1   NAG C O6  1 
HETATM 5163 O  O7  . NAG C 2 .   ? 43.330 -5.067  14.830  1.00 45.68 ? 1   NAG C O7  1 
HETATM 5164 C  C1  . NAG C 2 .   ? 37.946 -8.251  17.551  1.00 63.56 ? 2   NAG C C1  1 
HETATM 5165 C  C2  . NAG C 2 .   ? 37.475 -9.437  18.399  1.00 65.12 ? 2   NAG C C2  1 
HETATM 5166 C  C3  . NAG C 2 .   ? 36.647 -8.937  19.583  1.00 66.09 ? 2   NAG C C3  1 
HETATM 5167 C  C4  . NAG C 2 .   ? 37.457 -7.917  20.386  1.00 66.41 ? 2   NAG C C4  1 
HETATM 5168 C  C5  . NAG C 2 .   ? 37.943 -6.792  19.462  1.00 66.41 ? 2   NAG C C5  1 
HETATM 5169 C  C6  . NAG C 2 .   ? 38.835 -5.789  20.179  1.00 67.59 ? 2   NAG C C6  1 
HETATM 5170 C  C7  . NAG C 2 .   ? 36.962 -11.649 17.606  1.00 68.26 ? 2   NAG C C7  1 
HETATM 5171 C  C8  . NAG C 2 .   ? 36.008 -12.551 18.378  1.00 68.19 ? 2   NAG C C8  1 
HETATM 5172 N  N2  . NAG C 2 .   ? 36.690 -10.348 17.591  1.00 67.10 ? 2   NAG C N2  1 
HETATM 5173 O  O3  . NAG C 2 .   ? 36.293 -10.032 20.416  1.00 66.94 ? 2   NAG C O3  1 
HETATM 5174 O  O4  . NAG C 2 .   ? 36.652 -7.376  21.424  1.00 67.58 ? 2   NAG C O4  1 
HETATM 5175 O  O5  . NAG C 2 .   ? 38.711 -7.342  18.364  1.00 65.07 ? 2   NAG C O5  1 
HETATM 5176 O  O6  . NAG C 2 .   ? 39.943 -6.427  20.806  1.00 68.27 ? 2   NAG C O6  1 
HETATM 5177 O  O7  . NAG C 2 .   ? 37.940 -12.134 17.031  1.00 67.69 ? 2   NAG C O7  1 
HETATM 5178 C  C1  . 72X D 3 .   ? 29.052 -7.736  -14.580 1.00 21.69 ? 400 72X A C1  1 
HETATM 5179 O  O2  . 72X D 3 .   ? 28.338 -7.442  -15.802 1.00 21.01 ? 400 72X A O2  1 
HETATM 5180 C  C3  . 72X D 3 .   ? 30.557 -8.072  -14.920 1.00 23.00 ? 400 72X A C3  1 
HETATM 5181 C  C4  . 72X D 3 .   ? 31.201 -8.081  -16.228 1.00 24.80 ? 400 72X A C4  1 
HETATM 5182 C  C5  . 72X D 3 .   ? 31.383 -8.421  -13.660 1.00 23.19 ? 400 72X A C5  1 
HETATM 5183 C  C6  . 72X D 3 .   ? 32.622 -8.420  -16.331 1.00 22.35 ? 400 72X A C6  1 
HETATM 5184 C  C7  . 72X D 3 .   ? 32.777 -8.752  -13.813 1.00 25.87 ? 400 72X A C7  1 
HETATM 5185 C  C8  . 72X D 3 .   ? 33.400 -8.753  -15.141 1.00 24.39 ? 400 72X A C8  1 
HETATM 5186 C  C15 . 72X D 3 .   ? 28.981 -6.449  -13.672 1.00 21.88 ? 400 72X A C15 1 
HETATM 5187 C  C18 . 72X D 3 .   ? 29.615 -5.111  -14.153 1.00 23.56 ? 400 72X A C18 1 
HETATM 5188 C  C21 . 72X D 3 .   ? 29.515 -3.907  -13.182 1.00 22.38 ? 400 72X A C21 1 
HETATM 5189 C  C24 . 72X D 3 .   ? 28.077 -3.473  -12.832 1.00 27.27 ? 400 72X A C24 1 
HETATM 5190 O  O27 . 72X D 3 .   ? 27.365 -3.191  -14.005 1.00 29.48 ? 400 72X A O27 1 
HETATM 5191 C  C28 . 72X D 3 .   ? 26.034 -2.806  -13.751 1.00 28.16 ? 400 72X A C28 1 
HETATM 5192 C  C32 . 72X D 3 .   ? 26.530 -8.826  -9.182  1.00 18.55 ? 400 72X A C32 1 
HETATM 5193 C  C33 . 72X D 3 .   ? 25.114 -8.355  -8.723  1.00 17.00 ? 400 72X A C33 1 
HETATM 5194 C  C34 . 72X D 3 .   ? 27.664 -7.816  -8.854  1.00 17.16 ? 400 72X A C34 1 
HETATM 5195 N  N35 . 72X D 3 .   ? 25.030 -8.125  -7.270  1.00 19.06 ? 400 72X A N35 1 
HETATM 5196 C  C36 . 72X D 3 .   ? 29.108 -8.216  -9.244  1.00 20.47 ? 400 72X A C36 1 
HETATM 5197 C  C37 . 72X D 3 .   ? 30.119 -7.105  -8.861  1.00 18.11 ? 400 72X A C37 1 
HETATM 5198 C  C38 . 72X D 3 .   ? 31.595 -7.457  -9.234  1.00 22.66 ? 400 72X A C38 1 
HETATM 5199 C  C39 . 72X D 3 .   ? 32.076 -8.839  -8.688  1.00 23.49 ? 400 72X A C39 1 
HETATM 5200 C  C40 . 72X D 3 .   ? 29.556 -9.588  -8.512  1.00 19.19 ? 400 72X A C40 1 
HETATM 5201 C  C41 . 72X D 3 .   ? 31.028 -10.035 -8.872  1.00 25.85 ? 400 72X A C41 1 
HETATM 5202 N  N42 . 72X D 3 .   ? 26.535 -9.028  -10.622 1.00 20.23 ? 400 72X A N42 1 
HETATM 5203 C  C43 . 72X D 3 .   ? 26.258 -10.177 -11.342 1.00 20.20 ? 400 72X A C43 1 
HETATM 5204 O  O44 . 72X D 3 .   ? 25.953 -11.234 -10.790 1.00 24.72 ? 400 72X A O44 1 
HETATM 5205 N  N45 . 72X D 3 .   ? 26.365 -10.015 -12.732 1.00 23.28 ? 400 72X A N45 1 
HETATM 5206 C  C46 . 72X D 3 .   ? 27.606 -11.560 -14.003 1.00 21.53 ? 400 72X A C46 1 
HETATM 5207 C  C47 . 72X D 3 .   ? 28.323 -10.347 -14.687 1.00 22.19 ? 400 72X A C47 1 
HETATM 5208 C  C48 . 72X D 3 .   ? 28.317 -8.962  -13.823 1.00 21.27 ? 400 72X A C48 1 
HETATM 5209 C  C49 . 72X D 3 .   ? 26.754 -8.717  -13.446 1.00 20.34 ? 400 72X A C49 1 
HETATM 5210 C  C50 . 72X D 3 .   ? 26.126 -11.100 -13.655 1.00 18.98 ? 400 72X A C50 1 
HETATM 5211 C  C51 . 72X D 3 .   ? 25.176 -9.329  -6.443  1.00 23.22 ? 400 72X A C51 1 
HETATM 5212 CL CL1 . 72X D 3 .   ? 33.692 -9.144  -12.446 1.00 26.56 ? 400 72X A CL1 1 
HETATM 5213 C  C1  . GOL E 4 .   ? 18.794 -8.000  -45.702 1.00 55.42 ? 500 GOL A C1  1 
HETATM 5214 O  O1  . GOL E 4 .   ? 20.006 -8.640  -45.249 1.00 58.33 ? 500 GOL A O1  1 
HETATM 5215 C  C2  . GOL E 4 .   ? 18.194 -7.198  -44.519 1.00 54.55 ? 500 GOL A C2  1 
HETATM 5216 O  O2  . GOL E 4 .   ? 19.147 -6.227  -44.085 1.00 54.47 ? 500 GOL A O2  1 
HETATM 5217 C  C3  . GOL E 4 .   ? 16.917 -6.513  -44.973 1.00 53.57 ? 500 GOL A C3  1 
HETATM 5218 O  O3  . GOL E 4 .   ? 16.364 -5.771  -43.887 1.00 54.70 ? 500 GOL A O3  1 
HETATM 5219 C  C1  . GOL F 4 .   ? 1.145  -7.854  -2.369  1.00 59.49 ? 501 GOL A C1  1 
HETATM 5220 O  O1  . GOL F 4 .   ? 0.479  -6.656  -2.811  1.00 57.82 ? 501 GOL A O1  1 
HETATM 5221 C  C2  . GOL F 4 .   ? 0.078  -8.975  -2.206  1.00 60.43 ? 501 GOL A C2  1 
HETATM 5222 O  O2  . GOL F 4 .   ? -0.566 -9.182  -3.468  1.00 59.97 ? 501 GOL A O2  1 
HETATM 5223 C  C3  . GOL F 4 .   ? 0.753  -10.271 -1.734  1.00 60.38 ? 501 GOL A C3  1 
HETATM 5224 O  O3  . GOL F 4 .   ? -0.226 -11.308 -1.579  1.00 58.77 ? 501 GOL A O3  1 
HETATM 5225 C  C1  . GOL G 4 .   ? 50.065 -9.293  5.789   1.00 56.52 ? 502 GOL A C1  1 
HETATM 5226 O  O1  . GOL G 4 .   ? 50.032 -8.252  4.779   1.00 58.09 ? 502 GOL A O1  1 
HETATM 5227 C  C2  . GOL G 4 .   ? 48.660 -9.969  5.850   1.00 54.48 ? 502 GOL A C2  1 
HETATM 5228 O  O2  . GOL G 4 .   ? 48.368 -10.534 4.569   1.00 56.12 ? 502 GOL A O2  1 
HETATM 5229 C  C3  . GOL G 4 .   ? 48.655 -11.068 6.911   1.00 53.96 ? 502 GOL A C3  1 
HETATM 5230 O  O3  . GOL G 4 .   ? 47.361 -11.685 6.964   1.00 49.83 ? 502 GOL A O3  1 
HETATM 5231 C  C1  . GOL H 4 .   ? 29.110 -13.045 -0.663  1.00 49.66 ? 503 GOL A C1  1 
HETATM 5232 O  O1  . GOL H 4 .   ? 30.144 -12.655 -1.599  1.00 50.51 ? 503 GOL A O1  1 
HETATM 5233 C  C2  . GOL H 4 .   ? 27.900 -12.093 -0.839  1.00 46.88 ? 503 GOL A C2  1 
HETATM 5234 O  O2  . GOL H 4 .   ? 27.444 -12.218 -2.184  1.00 47.24 ? 503 GOL A O2  1 
HETATM 5235 C  C3  . GOL H 4 .   ? 26.784 -12.479 0.143   1.00 47.00 ? 503 GOL A C3  1 
HETATM 5236 O  O3  . GOL H 4 .   ? 25.659 -11.597 -0.010  1.00 45.54 ? 503 GOL A O3  1 
HETATM 5237 CL CL  . CL  I 5 .   ? 6.766  -18.292 -13.610 1.00 51.17 ? 700 CL  A CL  1 
HETATM 5238 C  C1  . 72X J 3 .   ? 37.459 -23.114 -24.005 1.00 31.42 ? 400 72X B C1  1 
HETATM 5239 O  O2  . 72X J 3 .   ? 37.304 -23.775 -22.726 1.00 28.42 ? 400 72X B O2  1 
HETATM 5240 C  C3  . 72X J 3 .   ? 37.829 -21.601 -23.764 1.00 31.76 ? 400 72X B C3  1 
HETATM 5241 C  C4  . 72X J 3 .   ? 38.015 -20.911 -22.490 1.00 32.04 ? 400 72X B C4  1 
HETATM 5242 C  C5  . 72X J 3 .   ? 37.995 -20.822 -25.101 1.00 32.12 ? 400 72X B C5  1 
HETATM 5243 C  C6  . 72X J 3 .   ? 38.363 -19.489 -22.494 1.00 34.58 ? 400 72X B C6  1 
HETATM 5244 C  C7  . 72X J 3 .   ? 38.335 -19.421 -25.055 1.00 34.40 ? 400 72X B C7  1 
HETATM 5245 C  C8  . 72X J 3 .   ? 38.520 -18.753 -23.758 1.00 33.47 ? 400 72X B C8  1 
HETATM 5246 C  C15 . 72X J 3 .   ? 38.637 -23.851 -24.774 1.00 30.08 ? 400 72X B C15 1 
HETATM 5247 C  C18 . 72X J 3 .   ? 40.074 -23.873 -24.162 1.00 30.94 ? 400 72X B C18 1 
HETATM 5248 C  C21 . 72X J 3 .   ? 41.176 -24.588 -24.977 1.00 32.99 ? 400 72X B C21 1 
HETATM 5249 C  C24 . 72X J 3 .   ? 40.869 -26.047 -25.355 1.00 34.12 ? 400 72X B C24 1 
HETATM 5250 O  O27 . 72X J 3 .   ? 40.946 -26.859 -24.218 1.00 38.76 ? 400 72X B O27 1 
HETATM 5251 C  C28 . 72X J 3 .   ? 40.679 -28.210 -24.499 1.00 37.16 ? 400 72X B C28 1 
HETATM 5252 C  C32 . 72X J 3 .   ? 35.568 -25.251 -29.426 1.00 32.56 ? 400 72X B C32 1 
HETATM 5253 C  C33 . 72X J 3 .   ? 35.253 -26.729 -29.821 1.00 32.03 ? 400 72X B C33 1 
HETATM 5254 C  C34 . 72X J 3 .   ? 37.026 -24.802 -29.733 1.00 33.59 ? 400 72X B C34 1 
HETATM 5255 N  N35 . 72X J 3 .   ? 35.477 -27.008 -31.256 1.00 32.83 ? 400 72X B N35 1 
HETATM 5256 C  C36 . 72X J 3 .   ? 37.422 -23.346 -29.354 1.00 34.05 ? 400 72X B C36 1 
HETATM 5257 C  C37 . 72X J 3 .   ? 38.904 -23.050 -29.722 1.00 34.55 ? 400 72X B C37 1 
HETATM 5258 C  C38 . 72X J 3 .   ? 39.361 -21.597 -29.352 1.00 32.44 ? 400 72X B C38 1 
HETATM 5259 C  C39 . 72X J 3 .   ? 38.419 -20.470 -29.883 1.00 34.04 ? 400 72X B C39 1 
HETATM 5260 C  C40 . 72X J 3 .   ? 36.490 -22.263 -30.090 1.00 34.20 ? 400 72X B C40 1 
HETATM 5261 C  C41 . 72X J 3 .   ? 36.855 -20.764 -29.728 1.00 35.27 ? 400 72X B C41 1 
HETATM 5262 N  N42 . 72X J 3 .   ? 35.332 -25.030 -28.000 1.00 32.78 ? 400 72X B N42 1 
HETATM 5263 C  C43 . 72X J 3 .   ? 34.154 -24.662 -27.364 1.00 31.41 ? 400 72X B C43 1 
HETATM 5264 O  O44 . 72X J 3 .   ? 33.104 -24.477 -27.995 1.00 29.48 ? 400 72X B O44 1 
HETATM 5265 N  N45 . 72X J 3 .   ? 34.276 -24.520 -25.967 1.00 30.36 ? 400 72X B N45 1 
HETATM 5266 C  C46 . 72X J 3 .   ? 33.445 -22.602 -24.848 1.00 28.62 ? 400 72X B C46 1 
HETATM 5267 C  C47 . 72X J 3 .   ? 34.815 -22.505 -24.101 1.00 30.16 ? 400 72X B C47 1 
HETATM 5268 C  C48 . 72X J 3 .   ? 36.076 -23.231 -24.845 1.00 29.23 ? 400 72X B C48 1 
HETATM 5269 C  C49 . 72X J 3 .   ? 35.557 -24.738 -25.159 1.00 29.93 ? 400 72X B C49 1 
HETATM 5270 C  C50 . 72X J 3 .   ? 33.151 -24.132 -25.130 1.00 30.03 ? 400 72X B C50 1 
HETATM 5271 C  C51 . 72X J 3 .   ? 34.484 -26.404 -32.160 1.00 30.83 ? 400 72X B C51 1 
HETATM 5272 CL CL1 . 72X J 3 .   ? 38.516 -18.549 -26.511 1.00 33.00 ? 400 72X B CL1 1 
HETATM 5273 C  C1  . NAG K 6 .   ? 44.203 -16.311 -51.866 1.00 77.86 ? 600 NAG B C1  1 
HETATM 5274 C  C2  . NAG K 6 .   ? 44.113 -15.976 -53.359 1.00 79.70 ? 600 NAG B C2  1 
HETATM 5275 C  C3  . NAG K 6 .   ? 42.866 -16.629 -53.964 1.00 80.45 ? 600 NAG B C3  1 
HETATM 5276 C  C4  . NAG K 6 .   ? 42.874 -18.137 -53.687 1.00 80.67 ? 600 NAG B C4  1 
HETATM 5277 C  C5  . NAG K 6 .   ? 43.048 -18.395 -52.185 1.00 80.70 ? 600 NAG B C5  1 
HETATM 5278 C  C6  . NAG K 6 .   ? 43.187 -19.873 -51.866 1.00 81.67 ? 600 NAG B C6  1 
HETATM 5279 C  C7  . NAG K 6 .   ? 45.158 -13.899 -53.966 1.00 81.70 ? 600 NAG B C7  1 
HETATM 5280 C  C8  . NAG K 6 .   ? 45.667 -12.763 -53.096 1.00 82.04 ? 600 NAG B C8  1 
