data_3GWX
# 
_entry.id   3GWX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GWX         
RCSB  RCSB000948   
WWPDB D_1000000948 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GWX 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-26 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, H.E.'        1  
'Lambert, M.H.'   2  
'Montana, V.G.'   3  
'Parks, D.J.'     4  
'Blanchard, S.G.' 5  
'Brown, P.J.'     6  
'Sternbach, D.D.' 7  
'Lehmann, J.M.'   8  
'Wisely, G.B.'    9  
'Willson, T.M.'   10 
'Kliewer, S.A.'   11 
'Milburn, M.V.'   12 
# 
_citation.id                        primary 
_citation.title                     'Molecular recognition of fatty acids by peroxisome proliferator-activated receptors.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            3 
_citation.page_first                397 
_citation.page_last                 403 
_citation.year                      1999 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10198642 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(00)80467-0' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, H.E.'        1  
primary 'Lambert, M.H.'   2  
primary 'Montana, V.G.'   3  
primary 'Parks, D.J.'     4  
primary 'Blanchard, S.G.' 5  
primary 'Brown, P.J.'     6  
primary 'Sternbach, D.D.' 7  
primary 'Lehmann, J.M.'   8  
primary 'Wisely, G.B.'    9  
primary 'Willson, T.M.'   10 
primary 'Kliewer, S.A.'   11 
primary 'Milburn, M.V.'   12 
# 
_cell.entry_id           3GWX 
_cell.length_a           39.379 
_cell.length_b           95.543 
_cell.length_c           96.181 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.89 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3GWX 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR (PPAR-DELTA))' 31017.061 2  ? ? 'LIGAND BIDING DOMAIN' ? 
2 non-polymer syn '5,8,11,14,17-EICOSAPENTAENOIC ACID'                                302.451   2  ? ? ?                      ? 
3 water       nat water                                                               18.015    87 ? ? ?                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQ
CTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEP
KFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLV
TEHAQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQ
CTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEP
KFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLV
TEHAQMMQRIKKTETETSLHPLLQEIYKDMY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   VAL n 
1 3   ALA n 
1 4   ASP n 
1 5   LEU n 
1 6   LYS n 
1 7   ALA n 
1 8   PHE n 
1 9   SER n 
1 10  LYS n 
1 11  HIS n 
1 12  ILE n 
1 13  TYR n 
1 14  ASN n 
1 15  ALA n 
1 16  TYR n 
1 17  LEU n 
1 18  LYS n 
1 19  ASN n 
1 20  PHE n 
1 21  ASN n 
1 22  MET n 
1 23  THR n 
1 24  LYS n 
1 25  LYS n 
1 26  LYS n 
1 27  ALA n 
1 28  ARG n 
1 29  SER n 
1 30  ILE n 
1 31  LEU n 
1 32  THR n 
1 33  GLY n 
1 34  LYS n 
1 35  ALA n 
1 36  SER n 
1 37  HIS n 
1 38  THR n 
1 39  ALA n 
1 40  PRO n 
1 41  PHE n 
1 42  VAL n 
1 43  ILE n 
1 44  HIS n 
1 45  ASP n 
1 46  ILE n 
1 47  GLU n 
1 48  THR n 
1 49  LEU n 
1 50  TRP n 
1 51  GLN n 
1 52  ALA n 
1 53  GLU n 
1 54  LYS n 
1 55  GLY n 
1 56  LEU n 
1 57  VAL n 
1 58  TRP n 
1 59  LYS n 
1 60  GLN n 
1 61  LEU n 
1 62  VAL n 
1 63  ASN n 
1 64  GLY n 
1 65  LEU n 
1 66  PRO n 
1 67  PRO n 
1 68  TYR n 
1 69  LYS n 
1 70  GLU n 
1 71  ILE n 
1 72  SER n 
1 73  VAL n 
1 74  HIS n 
1 75  VAL n 
1 76  PHE n 
1 77  TYR n 
1 78  ARG n 
1 79  CYS n 
1 80  GLN n 
1 81  CYS n 
1 82  THR n 
1 83  THR n 
1 84  VAL n 
1 85  GLU n 
1 86  THR n 
1 87  VAL n 
1 88  ARG n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  GLU n 
1 93  PHE n 
1 94  ALA n 
1 95  LYS n 
1 96  SER n 
1 97  ILE n 
1 98  PRO n 
1 99  SER n 
1 100 PHE n 
1 101 SER n 
1 102 SER n 
1 103 LEU n 
1 104 PHE n 
1 105 LEU n 
1 106 ASN n 
1 107 ASP n 
1 108 GLN n 
1 109 VAL n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 LYS n 
1 114 TYR n 
1 115 GLY n 
1 116 VAL n 
1 117 HIS n 
1 118 GLU n 
1 119 ALA n 
1 120 ILE n 
1 121 PHE n 
1 122 ALA n 
1 123 MET n 
1 124 LEU n 
1 125 ALA n 
1 126 SER n 
1 127 ILE n 
1 128 VAL n 
1 129 ASN n 
1 130 LYS n 
1 131 ASP n 
1 132 GLY n 
1 133 LEU n 
1 134 LEU n 
1 135 VAL n 
1 136 ALA n 
1 137 ASN n 
1 138 GLY n 
1 139 SER n 
1 140 GLY n 
1 141 PHE n 
1 142 VAL n 
1 143 THR n 
1 144 ARG n 
1 145 GLU n 
1 146 PHE n 
1 147 LEU n 
1 148 ARG n 
1 149 SER n 
1 150 LEU n 
1 151 ARG n 
1 152 LYS n 
1 153 PRO n 
1 154 PHE n 
1 155 SER n 
1 156 ASP n 
1 157 ILE n 
1 158 ILE n 
1 159 GLU n 
1 160 PRO n 
1 161 LYS n 
1 162 PHE n 
1 163 GLU n 
1 164 PHE n 
1 165 ALA n 
1 166 VAL n 
1 167 LYS n 
1 168 PHE n 
1 169 ASN n 
1 170 ALA n 
1 171 LEU n 
1 172 GLU n 
1 173 LEU n 
1 174 ASP n 
1 175 ASP n 
1 176 SER n 
1 177 ASP n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 PHE n 
1 182 ILE n 
1 183 ALA n 
1 184 ALA n 
1 185 ILE n 
1 186 ILE n 
1 187 LEU n 
1 188 CYS n 
1 189 GLY n 
1 190 ASP n 
1 191 ARG n 
1 192 PRO n 
1 193 GLY n 
1 194 LEU n 
1 195 MET n 
1 196 ASN n 
1 197 VAL n 
1 198 PRO n 
1 199 ARG n 
1 200 VAL n 
1 201 GLU n 
1 202 ALA n 
1 203 ILE n 
1 204 GLN n 
1 205 ASP n 
1 206 THR n 
1 207 ILE n 
1 208 LEU n 
1 209 ARG n 
1 210 ALA n 
1 211 LEU n 
1 212 GLU n 
1 213 PHE n 
1 214 HIS n 
1 215 LEU n 
1 216 GLN n 
1 217 ALA n 
1 218 ASN n 
1 219 HIS n 
1 220 PRO n 
1 221 ASP n 
1 222 ALA n 
1 223 GLN n 
1 224 TYR n 
1 225 LEU n 
1 226 PHE n 
1 227 PRO n 
1 228 LYS n 
1 229 LEU n 
1 230 LEU n 
1 231 GLN n 
1 232 LYS n 
1 233 MET n 
1 234 ALA n 
1 235 ASP n 
1 236 LEU n 
1 237 ARG n 
1 238 GLN n 
1 239 LEU n 
1 240 VAL n 
1 241 THR n 
1 242 GLU n 
1 243 HIS n 
1 244 ALA n 
1 245 GLN n 
1 246 MET n 
1 247 MET n 
1 248 GLN n 
1 249 ARG n 
1 250 ILE n 
1 251 LYS n 
1 252 LYS n 
1 253 THR n 
1 254 GLU n 
1 255 THR n 
1 256 GLU n 
1 257 THR n 
1 258 SER n 
1 259 LEU n 
1 260 HIS n 
1 261 PRO n 
1 262 LEU n 
1 263 LEU n 
1 264 GLN n 
1 265 GLU n 
1 266 ILE n 
1 267 TYR n 
1 268 LYS n 
1 269 ASP n 
1 270 MET n 
1 271 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PPARD 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE30)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPAS_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q03181 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GWX A 1 ? 271 ? Q03181 171 ? 441 ? 207 477 
2 1 3GWX B 1 ? 271 ? Q03181 171 ? 441 ? 207 477 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'   121.158 
EPA non-polymer         . '5,8,11,14,17-EICOSAPENTAENOIC ACID' ? 'C20 H30 O2'     302.451 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3GWX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.89 
_exptl_crystal.density_percent_sol   57.41 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    'pH 9.0' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3GWX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   40000 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0800000 
_reflns.pdbx_Rsym_value              0.0800000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        53.0 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3GWX 
_refine.ls_number_reflns_obs                     18430 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1401347.12 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    71.3 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2420000 
_refine.ls_R_factor_R_free                       0.3010000 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1842 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               57.0 
_refine.aniso_B[1][1]                            2.35 
_refine.aniso_B[2][2]                            6.94 
_refine.aniso_B[3][3]                            -9.28 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.09 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.799 
_refine.solvent_model_param_bsol                 130.1 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3GWX 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4330 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         88 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               4505 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.86  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.07  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.45  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.03  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.47  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.54 
_refine_ls_shell.number_reflns_R_work             1376 
_refine_ls_shell.R_factor_R_work                  0.2890000 
_refine_ls_shell.percent_reflns_obs               35.6 
_refine_ls_shell.R_factor_R_free                  0.3530000 
_refine_ls_shell.R_factor_R_free_error            0.029 
_refine_ls_shell.percent_reflns_R_free            9.7 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   EPA.TOP     'X-RAY DIFFRACTION' 
3 EPA.PAR           ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GWX 
_struct.title                     'MOLECULAR RECOGNITION OF FATTY ACIDS BY PEROXISOME PROLIFERATOR-ACTIVATED RECEPTORS' 
_struct.pdbx_descriptor           'PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR (PPAR-DELTA)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GWX 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'PPAR, FATTY ACIDS, TRANSCRIPTION, NUCLEAR RECEPTOR FOLD, TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 17  ? LYS A 212 LEU A 223 1 ? 12 
HELX_P HELX_P2  2  LYS A 24  ? ILE A 30  ? LYS A 230 ILE A 236 1 ? 7  
HELX_P HELX_P3  3  ILE A 46  ? LYS A 54  ? ILE A 252 LYS A 260 1 ? 9  
HELX_P HELX_P4  4  ILE A 71  ? SER A 96  ? ILE A 277 SER A 302 1 ? 26 
HELX_P HELX_P5  5  PRO A 98  ? SER A 102 ? PRO A 304 SER A 308 1 ? 5  
HELX_P HELX_P6  6  LEU A 105 ? ILE A 127 ? LEU A 311 ILE A 333 1 ? 23 
HELX_P HELX_P7  7  ARG A 144 ? SER A 149 ? ARG A 350 SER A 355 1 ? 6  
HELX_P HELX_P8  8  LYS A 152 ? LEU A 171 ? LYS A 358 LEU A 377 1 ? 20 
HELX_P HELX_P9  9  ASP A 175 ? ILE A 186 ? ASP A 381 ILE A 392 1 ? 12 
HELX_P HELX_P10 10 VAL A 197 ? GLN A 216 ? VAL A 403 GLN A 422 1 ? 20 
HELX_P HELX_P11 11 LEU A 225 ? THR A 253 ? LEU A 431 THR A 459 1 ? 29 
HELX_P HELX_P12 12 PRO A 261 ? LYS A 268 ? PRO A 467 LYS A 474 1 ? 8  
HELX_P HELX_P13 13 ALA B 3   ? LEU B 5   ? ALA B 209 LEU B 211 5 ? 3  
HELX_P HELX_P14 14 HIS B 11  ? LEU B 17  ? HIS B 217 LEU B 223 1 ? 7  
HELX_P HELX_P15 15 LYS B 24  ? LEU B 31  ? LYS B 230 LEU B 237 1 ? 8  
HELX_P HELX_P16 16 ILE B 46  ? GLY B 55  ? ILE B 252 GLY B 261 1 ? 10 
HELX_P HELX_P17 17 ILE B 71  ? SER B 96  ? ILE B 277 SER B 302 1 ? 26 
HELX_P HELX_P18 18 LEU B 105 ? ILE B 127 ? LEU B 311 ILE B 333 1 ? 23 
HELX_P HELX_P19 19 ARG B 144 ? SER B 149 ? ARG B 350 SER B 355 1 ? 6  
HELX_P HELX_P20 20 GLU B 159 ? ASN B 169 ? GLU B 365 ASN B 375 1 ? 11 
HELX_P HELX_P21 21 ASP B 175 ? ILE B 186 ? ASP B 381 ILE B 392 1 ? 12 
HELX_P HELX_P22 22 VAL B 197 ? GLN B 216 ? VAL B 403 GLN B 422 1 ? 20 
HELX_P HELX_P23 23 PRO B 227 ? THR B 253 ? PRO B 433 THR B 459 1 ? 27 
HELX_P HELX_P24 24 PRO B 261 ? ILE B 266 ? PRO B 467 ILE B 472 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 41  ? ILE A 43  ? PHE A 247 ILE A 249 
A 2 GLY A 140 ? THR A 143 ? GLY A 346 THR A 349 
A 3 GLY A 132 ? VAL A 135 ? GLY A 338 VAL A 341 
B 1 GLY B 132 ? VAL B 135 ? GLY B 338 VAL B 341 
B 2 GLY B 140 ? THR B 143 ? GLY B 346 THR B 349 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 41  ? O PHE A 247 N PHE A 141 ? N PHE A 347 
A 2 3 O GLY A 140 ? O GLY A 346 N VAL A 135 ? N VAL A 341 
B 1 2 O LEU B 133 ? O LEU B 339 N VAL B 142 ? N VAL B 348 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE EPA A 1' 
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE EPA B 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 PHE A 76  ? PHE A 282 . ? 1_555 ? 
2  AC1 18 CYS A 79  ? CYS A 285 . ? 1_555 ? 
3  AC1 18 GLN A 80  ? GLN A 286 . ? 1_555 ? 
4  AC1 18 THR A 82  ? THR A 288 . ? 1_555 ? 
5  AC1 18 THR A 83  ? THR A 289 . ? 1_555 ? 
6  AC1 18 THR A 86  ? THR A 292 . ? 1_555 ? 
7  AC1 18 HIS A 117 ? HIS A 323 . ? 1_555 ? 
8  AC1 18 ILE A 120 ? ILE A 326 . ? 1_555 ? 
9  AC1 18 MET A 123 ? MET A 329 . ? 1_555 ? 
10 AC1 18 VAL A 142 ? VAL A 348 . ? 1_555 ? 
11 AC1 18 LEU A 147 ? LEU A 353 . ? 1_555 ? 
12 AC1 18 ILE A 157 ? ILE A 363 . ? 1_555 ? 
13 AC1 18 ILE A 158 ? ILE A 364 . ? 1_555 ? 
14 AC1 18 LYS A 161 ? LYS A 367 . ? 1_555 ? 
15 AC1 18 HIS A 243 ? HIS A 449 . ? 1_555 ? 
16 AC1 18 MET A 247 ? MET A 453 . ? 1_555 ? 
17 AC1 18 LEU A 263 ? LEU A 469 . ? 1_555 ? 
18 AC1 18 TYR A 267 ? TYR A 473 . ? 1_555 ? 
19 AC2 20 LEU B 49  ? LEU B 255 . ? 1_555 ? 
20 AC2 20 PHE B 76  ? PHE B 282 . ? 1_555 ? 
21 AC2 20 CYS B 79  ? CYS B 285 . ? 1_555 ? 
22 AC2 20 GLN B 80  ? GLN B 286 . ? 1_555 ? 
23 AC2 20 THR B 82  ? THR B 288 . ? 1_555 ? 
24 AC2 20 THR B 83  ? THR B 289 . ? 1_555 ? 
25 AC2 20 GLU B 89  ? GLU B 295 . ? 1_555 ? 
26 AC2 20 HIS B 117 ? HIS B 323 . ? 1_555 ? 
27 AC2 20 ILE B 120 ? ILE B 326 . ? 1_555 ? 
28 AC2 20 LEU B 124 ? LEU B 330 . ? 1_555 ? 
29 AC2 20 LEU B 133 ? LEU B 339 . ? 1_555 ? 
30 AC2 20 VAL B 135 ? VAL B 341 . ? 1_555 ? 
31 AC2 20 VAL B 142 ? VAL B 348 . ? 1_555 ? 
32 AC2 20 LEU B 147 ? LEU B 353 . ? 1_555 ? 
33 AC2 20 ILE B 158 ? ILE B 364 . ? 1_555 ? 
34 AC2 20 LYS B 161 ? LYS B 367 . ? 1_555 ? 
35 AC2 20 HIS B 243 ? HIS B 449 . ? 1_555 ? 
36 AC2 20 MET B 247 ? MET B 453 . ? 1_555 ? 
37 AC2 20 LEU B 263 ? LEU B 469 . ? 1_555 ? 
38 AC2 20 TYR B 267 ? TYR B 473 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GWX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GWX 
_atom_sites.fract_transf_matrix[1][1]   0.025394 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003519 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010466 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010496 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 1   ? 11.905  12.591  92.228  1.00 101.77 ? 207 GLN A N   1 
ATOM   2    C CA  . GLN A 1 1   ? 10.637  11.953  91.767  1.00 101.54 ? 207 GLN A CA  1 
ATOM   3    C C   . GLN A 1 1   ? 10.923  10.826  90.776  1.00 100.95 ? 207 GLN A C   1 
ATOM   4    O O   . GLN A 1 1   ? 11.193  11.076  89.601  1.00 100.23 ? 207 GLN A O   1 
ATOM   5    C CB  . GLN A 1 1   ? 9.723   12.995  91.109  1.00 101.93 ? 207 GLN A CB  1 
ATOM   6    C CG  . GLN A 1 1   ? 9.308   14.146  92.030  1.00 102.09 ? 207 GLN A CG  1 
ATOM   7    C CD  . GLN A 1 1   ? 8.404   15.167  91.344  1.00 102.21 ? 207 GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 1   ? 8.779   15.779  90.340  1.00 100.32 ? 207 GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 1   ? 7.208   15.356  91.891  1.00 101.43 ? 207 GLN A NE2 1 
ATOM   10   N N   . VAL A 1 2   ? 10.870  9.588   91.263  1.00 100.30 ? 208 VAL A N   1 
ATOM   11   C CA  . VAL A 1 2   ? 11.111  8.413   90.430  1.00 98.56  ? 208 VAL A CA  1 
ATOM   12   C C   . VAL A 1 2   ? 10.123  8.417   89.273  1.00 97.29  ? 208 VAL A C   1 
ATOM   13   O O   . VAL A 1 2   ? 10.441  7.989   88.165  1.00 96.55  ? 208 VAL A O   1 
ATOM   14   C CB  . VAL A 1 2   ? 10.927  7.107   91.241  1.00 99.59  ? 208 VAL A CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? 9.557   7.101   91.913  1.00 98.79  ? 208 VAL A CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? 11.082  5.890   90.324  1.00 98.88  ? 208 VAL A CG2 1 
ATOM   17   N N   . ALA A 1 3   ? 8.917   8.900   89.549  1.00 96.14  ? 209 ALA A N   1 
ATOM   18   C CA  . ALA A 1 3   ? 7.870   8.988   88.539  1.00 93.27  ? 209 ALA A CA  1 
ATOM   19   C C   . ALA A 1 3   ? 8.030   10.338  87.852  1.00 90.91  ? 209 ALA A C   1 
ATOM   20   O O   . ALA A 1 3   ? 8.869   11.148  88.258  1.00 90.78  ? 209 ALA A O   1 
ATOM   21   C CB  . ALA A 1 3   ? 6.492   8.888   89.197  1.00 93.87  ? 209 ALA A CB  1 
ATOM   22   N N   . ASP A 1 4   ? 7.235   10.582  86.815  1.00 87.74  ? 210 ASP A N   1 
ATOM   23   C CA  . ASP A 1 4   ? 7.313   11.853  86.104  1.00 84.12  ? 210 ASP A CA  1 
ATOM   24   C C   . ASP A 1 4   ? 8.747   12.004  85.594  1.00 80.55  ? 210 ASP A C   1 
ATOM   25   O O   . ASP A 1 4   ? 9.218   13.101  85.305  1.00 80.76  ? 210 ASP A O   1 
ATOM   26   C CB  . ASP A 1 4   ? 6.947   12.998  87.062  1.00 84.08  ? 210 ASP A CB  1 
ATOM   27   C CG  . ASP A 1 4   ? 6.719   14.314  86.352  1.00 83.40  ? 210 ASP A CG  1 
ATOM   28   O OD1 . ASP A 1 4   ? 5.891   14.349  85.414  1.00 82.86  ? 210 ASP A OD1 1 
ATOM   29   O OD2 . ASP A 1 4   ? 7.361   15.314  86.741  1.00 83.23  ? 210 ASP A OD2 1 
ATOM   30   N N   . LEU A 1 5   ? 9.436   10.874  85.501  1.00 77.15  ? 211 LEU A N   1 
ATOM   31   C CA  . LEU A 1 5   ? 10.810  10.833  85.025  1.00 73.99  ? 211 LEU A CA  1 
ATOM   32   C C   . LEU A 1 5   ? 10.764  10.192  83.651  1.00 72.24  ? 211 LEU A C   1 
ATOM   33   O O   . LEU A 1 5   ? 11.621  10.440  82.806  1.00 73.01  ? 211 LEU A O   1 
ATOM   34   C CB  . LEU A 1 5   ? 11.665  9.987   85.964  1.00 74.39  ? 211 LEU A CB  1 
ATOM   35   C CG  . LEU A 1 5   ? 13.157  9.880   85.655  1.00 74.83  ? 211 LEU A CG  1 
ATOM   36   C CD1 . LEU A 1 5   ? 13.806  11.252  85.753  1.00 76.55  ? 211 LEU A CD1 1 
ATOM   37   C CD2 . LEU A 1 5   ? 13.803  8.926   86.640  1.00 76.49  ? 211 LEU A CD2 1 
ATOM   38   N N   . LYS A 1 6   ? 9.747   9.360   83.450  1.00 68.50  ? 212 LYS A N   1 
ATOM   39   C CA  . LYS A 1 6   ? 9.521   8.671   82.189  1.00 66.27  ? 212 LYS A CA  1 
ATOM   40   C C   . LYS A 1 6   ? 8.982   9.689   81.180  1.00 65.41  ? 212 LYS A C   1 
ATOM   41   O O   . LYS A 1 6   ? 8.950   9.442   79.973  1.00 65.08  ? 212 LYS A O   1 
ATOM   42   C CB  . LYS A 1 6   ? 8.505   7.550   82.398  1.00 66.45  ? 212 LYS A CB  1 
ATOM   43   C CG  . LYS A 1 6   ? 7.139   8.031   82.867  1.00 67.94  ? 212 LYS A CG  1 
ATOM   44   C CD  . LYS A 1 6   ? 6.254   6.871   83.287  1.00 70.75  ? 212 LYS A CD  1 
ATOM   45   C CE  . LYS A 1 6   ? 6.813   6.166   84.513  1.00 71.93  ? 212 LYS A CE  1 
ATOM   46   N NZ  . LYS A 1 6   ? 6.003   4.975   84.888  1.00 75.95  ? 212 LYS A NZ  1 
ATOM   47   N N   . ALA A 1 7   ? 8.551   10.834  81.698  1.00 63.15  ? 213 ALA A N   1 
ATOM   48   C CA  . ALA A 1 7   ? 8.030   11.917  80.879  1.00 60.34  ? 213 ALA A CA  1 
ATOM   49   C C   . ALA A 1 7   ? 9.221   12.639  80.258  1.00 57.75  ? 213 ALA A C   1 
ATOM   50   O O   . ALA A 1 7   ? 9.283   12.836  79.051  1.00 58.00  ? 213 ALA A O   1 
ATOM   51   C CB  . ALA A 1 7   ? 7.234   12.869  81.746  1.00 60.19  ? 213 ALA A CB  1 
ATOM   52   N N   . PHE A 1 8   ? 10.163  13.033  81.105  1.00 57.62  ? 214 PHE A N   1 
ATOM   53   C CA  . PHE A 1 8   ? 11.381  13.713  80.677  1.00 56.24  ? 214 PHE A CA  1 
ATOM   54   C C   . PHE A 1 8   ? 12.105  12.838  79.660  1.00 56.43  ? 214 PHE A C   1 
ATOM   55   O O   . PHE A 1 8   ? 12.862  13.318  78.811  1.00 54.77  ? 214 PHE A O   1 
ATOM   56   C CB  . PHE A 1 8   ? 12.256  13.982  81.912  1.00 55.20  ? 214 PHE A CB  1 
ATOM   57   C CG  . PHE A 1 8   ? 13.732  13.952  81.655  1.00 52.74  ? 214 PHE A CG  1 
ATOM   58   C CD1 . PHE A 1 8   ? 14.420  12.743  81.617  1.00 52.68  ? 214 PHE A CD1 1 
ATOM   59   C CD2 . PHE A 1 8   ? 14.452  15.138  81.502  1.00 56.42  ? 214 PHE A CD2 1 
ATOM   60   C CE1 . PHE A 1 8   ? 15.807  12.711  81.436  1.00 51.35  ? 214 PHE A CE1 1 
ATOM   61   C CE2 . PHE A 1 8   ? 15.847  15.116  81.318  1.00 54.99  ? 214 PHE A CE2 1 
ATOM   62   C CZ  . PHE A 1 8   ? 16.521  13.896  81.288  1.00 51.06  ? 214 PHE A CZ  1 
ATOM   63   N N   . SER A 1 9   ? 11.842  11.543  79.746  1.00 55.04  ? 215 SER A N   1 
ATOM   64   C CA  . SER A 1 9   ? 12.461  10.584  78.859  1.00 52.88  ? 215 SER A CA  1 
ATOM   65   C C   . SER A 1 9   ? 11.764  10.595  77.509  1.00 52.94  ? 215 SER A C   1 
ATOM   66   O O   . SER A 1 9   ? 12.412  10.485  76.469  1.00 56.45  ? 215 SER A O   1 
ATOM   67   C CB  . SER A 1 9   ? 12.397  9.199   79.488  1.00 51.94  ? 215 SER A CB  1 
ATOM   68   O OG  . SER A 1 9   ? 13.115  8.271   78.715  1.00 57.09  ? 215 SER A OG  1 
ATOM   69   N N   . LYS A 1 10  ? 10.442  10.728  77.526  1.00 51.78  ? 216 LYS A N   1 
ATOM   70   C CA  . LYS A 1 10  ? 9.658   10.771  76.295  1.00 50.04  ? 216 LYS A CA  1 
ATOM   71   C C   . LYS A 1 10  ? 9.937   12.060  75.525  1.00 47.83  ? 216 LYS A C   1 
ATOM   72   O O   . LYS A 1 10  ? 9.839   12.093  74.296  1.00 46.44  ? 216 LYS A O   1 
ATOM   73   C CB  . LYS A 1 10  ? 8.155   10.679  76.607  1.00 52.04  ? 216 LYS A CB  1 
ATOM   74   C CG  . LYS A 1 10  ? 7.232   10.808  75.374  1.00 51.57  ? 216 LYS A CG  1 
ATOM   75   C CD  . LYS A 1 10  ? 5.759   10.921  75.792  1.00 54.92  ? 216 LYS A CD  1 
ATOM   76   C CE  . LYS A 1 10  ? 4.916   11.687  74.771  1.00 53.95  ? 216 LYS A CE  1 
ATOM   77   N NZ  . LYS A 1 10  ? 3.493   11.830  75.228  1.00 53.54  ? 216 LYS A NZ  1 
ATOM   78   N N   . HIS A 1 11  ? 10.266  13.128  76.242  1.00 46.22  ? 217 HIS A N   1 
ATOM   79   C CA  . HIS A 1 11  ? 10.557  14.388  75.587  1.00 49.94  ? 217 HIS A CA  1 
ATOM   80   C C   . HIS A 1 11  ? 11.862  14.217  74.834  1.00 49.33  ? 217 HIS A C   1 
ATOM   81   O O   . HIS A 1 11  ? 12.001  14.668  73.703  1.00 52.01  ? 217 HIS A O   1 
ATOM   82   C CB  . HIS A 1 11  ? 10.690  15.522  76.597  1.00 57.15  ? 217 HIS A CB  1 
ATOM   83   C CG  . HIS A 1 11  ? 10.707  16.878  75.964  1.00 66.57  ? 217 HIS A CG  1 
ATOM   84   N ND1 . HIS A 1 11  ? 11.632  17.241  75.008  1.00 70.92  ? 217 HIS A ND1 1 
ATOM   85   C CD2 . HIS A 1 11  ? 9.883   17.943  76.111  1.00 70.22  ? 217 HIS A CD2 1 
ATOM   86   C CE1 . HIS A 1 11  ? 11.376  18.469  74.592  1.00 72.89  ? 217 HIS A CE1 1 
ATOM   87   N NE2 . HIS A 1 11  ? 10.319  18.918  75.246  1.00 71.73  ? 217 HIS A NE2 1 
ATOM   88   N N   . ILE A 1 12  ? 12.821  13.552  75.464  1.00 48.00  ? 218 ILE A N   1 
ATOM   89   C CA  . ILE A 1 12  ? 14.099  13.297  74.824  1.00 45.22  ? 218 ILE A CA  1 
ATOM   90   C C   . ILE A 1 12  ? 13.872  12.414  73.591  1.00 43.89  ? 218 ILE A C   1 
ATOM   91   O O   . ILE A 1 12  ? 14.536  12.580  72.576  1.00 43.26  ? 218 ILE A O   1 
ATOM   92   C CB  . ILE A 1 12  ? 15.078  12.603  75.798  1.00 43.98  ? 218 ILE A CB  1 
ATOM   93   C CG1 . ILE A 1 12  ? 15.344  13.520  77.001  1.00 44.21  ? 218 ILE A CG1 1 
ATOM   94   C CG2 . ILE A 1 12  ? 16.375  12.274  75.085  1.00 43.94  ? 218 ILE A CG2 1 
ATOM   95   C CD1 . ILE A 1 12  ? 16.322  12.954  78.008  1.00 43.12  ? 218 ILE A CD1 1 
ATOM   96   N N   . TYR A 1 13  ? 12.921  11.486  73.690  1.00 42.80  ? 219 TYR A N   1 
ATOM   97   C CA  . TYR A 1 13  ? 12.589  10.582  72.583  1.00 42.91  ? 219 TYR A CA  1 
ATOM   98   C C   . TYR A 1 13  ? 11.932  11.310  71.420  1.00 42.63  ? 219 TYR A C   1 
ATOM   99   O O   . TYR A 1 13  ? 12.041  10.884  70.274  1.00 40.55  ? 219 TYR A O   1 
ATOM   100  C CB  . TYR A 1 13  ? 11.642  9.477   73.048  1.00 44.67  ? 219 TYR A CB  1 
ATOM   101  C CG  . TYR A 1 13  ? 11.357  8.436   71.984  1.00 43.33  ? 219 TYR A CG  1 
ATOM   102  C CD1 . TYR A 1 13  ? 12.363  7.997   71.121  1.00 43.79  ? 219 TYR A CD1 1 
ATOM   103  C CD2 . TYR A 1 13  ? 10.099  7.863   71.864  1.00 41.91  ? 219 TYR A CD2 1 
ATOM   104  C CE1 . TYR A 1 13  ? 12.124  7.017   70.174  1.00 38.66  ? 219 TYR A CE1 1 
ATOM   105  C CE2 . TYR A 1 13  ? 9.853   6.879   70.919  1.00 40.40  ? 219 TYR A CE2 1 
ATOM   106  C CZ  . TYR A 1 13  ? 10.870  6.463   70.078  1.00 41.06  ? 219 TYR A CZ  1 
ATOM   107  O OH  . TYR A 1 13  ? 10.632  5.490   69.138  1.00 45.25  ? 219 TYR A OH  1 
ATOM   108  N N   . ASN A 1 14  ? 11.231  12.395  71.735  1.00 44.85  ? 220 ASN A N   1 
ATOM   109  C CA  . ASN A 1 14  ? 10.572  13.197  70.725  1.00 42.90  ? 220 ASN A CA  1 
ATOM   110  C C   . ASN A 1 14  ? 11.652  14.039  70.058  1.00 39.86  ? 220 ASN A C   1 
ATOM   111  O O   . ASN A 1 14  ? 11.613  14.279  68.849  1.00 40.70  ? 220 ASN A O   1 
ATOM   112  C CB  . ASN A 1 14  ? 9.495   14.086  71.363  1.00 47.26  ? 220 ASN A CB  1 
ATOM   113  C CG  . ASN A 1 14  ? 8.288   13.282  71.866  1.00 57.49  ? 220 ASN A CG  1 
ATOM   114  O OD1 . ASN A 1 14  ? 7.389   13.832  72.506  1.00 62.78  ? 220 ASN A OD1 1 
ATOM   115  N ND2 . ASN A 1 14  ? 8.261   11.986  71.572  1.00 61.50  ? 220 ASN A ND2 1 
ATOM   116  N N   . ALA A 1 15  ? 12.637  14.456  70.846  1.00 37.48  ? 221 ALA A N   1 
ATOM   117  C CA  . ALA A 1 15  ? 13.739  15.258  70.321  1.00 37.93  ? 221 ALA A CA  1 
ATOM   118  C C   . ALA A 1 15  ? 14.602  14.435  69.375  1.00 37.13  ? 221 ALA A C   1 
ATOM   119  O O   . ALA A 1 15  ? 15.236  14.974  68.473  1.00 38.43  ? 221 ALA A O   1 
ATOM   120  C CB  . ALA A 1 15  ? 14.586  15.806  71.457  1.00 39.54  ? 221 ALA A CB  1 
ATOM   121  N N   . TYR A 1 16  ? 14.613  13.125  69.581  1.00 36.08  ? 222 TYR A N   1 
ATOM   122  C CA  . TYR A 1 16  ? 15.389  12.216  68.742  1.00 38.20  ? 222 TYR A CA  1 
ATOM   123  C C   . TYR A 1 16  ? 14.666  11.901  67.437  1.00 39.52  ? 222 TYR A C   1 
ATOM   124  O O   . TYR A 1 16  ? 15.283  11.810  66.387  1.00 40.40  ? 222 TYR A O   1 
ATOM   125  C CB  . TYR A 1 16  ? 15.666  10.936  69.526  1.00 39.21  ? 222 TYR A CB  1 
ATOM   126  C CG  . TYR A 1 16  ? 16.345  9.808   68.778  1.00 38.93  ? 222 TYR A CG  1 
ATOM   127  C CD1 . TYR A 1 16  ? 15.633  9.022   67.873  1.00 35.45  ? 222 TYR A CD1 1 
ATOM   128  C CD2 . TYR A 1 16  ? 17.661  9.441   69.083  1.00 39.67  ? 222 TYR A CD2 1 
ATOM   129  C CE1 . TYR A 1 16  ? 16.194  7.887   67.304  1.00 36.47  ? 222 TYR A CE1 1 
ATOM   130  C CE2 . TYR A 1 16  ? 18.239  8.301   68.519  1.00 40.90  ? 222 TYR A CE2 1 
ATOM   131  C CZ  . TYR A 1 16  ? 17.493  7.526   67.633  1.00 40.31  ? 222 TYR A CZ  1 
ATOM   132  O OH  . TYR A 1 16  ? 18.034  6.370   67.110  1.00 37.93  ? 222 TYR A OH  1 
ATOM   133  N N   . LEU A 1 17  ? 13.346  11.747  67.508  1.00 43.08  ? 223 LEU A N   1 
ATOM   134  C CA  . LEU A 1 17  ? 12.532  11.444  66.328  1.00 41.76  ? 223 LEU A CA  1 
ATOM   135  C C   . LEU A 1 17  ? 12.371  12.637  65.382  1.00 38.89  ? 223 LEU A C   1 
ATOM   136  O O   . LEU A 1 17  ? 12.246  12.489  64.180  1.00 37.44  ? 223 LEU A O   1 
ATOM   137  C CB  . LEU A 1 17  ? 11.159  10.945  66.783  1.00 42.98  ? 223 LEU A CB  1 
ATOM   138  C CG  . LEU A 1 17  ? 11.001  9.445   67.065  1.00 46.45  ? 223 LEU A CG  1 
ATOM   139  C CD1 . LEU A 1 17  ? 12.291  8.888   67.613  1.00 50.99  ? 223 LEU A CD1 1 
ATOM   140  C CD2 . LEU A 1 17  ? 9.839   9.206   68.041  1.00 45.27  ? 223 LEU A CD2 1 
ATOM   141  N N   . LYS A 1 18  ? 12.388  13.828  65.941  1.00 39.86  ? 224 LYS A N   1 
ATOM   142  C CA  . LYS A 1 18  ? 12.234  15.039  65.160  1.00 43.17  ? 224 LYS A CA  1 
ATOM   143  C C   . LYS A 1 18  ? 13.532  15.551  64.523  1.00 43.97  ? 224 LYS A C   1 
ATOM   144  O O   . LYS A 1 18  ? 13.502  16.366  63.593  1.00 45.19  ? 224 LYS A O   1 
ATOM   145  C CB  . LYS A 1 18  ? 11.656  16.123  66.084  1.00 44.64  ? 224 LYS A CB  1 
ATOM   146  C CG  . LYS A 1 18  ? 11.767  17.548  65.574  1.00 50.43  ? 224 LYS A CG  1 
ATOM   147  C CD  . LYS A 1 18  ? 11.201  18.519  66.599  1.00 57.35  ? 224 LYS A CD  1 
ATOM   148  C CE  . LYS A 1 18  ? 11.311  19.964  66.125  1.00 59.88  ? 224 LYS A CE  1 
ATOM   149  N NZ  . LYS A 1 18  ? 10.885  20.934  67.179  1.00 59.08  ? 224 LYS A NZ  1 
ATOM   150  N N   . ASN A 1 19  ? 14.666  15.051  64.999  1.00 44.60  ? 225 ASN A N   1 
ATOM   151  C CA  . ASN A 1 19  ? 15.942  15.574  64.546  1.00 41.49  ? 225 ASN A CA  1 
ATOM   152  C C   . ASN A 1 19  ? 16.908  14.719  63.775  1.00 40.97  ? 225 ASN A C   1 
ATOM   153  O O   . ASN A 1 19  ? 17.799  15.261  63.138  1.00 41.00  ? 225 ASN A O   1 
ATOM   154  C CB  . ASN A 1 19  ? 16.665  16.184  65.747  1.00 41.70  ? 225 ASN A CB  1 