HETATM 5281 N  N2  . NAG K 6 .   ? 44.069 -14.541 -53.556 1.00 81.07 ? 600 NAG B N2  1 
HETATM 5282 O  O3  . NAG K 6 .   ? 42.836 -16.399 -55.366 1.00 80.14 ? 600 NAG B O3  1 
HETATM 5283 O  O4  . NAG K 6 .   ? 41.656 -18.718 -54.133 1.00 80.05 ? 600 NAG B O4  1 
HETATM 5284 O  O5  . NAG K 6 .   ? 44.243 -17.737 -51.694 1.00 79.60 ? 600 NAG B O5  1 
HETATM 5285 O  O6  . NAG K 6 .   ? 43.143 -20.662 -53.047 1.00 82.81 ? 600 NAG B O6  1 
HETATM 5286 O  O7  . NAG K 6 .   ? 45.759 -14.198 -54.998 1.00 82.22 ? 600 NAG B O7  1 
HETATM 5287 C  C1  . GOL L 4 .   ? 35.862 -49.710 -23.184 1.00 64.17 ? 504 GOL B C1  1 
HETATM 5288 O  O1  . GOL L 4 .   ? 35.569 -49.322 -21.827 1.00 65.03 ? 504 GOL B O1  1 
HETATM 5289 C  C2  . GOL L 4 .   ? 37.137 -48.951 -23.649 1.00 64.98 ? 504 GOL B C2  1 
HETATM 5290 O  O2  . GOL L 4 .   ? 38.227 -49.286 -22.784 1.00 64.31 ? 504 GOL B O2  1 
HETATM 5291 C  C3  . GOL L 4 .   ? 37.470 -49.340 -25.086 1.00 64.56 ? 504 GOL B C3  1 
HETATM 5292 O  O3  . GOL L 4 .   ? 38.645 -48.640 -25.515 1.00 64.35 ? 504 GOL B O3  1 
HETATM 5293 O  O   . HOH M 7 .   ? 20.523 -6.153  -1.086  1.00 15.65 ? 1   HOH A O   1 
HETATM 5294 O  O   . HOH M 7 .   ? 30.593 -6.958  -2.078  1.00 19.01 ? 2   HOH A O   1 
HETATM 5295 O  O   . HOH M 7 .   ? 17.487 -14.178 -11.194 1.00 20.41 ? 341 HOH A O   1 
HETATM 5296 O  O   . HOH M 7 .   ? 33.786 -4.132  3.695   1.00 20.83 ? 342 HOH A O   1 
HETATM 5297 O  O   . HOH M 7 .   ? 26.203 18.779  6.943   1.00 42.36 ? 343 HOH A O   1 
HETATM 5298 O  O   . HOH M 7 .   ? 48.580 7.410   -5.551  1.00 45.24 ? 344 HOH A O   1 
HETATM 5299 O  O   . HOH M 7 .   ? 26.453 -17.290 -3.699  1.00 40.25 ? 345 HOH A O   1 
HETATM 5300 O  O   . HOH M 7 .   ? 28.344 -19.193 -2.748  1.00 45.64 ? 346 HOH A O   1 
HETATM 5301 O  O   . HOH M 7 .   ? 29.151 -21.211 -1.268  1.00 44.68 ? 347 HOH A O   1 
HETATM 5302 O  O   . HOH M 7 .   ? 26.850 -11.824 7.767   1.00 49.35 ? 348 HOH A O   1 
HETATM 5303 O  O   . HOH M 7 .   ? 9.441  12.559  -4.669  1.00 48.85 ? 349 HOH A O   1 
HETATM 5304 O  O   . HOH M 7 .   ? 7.319  -5.583  -1.090  1.00 44.91 ? 350 HOH A O   1 
HETATM 5305 O  O   . HOH M 7 .   ? 2.228  -4.605  -7.857  1.00 36.41 ? 351 HOH A O   1 
HETATM 5306 O  O   . HOH M 7 .   ? 3.623  -5.930  -20.944 1.00 44.54 ? 352 HOH A O   1 
HETATM 5307 O  O   . HOH M 7 .   ? 15.899 2.298   -21.238 1.00 40.36 ? 353 HOH A O   1 
HETATM 5308 O  O   . HOH M 7 .   ? 19.161 -1.732  -23.104 1.00 29.69 ? 354 HOH A O   1 
HETATM 5309 O  O   . HOH M 7 .   ? 18.682 5.760   -14.494 1.00 21.39 ? 355 HOH A O   1 
HETATM 5310 O  O   . HOH M 7 .   ? 16.411 -17.213 -8.583  1.00 28.59 ? 356 HOH A O   1 
HETATM 5311 O  O   . HOH M 7 .   ? 8.102  -3.642  -27.332 1.00 24.11 ? 357 HOH A O   1 
HETATM 5312 O  O   . HOH M 7 .   ? 21.288 -11.148 -11.243 1.00 19.57 ? 358 HOH A O   1 
HETATM 5313 O  O   . HOH M 7 .   ? 22.452 -3.946  -19.734 1.00 25.11 ? 359 HOH A O   1 
HETATM 5314 O  O   . HOH M 7 .   ? 28.074 0.925   -10.152 1.00 21.19 ? 360 HOH A O   1 
HETATM 5315 O  O   . HOH M 7 .   ? 17.092 -0.224  -20.649 1.00 28.48 ? 361 HOH A O   1 
HETATM 5316 O  O   . HOH M 7 .   ? 28.470 -8.884  0.836   1.00 33.19 ? 362 HOH A O   1 
HETATM 5317 O  O   . HOH M 7 .   ? 30.306 -1.986  2.088   1.00 21.58 ? 363 HOH A O   1 
HETATM 5318 O  O   . HOH M 7 .   ? 30.943 -15.203 0.546   1.00 28.87 ? 364 HOH A O   1 
HETATM 5319 O  O   . HOH M 7 .   ? 22.032 10.134  -9.448  1.00 28.98 ? 365 HOH A O   1 
HETATM 5320 O  O   . HOH M 7 .   ? 33.994 -1.053  8.633   1.00 24.52 ? 366 HOH A O   1 
HETATM 5321 O  O   . HOH M 7 .   ? 23.934 -8.987  -15.504 1.00 24.84 ? 367 HOH A O   1 
HETATM 5322 O  O   . HOH M 7 .   ? 14.481 -3.354  -30.422 1.00 26.86 ? 368 HOH A O   1 
HETATM 5323 O  O   . HOH M 7 .   ? 31.187 -4.796  4.856   1.00 24.68 ? 369 HOH A O   1 
HETATM 5324 O  O   . HOH M 7 .   ? 17.232 -20.393 -7.037  1.00 21.64 ? 370 HOH A O   1 
HETATM 5325 O  O   . HOH M 7 .   ? 49.079 -3.815  0.285   1.00 24.79 ? 371 HOH A O   1 
HETATM 5326 O  O   . HOH M 7 .   ? 25.291 10.668  7.621   1.00 28.87 ? 372 HOH A O   1 
HETATM 5327 O  O   . HOH M 7 .   ? 35.574 -15.367 4.853   1.00 28.87 ? 373 HOH A O   1 
HETATM 5328 O  O   . HOH M 7 .   ? 45.853 -5.808  7.032   1.00 25.31 ? 374 HOH A O   1 
HETATM 5329 O  O   . HOH M 7 .   ? 15.987 -19.714 -9.308  1.00 31.42 ? 375 HOH A O   1 
HETATM 5330 O  O   . HOH M 7 .   ? 22.174 -19.907 -12.571 1.00 27.55 ? 376 HOH A O   1 
HETATM 5331 O  O   . HOH M 7 .   ? 26.247 -11.624 -4.359  1.00 25.05 ? 377 HOH A O   1 
HETATM 5332 O  O   . HOH M 7 .   ? 48.921 5.914   -0.277  1.00 26.78 ? 378 HOH A O   1 
HETATM 5333 O  O   . HOH M 7 .   ? 38.250 -6.102  -11.067 1.00 29.43 ? 379 HOH A O   1 
HETATM 5334 O  O   . HOH M 7 .   ? 2.394  -2.388  -22.686 1.00 31.62 ? 380 HOH A O   1 
HETATM 5335 O  O   . HOH M 7 .   ? 35.943 -18.186 -8.578  1.00 33.03 ? 381 HOH A O   1 
HETATM 5336 O  O   . HOH M 7 .   ? 10.963 -15.167 -7.286  1.00 25.79 ? 382 HOH A O   1 
HETATM 5337 O  O   . HOH M 7 .   ? 12.815 -20.835 -23.965 1.00 41.62 ? 383 HOH A O   1 
HETATM 5338 O  O   . HOH M 7 .   ? 50.620 4.076   -4.145  1.00 42.68 ? 384 HOH A O   1 
HETATM 5339 O  O   . HOH M 7 .   ? 37.782 -15.259 8.697   1.00 38.14 ? 385 HOH A O   1 
HETATM 5340 O  O   . HOH M 7 .   ? 20.801 -12.420 -22.909 1.00 25.88 ? 386 HOH A O   1 
HETATM 5341 O  O   . HOH M 7 .   ? 22.774 0.610   2.494   1.00 32.38 ? 387 HOH A O   1 
HETATM 5342 O  O   . HOH M 7 .   ? 35.009 -6.466  3.062   1.00 24.49 ? 388 HOH A O   1 
HETATM 5343 O  O   . HOH M 7 .   ? 23.051 -2.438  7.244   1.00 30.66 ? 389 HOH A O   1 
HETATM 5344 O  O   . HOH M 7 .   ? 48.440 -14.026 -4.422  1.00 28.31 ? 390 HOH A O   1 
HETATM 5345 O  O   . HOH M 7 .   ? 9.515  -0.659  5.360   1.00 35.79 ? 391 HOH A O   1 
HETATM 5346 O  O   . HOH M 7 .   ? 27.176 -0.016  2.132   1.00 23.88 ? 392 HOH A O   1 
HETATM 5347 O  O   . HOH M 7 .   ? 23.476 -7.356  -29.845 1.00 30.16 ? 393 HOH A O   1 
HETATM 5348 O  O   . HOH M 7 .   ? 43.405 -13.823 -12.596 1.00 32.58 ? 394 HOH A O   1 
HETATM 5349 O  O   . HOH M 7 .   ? 25.234 3.396   10.816  1.00 30.19 ? 395 HOH A O   1 
HETATM 5350 O  O   . HOH M 7 .   ? 45.943 10.514  -5.839  1.00 44.22 ? 396 HOH A O   1 
HETATM 5351 O  O   . HOH M 7 .   ? 33.772 4.904   10.209  1.00 35.42 ? 397 HOH A O   1 
HETATM 5352 O  O   . HOH M 7 .   ? 25.007 -10.946 -31.326 1.00 50.65 ? 398 HOH A O   1 
HETATM 5353 O  O   . HOH M 7 .   ? 33.696 8.398   -9.975  1.00 39.48 ? 399 HOH A O   1 
HETATM 5354 O  O   . HOH M 7 .   ? 52.924 -5.398  -1.333  1.00 30.14 ? 401 HOH A O   1 
HETATM 5355 O  O   . HOH M 7 .   ? 20.239 -0.941  -29.201 1.00 33.77 ? 402 HOH A O   1 
HETATM 5356 O  O   . HOH M 7 .   ? 40.901 -2.031  11.697  1.00 84.22 ? 403 HOH A O   1 
HETATM 5357 O  O   . HOH M 7 .   ? 0.092  -12.530 -8.383  1.00 39.75 ? 404 HOH A O   1 
HETATM 5358 O  O   . HOH M 7 .   ? 17.054 10.004  6.705   1.00 33.61 ? 405 HOH A O   1 
HETATM 5359 O  O   . HOH M 7 .   ? 13.019 8.768   0.829   1.00 35.89 ? 406 HOH A O   1 
HETATM 5360 O  O   . HOH M 7 .   ? 48.355 -5.007  3.826   1.00 20.68 ? 407 HOH A O   1 
HETATM 5361 O  O   . HOH M 7 .   ? 5.132  0.630   -24.062 1.00 40.78 ? 408 HOH A O   1 
HETATM 5362 O  O   . HOH M 7 .   ? 4.306  -16.918 -8.854  1.00 30.73 ? 409 HOH A O   1 
HETATM 5363 O  O   . HOH M 7 .   ? 6.938  5.445   -11.731 1.00 48.14 ? 410 HOH A O   1 
HETATM 5364 O  O   . HOH M 7 .   ? 13.670 -6.983  1.569   1.00 28.49 ? 411 HOH A O   1 
HETATM 5365 O  O   . HOH M 7 .   ? 15.472 -20.934 -22.600 1.00 38.64 ? 412 HOH A O   1 
HETATM 5366 O  O   . HOH M 7 .   ? 6.142  -1.017  -27.543 1.00 29.93 ? 413 HOH A O   1 
HETATM 5367 O  O   . HOH M 7 .   ? 43.306 -9.824  12.735  1.00 31.87 ? 414 HOH A O   1 
HETATM 5368 O  O   . HOH M 7 .   ? 20.865 8.070   11.128  1.00 29.40 ? 415 HOH A O   1 
HETATM 5369 O  O   . HOH M 7 .   ? 48.814 -4.226  -11.631 1.00 33.62 ? 416 HOH A O   1 
HETATM 5370 O  O   . HOH M 7 .   ? 35.259 1.508   -19.222 1.00 33.31 ? 417 HOH A O   1 
HETATM 5371 O  O   . HOH M 7 .   ? 48.488 -0.798  -9.092  1.00 30.60 ? 418 HOH A O   1 
HETATM 5372 O  O   . HOH M 7 .   ? 5.745  -6.458  0.756   1.00 38.73 ? 419 HOH A O   1 
HETATM 5373 O  O   . HOH M 7 .   ? 34.545 9.285   -5.118  1.00 40.25 ? 420 HOH A O   1 
HETATM 5374 O  O   . HOH M 7 .   ? 5.246  -1.418  -0.393  1.00 40.07 ? 421 HOH A O   1 
HETATM 5375 O  O   . HOH M 7 .   ? 23.945 -12.859 -8.213  1.00 43.15 ? 422 HOH A O   1 
HETATM 5376 O  O   . HOH M 7 .   ? 42.014 -1.455  -14.475 1.00 45.86 ? 423 HOH A O   1 
HETATM 5377 O  O   . HOH M 7 .   ? 24.622 -1.395  -37.984 1.00 33.32 ? 424 HOH A O   1 
HETATM 5378 O  O   . HOH M 7 .   ? 4.823  6.385   -3.336  1.00 36.72 ? 425 HOH A O   1 
HETATM 5379 O  O   . HOH M 7 .   ? 45.053 -15.499 -14.093 1.00 35.33 ? 426 HOH A O   1 
HETATM 5380 O  O   . HOH M 7 .   ? 3.377  -5.338  -26.425 1.00 48.80 ? 427 HOH A O   1 
HETATM 5381 O  O   . HOH M 7 .   ? 39.948 -17.518 -3.687  1.00 37.40 ? 428 HOH A O   1 
HETATM 5382 O  O   . HOH M 7 .   ? 11.365 0.781   8.777   1.00 51.16 ? 429 HOH A O   1 
HETATM 5383 O  O   . HOH M 7 .   ? 30.839 -7.155  -21.017 1.00 57.42 ? 430 HOH A O   1 
HETATM 5384 O  O   . HOH M 7 .   ? 35.723 -11.472 9.819   1.00 44.34 ? 431 HOH A O   1 
HETATM 5385 O  O   . HOH M 7 .   ? 22.861 -19.010 0.279   1.00 40.68 ? 432 HOH A O   1 
HETATM 5386 O  O   . HOH M 7 .   ? 21.063 -3.573  8.910   1.00 34.77 ? 433 HOH A O   1 
HETATM 5387 O  O   . HOH M 7 .   ? 37.469 -0.756  11.188  1.00 41.24 ? 434 HOH A O   1 
HETATM 5388 O  O   . HOH M 7 .   ? 26.857 -16.204 -26.660 1.00 38.54 ? 435 HOH A O   1 
HETATM 5389 O  O   . HOH M 7 .   ? 6.072  -18.951 -23.057 1.00 31.02 ? 436 HOH A O   1 
HETATM 5390 O  O   . HOH M 7 .   ? 51.387 1.811   6.047   1.00 39.13 ? 437 HOH A O   1 
HETATM 5391 O  O   . HOH M 7 .   ? 22.644 -11.758 -5.770  1.00 37.72 ? 438 HOH A O   1 
HETATM 5392 O  O   . HOH M 7 .   ? 42.387 3.786   9.195   1.00 35.02 ? 439 HOH A O   1 
HETATM 5393 O  O   . HOH M 7 .   ? 10.635 2.843   -25.681 1.00 37.71 ? 440 HOH A O   1 
HETATM 5394 O  O   . HOH M 7 .   ? 41.624 8.248   0.779   1.00 35.62 ? 441 HOH A O   1 
HETATM 5395 O  O   . HOH M 7 .   ? 21.089 -17.124 -18.835 1.00 40.04 ? 442 HOH A O   1 
HETATM 5396 O  O   . HOH M 7 .   ? 22.146 -19.361 -15.317 1.00 29.37 ? 443 HOH A O   1 
HETATM 5397 O  O   . HOH M 7 .   ? 6.176  1.881   -17.045 1.00 27.72 ? 444 HOH A O   1 
HETATM 5398 O  O   . HOH M 7 .   ? 8.765  -15.874 -11.394 1.00 30.13 ? 445 HOH A O   1 
HETATM 5399 O  O   . HOH M 7 .   ? 6.447  -3.690  -30.418 1.00 39.58 ? 446 HOH A O   1 