ATOM   155  C CG  . ASN A 1 19  ? 16.090  17.524  66.129  1.00 41.48  ? 225 ASN A CG  1 
ATOM   156  O OD1 . ASN A 1 19  ? 16.287  18.511  65.421  1.00 39.78  ? 225 ASN A OD1 1 
ATOM   157  N ND2 . ASN A 1 19  ? 15.360  17.568  67.242  1.00 39.19  ? 225 ASN A ND2 1 
ATOM   158  N N   . PHE A 1 20  ? 16.754  13.404  63.840  1.00 39.60  ? 226 PHE A N   1 
ATOM   159  C CA  . PHE A 1 20  ? 17.627  12.495  63.099  1.00 41.66  ? 226 PHE A CA  1 
ATOM   160  C C   . PHE A 1 20  ? 16.926  11.960  61.834  1.00 42.59  ? 226 PHE A C   1 
ATOM   161  O O   . PHE A 1 20  ? 15.833  11.411  61.908  1.00 43.09  ? 226 PHE A O   1 
ATOM   162  C CB  . PHE A 1 20  ? 18.053  11.339  64.011  1.00 39.24  ? 226 PHE A CB  1 
ATOM   163  C CG  . PHE A 1 20  ? 18.961  11.762  65.121  1.00 38.72  ? 226 PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 20  ? 20.172  12.381  64.828  1.00 39.98  ? 226 PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 20  ? 18.600  11.576  66.455  1.00 37.14  ? 226 PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 20  ? 21.016  12.814  65.839  1.00 35.72  ? 226 PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 20  ? 19.431  12.005  67.485  1.00 38.58  ? 226 PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 20  ? 20.645  12.627  67.180  1.00 38.27  ? 226 PHE A CZ  1 
ATOM   169  N N   . ASN A 1 21  ? 17.558  12.108  60.675  1.00 47.53  ? 227 ASN A N   1 
ATOM   170  C CA  . ASN A 1 21  ? 16.948  11.649  59.424  1.00 51.75  ? 227 ASN A CA  1 
ATOM   171  C C   . ASN A 1 21  ? 16.920  10.127  59.261  1.00 52.43  ? 227 ASN A C   1 
ATOM   172  O O   . ASN A 1 21  ? 16.300  9.601   58.354  1.00 51.82  ? 227 ASN A O   1 
ATOM   173  C CB  . ASN A 1 21  ? 17.664  12.281  58.229  1.00 57.03  ? 227 ASN A CB  1 
ATOM   174  C CG  . ASN A 1 21  ? 16.693  12.790  57.166  1.00 63.75  ? 227 ASN A CG  1 
ATOM   175  O OD1 . ASN A 1 21  ? 15.978  12.011  56.522  1.00 63.77  ? 227 ASN A OD1 1 
ATOM   176  N ND2 . ASN A 1 21  ? 16.658  14.111  56.987  1.00 65.39  ? 227 ASN A ND2 1 
ATOM   177  N N   . MET A 1 22  ? 17.581  9.410   60.152  1.00 56.11  ? 228 MET A N   1 
ATOM   178  C CA  . MET A 1 22  ? 17.610  7.959   60.057  1.00 56.76  ? 228 MET A CA  1 
ATOM   179  C C   . MET A 1 22  ? 17.586  7.362   61.459  1.00 58.14  ? 228 MET A C   1 
ATOM   180  O O   . MET A 1 22  ? 18.406  7.728   62.304  1.00 59.25  ? 228 MET A O   1 
ATOM   181  C CB  . MET A 1 22  ? 18.884  7.528   59.340  1.00 58.30  ? 228 MET A CB  1 
ATOM   182  C CG  . MET A 1 22  ? 19.040  6.039   59.131  1.00 58.43  ? 228 MET A CG  1 
ATOM   183  S SD  . MET A 1 22  ? 18.025  5.423   57.796  1.00 56.33  ? 228 MET A SD  1 
ATOM   184  C CE  . MET A 1 22  ? 17.201  4.157   58.614  1.00 55.72  ? 228 MET A CE  1 
ATOM   185  N N   . THR A 1 23  ? 16.643  6.455   61.706  1.00 55.71  ? 229 THR A N   1 
ATOM   186  C CA  . THR A 1 23  ? 16.525  5.804   63.008  1.00 51.99  ? 229 THR A CA  1 
ATOM   187  C C   . THR A 1 23  ? 16.867  4.341   62.828  1.00 48.22  ? 229 THR A C   1 
ATOM   188  O O   . THR A 1 23  ? 16.936  3.861   61.707  1.00 43.66  ? 229 THR A O   1 
ATOM   189  C CB  . THR A 1 23  ? 15.101  5.890   63.563  1.00 52.34  ? 229 THR A CB  1 
ATOM   190  O OG1 . THR A 1 23  ? 14.219  5.156   62.709  1.00 53.58  ? 229 THR A OG1 1 
ATOM   191  C CG2 . THR A 1 23  ? 14.651  7.334   63.648  1.00 49.67  ? 229 THR A CG2 1 
ATOM   192  N N   . LYS A 1 24  ? 17.083  3.632   63.927  1.00 47.42  ? 230 LYS A N   1 
ATOM   193  C CA  . LYS A 1 24  ? 17.423  2.228   63.820  1.00 48.40  ? 230 LYS A CA  1 
ATOM   194  C C   . LYS A 1 24  ? 16.248  1.469   63.218  1.00 51.90  ? 230 LYS A C   1 
ATOM   195  O O   . LYS A 1 24  ? 16.437  0.589   62.376  1.00 50.16  ? 230 LYS A O   1 
ATOM   196  C CB  . LYS A 1 24  ? 17.788  1.653   65.189  1.00 42.94  ? 230 LYS A CB  1 
ATOM   197  C CG  . LYS A 1 24  ? 18.405  0.274   65.126  1.00 36.47  ? 230 LYS A CG  1 
ATOM   198  C CD  . LYS A 1 24  ? 18.833  -0.163  66.491  1.00 32.19  ? 230 LYS A CD  1 
ATOM   199  C CE  . LYS A 1 24  ? 19.585  -1.472  66.477  1.00 35.23  ? 230 LYS A CE  1 
ATOM   200  N NZ  . LYS A 1 24  ? 19.682  -2.069  67.866  1.00 33.56  ? 230 LYS A NZ  1 
ATOM   201  N N   . LYS A 1 25  ? 15.034  1.822   63.632  1.00 54.79  ? 231 LYS A N   1 
ATOM   202  C CA  . LYS A 1 25  ? 13.835  1.159   63.117  1.00 59.81  ? 231 LYS A CA  1 
ATOM   203  C C   . LYS A 1 25  ? 13.785  1.179   61.580  1.00 59.54  ? 231 LYS A C   1 
ATOM   204  O O   . LYS A 1 25  ? 13.665  0.131   60.940  1.00 59.00  ? 231 LYS A O   1 
ATOM   205  C CB  . LYS A 1 25  ? 12.572  1.821   63.682  1.00 58.79  ? 231 LYS A CB  1 
ATOM   206  C CG  . LYS A 1 25  ? 11.282  1.319   63.048  1.00 60.82  ? 231 LYS A CG  1 
ATOM   207  C CD  . LYS A 1 25  ? 10.104  2.223   63.385  1.00 64.42  ? 231 LYS A CD  1 
ATOM   208  C CE  . LYS A 1 25  ? 10.400  3.695   63.058  1.00 66.98  ? 231 LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 25  ? 10.731  3.959   61.622  1.00 67.32  ? 231 LYS A NZ  1 
ATOM   210  N N   . LYS A 1 26  ? 13.875  2.377   61.005  1.00 57.55  ? 232 LYS A N   1 
ATOM   211  C CA  . LYS A 1 26  ? 13.851  2.550   59.559  1.00 58.83  ? 232 LYS A CA  1 
ATOM   212  C C   . LYS A 1 26  ? 15.016  1.821   58.909  1.00 58.46  ? 232 LYS A C   1 
ATOM   213  O O   . LYS A 1 26  ? 14.906  1.352   57.777  1.00 56.96  ? 232 LYS A O   1 
ATOM   214  C CB  . LYS A 1 26  ? 13.926  4.037   59.204  1.00 60.41  ? 232 LYS A CB  1 
ATOM   215  C CG  . LYS A 1 26  ? 14.047  4.320   57.707  1.00 61.79  ? 232 LYS A CG  1 
ATOM   216  C CD  . LYS A 1 26  ? 14.227  5.814   57.443  1.00 63.02  ? 232 LYS A CD  1 
ATOM   217  C CE  . LYS A 1 26  ? 14.540  6.101   55.977  1.00 63.29  ? 232 LYS A CE  1 
ATOM   218  N NZ  . LYS A 1 26  ? 14.777  7.559   55.735  1.00 60.49  ? 232 LYS A NZ  1 
ATOM   219  N N   . ALA A 1 27  ? 16.126  1.742   59.641  1.00 58.69  ? 233 ALA A N   1 
ATOM   220  C CA  . ALA A 1 27  ? 17.346  1.093   59.174  1.00 58.99  ? 233 ALA A CA  1 
ATOM   221  C C   . ALA A 1 27  ? 17.257  -0.432  59.215  1.00 59.53  ? 233 ALA A C   1 
ATOM   222  O O   . ALA A 1 27  ? 17.592  -1.112  58.242  1.00 60.77  ? 233 ALA A O   1 
ATOM   223  C CB  . ALA A 1 27  ? 18.530  1.571   60.011  1.00 56.00  ? 233 ALA A CB  1 
ATOM   224  N N   . ARG A 1 28  ? 16.807  -0.968  60.343  1.00 61.04  ? 234 ARG A N   1 
ATOM   225  C CA  . ARG A 1 28  ? 16.685  -2.411  60.496  1.00 62.03  ? 234 ARG A CA  1 
ATOM   226  C C   . ARG A 1 28  ? 15.652  -2.955  59.518  1.00 62.45  ? 234 ARG A C   1 
ATOM   227  O O   . ARG A 1 28  ? 15.703  -4.124  59.136  1.00 62.05  ? 234 ARG A O   1 
ATOM   228  C CB  . ARG A 1 28  ? 16.286  -2.756  61.933  1.00 61.22  ? 234 ARG A CB  1 
ATOM   229  C CG  . ARG A 1 28  ? 17.316  -2.375  62.993  1.00 63.49  ? 234 ARG A CG  1 
ATOM   230  C CD  . ARG A 1 28  ? 18.224  -3.539  63.373  1.00 66.15  ? 234 ARG A CD  1 
ATOM   231  N NE  . ARG A 1 28  ? 19.272  -3.825  62.395  1.00 68.32  ? 234 ARG A NE  1 
ATOM   232  C CZ  . ARG A 1 28  ? 20.323  -3.043  62.167  1.00 70.03  ? 234 ARG A CZ  1 
ATOM   233  N NH1 . ARG A 1 28  ? 20.469  -1.912  62.840  1.00 70.23  ? 234 ARG A NH1 1 
ATOM   234  N NH2 . ARG A 1 28  ? 21.246  -3.405  61.283  1.00 70.07  ? 234 ARG A NH2 1 
ATOM   235  N N   . SER A 1 29  ? 14.726  -2.097  59.103  1.00 62.47  ? 235 SER A N   1 
ATOM   236  C CA  . SER A 1 29  ? 13.678  -2.499  58.170  1.00 64.27  ? 235 SER A CA  1 
ATOM   237  C C   . SER A 1 29  ? 14.197  -2.600  56.738  1.00 65.68  ? 235 SER A C   1 
ATOM   238  O O   . SER A 1 29  ? 13.637  -3.325  55.914  1.00 67.09  ? 235 SER A O   1 
ATOM   239  C CB  . SER A 1 29  ? 12.518  -1.503  58.210  1.00 63.56  ? 235 SER A CB  1 
ATOM   240  O OG  . SER A 1 29  ? 12.889  -0.259  57.639  1.00 63.39  ? 235 SER A OG  1 
ATOM   241  N N   . ILE A 1 30  ? 15.257  -1.860  56.440  1.00 64.95  ? 236 ILE A N   1 
ATOM   242  C CA  . ILE A 1 30  ? 15.839  -1.885  55.109  1.00 63.96  ? 236 ILE A CA  1 
ATOM   243  C C   . ILE A 1 30  ? 16.677  -3.142  54.937  1.00 67.41  ? 236 ILE A C   1 
ATOM   244  O O   . ILE A 1 30  ? 16.702  -3.747  53.873  1.00 69.23  ? 236 ILE A O   1 
ATOM   245  C CB  . ILE A 1 30  ? 16.686  -0.628  54.869  1.00 59.51  ? 236 ILE A CB  1 
ATOM   246  C CG1 . ILE A 1 30  ? 15.754  0.579   54.789  1.00 52.83  ? 236 ILE A CG1 1 
ATOM   247  C CG2 . ILE A 1 30  ? 17.515  -0.773  53.602  1.00 58.28  ? 236 ILE A CG2 1 
ATOM   248  C CD1 . ILE A 1 30  ? 16.445  1.872   54.479  1.00 52.90  ? 236 ILE A CD1 1 
ATOM   249  N N   . LEU A 1 31  ? 17.354  -3.548  55.997  1.00 73.63  ? 237 LEU A N   1 
ATOM   250  C CA  . LEU A 1 31  ? 18.164  -4.750  55.941  1.00 79.26  ? 237 LEU A CA  1 
ATOM   251  C C   . LEU A 1 31  ? 17.279  -5.958  56.283  1.00 83.70  ? 237 LEU A C   1 
ATOM   252  O O   . LEU A 1 31  ? 17.706  -6.882  56.979  1.00 83.57  ? 237 LEU A O   1 
ATOM   253  C CB  . LEU A 1 31  ? 19.343  -4.629  56.918  1.00 79.69  ? 237 LEU A CB  1 
ATOM   254  C CG  . LEU A 1 31  ? 20.363  -3.508  56.638  1.00 79.82  ? 237 LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 31  ? 19.720  -2.142  56.826  1.00 79.49  ? 237 LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 31  ? 21.558  -3.652  57.569  1.00 79.44  ? 237 LEU A CD2 1 
ATOM   257  N N   . THR A 1 32  ? 16.042  -5.934  55.783  1.00 87.96  ? 238 THR A N   1 
ATOM   258  C CA  . THR A 1 32  ? 15.076  -7.011  56.015  1.00 93.34  ? 238 THR A CA  1 
ATOM   259  C C   . THR A 1 32  ? 15.234  -8.139  54.996  1.00 96.07  ? 238 THR A C   1 
ATOM   260  O O   . THR A 1 32  ? 16.002  -8.025  54.042  1.00 96.58  ? 238 THR A O   1 
ATOM   261  C CB  . THR A 1 32  ? 13.615  -6.494  55.932  1.00 94.80  ? 238 THR A CB  1 
ATOM   262  O OG1 . THR A 1 32  ? 12.708  -7.549  56.278  1.00 95.55  ? 238 THR A OG1 1 
ATOM   263  C CG2 . THR A 1 32  ? 13.293  -6.025  54.517  1.00 94.42  ? 238 THR A CG2 1 
ATOM   264  N N   . GLY A 1 33  ? 14.489  -9.222  55.197  1.00 99.53  ? 239 GLY A N   1 
ATOM   265  C CA  . GLY A 1 33  ? 14.564  -10.360 54.297  1.00 103.37 ? 239 GLY A CA  1 
ATOM   266  C C   . GLY A 1 33  ? 14.036  -10.088 52.900  1.00 105.88 ? 239 GLY A C   1 
ATOM   267  O O   . GLY A 1 33  ? 14.810  -9.804  51.983  1.00 106.17 ? 239 GLY A O   1 
ATOM   268  N N   . LYS A 1 34  ? 12.719  -10.184 52.734  1.00 107.99 ? 240 LYS A N   1 
ATOM   269  C CA  . LYS A 1 34  ? 12.096  -9.944  51.436  1.00 109.80 ? 240 LYS A CA  1 
ATOM   270  C C   . LYS A 1 34  ? 10.664  -9.426  51.593  1.00 111.57 ? 240 LYS A C   1 
ATOM   271  O O   . LYS A 1 34  ? 10.206  -8.604  50.797  1.00 111.98 ? 240 LYS A O   1 
ATOM   272  C CB  . LYS A 1 34  ? 12.092  -11.234 50.599  1.00 108.66 ? 240 LYS A CB  1 
ATOM   273  C CG  . LYS A 1 34  ? 11.010  -12.247 50.983  1.00 107.05 ? 240 LYS A CG  1 
ATOM   274  C CD  . LYS A 1 34  ? 11.200  -12.812 52.382  1.00 104.91 ? 240 LYS A CD  1 
ATOM   275  C CE  . LYS A 1 34  ? 9.923   -13.479 52.868  1.00 103.13 ? 240 LYS A CE  1 
ATOM   276  N NZ  . LYS A 1 34  ? 9.381   -14.438 51.869  1.00 100.09 ? 240 LYS A NZ  1 
ATOM   277  N N   . ALA A 1 35  ? 9.964   -9.909  52.618  1.00 112.92 ? 241 ALA A N   1 
ATOM   278  C CA  . ALA A 1 35  ? 8.584   -9.501  52.875  1.00 114.20 ? 241 ALA A CA  1 
ATOM   279  C C   . ALA A 1 35  ? 8.465   -7.979  52.867  1.00 115.01 ? 241 ALA A C   1 
ATOM   280  O O   . ALA A 1 35  ? 8.828   -7.317  53.844  1.00 115.79 ? 241 ALA A O   1 
ATOM   281  C CB  . ALA A 1 35  ? 8.116   -10.060 54.216  1.00 113.35 ? 241 ALA A CB  1 
ATOM   282  N N   . SER A 1 36  ? 7.953   -7.435  51.763  1.00 115.14 ? 242 SER A N   1 
ATOM   283  C CA  . SER A 1 36  ? 7.798   -5.988  51.609  1.00 115.00 ? 242 SER A CA  1 
ATOM   284  C C   . SER A 1 36  ? 9.191   -5.348  51.631  1.00 114.84 ? 242 SER A C   1 
ATOM   285  O O   . SER A 1 36  ? 9.397   -4.275  52.207  1.00 115.87 ? 242 SER A O   1 
ATOM   286  C CB  . SER A 1 36  ? 6.934   -5.426  52.744  1.00 114.70 ? 242 SER A CB  1 
ATOM   287  O OG  . SER A 1 36  ? 5.669   -6.064  52.775  1.00 113.89 ? 242 SER A OG  1 
ATOM   288  N N   . HIS A 1 37  ? 10.137  -6.029  50.986  1.00 113.12 ? 243 HIS A N   1 
ATOM   289  C CA  . HIS A 1 37  ? 11.533  -5.606  50.910  1.00 110.69 ? 243 HIS A CA  1 
ATOM   290  C C   . HIS A 1 37  ? 11.714  -4.180  50.383  1.00 108.56 ? 243 HIS A C   1 
ATOM   291  O O   . HIS A 1 37  ? 10.745  -3.442  50.193  1.00 107.73 ? 243 HIS A O   1 
ATOM   292  C CB  . HIS A 1 37  ? 12.304  -6.591  50.021  1.00 111.25 ? 243 HIS A CB  1 
ATOM   293  C CG  . HIS A 1 37  ? 13.761  -6.697  50.350  1.00 113.10 ? 243 HIS A CG  1 
ATOM   294  N ND1 . HIS A 1 37  ? 14.621  -7.517  49.651  1.00 113.60 ? 243 HIS A ND1 1 
ATOM   295  C CD2 . HIS A 1 37  ? 14.506  -6.101  51.310  1.00 114.51 ? 243 HIS A CD2 1 
ATOM   296  C CE1 . HIS A 1 37  ? 15.834  -7.421  50.169  1.00 114.32 ? 243 HIS A CE1 1 
ATOM   297  N NE2 . HIS A 1 37  ? 15.792  -6.569  51.177  1.00 114.78 ? 243 HIS A NE2 1 
ATOM   298  N N   . THR A 1 38  ? 12.973  -3.802  50.172  1.00 106.72 ? 244 THR A N   1 
ATOM   299  C CA  . THR A 1 38  ? 13.339  -2.485  49.647  1.00 104.29 ? 244 THR A CA  1 
ATOM   300  C C   . THR A 1 38  ? 14.612  -2.658  48.815  1.00 102.29 ? 244 THR A C   1 
ATOM   301  O O   . THR A 1 38  ? 14.731  -2.121  47.709  1.00 101.82 ? 244 THR A O   1 
ATOM   302  C CB  . THR A 1 38  ? 13.618  -1.454  50.778  1.00 104.21 ? 244 THR A CB  1 
ATOM   303  O OG1 . THR A 1 38  ? 14.709  -1.911  51.588  1.00 102.01 ? 244 THR A OG1 1 
ATOM   304  C CG2 . THR A 1 38  ? 12.375  -1.250  51.646  1.00 102.17 ? 244 THR A CG2 1 
ATOM   305  N N   . ALA A 1 39  ? 15.553  -3.424  49.363  1.00 99.39  ? 245 ALA A N   1 
ATOM   306  C CA  . ALA A 1 39  ? 16.827  -3.710  48.706  1.00 95.56  ? 245 ALA A CA  1 
ATOM   307  C C   . ALA A 1 39  ? 17.539  -2.457  48.199  1.00 92.51  ? 245 ALA A C   1 
ATOM   308  O O   . ALA A 1 39  ? 17.232  -1.952  47.113  1.00 90.92  ? 245 ALA A O   1 
ATOM   309  C CB  . ALA A 1 39  ? 16.611  -4.691  47.555  1.00 95.08  ? 245 ALA A CB  1 
ATOM   310  N N   . PRO A 1 40  ? 18.499  -1.935  48.990  1.00 89.18  ? 246 PRO A N   1 
ATOM   311  C CA  . PRO A 1 40  ? 19.274  -0.739  48.638  1.00 85.64  ? 246 PRO A CA  1 
ATOM   312  C C   . PRO A 1 40  ? 20.355  -1.045  47.598  1.00 82.95  ? 246 PRO A C   1 
ATOM   313  O O   . PRO A 1 40  ? 20.850  -2.171  47.503  1.00 81.19  ? 246 PRO A O   1 
ATOM   314  C CB  . PRO A 1 40  ? 19.871  -0.316  49.976  1.00 84.67  ? 246 PRO A CB  1 
ATOM   315  C CG  . PRO A 1 40  ? 20.130  -1.628  50.628  1.00 85.63  ? 246 PRO A CG  1 
ATOM   316  C CD  . PRO A 1 40  ? 18.843  -2.387  50.352  1.00 87.09  ? 246 PRO A CD  1 
ATOM   317  N N   . PHE A 1 41  ? 20.717  -0.038  46.818  1.00 79.45  ? 247 PHE A N   1 
ATOM   318  C CA  . PHE A 1 41  ? 21.735  -0.215  45.799  1.00 77.25  ? 247 PHE A CA  1 
ATOM   319  C C   . PHE A 1 41  ? 23.086  -0.504  46.468  1.00 72.56  ? 247 PHE A C   1 
ATOM   320  O O   . PHE A 1 41  ? 23.560  0.270   47.302  1.00 72.24  ? 247 PHE A O   1 
ATOM   321  C CB  . PHE A 1 41  ? 21.792  1.044   44.932  1.00 83.49  ? 247 PHE A CB  1 
ATOM   322  C CG  . PHE A 1 41  ? 20.466  1.393   44.276  1.00 90.74  ? 247 PHE A CG  1 
ATOM   323  C CD1 . PHE A 1 41  ? 19.872  0.521   43.355  1.00 91.47  ? 247 PHE A CD1 1 
ATOM   324  C CD2 . PHE A 1 41  ? 19.815  2.597   44.571  1.00 92.61  ? 247 PHE A CD2 1 
ATOM   325  C CE1 . PHE A 1 41  ? 18.653  0.843   42.736  1.00 90.15  ? 247 PHE A CE1 1 
ATOM   326  C CE2 . PHE A 1 41  ? 18.593  2.927   43.956  1.00 91.85  ? 247 PHE A CE2 1 
ATOM   327  C CZ  . PHE A 1 41  ? 18.015  2.047   43.037  1.00 91.23  ? 247 PHE A CZ  1 
ATOM   328  N N   . VAL A 1 42  ? 23.697  -1.626  46.100  1.00 65.03  ? 248 VAL A N   1 
ATOM   329  C CA  . VAL A 1 42  ? 24.974  -2.040  46.680  1.00 59.47  ? 248 VAL A CA  1 
ATOM   330  C C   . VAL A 1 42  ? 26.220  -1.415  46.043  1.00 58.97  ? 248 VAL A C   1 
ATOM   331  O O   . VAL A 1 42  ? 26.297  -1.277  44.824  1.00 61.58  ? 248 VAL A O   1 
ATOM   332  C CB  . VAL A 1 42  ? 25.125  -3.594  46.621  1.00 56.76  ? 248 VAL A CB  1 
ATOM   333  C CG1 . VAL A 1 42  ? 26.532  -4.012  47.031  1.00 52.58  ? 248 VAL A CG1 1 
ATOM   334  C CG2 . VAL A 1 42  ? 24.102  -4.254  47.536  1.00 50.53  ? 248 VAL A CG2 1 
ATOM   335  N N   . ILE A 1 43  ? 27.188  -1.035  46.878  1.00 56.74  ? 249 ILE A N   1 
ATOM   336  C CA  . ILE A 1 43  ? 28.459  -0.470  46.409  1.00 52.82  ? 249 ILE A CA  1 
ATOM   337  C C   . ILE A 1 43  ? 29.545  -1.386  46.962  1.00 51.74  ? 249 ILE A C   1 
ATOM   338  O O   . ILE A 1 43  ? 29.764  -1.416  48.168  1.00 52.90  ? 249 ILE A O   1 
ATOM   339  C CB  . ILE A 1 43  ? 28.703  0.940   46.966  1.00 50.64  ? 249 ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 43  ? 27.488  1.824   46.706  1.00 51.10  ? 249 ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 43  ? 29.940  1.545   46.330  1.00 45.42  ? 249 ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 43  ? 27.517  3.128   47.498  1.00 51.44  ? 249 ILE A CD1 1 
ATOM   343  N N   . HIS A 1 44  ? 30.222  -2.134  46.096  1.00 52.02  ? 250 HIS A N   1 
ATOM   344  C CA  . HIS A 1 44  ? 31.251  -3.068  46.557  1.00 53.13  ? 250 HIS A CA  1 
ATOM   345  C C   . HIS A 1 44  ? 32.576  -2.977  45.809  1.00 52.23  ? 250 HIS A C   1 
ATOM   346  O O   . HIS A 1 44  ? 33.511  -3.721  46.099  1.00 53.11  ? 250 HIS A O   1 
ATOM   347  C CB  . HIS A 1 44  ? 30.721  -4.496  46.459  1.00 51.75  ? 250 HIS A CB  1 
ATOM   348  C CG  . HIS A 1 44  ? 30.399  -4.916  45.061  1.00 52.86  ? 250 HIS A CG  1 
ATOM   349  N ND1 . HIS A 1 44  ? 31.337  -5.468  44.216  1.00 52.03  ? 250 HIS A ND1 1 
ATOM   350  C CD2 . HIS A 1 44  ? 29.260  -4.805  44.340  1.00 53.18  ? 250 HIS A CD2 1 
ATOM   351  C CE1 . HIS A 1 44  ? 30.789  -5.680  43.035  1.00 49.93  ? 250 HIS A CE1 1 
ATOM   352  N NE2 . HIS A 1 44  ? 29.529  -5.286  43.083  1.00 51.08  ? 250 HIS A NE2 1 
ATOM   353  N N   . ASP A 1 45  ? 32.648  -2.070  44.844  1.00 52.50  ? 251 ASP A N   1 
ATOM   354  C CA  . ASP A 1 45  ? 33.858  -1.867  44.055  1.00 53.61  ? 251 ASP A CA  1 
ATOM   355  C C   . ASP A 1 45  ? 33.899  -0.442  43.526  1.00 52.87  ? 251 ASP A C   1 
ATOM   356  O O   . ASP A 1 45  ? 33.034  0.386   43.827  1.00 51.75  ? 251 ASP A O   1 
ATOM   357  C CB  . ASP A 1 45  ? 33.904  -2.824  42.856  1.00 60.19  ? 251 ASP A CB  1 
ATOM   358  C CG  . ASP A 1 45  ? 34.400  -4.205  43.222  1.00 66.35  ? 251 ASP A CG  1 
ATOM   359  O OD1 . ASP A 1 45  ? 35.478  -4.297  43.860  1.00 69.69  ? 251 ASP A OD1 1 
ATOM   360  O OD2 . ASP A 1 45  ? 33.720  -5.196  42.860  1.00 67.99  ? 251 ASP A OD2 1 
ATOM   361  N N   . ILE A 1 46  ? 34.906  -0.175  42.711  1.00 49.22  ? 252 ILE A N   1 
ATOM   362  C CA  . ILE A 1 46  ? 35.066  1.129   42.118  1.00 45.83  ? 252 ILE A CA  1 
ATOM   363  C C   . ILE A 1 46  ? 33.955  1.362   41.104  1.00 50.15  ? 252 ILE A C   1 
ATOM   364  O O   . ILE A 1 46  ? 33.435  2.469   40.988  1.00 53.05  ? 252 ILE A O   1 
ATOM   365  C CB  . ILE A 1 46  ? 36.433  1.223   41.436  1.00 44.90  ? 252 ILE A CB  1 
ATOM   366  C CG1 . ILE A 1 46  ? 37.536  1.170   42.494  1.00 41.88  ? 252 ILE A CG1 1 
ATOM   367  C CG2 . ILE A 1 46  ? 36.527  2.494   40.613  1.00 44.88  ? 252 ILE A CG2 1 
ATOM   368  C CD1 . ILE A 1 46  ? 38.933  1.140   41.920  1.00 37.69  ? 252 ILE A CD1 1 
ATOM   369  N N   . GLU A 1 47  ? 33.576  0.320   40.370  1.00 54.35  ? 253 GLU A N   1 
ATOM   370  C CA  . GLU A 1 47  ? 32.527  0.459   39.366  1.00 55.71  ? 253 GLU A CA  1 
ATOM   371  C C   . GLU A 1 47  ? 31.220  0.880   40.042  1.00 55.17  ? 253 GLU A C   1 
ATOM   372  O O   . GLU A 1 47  ? 30.718  1.978   39.795  1.00 52.76  ? 253 GLU A O   1 
ATOM   373  C CB  . GLU A 1 47  ? 32.348  -0.858  38.592  1.00 59.95  ? 253 GLU A CB  1 
ATOM   374  C CG  . GLU A 1 47  ? 31.611  -0.738  37.232  1.00 67.45  ? 253 GLU A CG  1 
ATOM   375  C CD  . GLU A 1 47  ? 32.478  -0.155  36.097  1.00 72.97  ? 253 GLU A CD  1 
ATOM   376  O OE1 . GLU A 1 47  ? 32.957  0.996   36.218  1.00 75.42  ? 253 GLU A OE1 1 
ATOM   377  O OE2 . GLU A 1 47  ? 32.677  -0.848  35.073  1.00 72.66  ? 253 GLU A OE2 1 
ATOM   378  N N   . THR A 1 48  ? 30.687  0.021   40.908  1.00 55.97  ? 254 THR A N   1 
ATOM   379  C CA  . THR A 1 48  ? 29.442  0.312   41.628  1.00 58.18  ? 254 THR A CA  1 
ATOM   380  C C   . THR A 1 48  ? 29.490  1.645   42.386  1.00 56.92  ? 254 THR A C   1 
ATOM   381  O O   . THR A 1 48  ? 28.464  2.276   42.612  1.00 56.85  ? 254 THR A O   1 
ATOM   382  C CB  . THR A 1 48  ? 29.098  -0.809  42.636  1.00 61.80  ? 254 THR A CB  1 
ATOM   383  O OG1 . THR A 1 48  ? 30.171  -0.960  43.576  1.00 66.19  ? 254 THR A OG1 1 
ATOM   384  C CG2 . THR A 1 48  ? 28.885  -2.130  41.915  1.00 62.38  ? 254 THR A CG2 1 
ATOM   385  N N   . LEU A 1 49  ? 30.686  2.062   42.787  1.00 55.99  ? 255 LEU A N   1 
ATOM   386  C CA  . LEU A 1 49  ? 30.850  3.332   43.487  1.00 54.06  ? 255 LEU A CA  1 
ATOM   387  C C   . LEU A 1 49  ? 30.593  4.421   42.458  1.00 53.98  ? 255 LEU A C   1 
ATOM   388  O O   . LEU A 1 49  ? 29.957  5.433   42.736  1.00 53.89  ? 255 LEU A O   1 
ATOM   389  C CB  . LEU A 1 49  ? 32.275  3.466   44.028  1.00 52.74  ? 255 LEU A CB  1 
ATOM   390  C CG  . LEU A 1 49  ? 32.539  4.494   45.134  1.00 52.58  ? 255 LEU A CG  1 
ATOM   391  C CD1 . LEU A 1 49  ? 33.989  4.384   45.524  1.00 56.31  ? 255 LEU A CD1 1 
ATOM   392  C CD2 . LEU A 1 49  ? 32.212  5.912   44.692  1.00 51.00  ? 255 LEU A CD2 1 
ATOM   393  N N   . TRP A 1 50  ? 31.101  4.208   41.256  1.00 55.50  ? 256 TRP A N   1 
ATOM   394  C CA  . TRP A 1 50  ? 30.905  5.176   40.202  1.00 56.77  ? 256 TRP A CA  1 
ATOM   395  C C   . TRP A 1 50  ? 29.425  5.172   39.808  1.00 56.35  ? 256 TRP A C   1 
ATOM   396  O O   . TRP A 1 50  ? 28.831  6.219   39.521  1.00 54.48  ? 256 TRP A O   1 
ATOM   397  C CB  . TRP A 1 50  ? 31.789  4.818   39.010  1.00 57.34  ? 256 TRP A CB  1 
ATOM   398  C CG  . TRP A 1 50  ? 31.769  5.857   37.935  1.00 59.72  ? 256 TRP A CG  1 
ATOM   399  C CD1 . TRP A 1 50  ? 32.255  7.135   38.006  1.00 57.55  ? 256 TRP A CD1 1 
ATOM   400  C CD2 . TRP A 1 50  ? 31.228  5.702   36.621  1.00 57.91  ? 256 TRP A CD2 1 
ATOM   401  N NE1 . TRP A 1 50  ? 32.045  7.784   36.810  1.00 57.83  ? 256 TRP A NE1 1 
ATOM   402  C CE2 . TRP A 1 50  ? 31.412  6.929   35.947  1.00 56.77  ? 256 TRP A CE2 1 
ATOM   403  C CE3 . TRP A 1 50  ? 30.592  4.648   35.954  1.00 57.15  ? 256 TRP A CE3 1 
ATOM   404  C CZ2 . TRP A 1 50  ? 30.995  7.121   34.632  1.00 55.69  ? 256 TRP A CZ2 1 
ATOM   405  C CZ3 . TRP A 1 50  ? 30.176  4.840   34.647  1.00 54.16  ? 256 TRP A CZ3 1 
ATOM   406  C CH2 . TRP A 1 50  ? 30.376  6.069   34.001  1.00 56.72  ? 256 TRP A CH2 1 
ATOM   407  N N   . GLN A 1 51  ? 28.821  3.991   39.805  1.00 57.17  ? 257 GLN A N   1 
ATOM   408  C CA  . GLN A 1 51  ? 27.418  3.895   39.453  1.00 58.01  ? 257 GLN A CA  1 
ATOM   409  C C   . GLN A 1 51  ? 26.589  4.556   40.531  1.00 59.24  ? 257 GLN A C   1 
ATOM   410  O O   . GLN A 1 51  ? 25.544  5.143   40.247  1.00 59.57  ? 257 GLN A O   1 
ATOM   411  C CB  . GLN A 1 51  ? 27.011  2.440   39.291  1.00 59.22  ? 257 GLN A CB  1 
ATOM   412  C CG  . GLN A 1 51  ? 27.486  1.832   37.991  1.00 62.03  ? 257 GLN A CG  1 
ATOM   413  C CD  . GLN A 1 51  ? 27.312  0.336   37.970  1.00 64.52  ? 257 GLN A CD  1 
ATOM   414  O OE1 . GLN A 1 51  ? 26.260  -0.181  38.360  1.00 61.83  ? 257 GLN A OE1 1 
ATOM   415  N NE2 . GLN A 1 51  ? 28.340  -0.377  37.509  1.00 67.82  ? 257 GLN A NE2 1 
ATOM   416  N N   . ALA A 1 52  ? 27.068  4.467   41.771  1.00 58.23  ? 258 ALA A N   1 
ATOM   417  C CA  . ALA A 1 52  ? 26.374  5.073   42.897  1.00 55.06  ? 258 ALA A CA  1 
ATOM   418  C C   . ALA A 1 52  ? 26.407  6.580   42.711  1.00 54.94  ? 258 ALA A C   1 
ATOM   419  O O   . ALA A 1 52  ? 25.375  7.227   42.610  1.00 52.86  ? 258 ALA A O   1 
ATOM   420  C CB  . ALA A 1 52  ? 27.057  4.683   44.211  1.00 54.27  ? 258 ALA A CB  1 
ATOM   421  N N   . GLU A 1 53  ? 27.609  7.132   42.659  1.00 57.79  ? 259 GLU A N   1 
ATOM   422  C CA  . GLU A 1 53  ? 27.787  8.560   42.489  1.00 64.29  ? 259 GLU A CA  1 
ATOM   423  C C   . GLU A 1 53  ? 26.860  9.127   41.425  1.00 68.00  ? 259 GLU A C   1 
ATOM   424  O O   . GLU A 1 53  ? 26.355  10.243  41.568  1.00 69.55  ? 259 GLU A O   1 
ATOM   425  C CB  . GLU A 1 53  ? 29.235  8.865   42.110  1.00 65.82  ? 259 GLU A CB  1 
ATOM   426  C CG  . GLU A 1 53  ? 30.258  8.470   43.161  1.00 65.80  ? 259 GLU A CG  1 
ATOM   427  C CD  . GLU A 1 53  ? 30.088  9.235   44.457  1.00 66.65  ? 259 GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 53  ? 29.931  10.474  44.400  1.00 67.18  ? 259 GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 53  ? 30.124  8.599   45.530  1.00 63.70  ? 259 GLU A OE2 1 
ATOM   430  N N   . LYS A 1 54  ? 26.634  8.370   40.355  1.00 72.65  ? 260 LYS A N   1 
ATOM   431  C CA  . LYS A 1 54  ? 25.765  8.850   39.286  1.00 77.14  ? 260 LYS A CA  1 
ATOM   432  C C   . LYS A 1 54  ? 24.298  8.523   39.516  1.00 80.17  ? 260 LYS A C   1 
ATOM   433  O O   . LYS A 1 54  ? 23.427  9.326   39.194  1.00 80.98  ? 260 LYS A O   1 
ATOM   434  C CB  . LYS A 1 54  ? 26.212  8.293   37.938  1.00 75.85  ? 260 LYS A CB  1 
ATOM   435  C CG  . LYS A 1 54  ? 27.580  8.798   37.493  1.00 74.76  ? 260 LYS A CG  1 
ATOM   436  C CD  . LYS A 1 54  ? 27.837  8.454   36.040  1.00 72.51  ? 260 LYS A CD  1 
ATOM   437  C CE  . LYS A 1 54  ? 27.732  6.967   35.813  1.00 70.39  ? 260 LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 54  ? 27.670  6.656   34.362  1.00 72.95  ? 260 LYS A NZ  1 
ATOM   439  N N   . GLY A 1 55  ? 24.030  7.349   40.079  1.00 83.30  ? 261 GLY A N   1 
ATOM   440  C CA  . GLY A 1 55  ? 22.659  6.947   40.343  1.00 85.22  ? 261 GLY A CA  1 
ATOM   441  C C   . GLY A 1 55  ? 22.169  7.375   41.715  1.00 87.26  ? 261 GLY A C   1 
ATOM   442  O O   . GLY A 1 55  ? 21.463  8.378   41.842  1.00 86.03  ? 261 GLY A O   1 
ATOM   443  N N   . LEU A 1 56  ? 22.544  6.606   42.737  1.00 89.90  ? 262 LEU A N   1 
ATOM   444  C CA  . LEU A 1 56  ? 22.166  6.879   44.123  1.00 91.57  ? 262 LEU A CA  1 
ATOM   445  C C   . LEU A 1 56  ? 22.524  8.312   44.472  1.00 92.89  ? 262 LEU A C   1 
ATOM   446  O O   . LEU A 1 56  ? 21.849  8.958   45.272  1.00 92.06  ? 262 LEU A O   1 
ATOM   447  C CB  . LEU A 1 56  ? 22.907  5.933   45.068  1.00 91.88  ? 262 LEU A CB  1 
ATOM   448  C CG  . LEU A 1 56  ? 22.642  4.428   44.954  1.00 93.18  ? 262 LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 56  ? 22.951  3.925   43.554  1.00 95.35  ? 262 LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 56  ? 23.500  3.703   45.969  1.00 94.58  ? 262 LEU A CD2 1 
ATOM   451  N N   . VAL A 1 57  ? 23.604  8.782   43.852  1.00 95.74  ? 263 VAL A N   1 
ATOM   452  C CA  . VAL A 1 57  ? 24.140  10.130  44.019  1.00 97.37  ? 263 VAL A CA  1 
ATOM   453  C C   . VAL A 1 57  ? 24.177  10.653  45.452  1.00 99.35  ? 263 VAL A C   1 
ATOM   454  O O   . VAL A 1 57  ? 23.725  9.993   46.393  1.00 100.44 ? 263 VAL A O   1 
ATOM   455  C CB  . VAL A 1 57  ? 23.373  11.156  43.139  1.00 96.37  ? 263 VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 57  ? 23.406  10.717  41.689  1.00 94.54  ? 263 VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 57  ? 21.938  11.305  43.624  1.00 96.38  ? 263 VAL A CG2 1 
ATOM   458  N N   . TRP A 1 58  ? 24.738  11.848  45.597  1.00 100.10 ? 264 TRP A N   1 
ATOM   459  C CA  . TRP A 1 58  ? 24.866  12.514  46.886  1.00 101.10 ? 264 TRP A CA  1 
ATOM   460  C C   . TRP A 1 58  ? 24.755  14.020  46.657  1.00 102.92 ? 264 TRP A C   1 
ATOM   461  O O   . TRP A 1 58  ? 23.795  14.653  47.108  1.00 102.97 ? 264 TRP A O   1 
ATOM   462  C CB  . TRP A 1 58  ? 26.210  12.153  47.519  1.00 98.79  ? 264 TRP A CB  1 
ATOM   463  C CG  . TRP A 1 58  ? 26.174  10.870  48.309  1.00 97.21  ? 264 TRP A CG  1 
ATOM   464  C CD1 . TRP A 1 58  ? 25.727  10.710  49.589  1.00 97.57  ? 264 TRP A CD1 1 
ATOM   465  C CD2 . TRP A 1 58  ? 26.614  9.575   47.878  1.00 96.45  ? 264 TRP A CD2 1 
ATOM   466  N NE1 . TRP A 1 58  ? 25.866  9.402   49.986  1.00 95.65  ? 264 TRP A NE1 1 
ATOM   467  C CE2 . TRP A 1 58  ? 26.409  8.680   48.953  1.00 94.69  ? 264 TRP A CE2 1 
ATOM   468  C CE3 . TRP A 1 58  ? 27.163  9.080   46.687  1.00 95.45  ? 264 TRP A CE3 1 
ATOM   469  C CZ2 . TRP A 1 58  ? 26.734  7.323   48.878  1.00 91.42  ? 264 TRP A CZ2 1 
ATOM   470  C CZ3 . TRP A 1 58  ? 27.486  7.726   46.612  1.00 93.63  ? 264 TRP A CZ3 1 
ATOM   471  C CH2 . TRP A 1 58  ? 27.270  6.866   47.704  1.00 91.25  ? 264 TRP A CH2 1 
ATOM   472  N N   . LYS A 1 59  ? 25.739  14.579  45.951  1.00 104.38 ? 265 LYS A N   1 
ATOM   473  C CA  . LYS A 1 59  ? 25.753  16.002  45.614  1.00 104.63 ? 265 LYS A CA  1 
ATOM   474  C C   . LYS A 1 59  ? 27.108  16.496  45.092  1.00 105.22 ? 265 LYS A C   1 
ATOM   475  O O   . LYS A 1 59  ? 27.602  16.034  44.056  1.00 105.64 ? 265 LYS A O   1 
ATOM   476  C CB  . LYS A 1 59  ? 25.337  16.852  46.819  1.00 103.78 ? 265 LYS A CB  1 
ATOM   477  C CG  . LYS A 1 59  ? 24.711  18.193  46.438  1.00 103.35 ? 265 LYS A CG  1 
ATOM   478  C CD  . LYS A 1 59  ? 23.198  18.097  46.220  1.00 102.47 ? 265 LYS A CD  1 
ATOM   479  C CE  . LYS A 1 59  ? 22.801  16.984  45.255  1.00 101.48 ? 265 LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 59  ? 23.485  17.102  43.937  1.00 102.01 ? 265 LYS A NZ  1 
ATOM   481  N N   . GLN A 1 60  ? 27.694  17.439  45.826  1.00 104.81 ? 266 GLN A N   1 
ATOM   482  C CA  . GLN A 1 60  ? 28.977  18.045  45.476  1.00 103.77 ? 266 GLN A CA  1 
ATOM   483  C C   . GLN A 1 60  ? 30.115  17.054  45.237  1.00 103.95 ? 266 GLN A C   1 
ATOM   484  O O   . GLN A 1 60  ? 30.417  16.692  44.091  1.00 102.24 ? 266 GLN A O   1 
ATOM   485  C CB  . GLN A 1 60  ? 29.384  19.051  46.571  1.00 101.31 ? 266 GLN A CB  1 
ATOM   486  C CG  . GLN A 1 60  ? 30.788  19.646  46.422  1.00 98.23  ? 266 GLN A CG  1 
ATOM   487  C CD  . GLN A 1 60  ? 31.805  19.021  47.370  1.00 96.30  ? 266 GLN A CD  1 
ATOM   488  O OE1 . GLN A 1 60  ? 33.011  19.236  47.241  1.00 94.28  ? 266 GLN A OE1 1 
ATOM   489  N NE2 . GLN A 1 60  ? 31.319  18.251  48.333  1.00 95.95  ? 266 GLN A NE2 1 
ATOM   490  N N   . LEU A 1 61  ? 30.732  16.625  46.335  1.00 104.48 ? 267 LEU A N   1 
ATOM   491  C CA  . LEU A 1 61  ? 31.867  15.710  46.322  1.00 104.26 ? 267 LEU A CA  1 
ATOM   492  C C   . LEU A 1 61  ? 31.809  14.544  45.338  1.00 104.86 ? 267 LEU A C   1 
ATOM   493  O O   . LEU A 1 61  ? 31.309  13.463  45.655  1.00 105.95 ? 267 LEU A O   1 
ATOM   494  C CB  . LEU A 1 61  ? 32.125  15.177  47.737  1.00 101.50 ? 267 LEU A CB  1 
ATOM   495  C CG  . LEU A 1 61  ? 31.056  14.328  48.424  1.00 100.03 ? 267 LEU A CG  1 
ATOM   496  C CD1 . LEU A 1 61  ? 31.568  13.950  49.794  1.00 101.00 ? 267 LEU A CD1 1 
ATOM   497  C CD2 . LEU A 1 61  ? 29.737  15.081  48.540  1.00 99.10  ? 267 LEU A CD2 1 
ATOM   498  N N   . VAL A 1 62  ? 32.330  14.782  44.137  1.00 103.80 ? 268 VAL A N   1 
ATOM   499  C CA  . VAL A 1 62  ? 32.399  13.768  43.093  1.00 101.89 ? 268 VAL A CA  1 
ATOM   500  C C   . VAL A 1 62  ? 33.764  13.980  42.443  1.00 100.70 ? 268 VAL A C   1 
ATOM   501  O O   . VAL A 1 62  ? 34.022  13.539  41.322  1.00 100.79 ? 268 VAL A O   1 
ATOM   502  C CB  . VAL A 1 62  ? 31.278  13.944  42.045  1.00 102.58 ? 268 VAL A CB  1 
ATOM   503  C CG1 . VAL A 1 62  ? 31.262  12.747  41.097  1.00 101.71 ? 268 VAL A CG1 1 
ATOM   504  C CG2 . VAL A 1 62  ? 29.928  14.088  42.745  1.00 102.42 ? 268 VAL A CG2 1 
ATOM   505  N N   . ASN A 1 63  ? 34.628  14.670  43.189  1.00 99.35  ? 269 ASN A N   1 
ATOM   506  C CA  . ASN A 1 63  ? 35.993  14.994  42.778  1.00 97.11  ? 269 ASN A CA  1 
ATOM   507  C C   . ASN A 1 63  ? 36.675  13.767  42.176  1.00 96.87  ? 269 ASN A C   1 
ATOM   508  O O   . ASN A 1 63  ? 36.380  12.625  42.549  1.00 95.46  ? 269 ASN A O   1 
ATOM   509  C CB  . ASN A 1 63  ? 36.781  15.518  43.995  1.00 93.99  ? 269 ASN A CB  1 
ATOM   510  C CG  . ASN A 1 63  ? 38.185  15.989  43.648  1.00 90.15  ? 269 ASN A CG  1 
ATOM   511  O OD1 . ASN A 1 63  ? 39.050  15.199  43.271  1.00 88.12  ? 269 ASN A OD1 1 
ATOM   512  N ND2 . ASN A 1 63  ? 38.419  17.287  43.789  1.00 88.71  ? 269 ASN A ND2 1 
ATOM   513  N N   . GLY A 1 64  ? 37.579  14.018  41.234  1.00 97.06  ? 270 GLY A N   1 
ATOM   514  C CA  . GLY A 1 64  ? 38.296  12.943  40.575  1.00 95.90  ? 270 GLY A CA  1 
ATOM   515  C C   . GLY A 1 64  ? 38.979  12.015  41.551  1.00 93.80  ? 270 GLY A C   1 
ATOM   516  O O   . GLY A 1 64  ? 38.600  11.938  42.711  1.00 92.86  ? 270 GLY A O   1 
ATOM   517  N N   . LEU A 1 65  ? 39.983  11.293  41.080  1.00 94.60  ? 271 LEU A N   1 
ATOM   518  C CA  . LEU A 1 65  ? 40.694  10.374  41.948  1.00 95.26  ? 271 LEU A CA  1 
ATOM   519  C C   . LEU A 1 65  ? 42.225  10.517  41.847  1.00 97.13  ? 271 LEU A C   1 
ATOM   520  O O   . LEU A 1 65  ? 42.911  10.679  42.861  1.00 95.27  ? 271 LEU A O   1 
ATOM   521  C CB  . LEU A 1 65  ? 40.217  8.942   41.671  1.00 91.66  ? 271 LEU A CB  1 
ATOM   522  C CG  . LEU A 1 65  ? 38.893  8.559   42.363  1.00 88.57  ? 271 LEU A CG  1 
ATOM   523  C CD1 . LEU A 1 65  ? 37.753  9.432   41.888  1.00 84.32  ? 271 LEU A CD1 1 
ATOM   524  C CD2 . LEU A 1 65  ? 38.575  7.103   42.091  1.00 88.15  ? 271 LEU A CD2 1 
ATOM   525  N N   . PRO A 1 66  ? 42.785  10.464  40.636  1.00 99.01  ? 272 PRO A N   1 
ATOM   526  C CA  . PRO A 1 66  ? 44.246  10.620  40.617  1.00 100.25 ? 272 PRO A CA  1 
ATOM   527  C C   . PRO A 1 66  ? 44.736  11.991  41.135  1.00 100.31 ? 272 PRO A C   1 
ATOM   528  O O   . PRO A 1 66  ? 45.758  12.072  41.823  1.00 100.42 ? 272 PRO A O   1 
ATOM   529  C CB  . PRO A 1 66  ? 44.595  10.387  39.151  1.00 99.36  ? 272 PRO A CB  1 
ATOM   530  C CG  . PRO A 1 66  ? 43.595  9.359   38.746  1.00 98.95  ? 272 PRO A CG  1 
ATOM   531  C CD  . PRO A 1 66  ? 42.312  9.885   39.365  1.00 98.74  ? 272 PRO A CD  1 
ATOM   532  N N   . PRO A 1 67  ? 44.005  13.076  40.828  1.00 100.08 ? 273 PRO A N   1 
ATOM   533  C CA  . PRO A 1 67  ? 44.389  14.428  41.250  1.00 99.38  ? 273 PRO A CA  1 
ATOM   534  C C   . PRO A 1 67  ? 43.955  14.934  42.632  1.00 98.46  ? 273 PRO A C   1 
ATOM   535  O O   . PRO A 1 67  ? 42.759  14.982  42.947  1.00 99.19  ? 273 PRO A O   1 
ATOM   536  C CB  . PRO A 1 67  ? 43.827  15.296  40.139  1.00 100.38 ? 273 PRO A CB  1 
ATOM   537  C CG  . PRO A 1 67  ? 42.518  14.613  39.852  1.00 100.63 ? 273 PRO A CG  1 
ATOM   538  C CD  . PRO A 1 67  ? 42.872  13.135  39.874  1.00 99.97  ? 273 PRO A CD  1 
ATOM   539  N N   . TYR A 1 68  ? 44.946  15.332  43.427  1.00 96.47  ? 274 TYR A N   1 
ATOM   540  C CA  . TYR A 1 68  ? 44.753  15.887  44.774  1.00 93.53  ? 274 TYR A CA  1 
ATOM   541  C C   . TYR A 1 68  ? 43.639  15.227  45.590  1.00 89.64  ? 274 TYR A C   1 
ATOM   542  O O   . TYR A 1 68  ? 43.264  15.719  46.654  1.00 90.04  ? 274 TYR A O   1 
ATOM   543  C CB  . TYR A 1 68  ? 44.454  17.390  44.684  1.00 96.38  ? 274 TYR A CB  1 
ATOM   544  C CG  . TYR A 1 68  ? 45.281  18.165  43.671  1.00 98.51  ? 274 TYR A CG  1 
ATOM   545  C CD1 . TYR A 1 68  ? 45.174  17.905  42.302  1.00 99.19  ? 274 TYR A CD1 1 
ATOM   546  C CD2 . TYR A 1 68  ? 46.138  19.186  44.081  1.00 98.16  ? 274 TYR A CD2 1 
ATOM   547  C CE1 . TYR A 1 68  ? 45.897  18.645  41.369  1.00 100.04 ? 274 TYR A CE1 1 
ATOM   548  C CE2 . TYR A 1 68  ? 46.864  19.931  43.158  1.00 98.82  ? 274 TYR A CE2 1 
ATOM   549  C CZ  . TYR A 1 68  ? 46.740  19.656  41.805  1.00 100.12 ? 274 TYR A CZ  1 
ATOM   550  O OH  . TYR A 1 68  ? 47.457  20.393  40.886  1.00 101.52 ? 274 TYR A OH  1 
ATOM   551  N N   . LYS A 1 69  ? 43.121  14.114  45.089  1.00 83.87  ? 275 LYS A N   1 
ATOM   552  C CA  . LYS A 1 69  ? 42.040  13.391  45.736  1.00 76.45  ? 275 LYS A CA  1 
ATOM   553  C C   . LYS A 1 69  ? 41.838  12.152  44.876  1.00 72.48  ? 275 LYS A C   1 
ATOM   554  O O   . LYS A 1 69  ? 41.664  12.276  43.669  1.00 67.73  ? 275 LYS A O   1 
ATOM   555  C CB  . LYS A 1 69  ? 40.780  14.270  45.748  1.00 76.71  ? 275 LYS A CB  1 
ATOM   556  C CG  . LYS A 1 69  ? 39.520  13.641  46.343  1.00 72.27  ? 275 LYS A CG  1 
ATOM   557  C CD  . LYS A 1 69  ? 38.887  12.672  45.375  1.00 68.95  ? 275 LYS A CD  1 
ATOM   558  C CE  . LYS A 1 69  ? 37.502  12.255  45.805  1.00 67.41  ? 275 LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 69  ? 36.485  13.336  45.757  1.00 66.77  ? 275 LYS A NZ  1 
ATOM   560  N N   . GLU A 1 70  ? 41.883  10.977  45.514  1.00 69.35  ? 276 GLU A N   1 
ATOM   561  C CA  . GLU A 1 70  ? 41.732  9.663   44.872  1.00 63.04  ? 276 GLU A CA  1 
ATOM   562  C C   . GLU A 1 70  ? 40.477  8.924   45.343  1.00 62.17  ? 276 GLU A C   1 
ATOM   563  O O   . GLU A 1 70  ? 39.579  9.520   45.939  1.00 63.13  ? 276 GLU A O   1 
ATOM   564  C CB  . GLU A 1 70  ? 42.966  8.806   45.169  1.00 58.21  ? 276 GLU A CB  1 
ATOM   565  C CG  . GLU A 1 70  ? 43.367  8.860   46.640  1.00 50.83  ? 276 GLU A CG  1 
ATOM   566  C CD  . GLU A 1 70  ? 44.535  7.964   46.989  1.00 49.94  ? 276 GLU A CD  1 
ATOM   567  O OE1 . GLU A 1 70  ? 44.380  6.728   46.939  1.00 53.22  ? 276 GLU A OE1 1 
ATOM   568  O OE2 . GLU A 1 70  ? 45.611  8.493   47.328  1.00 48.42  ? 276 GLU A OE2 1 
ATOM   569  N N   . ILE A 1 71  ? 40.430  7.622   45.073  1.00 59.38  ? 277 ILE A N   1 
ATOM   570  C CA  . ILE A 1 71  ? 39.302  6.772   45.453  1.00 58.72  ? 277 ILE A CA  1 
ATOM   571  C C   . ILE A 1 71  ? 39.109  6.699   46.981  1.00 58.28  ? 277 ILE A C   1 
ATOM   572  O O   . ILE A 1 71  ? 38.070  7.119   47.499  1.00 56.54  ? 277 ILE A O   1 
ATOM   573  C CB  . ILE A 1 71  ? 39.493  5.334   44.854  1.00 62.74  ? 277 ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 71  ? 38.473  4.353   45.438  1.00 60.85  ? 277 ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 71  ? 40.921  4.843   45.115  1.00 67.96  ? 277 ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 71  ? 37.070  4.587   44.963  1.00 60.63  ? 277 ILE A CD1 1 
ATOM   577  N N   . SER A 1 72  ? 40.106  6.168   47.692  1.00 54.50  ? 278 SER A N   1 
ATOM   578  C CA  . SER A 1 72  ? 40.045  6.046   49.150  1.00 50.66  ? 278 SER A CA  1 
ATOM   579  C C   . SER A 1 72  ? 39.710  7.395   49.792  1.00 48.37  ? 278 SER A C   1 
ATOM   580  O O   . SER A 1 72  ? 38.894  7.478   50.713  1.00 48.55  ? 278 SER A O   1 
ATOM   581  C CB  . SER A 1 72  ? 41.381  5.536   49.693  1.00 50.34  ? 278 SER A CB  1 
ATOM   582  O OG  . SER A 1 72  ? 41.640  4.212   49.267  1.00 49.70  ? 278 SER A OG  1 
ATOM   583  N N   . VAL A 1 73  ? 40.354  8.443   49.292  1.00 43.71  ? 279 VAL A N   1 
ATOM   584  C CA  . VAL A 1 73  ? 40.142  9.804   49.767  1.00 40.38  ? 279 VAL A CA  1 
ATOM   585  C C   . VAL A 1 73  ? 38.722  10.291  49.462  1.00 38.08  ? 279 VAL A C   1 
ATOM   586  O O   . VAL A 1 73  ? 38.179  11.123  50.193  1.00 35.97  ? 279 VAL A O   1 
ATOM   587  C CB  . VAL A 1 73  ? 41.163  10.762  49.118  1.00 39.91  ? 279 VAL A CB  1 
ATOM   588  C CG1 . VAL A 1 73  ? 40.851  12.215  49.494  1.00 34.11  ? 279 VAL A CG1 1 
ATOM   589  C CG2 . VAL A 1 73  ? 42.574  10.358  49.541  1.00 34.56  ? 279 VAL A CG2 1 
ATOM   590  N N   . HIS A 1 74  ? 38.142  9.783   48.373  1.00 34.85  ? 280 HIS A N   1 
ATOM   591  C CA  . HIS A 1 74  ? 36.775  10.132  47.980  1.00 35.13  ? 280 HIS A CA  1 
ATOM   592  C C   . HIS A 1 74  ? 35.811  9.546   48.999  1.00 36.61  ? 280 HIS A C   1 
ATOM   593  O O   . HIS A 1 74  ? 34.768  10.128  49.284  1.00 37.21  ? 280 HIS A O   1 
ATOM   594  C CB  . HIS A 1 74  ? 36.412  9.553   46.608  1.00 35.91  ? 280 HIS A CB  1 
ATOM   595  C CG  . HIS A 1 74  ? 34.972  9.742   46.247  1.00 36.93  ? 280 HIS A CG  1 
ATOM   596  N ND1 . HIS A 1 74  ? 34.430  10.981  45.978  1.00 42.45  ? 280 HIS A ND1 1 
ATOM   597  C CD2 . HIS A 1 74  ? 33.939  8.867   46.211  1.00 37.67  ? 280 HIS A CD2 1 
ATOM   598  C CE1 . HIS A 1 74  ? 33.125  10.863  45.800  1.00 40.16  ? 280 HIS A CE1 1 
ATOM   599  N NE2 . HIS A 1 74  ? 32.802  9.590   45.936  1.00 40.79  ? 280 HIS A NE2 1 
ATOM   600  N N   . VAL A 1 75  ? 36.156  8.368   49.513  1.00 34.80  ? 281 VAL A N   1 
ATOM   601  C CA  . VAL A 1 75  ? 35.324  7.719   50.509  1.00 37.99  ? 281 VAL A CA  1 
ATOM   602  C C   . VAL A 1 75  ? 35.500  8.510   51.805  1.00 39.58  ? 281 VAL A C   1 
ATOM   603  O O   . VAL A 1 75  ? 34.531  8.805   52.514  1.00 36.55  ? 281 VAL A O   1 
ATOM   604  C CB  . VAL A 1 75  ? 35.723  6.228   50.688  1.00 36.47  ? 281 VAL A CB  1 
ATOM   605  C CG1 . VAL A 1 75  ? 34.969  5.611   51.881  1.00 33.95  ? 281 VAL A CG1 1 
ATOM   606  C CG2 . VAL A 1 75  ? 35.367  5.459   49.430  1.00 32.02  ? 281 VAL A CG2 1 
ATOM   607  N N   . PHE A 1 76  ? 36.745  8.868   52.093  1.00 38.67  ? 282 PHE A N   1 
ATOM   608  C CA  . PHE A 1 76  ? 37.044  9.665   53.269  1.00 40.13  ? 282 PHE A CA  1 
ATOM   609  C C   . PHE A 1 76  ? 36.236  10.968  53.211  1.00 40.66  ? 282 PHE A C   1 
ATOM   610  O O   . PHE A 1 76  ? 35.686  11.407  54.226  1.00 41.00  ? 282 PHE A O   1 
ATOM   611  C CB  . PHE A 1 76  ? 38.539  9.996   53.321  1.00 39.93  ? 282 PHE A CB  1 
ATOM   612  C CG  . PHE A 1 76  ? 38.962  10.663  54.601  1.00 39.99  ? 282 PHE A CG  1 
ATOM   613  C CD1 . PHE A 1 76  ? 38.862  9.990   55.811  1.00 38.16  ? 282 PHE A CD1 1 
ATOM   614  C CD2 . PHE A 1 76  ? 39.477  11.956  54.594  1.00 39.81  ? 282 PHE A CD2 1 
ATOM   615  C CE1 . PHE A 1 76  ? 39.264  10.590  56.987  1.00 39.24  ? 282 PHE A CE1 1 
ATOM   616  C CE2 . PHE A 1 76  ? 39.881  12.563  55.770  1.00 35.50  ? 282 PHE A CE2 1 
ATOM   617  C CZ  . PHE A 1 76  ? 39.778  11.880  56.967  1.00 37.10  ? 282 PHE A CZ  1 
ATOM   618  N N   . TYR A 1 77  ? 36.177  11.580  52.025  1.00 39.44  ? 283 TYR A N   1 
ATOM   619  C CA  . TYR A 1 77  ? 35.443  12.827  51.839  1.00 39.63  ? 283 TYR A CA  1 
ATOM   620  C C   . TYR A 1 77  ? 33.963  12.648  52.095  1.00 37.41  ? 283 TYR A C   1 
ATOM   621  O O   . TYR A 1 77  ? 33.308  13.509  52.667  1.00 35.16  ? 283 TYR A O   1 
ATOM   622  C CB  . TYR A 1 77  ? 35.644  13.369  50.420  1.00 44.62  ? 283 TYR A CB  1 
ATOM   623  C CG  . TYR A 1 77  ? 36.903  14.181  50.237  1.00 47.14  ? 283 TYR A CG  1 
ATOM   624  C CD1 . TYR A 1 77  ? 37.894  14.184  51.204  1.00 48.66  ? 283 TYR A CD1 1 
ATOM   625  C CD2 . TYR A 1 77  ? 37.114  14.914  49.078  1.00 49.33  ? 283 TYR A CD2 1 
ATOM   626  C CE1 . TYR A 1 77  ? 39.074  14.900  51.027  1.00 53.49  ? 283 TYR A CE1 1 
ATOM   627  C CE2 . TYR A 1 77  ? 38.300  15.639  48.885  1.00 52.96  ? 283 TYR A CE2 1 
ATOM   628  C CZ  . TYR A 1 77  ? 39.273  15.621  49.868  1.00 54.23  ? 283 TYR A CZ  1 
ATOM   629  O OH  . TYR A 1 77  ? 40.451  16.310  49.700  1.00 54.58  ? 283 TYR A OH  1 
ATOM   630  N N   . ARG A 1 78  ? 33.426  11.529  51.643  1.00 38.75  ? 284 ARG A N   1 
ATOM   631  C CA  . ARG A 1 78  ? 32.018  11.267  51.843  1.00 41.65  ? 284 ARG A CA  1 
ATOM   632  C C   . ARG A 1 78  ? 31.819  10.931  53.308  1.00 42.05  ? 284 ARG A C   1 
ATOM   633  O O   . ARG A 1 78  ? 30.782  11.230  53.887  1.00 41.43  ? 284 ARG A O   1 
ATOM   634  C CB  . ARG A 1 78  ? 31.566  10.131  50.920  1.00 46.02  ? 284 ARG A CB  1 
ATOM   635  C CG  . ARG A 1 78  ? 31.126  10.633  49.551  1.00 46.30  ? 284 ARG A CG  1 
ATOM   636  C CD  . ARG A 1 78  ? 29.718  11.204  49.640  1.00 50.89  ? 284 ARG A CD  1 
ATOM   637  N NE  . ARG A 1 78  ? 29.343  12.007  48.481  1.00 52.46  ? 284 ARG A NE  1 
ATOM   638  C CZ  . ARG A 1 78  ? 29.465  11.609  47.224  1.00 57.35  ? 284 ARG A CZ  1 
ATOM   639  N NH1 . ARG A 1 78  ? 29.959  10.412  46.958  1.00 59.68  ? 284 ARG A NH1 1 
ATOM   640  N NH2 . ARG A 1 78  ? 29.089  12.407  46.234  1.00 60.11  ? 284 ARG A NH2 1 
ATOM   641  N N   . CYS A 1 79  ? 32.837  10.324  53.907  1.00 43.04  ? 285 CYS A N   1 
ATOM   642  C CA  . CYS A 1 79  ? 32.801  9.983   55.325  1.00 43.72  ? 285 CYS A CA  1 
ATOM   643  C C   . CYS A 1 79  ? 32.674  11.235  56.182  1.00 41.97  ? 285 CYS A C   1 
ATOM   644  O O   . CYS A 1 79  ? 31.779  11.317  57.010  1.00 39.60  ? 285 CYS A O   1 
ATOM   645  C CB  . CYS A 1 79  ? 34.055  9.207   55.735  1.00 44.80  ? 285 CYS A CB  1 
ATOM   646  S SG  . CYS A 1 79  ? 33.908  7.415   55.534  1.00 50.20  ? 285 CYS A SG  1 
ATOM   647  N N   . GLN A 1 80  ? 33.549  12.217  55.979  1.00 42.78  ? 286 GLN A N   1 
ATOM   648  C CA  . GLN A 1 80  ? 33.452  13.423  56.782  1.00 42.82  ? 286 GLN A CA  1 
ATOM   649  C C   . GLN A 1 80  ? 32.264  14.290  56.426  1.00 42.01  ? 286 GLN A C   1 
ATOM   650  O O   . GLN A 1 80  ? 31.833  15.099  57.244  1.00 42.37  ? 286 GLN A O   1 
ATOM   651  C CB  . GLN A 1 80  ? 34.748  14.235  56.755  1.00 44.19  ? 286 GLN A CB  1 
ATOM   652  C CG  . GLN A 1 80  ? 35.160  14.851  55.460  1.00 43.64  ? 286 GLN A CG  1 
ATOM   653  C CD  . GLN A 1 80  ? 36.498  15.570  55.590  1.00 44.32  ? 286 GLN A CD  1 
ATOM   654  O OE1 . GLN A 1 80  ? 36.639  16.512  56.374  1.00 43.10  ? 286 GLN A OE1 1 
ATOM   655  N NE2 . GLN A 1 80  ? 37.486  15.121  54.826  1.00 43.89  ? 286 GLN A NE2 1 
ATOM   656  N N   . CYS A 1 81  ? 31.711  14.117  55.230  1.00 40.14  ? 287 CYS A N   1 
ATOM   657  C CA  . CYS A 1 81  ? 30.521  14.882  54.868  1.00 44.09  ? 287 CYS A CA  1 
ATOM   658  C C   . CYS A 1 81  ? 29.330  14.336  55.671  1.00 43.75  ? 287 CYS A C   1 
ATOM   659  O O   . CYS A 1 81  ? 28.508  15.092  56.170  1.00 44.81  ? 287 CYS A O   1 
ATOM   660  C CB  . CYS A 1 81  ? 30.223  14.776  53.371  1.00 50.19  ? 287 CYS A CB  1 
ATOM   661  S SG  . CYS A 1 81  ? 30.576  16.285  52.465  1.00 55.46  ? 287 CYS A SG  1 
ATOM   662  N N   . THR A 1 82  ? 29.235  13.019  55.796  1.00 43.12  ? 288 THR A N   1 
ATOM   663  C CA  . THR A 1 82  ? 28.148  12.429  56.571  1.00 43.74  ? 288 THR A CA  1 
ATOM   664  C C   . THR A 1 82  ? 28.352  12.783  58.048  1.00 43.65  ? 288 THR A C   1 
ATOM   665  O O   . THR A 1 82  ? 27.391  12.931  58.799  1.00 45.33  ? 288 THR A O   1 
ATOM   666  C CB  . THR A 1 82  ? 28.097  10.891  56.429  1.00 43.12  ? 288 THR A CB  1 
ATOM   667  O OG1 . THR A 1 82  ? 28.016  10.532  55.047  1.00 39.89  ? 288 THR A OG1 1 
ATOM   668  C CG2 . THR A 1 82  ? 26.875  10.344  57.132  1.00 40.68  ? 288 THR A CG2 1 
ATOM   669  N N   . THR A 1 83  ? 29.611  12.938  58.452  1.00 42.62  ? 289 THR A N   1 
ATOM   670  C CA  . THR A 1 83  ? 29.951  13.289  59.829  1.00 41.32  ? 289 THR A CA  1 
ATOM   671  C C   . THR A 1 83  ? 29.547  14.721  60.188  1.00 40.44  ? 289 THR A C   1 
ATOM   672  O O   . THR A 1 83  ? 29.035  14.972  61.281  1.00 39.91  ? 289 THR A O   1 
ATOM   673  C CB  . THR A 1 83  ? 31.465  13.092  60.083  1.00 41.64  ? 289 THR A CB  1 
ATOM   674  O OG1 . THR A 1 83  ? 31.676  11.825  60.722  1.00 41.68  ? 289 THR A OG1 1 
ATOM   675  C CG2 . THR A 1 83  ? 32.020  14.194  60.958  1.00 43.19  ? 289 THR A CG2 1 
ATOM   676  N N   . VAL A 1 84  ? 29.783  15.654  59.269  1.00 41.09  ? 290 VAL A N   1 
ATOM   677  C CA  . VAL A 1 84  ? 29.427  17.053  59.486  1.00 39.79  ? 290 VAL A CA  1 
ATOM   678  C C   . VAL A 1 84  ? 27.902  17.206  59.507  1.00 39.40  ? 290 VAL A C   1 
ATOM   679  O O   . VAL A 1 84  ? 27.364  18.043  60.230  1.00 39.26  ? 290 VAL A O   1 
ATOM   680  C CB  . VAL A 1 84  ? 30.032  17.963  58.389  1.00 37.52  ? 290 VAL A CB  1 
ATOM   681  C CG1 . VAL A 1 84  ? 29.518  19.377  58.532  1.00 39.74  ? 290 VAL A CG1 1 
ATOM   682  C CG2 . VAL A 1 84  ? 31.539  17.967  58.499  1.00 39.59  ? 290 VAL A CG2 1 
ATOM   683  N N   . GLU A 1 85  ? 27.202  16.391  58.727  1.00 39.13  ? 291 GLU A N   1 
ATOM   684  C CA  . GLU A 1 85  ? 25.758  16.477  58.722  1.00 42.63  ? 291 GLU A CA  1 
ATOM   685  C C   . GLU A 1 85  ? 25.208  15.899  60.026  1.00 41.58  ? 291 GLU A C   1 
ATOM   686  O O   . GLU A 1 85  ? 24.281  16.465  60.600  1.00 44.69  ? 291 GLU A O   1 
ATOM   687  C CB  . GLU A 1 85  ? 25.165  15.745  57.511  1.00 49.94  ? 291 GLU A CB  1 
ATOM   688  C CG  . GLU A 1 85  ? 23.931  16.449  56.888  1.00 59.97  ? 291 GLU A CG  1 
ATOM   689  C CD  . GLU A 1 85  ? 22.621  16.240  57.666  1.00 67.71  ? 291 GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 85  ? 21.619  16.917  57.349  1.00 71.95  ? 291 GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 85  ? 22.574  15.394  58.585  1.00 72.01  ? 291 GLU A OE2 1 
ATOM   692  N N   . THR A 1 86  ? 25.771  14.792  60.510  1.00 36.56  ? 292 THR A N   1 
ATOM   693  C CA  . THR A 1 86  ? 25.270  14.215  61.759  1.00 33.89  ? 292 THR A CA  1 
ATOM   694  C C   . THR A 1 86  ? 25.516  15.136  62.953  1.00 33.09  ? 292 THR A C   1 
ATOM   695  O O   . THR A 1 86  ? 24.795  15.074  63.952  1.00 32.92  ? 292 THR A O   1 
ATOM   696  C CB  . THR A 1 86  ? 25.908  12.850  62.074  1.00 35.42  ? 292 THR A CB  1 
ATOM   697  O OG1 . THR A 1 86  ? 25.549  11.893  61.067  1.00 33.49  ? 292 THR A OG1 1 
ATOM   698  C CG2 . THR A 1 86  ? 25.425  12.352  63.426  1.00 26.38  ? 292 THR A CG2 1 
ATOM   699  N N   . VAL A 1 87  ? 26.536  15.984  62.858  1.00 32.07  ? 293 VAL A N   1 
ATOM   700  C CA  . VAL A 1 87  ? 26.846  16.924  63.923  1.00 31.42  ? 293 VAL A CA  1 
ATOM   701  C C   . VAL A 1 87  ? 25.725  17.968  64.007  1.00 33.98  ? 293 VAL A C   1 
ATOM   702  O O   . VAL A 1 87  ? 25.248  18.296  65.095  1.00 32.97  ? 293 VAL A O   1 
ATOM   703  C CB  . VAL A 1 87  ? 28.220  17.599  63.671  1.00 32.33  ? 293 VAL A CB  1 
ATOM   704  C CG1 . VAL A 1 87  ? 28.435  18.774  64.636  1.00 26.76  ? 293 VAL A CG1 1 
ATOM   705  C CG2 . VAL A 1 87  ? 29.335  16.566  63.842  1.00 29.91  ? 293 VAL A CG2 1 
ATOM   706  N N   . ARG A 1 88  ? 25.289  18.470  62.855  1.00 38.03  ? 294 ARG A N   1 
ATOM   707  C CA  . ARG A 1 88  ? 24.210  19.453  62.822  1.00 41.87  ? 294 ARG A CA  1 
ATOM   708  C C   . ARG A 1 88  ? 22.944  18.913  63.487  1.00 41.80  ? 294 ARG A C   1 
ATOM   709  O O   . ARG A 1 88  ? 22.282  19.615  64.262  1.00 40.59  ? 294 ARG A O   1 
ATOM   710  C CB  . ARG A 1 88  ? 23.910  19.881  61.380  1.00 45.60  ? 294 ARG A CB  1 
ATOM   711  C CG  . ARG A 1 88  ? 24.798  21.024  60.906  1.00 53.10  ? 294 ARG A CG  1 
ATOM   712  C CD  . ARG A 1 88  ? 24.297  21.704  59.643  1.00 56.48  ? 294 ARG A CD  1 
ATOM   713  N NE  . ARG A 1 88  ? 25.024  22.951  59.413  1.00 63.19  ? 294 ARG A NE  1 
ATOM   714  C CZ  . ARG A 1 88  ? 24.890  24.050  60.158  1.00 66.53  ? 294 ARG A CZ  1 
ATOM   715  N NH1 . ARG A 1 88  ? 24.052  24.071  61.186  1.00 66.96  ? 294 ARG A NH1 1 
ATOM   716  N NH2 . ARG A 1 88  ? 25.608  25.132  59.891  1.00 68.56  ? 294 ARG A NH2 1 
ATOM   717  N N   . GLU A 1 89  ? 22.618  17.659  63.196  1.00 40.29  ? 295 GLU A N   1 
ATOM   718  C CA  . GLU A 1 89  ? 21.445  17.037  63.780  1.00 40.38  ? 295 GLU A CA  1 
ATOM   719  C C   . GLU A 1 89  ? 21.641  16.872  65.283  1.00 39.49  ? 295 GLU A C   1 
ATOM   720  O O   . GLU A 1 89  ? 20.735  17.110  66.058  1.00 39.93  ? 295 GLU A O   1 
ATOM   721  C CB  . GLU A 1 89  ? 21.193  15.687  63.112  1.00 41.59  ? 295 GLU A CB  1 
ATOM   722  C CG  . GLU A 1 89  ? 21.118  15.778  61.599  1.00 46.62  ? 295 GLU A CG  1 
ATOM   723  C CD  . GLU A 1 89  ? 20.400  14.601  60.969  1.00 51.84  ? 295 GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 89  ? 20.839  13.448  61.163  1.00 55.06  ? 295 GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 89  ? 19.388  14.835  60.275  1.00 52.92  ? 295 GLU A OE2 1 
ATOM   726  N N   . LEU A 1 90  ? 22.840  16.479  65.690  1.00 38.96  ? 296 LEU A N   1 
ATOM   727  C CA  . LEU A 1 90  ? 23.137  16.296  67.101  1.00 36.80  ? 296 LEU A CA  1 
ATOM   728  C C   . LEU A 1 90  ? 23.028  17.598  67.865  1.00 34.68  ? 296 LEU A C   1 
ATOM   729  O O   . LEU A 1 90  ? 22.682  17.603  69.042  1.00 35.08  ? 296 LEU A O   1 
ATOM   730  C CB  . LEU A 1 90  ? 24.536  15.704  67.278  1.00 39.66  ? 296 LEU A CB  1 
ATOM   731  C CG  . LEU A 1 90  ? 24.562  14.181  67.230  1.00 38.58  ? 296 LEU A CG  1 
ATOM   732  C CD1 . LEU A 1 90  ? 25.995  13.695  67.176  1.00 43.95  ? 296 LEU A CD1 1 
ATOM   733  C CD2 . LEU A 1 90  ? 23.831  13.629  68.465  1.00 38.71  ? 296 LEU A CD2 1 
ATOM   734  N N   . THR A 1 91  ? 23.330  18.701  67.195  1.00 32.04  ? 297 THR A N   1 
ATOM   735  C CA  . THR A 1 91  ? 23.244  20.006  67.824  1.00 31.84  ? 297 THR A CA  1 
ATOM   736  C C   . THR A 1 91  ? 21.779  20.338  68.064  1.00 33.72  ? 297 THR A C   1 
ATOM   737  O O   . THR A 1 91  ? 21.394  20.758  69.157  1.00 31.72  ? 297 THR A O   1 
ATOM   738  C CB  . THR A 1 91  ? 23.882  21.077  66.925  1.00 35.70  ? 297 THR A CB  1 
ATOM   739  O OG1 . THR A 1 91  ? 25.278  20.797  66.775  1.00 29.74  ? 297 THR A OG1 1 
ATOM   740  C CG2 . THR A 1 91  ? 23.697  22.462  67.517  1.00 30.94  ? 297 THR A CG2 1 
ATOM   741  N N   . GLU A 1 92  ? 20.956  20.137  67.039  1.00 36.87  ? 298 GLU A N   1 
ATOM   742  C CA  . GLU A 1 92  ? 19.518  20.401  67.140  1.00 37.86  ? 298 GLU A CA  1 
ATOM   743  C C   . GLU A 1 92  ? 18.898  19.464  68.184  1.00 36.51  ? 298 GLU A C   1 
ATOM   744  O O   . GLU A 1 92  ? 18.085  19.883  69.001  1.00 39.59  ? 298 GLU A O   1 
ATOM   745  C CB  . GLU A 1 92  ? 18.860  20.217  65.772  1.00 39.24  ? 298 GLU A CB  1 
ATOM   746  C CG  . GLU A 1 92  ? 18.169  21.466  65.209  1.00 44.15  ? 298 GLU A CG  1 
ATOM   747  C CD  . GLU A 1 92  ? 18.975  22.754  65.357  1.00 49.94  ? 298 GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 92  ? 20.131  22.821  64.882  1.00 51.91  ? 298 GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 92  ? 18.435  23.715  65.949  1.00 51.53  ? 298 GLU A OE2 1 
ATOM   750  N N   . PHE A 1 93  ? 19.298  18.201  68.166  1.00 34.34  ? 299 PHE A N   1 
ATOM   751  C CA  . PHE A 1 93  ? 18.806  17.238  69.138  1.00 33.30  ? 299 PHE A CA  1 
ATOM   752  C C   . PHE A 1 93  ? 19.023  17.773  70.549  1.00 36.13  ? 299 PHE A C   1 
ATOM   753  O O   . PHE A 1 93  ? 18.081  17.876  71.353  1.00 40.45  ? 299 PHE A O   1 
ATOM   754  C CB  . PHE A 1 93  ? 19.556  15.915  68.970  1.00 34.29  ? 299 PHE A CB  1 
ATOM   755  C CG  . PHE A 1 93  ? 19.360  14.946  70.107  1.00 35.71  ? 299 PHE A CG  1 
ATOM   756  C CD1 . PHE A 1 93  ? 18.110  14.374  70.357  1.00 31.96  ? 299 PHE A CD1 1 
ATOM   757  C CD2 . PHE A 1 93  ? 20.435  14.583  70.922  1.00 34.41  ? 299 PHE A CD2 1 
ATOM   758  C CE1 . PHE A 1 93  ? 17.940  13.457  71.392  1.00 27.67  ? 299 PHE A CE1 1 
ATOM   759  C CE2 . PHE A 1 93  ? 20.269  13.659  71.963  1.00 33.95  ? 299 PHE A CE2 1 
ATOM   760  C CZ  . PHE A 1 93  ? 19.023  13.098  72.195  1.00 32.50  ? 299 PHE A CZ  1 
ATOM   761  N N   . ALA A 1 94  ? 20.273  18.099  70.855  1.00 35.59  ? 300 ALA A N   1 
ATOM   762  C CA  . ALA A 1 94  ? 20.631  18.622  72.170  1.00 31.88  ? 300 ALA A CA  1 
ATOM   763  C C   . ALA A 1 94  ? 19.860  19.884  72.540  1.00 32.96  ? 300 ALA A C   1 
ATOM   764  O O   . ALA A 1 94  ? 19.461  20.064  73.684  1.00 36.66  ? 300 ALA A O   1 
ATOM   765  C CB  . ALA A 1 94  ? 22.137  18.898  72.225  1.00 26.49  ? 300 ALA A CB  1 
ATOM   766  N N   . LYS A 1 95  ? 19.670  20.774  71.577  1.00 38.42  ? 301 LYS A N   1 
ATOM   767  C CA  . LYS A 1 95  ? 18.962  22.026  71.836  1.00 43.48  ? 301 LYS A CA  1 
ATOM   768  C C   . LYS A 1 95  ? 17.466  21.802  72.071  1.00 47.23  ? 301 LYS A C   1 
ATOM   769  O O   . LYS A 1 95  ? 16.765  22.686  72.562  1.00 49.96  ? 301 LYS A O   1 
ATOM   770  C CB  . LYS A 1 95  ? 19.189  23.010  70.682  1.00 44.23  ? 301 LYS A CB  1 
ATOM   771  C CG  . LYS A 1 95  ? 20.653  23.333  70.441  1.00 45.37  ? 301 LYS A CG  1 