HETATM 5400 O  O   . HOH M 7 .   ? 21.675 -10.587 -8.459  1.00 34.33 ? 447 HOH A O   1 
HETATM 5401 O  O   . HOH M 7 .   ? 13.339 6.989   -18.463 1.00 34.13 ? 448 HOH A O   1 
HETATM 5402 O  O   . HOH M 7 .   ? 18.817 6.517   -18.650 1.00 37.00 ? 449 HOH A O   1 
HETATM 5403 O  O   . HOH M 7 .   ? 33.034 0.696   11.808  1.00 38.17 ? 450 HOH A O   1 
HETATM 5404 O  O   . HOH M 7 .   ? 12.599 -6.116  8.611   1.00 39.04 ? 451 HOH A O   1 
HETATM 5405 O  O   . HOH M 7 .   ? 13.817 -10.005 1.486   1.00 39.84 ? 452 HOH A O   1 
HETATM 5406 O  O   . HOH M 7 .   ? 2.525  -0.462  -19.366 1.00 34.21 ? 453 HOH A O   1 
HETATM 5407 O  O   . HOH M 7 .   ? 30.964 15.195  -4.996  1.00 48.19 ? 454 HOH A O   1 
HETATM 5408 O  O   . HOH M 7 .   ? 47.849 10.342  8.252   1.00 50.96 ? 455 HOH A O   1 
HETATM 5409 O  O   . HOH M 7 .   ? 13.619 -19.553 -0.886  1.00 36.04 ? 456 HOH A O   1 
HETATM 5410 O  O   . HOH M 7 .   ? 41.985 2.257   -11.567 1.00 35.67 ? 457 HOH A O   1 
HETATM 5411 O  O   . HOH M 7 .   ? 23.158 3.429   -25.935 1.00 36.63 ? 458 HOH A O   1 
HETATM 5412 O  O   . HOH M 7 .   ? 8.749  -9.410  -34.508 1.00 34.01 ? 459 HOH A O   1 
HETATM 5413 O  O   . HOH M 7 .   ? 30.539 6.983   -19.478 1.00 44.61 ? 460 HOH A O   1 
HETATM 5414 O  O   . HOH M 7 .   ? 45.935 6.604   -7.231  1.00 29.85 ? 461 HOH A O   1 
HETATM 5415 O  O   . HOH M 7 .   ? 9.498  4.085   7.949   1.00 47.03 ? 462 HOH A O   1 
HETATM 5416 O  O   . HOH M 7 .   ? 52.131 -8.079  -7.184  1.00 41.44 ? 463 HOH A O   1 
HETATM 5417 O  O   . HOH M 7 .   ? 10.427 -23.252 -17.602 1.00 52.07 ? 464 HOH A O   1 
HETATM 5418 O  O   . HOH M 7 .   ? 23.570 -18.120 -9.078  1.00 46.01 ? 465 HOH A O   1 
HETATM 5419 O  O   . HOH M 7 .   ? 13.694 -21.299 -9.180  1.00 34.72 ? 466 HOH A O   1 
HETATM 5420 O  O   . HOH M 7 .   ? 22.067 -10.094 -13.691 1.00 36.95 ? 467 HOH A O   1 
HETATM 5421 O  O   . HOH M 7 .   ? 37.226 -21.500 -1.353  1.00 51.83 ? 468 HOH A O   1 
HETATM 5422 O  O   . HOH M 7 .   ? 49.937 6.445   -2.630  1.00 36.25 ? 469 HOH A O   1 
HETATM 5423 O  O   . HOH M 7 .   ? 14.208 -22.440 -12.330 1.00 34.39 ? 470 HOH A O   1 
HETATM 5424 O  O   . HOH M 7 .   ? 16.455 -22.512 -5.411  1.00 38.16 ? 471 HOH A O   1 
HETATM 5425 O  O   . HOH M 7 .   ? 17.845 -0.367  -28.441 1.00 37.09 ? 472 HOH A O   1 
HETATM 5426 O  O   . HOH M 7 .   ? 18.433 9.207   -19.238 1.00 31.66 ? 473 HOH A O   1 
HETATM 5427 O  O   . HOH M 7 .   ? 29.688 -8.585  -23.246 1.00 50.74 ? 474 HOH A O   1 
HETATM 5428 O  O   . HOH M 7 .   ? 6.837  -5.732  3.224   1.00 46.87 ? 475 HOH A O   1 
HETATM 5429 O  O   . HOH M 7 .   ? -1.742 -2.322  -12.250 1.00 48.84 ? 476 HOH A O   1 
HETATM 5430 O  O   . HOH M 7 .   ? 49.118 -16.796 -4.196  1.00 35.05 ? 477 HOH A O   1 
HETATM 5431 O  O   . HOH M 7 .   ? 17.310 -23.232 -20.436 1.00 40.38 ? 478 HOH A O   1 
HETATM 5432 O  O   . HOH M 7 .   ? 49.986 -11.888 2.251   1.00 47.66 ? 479 HOH A O   1 
HETATM 5433 O  O   . HOH M 7 .   ? 39.761 -17.832 -14.291 1.00 34.16 ? 480 HOH A O   1 
HETATM 5434 O  O   . HOH M 7 .   ? 18.688 -2.684  9.242   1.00 50.34 ? 481 HOH A O   1 
HETATM 5435 O  O   . HOH M 7 .   ? 17.878 0.171   7.381   1.00 43.57 ? 482 HOH A O   1 
HETATM 5436 O  O   . HOH M 7 .   ? 4.522  11.587  -10.862 1.00 55.66 ? 483 HOH A O   1 
HETATM 5437 O  O   . HOH M 7 .   ? 43.832 8.685   -10.171 1.00 46.49 ? 484 HOH A O   1 
HETATM 5438 O  O   . HOH M 7 .   ? 4.206  -16.893 -4.705  1.00 34.39 ? 485 HOH A O   1 
HETATM 5439 O  O   . HOH M 7 .   ? 35.916 -18.449 -11.244 1.00 32.02 ? 486 HOH A O   1 
HETATM 5440 O  O   . HOH M 7 .   ? 2.830  -1.830  -26.962 1.00 42.93 ? 487 HOH A O   1 
HETATM 5441 O  O   . HOH M 7 .   ? 55.027 -3.065  -2.831  1.00 45.35 ? 488 HOH A O   1 
HETATM 5442 O  O   . HOH M 7 .   ? 25.737 -10.300 -17.170 1.00 45.77 ? 489 HOH A O   1 
HETATM 5443 O  O   . HOH M 7 .   ? 26.350 7.531   -20.995 1.00 38.88 ? 490 HOH A O   1 
HETATM 5444 O  O   . HOH M 7 .   ? 39.677 9.307   -6.277  1.00 62.56 ? 491 HOH A O   1 
HETATM 5445 O  O   . HOH M 7 .   ? 16.516 13.907  -2.672  1.00 40.58 ? 492 HOH A O   1 
HETATM 5446 O  O   . HOH M 7 .   ? 21.624 -16.533 -1.702  1.00 49.78 ? 493 HOH A O   1 
HETATM 5447 O  O   . HOH M 7 .   ? 28.911 7.370   -21.293 1.00 42.14 ? 494 HOH A O   1 
HETATM 5448 O  O   . HOH M 7 .   ? 29.523 2.360   11.922  1.00 45.80 ? 495 HOH A O   1 
HETATM 5449 O  O   . HOH M 7 .   ? 5.459  -12.308 -4.329  1.00 55.28 ? 496 HOH A O   1 
HETATM 5450 O  O   . HOH M 7 .   ? 31.298 2.029   -24.122 1.00 35.57 ? 497 HOH A O   1 
HETATM 5451 O  O   . HOH M 7 .   ? 16.982 -21.889 -27.808 1.00 46.86 ? 498 HOH A O   1 
HETATM 5452 O  O   . HOH M 7 .   ? -1.934 -11.485 -4.120  1.00 38.75 ? 499 HOH A O   1 
HETATM 5453 O  O   . HOH M 7 .   ? 38.735 0.369   -17.369 1.00 47.07 ? 504 HOH A O   1 
HETATM 5454 O  O   . HOH M 7 .   ? 11.730 10.026  6.049   1.00 49.97 ? 505 HOH A O   1 
HETATM 5455 O  O   . HOH M 7 .   ? 3.734  1.063   -3.560  1.00 34.57 ? 506 HOH A O   1 
HETATM 5456 O  O   . HOH M 7 .   ? 7.011  10.419  -19.668 1.00 42.95 ? 507 HOH A O   1 
HETATM 5457 O  O   . HOH M 7 .   ? 38.384 -19.164 -7.886  1.00 32.38 ? 508 HOH A O   1 
HETATM 5458 O  O   . HOH M 7 .   ? 50.427 -12.411 4.610   1.00 42.11 ? 509 HOH A O   1 
HETATM 5459 O  O   . HOH M 7 .   ? 42.521 -3.771  12.729  1.00 37.15 ? 510 HOH A O   1 
HETATM 5460 O  O   . HOH M 7 .   ? 26.258 -6.479  -24.122 1.00 53.76 ? 511 HOH A O   1 
HETATM 5461 O  O   . HOH M 7 .   ? 21.601 -23.922 -22.343 1.00 40.45 ? 512 HOH A O   1 
HETATM 5462 O  O   . HOH M 7 .   ? 38.158 6.560   -12.367 1.00 50.52 ? 513 HOH A O   1 
HETATM 5463 O  O   . HOH M 7 .   ? 0.234  -4.859  -4.946  1.00 41.76 ? 514 HOH A O   1 
HETATM 5464 O  O   . HOH M 7 .   ? 52.675 7.908   -2.180  1.00 39.77 ? 515 HOH A O   1 
HETATM 5465 O  O   . HOH M 7 .   ? 14.189 -7.047  -42.578 1.00 43.17 ? 516 HOH A O   1 
HETATM 5466 O  O   . HOH M 7 .   ? 38.558 7.013   12.086  1.00 41.75 ? 517 HOH A O   1 
HETATM 5467 O  O   . HOH M 7 .   ? 26.604 -13.053 -6.830  1.00 45.29 ? 518 HOH A O   1 
HETATM 5468 O  O   . HOH M 7 .   ? 30.302 9.438   -17.305 1.00 39.58 ? 519 HOH A O   1 
HETATM 5469 O  O   . HOH M 7 .   ? 16.840 -6.340  11.868  1.00 54.48 ? 520 HOH A O   1 
HETATM 5470 O  O   . HOH M 7 .   ? 31.616 -22.705 -2.995  1.00 41.24 ? 521 HOH A O   1 
HETATM 5471 O  O   . HOH M 7 .   ? 23.702 -6.622  -35.853 1.00 37.04 ? 522 HOH A O   1 
HETATM 5472 O  O   . HOH M 7 .   ? 34.104 -20.282 0.473   1.00 55.57 ? 523 HOH A O   1 
HETATM 5473 O  O   . HOH M 7 .   ? 48.491 5.225   -6.786  1.00 43.87 ? 524 HOH A O   1 
HETATM 5474 O  O   . HOH M 7 .   ? -1.813 -4.793  -6.938  1.00 42.90 ? 525 HOH A O   1 
HETATM 5475 O  O   . HOH M 7 .   ? 22.926 -18.020 -21.846 1.00 40.01 ? 526 HOH A O   1 
HETATM 5476 O  O   . HOH M 7 .   ? 24.475 -13.876 -37.406 1.00 44.57 ? 527 HOH A O   1 
HETATM 5477 O  O   . HOH M 7 .   ? 24.659 -8.777  -34.085 1.00 44.76 ? 528 HOH A O   1 
HETATM 5478 O  O   . HOH M 7 .   ? 37.726 -19.943 -12.398 1.00 47.63 ? 529 HOH A O   1 
HETATM 5479 O  O   . HOH M 7 .   ? 41.015 6.321   10.014  1.00 40.38 ? 530 HOH A O   1 
HETATM 5480 O  O   . HOH M 7 .   ? 30.348 -14.160 7.192   1.00 42.27 ? 531 HOH A O   1 
HETATM 5481 O  O   . HOH M 7 .   ? 1.549  -20.427 -9.419  1.00 41.86 ? 532 HOH A O   1 
HETATM 5482 O  O   . HOH N 7 .   ? 30.703 -42.066 -9.689  1.00 18.38 ? 3   HOH B O   1 
HETATM 5483 O  O   . HOH N 7 .   ? 49.112 -52.653 -21.650 1.00 48.26 ? 341 HOH B O   1 
HETATM 5484 O  O   . HOH N 7 .   ? 27.023 -48.327 -30.034 1.00 41.19 ? 342 HOH B O   1 
HETATM 5485 O  O   . HOH N 7 .   ? 37.572 -30.167 -18.416 1.00 19.49 ? 343 HOH B O   1 
HETATM 5486 O  O   . HOH N 7 .   ? 26.360 -30.504 -27.167 1.00 24.67 ? 344 HOH B O   1 
HETATM 5487 O  O   . HOH N 7 .   ? 38.257 -36.257 -16.867 1.00 22.83 ? 345 HOH B O   1 
HETATM 5488 O  O   . HOH N 7 .   ? 22.122 -21.882 -8.374  1.00 26.84 ? 346 HOH B O   1 
HETATM 5489 O  O   . HOH N 7 .   ? 34.767 -26.945 -8.732  1.00 27.09 ? 347 HOH B O   1 
HETATM 5490 O  O   . HOH N 7 .   ? 44.541 -28.645 -27.742 1.00 21.56 ? 348 HOH B O   1 
HETATM 5491 O  O   . HOH N 7 .   ? 26.925 -45.560 -10.568 1.00 24.97 ? 349 HOH B O   1 
HETATM 5492 O  O   . HOH N 7 .   ? 39.441 -23.234 -37.131 1.00 26.93 ? 350 HOH B O   1 
HETATM 5493 O  O   . HOH N 7 .   ? 49.969 -38.562 -27.510 1.00 28.01 ? 351 HOH B O   1 
HETATM 5494 O  O   . HOH N 7 .   ? 44.484 -46.519 -37.062 1.00 25.63 ? 352 HOH B O   1 
HETATM 5495 O  O   . HOH N 7 .   ? 22.108 -47.377 -11.109 1.00 38.03 ? 353 HOH B O   1 
HETATM 5496 O  O   . HOH N 7 .   ? 44.928 -34.792 -48.369 1.00 54.31 ? 354 HOH B O   1 
HETATM 5497 O  O   . HOH N 7 .   ? 27.010 -47.777 -11.862 1.00 49.38 ? 355 HOH B O   1 
HETATM 5498 O  O   . HOH N 7 .   ? 23.370 -49.302 -10.112 1.00 42.06 ? 356 HOH B O   1 
HETATM 5499 O  O   . HOH N 7 .   ? 39.533 -38.543 -16.085 1.00 35.54 ? 357 HOH B O   1 
HETATM 5500 O  O   . HOH N 7 .   ? 46.748 -45.553 -47.626 1.00 39.89 ? 358 HOH B O   1 
HETATM 5501 O  O   . HOH N 7 .   ? 43.523 -16.018 -27.816 1.00 30.98 ? 359 HOH B O   1 
HETATM 5502 O  O   . HOH N 7 .   ? 26.099 -38.124 -3.546  1.00 25.26 ? 360 HOH B O   1 
HETATM 5503 O  O   . HOH N 7 .   ? 39.255 -41.418 -47.250 1.00 35.90 ? 361 HOH B O   1 
HETATM 5504 O  O   . HOH N 7 .   ? 26.846 -45.710 -15.802 1.00 34.98 ? 362 HOH B O   1 
HETATM 5505 O  O   . HOH N 7 .   ? 25.263 -25.263 -19.503 1.00 31.67 ? 363 HOH B O   1 
HETATM 5506 O  O   . HOH N 7 .   ? 33.750 -51.085 -34.215 1.00 39.49 ? 364 HOH B O   1 
HETATM 5507 O  O   . HOH N 7 .   ? 29.385 -27.068 -15.713 1.00 29.48 ? 365 HOH B O   1 
HETATM 5508 O  O   . HOH N 7 .   ? 31.448 -48.256 -36.152 1.00 36.76 ? 366 HOH B O   1 
HETATM 5509 O  O   . HOH N 7 .   ? 24.145 -33.857 -5.697  1.00 28.75 ? 367 HOH B O   1 
HETATM 5510 O  O   . HOH N 7 .   ? 30.864 -25.553 -30.549 1.00 35.50 ? 368 HOH B O   1 
HETATM 5511 O  O   . HOH N 7 .   ? 44.195 -38.640 -22.469 1.00 28.34 ? 369 HOH B O   1 
HETATM 5512 O  O   . HOH N 7 .   ? 22.171 -36.496 -31.469 1.00 39.28 ? 370 HOH B O   1 
HETATM 5513 O  O   . HOH N 7 .   ? 39.286 -32.950 -45.218 1.00 36.68 ? 371 HOH B O   1 
HETATM 5514 O  O   . HOH N 7 .   ? 37.936 -51.957 -32.720 1.00 35.79 ? 372 HOH B O   1 
HETATM 5515 O  O   . HOH N 7 .   ? 42.595 -43.522 -18.218 1.00 30.71 ? 373 HOH B O   1 
HETATM 5516 O  O   . HOH N 7 .   ? 33.800 -26.875 -23.317 1.00 26.75 ? 374 HOH B O   1 
HETATM 5517 O  O   . HOH N 7 .   ? 32.310 -23.780 -31.637 1.00 32.29 ? 375 HOH B O   1 
HETATM 5518 O  O   . HOH N 7 .   ? 31.771 -45.452 -9.201  1.00 26.92 ? 376 HOH B O   1 