ATOM   772  C CD  . LYS A 1 95  ? 20.858  24.277  69.277  1.00 47.62  ? 301 LYS A CD  1 
ATOM   773  C CE  . LYS A 1 95  ? 20.447  25.683  69.642  1.00 55.63  ? 301 LYS A CE  1 
ATOM   774  N NZ  . LYS A 1 95  ? 21.248  26.208  70.796  1.00 57.35  ? 301 LYS A NZ  1 
ATOM   775  N N   . SER A 1 96  ? 16.978  20.615  71.732  1.00 47.92  ? 302 SER A N   1 
ATOM   776  C CA  . SER A 1 96  ? 15.575  20.308  71.956  1.00 48.54  ? 302 SER A CA  1 
ATOM   777  C C   . SER A 1 96  ? 15.460  19.755  73.376  1.00 50.93  ? 302 SER A C   1 
ATOM   778  O O   . SER A 1 96  ? 14.415  19.258  73.787  1.00 55.46  ? 302 SER A O   1 
ATOM   779  C CB  . SER A 1 96  ? 15.079  19.282  70.932  1.00 46.47  ? 302 SER A CB  1 
ATOM   780  O OG  . SER A 1 96  ? 15.197  19.776  69.607  1.00 47.26  ? 302 SER A OG  1 
ATOM   781  N N   . ILE A 1 97  ? 16.556  19.830  74.118  1.00 50.14  ? 303 ILE A N   1 
ATOM   782  C CA  . ILE A 1 97  ? 16.582  19.365  75.501  1.00 52.11  ? 303 ILE A CA  1 
ATOM   783  C C   . ILE A 1 97  ? 16.732  20.631  76.366  1.00 54.97  ? 303 ILE A C   1 
ATOM   784  O O   . ILE A 1 97  ? 17.840  21.145  76.542  1.00 54.74  ? 303 ILE A O   1 
ATOM   785  C CB  . ILE A 1 97  ? 17.772  18.398  75.718  1.00 50.77  ? 303 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 97  ? 17.669  17.235  74.724  1.00 48.01  ? 303 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 97  ? 17.774  17.880  77.149  1.00 49.37  ? 303 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 97  ? 18.907  16.355  74.635  1.00 40.24  ? 303 ILE A CD1 1 
ATOM   789  N N   . PRO A 1 98  ? 15.606  21.145  76.914  1.00 55.72  ? 304 PRO A N   1 
ATOM   790  C CA  . PRO A 1 98  ? 15.586  22.350  77.750  1.00 54.86  ? 304 PRO A CA  1 
ATOM   791  C C   . PRO A 1 98  ? 16.778  22.473  78.685  1.00 56.45  ? 304 PRO A C   1 
ATOM   792  O O   . PRO A 1 98  ? 17.428  23.524  78.742  1.00 56.02  ? 304 PRO A O   1 
ATOM   793  C CB  . PRO A 1 98  ? 14.266  22.224  78.500  1.00 54.31  ? 304 PRO A CB  1 
ATOM   794  C CG  . PRO A 1 98  ? 13.390  21.546  77.512  1.00 50.87  ? 304 PRO A CG  1 
ATOM   795  C CD  . PRO A 1 98  ? 14.298  20.462  76.979  1.00 55.03  ? 304 PRO A CD  1 
ATOM   796  N N   . SER A 1 99  ? 17.055  21.391  79.408  1.00 56.38  ? 305 SER A N   1 
ATOM   797  C CA  . SER A 1 99  ? 18.163  21.344  80.349  1.00 57.34  ? 305 SER A CA  1 
ATOM   798  C C   . SER A 1 99  ? 19.462  21.724  79.655  1.00 57.40  ? 305 SER A C   1 
ATOM   799  O O   . SER A 1 99  ? 20.291  22.443  80.215  1.00 57.40  ? 305 SER A O   1 
ATOM   800  C CB  . SER A 1 99  ? 18.269  19.944  80.931  1.00 58.90  ? 305 SER A CB  1 
ATOM   801  O OG  . SER A 1 99  ? 17.004  19.548  81.428  1.00 62.24  ? 305 SER A OG  1 
ATOM   802  N N   . PHE A 1 100 ? 19.628  21.240  78.429  1.00 56.67  ? 306 PHE A N   1 
ATOM   803  C CA  . PHE A 1 100 ? 20.812  21.534  77.637  1.00 56.72  ? 306 PHE A CA  1 
ATOM   804  C C   . PHE A 1 100 ? 20.849  23.014  77.247  1.00 58.09  ? 306 PHE A C   1 
ATOM   805  O O   . PHE A 1 100 ? 21.854  23.697  77.445  1.00 57.43  ? 306 PHE A O   1 
ATOM   806  C CB  . PHE A 1 100 ? 20.822  20.681  76.363  1.00 54.85  ? 306 PHE A CB  1 
ATOM   807  C CG  . PHE A 1 100 ? 22.058  20.858  75.526  1.00 52.61  ? 306 PHE A CG  1 
ATOM   808  C CD1 . PHE A 1 100 ? 23.252  20.231  75.881  1.00 47.41  ? 306 PHE A CD1 1 
ATOM   809  C CD2 . PHE A 1 100 ? 22.039  21.680  74.400  1.00 50.88  ? 306 PHE A CD2 1 
ATOM   810  C CE1 . PHE A 1 100 ? 24.407  20.421  75.131  1.00 47.19  ? 306 PHE A CE1 1 
ATOM   811  C CE2 . PHE A 1 100 ? 23.191  21.879  73.640  1.00 47.98  ? 306 PHE A CE2 1 
ATOM   812  C CZ  . PHE A 1 100 ? 24.379  21.248  74.008  1.00 48.47  ? 306 PHE A CZ  1 
ATOM   813  N N   . SER A 1 101 ? 19.742  23.503  76.693  1.00 59.17  ? 307 SER A N   1 
ATOM   814  C CA  . SER A 1 101 ? 19.656  24.888  76.250  1.00 58.86  ? 307 SER A CA  1 
ATOM   815  C C   . SER A 1 101 ? 19.701  25.914  77.373  1.00 58.06  ? 307 SER A C   1 
ATOM   816  O O   . SER A 1 101 ? 19.826  27.109  77.113  1.00 57.97  ? 307 SER A O   1 
ATOM   817  C CB  . SER A 1 101 ? 18.410  25.077  75.390  1.00 58.80  ? 307 SER A CB  1 
ATOM   818  O OG  . SER A 1 101 ? 18.552  24.369  74.169  1.00 59.65  ? 307 SER A OG  1 
ATOM   819  N N   . SER A 1 102 ? 19.600  25.443  78.614  1.00 56.30  ? 308 SER A N   1 
ATOM   820  C CA  . SER A 1 102 ? 19.680  26.311  79.792  1.00 57.44  ? 308 SER A CA  1 
ATOM   821  C C   . SER A 1 102 ? 21.101  26.859  79.888  1.00 56.42  ? 308 SER A C   1 
ATOM   822  O O   . SER A 1 102 ? 21.305  28.058  80.050  1.00 59.13  ? 308 SER A O   1 
ATOM   823  C CB  . SER A 1 102 ? 19.384  25.523  81.074  1.00 58.22  ? 308 SER A CB  1 
ATOM   824  O OG  . SER A 1 102 ? 18.078  24.979  81.066  1.00 64.02  ? 308 SER A OG  1 
ATOM   825  N N   . LEU A 1 103 ? 22.071  25.949  79.796  1.00 54.52  ? 309 LEU A N   1 
ATOM   826  C CA  . LEU A 1 103 ? 23.500  26.254  79.858  1.00 50.96  ? 309 LEU A CA  1 
ATOM   827  C C   . LEU A 1 103 ? 23.897  27.364  78.902  1.00 50.53  ? 309 LEU A C   1 
ATOM   828  O O   . LEU A 1 103 ? 23.170  27.667  77.965  1.00 50.22  ? 309 LEU A O   1 
ATOM   829  C CB  . LEU A 1 103 ? 24.317  25.007  79.492  1.00 48.83  ? 309 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 103 ? 24.141  23.700  80.271  1.00 48.15  ? 309 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 103 ? 24.766  22.544  79.484  1.00 42.70  ? 309 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 103 ? 24.773  23.844  81.654  1.00 46.51  ? 309 LEU A CD2 1 
ATOM   833  N N   . PHE A 1 104 ? 25.064  27.958  79.130  1.00 51.08  ? 310 PHE A N   1 
ATOM   834  C CA  . PHE A 1 104 ? 25.559  29.004  78.243  1.00 49.94  ? 310 PHE A CA  1 
ATOM   835  C C   . PHE A 1 104 ? 26.089  28.349  76.973  1.00 49.28  ? 310 PHE A C   1 
ATOM   836  O O   . PHE A 1 104 ? 26.605  27.237  77.014  1.00 50.63  ? 310 PHE A O   1 
ATOM   837  C CB  . PHE A 1 104 ? 26.651  29.811  78.935  1.00 49.99  ? 310 PHE A CB  1 
ATOM   838  C CG  . PHE A 1 104 ? 26.119  30.836  79.895  1.00 54.77  ? 310 PHE A CG  1 
ATOM   839  C CD1 . PHE A 1 104 ? 25.379  31.921  79.434  1.00 54.95  ? 310 PHE A CD1 1 
ATOM   840  C CD2 . PHE A 1 104 ? 26.321  30.698  81.265  1.00 58.00  ? 310 PHE A CD2 1 
ATOM   841  C CE1 . PHE A 1 104 ? 24.845  32.852  80.319  1.00 54.14  ? 310 PHE A CE1 1 
ATOM   842  C CE2 . PHE A 1 104 ? 25.791  31.626  82.164  1.00 56.98  ? 310 PHE A CE2 1 
ATOM   843  C CZ  . PHE A 1 104 ? 25.050  32.704  81.687  1.00 58.21  ? 310 PHE A CZ  1 
ATOM   844  N N   . LEU A 1 105 ? 25.941  29.030  75.844  1.00 49.76  ? 311 LEU A N   1 
ATOM   845  C CA  . LEU A 1 105 ? 26.380  28.496  74.560  1.00 46.41  ? 311 LEU A CA  1 
ATOM   846  C C   . LEU A 1 105 ? 27.812  28.003  74.574  1.00 45.27  ? 311 LEU A C   1 
ATOM   847  O O   . LEU A 1 105 ? 28.122  26.991  73.954  1.00 44.88  ? 311 LEU A O   1 
ATOM   848  C CB  . LEU A 1 105 ? 26.223  29.545  73.453  1.00 48.84  ? 311 LEU A CB  1 
ATOM   849  C CG  . LEU A 1 105 ? 24.869  29.683  72.756  1.00 49.53  ? 311 LEU A CG  1 
ATOM   850  C CD1 . LEU A 1 105 ? 24.983  30.742  71.666  1.00 51.64  ? 311 LEU A CD1 1 
ATOM   851  C CD2 . LEU A 1 105 ? 24.455  28.348  72.150  1.00 48.96  ? 311 LEU A CD2 1 
ATOM   852  N N   . ASN A 1 106 ? 28.694  28.719  75.260  1.00 41.74  ? 312 ASN A N   1 
ATOM   853  C CA  . ASN A 1 106 ? 30.084  28.292  75.306  1.00 41.05  ? 312 ASN A CA  1 
ATOM   854  C C   . ASN A 1 106 ? 30.172  26.877  75.883  1.00 40.62  ? 312 ASN A C   1 
ATOM   855  O O   . ASN A 1 106 ? 30.899  26.032  75.366  1.00 42.40  ? 312 ASN A O   1 
ATOM   856  C CB  . ASN A 1 106 ? 30.930  29.281  76.122  1.00 39.36  ? 312 ASN A CB  1 
ATOM   857  C CG  . ASN A 1 106 ? 30.409  29.473  77.534  1.00 40.45  ? 312 ASN A CG  1 
ATOM   858  O OD1 . ASN A 1 106 ? 29.202  29.545  77.763  1.00 41.09  ? 312 ASN A OD1 1 
ATOM   859  N ND2 . ASN A 1 106 ? 31.324  29.574  78.488  1.00 37.97  ? 312 ASN A ND2 1 
ATOM   860  N N   . ASP A 1 107 ? 29.423  26.615  76.944  1.00 38.05  ? 313 ASP A N   1 
ATOM   861  C CA  . ASP A 1 107 ? 29.418  25.296  77.540  1.00 38.29  ? 313 ASP A CA  1 
ATOM   862  C C   . ASP A 1 107 ? 28.769  24.279  76.592  1.00 38.37  ? 313 ASP A C   1 
ATOM   863  O O   . ASP A 1 107 ? 29.217  23.127  76.488  1.00 38.04  ? 313 ASP A O   1 
ATOM   864  C CB  . ASP A 1 107 ? 28.665  25.323  78.865  1.00 39.37  ? 313 ASP A CB  1 
ATOM   865  C CG  . ASP A 1 107 ? 29.593  25.257  80.055  1.00 41.11  ? 313 ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 107 ? 30.809  25.068  79.851  1.00 42.02  ? 313 ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 107 ? 29.104  25.387  81.195  1.00 46.97  ? 313 ASP A OD2 1 
ATOM   868  N N   . GLN A 1 108 ? 27.711  24.707  75.909  1.00 36.48  ? 314 GLN A N   1 
ATOM   869  C CA  . GLN A 1 108 ? 27.017  23.835  74.970  1.00 37.49  ? 314 GLN A CA  1 
ATOM   870  C C   . GLN A 1 108 ? 27.983  23.367  73.906  1.00 35.36  ? 314 GLN A C   1 
ATOM   871  O O   . GLN A 1 108 ? 28.011  22.201  73.554  1.00 37.38  ? 314 GLN A O   1 
ATOM   872  C CB  . GLN A 1 108 ? 25.833  24.562  74.322  1.00 32.52  ? 314 GLN A CB  1 
ATOM   873  C CG  . GLN A 1 108 ? 24.662  24.735  75.261  1.00 34.36  ? 314 GLN A CG  1 
ATOM   874  C CD  . GLN A 1 108 ? 23.510  25.515  74.643  1.00 41.22  ? 314 GLN A CD  1 
ATOM   875  O OE1 . GLN A 1 108 ? 22.726  26.129  75.352  1.00 45.83  ? 314 GLN A OE1 1 
ATOM   876  N NE2 . GLN A 1 108 ? 23.399  25.485  73.321  1.00 43.43  ? 314 GLN A NE2 1 
ATOM   877  N N   . VAL A 1 109 ? 28.787  24.287  73.402  1.00 36.94  ? 315 VAL A N   1 
ATOM   878  C CA  . VAL A 1 109 ? 29.757  23.962  72.375  1.00 33.85  ? 315 VAL A CA  1 
ATOM   879  C C   . VAL A 1 109 ? 30.811  23.000  72.883  1.00 33.94  ? 315 VAL A C   1 
ATOM   880  O O   . VAL A 1 109 ? 31.206  22.098  72.164  1.00 38.14  ? 315 VAL A O   1 
ATOM   881  C CB  . VAL A 1 109 ? 30.440  25.233  71.849  1.00 33.67  ? 315 VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 109 ? 31.580  24.878  70.932  1.00 32.03  ? 315 VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 109 ? 29.423  26.077  71.113  1.00 32.10  ? 315 VAL A CG2 1 
ATOM   884  N N   . THR A 1 110 ? 31.254  23.164  74.122  1.00 34.67  ? 316 THR A N   1 
ATOM   885  C CA  . THR A 1 110 ? 32.285  22.277  74.630  1.00 35.39  ? 316 THR A CA  1 
ATOM   886  C C   . THR A 1 110 ? 31.733  20.867  74.713  1.00 34.82  ? 316 THR A C   1 
ATOM   887  O O   . THR A 1 110 ? 32.449  19.900  74.461  1.00 34.98  ? 316 THR A O   1 
ATOM   888  C CB  . THR A 1 110 ? 32.815  22.724  76.005  1.00 37.09  ? 316 THR A CB  1 
ATOM   889  O OG1 . THR A 1 110 ? 31.811  22.510  76.995  1.00 49.38  ? 316 THR A OG1 1 
ATOM   890  C CG2 . THR A 1 110 ? 33.192  24.187  75.985  1.00 30.40  ? 316 THR A CG2 1 
ATOM   891  N N   . LEU A 1 111 ? 30.450  20.754  75.039  1.00 33.54  ? 317 LEU A N   1 
ATOM   892  C CA  . LEU A 1 111 ? 29.813  19.453  75.119  1.00 31.18  ? 317 LEU A CA  1 
ATOM   893  C C   . LEU A 1 111 ? 29.657  18.861  73.714  1.00 33.25  ? 317 LEU A C   1 
ATOM   894  O O   . LEU A 1 111 ? 29.980  17.699  73.483  1.00 35.99  ? 317 LEU A O   1 
ATOM   895  C CB  . LEU A 1 111 ? 28.451  19.568  75.814  1.00 27.82  ? 317 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 111 ? 28.440  19.841  77.327  1.00 24.48  ? 317 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 111 ? 27.011  19.931  77.814  1.00 26.11  ? 317 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 111 ? 29.188  18.739  78.062  1.00 21.15  ? 317 LEU A CD2 1 
ATOM   899  N N   . LEU A 1 112 ? 29.173  19.647  72.761  1.00 33.24  ? 318 LEU A N   1 
ATOM   900  C CA  . LEU A 1 112 ? 29.030  19.120  71.415  1.00 36.76  ? 318 LEU A CA  1 
ATOM   901  C C   . LEU A 1 112 ? 30.422  18.787  70.852  1.00 38.60  ? 318 LEU A C   1 
ATOM   902  O O   . LEU A 1 112 ? 30.591  17.820  70.125  1.00 41.72  ? 318 LEU A O   1 
ATOM   903  C CB  . LEU A 1 112 ? 28.275  20.123  70.527  1.00 30.96  ? 318 LEU A CB  1 
ATOM   904  C CG  . LEU A 1 112 ? 26.773  20.185  70.847  1.00 31.17  ? 318 LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 112 ? 26.170  21.400  70.230  1.00 28.13  ? 318 LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 112 ? 26.059  18.920  70.346  1.00 25.15  ? 318 LEU A CD2 1 
ATOM   907  N N   . LYS A 1 113 ? 31.427  19.558  71.236  1.00 39.70  ? 319 LYS A N   1 
ATOM   908  C CA  . LYS A 1 113 ? 32.781  19.321  70.758  1.00 38.11  ? 319 LYS A CA  1 
ATOM   909  C C   . LYS A 1 113 ? 33.442  18.019  71.218  1.00 35.16  ? 319 LYS A C   1 
ATOM   910  O O   . LYS A 1 113 ? 34.130  17.355  70.451  1.00 32.35  ? 319 LYS A O   1 
ATOM   911  C CB  . LYS A 1 113 ? 33.696  20.474  71.161  1.00 37.48  ? 319 LYS A CB  1 
ATOM   912  C CG  . LYS A 1 113 ? 35.113  20.282  70.651  1.00 34.41  ? 319 LYS A CG  1 
ATOM   913  C CD  . LYS A 1 113 ? 36.053  21.247  71.296  1.00 39.22  ? 319 LYS A CD  1 
ATOM   914  C CE  . LYS A 1 113 ? 37.479  20.971  70.892  1.00 37.31  ? 319 LYS A CE  1 
ATOM   915  N NZ  . LYS A 1 113 ? 38.380  21.798  71.726  1.00 42.09  ? 319 LYS A NZ  1 
ATOM   916  N N   . TYR A 1 114 ? 33.260  17.657  72.473  1.00 30.06  ? 320 TYR A N   1 
ATOM   917  C CA  . TYR A 1 114 ? 33.902  16.447  72.956  1.00 32.20  ? 320 TYR A CA  1 
ATOM   918  C C   . TYR A 1 114 ? 32.999  15.233  72.972  1.00 33.83  ? 320 TYR A C   1 
ATOM   919  O O   . TYR A 1 114 ? 33.469  14.124  73.210  1.00 37.36  ? 320 TYR A O   1 
ATOM   920  C CB  . TYR A 1 114 ? 34.478  16.694  74.349  1.00 34.01  ? 320 TYR A CB  1 
ATOM   921  C CG  . TYR A 1 114 ? 35.675  17.606  74.331  1.00 36.53  ? 320 TYR A CG  1 
ATOM   922  C CD1 . TYR A 1 114 ? 36.931  17.125  73.969  1.00 36.54  ? 320 TYR A CD1 1 
ATOM   923  C CD2 . TYR A 1 114 ? 35.550  18.952  74.651  1.00 38.34  ? 320 TYR A CD2 1 
ATOM   924  C CE1 . TYR A 1 114 ? 38.027  17.955  73.929  1.00 37.86  ? 320 TYR A CE1 1 
ATOM   925  C CE2 . TYR A 1 114 ? 36.648  19.791  74.608  1.00 41.03  ? 320 TYR A CE2 1 
ATOM   926  C CZ  . TYR A 1 114 ? 37.884  19.283  74.246  1.00 40.43  ? 320 TYR A CZ  1 
ATOM   927  O OH  . TYR A 1 114 ? 38.980  20.116  74.197  1.00 45.82  ? 320 TYR A OH  1 
ATOM   928  N N   . GLY A 1 115 ? 31.709  15.435  72.715  1.00 33.87  ? 321 GLY A N   1 
ATOM   929  C CA  . GLY A 1 115 ? 30.786  14.316  72.710  1.00 34.57  ? 321 GLY A CA  1 
ATOM   930  C C   . GLY A 1 115 ? 30.193  13.911  71.364  1.00 37.36  ? 321 GLY A C   1 
ATOM   931  O O   . GLY A 1 115 ? 29.732  12.775  71.215  1.00 35.79  ? 321 GLY A O   1 
ATOM   932  N N   . VAL A 1 116 ? 30.203  14.808  70.380  1.00 36.28  ? 322 VAL A N   1 
ATOM   933  C CA  . VAL A 1 116 ? 29.601  14.501  69.077  1.00 39.92  ? 322 VAL A CA  1 
ATOM   934  C C   . VAL A 1 116 ? 30.126  13.238  68.364  1.00 37.65  ? 322 VAL A C   1 
ATOM   935  O O   . VAL A 1 116 ? 29.351  12.536  67.735  1.00 35.77  ? 322 VAL A O   1 
ATOM   936  C CB  . VAL A 1 116 ? 29.696  15.723  68.110  1.00 42.27  ? 322 VAL A CB  1 
ATOM   937  C CG1 . VAL A 1 116 ? 31.121  15.877  67.563  1.00 44.22  ? 322 VAL A CG1 1 
ATOM   938  C CG2 . VAL A 1 116 ? 28.703  15.573  66.994  1.00 44.85  ? 322 VAL A CG2 1 
ATOM   939  N N   . HIS A 1 117 ? 31.422  12.946  68.458  1.00 33.99  ? 323 HIS A N   1 
ATOM   940  C CA  . HIS A 1 117 ? 31.960  11.757  67.810  1.00 32.37  ? 323 HIS A CA  1 
ATOM   941  C C   . HIS A 1 117 ? 31.556  10.473  68.495  1.00 32.81  ? 323 HIS A C   1 
ATOM   942  O O   . HIS A 1 117 ? 31.353  9.447   67.835  1.00 32.48  ? 323 HIS A O   1 
ATOM   943  C CB  . HIS A 1 117 ? 33.480  11.808  67.721  1.00 34.75  ? 323 HIS A CB  1 
ATOM   944  C CG  . HIS A 1 117 ? 33.980  12.636  66.588  1.00 34.17  ? 323 HIS A CG  1 
ATOM   945  N ND1 . HIS A 1 117 ? 34.132  14.002  66.678  1.00 36.89  ? 323 HIS A ND1 1 
ATOM   946  C CD2 . HIS A 1 117 ? 34.299  12.303  65.314  1.00 35.62  ? 323 HIS A CD2 1 
ATOM   947  C CE1 . HIS A 1 117 ? 34.521  14.477  65.509  1.00 39.13  ? 323 HIS A CE1 1 
ATOM   948  N NE2 . HIS A 1 117 ? 34.627  13.465  64.663  1.00 35.42  ? 323 HIS A NE2 1 
ATOM   949  N N   . GLU A 1 118 ? 31.464  10.531  69.818  1.00 31.93  ? 324 GLU A N   1 
ATOM   950  C CA  . GLU A 1 118 ? 31.041  9.384   70.606  1.00 33.07  ? 324 GLU A CA  1 
ATOM   951  C C   . GLU A 1 118 ? 29.599  9.056   70.235  1.00 32.65  ? 324 GLU A C   1 
ATOM   952  O O   . GLU A 1 118 ? 29.243  7.887   70.090  1.00 31.30  ? 324 GLU A O   1 
ATOM   953  C CB  . GLU A 1 118 ? 31.091  9.690   72.100  1.00 34.07  ? 324 GLU A CB  1 
ATOM   954  C CG  . GLU A 1 118 ? 32.411  9.501   72.806  1.00 33.12  ? 324 GLU A CG  1 
ATOM   955  C CD  . GLU A 1 118 ? 32.310  9.959   74.249  1.00 35.13  ? 324 GLU A CD  1 
ATOM   956  O OE1 . GLU A 1 118 ? 31.185  9.922   74.780  1.00 36.93  ? 324 GLU A OE1 1 
ATOM   957  O OE2 . GLU A 1 118 ? 33.332  10.346  74.858  1.00 34.25  ? 324 GLU A OE2 1 
ATOM   958  N N   . ALA A 1 119 ? 28.764  10.083  70.094  1.00 30.83  ? 325 ALA A N   1 
ATOM   959  C CA  . ALA A 1 119 ? 27.366  9.849   69.731  1.00 34.16  ? 325 ALA A CA  1 
ATOM   960  C C   . ALA A 1 119 ? 27.270  9.327   68.281  1.00 36.01  ? 325 ALA A C   1 
ATOM   961  O O   . ALA A 1 119 ? 26.428  8.478   67.951  1.00 31.13  ? 325 ALA A O   1 
ATOM   962  C CB  . ALA A 1 119 ? 26.561  11.140  69.891  1.00 33.54  ? 325 ALA A CB  1 
ATOM   963  N N   . ILE A 1 120 ? 28.146  9.848   67.429  1.00 31.96  ? 326 ILE A N   1 
ATOM   964  C CA  . ILE A 1 120 ? 28.168  9.449   66.040  1.00 33.77  ? 326 ILE A CA  1 
ATOM   965  C C   . ILE A 1 120 ? 28.551  7.980   65.871  1.00 35.75  ? 326 ILE A C   1 
ATOM   966  O O   . ILE A 1 120 ? 28.111  7.329   64.931  1.00 33.50  ? 326 ILE A O   1 
ATOM   967  C CB  . ILE A 1 120 ? 29.136  10.331  65.239  1.00 33.58  ? 326 ILE A CB  1 
ATOM   968  C CG1 . ILE A 1 120 ? 28.529  11.718  65.063  1.00 30.64  ? 326 ILE A CG1 1 
ATOM   969  C CG2 . ILE A 1 120 ? 29.455  9.685   63.898  1.00 29.21  ? 326 ILE A CG2 1 
ATOM   970  C CD1 . ILE A 1 120 ? 29.361  12.619  64.189  1.00 31.51  ? 326 ILE A CD1 1 
ATOM   971  N N   . PHE A 1 121 ? 29.355  7.452   66.784  1.00 37.27  ? 327 PHE A N   1 
ATOM   972  C CA  . PHE A 1 121 ? 29.753  6.069   66.662  1.00 38.81  ? 327 PHE A CA  1 
ATOM   973  C C   . PHE A 1 121 ? 28.725  5.120   67.254  1.00 39.46  ? 327 PHE A C   1 
ATOM   974  O O   . PHE A 1 121 ? 28.586  3.985   66.794  1.00 39.30  ? 327 PHE A O   1 
ATOM   975  C CB  . PHE A 1 121 ? 31.132  5.869   67.279  1.00 36.41  ? 327 PHE A CB  1 
ATOM   976  C CG  . PHE A 1 121 ? 32.225  6.614   66.548  1.00 43.03  ? 327 PHE A CG  1 
ATOM   977  C CD1 . PHE A 1 121 ? 32.032  7.049   65.232  1.00 39.49  ? 327 PHE A CD1 1 
ATOM   978  C CD2 . PHE A 1 121 ? 33.442  6.890   67.176  1.00 43.91  ? 327 PHE A CD2 1 
ATOM   979  C CE1 . PHE A 1 121 ? 33.029  7.743   64.566  1.00 42.60  ? 327 PHE A CE1 1 
ATOM   980  C CE2 . PHE A 1 121 ? 34.439  7.583   66.510  1.00 39.97  ? 327 PHE A CE2 1 
ATOM   981  C CZ  . PHE A 1 121 ? 34.234  8.010   65.209  1.00 39.84  ? 327 PHE A CZ  1 
ATOM   982  N N   . ALA A 1 122 ? 27.997  5.583   68.268  1.00 39.85  ? 328 ALA A N   1 
ATOM   983  C CA  . ALA A 1 122 ? 26.952  4.764   68.879  1.00 37.62  ? 328 ALA A CA  1 
ATOM   984  C C   . ALA A 1 122 ? 25.862  4.574   67.829  1.00 36.85  ? 328 ALA A C   1 
ATOM   985  O O   . ALA A 1 122 ? 25.433  3.453   67.588  1.00 38.44  ? 328 ALA A O   1 
ATOM   986  C CB  . ALA A 1 122 ? 26.382  5.452   70.101  1.00 34.66  ? 328 ALA A CB  1 
ATOM   987  N N   . MET A 1 123 ? 25.445  5.675   67.195  1.00 34.19  ? 329 MET A N   1 
ATOM   988  C CA  . MET A 1 123 ? 24.412  5.650   66.158  1.00 35.93  ? 329 MET A CA  1 
ATOM   989  C C   . MET A 1 123 ? 24.829  4.863   64.901  1.00 35.36  ? 329 MET A C   1 
ATOM   990  O O   . MET A 1 123 ? 24.001  4.195   64.265  1.00 34.00  ? 329 MET A O   1 
ATOM   991  C CB  . MET A 1 123 ? 24.026  7.085   65.758  1.00 30.78  ? 329 MET A CB  1 
ATOM   992  C CG  . MET A 1 123 ? 23.497  7.921   66.899  1.00 32.84  ? 329 MET A CG  1 
ATOM   993  S SD  . MET A 1 123 ? 22.938  9.588   66.440  1.00 37.80  ? 329 MET A SD  1 
ATOM   994  C CE  . MET A 1 123 ? 21.179  9.338   66.575  1.00 30.08  ? 329 MET A CE  1 
ATOM   995  N N   . LEU A 1 124 ? 26.101  4.962   64.538  1.00 34.02  ? 330 LEU A N   1 
ATOM   996  C CA  . LEU A 1 124 ? 26.636  4.259   63.377  1.00 35.74  ? 330 LEU A CA  1 
ATOM   997  C C   . LEU A 1 124 ? 26.184  2.781   63.375  1.00 38.27  ? 330 LEU A C   1 
ATOM   998  O O   . LEU A 1 124 ? 25.873  2.200   62.316  1.00 36.71  ? 330 LEU A O   1 
ATOM   999  C CB  . LEU A 1 124 ? 28.163  4.381   63.400  1.00 37.40  ? 330 LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 124 ? 29.099  3.716   62.394  1.00 36.28  ? 330 LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 124 ? 29.258  2.269   62.750  1.00 45.03  ? 330 LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 124 ? 28.575  3.890   60.996  1.00 40.43  ? 330 LEU A CD2 1 
ATOM   1003 N N   . ALA A 1 125 ? 26.127  2.196   64.568  1.00 37.12  ? 331 ALA A N   1 
ATOM   1004 C CA  . ALA A 1 125 ? 25.703  0.806   64.762  1.00 41.13  ? 331 ALA A CA  1 
ATOM   1005 C C   . ALA A 1 125 ? 24.285  0.542   64.263  1.00 41.83  ? 331 ALA A C   1 
ATOM   1006 O O   . ALA A 1 125 ? 23.977  -0.565  63.843  1.00 45.29  ? 331 ALA A O   1 
ATOM   1007 C CB  . ALA A 1 125 ? 25.799  0.435   66.235  1.00 38.52  ? 331 ALA A CB  1 
ATOM   1008 N N   . SER A 1 126 ? 23.423  1.553   64.323  1.00 41.63  ? 332 SER A N   1 
ATOM   1009 C CA  . SER A 1 126 ? 22.043  1.425   63.868  1.00 38.66  ? 332 SER A CA  1 
ATOM   1010 C C   . SER A 1 126 ? 21.910  1.165   62.363  1.00 40.83  ? 332 SER A C   1 
ATOM   1011 O O   . SER A 1 126 ? 21.006  0.440   61.938  1.00 44.32  ? 332 SER A O   1 
ATOM   1012 C CB  . SER A 1 126 ? 21.259  2.682   64.229  1.00 35.76  ? 332 SER A CB  1 
ATOM   1013 O OG  . SER A 1 126 ? 21.185  2.849   65.631  1.00 40.44  ? 332 SER A OG  1 
ATOM   1014 N N   . ILE A 1 127 ? 22.800  1.753   61.565  1.00 36.55  ? 333 ILE A N   1 
ATOM   1015 C CA  . ILE A 1 127 ? 22.773  1.585   60.110  1.00 37.61  ? 333 ILE A CA  1 
ATOM   1016 C C   . ILE A 1 127 ? 23.791  0.549   59.630  1.00 39.48  ? 333 ILE A C   1 
ATOM   1017 O O   . ILE A 1 127 ? 23.941  0.309   58.426  1.00 36.90  ? 333 ILE A O   1 
ATOM   1018 C CB  . ILE A 1 127 ? 23.125  2.905   59.383  1.00 34.49  ? 333 ILE A CB  1 
ATOM   1019 C CG1 . ILE A 1 127 ? 24.525  3.371   59.800  1.00 32.70  ? 333 ILE A CG1 1 
ATOM   1020 C CG2 . ILE A 1 127 ? 22.107  3.959   59.705  1.00 36.36  ? 333 ILE A CG2 1 
ATOM   1021 C CD1 . ILE A 1 127 ? 25.111  4.444   58.934  1.00 29.71  ? 333 ILE A CD1 1 
ATOM   1022 N N   . VAL A 1 128 ? 24.495  -0.059  60.571  1.00 40.68  ? 334 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 128 ? 25.528  -0.997  60.208  1.00 44.57  ? 334 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 128 ? 25.088  -2.426  60.202  1.00 47.85  ? 334 VAL A C   1 
ATOM   1025 O O   . VAL A 1 128 ? 24.099  -2.803  60.809  1.00 48.99  ? 334 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 128 ? 26.770  -0.821  61.133  1.00 47.37  ? 334 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 128 ? 27.374  -2.170  61.559  1.00 40.82  ? 334 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 128 ? 27.798  0.003   60.401  1.00 48.26  ? 334 VAL A CG2 1 
ATOM   1029 N N   . ASN A 1 129 ? 25.848  -3.230  59.489  1.00 51.76  ? 335 ASN A N   1 
ATOM   1030 C CA  . ASN A 1 129 ? 25.549  -4.629  59.402  1.00 55.66  ? 335 ASN A CA  1 
ATOM   1031 C C   . ASN A 1 129 ? 26.855  -5.372  59.530  1.00 57.61  ? 335 ASN A C   1 
ATOM   1032 O O   . ASN A 1 129 ? 27.930  -4.779  59.464  1.00 57.83  ? 335 ASN A O   1 
ATOM   1033 C CB  . ASN A 1 129 ? 24.907  -4.939  58.062  1.00 58.56  ? 335 ASN A CB  1 
ATOM   1034 C CG  . ASN A 1 129 ? 24.630  -6.379  57.905  1.00 58.66  ? 335 ASN A CG  1 
ATOM   1035 O OD1 . ASN A 1 129 ? 23.734  -6.920  58.545  1.00 61.84  ? 335 ASN A OD1 1 
ATOM   1036 N ND2 . ASN A 1 129 ? 25.415  -7.035  57.072  1.00 63.88  ? 335 ASN A ND2 1 
ATOM   1037 N N   . LYS A 1 130 ? 26.760  -6.678  59.711  1.00 59.12  ? 336 LYS A N   1 
ATOM   1038 C CA  . LYS A 1 130 ? 27.945  -7.495  59.854  1.00 58.66  ? 336 LYS A CA  1 
ATOM   1039 C C   . LYS A 1 130 ? 28.760  -7.442  58.567  1.00 56.48  ? 336 LYS A C   1 
ATOM   1040 O O   . LYS A 1 130 ? 29.975  -7.594  58.603  1.00 56.28  ? 336 LYS A O   1 
ATOM   1041 C CB  . LYS A 1 130 ? 27.532  -8.936  60.182  1.00 61.73  ? 336 LYS A CB  1 
ATOM   1042 C CG  . LYS A 1 130 ? 28.655  -9.817  60.689  1.00 63.41  ? 336 LYS A CG  1 
ATOM   1043 C CD  . LYS A 1 130 ? 28.164  -11.215 61.057  1.00 65.85  ? 336 LYS A CD  1 
ATOM   1044 C CE  . LYS A 1 130 ? 27.733  -12.016 59.838  1.00 66.56  ? 336 LYS A CE  1 
ATOM   1045 N NZ  . LYS A 1 130 ? 26.523  -11.451 59.187  1.00 69.93  ? 336 LYS A NZ  1 
ATOM   1046 N N   . ASP A 1 131 ? 28.089  -7.192  57.441  1.00 55.89  ? 337 ASP A N   1 
ATOM   1047 C CA  . ASP A 1 131 ? 28.751  -7.144  56.131  1.00 55.81  ? 337 ASP A CA  1 
ATOM   1048 C C   . ASP A 1 131 ? 28.918  -5.772  55.452  1.00 55.77  ? 337 ASP A C   1 
ATOM   1049 O O   . ASP A 1 131 ? 29.620  -5.674  54.445  1.00 56.89  ? 337 ASP A O   1 
ATOM   1050 C CB  . ASP A 1 131 ? 28.046  -8.088  55.144  1.00 56.05  ? 337 ASP A CB  1 
ATOM   1051 C CG  . ASP A 1 131 ? 28.172  -9.551  55.530  1.00 57.69  ? 337 ASP A CG  1 
ATOM   1052 O OD1 . ASP A 1 131 ? 29.307  -10.065 55.625  1.00 58.79  ? 337 ASP A OD1 1 
ATOM   1053 O OD2 . ASP A 1 131 ? 27.126  -10.193 55.737  1.00 60.54  ? 337 ASP A OD2 1 
ATOM   1054 N N   . GLY A 1 132 ? 28.277  -4.726  55.973  1.00 53.02  ? 338 GLY A N   1 
ATOM   1055 C CA  . GLY A 1 132 ? 28.418  -3.407  55.370  1.00 45.26  ? 338 GLY A CA  1 
ATOM   1056 C C   . GLY A 1 132 ? 27.559  -2.360  56.047  1.00 39.63  ? 338 GLY A C   1 
ATOM   1057 O O   . GLY A 1 132 ? 27.183  -2.532  57.185  1.00 37.90  ? 338 GLY A O   1 
ATOM   1058 N N   . LEU A 1 133 ? 27.244  -1.270  55.364  1.00 38.40  ? 339 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 133 ? 26.407  -0.252  55.975  1.00 40.39  ? 339 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 133 ? 25.668  0.598   54.966  1.00 39.53  ? 339 LEU A C   1 
ATOM   1061 O O   . LEU A 1 133 ? 26.108  0.760   53.832  1.00 42.24  ? 339 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 133 ? 27.228  0.668   56.889  1.00 48.29  ? 339 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 133 ? 28.219  1.653   56.259  1.00 50.47  ? 339 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 133 ? 28.326  2.873   57.153  1.00 50.84  ? 339 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 133 ? 29.578  0.992   56.056  1.00 49.53  ? 339 LEU A CD2 1 
ATOM   1066 N N   . LEU A 1 134 ? 24.539  1.141   55.402  1.00 38.42  ? 340 LEU A N   1 
ATOM   1067 C CA  . LEU A 1 134 ? 23.696  2.002   54.585  1.00 39.21  ? 340 LEU A CA  1 
ATOM   1068 C C   . LEU A 1 134 ? 24.286  3.385   54.397  1.00 39.74  ? 340 LEU A C   1 
ATOM   1069 O O   . LEU A 1 134 ? 24.974  3.892   55.259  1.00 42.64  ? 340 LEU A O   1 
ATOM   1070 C CB  . LEU A 1 134 ? 22.330  2.190   55.250  1.00 40.08  ? 340 LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 134 ? 21.370  1.022   55.428  1.00 42.46  ? 340 LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 134 ? 20.119  1.537   56.110  1.00 42.81  ? 340 LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 134 ? 21.036  0.401   54.069  1.00 45.66  ? 340 LEU A CD2 1 
ATOM   1074 N N   . VAL A 1 135 ? 23.984  4.011   53.271  1.00 42.17  ? 341 VAL A N   1 
ATOM   1075 C CA  . VAL A 1 135 ? 24.444  5.364   53.029  1.00 42.76  ? 341 VAL A CA  1 
ATOM   1076 C C   . VAL A 1 135 ? 23.373  6.106   52.253  1.00 45.42  ? 341 VAL A C   1 
ATOM   1077 O O   . VAL A 1 135 ? 22.525  5.493   51.620  1.00 41.05  ? 341 VAL A O   1 