HETATM 5519 O  O   . HOH N 7 .   ? 29.928 -38.552 -1.260  1.00 31.90 ? 377 HOH B O   1 
HETATM 5520 O  O   . HOH N 7 .   ? 23.456 -29.885 -29.927 1.00 26.58 ? 378 HOH B O   1 
HETATM 5521 O  O   . HOH N 7 .   ? 33.820 -22.505 -37.117 1.00 52.90 ? 379 HOH B O   1 
HETATM 5522 O  O   . HOH N 7 .   ? 34.885 -9.356  -35.923 1.00 47.22 ? 380 HOH B O   1 
HETATM 5523 O  O   . HOH N 7 .   ? 45.112 -48.802 -41.783 1.00 29.60 ? 381 HOH B O   1 
HETATM 5524 O  O   . HOH N 7 .   ? 47.386 -25.105 -14.313 1.00 37.04 ? 382 HOH B O   1 
HETATM 5525 O  O   . HOH N 7 .   ? 37.654 -44.872 -45.384 1.00 37.45 ? 383 HOH B O   1 
HETATM 5526 O  O   . HOH N 7 .   ? 19.294 -27.569 -16.031 1.00 43.85 ? 384 HOH B O   1 
HETATM 5527 O  O   . HOH N 7 .   ? 24.881 -31.656 -4.266  1.00 26.17 ? 385 HOH B O   1 
HETATM 5528 O  O   . HOH N 7 .   ? 35.629 -31.481 -39.764 1.00 37.67 ? 386 HOH B O   1 
HETATM 5529 O  O   . HOH N 7 .   ? 49.026 -51.202 -25.275 1.00 39.09 ? 387 HOH B O   1 
HETATM 5530 O  O   . HOH N 7 .   ? 58.079 -12.385 -47.178 1.00 43.18 ? 388 HOH B O   1 
HETATM 5531 O  O   . HOH N 7 .   ? 41.030 -52.382 -36.789 1.00 33.63 ? 389 HOH B O   1 
HETATM 5532 O  O   . HOH N 7 .   ? 35.013 -15.373 -44.276 1.00 37.71 ? 390 HOH B O   1 
HETATM 5533 O  O   . HOH N 7 .   ? 39.198 -39.115 -44.493 1.00 30.43 ? 391 HOH B O   1 
HETATM 5534 O  O   . HOH N 7 .   ? 34.901 -32.421 -37.159 1.00 27.79 ? 392 HOH B O   1 
HETATM 5535 O  O   . HOH N 7 .   ? 20.917 -29.008 -29.568 1.00 31.63 ? 393 HOH B O   1 
HETATM 5536 O  O   . HOH N 7 .   ? 33.584 -36.718 -7.200  1.00 35.86 ? 394 HOH B O   1 
HETATM 5537 O  O   . HOH N 7 .   ? 30.818 -29.439 6.911   1.00 48.87 ? 395 HOH B O   1 
HETATM 5538 O  O   . HOH N 7 .   ? 48.237 -46.151 -34.763 1.00 40.89 ? 396 HOH B O   1 
HETATM 5539 O  O   . HOH N 7 .   ? 29.565 -44.545 -35.683 1.00 33.64 ? 397 HOH B O   1 
HETATM 5540 O  O   . HOH N 7 .   ? 49.127 -32.000 -16.569 1.00 44.43 ? 398 HOH B O   1 
HETATM 5541 O  O   . HOH N 7 .   ? 54.644 -46.231 -43.409 1.00 51.63 ? 399 HOH B O   1 
HETATM 5542 O  O   . HOH N 7 .   ? 39.848 -51.288 -25.389 1.00 45.56 ? 401 HOH B O   1 
HETATM 5543 O  O   . HOH N 7 .   ? 42.185 -34.095 -40.292 1.00 31.06 ? 402 HOH B O   1 
HETATM 5544 O  O   . HOH N 7 .   ? 38.044 -30.433 1.407   1.00 36.49 ? 403 HOH B O   1 
HETATM 5545 O  O   . HOH N 7 .   ? 36.695 -24.193 -39.453 1.00 34.50 ? 404 HOH B O   1 
HETATM 5546 O  O   . HOH N 7 .   ? 16.434 -36.803 -14.739 1.00 34.07 ? 405 HOH B O   1 
HETATM 5547 O  O   . HOH N 7 .   ? 25.683 -11.954 -35.884 1.00 49.05 ? 406 HOH B O   1 
HETATM 5548 O  O   . HOH N 7 .   ? 33.635 -47.691 -43.175 1.00 41.47 ? 407 HOH B O   1 
HETATM 5549 O  O   . HOH N 7 .   ? 42.409 -52.733 -31.919 1.00 44.93 ? 408 HOH B O   1 
HETATM 5550 O  O   . HOH N 7 .   ? 37.488 -33.413 -14.574 1.00 32.04 ? 409 HOH B O   1 
HETATM 5551 O  O   . HOH N 7 .   ? 38.278 -35.987 -8.553  1.00 49.17 ? 410 HOH B O   1 
HETATM 5552 O  O   . HOH N 7 .   ? 49.034 -35.955 -13.082 1.00 44.23 ? 411 HOH B O   1 
HETATM 5553 O  O   . HOH N 7 .   ? 18.119 -29.898 -14.281 1.00 41.68 ? 412 HOH B O   1 
HETATM 5554 O  O   . HOH N 7 .   ? 40.147 -30.572 -9.698  1.00 40.04 ? 413 HOH B O   1 
HETATM 5555 O  O   . HOH N 7 .   ? 26.668 -19.943 -28.566 1.00 37.61 ? 414 HOH B O   1 
HETATM 5556 O  O   . HOH N 7 .   ? 42.203 -49.781 -23.752 1.00 34.03 ? 415 HOH B O   1 
HETATM 5557 O  O   . HOH N 7 .   ? 33.016 -47.426 -12.889 1.00 44.00 ? 416 HOH B O   1 
HETATM 5558 O  O   . HOH N 7 .   ? 50.735 -38.838 -46.143 1.00 33.58 ? 417 HOH B O   1 
HETATM 5559 O  O   . HOH N 7 .   ? 39.417 -49.390 -43.572 1.00 30.36 ? 418 HOH B O   1 
HETATM 5560 O  O   . HOH N 7 .   ? 26.794 -17.796 -18.871 1.00 36.02 ? 419 HOH B O   1 
HETATM 5561 O  O   . HOH N 7 .   ? 18.880 -30.778 -9.341  1.00 42.02 ? 420 HOH B O   1 
HETATM 5562 O  O   . HOH N 7 .   ? 53.923 -27.133 -27.630 1.00 45.16 ? 421 HOH B O   1 
HETATM 5563 O  O   . HOH N 7 .   ? 50.726 -49.930 -19.362 1.00 40.17 ? 422 HOH B O   1 
HETATM 5564 O  O   . HOH N 7 .   ? 13.970 -32.742 -9.960  1.00 44.79 ? 423 HOH B O   1 
HETATM 5565 O  O   . HOH N 7 .   ? 38.811 -5.150  -23.524 1.00 36.32 ? 424 HOH B O   1 
HETATM 5566 O  O   . HOH N 7 .   ? 43.743 -30.155 -40.125 1.00 33.88 ? 425 HOH B O   1 
HETATM 5567 O  O   . HOH N 7 .   ? 35.505 -23.472 -20.545 1.00 38.12 ? 426 HOH B O   1 
HETATM 5568 O  O   . HOH N 7 .   ? 26.843 -23.531 -17.566 1.00 60.58 ? 427 HOH B O   1 
HETATM 5569 O  O   . HOH N 7 .   ? 33.583 -33.363 3.834   1.00 37.08 ? 428 HOH B O   1 
HETATM 5570 O  O   . HOH N 7 .   ? 58.372 -7.169  -34.042 1.00 47.78 ? 429 HOH B O   1 
HETATM 5571 O  O   . HOH N 7 .   ? 25.881 -34.902 -38.263 1.00 48.67 ? 430 HOH B O   1 
HETATM 5572 O  O   . HOH N 7 .   ? 39.647 -8.051  -26.869 1.00 41.65 ? 431 HOH B O   1 
HETATM 5573 O  O   . HOH N 7 .   ? 21.244 -27.569 -31.785 1.00 44.25 ? 432 HOH B O   1 
HETATM 5574 O  O   . HOH N 7 .   ? 38.950 -33.032 -9.207  1.00 33.37 ? 433 HOH B O   1 
HETATM 5575 O  O   . HOH N 7 .   ? 17.467 -33.497 -8.920  1.00 33.14 ? 434 HOH B O   1 
HETATM 5576 O  O   . HOH N 7 .   ? 35.730 -32.348 4.710   1.00 25.96 ? 435 HOH B O   1 
HETATM 5577 O  O   . HOH N 7 .   ? 41.353 -3.613  -35.509 1.00 34.07 ? 436 HOH B O   1 
HETATM 5578 O  O   . HOH N 7 .   ? 35.266 -38.102 -6.119  1.00 37.85 ? 437 HOH B O   1 
HETATM 5579 O  O   . HOH N 7 .   ? 43.967 -51.545 -36.626 1.00 36.43 ? 438 HOH B O   1 
HETATM 5580 O  O   . HOH N 7 .   ? 24.207 -46.051 -9.272  1.00 30.89 ? 439 HOH B O   1 
HETATM 5581 O  O   . HOH N 7 .   ? 31.860 -28.111 -24.549 1.00 37.38 ? 440 HOH B O   1 
HETATM 5582 O  O   . HOH N 7 .   ? 40.226 -34.114 -13.027 1.00 48.22 ? 441 HOH B O   1 
HETATM 5583 O  O   . HOH N 7 .   ? 32.845 -24.480 -34.069 1.00 50.78 ? 442 HOH B O   1 
HETATM 5584 O  O   . HOH N 7 .   ? 24.981 -46.469 -21.924 1.00 46.09 ? 443 HOH B O   1 
HETATM 5585 O  O   . HOH N 7 .   ? 24.063 -22.434 -6.839  1.00 33.67 ? 444 HOH B O   1 
HETATM 5586 O  O   . HOH N 7 .   ? 50.982 -49.318 -24.425 1.00 41.44 ? 445 HOH B O   1 
HETATM 5587 O  O   . HOH N 7 .   ? 30.788 -27.728 -32.462 1.00 34.06 ? 446 HOH B O   1 
HETATM 5588 O  O   . HOH N 7 .   ? 20.028 -37.671 -32.619 1.00 47.70 ? 447 HOH B O   1 
HETATM 5589 O  O   . HOH N 7 .   ? 46.928 -46.438 -38.731 1.00 30.23 ? 448 HOH B O   1 
HETATM 5590 O  O   . HOH N 7 .   ? 35.553 -22.664 -18.069 1.00 51.44 ? 449 HOH B O   1 
HETATM 5591 O  O   . HOH N 7 .   ? 44.519 -31.872 -11.556 1.00 46.94 ? 450 HOH B O   1 
HETATM 5592 O  O   . HOH N 7 .   ? 37.681 -37.027 -5.910  1.00 43.74 ? 451 HOH B O   1 
HETATM 5593 O  O   . HOH N 7 .   ? 43.554 -26.265 -40.240 1.00 36.90 ? 452 HOH B O   1 
HETATM 5594 O  O   . HOH N 7 .   ? 38.888 -5.777  -26.073 1.00 48.53 ? 453 HOH B O   1 
HETATM 5595 O  O   . HOH N 7 .   ? 19.724 -23.831 -4.670  1.00 46.69 ? 454 HOH B O   1 
HETATM 5596 O  O   . HOH N 7 .   ? 25.792 -43.283 -4.354  1.00 52.38 ? 455 HOH B O   1 
HETATM 5597 O  O   . HOH N 7 .   ? 20.340 -21.542 -16.410 1.00 58.02 ? 456 HOH B O   1 
HETATM 5598 O  O   . HOH N 7 .   ? 62.600 -11.654 -42.695 1.00 43.75 ? 457 HOH B O   1 
HETATM 5599 O  O   . HOH N 7 .   ? 34.617 -25.204 4.335   1.00 43.60 ? 458 HOH B O   1 
HETATM 5600 O  O   . HOH N 7 .   ? 53.482 -30.087 -20.313 1.00 56.28 ? 459 HOH B O   1 
HETATM 5601 O  O   . HOH N 7 .   ? 52.202 -36.376 -13.437 1.00 46.21 ? 460 HOH B O   1 
HETATM 5602 O  O   . HOH N 7 .   ? 31.774 -24.062 -37.643 1.00 48.94 ? 461 HOH B O   1 
HETATM 5603 O  O   . HOH N 7 .   ? 57.903 -26.300 -26.778 1.00 60.46 ? 462 HOH B O   1 
HETATM 5604 O  O   . HOH N 7 .   ? 29.363 -43.382 -6.825  1.00 49.38 ? 463 HOH B O   1 
HETATM 5605 O  O   . HOH N 7 .   ? 41.733 -28.895 -51.642 1.00 59.25 ? 464 HOH B O   1 
HETATM 5606 O  O   . HOH N 7 .   ? 28.265 -46.419 -31.665 1.00 44.67 ? 465 HOH B O   1 
HETATM 5607 O  O   . HOH N 7 .   ? 37.205 -3.109  -35.523 1.00 42.32 ? 466 HOH B O   1 
HETATM 5608 O  O   . HOH N 7 .   ? 50.134 -29.697 -17.143 1.00 40.18 ? 467 HOH B O   1 
HETATM 5609 O  O   . HOH N 7 .   ? 39.796 -53.500 -28.848 1.00 38.80 ? 468 HOH B O   1 
HETATM 5610 O  O   . HOH N 7 .   ? 37.391 -10.234 -42.306 1.00 59.13 ? 469 HOH B O   1 
HETATM 5611 O  O   . HOH N 7 .   ? 38.752 -24.856 -10.944 1.00 36.73 ? 470 HOH B O   1 
HETATM 5612 O  O   . HOH N 7 .   ? 51.107 -47.277 -31.296 1.00 41.84 ? 471 HOH B O   1 
HETATM 5613 O  O   . HOH N 7 .   ? 38.274 -32.221 3.342   1.00 43.22 ? 472 HOH B O   1 
HETATM 5614 O  O   . HOH N 7 .   ? 57.752 -44.481 -46.232 1.00 43.49 ? 473 HOH B O   1 
HETATM 5615 O  O   . HOH N 7 .   ? 33.627 -25.328 -21.284 1.00 36.77 ? 474 HOH B O   1 
HETATM 5616 O  O   . HOH N 7 .   ? 24.175 -23.150 -23.781 1.00 53.48 ? 475 HOH B O   1 
HETATM 5617 O  O   . HOH N 7 .   ? 37.465 -47.733 -44.118 1.00 37.97 ? 476 HOH B O   1 
HETATM 5618 O  O   . HOH N 7 .   ? 23.079 -24.012 -4.748  1.00 46.30 ? 477 HOH B O   1 
HETATM 5619 O  O   . HOH N 7 .   ? 43.922 -33.907 -9.973  1.00 52.21 ? 478 HOH B O   1 
HETATM 5620 O  O   . HOH N 7 .   ? 23.952 -23.336 -26.536 1.00 54.78 ? 479 HOH B O   1 
HETATM 5621 O  O   . HOH N 7 .   ? 52.435 -37.287 -44.646 1.00 42.70 ? 480 HOH B O   1 
HETATM 5622 O  O   . HOH N 7 .   ? 42.268 -20.240 -41.626 1.00 50.47 ? 481 HOH B O   1 
HETATM 5623 O  O   . HOH N 7 .   ? 31.920 -28.789 -30.159 1.00 39.36 ? 482 HOH B O   1 
HETATM 5624 O  O   . HOH N 7 .   ? 28.317 -12.643 -31.901 1.00 47.85 ? 483 HOH B O   1 
HETATM 5625 O  O   . HOH N 7 .   ? 34.568 -47.574 -19.667 1.00 38.25 ? 484 HOH B O   1 
HETATM 5626 O  O   . HOH N 7 .   ? 25.279 -19.937 -5.914  1.00 50.57 ? 485 HOH B O   1 
HETATM 5627 O  O   . HOH N 7 .   ? 46.100 -25.221 -50.958 1.00 53.22 ? 486 HOH B O   1 
HETATM 5628 O  O   . HOH N 7 .   ? 32.672 -19.413 -39.344 1.00 57.16 ? 487 HOH B O   1 
HETATM 5629 O  O   . HOH N 7 .   ? 21.624 -33.159 -1.541  1.00 55.44 ? 488 HOH B O   1 
HETATM 5630 O  O   . HOH N 7 .   ? 30.788 -28.531 -27.048 1.00 38.22 ? 489 HOH B O   1 
HETATM 5631 O  O   . HOH N 7 .   ? 43.416 -22.418 -42.312 1.00 44.35 ? 490 HOH B O   1 
HETATM 5632 O  O   . HOH N 7 .   ? 23.521 -29.773 -5.352  1.00 31.72 ? 491 HOH B O   1 
HETATM 5633 O  O   . HOH N 7 .   ? 50.723 -45.913 -33.669 1.00 54.12 ? 492 HOH B O   1 
HETATM 5634 O  O   . HOH N 7 .   ? 34.763 -31.226 7.207   1.00 52.65 ? 493 HOH B O   1 
HETATM 5635 O  O   . HOH N 7 .   ? 51.540 -45.003 -36.976 1.00 37.97 ? 494 HOH B O   1 
HETATM 5636 O  O   . HOH N 7 .   ? 42.716 -17.535 -13.349 1.00 60.06 ? 495 HOH B O   1 
HETATM 5637 O  O   . HOH N 7 .   ? 41.956 -12.933 -54.441 1.00 42.48 ? 496 HOH B O   1 
HETATM 5638 O  O   . HOH N 7 .   ? 42.470 -31.828 -41.922 1.00 37.59 ? 497 HOH B O   1 
HETATM 5639 O  O   . HOH N 7 .   ? 45.127 -51.604 -30.348 1.00 47.65 ? 498 HOH B O   1 
HETATM 5640 O  O   . HOH N 7 .   ? 41.839 -24.646 -43.690 1.00 38.00 ? 499 HOH B O   1 
HETATM 5641 O  O   . HOH N 7 .   ? 20.565 -27.434 -19.687 1.00 49.35 ? 500 HOH B O   1 
HETATM 5642 O  O   . HOH N 7 .   ? 44.846 -38.396 -18.230 1.00 37.71 ? 501 HOH B O   1 
HETATM 5643 O  O   . HOH N 7 .   ? 41.914 -43.804 -47.337 1.00 45.44 ? 502 HOH B O   1 
HETATM 5644 O  O   . HOH N 7 .   ? 33.185 -28.026 6.141   1.00 51.08 ? 503 HOH B O   1 
HETATM 5645 O  O   . HOH N 7 .   ? 22.479 -25.162 -19.479 1.00 38.07 ? 505 HOH B O   1 
HETATM 5646 O  O   . HOH N 7 .   ? 36.576 -25.430 -14.841 1.00 46.61 ? 506 HOH B O   1 
HETATM 5647 O  O   . HOH N 7 .   ? 41.759 -19.508 -10.162 1.00 38.52 ? 508 HOH B O   1 
HETATM 5648 O  O   . HOH N 7 .   ? 45.581 -46.030 -17.304 1.00 44.33 ? 509 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   4   4   GLY GLY A . n 
A 1 2   ASN 2   5   5   ASN ALA A . n 
A 1 3   THR 3   6   6   THR THR A . n 
A 1 4   THR 4   7   7   THR THR A . n 
A 1 5   SER 5   8   8   SER SER A . n 
A 1 6   SER 6   9   9   SER SER A . n 
A 1 7   VAL 7   10  10  VAL VAL A . n 
A 1 8   ILE 8   11  11  ILE ILE A . n 
A 1 9   LEU 9   12  12  LEU LEU A . n 
A 1 10  THR 10  13  13  THR THR A . n 
A 1 11  ASN 11  14  14  ASN ASN A . n 
A 1 12  TYR 12  15  15  TYR TYR A . n 
A 1 13  MET 13  16  16  MET MET A . n 
A 1 14  ASP 14  17  17  ASP ASP A . n 
A 1 15  THR 15  18  18  THR THR A . n 
A 1 16  GLN 16  19  19  GLN GLN A . n 
A 1 17  TYR 17  20  20  TYR TYR A . n 
A 1 18  TYR 18  21  21  TYR TYR A . n 
A 1 19  GLY 19  22  22  GLY GLY A . n 
A 1 20  GLU 20  23  23  GLU GLU A . n 
A 1 21  ILE 21  24  24  ILE ILE A . n 
A 1 22  GLY 22  25  25  GLY GLY A . n 
A 1 23  ILE 23  26  26  ILE ILE A . n 
A 1 24  GLY 24  27  27  GLY GLY A . n 
A 1 25  THR 25  28  28  THR THR A . n 
A 1 26  PRO 26  29  29  PRO PRO A . n 
A 1 27  PRO 27  30  30  PRO PRO A . n 
A 1 28  GLN 28  31  31  GLN GLN A . n 
A 1 29  THR 29  32  32  THR THR A . n 
A 1 30  PHE 30  33  33  PHE PHE A . n 
A 1 31  LYS 31  34  34  LYS LYS A . n 
A 1 32  VAL 32  35  35  VAL VAL A . n 
A 1 33  VAL 33  36  36  VAL VAL A . n 
A 1 34  PHE 34  37  37  PHE PHE A . n 
A 1 35  ASP 35  38  38  ASP ASP A . n 
A 1 36  THR 36  39  39  THR THR A . n 
A 1 37  GLY 37  40  40  GLY GLY A . n 
A 1 38  SER 38  41  41  SER SER A . n 
A 1 39  SER 39  42  42  SER SER A . n 
A 1 40  ASN 40  43  43  ASN ASN A . n 
A 1 41  VAL 41  44  44  VAL VAL A . n 
A 1 42  TRP 42  45  45  TRP TRP A . n 
A 1 43  VAL 43  46  46  VAL VAL A . n 
A 1 44  PRO 44  47  47  PRO PRO A . n 
A 1 45  SER 45  48  48  SER SER A . n 
A 1 46  SER 46  49  49  SER SER A . n 
A 1 47  LYS 47  50  50  LYS LYS A . n 
A 1 48  CYS 48  51  51  CYS CYS A . n 
A 1 49  SER 49  52  52  SER SER A . n 
A 1 50  ARG 50  53  53  ARG ARG A . n 
A 1 51  LEU 51  54  54  LEU LEU A . n 
A 1 52  TYR 52  55  55  TYR TYR A . n 
A 1 53  THR 53  56  56  THR THR A . n 
A 1 54  ALA 54  57  57  ALA ALA A . n 
A 1 55  CYS 55  58  58  CYS CYS A . n 
A 1 56  VAL 56  59  59  VAL VAL A . n 
A 1 57  TYR 57  60  60  TYR TYR A . n 
A 1 58  HIS 58  61  61  HIS HIS A . n 
A 1 59  LYS 59  62  62  LYS LYS A . n 
A 1 60  LEU 60  63  63  LEU LEU A . n 
A 1 61  PHE 61  64  64  PHE PHE A . n 
A 1 62  ASP 62  65  65  ASP ASP A . n 
A 1 63  ALA 63  66  66  ALA ALA A . n 
A 1 64  SER 64  67  67  SER SER A . n 
A 1 65  ASP 65  68  68  ASP ASP A . n 
A 1 66  SER 66  69  69  SER SER A . n 
A 1 67  SER 67  70  70  SER SER A . n 
A 1 68  SER 68  71  71  SER SER A . n 
A 1 69  TYR 69  72  72  TYR TYR A . n 
A 1 70  LYS 70  73  73  LYS LYS A . n 
A 1 71  HIS 71  74  74  HIS HIS A . n 
A 1 72  ASN 72  75  75  ASN ASN A . n 
A 1 73  GLY 73  76  76  GLY GLY A . n 
A 1 74  THR 74  77  77  THR THR A . n 
A 1 75  GLU 75  78  78  GLU GLU A . n 
A 1 76  LEU 76  79  79  LEU LEU A . n 
A 1 77  THR 77  80  80  THR THR A . n 
A 1 78  LEU 78  81  81  LEU LEU A . n 
A 1 79  ARG 79  82  82  ARG ARG A . n 
A 1 80  TYR 80  83  83  TYR TYR A . n 
A 1 81  SER 81  84  84  SER SER A . n 
A 1 82  THR 82  85  85  THR THR A . n 
A 1 83  GLY 83  86  86  GLY GLY A . n 
A 1 84  THR 84  87  87  THR THR A . n 
A 1 85  VAL 85  88  88  VAL VAL A . n 
A 1 86  SER 86  89  89  SER SER A . n 
A 1 87  GLY 87  90  90  GLY GLY A . n 
A 1 88  PHE 88  91  91  PHE PHE A . n 
A 1 89  LEU 89  92  92  LEU LEU A . n 
A 1 90  SER 90  93  93  SER SER A . n 
A 1 91  GLN 91  94  94  GLN GLN A . n 
A 1 92  ASP 92  95  95  ASP ASP A . n 
A 1 93  ILE 93  96  96  ILE ILE A . n 
A 1 94  ILE 94  97  97  ILE ILE A . n 
A 1 95  THR 95  98  98  THR THR A . n 
A 1 96  VAL 96  99  99  VAL VAL A . n 
A 1 97  GLY 97  100 100 GLY GLY A . n 
A 1 98  GLY 98  101 101 GLY GLY A . n 
A 1 99  ILE 99  102 102 ILE ILE A . n 
A 1 100 THR 100 103 103 THR THR A . n 
A 1 101 VAL 101 104 104 VAL VAL A . n 
A 1 102 THR 102 105 105 THR THR A . n 
A 1 103 GLN 103 106 106 GLN GLN A . n 
A 1 104 MET 104 107 107 MET MET A . n 
A 1 105 PHE 105 108 108 PHE PHE A . n 
A 1 106 GLY 106 109 109 GLY GLY A . n 
A 1 107 GLU 107 110 110 GLU GLU A . n 
A 1 108 VAL 108 111 111 VAL VAL A . n 
A 1 109 THR 109 112 112 THR THR A . n 
A 1 110 GLU 110 113 113 GLU GLU A . n 
A 1 111 MET 111 114 114 MET MET A . n 
A 1 112 PRO 112 115 115 PRO PRO A . n 
A 1 113 ALA 113 116 116 ALA ALA A . n 
A 1 114 LEU 114 117 117 LEU LEU A . n 
A 1 115 PRO 115 118 118 PRO PRO A . n 
A 1 116 PHE 116 119 119 PHE PHE A . n 
A 1 117 MET 117 120 120 MET MET A . n 
A 1 118 LEU 118 121 121 LEU LEU A . n 
A 1 119 ALA 119 122 122 ALA ALA A . n 
A 1 120 GLU 120 123 123 GLU GLU A . n 
A 1 121 PHE 121 124 124 PHE PHE A . n 
A 1 122 ASP 122 125 125 ASP ASP A . n 
A 1 123 GLY 123 126 126 GLY GLY A . n 
A 1 124 VAL 124 127 127 VAL VAL A . n 
A 1 125 VAL 125 128 128 VAL VAL A . n 
A 1 126 GLY 126 129 129 GLY GLY A . n 
A 1 127 MET 127 130 130 MET MET A . n 
A 1 128 GLY 128 131 131 GLY GLY A . n 
A 1 129 PHE 129 132 132 PHE PHE A . n 
A 1 130 ILE 130 133 133 ILE ILE A . n 
A 1 131 GLU 131 134 134 GLU GLU A . n 
A 1 132 GLN 132 135 135 GLN GLN A . n 
A 1 133 ALA 133 136 136 ALA ALA A . n 
A 1 134 ILE 134 137 137 ILE ILE A . n 
A 1 135 GLY 135 138 138 GLY GLY A . n 
A 1 136 ARG 136 139 139 ARG ARG A . n 
A 1 137 VAL 137 140 140 VAL VAL A . n 
A 1 138 THR 138 141 141 THR THR A . n 
A 1 139 PRO 139 142 142 PRO PRO A . n 
A 1 140 ILE 140 143 143 ILE ILE A . n 
A 1 141 PHE 141 144 144 PHE PHE A . n 
A 1 142 ASP 142 145 145 ASP ASP A . n 
A 1 143 ASN 143 146 146 ASN ASN A . n 
A 1 144 ILE 144 147 147 ILE ILE A . n 
A 1 145 ILE 145 148 148 ILE ILE A . n 
A 1 146 SER 146 149 149 SER SER A . n 
A 1 147 GLN 147 150 150 GLN GLN A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 VAL 149 152 152 VAL VAL A . n 
A 1 150 LEU 150 153 153 LEU LEU A . n 
A 1 151 LYS 151 154 154 LYS LYS A . n 
A 1 152 GLU 152 155 155 GLU GLU A . n 
A 1 153 ASP 153 156 156 ASP ASP A . n 
A 1 154 VAL 154 157 157 VAL VAL A . n 
A 1 155 PHE 155 158 158 PHE PHE A . n 
A 1 156 SER 156 159 159 SER SER A . n 
A 1 157 PHE 157 160 160 PHE PHE A . n 
A 1 158 TYR 158 161 161 TYR TYR A . n 
A 1 159 TYR 159 162 162 TYR TYR A . n 
A 1 160 ASN 160 163 163 ASN ASN A . n 
A 1 161 ARG 161 164 164 ARG ARG A . n 
A 1 162 ASP 162 165 165 ASP ASP A . n 
A 1 163 SER 163 166 166 SER SER A . n 
A 1 164 GLU 164 167 167 GLU GLU A . n 
A 1 165 ASN 165 168 168 ASN ASN A . n 
A 1 166 SER 166 169 169 SER SER A . n 
A 1 167 GLN 167 170 170 GLN GLN A . n 
A 1 168 SER 168 171 171 SER SER A . n 
A 1 169 LEU 169 172 172 LEU LEU A . n 
A 1 170 GLY 170 173 173 GLY GLY A . n 
A 1 171 GLY 171 174 174 GLY GLY A . n 
A 1 172 GLN 172 175 175 GLN GLN A . n 
A 1 173 ILE 173 176 176 ILE ILE A . n 
A 1 174 VAL 174 177 177 VAL VAL A . n 
A 1 175 LEU 175 178 178 LEU LEU A . n 
A 1 176 GLY 176 179 179 GLY GLY A . n 
A 1 177 GLY 177 180 180 GLY GLY A . n 
A 1 178 SER 178 181 181 SER SER A . n 
A 1 179 ASP 179 182 182 ASP ASP A . n 
A 1 180 PRO 180 183 183 PRO PRO A . n 
A 1 181 GLN 181 184 184 GLN GLN A . n 
A 1 182 HIS 182 185 185 HIS HIS A . n 
A 1 183 TYR 183 186 186 TYR TYR A . n 
A 1 184 GLU 184 187 187 GLU GLU A . n 
A 1 185 GLY 185 188 188 GLY GLY A . n 
A 1 186 ASN 186 189 189 ASN ASN A . n 
A 1 187 PHE 187 190 190 PHE PHE A . n 
A 1 188 HIS 188 191 191 HIS HIS A . n 
A 1 189 TYR 189 192 192 TYR TYR A . n 
A 1 190 ILE 190 193 193 ILE ILE A . n 
A 1 191 ASN 191 194 194 ASN ASN A . n 
A 1 192 LEU 192 195 195 LEU LEU A . n 
A 1 193 ILE 193 196 196 ILE ILE A . n 
A 1 194 LYS 194 197 197 LYS LYS A . n 
A 1 195 THR 195 198 198 THR THR A . n 
A 1 196 GLY 196 199 199 GLY GLY A . n 
A 1 197 VAL 197 200 200 VAL VAL A . n 
A 1 198 TRP 198 201 201 TRP TRP A . n 
A 1 199 GLN 199 202 202 GLN GLN A . n 
A 1 200 ILE 200 203 203 ILE ILE A . n 
A 1 201 GLN 201 204 204 GLN GLN A . n 
A 1 202 MET 202 205 205 MET MET A . n 
A 1 203 LYS 203 206 206 LYS LYS A . n 
A 1 204 GLY 204 207 207 GLY GLY A . n 
A 1 205 VAL 205 208 208 VAL VAL A . n 
A 1 206 SER 206 209 209 SER SER A . n 
A 1 207 VAL 207 210 210 VAL VAL A . n 
A 1 208 GLY 208 211 211 GLY GLY A . n 
A 1 209 SER 209 212 212 SER SER A . n 
A 1 210 SER 210 213 213 SER SER A . n 
A 1 211 THR 211 214 214 THR THR A . n 
A 1 212 LEU 212 215 215 LEU LEU A . n 
A 1 213 LEU 213 216 216 LEU LEU A . n 
A 1 214 CYS 214 217 217 CYS CYS A . n 
A 1 215 GLU 215 218 218 GLU GLU A . n 
A 1 216 ASP 216 219 219 ASP ASP A . n 
A 1 217 GLY 217 220 220 GLY GLY A . n 
A 1 218 CYS 218 221 221 CYS CYS A . n 
A 1 219 LEU 219 222 222 LEU LEU A . n 
A 1 220 ALA 220 223 223 ALA ALA A . n 
A 1 221 LEU 221 224 224 LEU LEU A . n 
A 1 222 VAL 222 225 225 VAL VAL A . n 
A 1 223 ASP 223 226 226 ASP ASP A . n 
A 1 224 THR 224 227 227 THR THR A . n 
A 1 225 GLY 225 228 228 GLY GLY A . n 
A 1 226 ALA 226 229 229 ALA ALA A . n 
A 1 227 SER 227 230 230 SER SER A . n 
A 1 228 TYR 228 231 231 TYR TYR A . n 
A 1 229 ILE 229 232 232 ILE ILE A . n 
A 1 230 SER 230 233 233 SER SER A . n 
A 1 231 GLY 231 234 234 GLY GLY A . n 
A 1 232 SER 232 235 235 SER SER A . n 
A 1 233 THR 233 236 236 THR THR A . n 
A 1 234 SER 234 237 237 SER SER A . n 
A 1 235 SER 235 238 238 SER SER A . n 
A 1 236 ILE 236 239 239 ILE ILE A . n 
A 1 237 GLU 237 240 240 GLU GLU A . n 
A 1 238 LYS 238 241 241 LYS LYS A . n 
A 1 239 LEU 239 242 242 LEU LEU A . n 
A 1 240 MET 240 243 243 MET MET A . n 