ATOM   1078 C CB  . VAL A 1 135 ? 25.784  5.400   52.256  1.00 43.68  ? 341 VAL A CB  1 
ATOM   1079 C CG1 . VAL A 1 135 ? 26.921  5.010   53.193  1.00 35.40  ? 341 VAL A CG1 1 
ATOM   1080 C CG2 . VAL A 1 135 ? 25.729  4.465   51.025  1.00 41.46  ? 341 VAL A CG2 1 
ATOM   1081 N N   . ALA A 1 136 ? 23.402  7.431   52.321  1.00 52.39  ? 342 ALA A N   1 
ATOM   1082 C CA  . ALA A 1 136 ? 22.414  8.242   51.622  1.00 57.19  ? 342 ALA A CA  1 
ATOM   1083 C C   . ALA A 1 136 ? 21.001  7.745   51.939  1.00 60.52  ? 342 ALA A C   1 
ATOM   1084 O O   . ALA A 1 136 ? 20.382  7.050   51.132  1.00 62.43  ? 342 ALA A O   1 
ATOM   1085 C CB  . ALA A 1 136 ? 22.668  8.187   50.114  1.00 58.23  ? 342 ALA A CB  1 
ATOM   1086 N N   . ASN A 1 137 ? 20.509  8.090   53.125  1.00 61.29  ? 343 ASN A N   1 
ATOM   1087 C CA  . ASN A 1 137 ? 19.169  7.702   53.565  1.00 64.45  ? 343 ASN A CA  1 
ATOM   1088 C C   . ASN A 1 137 ? 18.775  6.236   53.391  1.00 62.91  ? 343 ASN A C   1 
ATOM   1089 O O   . ASN A 1 137 ? 17.594  5.916   53.313  1.00 62.17  ? 343 ASN A O   1 
ATOM   1090 C CB  . ASN A 1 137 ? 18.118  8.583   52.884  1.00 67.58  ? 343 ASN A CB  1 
ATOM   1091 C CG  . ASN A 1 137 ? 18.186  10.023  53.340  1.00 71.26  ? 343 ASN A CG  1 
ATOM   1092 O OD1 . ASN A 1 137 ? 17.414  10.865  52.887  1.00 78.58  ? 343 ASN A OD1 1 
ATOM   1093 N ND2 . ASN A 1 137 ? 19.115  10.316  54.241  1.00 72.79  ? 343 ASN A ND2 1 
ATOM   1094 N N   . GLY A 1 138 ? 19.756  5.344   53.346  1.00 63.70  ? 344 GLY A N   1 
ATOM   1095 C CA  . GLY A 1 138 ? 19.443  3.933   53.199  1.00 65.44  ? 344 GLY A CA  1 
ATOM   1096 C C   . GLY A 1 138 ? 19.286  3.524   51.749  1.00 67.46  ? 344 GLY A C   1 
ATOM   1097 O O   . GLY A 1 138 ? 19.076  2.344   51.437  1.00 67.39  ? 344 GLY A O   1 
ATOM   1098 N N   . SER A 1 139 ? 19.379  4.508   50.861  1.00 64.91  ? 345 SER A N   1 
ATOM   1099 C CA  . SER A 1 139 ? 19.265  4.267   49.435  1.00 64.57  ? 345 SER A CA  1 
ATOM   1100 C C   . SER A 1 139 ? 20.409  3.360   48.987  1.00 63.52  ? 345 SER A C   1 
ATOM   1101 O O   . SER A 1 139 ? 20.251  2.535   48.084  1.00 63.47  ? 345 SER A O   1 
ATOM   1102 C CB  . SER A 1 139 ? 19.332  5.592   48.681  1.00 67.61  ? 345 SER A CB  1 
ATOM   1103 O OG  . SER A 1 139 ? 19.329  5.381   47.284  1.00 71.13  ? 345 SER A OG  1 
ATOM   1104 N N   . GLY A 1 140 ? 21.563  3.511   49.632  1.00 59.20  ? 346 GLY A N   1 
ATOM   1105 C CA  . GLY A 1 140 ? 22.709  2.697   49.275  1.00 54.41  ? 346 GLY A CA  1 
ATOM   1106 C C   . GLY A 1 140 ? 23.228  1.818   50.397  1.00 51.56  ? 346 GLY A C   1 
ATOM   1107 O O   . GLY A 1 140 ? 22.842  1.972   51.556  1.00 52.88  ? 346 GLY A O   1 
ATOM   1108 N N   . PHE A 1 141 ? 24.110  0.889   50.042  1.00 45.58  ? 347 PHE A N   1 
ATOM   1109 C CA  . PHE A 1 141 ? 24.706  -0.015  51.005  1.00 40.67  ? 347 PHE A CA  1 
ATOM   1110 C C   . PHE A 1 141 ? 26.141  -0.371  50.590  1.00 42.55  ? 347 PHE A C   1 
ATOM   1111 O O   . PHE A 1 141 ? 26.369  -1.072  49.605  1.00 41.18  ? 347 PHE A O   1 
ATOM   1112 C CB  . PHE A 1 141 ? 23.841  -1.267  51.134  1.00 38.87  ? 347 PHE A CB  1 
ATOM   1113 C CG  . PHE A 1 141 ? 24.366  -2.269  52.131  1.00 37.43  ? 347 PHE A CG  1 
ATOM   1114 C CD1 . PHE A 1 141 ? 25.136  -3.345  51.714  1.00 35.23  ? 347 PHE A CD1 1 
ATOM   1115 C CD2 . PHE A 1 141 ? 24.108  -2.123  53.481  1.00 30.50  ? 347 PHE A CD2 1 
ATOM   1116 C CE1 . PHE A 1 141 ? 25.636  -4.251  52.622  1.00 30.32  ? 347 PHE A CE1 1 
ATOM   1117 C CE2 . PHE A 1 141 ? 24.607  -3.026  54.394  1.00 33.48  ? 347 PHE A CE2 1 
ATOM   1118 C CZ  . PHE A 1 141 ? 25.375  -4.098  53.963  1.00 31.62  ? 347 PHE A CZ  1 
ATOM   1119 N N   . VAL A 1 142 ? 27.112  0.130   51.351  1.00 44.04  ? 348 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 142 ? 28.524  -0.111  51.057  1.00 43.21  ? 348 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 142 ? 29.051  -1.282  51.858  1.00 42.98  ? 348 VAL A C   1 
ATOM   1122 O O   . VAL A 1 142 ? 28.949  -1.304  53.078  1.00 42.23  ? 348 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 142 ? 29.376  1.128   51.368  1.00 42.17  ? 348 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 142 ? 30.823  0.852   51.036  1.00 41.80  ? 348 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 142 ? 28.871  2.321   50.561  1.00 44.79  ? 348 VAL A CG2 1 
ATOM   1126 N N   . THR A 1 143 ? 29.620  -2.266  51.174  1.00 43.26  ? 349 THR A N   1 
ATOM   1127 C CA  . THR A 1 143 ? 30.124  -3.446  51.870  1.00 44.65  ? 349 THR A CA  1 
ATOM   1128 C C   . THR A 1 143 ? 31.364  -3.190  52.731  1.00 43.16  ? 349 THR A C   1 
ATOM   1129 O O   . THR A 1 143 ? 32.187  -2.317  52.453  1.00 41.59  ? 349 THR A O   1 
ATOM   1130 C CB  . THR A 1 143 ? 30.408  -4.613  50.879  1.00 42.75  ? 349 THR A CB  1 
ATOM   1131 O OG1 . THR A 1 143 ? 31.561  -4.311  50.094  1.00 44.75  ? 349 THR A OG1 1 
ATOM   1132 C CG2 . THR A 1 143 ? 29.229  -4.801  49.946  1.00 41.31  ? 349 THR A CG2 1 
ATOM   1133 N N   . ARG A 1 144 ? 31.464  -3.969  53.796  1.00 45.65  ? 350 ARG A N   1 
ATOM   1134 C CA  . ARG A 1 144 ? 32.563  -3.874  54.732  1.00 46.43  ? 350 ARG A CA  1 
ATOM   1135 C C   . ARG A 1 144 ? 33.836  -4.285  54.010  1.00 49.44  ? 350 ARG A C   1 
ATOM   1136 O O   . ARG A 1 144 ? 34.911  -3.748  54.268  1.00 48.32  ? 350 ARG A O   1 
ATOM   1137 C CB  . ARG A 1 144 ? 32.283  -4.795  55.924  1.00 45.07  ? 350 ARG A CB  1 
ATOM   1138 C CG  . ARG A 1 144 ? 33.346  -4.796  56.982  1.00 44.39  ? 350 ARG A CG  1 
ATOM   1139 C CD  . ARG A 1 144 ? 32.931  -5.651  58.158  1.00 49.35  ? 350 ARG A CD  1 
ATOM   1140 N NE  . ARG A 1 144 ? 33.950  -5.625  59.200  1.00 51.43  ? 350 ARG A NE  1 
ATOM   1141 C CZ  . ARG A 1 144 ? 33.738  -5.954  60.466  1.00 52.09  ? 350 ARG A CZ  1 
ATOM   1142 N NH1 . ARG A 1 144 ? 32.536  -6.353  60.863  1.00 51.88  ? 350 ARG A NH1 1 
ATOM   1143 N NH2 . ARG A 1 144 ? 34.722  -5.835  61.346  1.00 51.74  ? 350 ARG A NH2 1 
ATOM   1144 N N   . GLU A 1 145 ? 33.697  -5.231  53.086  1.00 54.76  ? 351 GLU A N   1 
ATOM   1145 C CA  . GLU A 1 145 ? 34.835  -5.727  52.317  1.00 55.52  ? 351 GLU A CA  1 
ATOM   1146 C C   . GLU A 1 145 ? 35.448  -4.597  51.505  1.00 52.49  ? 351 GLU A C   1 
ATOM   1147 O O   . GLU A 1 145 ? 36.669  -4.410  51.507  1.00 53.45  ? 351 GLU A O   1 
ATOM   1148 C CB  . GLU A 1 145 ? 34.392  -6.853  51.386  1.00 61.65  ? 351 GLU A CB  1 
ATOM   1149 C CG  . GLU A 1 145 ? 33.392  -6.407  50.339  1.00 70.25  ? 351 GLU A CG  1 
ATOM   1150 C CD  . GLU A 1 145 ? 32.975  -7.525  49.402  1.00 74.67  ? 351 GLU A CD  1 
ATOM   1151 O OE1 . GLU A 1 145 ? 32.343  -8.496  49.874  1.00 79.42  ? 351 GLU A OE1 1 
ATOM   1152 O OE2 . GLU A 1 145 ? 33.280  -7.429  48.193  1.00 78.47  ? 351 GLU A OE2 1 
ATOM   1153 N N   . PHE A 1 146 ? 34.603  -3.846  50.809  1.00 47.58  ? 352 PHE A N   1 
ATOM   1154 C CA  . PHE A 1 146 ? 35.084  -2.727  50.012  1.00 45.10  ? 352 PHE A CA  1 
ATOM   1155 C C   . PHE A 1 146 ? 35.888  -1.773  50.908  1.00 45.54  ? 352 PHE A C   1 
ATOM   1156 O O   . PHE A 1 146 ? 37.085  -1.566  50.691  1.00 44.34  ? 352 PHE A O   1 
ATOM   1157 C CB  . PHE A 1 146 ? 33.900  -1.991  49.352  1.00 42.22  ? 352 PHE A CB  1 
ATOM   1158 C CG  . PHE A 1 146 ? 34.299  -0.766  48.560  1.00 40.01  ? 352 PHE A CG  1 
ATOM   1159 C CD1 . PHE A 1 146 ? 35.189  -0.859  47.504  1.00 36.58  ? 352 PHE A CD1 1 
ATOM   1160 C CD2 . PHE A 1 146 ? 33.812  0.494   48.908  1.00 44.96  ? 352 PHE A CD2 1 
ATOM   1161 C CE1 . PHE A 1 146 ? 35.594  0.279   46.812  1.00 38.45  ? 352 PHE A CE1 1 
ATOM   1162 C CE2 . PHE A 1 146 ? 34.211  1.648   48.223  1.00 36.83  ? 352 PHE A CE2 1 
ATOM   1163 C CZ  . PHE A 1 146 ? 35.102  1.539   47.176  1.00 37.84  ? 352 PHE A CZ  1 
ATOM   1164 N N   . LEU A 1 147 ? 35.247  -1.226  51.936  1.00 43.43  ? 353 LEU A N   1 
ATOM   1165 C CA  . LEU A 1 147 ? 35.938  -0.288  52.817  1.00 43.82  ? 353 LEU A CA  1 
ATOM   1166 C C   . LEU A 1 147 ? 37.328  -0.747  53.251  1.00 44.93  ? 353 LEU A C   1 
ATOM   1167 O O   . LEU A 1 147 ? 38.275  0.039   53.229  1.00 46.35  ? 353 LEU A O   1 
ATOM   1168 C CB  . LEU A 1 147 ? 35.069  0.038   54.034  1.00 37.20  ? 353 LEU A CB  1 
ATOM   1169 C CG  . LEU A 1 147 ? 33.732  0.660   53.607  1.00 36.85  ? 353 LEU A CG  1 
ATOM   1170 C CD1 . LEU A 1 147 ? 32.835  0.949   54.806  1.00 36.47  ? 353 LEU A CD1 1 
ATOM   1171 C CD2 . LEU A 1 147 ? 34.020  1.919   52.812  1.00 35.44  ? 353 LEU A CD2 1 
ATOM   1172 N N   . ARG A 1 148 ? 37.473  -2.018  53.606  1.00 44.49  ? 354 ARG A N   1 
ATOM   1173 C CA  . ARG A 1 148 ? 38.775  -2.503  54.043  1.00 49.27  ? 354 ARG A CA  1 
ATOM   1174 C C   . ARG A 1 148 ? 39.804  -2.709  52.934  1.00 50.10  ? 354 ARG A C   1 
ATOM   1175 O O   . ARG A 1 148 ? 40.926  -3.148  53.199  1.00 46.41  ? 354 ARG A O   1 
ATOM   1176 C CB  . ARG A 1 148 ? 38.612  -3.790  54.852  1.00 51.92  ? 354 ARG A CB  1 
ATOM   1177 C CG  . ARG A 1 148 ? 37.985  -4.937  54.113  1.00 53.71  ? 354 ARG A CG  1 
ATOM   1178 C CD  . ARG A 1 148 ? 37.248  -5.841  55.087  1.00 60.04  ? 354 ARG A CD  1 
ATOM   1179 N NE  . ARG A 1 148 ? 38.001  -6.052  56.318  1.00 63.59  ? 354 ARG A NE  1 
ATOM   1180 C CZ  . ARG A 1 148 ? 37.560  -6.764  57.350  1.00 68.25  ? 354 ARG A CZ  1 
ATOM   1181 N NH1 . ARG A 1 148 ? 36.364  -7.340  57.305  1.00 67.55  ? 354 ARG A NH1 1 
ATOM   1182 N NH2 . ARG A 1 148 ? 38.319  -6.903  58.430  1.00 70.93  ? 354 ARG A NH2 1 
ATOM   1183 N N   . SER A 1 149 ? 39.425  -2.379  51.701  1.00 51.53  ? 355 SER A N   1 
ATOM   1184 C CA  . SER A 1 149 ? 40.313  -2.521  50.551  1.00 53.63  ? 355 SER A CA  1 
ATOM   1185 C C   . SER A 1 149 ? 40.894  -1.170  50.135  1.00 54.97  ? 355 SER A C   1 
ATOM   1186 O O   . SER A 1 149 ? 41.474  -1.036  49.055  1.00 56.86  ? 355 SER A O   1 
ATOM   1187 C CB  . SER A 1 149 ? 39.551  -3.103  49.362  1.00 54.49  ? 355 SER A CB  1 
ATOM   1188 O OG  . SER A 1 149 ? 38.793  -2.094  48.710  1.00 54.04  ? 355 SER A OG  1 
ATOM   1189 N N   . LEU A 1 150 ? 40.724  -0.168  50.988  1.00 54.64  ? 356 LEU A N   1 
ATOM   1190 C CA  . LEU A 1 150 ? 41.218  1.164   50.694  1.00 56.30  ? 356 LEU A CA  1 
ATOM   1191 C C   . LEU A 1 150 ? 42.674  1.288   51.124  1.00 56.77  ? 356 LEU A C   1 
ATOM   1192 O O   . LEU A 1 150 ? 43.221  0.364   51.721  1.00 57.02  ? 356 LEU A O   1 
ATOM   1193 C CB  . LEU A 1 150 ? 40.336  2.187   51.411  1.00 56.44  ? 356 LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 150 ? 39.007  2.584   50.736  1.00 60.89  ? 356 LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 150 ? 38.437  1.431   49.915  1.00 59.87  ? 356 LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 150 ? 38.005  3.048   51.806  1.00 59.55  ? 356 LEU A CD2 1 
ATOM   1197 N N   . ARG A 1 151 ? 43.316  2.408   50.801  1.00 57.28  ? 357 ARG A N   1 
ATOM   1198 C CA  . ARG A 1 151 ? 44.707  2.599   51.206  1.00 57.15  ? 357 ARG A CA  1 
ATOM   1199 C C   . ARG A 1 151 ? 44.790  2.476   52.723  1.00 56.93  ? 357 ARG A C   1 
ATOM   1200 O O   . ARG A 1 151 ? 43.937  2.988   53.442  1.00 57.31  ? 357 ARG A O   1 
ATOM   1201 C CB  . ARG A 1 151 ? 45.235  3.978   50.779  1.00 59.78  ? 357 ARG A CB  1 
ATOM   1202 C CG  . ARG A 1 151 ? 45.066  4.288   49.305  1.00 57.15  ? 357 ARG A CG  1 
ATOM   1203 C CD  . ARG A 1 151 ? 46.190  5.156   48.747  1.00 56.59  ? 357 ARG A CD  1 
ATOM   1204 N NE  . ARG A 1 151 ? 46.068  6.581   49.036  1.00 54.02  ? 357 ARG A NE  1 
ATOM   1205 C CZ  . ARG A 1 151 ? 46.575  7.181   50.108  1.00 53.15  ? 357 ARG A CZ  1 
ATOM   1206 N NH1 . ARG A 1 151 ? 47.240  6.478   51.012  1.00 51.33  ? 357 ARG A NH1 1 
ATOM   1207 N NH2 . ARG A 1 151 ? 46.448  8.493   50.254  1.00 48.71  ? 357 ARG A NH2 1 
ATOM   1208 N N   . LYS A 1 152 ? 45.840  1.808   53.188  1.00 57.58  ? 358 LYS A N   1 
ATOM   1209 C CA  . LYS A 1 152 ? 46.087  1.556   54.601  1.00 55.46  ? 358 LYS A CA  1 
ATOM   1210 C C   . LYS A 1 152 ? 45.640  2.638   55.563  1.00 58.00  ? 358 LYS A C   1 
ATOM   1211 O O   . LYS A 1 152 ? 45.092  2.336   56.628  1.00 62.82  ? 358 LYS A O   1 
ATOM   1212 C CB  . LYS A 1 152 ? 47.566  1.281   54.834  1.00 53.28  ? 358 LYS A CB  1 
ATOM   1213 C CG  . LYS A 1 152 ? 47.918  1.060   56.293  1.00 56.29  ? 358 LYS A CG  1 
ATOM   1214 C CD  . LYS A 1 152 ? 47.149  -0.117  56.884  1.00 56.05  ? 358 LYS A CD  1 
ATOM   1215 C CE  . LYS A 1 152 ? 47.658  -1.436  56.326  1.00 56.60  ? 358 LYS A CE  1 
ATOM   1216 N NZ  . LYS A 1 152 ? 46.826  -2.609  56.732  1.00 61.71  ? 358 LYS A NZ  1 
ATOM   1217 N N   . PRO A 1 153 ? 45.867  3.916   55.221  1.00 53.87  ? 359 PRO A N   1 
ATOM   1218 C CA  . PRO A 1 153 ? 45.406  4.897   56.208  1.00 50.09  ? 359 PRO A CA  1 
ATOM   1219 C C   . PRO A 1 153 ? 43.889  4.860   56.430  1.00 47.92  ? 359 PRO A C   1 
ATOM   1220 O O   . PRO A 1 153 ? 43.412  4.504   57.506  1.00 43.89  ? 359 PRO A O   1 
ATOM   1221 C CB  . PRO A 1 153 ? 45.895  6.229   55.626  1.00 51.12  ? 359 PRO A CB  1 
ATOM   1222 C CG  . PRO A 1 153 ? 45.937  5.958   54.120  1.00 50.27  ? 359 PRO A CG  1 
ATOM   1223 C CD  . PRO A 1 153 ? 46.499  4.562   54.056  1.00 50.87  ? 359 PRO A CD  1 
ATOM   1224 N N   . PHE A 1 154 ? 43.144  5.204   55.389  1.00 46.53  ? 360 PHE A N   1 
ATOM   1225 C CA  . PHE A 1 154 ? 41.693  5.269   55.443  1.00 47.31  ? 360 PHE A CA  1 
ATOM   1226 C C   . PHE A 1 154 ? 41.004  3.972   55.853  1.00 47.03  ? 360 PHE A C   1 
ATOM   1227 O O   . PHE A 1 154 ? 40.014  3.984   56.576  1.00 45.35  ? 360 PHE A O   1 
ATOM   1228 C CB  . PHE A 1 154 ? 41.180  5.758   54.090  1.00 47.20  ? 360 PHE A CB  1 
ATOM   1229 C CG  . PHE A 1 154 ? 41.890  6.988   53.596  1.00 44.70  ? 360 PHE A CG  1 
ATOM   1230 C CD1 . PHE A 1 154 ? 43.034  6.878   52.810  1.00 46.32  ? 360 PHE A CD1 1 
ATOM   1231 C CD2 . PHE A 1 154 ? 41.433  8.258   53.946  1.00 43.87  ? 360 PHE A CD2 1 
ATOM   1232 C CE1 . PHE A 1 154 ? 43.722  8.026   52.370  1.00 46.79  ? 360 PHE A CE1 1 
ATOM   1233 C CE2 . PHE A 1 154 ? 42.104  9.415   53.520  1.00 45.41  ? 360 PHE A CE2 1 
ATOM   1234 C CZ  . PHE A 1 154 ? 43.253  9.303   52.727  1.00 46.90  ? 360 PHE A CZ  1 
ATOM   1235 N N   . SER A 1 155 ? 41.539  2.850   55.402  1.00 49.12  ? 361 SER A N   1 
ATOM   1236 C CA  . SER A 1 155 ? 40.985  1.549   55.743  1.00 50.71  ? 361 SER A CA  1 
ATOM   1237 C C   . SER A 1 155 ? 40.920  1.217   57.242  1.00 49.71  ? 361 SER A C   1 
ATOM   1238 O O   . SER A 1 155 ? 39.922  0.671   57.698  1.00 49.87  ? 361 SER A O   1 
ATOM   1239 C CB  . SER A 1 155 ? 41.774  0.459   55.022  1.00 52.92  ? 361 SER A CB  1 
ATOM   1240 O OG  . SER A 1 155 ? 41.696  0.642   53.619  1.00 62.06  ? 361 SER A OG  1 
ATOM   1241 N N   . ASP A 1 156 ? 41.955  1.545   58.013  1.00 49.05  ? 362 ASP A N   1 
ATOM   1242 C CA  . ASP A 1 156 ? 41.928  1.191   59.430  1.00 53.11  ? 362 ASP A CA  1 
ATOM   1243 C C   . ASP A 1 156 ? 41.246  2.163   60.389  1.00 52.23  ? 362 ASP A C   1 
ATOM   1244 O O   . ASP A 1 156 ? 41.150  1.893   61.590  1.00 49.69  ? 362 ASP A O   1 
ATOM   1245 C CB  . ASP A 1 156 ? 43.335  0.848   59.937  1.00 58.11  ? 362 ASP A CB  1 
ATOM   1246 C CG  . ASP A 1 156 ? 44.378  1.845   59.503  1.00 64.09  ? 362 ASP A CG  1 
ATOM   1247 O OD1 . ASP A 1 156 ? 44.139  3.062   59.655  1.00 67.99  ? 362 ASP A OD1 1 
ATOM   1248 O OD2 . ASP A 1 156 ? 45.444  1.404   59.015  1.00 66.43  ? 362 ASP A OD2 1 
ATOM   1249 N N   . ILE A 1 157 ? 40.767  3.289   59.877  1.00 52.47  ? 363 ILE A N   1 
ATOM   1250 C CA  . ILE A 1 157 ? 40.040  4.212   60.738  1.00 52.93  ? 363 ILE A CA  1 
ATOM   1251 C C   . ILE A 1 157 ? 38.579  3.749   60.667  1.00 52.65  ? 363 ILE A C   1 
ATOM   1252 O O   . ILE A 1 157 ? 37.770  4.052   61.538  1.00 52.55  ? 363 ILE A O   1 
ATOM   1253 C CB  . ILE A 1 157 ? 40.146  5.669   60.254  1.00 52.68  ? 363 ILE A CB  1 
ATOM   1254 C CG1 . ILE A 1 157 ? 39.422  5.831   58.927  1.00 52.34  ? 363 ILE A CG1 1 
ATOM   1255 C CG2 . ILE A 1 157 ? 41.608  6.057   60.097  1.00 57.57  ? 363 ILE A CG2 1 
ATOM   1256 C CD1 . ILE A 1 157 ? 39.484  7.235   58.376  1.00 56.96  ? 363 ILE A CD1 1 
ATOM   1257 N N   . ILE A 1 158 ? 38.272  2.981   59.622  1.00 51.38  ? 364 ILE A N   1 
ATOM   1258 C CA  . ILE A 1 158 ? 36.934  2.449   59.391  1.00 49.34  ? 364 ILE A CA  1 
ATOM   1259 C C   . ILE A 1 158 ? 36.660  1.135   60.140  1.00 46.11  ? 364 ILE A C   1 
ATOM   1260 O O   . ILE A 1 158 ? 35.609  0.982   60.759  1.00 42.15  ? 364 ILE A O   1 
ATOM   1261 C CB  . ILE A 1 158 ? 36.694  2.215   57.866  1.00 52.51  ? 364 ILE A CB  1 
ATOM   1262 C CG1 . ILE A 1 158 ? 36.857  3.525   57.101  1.00 52.16  ? 364 ILE A CG1 1 
ATOM   1263 C CG2 . ILE A 1 158 ? 35.277  1.692   57.623  1.00 52.75  ? 364 ILE A CG2 1 
ATOM   1264 C CD1 . ILE A 1 158 ? 35.729  4.499   57.338  1.00 55.20  ? 364 ILE A CD1 1 
ATOM   1265 N N   . GLU A 1 159 ? 37.605  0.194   60.077  1.00 45.50  ? 365 GLU A N   1 
ATOM   1266 C CA  . GLU A 1 159 ? 37.465  -1.120  60.728  1.00 45.53  ? 365 GLU A CA  1 
ATOM   1267 C C   . GLU A 1 159 ? 36.993  -1.097  62.172  1.00 44.03  ? 365 GLU A C   1 
ATOM   1268 O O   . GLU A 1 159 ? 35.954  -1.668  62.485  1.00 45.52  ? 365 GLU A O   1 
ATOM   1269 C CB  . GLU A 1 159 ? 38.781  -1.916  60.663  1.00 49.31  ? 365 GLU A CB  1 
ATOM   1270 C CG  . GLU A 1 159 ? 38.695  -3.239  59.899  1.00 52.79  ? 365 GLU A CG  1 
ATOM   1271 C CD  . GLU A 1 159 ? 37.686  -4.214  60.496  1.00 55.76  ? 365 GLU A CD  1 
ATOM   1272 O OE1 . GLU A 1 159 ? 37.889  -4.674  61.640  1.00 55.53  ? 365 GLU A OE1 1 
ATOM   1273 O OE2 . GLU A 1 159 ? 36.686  -4.522  59.814  1.00 55.27  ? 365 GLU A OE2 1 
ATOM   1274 N N   . PRO A 1 160 ? 37.740  -0.432  63.073  1.00 43.32  ? 366 PRO A N   1 
ATOM   1275 C CA  . PRO A 1 160 ? 37.356  -0.367  64.495  1.00 43.23  ? 366 PRO A CA  1 
ATOM   1276 C C   . PRO A 1 160 ? 35.875  -0.007  64.751  1.00 44.30  ? 366 PRO A C   1 
ATOM   1277 O O   . PRO A 1 160 ? 35.245  -0.514  65.696  1.00 42.43  ? 366 PRO A O   1 
ATOM   1278 C CB  . PRO A 1 160 ? 38.321  0.672   65.064  1.00 42.28  ? 366 PRO A CB  1 
ATOM   1279 C CG  . PRO A 1 160 ? 39.519  0.544   64.154  1.00 43.50  ? 366 PRO A CG  1 
ATOM   1280 C CD  . PRO A 1 160 ? 38.899  0.439   62.805  1.00 39.38  ? 366 PRO A CD  1 
ATOM   1281 N N   . LYS A 1 161 ? 35.329  0.864   63.909  1.00 42.72  ? 367 LYS A N   1 
ATOM   1282 C CA  . LYS A 1 161 ? 33.936  1.272   64.023  1.00 46.44  ? 367 LYS A CA  1 
ATOM   1283 C C   . LYS A 1 161 ? 32.985  0.072   63.886  1.00 47.30  ? 367 LYS A C   1 
ATOM   1284 O O   . LYS A 1 161 ? 31.974  -0.014  64.586  1.00 44.12  ? 367 LYS A O   1 
ATOM   1285 C CB  . LYS A 1 161 ? 33.634  2.306   62.952  1.00 51.57  ? 367 LYS A CB  1 
ATOM   1286 C CG  . LYS A 1 161 ? 34.715  3.358   62.827  1.00 52.51  ? 367 LYS A CG  1 
ATOM   1287 C CD  . LYS A 1 161 ? 34.851  4.160   64.094  1.00 50.91  ? 367 LYS A CD  1 
ATOM   1288 C CE  . LYS A 1 161 ? 35.713  5.417   63.884  1.00 53.75  ? 367 LYS A CE  1 
ATOM   1289 N NZ  . LYS A 1 161 ? 37.127  5.185   63.505  1.00 49.90  ? 367 LYS A NZ  1 
ATOM   1290 N N   . PHE A 1 162 ? 33.316  -0.848  62.980  1.00 48.35  ? 368 PHE A N   1 
ATOM   1291 C CA  . PHE A 1 162 ? 32.522  -2.058  62.780  1.00 48.93  ? 368 PHE A CA  1 
ATOM   1292 C C   . PHE A 1 162 ? 32.640  -2.969  63.980  1.00 52.37  ? 368 PHE A C   1 
ATOM   1293 O O   . PHE A 1 162 ? 31.629  -3.419  64.518  1.00 54.59  ? 368 PHE A O   1 
ATOM   1294 C CB  . PHE A 1 162 ? 32.967  -2.817  61.529  1.00 45.24  ? 368 PHE A CB  1 
ATOM   1295 C CG  . PHE A 1 162 ? 32.235  -2.404  60.293  1.00 43.75  ? 368 PHE A CG  1 
ATOM   1296 C CD1 . PHE A 1 162 ? 30.865  -2.663  60.166  1.00 43.72  ? 368 PHE A CD1 1 
ATOM   1297 C CD2 . PHE A 1 162 ? 32.887  -1.701  59.282  1.00 41.40  ? 368 PHE A CD2 1 
ATOM   1298 C CE1 . PHE A 1 162 ? 30.147  -2.225  59.054  1.00 36.90  ? 368 PHE A CE1 1 
ATOM   1299 C CE2 . PHE A 1 162 ? 32.185  -1.258  58.165  1.00 41.84  ? 368 PHE A CE2 1 
ATOM   1300 C CZ  . PHE A 1 162 ? 30.803  -1.522  58.054  1.00 40.43  ? 368 PHE A CZ  1 
ATOM   1301 N N   . GLU A 1 163 ? 33.871  -3.247  64.399  1.00 53.06  ? 369 GLU A N   1 
ATOM   1302 C CA  . GLU A 1 163 ? 34.077  -4.116  65.550  1.00 54.69  ? 369 GLU A CA  1 
ATOM   1303 C C   . GLU A 1 163 ? 33.193  -3.633  66.683  1.00 52.56  ? 369 GLU A C   1 
ATOM   1304 O O   . GLU A 1 163 ? 32.619  -4.437  67.419  1.00 55.72  ? 369 GLU A O   1 
ATOM   1305 C CB  . GLU A 1 163 ? 35.544  -4.108  66.006  1.00 55.73  ? 369 GLU A CB  1 
ATOM   1306 C CG  . GLU A 1 163 ? 36.488  -4.904  65.117  1.00 60.51  ? 369 GLU A CG  1 
ATOM   1307 C CD  . GLU A 1 163 ? 37.932  -4.839  65.590  1.00 64.09  ? 369 GLU A CD  1 
ATOM   1308 O OE1 . GLU A 1 163 ? 38.197  -5.246  66.740  1.00 67.23  ? 369 GLU A OE1 1 
ATOM   1309 O OE2 . GLU A 1 163 ? 38.801  -4.380  64.813  1.00 63.15  ? 369 GLU A OE2 1 
ATOM   1310 N N   . PHE A 1 164 ? 33.069  -2.318  66.817  1.00 48.53  ? 370 PHE A N   1 
ATOM   1311 C CA  . PHE A 1 164 ? 32.253  -1.772  67.887  1.00 43.32  ? 370 PHE A CA  1 
ATOM   1312 C C   . PHE A 1 164 ? 30.767  -1.953  67.605  1.00 42.63  ? 370 PHE A C   1 
ATOM   1313 O O   . PHE A 1 164 ? 30.027  -2.440  68.455  1.00 41.83  ? 370 PHE A O   1 
ATOM   1314 C CB  . PHE A 1 164 ? 32.574  -0.287  68.109  1.00 33.20  ? 370 PHE A CB  1 
ATOM   1315 C CG  . PHE A 1 164 ? 31.741  0.347   69.179  1.00 31.33  ? 370 PHE A CG  1 
ATOM   1316 C CD1 . PHE A 1 164 ? 30.413  0.680   68.940  1.00 29.95  ? 370 PHE A CD1 1 
ATOM   1317 C CD2 . PHE A 1 164 ? 32.245  0.518   70.457  1.00 22.03  ? 370 PHE A CD2 1 
ATOM   1318 C CE1 . PHE A 1 164 ? 29.608  1.164   69.954  1.00 26.76  ? 370 PHE A CE1 1 
ATOM   1319 C CE2 . PHE A 1 164 ? 31.447  0.998   71.463  1.00 23.89  ? 370 PHE A CE2 1 
ATOM   1320 C CZ  . PHE A 1 164 ? 30.119  1.321   71.216  1.00 19.97  ? 370 PHE A CZ  1 
ATOM   1321 N N   . ALA A 1 165 ? 30.347  -1.567  66.405  1.00 45.10  ? 371 ALA A N   1 
ATOM   1322 C CA  . ALA A 1 165 ? 28.950  -1.645  65.979  1.00 45.31  ? 371 ALA A CA  1 
ATOM   1323 C C   . ALA A 1 165 ? 28.306  -3.020  66.134  1.00 46.86  ? 371 ALA A C   1 
ATOM   1324 O O   . ALA A 1 165 ? 27.178  -3.142  66.608  1.00 49.03  ? 371 ALA A O   1 
ATOM   1325 C CB  . ALA A 1 165 ? 28.838  -1.187  64.534  1.00 40.25  ? 371 ALA A CB  1 
ATOM   1326 N N   . VAL A 1 166 ? 29.027  -4.052  65.726  1.00 48.33  ? 372 VAL A N   1 
ATOM   1327 C CA  . VAL A 1 166 ? 28.525  -5.412  65.801  1.00 49.88  ? 372 VAL A CA  1 
ATOM   1328 C C   . VAL A 1 166 ? 28.233  -5.823  67.241  1.00 51.67  ? 372 VAL A C   1 
ATOM   1329 O O   . VAL A 1 166 ? 27.167  -6.374  67.536  1.00 51.77  ? 372 VAL A O   1 
ATOM   1330 C CB  . VAL A 1 166 ? 29.539  -6.392  65.152  1.00 50.95  ? 372 VAL A CB  1 
ATOM   1331 C CG1 . VAL A 1 166 ? 29.052  -7.829  65.273  1.00 51.95  ? 372 VAL A CG1 1 
ATOM   1332 C CG2 . VAL A 1 166 ? 29.730  -6.024  63.689  1.00 50.36  ? 372 VAL A CG2 1 
ATOM   1333 N N   . LYS A 1 167 ? 29.174  -5.550  68.138  1.00 51.14  ? 373 LYS A N   1 
ATOM   1334 C CA  . LYS A 1 167 ? 28.992  -5.895  69.543  1.00 49.59  ? 373 LYS A CA  1 
ATOM   1335 C C   . LYS A 1 167 ? 27.915  -5.017  70.171  1.00 47.90  ? 373 LYS A C   1 
ATOM   1336 O O   . LYS A 1 167 ? 27.198  -5.441  71.079  1.00 47.25  ? 373 LYS A O   1 
ATOM   1337 C CB  . LYS A 1 167 ? 30.310  -5.725  70.315  1.00 52.46  ? 373 LYS A CB  1 
ATOM   1338 C CG  . LYS A 1 167 ? 31.418  -6.709  69.915  1.00 58.65  ? 373 LYS A CG  1 
ATOM   1339 C CD  . LYS A 1 167 ? 32.716  -6.450  70.679  1.00 60.18  ? 373 LYS A CD  1 
ATOM   1340 C CE  . LYS A 1 167 ? 33.241  -5.035  70.430  1.00 63.62  ? 373 LYS A CE  1 
ATOM   1341 N NZ  . LYS A 1 167 ? 34.478  -4.718  71.193  1.00 64.51  ? 373 LYS A NZ  1 
ATOM   1342 N N   . PHE A 1 168 ? 27.803  -3.786  69.689  1.00 43.35  ? 374 PHE A N   1 
ATOM   1343 C CA  . PHE A 1 168 ? 26.819  -2.887  70.240  1.00 39.17  ? 374 PHE A CA  1 
ATOM   1344 C C   . PHE A 1 168 ? 25.426  -3.367  69.889  1.00 37.74  ? 374 PHE A C   1 
ATOM   1345 O O   . PHE A 1 168 ? 24.544  -3.361  70.729  1.00 38.21  ? 374 PHE A O   1 
ATOM   1346 C CB  . PHE A 1 168 ? 27.031  -1.461  69.729  1.00 38.63  ? 374 PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 168 ? 26.253  -0.429  70.499  1.00 38.27  ? 374 PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 168 ? 26.587  -0.129  71.817  1.00 37.29  ? 374 PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 168 ? 25.169  0.220   69.923  1.00 33.92  ? 374 PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 168 ? 25.856  0.798   72.541  1.00 35.09  ? 374 PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 168 ? 24.435  1.143   70.638  1.00 28.86  ? 374 PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 168 ? 24.778  1.433   71.947  1.00 35.83  ? 374 PHE A CZ  1 
ATOM   1353 N N   . ASN A 1 169 ? 25.225  -3.799  68.652  1.00 38.55  ? 375 ASN A N   1 
ATOM   1354 C CA  . ASN A 1 169 ? 23.912  -4.267  68.237  1.00 40.97  ? 375 ASN A CA  1 
ATOM   1355 C C   . ASN A 1 169 ? 23.436  -5.552  68.922  1.00 42.19  ? 375 ASN A C   1 
ATOM   1356 O O   . ASN A 1 169 ? 22.256  -5.886  68.873  1.00 43.81  ? 375 ASN A O   1 
ATOM   1357 C CB  . ASN A 1 169 ? 23.863  -4.413  66.716  1.00 40.30  ? 375 ASN A CB  1 
ATOM   1358 C CG  . ASN A 1 169 ? 23.803  -3.069  66.007  1.00 42.44  ? 375 ASN A CG  1 
ATOM   1359 O OD1 . ASN A 1 169 ? 23.515  -2.046  66.628  1.00 42.37  ? 375 ASN A OD1 1 
ATOM   1360 N ND2 . ASN A 1 169 ? 24.060  -3.068  64.703  1.00 40.69  ? 375 ASN A ND2 1 
ATOM   1361 N N   . ALA A 1 170 ? 24.346  -6.261  69.570  1.00 42.63  ? 376 ALA A N   1 
ATOM   1362 C CA  . ALA A 1 170 ? 23.976  -7.470  70.287  1.00 44.38  ? 376 ALA A CA  1 
ATOM   1363 C C   . ALA A 1 170 ? 23.081  -7.118  71.490  1.00 45.77  ? 376 ALA A C   1 
ATOM   1364 O O   . ALA A 1 170 ? 22.271  -7.939  71.939  1.00 44.56  ? 376 ALA A O   1 
ATOM   1365 C CB  . ALA A 1 170 ? 25.224  -8.195  70.753  1.00 42.18  ? 376 ALA A CB  1 
ATOM   1366 N N   . LEU A 1 171 ? 23.225  -5.896  72.007  1.00 45.63  ? 377 LEU A N   1 
ATOM   1367 C CA  . LEU A 1 171 ? 22.414  -5.448  73.141  1.00 46.35  ? 377 LEU A CA  1 
ATOM   1368 C C   . LEU A 1 171 ? 20.931  -5.276  72.762  1.00 48.83  ? 377 LEU A C   1 
ATOM   1369 O O   . LEU A 1 171 ? 20.061  -5.172  73.643  1.00 47.23  ? 377 LEU A O   1 
ATOM   1370 C CB  . LEU A 1 171 ? 22.962  -4.139  73.706  1.00 47.68  ? 377 LEU A CB  1 
ATOM   1371 C CG  . LEU A 1 171 ? 24.358  -4.173  74.336  1.00 49.79  ? 377 LEU A CG  1 
ATOM   1372 C CD1 . LEU A 1 171 ? 25.395  -4.446  73.268  1.00 52.87  ? 377 LEU A CD1 1 
ATOM   1373 C CD2 . LEU A 1 171 ? 24.650  -2.842  75.000  1.00 50.61  ? 377 LEU A CD2 1 
ATOM   1374 N N   . GLU A 1 172 ? 20.661  -5.228  71.453  1.00 47.20  ? 378 GLU A N   1 
ATOM   1375 C CA  . GLU A 1 172 ? 19.300  -5.128  70.921  1.00 48.81  ? 378 GLU A CA  1 
ATOM   1376 C C   . GLU A 1 172 ? 18.506  -3.898  71.381  1.00 46.97  ? 378 GLU A C   1 
ATOM   1377 O O   . GLU A 1 172 ? 17.371  -4.017  71.814  1.00 44.82  ? 378 GLU A O   1 
ATOM   1378 C CB  . GLU A 1 172 ? 18.523  -6.397  71.301  1.00 55.09  ? 378 GLU A CB  1 
ATOM   1379 C CG  . GLU A 1 172 ? 19.265  -7.709  71.042  1.00 63.42  ? 378 GLU A CG  1 
ATOM   1380 C CD  . GLU A 1 172 ? 18.703  -8.877  71.846  1.00 69.29  ? 378 GLU A CD  1 
ATOM   1381 O OE1 . GLU A 1 172 ? 17.474  -9.107  71.784  1.00 72.37  ? 378 GLU A OE1 1 
ATOM   1382 O OE2 . GLU A 1 172 ? 19.492  -9.565  72.538  1.00 69.55  ? 378 GLU A OE2 1 
ATOM   1383 N N   . LEU A 1 173 ? 19.095  -2.718  71.275  1.00 46.48  ? 379 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 173 ? 18.423  -1.489  71.690  1.00 45.94  ? 379 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 173 ? 17.493  -0.910  70.617  1.00 45.85  ? 379 LEU A C   1 