A 1 241 GLU 241 244 244 GLU GLU A . n 
A 1 242 ALA 242 245 245 ALA ALA A . n 
A 1 243 LEU 243 246 246 LEU LEU A . n 
A 1 244 GLY 244 247 247 GLY GLY A . n 
A 1 245 ALA 245 248 248 ALA ALA A . n 
A 1 246 LYS 246 249 249 LYS LYS A . n 
A 1 247 LYS 247 250 250 LYS LYS A . n 
A 1 248 ARG 248 251 251 ARG ARG A . n 
A 1 249 LEU 249 252 252 LEU LEU A . n 
A 1 250 PHE 250 253 253 PHE PHE A . n 
A 1 251 ASP 251 254 254 ASP ASP A . n 
A 1 252 TYR 252 255 255 TYR TYR A . n 
A 1 253 VAL 253 256 256 VAL VAL A . n 
A 1 254 VAL 254 257 257 VAL VAL A . n 
A 1 255 LYS 255 258 258 LYS LYS A . n 
A 1 256 CYS 256 259 259 CYS CYS A . n 
A 1 257 ASN 257 260 260 ASN ASN A . n 
A 1 258 GLU 258 261 261 GLU GLU A . n 
A 1 259 GLY 259 262 262 GLY GLY A . n 
A 1 260 PRO 260 263 263 PRO PRO A . n 
A 1 261 THR 261 264 264 THR THR A . n 
A 1 262 LEU 262 265 265 LEU LEU A . n 
A 1 263 PRO 263 266 266 PRO PRO A . n 
A 1 264 ASP 264 267 267 ASP ASP A . n 
A 1 265 ILE 265 268 268 ILE ILE A . n 
A 1 266 SER 266 269 269 SER SER A . n 
A 1 267 PHE 267 270 270 PHE PHE A . n 
A 1 268 HIS 268 271 271 HIS HIS A . n 
A 1 269 LEU 269 272 272 LEU LEU A . n 
A 1 270 GLY 270 273 273 GLY GLY A . n 
A 1 271 GLY 271 274 274 GLY GLY A . n 
A 1 272 LYS 272 275 275 LYS LYS A . n 
A 1 273 GLU 273 276 276 GLU GLU A . n 
A 1 274 TYR 274 277 277 TYR TYR A . n 
A 1 275 THR 275 278 278 THR THR A . n 
A 1 276 LEU 276 279 279 LEU LEU A . n 
A 1 277 THR 277 280 280 THR THR A . n 
A 1 278 SER 278 281 281 SER SER A . n 
A 1 279 ALA 279 282 282 ALA ALA A . n 
A 1 280 ASP 280 283 283 ASP ASP A . n 
A 1 281 TYR 281 284 284 TYR TYR A . n 
A 1 282 VAL 282 285 285 VAL VAL A . n 
A 1 283 PHE 283 286 286 PHE PHE A . n 
A 1 284 GLN 284 287 287 GLN GLN A . n 
A 1 285 GLU 285 288 288 GLU GLU A . n 
A 1 286 SER 286 289 289 SER SER A . n 
A 1 287 TYR 287 290 290 TYR TYR A . n 
A 1 288 SER 288 291 291 SER SER A . n 
A 1 289 SER 289 292 292 SER SER A . n 
A 1 290 LYS 290 293 293 LYS LYS A . n 
A 1 291 LYS 291 294 294 LYS LYS A . n 
A 1 292 LEU 292 295 295 LEU LEU A . n 
A 1 293 CYS 293 296 296 CYS CYS A . n 
A 1 294 THR 294 297 297 THR THR A . n 
A 1 295 LEU 295 298 298 LEU LEU A . n 
A 1 296 ALA 296 299 299 ALA ALA A . n 
A 1 297 ILE 297 300 300 ILE ILE A . n 
A 1 298 HIS 298 301 301 HIS HIS A . n 
A 1 299 ALA 299 302 302 ALA ALA A . n 
A 1 300 MET 300 303 303 MET MET A . n 
A 1 301 ASP 301 304 304 ASP ASP A . n 
A 1 302 ILE 302 305 305 ILE ILE A . n 
A 1 303 PRO 303 306 306 PRO PRO A . n 
A 1 304 PRO 304 307 307 PRO PRO A . n 
A 1 305 PRO 305 308 308 PRO PRO A . n 
A 1 306 THR 306 309 309 THR THR A . n 
A 1 307 GLY 307 310 310 GLY GLY A . n 
A 1 308 PRO 308 311 311 PRO PRO A . n 
A 1 309 THR 309 312 312 THR THR A . n 
A 1 310 TRP 310 313 313 TRP TRP A . n 
A 1 311 ALA 311 314 314 ALA ALA A . n 
A 1 312 LEU 312 315 315 LEU LEU A . n 
A 1 313 GLY 313 316 316 GLY GLY A . n 
A 1 314 ALA 314 317 317 ALA ALA A . n 
A 1 315 THR 315 318 318 THR THR A . n 
A 1 316 PHE 316 319 319 PHE PHE A . n 
A 1 317 ILE 317 320 320 ILE ILE A . n 
A 1 318 ARG 318 321 321 ARG ARG A . n 
A 1 319 LYS 319 322 322 LYS LYS A . n 
A 1 320 PHE 320 323 323 PHE PHE A . n 
A 1 321 TYR 321 324 324 TYR TYR A . n 
A 1 322 THR 322 325 325 THR THR A . n 
A 1 323 GLU 323 326 326 GLU GLU A . n 
A 1 324 PHE 324 327 327 PHE PHE A . n 
A 1 325 ASP 325 328 328 ASP ASP A . n 
A 1 326 ARG 326 329 329 ARG ARG A . n 
A 1 327 ARG 327 330 330 ARG ARG A . n 
A 1 328 ASN 328 331 331 ASN ASN A . n 
A 1 329 ASN 329 332 332 ASN ASN A . n 
A 1 330 ARG 330 333 333 ARG ARG A . n 
A 1 331 ILE 331 334 334 ILE ILE A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 PHE 333 336 336 PHE PHE A . n 
A 1 334 ALA 334 337 337 ALA ALA A . n 
A 1 335 LEU 335 338 338 LEU LEU A . n 
A 1 336 ALA 336 339 339 ALA ALA A . n 
A 1 337 ARG 337 340 340 ARG ARG A . n 
B 1 1   GLY 1   4   4   GLY GLY B . n 
B 1 2   ASN 2   5   5   ASN ASN B . n 
B 1 3   THR 3   6   6   THR THR B . n 
B 1 4   THR 4   7   7   THR THR B . n 
B 1 5   SER 5   8   8   SER SER B . n 
B 1 6   SER 6   9   9   SER SER B . n 
B 1 7   VAL 7   10  10  VAL VAL B . n 
B 1 8   ILE 8   11  11  ILE ILE B . n 
B 1 9   LEU 9   12  12  LEU LEU B . n 
B 1 10  THR 10  13  13  THR THR B . n 
B 1 11  ASN 11  14  14  ASN ASN B . n 
B 1 12  TYR 12  15  15  TYR TYR B . n 
B 1 13  MET 13  16  16  MET MET B . n 
B 1 14  ASP 14  17  17  ASP ASP B . n 
B 1 15  THR 15  18  18  THR THR B . n 
B 1 16  GLN 16  19  19  GLN GLN B . n 
B 1 17  TYR 17  20  20  TYR TYR B . n 
B 1 18  TYR 18  21  21  TYR TYR B . n 
B 1 19  GLY 19  22  22  GLY GLY B . n 
B 1 20  GLU 20  23  23  GLU GLU B . n 
B 1 21  ILE 21  24  24  ILE ILE B . n 
B 1 22  GLY 22  25  25  GLY GLY B . n 
B 1 23  ILE 23  26  26  ILE ILE B . n 
B 1 24  GLY 24  27  27  GLY GLY B . n 
B 1 25  THR 25  28  28  THR THR B . n 
B 1 26  PRO 26  29  29  PRO PRO B . n 
B 1 27  PRO 27  30  30  PRO PRO B . n 
B 1 28  GLN 28  31  31  GLN GLN B . n 
B 1 29  THR 29  32  32  THR THR B . n 
B 1 30  PHE 30  33  33  PHE PHE B . n 
B 1 31  LYS 31  34  34  LYS LYS B . n 
B 1 32  VAL 32  35  35  VAL VAL B . n 
B 1 33  VAL 33  36  36  VAL VAL B . n 
B 1 34  PHE 34  37  37  PHE PHE B . n 
B 1 35  ASP 35  38  38  ASP ASP B . n 
B 1 36  THR 36  39  39  THR THR B . n 
B 1 37  GLY 37  40  40  GLY GLY B . n 
B 1 38  SER 38  41  41  SER SER B . n 
B 1 39  SER 39  42  42  SER SER B . n 
B 1 40  ASN 40  43  43  ASN ASN B . n 
B 1 41  VAL 41  44  44  VAL VAL B . n 
B 1 42  TRP 42  45  45  TRP TRP B . n 
B 1 43  VAL 43  46  46  VAL VAL B . n 
B 1 44  PRO 44  47  47  PRO PRO B . n 
B 1 45  SER 45  48  48  SER SER B . n 
B 1 46  SER 46  49  49  SER SER B . n 
B 1 47  LYS 47  50  50  LYS LYS B . n 
B 1 48  CYS 48  51  51  CYS CYS B . n 
B 1 49  SER 49  52  52  SER SER B . n 
B 1 50  ARG 50  53  53  ARG ALA B . n 
B 1 51  LEU 51  54  54  LEU LEU B . n 
B 1 52  TYR 52  55  55  TYR TYR B . n 
B 1 53  THR 53  56  56  THR THR B . n 
B 1 54  ALA 54  57  57  ALA ALA B . n 
B 1 55  CYS 55  58  58  CYS CYS B . n 
B 1 56  VAL 56  59  59  VAL VAL B . n 
B 1 57  TYR 57  60  60  TYR TYR B . n 
B 1 58  HIS 58  61  61  HIS HIS B . n 
B 1 59  LYS 59  62  62  LYS LYS B . n 
B 1 60  LEU 60  63  63  LEU LEU B . n 
B 1 61  PHE 61  64  64  PHE PHE B . n 
B 1 62  ASP 62  65  65  ASP ASP B . n 
B 1 63  ALA 63  66  66  ALA ALA B . n 
B 1 64  SER 64  67  67  SER SER B . n 
B 1 65  ASP 65  68  68  ASP ASP B . n 
B 1 66  SER 66  69  69  SER SER B . n 
B 1 67  SER 67  70  70  SER SER B . n 
B 1 68  SER 68  71  71  SER SER B . n 
B 1 69  TYR 69  72  72  TYR TYR B . n 
B 1 70  LYS 70  73  73  LYS LYS B . n 
B 1 71  HIS 71  74  74  HIS HIS B . n 
B 1 72  ASN 72  75  75  ASN ASN B . n 
B 1 73  GLY 73  76  76  GLY GLY B . n 
B 1 74  THR 74  77  77  THR THR B . n 
B 1 75  GLU 75  78  78  GLU GLU B . n 
B 1 76  LEU 76  79  79  LEU LEU B . n 
B 1 77  THR 77  80  80  THR THR B . n 
B 1 78  LEU 78  81  81  LEU LEU B . n 
B 1 79  ARG 79  82  82  ARG ARG B . n 
B 1 80  TYR 80  83  83  TYR TYR B . n 
B 1 81  SER 81  84  84  SER SER B . n 
B 1 82  THR 82  85  85  THR THR B . n 
B 1 83  GLY 83  86  86  GLY GLY B . n 
B 1 84  THR 84  87  87  THR THR B . n 
B 1 85  VAL 85  88  88  VAL VAL B . n 
B 1 86  SER 86  89  89  SER SER B . n 
B 1 87  GLY 87  90  90  GLY GLY B . n 
B 1 88  PHE 88  91  91  PHE PHE B . n 
B 1 89  LEU 89  92  92  LEU LEU B . n 
B 1 90  SER 90  93  93  SER SER B . n 
B 1 91  GLN 91  94  94  GLN GLN B . n 
B 1 92  ASP 92  95  95  ASP ASP B . n 
B 1 93  ILE 93  96  96  ILE ILE B . n 
B 1 94  ILE 94  97  97  ILE ILE B . n 
B 1 95  THR 95  98  98  THR THR B . n 
B 1 96  VAL 96  99  99  VAL VAL B . n 
B 1 97  GLY 97  100 100 GLY GLY B . n 
B 1 98  GLY 98  101 101 GLY GLY B . n 
B 1 99  ILE 99  102 102 ILE ILE B . n 
B 1 100 THR 100 103 103 THR THR B . n 
B 1 101 VAL 101 104 104 VAL VAL B . n 
B 1 102 THR 102 105 105 THR THR B . n 
B 1 103 GLN 103 106 106 GLN GLN B . n 
B 1 104 MET 104 107 107 MET MET B . n 
B 1 105 PHE 105 108 108 PHE PHE B . n 
B 1 106 GLY 106 109 109 GLY GLY B . n 
B 1 107 GLU 107 110 110 GLU GLU B . n 
B 1 108 VAL 108 111 111 VAL VAL B . n 
B 1 109 THR 109 112 112 THR THR B . n 
B 1 110 GLU 110 113 113 GLU GLU B . n 
B 1 111 MET 111 114 114 MET MET B . n 
B 1 112 PRO 112 115 115 PRO PRO B . n 
B 1 113 ALA 113 116 116 ALA ALA B . n 
B 1 114 LEU 114 117 117 LEU LEU B . n 
B 1 115 PRO 115 118 118 PRO PRO B . n 
B 1 116 PHE 116 119 119 PHE PHE B . n 
B 1 117 MET 117 120 120 MET MET B . n 
B 1 118 LEU 118 121 121 LEU LEU B . n 
B 1 119 ALA 119 122 122 ALA ALA B . n 
B 1 120 GLU 120 123 123 GLU GLU B . n 
B 1 121 PHE 121 124 124 PHE PHE B . n 
B 1 122 ASP 122 125 125 ASP ASP B . n 
B 1 123 GLY 123 126 126 GLY GLY B . n 
B 1 124 VAL 124 127 127 VAL VAL B . n 
B 1 125 VAL 125 128 128 VAL VAL B . n 
B 1 126 GLY 126 129 129 GLY GLY B . n 
B 1 127 MET 127 130 130 MET MET B . n 
B 1 128 GLY 128 131 131 GLY GLY B . n 
B 1 129 PHE 129 132 132 PHE PHE B . n 
B 1 130 ILE 130 133 133 ILE ILE B . n 
B 1 131 GLU 131 134 134 GLU GLU B . n 
B 1 132 GLN 132 135 135 GLN GLN B . n 
B 1 133 ALA 133 136 136 ALA ALA B . n 
B 1 134 ILE 134 137 137 ILE ILE B . n 
B 1 135 GLY 135 138 138 GLY GLY B . n 
B 1 136 ARG 136 139 139 ARG ARG B . n 
B 1 137 VAL 137 140 140 VAL VAL B . n 
B 1 138 THR 138 141 141 THR THR B . n 
B 1 139 PRO 139 142 142 PRO PRO B . n 
B 1 140 ILE 140 143 143 ILE ILE B . n 
B 1 141 PHE 141 144 144 PHE PHE B . n 
B 1 142 ASP 142 145 145 ASP ASP B . n 
B 1 143 ASN 143 146 146 ASN ASN B . n 
B 1 144 ILE 144 147 147 ILE ILE B . n 
B 1 145 ILE 145 148 148 ILE ILE B . n 
B 1 146 SER 146 149 149 SER SER B . n 
B 1 147 GLN 147 150 150 GLN GLN B . n 
B 1 148 GLY 148 151 151 GLY GLY B . n 
B 1 149 VAL 149 152 152 VAL VAL B . n 
B 1 150 LEU 150 153 153 LEU LEU B . n 
B 1 151 LYS 151 154 154 LYS LYS B . n 
B 1 152 GLU 152 155 155 GLU GLU B . n 
B 1 153 ASP 153 156 156 ASP ASP B . n 
B 1 154 VAL 154 157 157 VAL VAL B . n 
B 1 155 PHE 155 158 158 PHE PHE B . n 
B 1 156 SER 156 159 159 SER SER B . n 
B 1 157 PHE 157 160 160 PHE PHE B . n 
B 1 158 TYR 158 161 161 TYR TYR B . n 
B 1 159 TYR 159 162 162 TYR TYR B . n 
B 1 160 ASN 160 163 163 ASN ASN B . n 
B 1 161 ARG 161 164 164 ARG ARG B . n 
B 1 162 ASP 162 165 165 ASP ASP B . n 
B 1 163 SER 163 166 ?   ?   ?   B . n 
B 1 164 GLU 164 167 ?   ?   ?   B . n 
B 1 165 ASN 165 168 ?   ?   ?   B . n 
B 1 166 SER 166 169 ?   ?   ?   B . n 
B 1 167 GLN 167 170 ?   ?   ?   B . n 
B 1 168 SER 168 171 171 SER SER B . n 
B 1 169 LEU 169 172 172 LEU LEU B . n 
B 1 170 GLY 170 173 173 GLY GLY B . n 
B 1 171 GLY 171 174 174 GLY GLY B . n 