ATOM   1386 O O   . LEU A 1 173 ? 17.743  -1.072  69.430  1.00 45.41  ? 379 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 173 ? 19.472  -0.433  72.051  1.00 43.98  ? 379 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 173 ? 20.350  -0.680  73.277  1.00 44.05  ? 379 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 173 ? 21.425  0.391   73.346  1.00 40.61  ? 379 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 173 ? 19.493  -0.654  74.528  1.00 40.80  ? 379 LEU A CD2 1 
ATOM   1391 N N   . ASP A 1 174 ? 16.421  -0.240  71.041  1.00 44.86  ? 380 ASP A N   1 
ATOM   1392 C CA  . ASP A 1 174 ? 15.499  0.398   70.100  1.00 45.29  ? 380 ASP A CA  1 
ATOM   1393 C C   . ASP A 1 174 ? 15.801  1.899   70.118  1.00 43.14  ? 380 ASP A C   1 
ATOM   1394 O O   . ASP A 1 174 ? 16.670  2.338   70.867  1.00 46.14  ? 380 ASP A O   1 
ATOM   1395 C CB  . ASP A 1 174 ? 14.026  0.131   70.461  1.00 46.21  ? 380 ASP A CB  1 
ATOM   1396 C CG  . ASP A 1 174 ? 13.634  0.677   71.818  1.00 49.51  ? 380 ASP A CG  1 
ATOM   1397 O OD1 . ASP A 1 174 ? 14.066  1.794   72.190  1.00 48.27  ? 380 ASP A OD1 1 
ATOM   1398 O OD2 . ASP A 1 174 ? 12.864  -0.024  72.503  1.00 52.21  ? 380 ASP A OD2 1 
ATOM   1399 N N   . ASP A 1 175 ? 15.096  2.683   69.311  1.00 38.18  ? 381 ASP A N   1 
ATOM   1400 C CA  . ASP A 1 175 ? 15.371  4.110   69.241  1.00 35.94  ? 381 ASP A CA  1 
ATOM   1401 C C   . ASP A 1 175 ? 15.148  4.864   70.528  1.00 36.52  ? 381 ASP A C   1 
ATOM   1402 O O   . ASP A 1 175 ? 15.922  5.760   70.854  1.00 36.84  ? 381 ASP A O   1 
ATOM   1403 C CB  . ASP A 1 175 ? 14.564  4.760   68.123  1.00 36.13  ? 381 ASP A CB  1 
ATOM   1404 C CG  . ASP A 1 175 ? 15.060  4.363   66.747  1.00 33.56  ? 381 ASP A CG  1 
ATOM   1405 O OD1 . ASP A 1 175 ? 16.209  4.681   66.394  1.00 33.33  ? 381 ASP A OD1 1 
ATOM   1406 O OD2 . ASP A 1 175 ? 14.296  3.722   66.010  1.00 41.25  ? 381 ASP A OD2 1 
ATOM   1407 N N   . SER A 1 176 ? 14.103  4.500   71.267  1.00 37.86  ? 382 SER A N   1 
ATOM   1408 C CA  . SER A 1 176 ? 13.796  5.167   72.531  1.00 34.95  ? 382 SER A CA  1 
ATOM   1409 C C   . SER A 1 176 ? 14.940  4.963   73.521  1.00 35.86  ? 382 SER A C   1 
ATOM   1410 O O   . SER A 1 176 ? 15.195  5.821   74.362  1.00 37.48  ? 382 SER A O   1 
ATOM   1411 C CB  . SER A 1 176 ? 12.499  4.621   73.117  1.00 31.18  ? 382 SER A CB  1 
ATOM   1412 O OG  . SER A 1 176 ? 12.677  3.276   73.506  1.00 32.60  ? 382 SER A OG  1 
ATOM   1413 N N   . ASP A 1 177 ? 15.620  3.823   73.440  1.00 36.03  ? 383 ASP A N   1 
ATOM   1414 C CA  . ASP A 1 177 ? 16.761  3.578   74.319  1.00 40.30  ? 383 ASP A CA  1 
ATOM   1415 C C   . ASP A 1 177 ? 17.909  4.486   73.857  1.00 37.51  ? 383 ASP A C   1 
ATOM   1416 O O   . ASP A 1 177 ? 18.534  5.194   74.649  1.00 35.90  ? 383 ASP A O   1 
ATOM   1417 C CB  . ASP A 1 177 ? 17.236  2.116   74.237  1.00 44.80  ? 383 ASP A CB  1 
ATOM   1418 C CG  . ASP A 1 177 ? 16.143  1.119   74.547  1.00 48.50  ? 383 ASP A CG  1 
ATOM   1419 O OD1 . ASP A 1 177 ? 15.348  1.381   75.477  1.00 51.69  ? 383 ASP A OD1 1 
ATOM   1420 O OD2 . ASP A 1 177 ? 16.093  0.070   73.867  1.00 44.53  ? 383 ASP A OD2 1 
ATOM   1421 N N   . LEU A 1 178 ? 18.179  4.461   72.560  1.00 35.65  ? 384 LEU A N   1 
ATOM   1422 C CA  . LEU A 1 178 ? 19.261  5.263   72.014  1.00 35.90  ? 384 LEU A CA  1 
ATOM   1423 C C   . LEU A 1 178 ? 19.124  6.743   72.344  1.00 36.57  ? 384 LEU A C   1 
ATOM   1424 O O   . LEU A 1 178 ? 20.119  7.419   72.593  1.00 35.64  ? 384 LEU A O   1 
ATOM   1425 C CB  . LEU A 1 178 ? 19.332  5.081   70.501  1.00 34.46  ? 384 LEU A CB  1 
ATOM   1426 C CG  . LEU A 1 178 ? 19.629  3.660   70.048  1.00 31.88  ? 384 LEU A CG  1 
ATOM   1427 C CD1 . LEU A 1 178 ? 19.352  3.590   68.569  1.00 25.29  ? 384 LEU A CD1 1 
ATOM   1428 C CD2 . LEU A 1 178 ? 21.077  3.276   70.366  1.00 27.85  ? 384 LEU A CD2 1 
ATOM   1429 N N   . ALA A 1 179 ? 17.896  7.247   72.350  1.00 34.77  ? 385 ALA A N   1 
ATOM   1430 C CA  . ALA A 1 179 ? 17.697  8.654   72.628  1.00 35.49  ? 385 ALA A CA  1 
ATOM   1431 C C   . ALA A 1 179 ? 18.265  8.980   73.992  1.00 38.91  ? 385 ALA A C   1 
ATOM   1432 O O   . ALA A 1 179 ? 18.983  9.963   74.146  1.00 44.47  ? 385 ALA A O   1 
ATOM   1433 C CB  . ALA A 1 179 ? 16.213  9.014   72.553  1.00 36.01  ? 385 ALA A CB  1 
ATOM   1434 N N   . LEU A 1 180 ? 17.961  8.146   74.978  1.00 36.44  ? 386 LEU A N   1 
ATOM   1435 C CA  . LEU A 1 180 ? 18.459  8.363   76.326  1.00 34.14  ? 386 LEU A CA  1 
ATOM   1436 C C   . LEU A 1 180 ? 19.975  8.197   76.381  1.00 35.30  ? 386 LEU A C   1 
ATOM   1437 O O   . LEU A 1 180 ? 20.678  8.979   77.022  1.00 28.82  ? 386 LEU A O   1 
ATOM   1438 C CB  . LEU A 1 180 ? 17.774  7.383   77.285  1.00 33.85  ? 386 LEU A CB  1 
ATOM   1439 C CG  . LEU A 1 180 ? 16.299  7.718   77.529  1.00 31.72  ? 386 LEU A CG  1 
ATOM   1440 C CD1 . LEU A 1 180 ? 15.605  6.579   78.246  1.00 32.90  ? 386 LEU A CD1 1 
ATOM   1441 C CD2 . LEU A 1 180 ? 16.204  9.010   78.340  1.00 29.20  ? 386 LEU A CD2 1 
ATOM   1442 N N   . PHE A 1 181 ? 20.471  7.185   75.676  1.00 37.67  ? 387 PHE A N   1 
ATOM   1443 C CA  . PHE A 1 181 ? 21.893  6.874   75.626  1.00 37.67  ? 387 PHE A CA  1 
ATOM   1444 C C   . PHE A 1 181 ? 22.718  8.011   75.017  1.00 38.12  ? 387 PHE A C   1 
ATOM   1445 O O   . PHE A 1 181 ? 23.745  8.400   75.559  1.00 35.81  ? 387 PHE A O   1 
ATOM   1446 C CB  . PHE A 1 181 ? 22.091  5.608   74.797  1.00 38.92  ? 387 PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 181 ? 23.489  5.078   74.821  1.00 37.75  ? 387 PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 181 ? 23.957  4.359   75.913  1.00 36.22  ? 387 PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 181 ? 24.343  5.297   73.751  1.00 34.26  ? 387 PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 181 ? 25.258  3.866   75.930  1.00 31.98  ? 387 PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 181 ? 25.636  4.808   73.765  1.00 31.20  ? 387 PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 181 ? 26.088  4.094   74.859  1.00 31.96  ? 387 PHE A CZ  1 
ATOM   1453 N N   . ILE A 1 182 ? 22.268  8.529   73.879  1.00 36.44  ? 388 ILE A N   1 
ATOM   1454 C CA  . ILE A 1 182 ? 22.961  9.610   73.187  1.00 32.56  ? 388 ILE A CA  1 
ATOM   1455 C C   . ILE A 1 182 ? 22.909  10.892  74.012  1.00 33.36  ? 388 ILE A C   1 
ATOM   1456 O O   . ILE A 1 182 ? 23.882  11.656  74.059  1.00 35.73  ? 388 ILE A O   1 
ATOM   1457 C CB  . ILE A 1 182 ? 22.364  9.799   71.744  1.00 34.98  ? 388 ILE A CB  1 
ATOM   1458 C CG1 . ILE A 1 182 ? 23.175  8.967   70.746  1.00 31.31  ? 388 ILE A CG1 1 
ATOM   1459 C CG2 . ILE A 1 182 ? 22.379  11.259  71.313  1.00 33.78  ? 388 ILE A CG2 1 
ATOM   1460 C CD1 . ILE A 1 182 ? 23.120  7.492   70.974  1.00 31.20  ? 388 ILE A CD1 1 
ATOM   1461 N N   . ALA A 1 183 ? 21.789  11.119  74.688  1.00 29.82  ? 389 ALA A N   1 
ATOM   1462 C CA  . ALA A 1 183 ? 21.664  12.306  75.523  1.00 30.23  ? 389 ALA A CA  1 
ATOM   1463 C C   . ALA A 1 183 ? 22.673  12.211  76.660  1.00 31.74  ? 389 ALA A C   1 
ATOM   1464 O O   . ALA A 1 183 ? 23.204  13.224  77.127  1.00 30.30  ? 389 ALA A O   1 
ATOM   1465 C CB  . ALA A 1 183 ? 20.243  12.410  76.088  1.00 25.96  ? 389 ALA A CB  1 
ATOM   1466 N N   . ALA A 1 184 ? 22.910  10.979  77.113  1.00 32.06  ? 390 ALA A N   1 
ATOM   1467 C CA  . ALA A 1 184 ? 23.858  10.701  78.184  1.00 32.27  ? 390 ALA A CA  1 
ATOM   1468 C C   . ALA A 1 184 ? 25.292  11.022  77.772  1.00 35.70  ? 390 ALA A C   1 
ATOM   1469 O O   . ALA A 1 184 ? 26.023  11.674  78.525  1.00 35.73  ? 390 ALA A O   1 
ATOM   1470 C CB  . ALA A 1 184 ? 23.760  9.240   78.608  1.00 33.67  ? 390 ALA A CB  1 
ATOM   1471 N N   . ILE A 1 185 ? 25.699  10.587  76.582  1.00 33.02  ? 391 ILE A N   1 
ATOM   1472 C CA  . ILE A 1 185 ? 27.058  10.852  76.174  1.00 36.58  ? 391 ILE A CA  1 
ATOM   1473 C C   . ILE A 1 185 ? 27.303  12.348  75.908  1.00 38.68  ? 391 ILE A C   1 
ATOM   1474 O O   . ILE A 1 185 ? 28.434  12.831  76.044  1.00 38.30  ? 391 ILE A O   1 
ATOM   1475 C CB  . ILE A 1 185 ? 27.479  9.927   74.963  1.00 35.48  ? 391 ILE A CB  1 
ATOM   1476 C CG1 . ILE A 1 185 ? 27.625  10.711  73.677  1.00 33.08  ? 391 ILE A CG1 1 
ATOM   1477 C CG2 . ILE A 1 185 ? 26.475  8.840   74.761  1.00 41.33  ? 391 ILE A CG2 1 
ATOM   1478 C CD1 . ILE A 1 185 ? 28.982  11.309  73.500  1.00 42.37  ? 391 ILE A CD1 1 
ATOM   1479 N N   . ILE A 1 186 ? 26.257  13.095  75.557  1.00 40.78  ? 392 ILE A N   1 
ATOM   1480 C CA  . ILE A 1 186 ? 26.438  14.521  75.302  1.00 39.06  ? 392 ILE A CA  1 
ATOM   1481 C C   . ILE A 1 186 ? 26.456  15.356  76.570  1.00 40.69  ? 392 ILE A C   1 
ATOM   1482 O O   . ILE A 1 186 ? 27.331  16.207  76.727  1.00 43.14  ? 392 ILE A O   1 
ATOM   1483 C CB  . ILE A 1 186 ? 25.371  15.094  74.362  1.00 37.94  ? 392 ILE A CB  1 
ATOM   1484 C CG1 . ILE A 1 186 ? 25.467  14.408  72.994  1.00 35.12  ? 392 ILE A CG1 1 
ATOM   1485 C CG2 . ILE A 1 186 ? 25.583  16.612  74.210  1.00 33.91  ? 392 ILE A CG2 1 
ATOM   1486 C CD1 . ILE A 1 186 ? 24.628  15.050  71.948  1.00 32.47  ? 392 ILE A CD1 1 
ATOM   1487 N N   . LEU A 1 187 ? 25.496  15.139  77.468  1.00 41.59  ? 393 LEU A N   1 
ATOM   1488 C CA  . LEU A 1 187 ? 25.469  15.890  78.731  1.00 42.75  ? 393 LEU A CA  1 
ATOM   1489 C C   . LEU A 1 187 ? 26.360  15.181  79.739  1.00 42.60  ? 393 LEU A C   1 
ATOM   1490 O O   . LEU A 1 187 ? 25.909  14.709  80.781  1.00 41.90  ? 393 LEU A O   1 
ATOM   1491 C CB  . LEU A 1 187 ? 24.044  16.003  79.266  1.00 44.22  ? 393 LEU A CB  1 
ATOM   1492 C CG  . LEU A 1 187 ? 23.260  17.020  78.437  1.00 46.75  ? 393 LEU A CG  1 
ATOM   1493 C CD1 . LEU A 1 187 ? 21.791  16.727  78.520  1.00 51.26  ? 393 LEU A CD1 1 
ATOM   1494 C CD2 . LEU A 1 187 ? 23.570  18.415  78.924  1.00 44.13  ? 393 LEU A CD2 1 
ATOM   1495 N N   . CYS A 1 188 ? 27.641  15.125  79.389  1.00 40.33  ? 394 CYS A N   1 
ATOM   1496 C CA  . CYS A 1 188 ? 28.665  14.478  80.175  1.00 38.75  ? 394 CYS A CA  1 
ATOM   1497 C C   . CYS A 1 188 ? 29.498  15.509  80.936  1.00 38.44  ? 394 CYS A C   1 
ATOM   1498 O O   . CYS A 1 188 ? 30.103  16.400  80.344  1.00 38.77  ? 394 CYS A O   1 
ATOM   1499 C CB  . CYS A 1 188 ? 29.532  13.651  79.231  1.00 37.79  ? 394 CYS A CB  1 
ATOM   1500 S SG  . CYS A 1 188 ? 31.043  13.113  79.941  1.00 48.42  ? 394 CYS A SG  1 
ATOM   1501 N N   . GLY A 1 189 ? 29.543  15.365  82.254  1.00 39.34  ? 395 GLY A N   1 
ATOM   1502 C CA  . GLY A 1 189 ? 30.265  16.318  83.080  1.00 39.05  ? 395 GLY A CA  1 
ATOM   1503 C C   . GLY A 1 189 ? 31.776  16.324  83.065  1.00 38.33  ? 395 GLY A C   1 
ATOM   1504 O O   . GLY A 1 189 ? 32.371  17.261  83.563  1.00 39.13  ? 395 GLY A O   1 
ATOM   1505 N N   . ASP A 1 190 ? 32.411  15.309  82.496  1.00 40.02  ? 396 ASP A N   1 
ATOM   1506 C CA  . ASP A 1 190 ? 33.870  15.269  82.484  1.00 42.87  ? 396 ASP A CA  1 
ATOM   1507 C C   . ASP A 1 190 ? 34.534  15.961  81.291  1.00 42.14  ? 396 ASP A C   1 
ATOM   1508 O O   . ASP A 1 190 ? 35.731  15.784  81.075  1.00 40.83  ? 396 ASP A O   1 
ATOM   1509 C CB  . ASP A 1 190 ? 34.355  13.825  82.521  1.00 50.36  ? 396 ASP A CB  1 
ATOM   1510 C CG  . ASP A 1 190 ? 33.566  12.970  83.484  1.00 62.97  ? 396 ASP A CG  1 
ATOM   1511 O OD1 . ASP A 1 190 ? 33.605  13.244  84.711  1.00 69.05  ? 396 ASP A OD1 1 
ATOM   1512 O OD2 . ASP A 1 190 ? 32.905  12.018  83.005  1.00 66.77  ? 396 ASP A OD2 1 
ATOM   1513 N N   . ARG A 1 191 ? 33.790  16.751  80.523  1.00 39.66  ? 397 ARG A N   1 
ATOM   1514 C CA  . ARG A 1 191 ? 34.396  17.397  79.358  1.00 39.29  ? 397 ARG A CA  1 
ATOM   1515 C C   . ARG A 1 191 ? 35.369  18.559  79.654  1.00 40.68  ? 397 ARG A C   1 
ATOM   1516 O O   . ARG A 1 191 ? 35.058  19.483  80.411  1.00 40.22  ? 397 ARG A O   1 
ATOM   1517 C CB  . ARG A 1 191 ? 33.306  17.863  78.371  1.00 36.34  ? 397 ARG A CB  1 
ATOM   1518 C CG  . ARG A 1 191 ? 32.303  16.775  77.941  1.00 32.36  ? 397 ARG A CG  1 
ATOM   1519 C CD  . ARG A 1 191 ? 32.977  15.543  77.306  1.00 31.42  ? 397 ARG A CD  1 
ATOM   1520 N NE  . ARG A 1 191 ? 31.991  14.613  76.756  1.00 31.84  ? 397 ARG A NE  1 
ATOM   1521 C CZ  . ARG A 1 191 ? 32.259  13.380  76.335  1.00 33.43  ? 397 ARG A CZ  1 
ATOM   1522 N NH1 . ARG A 1 191 ? 33.490  12.900  76.401  1.00 27.99  ? 397 ARG A NH1 1 
ATOM   1523 N NH2 . ARG A 1 191 ? 31.280  12.629  75.843  1.00 30.16  ? 397 ARG A NH2 1 
ATOM   1524 N N   . PRO A 1 192 ? 36.561  18.522  79.036  1.00 39.54  ? 398 PRO A N   1 
ATOM   1525 C CA  . PRO A 1 192 ? 37.635  19.511  79.160  1.00 40.33  ? 398 PRO A CA  1 
ATOM   1526 C C   . PRO A 1 192 ? 37.200  20.943  78.856  1.00 42.33  ? 398 PRO A C   1 
ATOM   1527 O O   . PRO A 1 192 ? 36.742  21.254  77.757  1.00 43.30  ? 398 PRO A O   1 
ATOM   1528 C CB  . PRO A 1 192 ? 38.672  19.019  78.154  1.00 37.54  ? 398 PRO A CB  1 
ATOM   1529 C CG  . PRO A 1 192 ? 38.471  17.546  78.167  1.00 37.28  ? 398 PRO A CG  1 
ATOM   1530 C CD  . PRO A 1 192 ? 36.979  17.426  78.141  1.00 37.38  ? 398 PRO A CD  1 
ATOM   1531 N N   . GLY A 1 193 ? 37.362  21.817  79.834  1.00 43.91  ? 399 GLY A N   1 
ATOM   1532 C CA  . GLY A 1 193 ? 36.983  23.203  79.648  1.00 45.68  ? 399 GLY A CA  1 
ATOM   1533 C C   . GLY A 1 193 ? 35.548  23.510  80.045  1.00 46.55  ? 399 GLY A C   1 
ATOM   1534 O O   . GLY A 1 193 ? 35.083  24.638  79.844  1.00 48.24  ? 399 GLY A O   1 
ATOM   1535 N N   . LEU A 1 194 ? 34.832  22.524  80.583  1.00 43.39  ? 400 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 194 ? 33.453  22.767  80.991  1.00 44.56  ? 400 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 194 ? 33.480  23.815  82.095  1.00 45.64  ? 400 LEU A C   1 
ATOM   1538 O O   . LEU A 1 194 ? 34.228  23.691  83.070  1.00 45.06  ? 400 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 194 ? 32.791  21.491  81.524  1.00 44.37  ? 400 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 194 ? 31.659  20.842  80.730  1.00 44.49  ? 400 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 194 ? 31.024  19.769  81.598  1.00 42.78  ? 400 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 194 ? 30.619  21.879  80.326  1.00 42.83  ? 400 LEU A CD2 1 
ATOM   1543 N N   . MET A 1 195 ? 32.657  24.843  81.938  1.00 47.26  ? 401 MET A N   1 
ATOM   1544 C CA  . MET A 1 195 ? 32.578  25.918  82.909  1.00 46.53  ? 401 MET A CA  1 
ATOM   1545 C C   . MET A 1 195 ? 31.703  25.534  84.108  1.00 45.00  ? 401 MET A C   1 
ATOM   1546 O O   . MET A 1 195 ? 32.178  25.481  85.235  1.00 48.24  ? 401 MET A O   1 
ATOM   1547 C CB  . MET A 1 195 ? 32.041  27.175  82.213  1.00 48.52  ? 401 MET A CB  1 
ATOM   1548 C CG  . MET A 1 195 ? 32.064  28.447  83.053  1.00 50.31  ? 401 MET A CG  1 
ATOM   1549 S SD  . MET A 1 195 ? 31.521  29.884  82.087  1.00 57.13  ? 401 MET A SD  1 
ATOM   1550 C CE  . MET A 1 195 ? 29.710  29.716  82.118  1.00 49.66  ? 401 MET A CE  1 
ATOM   1551 N N   . ASN A 1 196 ? 30.430  25.258  83.870  1.00 44.95  ? 402 ASN A N   1 
ATOM   1552 C CA  . ASN A 1 196 ? 29.520  24.895  84.953  1.00 47.04  ? 402 ASN A CA  1 
ATOM   1553 C C   . ASN A 1 196 ? 29.303  23.365  85.074  1.00 50.10  ? 402 ASN A C   1 
ATOM   1554 O O   . ASN A 1 196 ? 28.198  22.856  84.819  1.00 49.90  ? 402 ASN A O   1 
ATOM   1555 C CB  . ASN A 1 196 ? 28.186  25.614  84.725  1.00 46.71  ? 402 ASN A CB  1 
ATOM   1556 C CG  . ASN A 1 196 ? 27.177  25.376  85.841  1.00 47.66  ? 402 ASN A CG  1 
ATOM   1557 O OD1 . ASN A 1 196 ? 26.077  25.926  85.805  1.00 49.53  ? 402 ASN A OD1 1 
ATOM   1558 N ND2 . ASN A 1 196 ? 27.538  24.560  86.827  1.00 47.05  ? 402 ASN A ND2 1 
ATOM   1559 N N   . VAL A 1 197 ? 30.348  22.644  85.480  1.00 48.50  ? 403 VAL A N   1 
ATOM   1560 C CA  . VAL A 1 197 ? 30.268  21.192  85.622  1.00 49.15  ? 403 VAL A CA  1 
ATOM   1561 C C   . VAL A 1 197 ? 29.264  20.703  86.647  1.00 49.65  ? 403 VAL A C   1 
ATOM   1562 O O   . VAL A 1 197 ? 28.638  19.666  86.457  1.00 51.82  ? 403 VAL A O   1 
ATOM   1563 C CB  . VAL A 1 197 ? 31.647  20.559  85.958  1.00 49.61  ? 403 VAL A CB  1 
ATOM   1564 C CG1 . VAL A 1 197 ? 32.579  21.603  86.540  1.00 52.79  ? 403 VAL A CG1 1 
ATOM   1565 C CG2 . VAL A 1 197 ? 31.464  19.397  86.946  1.00 43.77  ? 403 VAL A CG2 1 
ATOM   1566 N N   . PRO A 1 198 ? 29.122  21.410  87.768  1.00 48.69  ? 404 PRO A N   1 
ATOM   1567 C CA  . PRO A 1 198 ? 28.140  20.912  88.732  1.00 48.42  ? 404 PRO A CA  1 
ATOM   1568 C C   . PRO A 1 198 ? 26.738  20.866  88.136  1.00 46.88  ? 404 PRO A C   1 
ATOM   1569 O O   . PRO A 1 198 ? 25.930  20.004  88.486  1.00 48.12  ? 404 PRO A O   1 
ATOM   1570 C CB  . PRO A 1 198 ? 28.271  21.900  89.889  1.00 44.49  ? 404 PRO A CB  1 
ATOM   1571 C CG  . PRO A 1 198 ? 29.726  22.139  89.908  1.00 46.76  ? 404 PRO A CG  1 
ATOM   1572 C CD  . PRO A 1 198 ? 30.029  22.370  88.419  1.00 50.48  ? 404 PRO A CD  1 
ATOM   1573 N N   . ARG A 1 199 ? 26.457  21.788  87.224  1.00 45.13  ? 405 ARG A N   1 
ATOM   1574 C CA  . ARG A 1 199 ? 25.151  21.825  86.589  1.00 44.28  ? 405 ARG A CA  1 
ATOM   1575 C C   . ARG A 1 199 ? 25.011  20.654  85.624  1.00 43.75  ? 405 ARG A C   1 
ATOM   1576 O O   . ARG A 1 199 ? 23.979  19.969  85.602  1.00 39.66  ? 405 ARG A O   1 
ATOM   1577 C CB  . ARG A 1 199 ? 24.970  23.143  85.843  1.00 46.03  ? 405 ARG A CB  1 
ATOM   1578 C CG  . ARG A 1 199 ? 23.642  23.280  85.121  1.00 51.79  ? 405 ARG A CG  1 
ATOM   1579 C CD  . ARG A 1 199 ? 22.456  22.919  85.998  1.00 53.55  ? 405 ARG A CD  1 
ATOM   1580 N NE  . ARG A 1 199 ? 21.229  23.479  85.446  1.00 58.36  ? 405 ARG A NE  1 
ATOM   1581 C CZ  . ARG A 1 199 ? 20.002  23.073  85.758  1.00 62.71  ? 405 ARG A CZ  1 
ATOM   1582 N NH1 . ARG A 1 199 ? 19.823  22.085  86.627  1.00 64.03  ? 405 ARG A NH1 1 
ATOM   1583 N NH2 . ARG A 1 199 ? 18.950  23.660  85.195  1.00 66.35  ? 405 ARG A NH2 1 
ATOM   1584 N N   . VAL A 1 200 ? 26.064  20.429  84.839  1.00 41.16  ? 406 VAL A N   1 
ATOM   1585 C CA  . VAL A 1 200 ? 26.088  19.352  83.864  1.00 40.09  ? 406 VAL A CA  1 
ATOM   1586 C C   . VAL A 1 200 ? 26.022  18.005  84.571  1.00 42.50  ? 406 VAL A C   1 
ATOM   1587 O O   . VAL A 1 200 ? 25.187  17.167  84.235  1.00 43.97  ? 406 VAL A O   1 
ATOM   1588 C CB  . VAL A 1 200 ? 27.364  19.417  82.980  1.00 37.15  ? 406 VAL A CB  1 
ATOM   1589 C CG1 . VAL A 1 200 ? 27.371  18.268  81.971  1.00 33.66  ? 406 VAL A CG1 1 
ATOM   1590 C CG2 . VAL A 1 200 ? 27.406  20.753  82.238  1.00 33.11  ? 406 VAL A CG2 1 
ATOM   1591 N N   . GLU A 1 201 ? 26.882  17.798  85.559  1.00 41.65  ? 407 GLU A N   1 
ATOM   1592 C CA  . GLU A 1 201 ? 26.875  16.534  86.279  1.00 43.36  ? 407 GLU A CA  1 
ATOM   1593 C C   . GLU A 1 201 ? 25.457  16.128  86.687  1.00 43.64  ? 407 GLU A C   1 
ATOM   1594 O O   . GLU A 1 201 ? 25.084  14.959  86.589  1.00 41.08  ? 407 GLU A O   1 
ATOM   1595 C CB  . GLU A 1 201 ? 27.751  16.632  87.524  1.00 45.95  ? 407 GLU A CB  1 
ATOM   1596 C CG  . GLU A 1 201 ? 29.228  16.754  87.257  1.00 50.26  ? 407 GLU A CG  1 
ATOM   1597 C CD  . GLU A 1 201 ? 30.025  16.773  88.544  1.00 56.54  ? 407 GLU A CD  1 
ATOM   1598 O OE1 . GLU A 1 201 ? 29.811  17.695  89.365  1.00 59.23  ? 407 GLU A OE1 1 
ATOM   1599 O OE2 . GLU A 1 201 ? 30.859  15.863  88.742  1.00 58.47  ? 407 GLU A OE2 1 
ATOM   1600 N N   . ALA A 1 202 ? 24.674  17.107  87.132  1.00 43.49  ? 408 ALA A N   1 
ATOM   1601 C CA  . ALA A 1 202 ? 23.307  16.868  87.582  1.00 45.22  ? 408 ALA A CA  1 
ATOM   1602 C C   . ALA A 1 202 ? 22.356  16.443  86.469  1.00 47.23  ? 408 ALA A C   1 
ATOM   1603 O O   . ALA A 1 202 ? 21.492  15.582  86.686  1.00 48.41  ? 408 ALA A O   1 
ATOM   1604 C CB  . ALA A 1 202 ? 22.771  18.101  88.283  1.00 39.29  ? 408 ALA A CB  1 
ATOM   1605 N N   . ILE A 1 203 ? 22.492  17.052  85.291  1.00 46.96  ? 409 ILE A N   1 
ATOM   1606 C CA  . ILE A 1 203 ? 21.629  16.692  84.163  1.00 46.66  ? 409 ILE A CA  1 
ATOM   1607 C C   . ILE A 1 203 ? 22.022  15.275  83.723  1.00 47.78  ? 409 ILE A C   1 
ATOM   1608 O O   . ILE A 1 203 ? 21.169  14.448  83.416  1.00 47.92  ? 409 ILE A O   1 
ATOM   1609 C CB  . ILE A 1 203 ? 21.775  17.692  82.978  1.00 45.93  ? 409 ILE A CB  1 
ATOM   1610 C CG1 . ILE A 1 203 ? 21.339  19.098  83.418  1.00 45.67  ? 409 ILE A CG1 1 
ATOM   1611 C CG2 . ILE A 1 203 ? 20.912  17.240  81.812  1.00 49.25  ? 409 ILE A CG2 1 
ATOM   1612 C CD1 . ILE A 1 203 ? 21.706  20.229  82.470  1.00 40.08  ? 409 ILE A CD1 1 
ATOM   1613 N N   . GLN A 1 204 ? 23.318  14.987  83.727  1.00 47.22  ? 410 GLN A N   1 
ATOM   1614 C CA  . GLN A 1 204 ? 23.775  13.655  83.367  1.00 47.55  ? 410 GLN A CA  1 
ATOM   1615 C C   . GLN A 1 204 ? 23.150  12.631  84.318  1.00 45.41  ? 410 GLN A C   1 
ATOM   1616 O O   . GLN A 1 204 ? 22.648  11.592  83.874  1.00 46.77  ? 410 GLN A O   1 
ATOM   1617 C CB  . GLN A 1 204 ? 25.311  13.548  83.432  1.00 46.96  ? 410 GLN A CB  1 
ATOM   1618 C CG  . GLN A 1 204 ? 25.794  12.087  83.470  1.00 47.12  ? 410 GLN A CG  1 
ATOM   1619 C CD  . GLN A 1 204 ? 27.246  11.903  83.091  1.00 49.82  ? 410 GLN A CD  1 
ATOM   1620 O OE1 . GLN A 1 204 ? 28.158  12.454  83.738  1.00 47.26  ? 410 GLN A OE1 1 
ATOM   1621 N NE2 . GLN A 1 204 ? 27.480  11.113  82.027  1.00 48.23  ? 410 GLN A NE2 1 
ATOM   1622 N N   . ASP A 1 205 ? 23.187  12.926  85.616  1.00 44.08  ? 411 ASP A N   1 
ATOM   1623 C CA  . ASP A 1 205 ? 22.631  12.023  86.615  1.00 43.33  ? 411 ASP A CA  1 
ATOM   1624 C C   . ASP A 1 205 ? 21.174  11.681  86.323  1.00 42.47  ? 411 ASP A C   1 
ATOM   1625 O O   . ASP A 1 205 ? 20.790  10.508  86.352  1.00 42.17  ? 411 ASP A O   1 
ATOM   1626 C CB  . ASP A 1 205 ? 22.728  12.624  88.024  1.00 45.66  ? 411 ASP A CB  1 
ATOM   1627 C CG  . ASP A 1 205 ? 22.335  11.616  89.117  1.00 44.47  ? 411 ASP A CG  1 
ATOM   1628 O OD1 . ASP A 1 205 ? 23.128  10.687  89.379  1.00 38.87  ? 411 ASP A OD1 1 
ATOM   1629 O OD2 . ASP A 1 205 ? 21.235  11.741  89.698  1.00 45.99  ? 411 ASP A OD2 1 
ATOM   1630 N N   . THR A 1 206 ? 20.365  12.706  86.062  1.00 40.13  ? 412 THR A N   1 
ATOM   1631 C CA  . THR A 1 206 ? 18.953  12.502  85.749  1.00 38.41  ? 412 THR A CA  1 
ATOM   1632 C C   . THR A 1 206 ? 18.747  11.643  84.493  1.00 39.67  ? 412 THR A C   1 
ATOM   1633 O O   . THR A 1 206 ? 17.863  10.780  84.468  1.00 39.51  ? 412 THR A O   1 
ATOM   1634 C CB  . THR A 1 206 ? 18.239  13.832  85.503  1.00 38.61  ? 412 THR A CB  1 
ATOM   1635 O OG1 . THR A 1 206 ? 18.292  14.634  86.687  1.00 39.44  ? 412 THR A OG1 1 
ATOM   1636 C CG2 . THR A 1 206 ? 16.783  13.586  85.117  1.00 36.91  ? 412 THR A CG2 1 
ATOM   1637 N N   . ILE A 1 207 ? 19.553  11.890  83.455  1.00 37.93  ? 413 ILE A N   1 
ATOM   1638 C CA  . ILE A 1 207 ? 19.439  11.146  82.202  1.00 36.57  ? 413 ILE A CA  1 
ATOM   1639 C C   . ILE A 1 207 ? 19.734  9.666   82.421  1.00 38.67  ? 413 ILE A C   1 
ATOM   1640 O O   . ILE A 1 207 ? 18.946  8.803   82.008  1.00 37.01  ? 413 ILE A O   1 
ATOM   1641 C CB  . ILE A 1 207 ? 20.399  11.695  81.097  1.00 34.29  ? 413 ILE A CB  1 
ATOM   1642 C CG1 . ILE A 1 207 ? 20.154  13.188  80.857  1.00 33.86  ? 413 ILE A CG1 1 
ATOM   1643 C CG2 . ILE A 1 207 ? 20.127  10.990  79.795  1.00 30.23  ? 413 ILE A CG2 1 
ATOM   1644 C CD1 . ILE A 1 207 ? 21.300  13.900  80.194  1.00 29.60  ? 413 ILE A CD1 1 
ATOM   1645 N N   . LEU A 1 208 ? 20.867  9.368   83.059  1.00 39.50  ? 414 LEU A N   1 
ATOM   1646 C CA  . LEU A 1 208 ? 21.227  7.969   83.334  1.00 43.94  ? 414 LEU A CA  1 
ATOM   1647 C C   . LEU A 1 208 ? 20.194  7.310   84.258  1.00 45.72  ? 414 LEU A C   1 
ATOM   1648 O O   . LEU A 1 208 ? 19.931  6.115   84.162  1.00 47.26  ? 414 LEU A O   1 
ATOM   1649 C CB  . LEU A 1 208 ? 22.621  7.875   83.970  1.00 39.34  ? 414 LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 208 ? 23.840  8.083   83.064  1.00 38.03  ? 414 LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 208 ? 25.070  8.348   83.908  1.00 39.40  ? 414 LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 208 ? 24.041  6.871   82.192  1.00 35.16  ? 414 LEU A CD2 1 
ATOM   1653 N N   . ARG A 1 209 ? 19.610  8.103   85.147  1.00 46.50  ? 415 ARG A N   1 
ATOM   1654 C CA  . ARG A 1 209 ? 18.603  7.614   86.081  1.00 48.45  ? 415 ARG A CA  1 
ATOM   1655 C C   . ARG A 1 209 ? 17.355  7.249   85.276  1.00 47.40  ? 415 ARG A C   1 
ATOM   1656 O O   . ARG A 1 209 ? 16.746  6.197   85.487  1.00 47.01  ? 415 ARG A O   1 
ATOM   1657 C CB  . ARG A 1 209 ? 18.296  8.716   87.091  1.00 52.64  ? 415 ARG A CB  1 
ATOM   1658 C CG  . ARG A 1 209 ? 17.730  8.256   88.404  1.00 60.11  ? 415 ARG A CG  1 
ATOM   1659 C CD  . ARG A 1 209 ? 17.801  9.400   89.416  1.00 65.10  ? 415 ARG A CD  1 
ATOM   1660 N NE  . ARG A 1 209 ? 19.174  9.679   89.833  1.00 69.18  ? 415 ARG A NE  1 
ATOM   1661 C CZ  . ARG A 1 209 ? 19.927  8.834   90.534  1.00 71.53  ? 415 ARG A CZ  1 
ATOM   1662 N NH1 . ARG A 1 209 ? 19.441  7.654   90.900  1.00 71.46  ? 415 ARG A NH1 1 
ATOM   1663 N NH2 . ARG A 1 209 ? 21.163  9.167   90.877  1.00 70.80  ? 415 ARG A NH2 1 
ATOM   1664 N N   . ALA A 1 210 ? 16.983  8.125   84.347  1.00 44.19  ? 416 ALA A N   1 
ATOM   1665 C CA  . ALA A 1 210 ? 15.832  7.883   83.478  1.00 42.16  ? 416 ALA A CA  1 
ATOM   1666 C C   . ALA A 1 210 ? 16.198  6.736   82.542  1.00 40.76  ? 416 ALA A C   1 
ATOM   1667 O O   . ALA A 1 210 ? 15.369  5.898   82.202  1.00 39.54  ? 416 ALA A O   1 
ATOM   1668 C CB  . ALA A 1 210 ? 15.516  9.123   82.675  1.00 36.26  ? 416 ALA A CB  1 
ATOM   1669 N N   . LEU A 1 211 ? 17.461  6.709   82.141  1.00 41.92  ? 417 LEU A N   1 
ATOM   1670 C CA  . LEU A 1 211 ? 17.956  5.672   81.267  1.00 43.63  ? 417 LEU A CA  1 
ATOM   1671 C C   . LEU A 1 211 ? 17.735  4.317   81.929  1.00 44.52  ? 417 LEU A C   1 
ATOM   1672 O O   . LEU A 1 211 ? 17.140  3.427   81.331  1.00 43.88  ? 417 LEU A O   1 
ATOM   1673 C CB  . LEU A 1 211 ? 19.445  5.910   80.962  1.00 44.84  ? 417 LEU A CB  1 
ATOM   1674 C CG  . LEU A 1 211 ? 20.140  5.043   79.893  1.00 46.31  ? 417 LEU A CG  1 
ATOM   1675 C CD1 . LEU A 1 211 ? 20.746  3.808   80.535  1.00 48.39  ? 417 LEU A CD1 1 
ATOM   1676 C CD2 . LEU A 1 211 ? 19.137  4.663   78.788  1.00 48.48  ? 417 LEU A CD2 1 
ATOM   1677 N N   . GLU A 1 212 ? 18.189  4.160   83.169  1.00 47.48  ? 418 GLU A N   1 
ATOM   1678 C CA  . GLU A 1 212 ? 18.012  2.879   83.855  1.00 51.68  ? 418 GLU A CA  1 
ATOM   1679 C C   . GLU A 1 212 ? 16.542  2.520   84.072  1.00 52.62  ? 418 GLU A C   1 
ATOM   1680 O O   . GLU A 1 212 ? 16.171  1.352   83.981  1.00 50.57  ? 418 GLU A O   1 
ATOM   1681 C CB  . GLU A 1 212 ? 18.734  2.861   85.202  1.00 53.26  ? 418 GLU A CB  1 
ATOM   1682 C CG  . GLU A 1 212 ? 18.704  1.498   85.855  1.00 56.98  ? 418 GLU A CG  1 
ATOM   1683 C CD  . GLU A 1 212 ? 19.307  1.500   87.229  1.00 59.26  ? 418 GLU A CD  1 
ATOM   1684 O OE1 . GLU A 1 212 ? 18.906  2.351   88.051  1.00 64.58  ? 418 GLU A OE1 1 
ATOM   1685 O OE2 . GLU A 1 212 ? 20.176  0.646   87.493  1.00 64.75  ? 418 GLU A OE2 1 
ATOM   1686 N N   . PHE A 1 213 ? 15.702  3.512   84.361  1.00 55.55  ? 419 PHE A N   1 
ATOM   1687 C CA  . PHE A 1 213 ? 14.281  3.235   84.564  1.00 56.28  ? 419 PHE A CA  1 
ATOM   1688 C C   . PHE A 1 213 ? 13.611  2.860   83.248  1.00 55.02  ? 419 PHE A C   1 
ATOM   1689 O O   . PHE A 1 213 ? 12.681  2.056   83.235  1.00 57.66  ? 419 PHE A O   1 
ATOM   1690 C CB  . PHE A 1 213 ? 13.551  4.432   85.196  1.00 58.32  ? 419 PHE A CB  1 
ATOM   1691 C CG  . PHE A 1 213 ? 13.838  4.616   86.666  1.00 61.81  ? 419 PHE A CG  1 
ATOM   1692 C CD1 . PHE A 1 213 ? 13.670  3.560   87.563  1.00 63.66  ? 419 PHE A CD1 1 