B 1 172 GLN 172 175 175 GLN GLN B . n 
B 1 173 ILE 173 176 176 ILE ILE B . n 
B 1 174 VAL 174 177 177 VAL VAL B . n 
B 1 175 LEU 175 178 178 LEU LEU B . n 
B 1 176 GLY 176 179 179 GLY GLY B . n 
B 1 177 GLY 177 180 180 GLY GLY B . n 
B 1 178 SER 178 181 181 SER SER B . n 
B 1 179 ASP 179 182 182 ASP ASP B . n 
B 1 180 PRO 180 183 183 PRO PRO B . n 
B 1 181 GLN 181 184 184 GLN GLN B . n 
B 1 182 HIS 182 185 185 HIS HIS B . n 
B 1 183 TYR 183 186 186 TYR TYR B . n 
B 1 184 GLU 184 187 187 GLU GLU B . n 
B 1 185 GLY 185 188 188 GLY GLY B . n 
B 1 186 ASN 186 189 189 ASN ASN B . n 
B 1 187 PHE 187 190 190 PHE PHE B . n 
B 1 188 HIS 188 191 191 HIS HIS B . n 
B 1 189 TYR 189 192 192 TYR TYR B . n 
B 1 190 ILE 190 193 193 ILE ILE B . n 
B 1 191 ASN 191 194 194 ASN ASN B . n 
B 1 192 LEU 192 195 195 LEU LEU B . n 
B 1 193 ILE 193 196 196 ILE ILE B . n 
B 1 194 LYS 194 197 197 LYS LYS B . n 
B 1 195 THR 195 198 198 THR THR B . n 
B 1 196 GLY 196 199 199 GLY GLY B . n 
B 1 197 VAL 197 200 200 VAL VAL B . n 
B 1 198 TRP 198 201 201 TRP TRP B . n 
B 1 199 GLN 199 202 202 GLN GLN B . n 
B 1 200 ILE 200 203 203 ILE ILE B . n 
B 1 201 GLN 201 204 204 GLN GLN B . n 
B 1 202 MET 202 205 205 MET MET B . n 
B 1 203 LYS 203 206 206 LYS LYS B . n 
B 1 204 GLY 204 207 207 GLY GLY B . n 
B 1 205 VAL 205 208 208 VAL VAL B . n 
B 1 206 SER 206 209 209 SER SER B . n 
B 1 207 VAL 207 210 210 VAL VAL B . n 
B 1 208 GLY 208 211 211 GLY GLY B . n 
B 1 209 SER 209 212 212 SER SER B . n 
B 1 210 SER 210 213 213 SER SER B . n 
B 1 211 THR 211 214 214 THR THR B . n 
B 1 212 LEU 212 215 215 LEU LEU B . n 
B 1 213 LEU 213 216 216 LEU LEU B . n 
B 1 214 CYS 214 217 217 CYS CYS B . n 
B 1 215 GLU 215 218 218 GLU GLU B . n 
B 1 216 ASP 216 219 219 ASP ASP B . n 
B 1 217 GLY 217 220 220 GLY GLY B . n 
B 1 218 CYS 218 221 221 CYS CYS B . n 
B 1 219 LEU 219 222 222 LEU LEU B . n 
B 1 220 ALA 220 223 223 ALA ALA B . n 
B 1 221 LEU 221 224 224 LEU LEU B . n 
B 1 222 VAL 222 225 225 VAL VAL B . n 
B 1 223 ASP 223 226 226 ASP ASP B . n 
B 1 224 THR 224 227 227 THR THR B . n 
B 1 225 GLY 225 228 228 GLY GLY B . n 
B 1 226 ALA 226 229 229 ALA ALA B . n 
B 1 227 SER 227 230 230 SER SER B . n 
B 1 228 TYR 228 231 231 TYR TYR B . n 
B 1 229 ILE 229 232 232 ILE ILE B . n 
B 1 230 SER 230 233 233 SER SER B . n 
B 1 231 GLY 231 234 234 GLY GLY B . n 
B 1 232 SER 232 235 235 SER SER B . n 
B 1 233 THR 233 236 236 THR THR B . n 
B 1 234 SER 234 237 237 SER SER B . n 
B 1 235 SER 235 238 238 SER SER B . n 
B 1 236 ILE 236 239 239 ILE ILE B . n 
B 1 237 GLU 237 240 240 GLU GLU B . n 
B 1 238 LYS 238 241 241 LYS LYS B . n 
B 1 239 LEU 239 242 242 LEU LEU B . n 
B 1 240 MET 240 243 243 MET MET B . n 
B 1 241 GLU 241 244 244 GLU GLU B . n 
B 1 242 ALA 242 245 245 ALA ALA B . n 
B 1 243 LEU 243 246 246 LEU LEU B . n 
B 1 244 GLY 244 247 247 GLY GLY B . n 
B 1 245 ALA 245 248 248 ALA ALA B . n 
B 1 246 LYS 246 249 249 LYS LYS B . n 
B 1 247 LYS 247 250 250 LYS LYS B . n 
B 1 248 ARG 248 251 251 ARG ARG B . n 
B 1 249 LEU 249 252 252 LEU LEU B . n 
B 1 250 PHE 250 253 253 PHE PHE B . n 
B 1 251 ASP 251 254 254 ASP ASP B . n 
B 1 252 TYR 252 255 255 TYR TYR B . n 
B 1 253 VAL 253 256 256 VAL VAL B . n 
B 1 254 VAL 254 257 257 VAL VAL B . n 
B 1 255 LYS 255 258 258 LYS LYS B . n 
B 1 256 CYS 256 259 259 CYS CYS B . n 
B 1 257 ASN 257 260 260 ASN ASN B . n 
B 1 258 GLU 258 261 261 GLU GLU B . n 
B 1 259 GLY 259 262 262 GLY GLY B . n 
B 1 260 PRO 260 263 263 PRO PRO B . n 
B 1 261 THR 261 264 264 THR THR B . n 
B 1 262 LEU 262 265 265 LEU LEU B . n 
B 1 263 PRO 263 266 266 PRO PRO B . n 
B 1 264 ASP 264 267 267 ASP ASP B . n 
B 1 265 ILE 265 268 268 ILE ILE B . n 
B 1 266 SER 266 269 269 SER SER B . n 
B 1 267 PHE 267 270 270 PHE PHE B . n 
B 1 268 HIS 268 271 271 HIS HIS B . n 
B 1 269 LEU 269 272 272 LEU LEU B . n 
B 1 270 GLY 270 273 273 GLY GLY B . n 
B 1 271 GLY 271 274 274 GLY GLY B . n 
B 1 272 LYS 272 275 275 LYS LYS B . n 
B 1 273 GLU 273 276 276 GLU GLU B . n 
B 1 274 TYR 274 277 277 TYR TYR B . n 
B 1 275 THR 275 278 278 THR THR B . n 
B 1 276 LEU 276 279 279 LEU LEU B . n 
B 1 277 THR 277 280 280 THR THR B . n 
B 1 278 SER 278 281 281 SER SER B . n 
B 1 279 ALA 279 282 282 ALA ALA B . n 
B 1 280 ASP 280 283 283 ASP ASP B . n 
B 1 281 TYR 281 284 284 TYR TYR B . n 
B 1 282 VAL 282 285 285 VAL VAL B . n 
B 1 283 PHE 283 286 286 PHE PHE B . n 
B 1 284 GLN 284 287 287 GLN GLN B . n 
B 1 285 GLU 285 288 288 GLU GLU B . n 
B 1 286 SER 286 289 289 SER SER B . n 
B 1 287 TYR 287 290 290 TYR TYR B . n 
B 1 288 SER 288 291 291 SER SER B . n 
B 1 289 SER 289 292 292 SER SER B . n 
B 1 290 LYS 290 293 293 LYS LYS B . n 
B 1 291 LYS 291 294 294 LYS LYS B . n 
B 1 292 LEU 292 295 295 LEU LEU B . n 
B 1 293 CYS 293 296 296 CYS CYS B . n 
B 1 294 THR 294 297 297 THR THR B . n 
B 1 295 LEU 295 298 298 LEU LEU B . n 
B 1 296 ALA 296 299 299 ALA ALA B . n 
B 1 297 ILE 297 300 300 ILE ILE B . n 
B 1 298 HIS 298 301 301 HIS HIS B . n 
B 1 299 ALA 299 302 302 ALA ALA B . n 
B 1 300 MET 300 303 303 MET MET B . n 
B 1 301 ASP 301 304 304 ASP ASP B . n 
B 1 302 ILE 302 305 305 ILE ILE B . n 
B 1 303 PRO 303 306 306 PRO PRO B . n 
B 1 304 PRO 304 307 307 PRO PRO B . n 
B 1 305 PRO 305 308 308 PRO PRO B . n 
B 1 306 THR 306 309 309 THR THR B . n 
B 1 307 GLY 307 310 310 GLY GLY B . n 
B 1 308 PRO 308 311 311 PRO PRO B . n 
B 1 309 THR 309 312 312 THR THR B . n 
B 1 310 TRP 310 313 313 TRP TRP B . n 
B 1 311 ALA 311 314 314 ALA ALA B . n 
B 1 312 LEU 312 315 315 LEU LEU B . n 
B 1 313 GLY 313 316 316 GLY GLY B . n 
B 1 314 ALA 314 317 317 ALA ALA B . n 
B 1 315 THR 315 318 318 THR THR B . n 
B 1 316 PHE 316 319 319 PHE PHE B . n 
B 1 317 ILE 317 320 320 ILE ILE B . n 
B 1 318 ARG 318 321 321 ARG ARG B . n 
B 1 319 LYS 319 322 322 LYS LYS B . n 
B 1 320 PHE 320 323 323 PHE PHE B . n 
B 1 321 TYR 321 324 324 TYR TYR B . n 
B 1 322 THR 322 325 325 THR THR B . n 
B 1 323 GLU 323 326 326 GLU GLU B . n 
B 1 324 PHE 324 327 327 PHE PHE B . n 
B 1 325 ASP 325 328 328 ASP ASP B . n 
B 1 326 ARG 326 329 329 ARG ARG B . n 
B 1 327 ARG 327 330 330 ARG ARG B . n 
B 1 328 ASN 328 331 331 ASN ASN B . n 
B 1 329 ASN 329 332 332 ASN ASN B . n 
B 1 330 ARG 330 333 333 ARG ARG B . n 
B 1 331 ILE 331 334 334 ILE ILE B . n 
B 1 332 GLY 332 335 335 GLY GLY B . n 
B 1 333 PHE 333 336 336 PHE PHE B . n 
B 1 334 ALA 334 337 337 ALA ALA B . n 
B 1 335 LEU 335 338 338 LEU LEU B . n 
B 1 336 ALA 336 339 339 ALA ALA B . n 
B 1 337 ARG 337 340 340 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 72X 1   400 400 72X 72X A . 
E 4 GOL 1   500 500 GOL GOL A . 
F 4 GOL 1   501 501 GOL GOL A . 
G 4 GOL 1   502 502 GOL GOL A . 
H 4 GOL 1   503 503 GOL GOL A . 
I 5 CL  1   700 700 CL  CL  A . 
J 3 72X 1   400 400 72X 72X B . 
K 6 NAG 1   600 600 NAG NAG B . 
L 4 GOL 1   504 504 GOL GOL B . 
M 7 HOH 1   1   1   HOH HOH A . 
M 7 HOH 2   2   2   HOH HOH A . 
M 7 HOH 3   341 4   HOH HOH A . 
M 7 HOH 4   342 5   HOH HOH A . 
M 7 HOH 5   343 343 HOH HOH A . 
M 7 HOH 6   344 344 HOH HOH A . 
M 7 HOH 7   345 345 HOH HOH A . 
M 7 HOH 8   346 346 HOH HOH A . 
M 7 HOH 9   347 347 HOH HOH A . 
M 7 HOH 10  348 348 HOH HOH A . 
M 7 HOH 11  349 349 HOH HOH A . 
M 7 HOH 12  350 350 HOH HOH A . 
M 7 HOH 13  351 351 HOH HOH A . 
M 7 HOH 14  352 352 HOH HOH A . 
M 7 HOH 15  353 353 HOH HOH A . 
M 7 HOH 16  354 11  HOH HOH A . 
M 7 HOH 17  355 13  HOH HOH A . 
M 7 HOH 18  356 14  HOH HOH A . 
M 7 HOH 19  357 15  HOH HOH A . 
M 7 HOH 20  358 17  HOH HOH A . 
M 7 HOH 21  359 18  HOH HOH A . 
M 7 HOH 22  360 20  HOH HOH A . 
M 7 HOH 23  361 22  HOH HOH A . 
M 7 HOH 24  362 24  HOH HOH A . 
M 7 HOH 25  363 25  HOH HOH A . 
M 7 HOH 26  364 26  HOH HOH A . 
M 7 HOH 27  365 27  HOH HOH A . 
M 7 HOH 28  366 28  HOH HOH A . 
M 7 HOH 29  367 29  HOH HOH A . 
M 7 HOH 30  368 30  HOH HOH A . 
M 7 HOH 31  369 31  HOH HOH A . 
M 7 HOH 32  370 32  HOH HOH A . 
M 7 HOH 33  371 34  HOH HOH A . 
M 7 HOH 34  372 35  HOH HOH A . 
M 7 HOH 35  373 36  HOH HOH A . 
M 7 HOH 36  374 37  HOH HOH A . 
M 7 HOH 37  375 39  HOH HOH A . 
M 7 HOH 38  376 41  HOH HOH A . 
M 7 HOH 39  377 42  HOH HOH A . 
M 7 HOH 40  378 45  HOH HOH A . 
M 7 HOH 41  379 46  HOH HOH A . 
M 7 HOH 42  380 47  HOH HOH A . 
M 7 HOH 43  381 48  HOH HOH A . 
M 7 HOH 44  382 52  HOH HOH A . 
M 7 HOH 45  383 56  HOH HOH A . 
M 7 HOH 46  384 58  HOH HOH A . 
M 7 HOH 47  385 59  HOH HOH A . 
M 7 HOH 48  386 60  HOH HOH A . 
M 7 HOH 49  387 61  HOH HOH A . 
M 7 HOH 50  388 62  HOH HOH A . 
M 7 HOH 51  389 64  HOH HOH A . 
M 7 HOH 52  390 66  HOH HOH A . 
M 7 HOH 53  391 67  HOH HOH A . 
M 7 HOH 54  392 68  HOH HOH A . 
M 7 HOH 55  393 70  HOH HOH A . 
M 7 HOH 56  394 73  HOH HOH A . 
M 7 HOH 57  395 74  HOH HOH A . 
M 7 HOH 58  396 76  HOH HOH A . 
M 7 HOH 59  397 77  HOH HOH A . 
M 7 HOH 60  398 78  HOH HOH A . 
M 7 HOH 61  399 79  HOH HOH A . 
M 7 HOH 62  401 80  HOH HOH A . 
M 7 HOH 63  402 81  HOH HOH A . 
M 7 HOH 64  403 82  HOH HOH A . 
M 7 HOH 65  404 83  HOH HOH A . 
M 7 HOH 66  405 84  HOH HOH A . 
M 7 HOH 67  406 87  HOH HOH A . 
M 7 HOH 68  407 88  HOH HOH A . 
M 7 HOH 69  408 90  HOH HOH A . 
M 7 HOH 70  409 91  HOH HOH A . 
M 7 HOH 71  410 92  HOH HOH A . 
M 7 HOH 72  411 93  HOH HOH A . 
M 7 HOH 73  412 94  HOH HOH A . 
M 7 HOH 74  413 95  HOH HOH A . 
M 7 HOH 75  414 96  HOH HOH A . 
M 7 HOH 76  415 97  HOH HOH A . 
M 7 HOH 77  416 99  HOH HOH A . 
M 7 HOH 78  417 100 HOH HOH A . 
M 7 HOH 79  418 101 HOH HOH A . 
M 7 HOH 80  419 103 HOH HOH A . 
M 7 HOH 81  420 105 HOH HOH A . 
M 7 HOH 82  421 107 HOH HOH A . 
M 7 HOH 83  422 110 HOH HOH A . 
M 7 HOH 84  423 112 HOH HOH A . 
M 7 HOH 85  424 113 HOH HOH A . 
M 7 HOH 86  425 114 HOH HOH A . 
M 7 HOH 87  426 120 HOH HOH A . 
M 7 HOH 88  427 123 HOH HOH A . 
M 7 HOH 89  428 125 HOH HOH A . 
M 7 HOH 90  429 128 HOH HOH A . 
M 7 HOH 91  430 133 HOH HOH A . 
M 7 HOH 92  431 134 HOH HOH A . 
M 7 HOH 93  432 135 HOH HOH A . 
M 7 HOH 94  433 138 HOH HOH A . 
M 7 HOH 95  434 141 HOH HOH A . 
M 7 HOH 96  435 145 HOH HOH A . 
M 7 HOH 97  436 151 HOH HOH A . 
M 7 HOH 98  437 154 HOH HOH A . 
M 7 HOH 99  438 156 HOH HOH A . 
M 7 HOH 100 439 157 HOH HOH A . 
M 7 HOH 101 440 158 HOH HOH A . 
M 7 HOH 102 441 159 HOH HOH A . 
M 7 HOH 103 442 161 HOH HOH A . 
M 7 HOH 104 443 162 HOH HOH A . 
M 7 HOH 105 444 163 HOH HOH A . 
M 7 HOH 106 445 165 HOH HOH A . 
M 7 HOH 107 446 170 HOH HOH A . 
M 7 HOH 108 447 173 HOH HOH A . 
M 7 HOH 109 448 177 HOH HOH A . 
M 7 HOH 110 449 178 HOH HOH A . 