ATOM   1693 C CD2 . PHE A 1 213 ? 14.270  5.849   87.158  1.00 63.55  ? 419 PHE A CD2 1 
ATOM   1694 C CE1 . PHE A 1 213 ? 13.928  3.729   88.933  1.00 63.19  ? 419 PHE A CE1 1 
ATOM   1695 C CE2 . PHE A 1 213 ? 14.532  6.032   88.526  1.00 62.99  ? 419 PHE A CE2 1 
ATOM   1696 C CZ  . PHE A 1 213 ? 14.360  4.968   89.414  1.00 63.11  ? 419 PHE A CZ  1 
ATOM   1697 N N   . HIS A 1 214 ? 14.080  3.430   82.140  1.00 51.36  ? 420 HIS A N   1 
ATOM   1698 C CA  . HIS A 1 214 ? 13.490  3.110   80.845  1.00 47.76  ? 420 HIS A CA  1 
ATOM   1699 C C   . HIS A 1 214 ? 13.845  1.697   80.429  1.00 45.89  ? 420 HIS A C   1 
ATOM   1700 O O   . HIS A 1 214 ? 13.026  1.011   79.836  1.00 42.00  ? 420 HIS A O   1 
ATOM   1701 C CB  . HIS A 1 214 ? 13.941  4.101   79.774  1.00 46.88  ? 420 HIS A CB  1 
ATOM   1702 C CG  . HIS A 1 214 ? 13.309  3.867   78.437  1.00 48.02  ? 420 HIS A CG  1 
ATOM   1703 N ND1 . HIS A 1 214 ? 13.756  2.901   77.557  1.00 47.57  ? 420 HIS A ND1 1 
ATOM   1704 C CD2 . HIS A 1 214 ? 12.245  4.454   77.841  1.00 47.54  ? 420 HIS A CD2 1 
ATOM   1705 C CE1 . HIS A 1 214 ? 12.996  2.906   76.478  1.00 45.64  ? 420 HIS A CE1 1 
ATOM   1706 N NE2 . HIS A 1 214 ? 12.071  3.837   76.625  1.00 46.52  ? 420 HIS A NE2 1 
ATOM   1707 N N   . LEU A 1 215 ? 15.063  1.264   80.753  1.00 48.66  ? 421 LEU A N   1 
ATOM   1708 C CA  . LEU A 1 215 ? 15.524  -0.089  80.435  1.00 50.24  ? 421 LEU A CA  1 
ATOM   1709 C C   . LEU A 1 215 ? 14.780  -1.081  81.316  1.00 54.36  ? 421 LEU A C   1 
ATOM   1710 O O   . LEU A 1 215 ? 14.806  -2.286  81.078  1.00 55.63  ? 421 LEU A O   1 
ATOM   1711 C CB  . LEU A 1 215 ? 17.026  -0.242  80.686  1.00 45.62  ? 421 LEU A CB  1 
ATOM   1712 C CG  . LEU A 1 215 ? 18.028  0.628   79.921  1.00 46.66  ? 421 LEU A CG  1 
ATOM   1713 C CD1 . LEU A 1 215 ? 19.442  0.230   80.355  1.00 38.12  ? 421 LEU A CD1 1 
ATOM   1714 C CD2 . LEU A 1 215 ? 17.852  0.462   78.411  1.00 37.26  ? 421 LEU A CD2 1 
ATOM   1715 N N   . GLN A 1 216 ? 14.130  -0.566  82.351  1.00 58.05  ? 422 GLN A N   1 
ATOM   1716 C CA  . GLN A 1 216 ? 13.350  -1.405  83.250  1.00 61.06  ? 422 GLN A CA  1 
ATOM   1717 C C   . GLN A 1 216 ? 12.086  -1.863  82.528  1.00 60.68  ? 422 GLN A C   1 
ATOM   1718 O O   . GLN A 1 216 ? 11.809  -3.060  82.438  1.00 61.99  ? 422 GLN A O   1 
ATOM   1719 C CB  . GLN A 1 216 ? 12.940  -0.619  84.497  1.00 65.18  ? 422 GLN A CB  1 
ATOM   1720 C CG  . GLN A 1 216 ? 14.062  -0.321  85.468  1.00 67.70  ? 422 GLN A CG  1 
ATOM   1721 C CD  . GLN A 1 216 ? 14.590  -1.568  86.130  1.00 69.07  ? 422 GLN A CD  1 
ATOM   1722 O OE1 . GLN A 1 216 ? 15.111  -2.463  85.467  1.00 72.15  ? 422 GLN A OE1 1 
ATOM   1723 N NE2 . GLN A 1 216 ? 14.455  -1.639  87.449  1.00 69.84  ? 422 GLN A NE2 1 
ATOM   1724 N N   . ALA A 1 217 ? 11.335  -0.895  82.009  1.00 59.68  ? 423 ALA A N   1 
ATOM   1725 C CA  . ALA A 1 217 ? 10.085  -1.166  81.316  1.00 60.72  ? 423 ALA A CA  1 
ATOM   1726 C C   . ALA A 1 217 ? 10.174  -1.270  79.797  1.00 63.36  ? 423 ALA A C   1 
ATOM   1727 O O   . ALA A 1 217 ? 9.275   -0.810  79.088  1.00 65.27  ? 423 ALA A O   1 
ATOM   1728 C CB  . ALA A 1 217 ? 9.074   -0.113  81.691  1.00 60.66  ? 423 ALA A CB  1 
ATOM   1729 N N   . ASN A 1 218 ? 11.252  -1.853  79.287  1.00 64.27  ? 424 ASN A N   1 
ATOM   1730 C CA  . ASN A 1 218 ? 11.388  -2.023  77.844  1.00 63.81  ? 424 ASN A CA  1 
ATOM   1731 C C   . ASN A 1 218 ? 12.189  -3.291  77.591  1.00 64.58  ? 424 ASN A C   1 
ATOM   1732 O O   . ASN A 1 218 ? 11.972  -3.985  76.595  1.00 65.94  ? 424 ASN A O   1 
ATOM   1733 C CB  . ASN A 1 218 ? 12.068  -0.802  77.195  1.00 61.92  ? 424 ASN A CB  1 
ATOM   1734 C CG  . ASN A 1 218 ? 12.075  -0.872  75.658  1.00 62.70  ? 424 ASN A CG  1 
ATOM   1735 O OD1 . ASN A 1 218 ? 12.597  0.020   74.982  1.00 57.35  ? 424 ASN A OD1 1 
ATOM   1736 N ND2 . ASN A 1 218 ? 11.498  -1.937  75.108  1.00 63.75  ? 424 ASN A ND2 1 
ATOM   1737 N N   . HIS A 1 219 ? 13.098  -3.606  78.509  1.00 64.69  ? 425 HIS A N   1 
ATOM   1738 C CA  . HIS A 1 219 ? 13.921  -4.805  78.386  1.00 66.91  ? 425 HIS A CA  1 
ATOM   1739 C C   . HIS A 1 219 ? 13.857  -5.653  79.660  1.00 68.70  ? 425 HIS A C   1 
ATOM   1740 O O   . HIS A 1 219 ? 14.887  -6.048  80.204  1.00 66.88  ? 425 HIS A O   1 
ATOM   1741 C CB  . HIS A 1 219 ? 15.376  -4.421  78.094  1.00 67.11  ? 425 HIS A CB  1 
ATOM   1742 C CG  . HIS A 1 219 ? 15.567  -3.709  76.792  1.00 67.67  ? 425 HIS A CG  1 
ATOM   1743 N ND1 . HIS A 1 219 ? 15.366  -4.322  75.574  1.00 69.09  ? 425 HIS A ND1 1 
ATOM   1744 C CD2 . HIS A 1 219 ? 15.931  -2.435  76.515  1.00 68.22  ? 425 HIS A CD2 1 
ATOM   1745 C CE1 . HIS A 1 219 ? 15.599  -3.457  74.603  1.00 68.51  ? 425 HIS A CE1 1 
ATOM   1746 N NE2 . HIS A 1 219 ? 15.944  -2.304  75.147  1.00 67.03  ? 425 HIS A NE2 1 
ATOM   1747 N N   . PRO A 1 220 ? 12.642  -5.957  80.143  1.00 70.94  ? 426 PRO A N   1 
ATOM   1748 C CA  . PRO A 1 220 ? 12.469  -6.759  81.356  1.00 72.48  ? 426 PRO A CA  1 
ATOM   1749 C C   . PRO A 1 220 ? 13.404  -7.957  81.402  1.00 75.04  ? 426 PRO A C   1 
ATOM   1750 O O   . PRO A 1 220 ? 14.372  -7.977  82.159  1.00 74.86  ? 426 PRO A O   1 
ATOM   1751 C CB  . PRO A 1 220 ? 11.005  -7.169  81.284  1.00 71.75  ? 426 PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 220 ? 10.373  -5.986  80.648  1.00 71.20  ? 426 PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 220 ? 11.334  -5.674  79.524  1.00 71.78  ? 426 PRO A CD  1 
ATOM   1754 N N   . ASP A 1 221 ? 13.102  -8.957  80.586  1.00 77.96  ? 427 ASP A N   1 
ATOM   1755 C CA  . ASP A 1 221 ? 13.917  -10.159 80.531  1.00 81.71  ? 427 ASP A CA  1 
ATOM   1756 C C   . ASP A 1 221 ? 15.207  -9.797  79.815  1.00 83.40  ? 427 ASP A C   1 
ATOM   1757 O O   . ASP A 1 221 ? 15.252  -9.783  78.583  1.00 84.88  ? 427 ASP A O   1 
ATOM   1758 C CB  . ASP A 1 221 ? 13.176  -11.260 79.764  1.00 82.83  ? 427 ASP A CB  1 
ATOM   1759 C CG  . ASP A 1 221 ? 11.762  -11.481 80.280  1.00 84.77  ? 427 ASP A CG  1 
ATOM   1760 O OD1 . ASP A 1 221 ? 11.589  -11.684 81.503  1.00 85.47  ? 427 ASP A OD1 1 
ATOM   1761 O OD2 . ASP A 1 221 ? 10.821  -11.452 79.459  1.00 84.01  ? 427 ASP A OD2 1 
ATOM   1762 N N   . ALA A 1 222 ? 16.244  -9.484  80.589  1.00 83.78  ? 428 ALA A N   1 
ATOM   1763 C CA  . ALA A 1 222 ? 17.538  -9.107  80.027  1.00 84.57  ? 428 ALA A CA  1 
ATOM   1764 C C   . ALA A 1 222 ? 18.631  -9.100  81.087  1.00 85.04  ? 428 ALA A C   1 
ATOM   1765 O O   . ALA A 1 222 ? 18.373  -8.804  82.253  1.00 87.45  ? 428 ALA A O   1 
ATOM   1766 C CB  . ALA A 1 222 ? 17.443  -7.731  79.373  1.00 84.82  ? 428 ALA A CB  1 
ATOM   1767 N N   . GLN A 1 223 ? 19.853  -9.414  80.665  1.00 84.91  ? 429 GLN A N   1 
ATOM   1768 C CA  . GLN A 1 223 ? 21.015  -9.464  81.553  1.00 83.84  ? 429 GLN A CA  1 
ATOM   1769 C C   . GLN A 1 223 ? 21.323  -8.139  82.246  1.00 82.37  ? 429 GLN A C   1 
ATOM   1770 O O   . GLN A 1 223 ? 20.422  -7.361  82.558  1.00 84.01  ? 429 GLN A O   1 
ATOM   1771 C CB  . GLN A 1 223 ? 22.248  -9.916  80.762  1.00 84.74  ? 429 GLN A CB  1 
ATOM   1772 C CG  . GLN A 1 223 ? 22.084  -9.861  79.239  1.00 82.18  ? 429 GLN A CG  1 
ATOM   1773 C CD  . GLN A 1 223 ? 21.799  -8.466  78.703  1.00 80.93  ? 429 GLN A CD  1 
ATOM   1774 O OE1 . GLN A 1 223 ? 21.617  -8.284  77.500  1.00 80.83  ? 429 GLN A OE1 1 
ATOM   1775 N NE2 . GLN A 1 223 ? 21.762  -7.478  79.590  1.00 77.29  ? 429 GLN A NE2 1 
ATOM   1776 N N   . TYR A 1 224 ? 22.606  -7.897  82.492  1.00 78.98  ? 430 TYR A N   1 
ATOM   1777 C CA  . TYR A 1 224 ? 23.047  -6.665  83.128  1.00 76.47  ? 430 TYR A CA  1 
ATOM   1778 C C   . TYR A 1 224 ? 23.155  -5.590  82.045  1.00 72.72  ? 430 TYR A C   1 
ATOM   1779 O O   . TYR A 1 224 ? 24.248  -5.124  81.725  1.00 72.47  ? 430 TYR A O   1 
ATOM   1780 C CB  . TYR A 1 224 ? 24.410  -6.880  83.794  1.00 80.15  ? 430 TYR A CB  1 
ATOM   1781 C CG  . TYR A 1 224 ? 24.484  -8.127  84.644  1.00 82.99  ? 430 TYR A CG  1 
ATOM   1782 C CD1 . TYR A 1 224 ? 23.646  -8.293  85.742  1.00 84.07  ? 430 TYR A CD1 1 
ATOM   1783 C CD2 . TYR A 1 224 ? 25.365  -9.159  84.326  1.00 85.73  ? 430 TYR A CD2 1 
ATOM   1784 C CE1 . TYR A 1 224 ? 23.681  -9.462  86.500  1.00 85.39  ? 430 TYR A CE1 1 
ATOM   1785 C CE2 . TYR A 1 224 ? 25.408  -10.333 85.079  1.00 85.93  ? 430 TYR A CE2 1 
ATOM   1786 C CZ  . TYR A 1 224 ? 24.561  -10.476 86.161  1.00 86.13  ? 430 TYR A CZ  1 
ATOM   1787 O OH  . TYR A 1 224 ? 24.587  -11.640 86.889  1.00 88.16  ? 430 TYR A OH  1 
ATOM   1788 N N   . LEU A 1 225 ? 22.013  -5.197  81.486  1.00 67.80  ? 431 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 225 ? 21.989  -4.205  80.421  1.00 63.87  ? 431 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 225 ? 22.531  -2.841  80.851  1.00 60.82  ? 431 LEU A C   1 
ATOM   1791 O O   . LEU A 1 225 ? 23.514  -2.364  80.292  1.00 62.18  ? 431 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 225 ? 20.565  -4.049  79.872  1.00 62.81  ? 431 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 225 ? 20.395  -3.631  78.400  1.00 61.99  ? 431 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 225 ? 18.912  -3.472  78.081  1.00 58.65  ? 431 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 225 ? 21.141  -2.332  78.119  1.00 63.01  ? 431 LEU A CD2 1 
ATOM   1796 N N   . PHE A 1 226 ? 21.901  -2.222  81.842  1.00 56.61  ? 432 PHE A N   1 
ATOM   1797 C CA  . PHE A 1 226 ? 22.325  -0.900  82.305  1.00 53.22  ? 432 PHE A CA  1 
ATOM   1798 C C   . PHE A 1 226 ? 23.828  -0.765  82.471  1.00 51.04  ? 432 PHE A C   1 
ATOM   1799 O O   . PHE A 1 226 ? 24.465  -0.002  81.756  1.00 51.41  ? 432 PHE A O   1 
ATOM   1800 C CB  . PHE A 1 226 ? 21.634  -0.541  83.624  1.00 51.88  ? 432 PHE A CB  1 
ATOM   1801 C CG  . PHE A 1 226 ? 21.898  0.859   84.083  1.00 53.17  ? 432 PHE A CG  1 
ATOM   1802 C CD1 . PHE A 1 226 ? 21.371  1.945   83.386  1.00 52.02  ? 432 PHE A CD1 1 
ATOM   1803 C CD2 . PHE A 1 226 ? 22.710  1.102   85.195  1.00 53.51  ? 432 PHE A CD2 1 
ATOM   1804 C CE1 . PHE A 1 226 ? 21.649  3.260   83.783  1.00 51.72  ? 432 PHE A CE1 1 
ATOM   1805 C CE2 . PHE A 1 226 ? 22.996  2.412   85.603  1.00 53.15  ? 432 PHE A CE2 1 
ATOM   1806 C CZ  . PHE A 1 226 ? 22.465  3.494   84.893  1.00 52.37  ? 432 PHE A CZ  1 
ATOM   1807 N N   . PRO A 1 227 ? 24.427  -1.508  83.407  1.00 51.33  ? 433 PRO A N   1 
ATOM   1808 C CA  . PRO A 1 227 ? 25.878  -1.327  83.517  1.00 50.42  ? 433 PRO A CA  1 
ATOM   1809 C C   . PRO A 1 227 ? 26.630  -1.732  82.253  1.00 47.42  ? 433 PRO A C   1 
ATOM   1810 O O   . PRO A 1 227 ? 27.729  -1.238  81.990  1.00 47.04  ? 433 PRO A O   1 
ATOM   1811 C CB  . PRO A 1 227 ? 26.247  -2.171  84.752  1.00 48.97  ? 433 PRO A CB  1 
ATOM   1812 C CG  . PRO A 1 227 ? 25.249  -3.275  84.715  1.00 50.98  ? 433 PRO A CG  1 
ATOM   1813 C CD  . PRO A 1 227 ? 23.952  -2.565  84.321  1.00 52.97  ? 433 PRO A CD  1 
ATOM   1814 N N   . LYS A 1 228 ? 26.037  -2.624  81.469  1.00 44.16  ? 434 LYS A N   1 
ATOM   1815 C CA  . LYS A 1 228 ? 26.688  -3.070  80.253  1.00 45.76  ? 434 LYS A CA  1 
ATOM   1816 C C   . LYS A 1 228 ? 26.801  -1.875  79.300  1.00 43.85  ? 434 LYS A C   1 
ATOM   1817 O O   . LYS A 1 228 ? 27.742  -1.771  78.514  1.00 44.49  ? 434 LYS A O   1 
ATOM   1818 C CB  . LYS A 1 228 ? 25.893  -4.219  79.625  1.00 49.17  ? 434 LYS A CB  1 
ATOM   1819 C CG  . LYS A 1 228 ? 26.620  -4.919  78.480  1.00 60.00  ? 434 LYS A CG  1 
ATOM   1820 C CD  . LYS A 1 228 ? 26.589  -6.442  78.616  1.00 61.94  ? 434 LYS A CD  1 
ATOM   1821 C CE  . LYS A 1 228 ? 25.168  -6.981  78.623  1.00 63.71  ? 434 LYS A CE  1 
ATOM   1822 N NZ  . LYS A 1 228 ? 25.134  -8.469  78.592  1.00 61.73  ? 434 LYS A NZ  1 
ATOM   1823 N N   . LEU A 1 229 ? 25.840  -0.962  79.395  1.00 40.43  ? 435 LEU A N   1 
ATOM   1824 C CA  . LEU A 1 229 ? 25.833  0.237   78.568  1.00 36.17  ? 435 LEU A CA  1 
ATOM   1825 C C   . LEU A 1 229 ? 26.811  1.292   79.086  1.00 33.73  ? 435 LEU A C   1 
ATOM   1826 O O   . LEU A 1 229 ? 27.293  2.107   78.314  1.00 31.66  ? 435 LEU A O   1 
ATOM   1827 C CB  . LEU A 1 229 ? 24.413  0.819   78.478  1.00 33.10  ? 435 LEU A CB  1 
ATOM   1828 C CG  . LEU A 1 229 ? 23.563  0.160   77.390  1.00 31.93  ? 435 LEU A CG  1 
ATOM   1829 C CD1 . LEU A 1 229 ? 22.185  0.799   77.266  1.00 31.40  ? 435 LEU A CD1 1 
ATOM   1830 C CD2 . LEU A 1 229 ? 24.304  0.307   76.095  1.00 31.34  ? 435 LEU A CD2 1 
ATOM   1831 N N   . LEU A 1 230 ? 27.100  1.263   80.387  1.00 35.04  ? 436 LEU A N   1 
ATOM   1832 C CA  . LEU A 1 230 ? 28.040  2.204   81.006  1.00 36.68  ? 436 LEU A CA  1 
ATOM   1833 C C   . LEU A 1 230 ? 29.458  1.896   80.569  1.00 38.35  ? 436 LEU A C   1 
ATOM   1834 O O   . LEU A 1 230 ? 30.285  2.792   80.408  1.00 36.24  ? 436 LEU A O   1 
ATOM   1835 C CB  . LEU A 1 230 ? 27.950  2.134   82.529  1.00 36.22  ? 436 LEU A CB  1 
ATOM   1836 C CG  . LEU A 1 230 ? 26.616  2.687   83.032  1.00 36.34  ? 436 LEU A CG  1 
ATOM   1837 C CD1 . LEU A 1 230 ? 26.527  2.649   84.553  1.00 39.98  ? 436 LEU A CD1 1 
ATOM   1838 C CD2 . LEU A 1 230 ? 26.483  4.111   82.523  1.00 35.79  ? 436 LEU A CD2 1 
ATOM   1839 N N   . GLN A 1 231 ? 29.738  0.614   80.374  1.00 40.16  ? 437 GLN A N   1 
ATOM   1840 C CA  . GLN A 1 231 ? 31.061  0.232   79.921  1.00 39.41  ? 437 GLN A CA  1 
ATOM   1841 C C   . GLN A 1 231 ? 31.159  0.576   78.437  1.00 38.00  ? 437 GLN A C   1 
ATOM   1842 O O   . GLN A 1 231 ? 32.244  0.858   77.934  1.00 38.35  ? 437 GLN A O   1 
ATOM   1843 C CB  . GLN A 1 231 ? 31.301  -1.264  80.149  1.00 37.53  ? 437 GLN A CB  1 
ATOM   1844 C CG  . GLN A 1 231 ? 32.636  -1.779  79.603  1.00 38.88  ? 437 GLN A CG  1 
ATOM   1845 C CD  . GLN A 1 231 ? 33.825  -1.177  80.312  1.00 36.22  ? 437 GLN A CD  1 
ATOM   1846 O OE1 . GLN A 1 231 ? 33.881  -1.171  81.534  1.00 47.95  ? 437 GLN A OE1 1 
ATOM   1847 N NE2 . GLN A 1 231 ? 34.787  -0.677  79.550  1.00 38.11  ? 437 GLN A NE2 1 
ATOM   1848 N N   . LYS A 1 232 ? 30.029  0.563   77.732  1.00 35.50  ? 438 LYS A N   1 
ATOM   1849 C CA  . LYS A 1 232 ? 30.045  0.896   76.305  1.00 34.97  ? 438 LYS A CA  1 
ATOM   1850 C C   . LYS A 1 232 ? 30.442  2.355   76.169  1.00 34.29  ? 438 LYS A C   1 
ATOM   1851 O O   . LYS A 1 232 ? 31.164  2.722   75.256  1.00 32.95  ? 438 LYS A O   1 
ATOM   1852 C CB  . LYS A 1 232 ? 28.672  0.675   75.665  1.00 34.38  ? 438 LYS A CB  1 
ATOM   1853 C CG  . LYS A 1 232 ? 28.658  -0.350  74.551  1.00 38.60  ? 438 LYS A CG  1 
ATOM   1854 C CD  . LYS A 1 232 ? 29.169  -1.689  75.038  1.00 39.00  ? 438 LYS A CD  1 
ATOM   1855 C CE  . LYS A 1 232 ? 29.160  -2.732  73.939  1.00 40.21  ? 438 LYS A CE  1 
ATOM   1856 N NZ  . LYS A 1 232 ? 29.742  -4.020  74.416  1.00 43.72  ? 438 LYS A NZ  1 
ATOM   1857 N N   . MET A 1 233 ? 29.957  3.177   77.094  1.00 36.56  ? 439 MET A N   1 
ATOM   1858 C CA  . MET A 1 233 ? 30.274  4.591   77.090  1.00 39.26  ? 439 MET A CA  1 
ATOM   1859 C C   . MET A 1 233 ? 31.781  4.730   77.268  1.00 41.17  ? 439 MET A C   1 
ATOM   1860 O O   . MET A 1 233 ? 32.437  5.503   76.560  1.00 43.16  ? 439 MET A O   1 
ATOM   1861 C CB  . MET A 1 233 ? 29.523  5.294   78.215  1.00 38.61  ? 439 MET A CB  1 
ATOM   1862 C CG  . MET A 1 233 ? 28.040  5.411   77.954  1.00 38.99  ? 439 MET A CG  1 
ATOM   1863 S SD  . MET A 1 233 ? 27.115  6.219   79.263  1.00 43.67  ? 439 MET A SD  1 
ATOM   1864 C CE  . MET A 1 233 ? 27.143  7.926   78.733  1.00 43.65  ? 439 MET A CE  1 
ATOM   1865 N N   . ALA A 1 234 ? 32.337  3.969   78.206  1.00 39.89  ? 440 ALA A N   1 
ATOM   1866 C CA  . ALA A 1 234 ? 33.779  3.996   78.425  1.00 39.10  ? 440 ALA A CA  1 
ATOM   1867 C C   . ALA A 1 234 ? 34.447  3.579   77.115  1.00 39.41  ? 440 ALA A C   1 
ATOM   1868 O O   . ALA A 1 234 ? 35.358  4.256   76.634  1.00 42.17  ? 440 ALA A O   1 
ATOM   1869 C CB  . ALA A 1 234 ? 34.166  3.036   79.549  1.00 37.70  ? 440 ALA A CB  1 
ATOM   1870 N N   . ASP A 1 235 ? 33.982  2.471   76.538  1.00 37.88  ? 441 ASP A N   1 
ATOM   1871 C CA  . ASP A 1 235 ? 34.524  1.975   75.276  1.00 38.34  ? 441 ASP A CA  1 
ATOM   1872 C C   . ASP A 1 235 ? 34.434  3.039   74.188  1.00 38.28  ? 441 ASP A C   1 
ATOM   1873 O O   . ASP A 1 235 ? 35.317  3.153   73.344  1.00 39.59  ? 441 ASP A O   1 
ATOM   1874 C CB  . ASP A 1 235 ? 33.767  0.734   74.797  1.00 39.61  ? 441 ASP A CB  1 
ATOM   1875 C CG  . ASP A 1 235 ? 33.723  -0.367  75.833  1.00 40.71  ? 441 ASP A CG  1 
ATOM   1876 O OD1 . ASP A 1 235 ? 34.654  -0.430  76.664  1.00 42.08  ? 441 ASP A OD1 1 
ATOM   1877 O OD2 . ASP A 1 235 ? 32.764  -1.174  75.797  1.00 39.71  ? 441 ASP A OD2 1 
ATOM   1878 N N   . LEU A 1 236 ? 33.354  3.811   74.209  1.00 38.97  ? 442 LEU A N   1 
ATOM   1879 C CA  . LEU A 1 236 ? 33.141  4.869   73.230  1.00 36.77  ? 442 LEU A CA  1 
ATOM   1880 C C   . LEU A 1 236 ? 34.165  5.970   73.422  1.00 36.70  ? 442 LEU A C   1 
ATOM   1881 O O   . LEU A 1 236 ? 34.690  6.523   72.449  1.00 31.66  ? 442 LEU A O   1 
ATOM   1882 C CB  . LEU A 1 236 ? 31.726  5.435   73.367  1.00 35.90  ? 442 LEU A CB  1 
ATOM   1883 C CG  . LEU A 1 236 ? 30.620  4.541   72.793  1.00 36.21  ? 442 LEU A CG  1 
ATOM   1884 C CD1 . LEU A 1 236 ? 29.266  5.070   73.206  1.00 33.45  ? 442 LEU A CD1 1 
ATOM   1885 C CD2 . LEU A 1 236 ? 30.737  4.502   71.258  1.00 38.24  ? 442 LEU A CD2 1 
ATOM   1886 N N   . ARG A 1 237 ? 34.466  6.267   74.686  1.00 36.58  ? 443 ARG A N   1 
ATOM   1887 C CA  . ARG A 1 237 ? 35.437  7.301   75.000  1.00 37.64  ? 443 ARG A CA  1 
ATOM   1888 C C   . ARG A 1 237 ? 36.826  6.924   74.494  1.00 39.65  ? 443 ARG A C   1 
ATOM   1889 O O   . ARG A 1 237 ? 37.612  7.793   74.123  1.00 40.86  ? 443 ARG A O   1 
ATOM   1890 C CB  . ARG A 1 237 ? 35.458  7.556   76.504  1.00 41.81  ? 443 ARG A CB  1 
ATOM   1891 C CG  . ARG A 1 237 ? 36.243  8.805   76.897  1.00 49.07  ? 443 ARG A CG  1 
ATOM   1892 C CD  . ARG A 1 237 ? 35.705  9.450   78.175  1.00 53.27  ? 443 ARG A CD  1 
ATOM   1893 N NE  . ARG A 1 237 ? 34.375  10.034  77.993  1.00 59.64  ? 443 ARG A NE  1 
ATOM   1894 C CZ  . ARG A 1 237 ? 33.231  9.369   78.125  1.00 63.59  ? 443 ARG A CZ  1 
ATOM   1895 N NH1 . ARG A 1 237 ? 33.233  8.082   78.447  1.00 66.84  ? 443 ARG A NH1 1 
ATOM   1896 N NH2 . ARG A 1 237 ? 32.079  9.994   77.932  1.00 63.36  ? 443 ARG A NH2 1 
ATOM   1897 N N   . GLN A 1 238 ? 37.116  5.623   74.462  1.00 39.32  ? 444 GLN A N   1 
ATOM   1898 C CA  . GLN A 1 238 ? 38.400  5.118   73.982  1.00 36.99  ? 444 GLN A CA  1 
ATOM   1899 C C   . GLN A 1 238 ? 38.462  5.058   72.454  1.00 34.98  ? 444 GLN A C   1 
ATOM   1900 O O   . GLN A 1 238 ? 39.482  5.371   71.851  1.00 31.79  ? 444 GLN A O   1 
ATOM   1901 C CB  . GLN A 1 238 ? 38.663  3.728   74.564  1.00 42.75  ? 444 GLN A CB  1 
ATOM   1902 C CG  . GLN A 1 238 ? 40.096  3.262   74.389  1.00 50.17  ? 444 GLN A CG  1 
ATOM   1903 C CD  . GLN A 1 238 ? 41.096  4.204   75.057  1.00 57.43  ? 444 GLN A CD  1 
ATOM   1904 O OE1 . GLN A 1 238 ? 42.285  4.170   74.751  1.00 64.52  ? 444 GLN A OE1 1 
ATOM   1905 N NE2 . GLN A 1 238 ? 40.616  5.041   75.977  1.00 56.68  ? 444 GLN A NE2 1 
ATOM   1906 N N   . LEU A 1 239 ? 37.362  4.652   71.831  1.00 35.03  ? 445 LEU A N   1 
ATOM   1907 C CA  . LEU A 1 239 ? 37.278  4.566   70.369  1.00 34.83  ? 445 LEU A CA  1 
ATOM   1908 C C   . LEU A 1 239 ? 37.484  5.956   69.757  1.00 32.34  ? 445 LEU A C   1 
ATOM   1909 O O   . LEU A 1 239 ? 38.095  6.108   68.709  1.00 32.11  ? 445 LEU A O   1 
ATOM   1910 C CB  . LEU A 1 239 ? 35.903  4.035   69.954  1.00 34.20  ? 445 LEU A CB  1 
ATOM   1911 C CG  . LEU A 1 239 ? 35.709  3.133   68.727  1.00 40.49  ? 445 LEU A CG  1 
ATOM   1912 C CD1 . LEU A 1 239 ? 34.262  3.276   68.299  1.00 40.87  ? 445 LEU A CD1 1 
ATOM   1913 C CD2 . LEU A 1 239 ? 36.624  3.494   67.568  1.00 38.23  ? 445 LEU A CD2 1 
ATOM   1914 N N   . VAL A 1 240 ? 36.960  6.979   70.413  1.00 33.18  ? 446 VAL A N   1 
ATOM   1915 C CA  . VAL A 1 240 ? 37.114  8.327   69.892  1.00 35.20  ? 446 VAL A CA  1 
ATOM   1916 C C   . VAL A 1 240 ? 38.545  8.799   70.091  1.00 35.99  ? 446 VAL A C   1 
ATOM   1917 O O   . VAL A 1 240 ? 39.058  9.619   69.335  1.00 36.08  ? 446 VAL A O   1 
ATOM   1918 C CB  . VAL A 1 240 ? 36.132  9.317   70.565  1.00 34.19  ? 446 VAL A CB  1 
ATOM   1919 C CG1 . VAL A 1 240 ? 36.576  10.756  70.310  1.00 35.62  ? 446 VAL A CG1 1 
ATOM   1920 C CG2 . VAL A 1 240 ? 34.742  9.102   70.018  1.00 33.24  ? 446 VAL A CG2 1 
ATOM   1921 N N   . THR A 1 241 ? 39.192  8.277   71.118  1.00 36.44  ? 447 THR A N   1 
ATOM   1922 C CA  . THR A 1 241 ? 40.572  8.643   71.357  1.00 39.01  ? 447 THR A CA  1 
ATOM   1923 C C   . THR A 1 241 ? 41.495  8.098   70.261  1.00 40.18  ? 447 THR A C   1 
ATOM   1924 O O   . THR A 1 241 ? 42.356  8.820   69.756  1.00 41.94  ? 447 THR A O   1 
ATOM   1925 C CB  . THR A 1 241 ? 41.029  8.152   72.732  1.00 39.08  ? 447 THR A CB  1 
ATOM   1926 O OG1 . THR A 1 241 ? 40.604  9.101   73.719  1.00 42.20  ? 447 THR A OG1 1 
ATOM   1927 C CG2 . THR A 1 241 ? 42.548  7.996   72.772  1.00 39.81  ? 447 THR A CG2 1 
ATOM   1928 N N   . GLU A 1 242 ? 41.310  6.832   69.893  1.00 38.67  ? 448 GLU A N   1 
ATOM   1929 C CA  . GLU A 1 242 ? 42.120  6.217   68.859  1.00 39.78  ? 448 GLU A CA  1 
ATOM   1930 C C   . GLU A 1 242 ? 41.728  6.766   67.490  1.00 39.44  ? 448 GLU A C   1 
ATOM   1931 O O   . GLU A 1 242 ? 42.512  6.729   66.551  1.00 41.39  ? 448 GLU A O   1 
ATOM   1932 C CB  . GLU A 1 242 ? 41.968  4.690   68.908  1.00 43.19  ? 448 GLU A CB  1 
ATOM   1933 C CG  . GLU A 1 242 ? 40.536  4.204   68.884  1.00 52.25  ? 448 GLU A CG  1 
ATOM   1934 C CD  . GLU A 1 242 ? 40.082  3.705   67.514  1.00 56.85  ? 448 GLU A CD  1 
ATOM   1935 O OE1 . GLU A 1 242 ? 40.603  2.654   67.077  1.00 59.25  ? 448 GLU A OE1 1 
ATOM   1936 O OE2 . GLU A 1 242 ? 39.212  4.356   66.882  1.00 54.04  ? 448 GLU A OE2 1 
ATOM   1937 N N   . HIS A 1 243 ? 40.508  7.273   67.374  1.00 37.47  ? 449 HIS A N   1 
ATOM   1938 C CA  . HIS A 1 243 ? 40.057  7.836   66.116  1.00 35.05  ? 449 HIS A CA  1 
ATOM   1939 C C   . HIS A 1 243 ? 40.766  9.169   65.878  1.00 33.83  ? 449 HIS A C   1 
ATOM   1940 O O   . HIS A 1 243 ? 41.151  9.511   64.757  1.00 35.61  ? 449 HIS A O   1 
ATOM   1941 C CB  . HIS A 1 243 ? 38.545  8.075   66.145  1.00 34.70  ? 449 HIS A CB  1 
ATOM   1942 C CG  . HIS A 1 243 ? 38.009  8.620   64.857  1.00 34.32  ? 449 HIS A CG  1 
ATOM   1943 N ND1 . HIS A 1 243 ? 37.782  7.826   63.753  1.00 27.57  ? 449 HIS A ND1 1 
ATOM   1944 C CD2 . HIS A 1 243 ? 37.730  9.890   64.475  1.00 29.26  ? 449 HIS A CD2 1 
ATOM   1945 C CE1 . HIS A 1 243 ? 37.383  8.583   62.748  1.00 23.75  ? 449 HIS A CE1 1 
ATOM   1946 N NE2 . HIS A 1 243 ? 37.345  9.836   63.158  1.00 25.90  ? 449 HIS A NE2 1 
ATOM   1947 N N   . ALA A 1 244 ? 40.899  9.922   66.956  1.00 35.02  ? 450 ALA A N   1 
ATOM   1948 C CA  . ALA A 1 244 ? 41.525  11.234  66.950  1.00 35.46  ? 450 ALA A CA  1 
ATOM   1949 C C   . ALA A 1 244 ? 43.008  11.098  66.645  1.00 35.22  ? 450 ALA A C   1 
ATOM   1950 O O   . ALA A 1 244 ? 43.612  11.974  66.020  1.00 34.65  ? 450 ALA A O   1 
ATOM   1951 C CB  . ALA A 1 244 ? 41.317  11.891  68.307  1.00 29.50  ? 450 ALA A CB  1 
ATOM   1952 N N   . GLN A 1 245 ? 43.586  9.987   67.091  1.00 35.62  ? 451 GLN A N   1 
ATOM   1953 C CA  . GLN A 1 245 ? 45.003  9.719   66.872  1.00 34.84  ? 451 GLN A CA  1 
ATOM   1954 C C   . GLN A 1 245 ? 45.202  9.381   65.412  1.00 35.13  ? 451 GLN A C   1 
ATOM   1955 O O   . GLN A 1 245 ? 46.193  9.780   64.797  1.00 38.47  ? 451 GLN A O   1 
ATOM   1956 C CB  . GLN A 1 245 ? 45.479  8.567   67.757  1.00 32.35  ? 451 GLN A CB  1 
ATOM   1957 C CG  . GLN A 1 245 ? 45.343  8.851   69.235  1.00 31.24  ? 451 GLN A CG  1 
ATOM   1958 C CD  . GLN A 1 245 ? 45.792  7.695   70.109  1.00 33.47  ? 451 GLN A CD  1 
ATOM   1959 O OE1 . GLN A 1 245 ? 45.856  6.545   69.670  1.00 38.61  ? 451 GLN A OE1 1 
ATOM   1960 N NE2 . GLN A 1 245 ? 46.090  7.994   71.360  1.00 38.00  ? 451 GLN A NE2 1 
ATOM   1961 N N   . MET A 1 246 ? 44.244  8.644   64.862  1.00 36.19  ? 452 MET A N   1 
ATOM   1962 C CA  . MET A 1 246 ? 44.284  8.251   63.465  1.00 37.88  ? 452 MET A CA  1 
ATOM   1963 C C   . MET A 1 246 ? 44.010  9.463   62.592  1.00 35.66  ? 452 MET A C   1 
ATOM   1964 O O   . MET A 1 246 ? 44.552  9.582   61.506  1.00 39.29  ? 452 MET A O   1 
ATOM   1965 C CB  . MET A 1 246 ? 43.246  7.171   63.188  1.00 40.17  ? 452 MET A CB  1 
ATOM   1966 C CG  . MET A 1 246 ? 43.491  5.871   63.920  1.00 46.96  ? 452 MET A CG  1 
ATOM   1967 S SD  . MET A 1 246 ? 42.353  4.576   63.380  1.00 50.67  ? 452 MET A SD  1 
ATOM   1968 C CE  . MET A 1 246 ? 43.309  3.788   62.199  1.00 46.33  ? 452 MET A CE  1 
ATOM   1969 N N   . MET A 1 247 ? 43.147  10.355  63.052  1.00 35.69  ? 453 MET A N   1 
ATOM   1970 C CA  . MET A 1 247 ? 42.871  11.567  62.290  1.00 36.16  ? 453 MET A CA  1 
ATOM   1971 C C   . MET A 1 247 ? 44.145  12.396  62.327  1.00 36.26  ? 453 MET A C   1 
ATOM   1972 O O   . MET A 1 247 ? 44.465  13.080  61.377  1.00 40.00  ? 453 MET A O   1 
ATOM   1973 C CB  . MET A 1 247 ? 41.710  12.365  62.909  1.00 35.71  ? 453 MET A CB  1 
ATOM   1974 C CG  . MET A 1 247 ? 40.325  11.879  62.516  1.00 33.56  ? 453 MET A CG  1 
ATOM   1975 S SD  . MET A 1 247 ? 40.029  11.975  60.718  1.00 40.11  ? 453 MET A SD  1 
ATOM   1976 C CE  . MET A 1 247 ? 40.369  10.255  60.326  1.00 40.49  ? 453 MET A CE  1 
ATOM   1977 N N   . GLN A 1 248 ? 44.877  12.313  63.435  1.00 38.33  ? 454 GLN A N   1 
ATOM   1978 C CA  . GLN A 1 248 ? 46.123  13.061  63.597  1.00 38.72  ? 454 GLN A CA  1 
ATOM   1979 C C   . GLN A 1 248 ? 47.119  12.635  62.535  1.00 37.60  ? 454 GLN A C   1 
ATOM   1980 O O   . GLN A 1 248 ? 47.731  13.465  61.858  1.00 34.85  ? 454 GLN A O   1 
ATOM   1981 C CB  . GLN A 1 248 ? 46.729  12.796  64.975  1.00 41.03  ? 454 GLN A CB  1 
ATOM   1982 C CG  . GLN A 1 248 ? 47.683  13.866  65.420  1.00 47.63  ? 454 GLN A CG  1 
ATOM   1983 C CD  . GLN A 1 248 ? 46.987  15.197  65.546  1.00 53.29  ? 454 GLN A CD  1 
ATOM   1984 O OE1 . GLN A 1 248 ? 46.007  15.319  66.283  1.00 57.52  ? 454 GLN A OE1 1 
ATOM   1985 N NE2 . GLN A 1 248 ? 47.478  16.207  64.823  1.00 53.55  ? 454 GLN A NE2 1 
ATOM   1986 N N   . ARG A 1 249 ? 47.281  11.327  62.411  1.00 35.28  ? 455 ARG A N   1 
ATOM   1987 C CA  . ARG A 1 249 ? 48.181  10.760  61.445  1.00 37.45  ? 455 ARG A CA  1 
ATOM   1988 C C   . ARG A 1 249 ? 47.866  11.208  60.022  1.00 41.21  ? 455 ARG A C   1 
ATOM   1989 O O   . ARG A 1 249 ? 48.767  11.594  59.284  1.00 42.79  ? 455 ARG A O   1 
ATOM   1990 C CB  . ARG A 1 249 ? 48.147  9.239   61.542  1.00 35.94  ? 455 ARG A CB  1 
ATOM   1991 C CG  . ARG A 1 249 ? 48.777  8.702   62.806  1.00 37.77  ? 455 ARG A CG  1 
ATOM   1992 C CD  . ARG A 1 249 ? 50.158  9.295   63.003  1.00 37.97  ? 455 ARG A CD  1 
ATOM   1993 N NE  . ARG A 1 249 ? 51.050  8.945   61.910  1.00 41.22  ? 455 ARG A NE  1 
ATOM   1994 C CZ  . ARG A 1 249 ? 52.209  9.543   61.673  1.00 42.85  ? 455 ARG A CZ  1 
ATOM   1995 N NH1 . ARG A 1 249 ? 52.617  10.531  62.453  1.00 43.35  ? 455 ARG A NH1 1 
ATOM   1996 N NH2 . ARG A 1 249 ? 52.965  9.139   60.664  1.00 40.66  ? 455 ARG A NH2 1 
ATOM   1997 N N   . ILE A 1 250 ? 46.597  11.166  59.632  1.00 41.96  ? 456 ILE A N   1 
ATOM   1998 C CA  . ILE A 1 250 ? 46.226  11.583  58.282  1.00 43.05  ? 456 ILE A CA  1 
ATOM   1999 C C   . ILE A 1 250 ? 46.508  13.067  58.047  1.00 41.96  ? 456 ILE A C   1 
ATOM   2000 O O   . ILE A 1 250 ? 46.749  13.478  56.922  1.00 44.84  ? 456 ILE A O   1 
ATOM   2001 C CB  . ILE A 1 250 ? 44.722  11.304  57.989  1.00 44.92  ? 456 ILE A CB  1 
ATOM   2002 C CG1 . ILE A 1 250 ? 44.362  11.773  56.589  1.00 49.10  ? 456 ILE A CG1 1 