M 7 HOH 111 450 180 HOH HOH A . 
M 7 HOH 112 451 181 HOH HOH A . 
M 7 HOH 113 452 182 HOH HOH A . 
M 7 HOH 114 453 185 HOH HOH A . 
M 7 HOH 115 454 186 HOH HOH A . 
M 7 HOH 116 455 187 HOH HOH A . 
M 7 HOH 117 456 188 HOH HOH A . 
M 7 HOH 118 457 189 HOH HOH A . 
M 7 HOH 119 458 190 HOH HOH A . 
M 7 HOH 120 459 192 HOH HOH A . 
M 7 HOH 121 460 195 HOH HOH A . 
M 7 HOH 122 461 197 HOH HOH A . 
M 7 HOH 123 462 199 HOH HOH A . 
M 7 HOH 124 463 200 HOH HOH A . 
M 7 HOH 125 464 202 HOH HOH A . 
M 7 HOH 126 465 204 HOH HOH A . 
M 7 HOH 127 466 206 HOH HOH A . 
M 7 HOH 128 467 207 HOH HOH A . 
M 7 HOH 129 468 210 HOH HOH A . 
M 7 HOH 130 469 214 HOH HOH A . 
M 7 HOH 131 470 216 HOH HOH A . 
M 7 HOH 132 471 219 HOH HOH A . 
M 7 HOH 133 472 220 HOH HOH A . 
M 7 HOH 134 473 221 HOH HOH A . 
M 7 HOH 135 474 222 HOH HOH A . 
M 7 HOH 136 475 227 HOH HOH A . 
M 7 HOH 137 476 228 HOH HOH A . 
M 7 HOH 138 477 229 HOH HOH A . 
M 7 HOH 139 478 230 HOH HOH A . 
M 7 HOH 140 479 233 HOH HOH A . 
M 7 HOH 141 480 236 HOH HOH A . 
M 7 HOH 142 481 238 HOH HOH A . 
M 7 HOH 143 482 240 HOH HOH A . 
M 7 HOH 144 483 241 HOH HOH A . 
M 7 HOH 145 484 245 HOH HOH A . 
M 7 HOH 146 485 247 HOH HOH A . 
M 7 HOH 147 486 249 HOH HOH A . 
M 7 HOH 148 487 250 HOH HOH A . 
M 7 HOH 149 488 251 HOH HOH A . 
M 7 HOH 150 489 256 HOH HOH A . 
M 7 HOH 151 490 258 HOH HOH A . 
M 7 HOH 152 491 260 HOH HOH A . 
M 7 HOH 153 492 263 HOH HOH A . 
M 7 HOH 154 493 266 HOH HOH A . 
M 7 HOH 155 494 267 HOH HOH A . 
M 7 HOH 156 495 268 HOH HOH A . 
M 7 HOH 157 496 269 HOH HOH A . 
M 7 HOH 158 497 273 HOH HOH A . 
M 7 HOH 159 498 276 HOH HOH A . 
M 7 HOH 160 499 277 HOH HOH A . 
M 7 HOH 161 504 279 HOH HOH A . 
M 7 HOH 162 505 281 HOH HOH A . 
M 7 HOH 163 506 283 HOH HOH A . 
M 7 HOH 164 507 284 HOH HOH A . 
M 7 HOH 165 508 285 HOH HOH A . 
M 7 HOH 166 509 286 HOH HOH A . 
M 7 HOH 167 510 288 HOH HOH A . 
M 7 HOH 168 511 290 HOH HOH A . 
M 7 HOH 169 512 291 HOH HOH A . 
M 7 HOH 170 513 295 HOH HOH A . 
M 7 HOH 171 514 298 HOH HOH A . 
M 7 HOH 172 515 302 HOH HOH A . 
M 7 HOH 173 516 305 HOH HOH A . 
M 7 HOH 174 517 310 HOH HOH A . 
M 7 HOH 175 518 311 HOH HOH A . 
M 7 HOH 176 519 312 HOH HOH A . 
M 7 HOH 177 520 313 HOH HOH A . 
M 7 HOH 178 521 314 HOH HOH A . 
M 7 HOH 179 522 315 HOH HOH A . 
M 7 HOH 180 523 318 HOH HOH A . 
M 7 HOH 181 524 322 HOH HOH A . 
M 7 HOH 182 525 324 HOH HOH A . 
M 7 HOH 183 526 325 HOH HOH A . 
M 7 HOH 184 527 329 HOH HOH A . 
M 7 HOH 185 528 333 HOH HOH A . 
M 7 HOH 186 529 335 HOH HOH A . 
M 7 HOH 187 530 339 HOH HOH A . 
M 7 HOH 188 531 340 HOH HOH A . 
M 7 HOH 189 532 336 HOH HOH A . 
N 7 HOH 1   3   3   HOH HOH B . 
N 7 HOH 2   341 341 HOH HOH B . 
N 7 HOH 3   342 342 HOH HOH B . 
N 7 HOH 4   343 6   HOH HOH B . 
N 7 HOH 5   344 7   HOH HOH B . 
N 7 HOH 6   345 8   HOH HOH B . 
N 7 HOH 7   346 9   HOH HOH B . 
N 7 HOH 8   347 10  HOH HOH B . 
N 7 HOH 9   348 12  HOH HOH B . 
N 7 HOH 10  349 16  HOH HOH B . 
N 7 HOH 11  350 19  HOH HOH B . 
N 7 HOH 12  351 21  HOH HOH B . 
N 7 HOH 13  352 23  HOH HOH B . 
N 7 HOH 14  353 33  HOH HOH B . 
N 7 HOH 15  354 354 HOH HOH B . 
N 7 HOH 16  355 355 HOH HOH B . 
N 7 HOH 17  356 356 HOH HOH B . 
N 7 HOH 18  357 38  HOH HOH B . 
N 7 HOH 19  358 40  HOH HOH B . 
N 7 HOH 20  359 43  HOH HOH B . 
N 7 HOH 21  360 44  HOH HOH B . 
N 7 HOH 22  361 49  HOH HOH B . 
N 7 HOH 23  362 50  HOH HOH B . 
N 7 HOH 24  363 51  HOH HOH B . 
N 7 HOH 25  364 53  HOH HOH B . 
N 7 HOH 26  365 54  HOH HOH B . 
N 7 HOH 27  366 55  HOH HOH B . 
N 7 HOH 28  367 57  HOH HOH B . 
N 7 HOH 29  368 63  HOH HOH B . 
N 7 HOH 30  369 65  HOH HOH B . 
N 7 HOH 31  370 69  HOH HOH B . 
N 7 HOH 32  371 71  HOH HOH B . 
N 7 HOH 33  372 72  HOH HOH B . 
N 7 HOH 34  373 75  HOH HOH B . 
N 7 HOH 35  374 85  HOH HOH B . 
N 7 HOH 36  375 86  HOH HOH B . 
N 7 HOH 37  376 89  HOH HOH B . 
N 7 HOH 38  377 98  HOH HOH B . 
N 7 HOH 39  378 102 HOH HOH B . 
N 7 HOH 40  379 104 HOH HOH B . 
N 7 HOH 41  380 106 HOH HOH B . 
N 7 HOH 42  381 108 HOH HOH B . 
N 7 HOH 43  382 109 HOH HOH B . 
N 7 HOH 44  383 111 HOH HOH B . 
N 7 HOH 45  384 115 HOH HOH B . 
N 7 HOH 46  385 116 HOH HOH B . 
N 7 HOH 47  386 117 HOH HOH B . 
N 7 HOH 48  387 118 HOH HOH B . 
N 7 HOH 49  388 119 HOH HOH B . 
N 7 HOH 50  389 121 HOH HOH B . 
N 7 HOH 51  390 122 HOH HOH B . 
N 7 HOH 52  391 124 HOH HOH B . 
N 7 HOH 53  392 126 HOH HOH B . 
N 7 HOH 54  393 127 HOH HOH B . 
N 7 HOH 55  394 129 HOH HOH B . 
N 7 HOH 56  395 130 HOH HOH B . 
N 7 HOH 57  396 131 HOH HOH B . 
N 7 HOH 58  397 132 HOH HOH B . 
N 7 HOH 59  398 136 HOH HOH B . 
N 7 HOH 60  399 137 HOH HOH B . 
N 7 HOH 61  401 139 HOH HOH B . 
N 7 HOH 62  402 140 HOH HOH B . 
N 7 HOH 63  403 142 HOH HOH B . 
N 7 HOH 64  404 143 HOH HOH B . 
N 7 HOH 65  405 144 HOH HOH B . 
N 7 HOH 66  406 146 HOH HOH B . 
N 7 HOH 67  407 147 HOH HOH B . 
N 7 HOH 68  408 148 HOH HOH B . 
N 7 HOH 69  409 149 HOH HOH B . 
N 7 HOH 70  410 150 HOH HOH B . 
N 7 HOH 71  411 152 HOH HOH B . 
N 7 HOH 72  412 153 HOH HOH B . 
N 7 HOH 73  413 155 HOH HOH B . 
N 7 HOH 74  414 160 HOH HOH B . 
N 7 HOH 75  415 164 HOH HOH B . 
N 7 HOH 76  416 166 HOH HOH B . 
N 7 HOH 77  417 167 HOH HOH B . 
N 7 HOH 78  418 168 HOH HOH B . 
N 7 HOH 79  419 169 HOH HOH B . 
N 7 HOH 80  420 171 HOH HOH B . 
N 7 HOH 81  421 172 HOH HOH B . 
N 7 HOH 82  422 174 HOH HOH B . 
N 7 HOH 83  423 175 HOH HOH B . 
N 7 HOH 84  424 176 HOH HOH B . 
N 7 HOH 85  425 179 HOH HOH B . 
N 7 HOH 86  426 183 HOH HOH B . 
N 7 HOH 87  427 184 HOH HOH B . 
N 7 HOH 88  428 191 HOH HOH B . 
N 7 HOH 89  429 193 HOH HOH B . 
N 7 HOH 90  430 194 HOH HOH B . 
N 7 HOH 91  431 196 HOH HOH B . 
N 7 HOH 92  432 198 HOH HOH B . 
N 7 HOH 93  433 201 HOH HOH B . 
N 7 HOH 94  434 203 HOH HOH B . 
N 7 HOH 95  435 205 HOH HOH B . 
N 7 HOH 96  436 208 HOH HOH B . 
N 7 HOH 97  437 209 HOH HOH B . 
N 7 HOH 98  438 211 HOH HOH B . 
N 7 HOH 99  439 212 HOH HOH B . 
N 7 HOH 100 440 213 HOH HOH B . 
N 7 HOH 101 441 215 HOH HOH B . 
N 7 HOH 102 442 217 HOH HOH B . 
N 7 HOH 103 443 218 HOH HOH B . 
N 7 HOH 104 444 223 HOH HOH B . 
N 7 HOH 105 445 224 HOH HOH B . 
N 7 HOH 106 446 225 HOH HOH B . 
N 7 HOH 107 447 226 HOH HOH B . 
N 7 HOH 108 448 231 HOH HOH B . 
N 7 HOH 109 449 232 HOH HOH B . 
N 7 HOH 110 450 234 HOH HOH B . 
N 7 HOH 111 451 235 HOH HOH B . 
N 7 HOH 112 452 237 HOH HOH B . 
N 7 HOH 113 453 239 HOH HOH B . 
N 7 HOH 114 454 242 HOH HOH B . 
N 7 HOH 115 455 243 HOH HOH B . 
N 7 HOH 116 456 244 HOH HOH B . 
N 7 HOH 117 457 246 HOH HOH B . 
N 7 HOH 118 458 248 HOH HOH B . 
N 7 HOH 119 459 252 HOH HOH B . 
N 7 HOH 120 460 253 HOH HOH B . 
N 7 HOH 121 461 254 HOH HOH B . 
N 7 HOH 122 462 255 HOH HOH B . 
N 7 HOH 123 463 257 HOH HOH B . 
N 7 HOH 124 464 259 HOH HOH B . 
N 7 HOH 125 465 261 HOH HOH B . 
N 7 HOH 126 466 262 HOH HOH B . 
N 7 HOH 127 467 264 HOH HOH B . 
N 7 HOH 128 468 265 HOH HOH B . 
N 7 HOH 129 469 270 HOH HOH B . 
N 7 HOH 130 470 271 HOH HOH B . 
N 7 HOH 131 471 272 HOH HOH B . 
N 7 HOH 132 472 274 HOH HOH B . 
N 7 HOH 133 473 275 HOH HOH B . 
N 7 HOH 134 474 278 HOH HOH B . 
N 7 HOH 135 475 280 HOH HOH B . 
N 7 HOH 136 476 282 HOH HOH B . 
N 7 HOH 137 477 287 HOH HOH B . 
N 7 HOH 138 478 289 HOH HOH B . 
N 7 HOH 139 479 292 HOH HOH B . 
N 7 HOH 140 480 293 HOH HOH B . 
N 7 HOH 141 481 294 HOH HOH B . 
N 7 HOH 142 482 296 HOH HOH B . 
N 7 HOH 143 483 297 HOH HOH B . 
N 7 HOH 144 484 299 HOH HOH B . 
N 7 HOH 145 485 300 HOH HOH B . 
N 7 HOH 146 486 301 HOH HOH B . 
N 7 HOH 147 487 303 HOH HOH B . 
N 7 HOH 148 488 304 HOH HOH B . 
N 7 HOH 149 489 306 HOH HOH B . 
N 7 HOH 150 490 307 HOH HOH B . 
N 7 HOH 151 491 308 HOH HOH B . 
N 7 HOH 152 492 309 HOH HOH B . 
N 7 HOH 153 493 316 HOH HOH B . 
N 7 HOH 154 494 317 HOH HOH B . 
N 7 HOH 155 495 319 HOH HOH B . 
N 7 HOH 156 496 320 HOH HOH B . 
N 7 HOH 157 497 321 HOH HOH B . 
N 7 HOH 158 498 323 HOH HOH B . 
N 7 HOH 159 499 326 HOH HOH B . 
N 7 HOH 160 500 327 HOH HOH B . 
N 7 HOH 161 501 328 HOH HOH B . 
N 7 HOH 162 502 330 HOH HOH B . 
N 7 HOH 163 503 331 HOH HOH B . 
N 7 HOH 164 505 332 HOH HOH B . 
N 7 HOH 165 506 334 HOH HOH B . 
N 7 HOH 166 508 337 HOH HOH B . 
N 7 HOH 167 509 338 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 72 A ASN 75 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 72 B ASN 75 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,M 
2 1 B,J,K,L,N         
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                      
2  4 'Structure model' atom_site                     
3  4 'Structure model' chem_comp                     
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_entity_nonpoly.comp_id'           
17 4 'Structure model' '_pdbx_entity_nonpoly.entity_id'         
18 4 'Structure model' '_pdbx_entity_nonpoly.name'              
19 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
20 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
21 4 'Structure model' '_struct_conn.pdbx_role'                 
22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
25 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ ? 
? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ ? 
? 2 
CNS         .     ?               package 'Axel T. Brunger'    axel.brunger@yale.edu refinement        http://cns-online.org/ 
Fortran_77 ? 3 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 4 
CBASS       .     ?               ?       ?                    ?                     'data collection' ? ?          ? 5 
MOLREP      .     ?               ?       ?                    ?                     phasing           ? ?          ? 6 
CNX         .     ?               ?       ?                    ?                     refinement        ? ?          ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 75  ? ? -131.34 -66.27  
2  1 ARG A 139 ? ? 37.89   43.51   
3  1 GLN A 170 ? ? -64.68  -102.45 
4  1 SER A 171 ? ? 46.56   102.03  
5  1 THR A 214 ? ? -65.95  95.02   
6  1 CYS A 221 ? ? -172.52 -177.56 
7  1 ALA A 299 ? ? -83.27  46.46   
8  1 ASN B 5   ? ? 79.83   -29.11  
9  1 MET B 16  ? ? 55.78   19.03   
10 1 ASN B 75  ? ? -134.96 -42.80  
11 1 ILE B 196 ? ? -58.82  -72.62  
12 1 ASN B 332 ? ? 39.10   67.29   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    171 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    172 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASN 5  ? CG  ? A ASN 2  CG  
2 1 Y 1 A ASN 5  ? OD1 ? A ASN 2  OD1 
3 1 Y 1 A ASN 5  ? ND2 ? A ASN 2  ND2 
4 1 Y 1 B ARG 53 ? CG  ? B ARG 50 CG  
5 1 Y 1 B ARG 53 ? CD  ? B ARG 50 CD  
6 1 Y 1 B ARG 53 ? NE  ? B ARG 50 NE  
7 1 Y 1 B ARG 53 ? CZ  ? B ARG 50 CZ  
8 1 Y 1 B ARG 53 ? NH1 ? B ARG 50 NH1 
9 1 Y 1 B ARG 53 ? NH2 ? B ARG 50 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B SER 166 ? B SER 163 
2 1 Y 1 B GLU 167 ? B GLU 164 
3 1 Y 1 B ASN 168 ? B ASN 165 
4 1 Y 1 B SER 169 ? B SER 166 
5 1 Y 1 B GLN 170 ? B GLN 167 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 E NAG 600 n 
C 2 NAG 2 C NAG 2 E NAG 601 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;(3R)-3-[(1S)-1-(3-chlorophenyl)-1-hydroxy-5-methoxypentyl]-N-{(1S)-2-cyclohexyl-1-[(methylamino)methyl]ethyl}piperidine-1-carboxamide
;
72X 
4 GLYCEROL GOL 
5 'CHLORIDE ION' CL  
6 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7 water HOH 
#