ATOM   2003 C CG2 . ILE A 1 250 ? 43.848  12.084  58.928  1.00 52.33  ? 456 ILE A CG2 1 
ATOM   2004 C CD1 . ILE A 1 250 ? 42.903  11.677  56.279  1.00 54.72  ? 456 ILE A CD1 1 
ATOM   2005 N N   . LYS A 1 251 ? 46.477  13.881  59.097  1.00 41.29  ? 457 LYS A N   1 
ATOM   2006 C CA  . LYS A 1 251 ? 46.736  15.306  58.915  1.00 41.21  ? 457 LYS A CA  1 
ATOM   2007 C C   . LYS A 1 251 ? 48.222  15.582  58.687  1.00 42.68  ? 457 LYS A C   1 
ATOM   2008 O O   . LYS A 1 251 ? 48.596  16.551  58.033  1.00 44.81  ? 457 LYS A O   1 
ATOM   2009 C CB  . LYS A 1 251 ? 46.249  16.118  60.118  1.00 37.19  ? 457 LYS A CB  1 
ATOM   2010 C CG  . LYS A 1 251 ? 46.450  17.616  59.904  1.00 38.53  ? 457 LYS A CG  1 
ATOM   2011 C CD  . LYS A 1 251 ? 46.078  18.438  61.116  1.00 42.55  ? 457 LYS A CD  1 
ATOM   2012 C CE  . LYS A 1 251 ? 46.599  19.851  60.987  1.00 42.65  ? 457 LYS A CE  1 
ATOM   2013 N NZ  . LYS A 1 251 ? 46.318  20.629  62.222  1.00 47.09  ? 457 LYS A NZ  1 
ATOM   2014 N N   . LYS A 1 252 ? 49.068  14.715  59.217  1.00 41.29  ? 458 LYS A N   1 
ATOM   2015 C CA  . LYS A 1 252 ? 50.498  14.868  59.071  1.00 44.52  ? 458 LYS A CA  1 
ATOM   2016 C C   . LYS A 1 252 ? 51.011  14.130  57.852  1.00 47.45  ? 458 LYS A C   1 
ATOM   2017 O O   . LYS A 1 252 ? 51.976  14.559  57.232  1.00 50.34  ? 458 LYS A O   1 
ATOM   2018 C CB  . LYS A 1 252 ? 51.196  14.319  60.316  1.00 46.25  ? 458 LYS A CB  1 
ATOM   2019 C CG  . LYS A 1 252 ? 52.702  14.085  60.192  1.00 45.75  ? 458 LYS A CG  1 
ATOM   2020 C CD  . LYS A 1 252 ? 53.470  15.382  60.097  1.00 46.33  ? 458 LYS A CD  1 
ATOM   2021 C CE  . LYS A 1 252 ? 54.952  15.111  60.211  1.00 48.66  ? 458 LYS A CE  1 
ATOM   2022 N NZ  . LYS A 1 252 ? 55.769  16.311  59.893  1.00 52.20  ? 458 LYS A NZ  1 
ATOM   2023 N N   . THR A 1 253 ? 50.341  13.032  57.509  1.00 50.84  ? 459 THR A N   1 
ATOM   2024 C CA  . THR A 1 253 ? 50.748  12.163  56.414  1.00 51.94  ? 459 THR A CA  1 
ATOM   2025 C C   . THR A 1 253 ? 50.035  12.353  55.077  1.00 53.90  ? 459 THR A C   1 
ATOM   2026 O O   . THR A 1 253 ? 50.657  12.269  54.016  1.00 51.73  ? 459 THR A O   1 
ATOM   2027 C CB  . THR A 1 253 ? 50.597  10.687  56.855  1.00 53.81  ? 459 THR A CB  1 
ATOM   2028 O OG1 . THR A 1 253 ? 51.141  9.821   55.856  1.00 60.33  ? 459 THR A OG1 1 
ATOM   2029 C CG2 . THR A 1 253 ? 49.131  10.335  57.051  1.00 52.63  ? 459 THR A CG2 1 
ATOM   2030 N N   . GLU A 1 254 ? 48.730  12.594  55.124  1.00 55.83  ? 460 GLU A N   1 
ATOM   2031 C CA  . GLU A 1 254 ? 47.942  12.777  53.908  1.00 56.17  ? 460 GLU A CA  1 
ATOM   2032 C C   . GLU A 1 254 ? 47.691  14.262  53.674  1.00 57.82  ? 460 GLU A C   1 
ATOM   2033 O O   . GLU A 1 254 ? 46.554  14.707  53.581  1.00 59.07  ? 460 GLU A O   1 
ATOM   2034 C CB  . GLU A 1 254 ? 46.612  12.037  54.039  1.00 53.27  ? 460 GLU A CB  1 
ATOM   2035 C CG  . GLU A 1 254 ? 46.384  10.950  53.017  1.00 57.49  ? 460 GLU A CG  1 
ATOM   2036 C CD  . GLU A 1 254 ? 47.385  9.830   53.119  1.00 57.57  ? 460 GLU A CD  1 
ATOM   2037 O OE1 . GLU A 1 254 ? 47.676  9.387   54.246  1.00 60.07  ? 460 GLU A OE1 1 
ATOM   2038 O OE2 . GLU A 1 254 ? 47.871  9.377   52.068  1.00 56.46  ? 460 GLU A OE2 1 
ATOM   2039 N N   . THR A 1 255 ? 48.767  15.026  53.573  1.00 59.88  ? 461 THR A N   1 
ATOM   2040 C CA  . THR A 1 255 ? 48.672  16.465  53.370  1.00 61.82  ? 461 THR A CA  1 
ATOM   2041 C C   . THR A 1 255 ? 47.853  16.863  52.145  1.00 62.53  ? 461 THR A C   1 
ATOM   2042 O O   . THR A 1 255 ? 47.243  17.933  52.106  1.00 61.54  ? 461 THR A O   1 
ATOM   2043 C CB  . THR A 1 255 ? 50.071  17.075  53.247  1.00 62.51  ? 461 THR A CB  1 
ATOM   2044 O OG1 . THR A 1 255 ? 49.956  18.483  53.009  1.00 67.17  ? 461 THR A OG1 1 
ATOM   2045 C CG2 . THR A 1 255 ? 50.836  16.417  52.112  1.00 60.26  ? 461 THR A CG2 1 
ATOM   2046 N N   . GLU A 1 256 ? 47.843  15.991  51.146  1.00 63.62  ? 462 GLU A N   1 
ATOM   2047 C CA  . GLU A 1 256 ? 47.119  16.238  49.913  1.00 63.89  ? 462 GLU A CA  1 
ATOM   2048 C C   . GLU A 1 256 ? 45.604  16.238  50.115  1.00 62.83  ? 462 GLU A C   1 
ATOM   2049 O O   . GLU A 1 256 ? 44.872  16.876  49.357  1.00 64.65  ? 462 GLU A O   1 
ATOM   2050 C CB  . GLU A 1 256 ? 47.504  15.177  48.883  1.00 69.01  ? 462 GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 256 ? 46.906  15.371  47.501  1.00 76.50  ? 462 GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 256 ? 47.263  14.230  46.560  1.00 81.14  ? 462 GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 256 ? 46.892  13.074  46.860  1.00 84.01  ? 462 GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 256 ? 47.916  14.487  45.525  1.00 83.07  ? 462 GLU A OE2 1 
ATOM   2055 N N   . THR A 1 257 ? 45.120  15.521  51.124  1.00 58.79  ? 463 THR A N   1 
ATOM   2056 C CA  . THR A 1 257 ? 43.684  15.480  51.355  1.00 56.02  ? 463 THR A CA  1 
ATOM   2057 C C   . THR A 1 257 ? 43.281  16.553  52.366  1.00 54.73  ? 463 THR A C   1 
ATOM   2058 O O   . THR A 1 257 ? 43.978  16.795  53.348  1.00 54.55  ? 463 THR A O   1 
ATOM   2059 C CB  . THR A 1 257 ? 43.231  14.076  51.824  1.00 53.89  ? 463 THR A CB  1 
ATOM   2060 O OG1 . THR A 1 257 ? 42.931  14.099  53.218  1.00 52.49  ? 463 THR A OG1 1 
ATOM   2061 C CG2 . THR A 1 257 ? 44.318  13.063  51.569  1.00 52.09  ? 463 THR A CG2 1 
ATOM   2062 N N   . SER A 1 258 ? 42.158  17.210  52.112  1.00 52.64  ? 464 SER A N   1 
ATOM   2063 C CA  . SER A 1 258 ? 41.709  18.276  52.988  1.00 51.83  ? 464 SER A CA  1 
ATOM   2064 C C   . SER A 1 258 ? 40.668  17.860  54.017  1.00 47.71  ? 464 SER A C   1 
ATOM   2065 O O   . SER A 1 258 ? 39.861  16.976  53.772  1.00 46.47  ? 464 SER A O   1 
ATOM   2066 C CB  . SER A 1 258 ? 41.173  19.437  52.142  1.00 54.04  ? 464 SER A CB  1 
ATOM   2067 O OG  . SER A 1 258 ? 40.166  18.997  51.252  1.00 56.27  ? 464 SER A OG  1 
ATOM   2068 N N   . LEU A 1 259 ? 40.702  18.522  55.170  1.00 45.72  ? 465 LEU A N   1 
ATOM   2069 C CA  . LEU A 1 259 ? 39.771  18.263  56.260  1.00 42.86  ? 465 LEU A CA  1 
ATOM   2070 C C   . LEU A 1 259 ? 38.832  19.453  56.387  1.00 40.00  ? 465 LEU A C   1 
ATOM   2071 O O   . LEU A 1 259 ? 39.231  20.587  56.180  1.00 41.45  ? 465 LEU A O   1 
ATOM   2072 C CB  . LEU A 1 259 ? 40.523  18.043  57.581  1.00 43.15  ? 465 LEU A CB  1 
ATOM   2073 C CG  . LEU A 1 259 ? 39.609  17.801  58.804  1.00 50.25  ? 465 LEU A CG  1 
ATOM   2074 C CD1 . LEU A 1 259 ? 38.719  16.575  58.566  1.00 50.05  ? 465 LEU A CD1 1 
ATOM   2075 C CD2 . LEU A 1 259 ? 40.438  17.616  60.071  1.00 47.73  ? 465 LEU A CD2 1 
ATOM   2076 N N   . HIS A 1 260 ? 37.577  19.173  56.709  1.00 38.48  ? 466 HIS A N   1 
ATOM   2077 C CA  . HIS A 1 260 ? 36.538  20.182  56.873  1.00 36.52  ? 466 HIS A CA  1 
ATOM   2078 C C   . HIS A 1 260 ? 36.849  21.106  58.050  1.00 38.13  ? 466 HIS A C   1 
ATOM   2079 O O   . HIS A 1 260 ? 37.199  20.645  59.137  1.00 39.41  ? 466 HIS A O   1 
ATOM   2080 C CB  . HIS A 1 260 ? 35.211  19.480  57.104  1.00 36.36  ? 466 HIS A CB  1 
ATOM   2081 C CG  . HIS A 1 260 ? 34.040  20.404  57.110  1.00 39.10  ? 466 HIS A CG  1 
ATOM   2082 N ND1 . HIS A 1 260 ? 33.914  21.431  58.018  1.00 41.60  ? 466 HIS A ND1 1 
ATOM   2083 C CD2 . HIS A 1 260 ? 32.951  20.469  56.310  1.00 35.69  ? 466 HIS A CD2 1 
ATOM   2084 C CE1 . HIS A 1 260 ? 32.796  22.091  57.776  1.00 40.51  ? 466 HIS A CE1 1 
ATOM   2085 N NE2 . HIS A 1 260 ? 32.196  21.528  56.744  1.00 36.92  ? 466 HIS A NE2 1 
ATOM   2086 N N   . PRO A 1 261 ? 36.704  22.425  57.861  1.00 39.14  ? 467 PRO A N   1 
ATOM   2087 C CA  . PRO A 1 261 ? 36.982  23.401  58.920  1.00 39.82  ? 467 PRO A CA  1 
ATOM   2088 C C   . PRO A 1 261 ? 36.297  23.142  60.266  1.00 41.17  ? 467 PRO A C   1 
ATOM   2089 O O   . PRO A 1 261 ? 36.872  23.420  61.315  1.00 40.19  ? 467 PRO A O   1 
ATOM   2090 C CB  . PRO A 1 261 ? 36.580  24.734  58.283  1.00 38.95  ? 467 PRO A CB  1 
ATOM   2091 C CG  . PRO A 1 261 ? 35.525  24.348  57.324  1.00 40.41  ? 467 PRO A CG  1 
ATOM   2092 C CD  . PRO A 1 261 ? 36.090  23.091  56.697  1.00 41.10  ? 467 PRO A CD  1 
ATOM   2093 N N   . LEU A 1 262 ? 35.087  22.595  60.250  1.00 42.29  ? 468 LEU A N   1 
ATOM   2094 C CA  . LEU A 1 262 ? 34.395  22.323  61.503  1.00 40.80  ? 468 LEU A CA  1 
ATOM   2095 C C   . LEU A 1 262 ? 35.052  21.163  62.238  1.00 41.11  ? 468 LEU A C   1 
ATOM   2096 O O   . LEU A 1 262 ? 35.177  21.170  63.466  1.00 41.25  ? 468 LEU A O   1 
ATOM   2097 C CB  . LEU A 1 262 ? 32.916  21.999  61.256  1.00 39.58  ? 468 LEU A CB  1 
ATOM   2098 C CG  . LEU A 1 262 ? 32.167  21.457  62.483  1.00 37.07  ? 468 LEU A CG  1 
ATOM   2099 C CD1 . LEU A 1 262 ? 32.368  22.400  63.637  1.00 36.07  ? 468 LEU A CD1 1 
ATOM   2100 C CD2 . LEU A 1 262 ? 30.685  21.302  62.177  1.00 34.43  ? 468 LEU A CD2 1 
ATOM   2101 N N   . LEU A 1 263 ? 35.470  20.162  61.479  1.00 41.96  ? 469 LEU A N   1 
ATOM   2102 C CA  . LEU A 1 263 ? 36.109  18.997  62.068  1.00 43.54  ? 469 LEU A CA  1 
ATOM   2103 C C   . LEU A 1 263 ? 37.518  19.307  62.596  1.00 44.51  ? 469 LEU A C   1 
ATOM   2104 O O   . LEU A 1 263 ? 37.980  18.694  63.560  1.00 44.91  ? 469 LEU A O   1 
ATOM   2105 C CB  . LEU A 1 263 ? 36.128  17.856  61.039  1.00 41.86  ? 469 LEU A CB  1 
ATOM   2106 C CG  . LEU A 1 263 ? 34.994  16.820  61.054  1.00 37.19  ? 469 LEU A CG  1 
ATOM   2107 C CD1 . LEU A 1 263 ? 33.656  17.433  61.429  1.00 34.43  ? 469 LEU A CD1 1 
ATOM   2108 C CD2 . LEU A 1 263 ? 34.938  16.178  59.675  1.00 33.32  ? 469 LEU A CD2 1 
ATOM   2109 N N   . GLN A 1 264 ? 38.213  20.254  61.976  1.00 47.02  ? 470 GLN A N   1 
ATOM   2110 C CA  . GLN A 1 264 ? 39.540  20.602  62.471  1.00 49.63  ? 470 GLN A CA  1 
ATOM   2111 C C   . GLN A 1 264 ? 39.390  21.314  63.824  1.00 48.73  ? 470 GLN A C   1 
ATOM   2112 O O   . GLN A 1 264 ? 40.253  21.197  64.696  1.00 47.16  ? 470 GLN A O   1 
ATOM   2113 C CB  . GLN A 1 264 ? 40.278  21.492  61.465  1.00 52.27  ? 470 GLN A CB  1 
ATOM   2114 C CG  . GLN A 1 264 ? 41.289  20.746  60.573  1.00 55.82  ? 470 GLN A CG  1 
ATOM   2115 C CD  . GLN A 1 264 ? 42.486  20.174  61.349  1.00 60.42  ? 470 GLN A CD  1 
ATOM   2116 O OE1 . GLN A 1 264 ? 43.243  20.909  61.986  1.00 60.46  ? 470 GLN A OE1 1 
ATOM   2117 N NE2 . GLN A 1 264 ? 42.657  18.857  61.286  1.00 59.84  ? 470 GLN A NE2 1 
ATOM   2118 N N   . GLU A 1 265 ? 38.275  22.029  63.985  1.00 47.95  ? 471 GLU A N   1 
ATOM   2119 C CA  . GLU A 1 265 ? 37.956  22.747  65.216  1.00 47.56  ? 471 GLU A CA  1 
ATOM   2120 C C   . GLU A 1 265 ? 37.735  21.779  66.376  1.00 46.91  ? 471 GLU A C   1 
ATOM   2121 O O   . GLU A 1 265 ? 38.138  22.047  67.502  1.00 44.10  ? 471 GLU A O   1 
ATOM   2122 C CB  . GLU A 1 265 ? 36.681  23.580  65.042  1.00 51.43  ? 471 GLU A CB  1 
ATOM   2123 C CG  . GLU A 1 265 ? 36.784  24.754  64.088  1.00 57.49  ? 471 GLU A CG  1 
ATOM   2124 C CD  . GLU A 1 265 ? 37.796  25.784  64.538  1.00 64.23  ? 471 GLU A CD  1 
ATOM   2125 O OE1 . GLU A 1 265 ? 39.005  25.467  64.539  1.00 66.99  ? 471 GLU A OE1 1 
ATOM   2126 O OE2 . GLU A 1 265 ? 37.384  26.907  64.898  1.00 67.16  ? 471 GLU A OE2 1 
ATOM   2127 N N   . ILE A 1 266 ? 37.067  20.665  66.093  1.00 50.47  ? 472 ILE A N   1 
ATOM   2128 C CA  . ILE A 1 266 ? 36.780  19.644  67.102  1.00 51.12  ? 472 ILE A CA  1 
ATOM   2129 C C   . ILE A 1 266 ? 38.083  18.974  67.535  1.00 53.10  ? 472 ILE A C   1 
ATOM   2130 O O   . ILE A 1 266 ? 38.213  18.541  68.674  1.00 53.71  ? 472 ILE A O   1 
ATOM   2131 C CB  . ILE A 1 266 ? 35.815  18.548  66.539  1.00 50.71  ? 472 ILE A CB  1 
ATOM   2132 C CG1 . ILE A 1 266 ? 34.438  19.145  66.262  1.00 46.84  ? 472 ILE A CG1 1 
ATOM   2133 C CG2 . ILE A 1 266 ? 35.696  17.386  67.504  1.00 46.17  ? 472 ILE A CG2 1 
ATOM   2134 C CD1 . ILE A 1 266 ? 33.410  18.127  65.798  1.00 42.32  ? 472 ILE A CD1 1 
ATOM   2135 N N   . TYR A 1 267 ? 39.052  18.897  66.628  1.00 56.05  ? 473 TYR A N   1 
ATOM   2136 C CA  . TYR A 1 267 ? 40.330  18.262  66.944  1.00 58.88  ? 473 TYR A CA  1 
ATOM   2137 C C   . TYR A 1 267 ? 41.425  19.239  67.396  1.00 62.02  ? 473 TYR A C   1 
ATOM   2138 O O   . TYR A 1 267 ? 42.468  18.812  67.891  1.00 59.70  ? 473 TYR A O   1 
ATOM   2139 C CB  . TYR A 1 267 ? 40.833  17.449  65.736  1.00 53.24  ? 473 TYR A CB  1 
ATOM   2140 C CG  . TYR A 1 267 ? 39.921  16.308  65.317  1.00 47.22  ? 473 TYR A CG  1 
ATOM   2141 C CD1 . TYR A 1 267 ? 39.531  15.324  66.226  1.00 45.66  ? 473 TYR A CD1 1 
ATOM   2142 C CD2 . TYR A 1 267 ? 39.449  16.220  64.013  1.00 46.22  ? 473 TYR A CD2 1 
ATOM   2143 C CE1 . TYR A 1 267 ? 38.692  14.286  65.842  1.00 40.36  ? 473 TYR A CE1 1 
ATOM   2144 C CE2 . TYR A 1 267 ? 38.609  15.184  63.618  1.00 41.32  ? 473 TYR A CE2 1 
ATOM   2145 C CZ  . TYR A 1 267 ? 38.236  14.227  64.538  1.00 41.30  ? 473 TYR A CZ  1 
ATOM   2146 O OH  . TYR A 1 267 ? 37.397  13.219  64.152  1.00 41.45  ? 473 TYR A OH  1 
ATOM   2147 N N   . LYS A 1 268 ? 41.181  20.538  67.229  1.00 67.24  ? 474 LYS A N   1 
ATOM   2148 C CA  . LYS A 1 268 ? 42.144  21.579  67.609  1.00 72.65  ? 474 LYS A CA  1 
ATOM   2149 C C   . LYS A 1 268 ? 42.749  21.349  68.993  1.00 77.10  ? 474 LYS A C   1 
ATOM   2150 O O   . LYS A 1 268 ? 43.961  21.183  69.139  1.00 78.64  ? 474 LYS A O   1 
ATOM   2151 C CB  . LYS A 1 268 ? 41.467  22.953  67.583  1.00 71.26  ? 474 LYS A CB  1 
ATOM   2152 C CG  . LYS A 1 268 ? 42.401  24.133  67.844  1.00 73.35  ? 474 LYS A CG  1 
ATOM   2153 C CD  . LYS A 1 268 ? 41.614  25.419  68.090  1.00 75.12  ? 474 LYS A CD  1 
ATOM   2154 C CE  . LYS A 1 268 ? 40.731  25.773  66.900  1.00 77.80  ? 474 LYS A CE  1 
ATOM   2155 N NZ  . LYS A 1 268 ? 39.821  26.924  67.166  1.00 76.20  ? 474 LYS A NZ  1 
ATOM   2156 N N   . ASP A 1 269 ? 41.895  21.353  70.009  1.00 81.09  ? 475 ASP A N   1 
ATOM   2157 C CA  . ASP A 1 269 ? 42.339  21.146  71.378  1.00 83.99  ? 475 ASP A CA  1 
ATOM   2158 C C   . ASP A 1 269 ? 42.067  19.700  71.768  1.00 85.91  ? 475 ASP A C   1 
ATOM   2159 O O   . ASP A 1 269 ? 42.224  19.315  72.925  1.00 86.94  ? 475 ASP A O   1 
ATOM   2160 C CB  . ASP A 1 269 ? 41.594  22.098  72.314  1.00 85.05  ? 475 ASP A CB  1 
ATOM   2161 C CG  . ASP A 1 269 ? 42.090  22.014  73.743  1.00 88.21  ? 475 ASP A CG  1 
ATOM   2162 O OD1 . ASP A 1 269 ? 43.294  22.250  73.971  1.00 90.32  ? 475 ASP A OD1 1 
ATOM   2163 O OD2 . ASP A 1 269 ? 41.274  21.716  74.641  1.00 89.97  ? 475 ASP A OD2 1 
ATOM   2164 N N   . MET A 1 270 ? 41.659  18.900  70.788  1.00 87.05  ? 476 MET A N   1 
ATOM   2165 C CA  . MET A 1 270 ? 41.371  17.491  71.021  1.00 87.63  ? 476 MET A CA  1 
ATOM   2166 C C   . MET A 1 270 ? 42.409  16.632  70.303  1.00 90.28  ? 476 MET A C   1 
ATOM   2167 O O   . MET A 1 270 ? 43.237  17.211  69.563  1.00 92.70  ? 476 MET A O   1 
ATOM   2168 C CB  . MET A 1 270 ? 39.969  17.145  70.511  1.00 83.82  ? 476 MET A CB  1 
ATOM   2169 C CG  . MET A 1 270 ? 39.497  15.755  70.890  1.00 80.01  ? 476 MET A CG  1 
ATOM   2170 S SD  . MET A 1 270 ? 37.794  15.455  70.418  1.00 75.63  ? 476 MET A SD  1 
ATOM   2171 C CE  . MET A 1 270 ? 38.011  14.393  69.057  1.00 79.40  ? 476 MET A CE  1 
ATOM   2172 N N   . TYR A 1 271 ? 42.387  15.395  70.487  1.00 92.81  ? 477 TYR A N   1 
ATOM   2173 N N   . GLN B 1 1   ? 9.014   -1.756  46.065  1.00 114.72 ? 207 GLN B N   1 
ATOM   2174 C CA  . GLN B 1 1   ? 10.190  -1.333  46.878  1.00 114.25 ? 207 GLN B CA  1 
ATOM   2175 C C   . GLN B 1 1   ? 11.192  -0.514  46.058  1.00 113.97 ? 207 GLN B C   1 
ATOM   2176 O O   . GLN B 1 1   ? 10.814  0.470   45.415  1.00 113.71 ? 207 GLN B O   1 
ATOM   2177 C CB  . GLN B 1 1   ? 10.876  -2.564  47.474  1.00 114.50 ? 207 GLN B CB  1 
ATOM   2178 C CG  . GLN B 1 1   ? 11.241  -3.641  46.466  1.00 115.03 ? 207 GLN B CG  1 
ATOM   2179 C CD  . GLN B 1 1   ? 11.864  -4.860  47.123  1.00 116.19 ? 207 GLN B CD  1 
ATOM   2180 O OE1 . GLN B 1 1   ? 12.964  -4.792  47.674  1.00 116.26 ? 207 GLN B OE1 1 
ATOM   2181 N NE2 . GLN B 1 1   ? 11.155  -5.985  47.072  1.00 116.80 ? 207 GLN B NE2 1 
ATOM   2182 N N   . VAL B 1 2   ? 12.462  -0.919  46.088  1.00 112.93 ? 208 VAL B N   1 
ATOM   2183 C CA  . VAL B 1 2   ? 13.511  -0.220  45.348  1.00 111.83 ? 208 VAL B CA  1 
ATOM   2184 C C   . VAL B 1 2   ? 14.172  -1.124  44.299  1.00 111.21 ? 208 VAL B C   1 
ATOM   2185 O O   . VAL B 1 2   ? 13.551  -1.458  43.291  1.00 111.21 ? 208 VAL B O   1 
ATOM   2186 C CB  . VAL B 1 2   ? 14.598  0.336   46.305  1.00 111.18 ? 208 VAL B CB  1 
ATOM   2187 C CG1 . VAL B 1 2   ? 15.555  1.247   45.541  1.00 111.07 ? 208 VAL B CG1 1 
ATOM   2188 C CG2 . VAL B 1 2   ? 13.944  1.096   47.445  1.00 111.29 ? 208 VAL B CG2 1 
ATOM   2189 N N   . ALA B 1 3   ? 15.423  -1.520  44.537  1.00 110.09 ? 209 ALA B N   1 
ATOM   2190 C CA  . ALA B 1 3   ? 16.164  -2.373  43.599  1.00 107.21 ? 209 ALA B CA  1 
ATOM   2191 C C   . ALA B 1 3   ? 15.310  -3.468  42.951  1.00 104.38 ? 209 ALA B C   1 
ATOM   2192 O O   . ALA B 1 3   ? 15.347  -3.644  41.733  1.00 104.45 ? 209 ALA B O   1 
ATOM   2193 C CB  . ALA B 1 3   ? 17.376  -3.000  44.301  1.00 108.20 ? 209 ALA B CB  1 
ATOM   2194 N N   . ASP B 1 4   ? 14.554  -4.206  43.763  1.00 99.99  ? 210 ASP B N   1 
ATOM   2195 C CA  . ASP B 1 4   ? 13.695  -5.270  43.251  1.00 95.26  ? 210 ASP B CA  1 
ATOM   2196 C C   . ASP B 1 4   ? 12.667  -4.667  42.290  1.00 91.56  ? 210 ASP B C   1 
ATOM   2197 O O   . ASP B 1 4   ? 12.357  -5.248  41.246  1.00 90.22  ? 210 ASP B O   1 
ATOM   2198 C CB  . ASP B 1 4   ? 12.992  -5.978  44.414  1.00 96.81  ? 210 ASP B CB  1 
ATOM   2199 C CG  . ASP B 1 4   ? 12.137  -7.155  43.960  1.00 98.22  ? 210 ASP B CG  1 
ATOM   2200 O OD1 . ASP B 1 4   ? 12.683  -8.085  43.327  1.00 99.46  ? 210 ASP B OD1 1 
ATOM   2201 O OD2 . ASP B 1 4   ? 10.919  -7.154  44.243  1.00 97.87  ? 210 ASP B OD2 1 
ATOM   2202 N N   . LEU B 1 5   ? 12.149  -3.496  42.649  1.00 86.00  ? 211 LEU B N   1 
ATOM   2203 C CA  . LEU B 1 5   ? 11.174  -2.788  41.823  1.00 81.36  ? 211 LEU B CA  1 
ATOM   2204 C C   . LEU B 1 5   ? 11.950  -1.894  40.851  1.00 79.72  ? 211 LEU B C   1 
ATOM   2205 O O   . LEU B 1 5   ? 11.392  -1.026  40.188  1.00 78.53  ? 211 LEU B O   1 
ATOM   2206 C CB  . LEU B 1 5   ? 10.268  -1.935  42.714  1.00 79.18  ? 211 LEU B CB  1 
ATOM   2207 C CG  . LEU B 1 5   ? 8.934   -1.447  42.154  1.00 76.36  ? 211 LEU B CG  1 
ATOM   2208 C CD1 . LEU B 1 5   ? 8.090   -2.637  41.737  1.00 76.91  ? 211 LEU B CD1 1 
ATOM   2209 C CD2 . LEU B 1 5   ? 8.211   -0.642  43.213  1.00 75.60  ? 211 LEU B CD2 1 
ATOM   2210 N N   . LYS B 1 6   ? 13.255  -2.123  40.791  1.00 79.17  ? 212 LYS B N   1 
ATOM   2211 C CA  . LYS B 1 6   ? 14.148  -1.370  39.920  1.00 77.47  ? 212 LYS B CA  1 
ATOM   2212 C C   . LYS B 1 6   ? 14.644  -2.359  38.872  1.00 76.26  ? 212 LYS B C   1 
ATOM   2213 O O   . LYS B 1 6   ? 14.693  -2.056  37.676  1.00 76.21  ? 212 LYS B O   1 
ATOM   2214 C CB  . LYS B 1 6   ? 15.331  -0.828  40.731  1.00 76.25  ? 212 LYS B CB  1 
ATOM   2215 C CG  . LYS B 1 6   ? 15.810  0.547   40.305  1.00 76.60  ? 212 LYS B CG  1 
ATOM   2216 C CD  . LYS B 1 6   ? 14.743  1.604   40.556  1.00 78.72  ? 212 LYS B CD  1 
ATOM   2217 C CE  . LYS B 1 6   ? 15.213  2.994   40.134  1.00 80.45  ? 212 LYS B CE  1 
ATOM   2218 N NZ  . LYS B 1 6   ? 16.383  3.476   40.923  1.00 82.29  ? 212 LYS B NZ  1 
ATOM   2219 N N   . ALA B 1 7   ? 15.003  -3.550  39.338  1.00 73.10  ? 213 ALA B N   1 
ATOM   2220 C CA  . ALA B 1 7   ? 15.476  -4.603  38.458  1.00 71.92  ? 213 ALA B CA  1 
ATOM   2221 C C   . ALA B 1 7   ? 14.271  -5.235  37.771  1.00 70.83  ? 213 ALA B C   1 
ATOM   2222 O O   . ALA B 1 7   ? 14.414  -6.155  36.966  1.00 71.14  ? 213 ALA B O   1 
ATOM   2223 C CB  . ALA B 1 7   ? 16.235  -5.648  39.258  1.00 72.37  ? 213 ALA B CB  1 
ATOM   2224 N N   . PHE B 1 8   ? 13.080  -4.750  38.114  1.00 69.72  ? 214 PHE B N   1 
ATOM   2225 C CA  . PHE B 1 8   ? 11.847  -5.252  37.517  1.00 66.77  ? 214 PHE B CA  1 
ATOM   2226 C C   . PHE B 1 8   ? 11.484  -4.353  36.354  1.00 66.47  ? 214 PHE B C   1 
ATOM   2227 O O   . PHE B 1 8   ? 11.098  -4.831  35.292  1.00 65.40  ? 214 PHE B O   1 
ATOM   2228 C CB  . PHE B 1 8   ? 10.700  -5.251  38.533  1.00 64.97  ? 214 PHE B CB  1 
ATOM   2229 C CG  . PHE B 1 8   ? 9.369   -5.682  37.959  1.00 61.36  ? 214 PHE B CG  1 
ATOM   2230 C CD1 . PHE B 1 8   ? 8.529   -4.763  37.340  1.00 60.18  ? 214 PHE B CD1 1 
ATOM   2231 C CD2 . PHE B 1 8   ? 8.956   -7.016  38.039  1.00 61.66  ? 214 PHE B CD2 1 
ATOM   2232 C CE1 . PHE B 1 8   ? 7.297   -5.160  36.809  1.00 58.60  ? 214 PHE B CE1 1 
ATOM   2233 C CE2 . PHE B 1 8   ? 7.722   -7.423  37.507  1.00 59.26  ? 214 PHE B CE2 1 
ATOM   2234 C CZ  . PHE B 1 8   ? 6.896   -6.492  36.893  1.00 57.06  ? 214 PHE B CZ  1 
ATOM   2235 N N   . SER B 1 9   ? 11.610  -3.047  36.572  1.00 66.07  ? 215 SER B N   1 
ATOM   2236 C CA  . SER B 1 9   ? 11.299  -2.064  35.548  1.00 66.37  ? 215 SER B CA  1 
ATOM   2237 C C   . SER B 1 9   ? 12.384  -2.053  34.471  1.00 67.21  ? 215 SER B C   1 
ATOM   2238 O O   . SER B 1 9   ? 12.183  -1.520  33.376  1.00 69.99  ? 215 SER B O   1 
ATOM   2239 C CB  . SER B 1 9   ? 11.160  -0.681  36.178  1.00 64.64  ? 215 SER B CB  1 
ATOM   2240 N N   . LYS B 1 10  ? 13.529  -2.652  34.784  1.00 65.64  ? 216 LYS B N   1 
ATOM   2241 C CA  . LYS B 1 10  ? 14.647  -2.711  33.851  1.00 64.17  ? 216 LYS B CA  1 
ATOM   2242 C C   . LYS B 1 10  ? 14.591  -4.001  33.038  1.00 62.20  ? 216 LYS B C   1 
ATOM   2243 O O   . LYS B 1 10  ? 14.992  -4.032  31.876  1.00 59.68  ? 216 LYS B O   1 
ATOM   2244 C CB  . LYS B 1 10  ? 15.978  -2.639  34.612  1.00 67.11  ? 216 LYS B CB  1 
ATOM   2245 C CG  . LYS B 1 10  ? 17.210  -2.357  33.742  1.00 67.46  ? 216 LYS B CG  1 
ATOM   2246 C CD  . LYS B 1 10  ? 18.496  -2.523  34.541  1.00 70.40  ? 216 LYS B CD  1 
ATOM   2247 C CE  . LYS B 1 10  ? 18.505  -1.682  35.821  1.00 70.01  ? 216 LYS B CE  1 
ATOM   2248 N NZ  . LYS B 1 10  ? 19.673  -2.016  36.689  1.00 66.29  ? 216 LYS B NZ  1 
ATOM   2249 N N   . HIS B 1 11  ? 14.099  -5.069  33.652  1.00 60.48  ? 217 HIS B N   1 
ATOM   2250 C CA  . HIS B 1 11  ? 14.003  -6.331  32.944  1.00 61.92  ? 217 HIS B CA  1 
ATOM   2251 C C   . HIS B 1 11  ? 12.927  -6.236  31.868  1.00 61.68  ? 217 HIS B C   1 
ATOM   2252 O O   . HIS B 1 11  ? 13.028  -6.869  30.817  1.00 62.41  ? 217 HIS B O   1 
ATOM   2253 C CB  . HIS B 1 11  ? 13.670  -7.474  33.892  1.00 63.62  ? 217 HIS B CB  1 
ATOM   2254 C CG  . HIS B 1 11  ? 13.576  -8.800  33.207  1.00 68.72  ? 217 HIS B CG  1 
ATOM   2255 N ND1 . HIS B 1 11  ? 12.544  -9.121  32.352  1.00 70.27  ? 217 HIS B ND1 1 
ATOM   2256 C CD2 . HIS B 1 11  ? 14.413  -9.865  33.205  1.00 71.46  ? 217 HIS B CD2 1 
ATOM   2257 C CE1 . HIS B 1 11  ? 12.749  -10.326 31.853  1.00 71.31  ? 217 HIS B CE1 1 
ATOM   2258 N NE2 . HIS B 1 11  ? 13.875  -10.800 32.354  1.00 70.25  ? 217 HIS B NE2 1 
ATOM   2259 N N   . ILE B 1 12  ? 11.894  -5.444  32.133  1.00 58.30  ? 218 ILE B N   1 
ATOM   2260 C CA  . ILE B 1 12  ? 10.827  -5.258  31.164  1.00 55.43  ? 218 ILE B CA  1 
ATOM   2261 C C   . ILE B 1 12  ? 11.275  -4.242  30.102  1.00 53.88  ? 218 ILE B C   1 
ATOM   2262 O O   . ILE B 1 12  ? 10.702  -4.169  29.024  1.00 53.76  ? 218 ILE B O   1 
ATOM   2263 C CB  . ILE B 1 12  ? 9.533   -4.784  31.868  1.00 54.26  ? 218 ILE B CB  1 
ATOM   2264 C CG1 . ILE B 1 12  ? 8.997   -5.915  32.747  1.00 51.08  ? 218 ILE B CG1 1 
ATOM   2265 C CG2 . ILE B 1 12  ? 8.476   -4.375  30.845  1.00 53.71  ? 218 ILE B CG2 1 
ATOM   2266 C CD1 . ILE B 1 12  ? 7.728   -5.554  33.503  1.00 53.04  ? 218 ILE B CD1 1 
ATOM   2267 N N   . TYR B 1 13  ? 12.313  -3.470  30.410  1.00 52.93  ? 219 TYR B N   1 
ATOM   2268 C CA  . TYR B 1 13  ? 12.838  -2.476  29.479  1.00 50.81  ? 219 TYR B CA  1 
ATOM   2269 C C   . TYR B 1 13  ? 13.795  -3.107  28.473  1.00 49.34  ? 219 TYR B C   1 
ATOM   2270 O O   . TYR B 1 13  ? 13.888  -2.655  27.336  1.00 46.87  ? 219 TYR B O   1 
ATOM   2271 C CB  . TYR B 1 13  ? 13.556  -1.354  30.234  1.00 52.11  ? 219 TYR B CB  1 
ATOM   2272 C CG  . TYR B 1 13  ? 14.176  -0.309  29.332  1.00 53.28  ? 219 TYR B CG  1 
ATOM   2273 C CD1 . TYR B 1 13  ? 15.538  -0.035  29.388  1.00 56.11  ? 219 TYR B CD1 1 
ATOM   2274 C CD2 . TYR B 1 13  ? 13.405  0.391   28.416  1.00 54.49  ? 219 TYR B CD2 1 
ATOM   2275 C CE1 . TYR B 1 13  ? 16.117  0.906   28.547  1.00 57.56  ? 219 TYR B CE1 1 
ATOM   2276 C CE2 . TYR B 1 13  ? 13.972  1.332   27.570  1.00 56.37  ? 219 TYR B CE2 1 
ATOM   2277 C CZ  . TYR B 1 13  ? 15.328  1.587   27.640  1.00 58.77  ? 219 TYR B CZ  1 
ATOM   2278 O OH  . TYR B 1 13  ? 15.902  2.511   26.790  1.00 61.58  ? 219 TYR B OH  1 
ATOM   2279 N N   . ASN B 1 14  ? 14.516  -4.143  28.889  1.00 50.35  ? 220 ASN B N   1 
ATOM   2280 C CA  . ASN B 1 14  ? 15.430  -4.813  27.975  1.00 52.22  ? 220 ASN B CA  1 
ATOM   2281 C C   . ASN B 1 14  ? 14.589  -5.729  27.096  1.00 50.12  ? 220 ASN B C   1 
ATOM   2282 O O   . ASN B 1 14  ? 14.857  -5.887  25.900  1.00 50.09  ? 220 ASN B O   1 
ATOM   2283 C CB  . ASN B 1 14  ? 16.502  -5.607  28.740  1.00 56.19  ? 220 ASN B CB  1 
ATOM   2284 C CG  . ASN B 1 14  ? 17.623  -4.718  29.275  1.00 61.41  ? 220 ASN B CG  1 
ATOM   2285 O OD1 . ASN B 1 14  ? 18.288  -4.007  28.513  1.00 61.40  ? 220 ASN B OD1 1 
ATOM   2286 N ND2 . ASN B 1 14  ? 17.834  -4.753  30.590  1.00 65.43  ? 220 ASN B ND2 1 
ATOM   2287 N N   . ALA B 1 15  ? 13.558  -6.320  27.687  1.00 47.36  ? 221 ALA B N   1 
ATOM   2288 C CA  . ALA B 1 15  ? 12.657  -7.187  26.938  1.00 48.00  ? 221 ALA B CA  1 
ATOM   2289 C C   . ALA B 1 15  ? 12.039  -6.337  25.816  1.00 48.75  ? 221 ALA B C   1 
ATOM   2290 O O   . ALA B 1 15  ? 11.859  -6.793  24.681  1.00 45.73  ? 221 ALA B O   1 
ATOM   2291 C CB  . ALA B 1 15  ? 11.564  -7.733  27.859  1.00 45.53  ? 221 ALA B CB  1 
ATOM   2292 N N   . TYR B 1 16  ? 11.723  -5.091  26.151  1.00 47.04  ? 222 TYR B N   1 
ATOM   2293 C CA  . TYR B 1 16  ? 11.147  -4.162  25.193  1.00 47.35  ? 222 TYR B CA  1 
ATOM   2294 C C   . TYR B 1 16  ? 12.187  -3.704  24.157  1.00 49.68  ? 222 TYR B C   1 
ATOM   2295 O O   . TYR B 1 16  ? 11.829  -3.348  23.039  1.00 53.55  ? 222 TYR B O   1 
ATOM   2296 C CB  . TYR B 1 16  ? 10.543  -2.970  25.947  1.00 44.52  ? 222 TYR B CB  1 
ATOM   2297 C CG  . TYR B 1 16  ? 10.070  -1.824  25.080  1.00 46.43  ? 222 TYR B CG  1 
ATOM   2298 C CD1 . TYR B 1 16  ? 10.977  -0.896  24.560  1.00 46.35  ? 222 TYR B CD1 1 
ATOM   2299 C CD2 . TYR B 1 16  ? 8.712   -1.629  24.826  1.00 48.60  ? 222 TYR B CD2 1 
ATOM   2300 C CE1 . TYR B 1 16  ? 10.546  0.203   23.824  1.00 44.13  ? 222 TYR B CE1 1 
ATOM   2301 C CE2 . TYR B 1 16  ? 8.269   -0.528  24.084  1.00 46.84  ? 222 TYR B CE2 1 
ATOM   2302 C CZ  . TYR B 1 16  ? 9.197   0.385   23.597  1.00 47.01  ? 222 TYR B CZ  1 
ATOM   2303 O OH  . TYR B 1 16  ? 8.772   1.511   22.934  1.00 50.48  ? 222 TYR B OH  1 
ATOM   2304 N N   . LEU B 1 17  ? 13.470  -3.720  24.516  1.00 49.47  ? 223 LEU B N   1 
ATOM   2305 C CA  . LEU B 1 17  ? 14.513  -3.316  23.575  1.00 47.18  ? 223 LEU B CA  1 
ATOM   2306 C C   . LEU B 1 17  ? 14.912  -4.431  22.616  1.00 49.37  ? 223 LEU B C   1 
ATOM   2307 O O   . LEU B 1 17  ? 15.355  -4.148  21.506  1.00 50.76  ? 223 LEU B O   1 
ATOM   2308 C CB  . LEU B 1 17  ? 15.775  -2.850  24.301  1.00 45.18  ? 223 LEU B CB  1 
ATOM   2309 C CG  . LEU B 1 17  ? 15.806  -1.473  24.958  1.00 45.18  ? 223 LEU B CG  1 
ATOM   2310 C CD1 . LEU B 1 17  ? 17.127  -1.287  25.708  1.00 33.57  ? 223 LEU B CD1 1 
ATOM   2311 C CD2 . LEU B 1 17  ? 15.606  -0.403  23.890  1.00 42.81  ? 223 LEU B CD2 1 
ATOM   2312 N N   . LYS B 1 18  ? 14.774  -5.690  23.024  1.00 48.45  ? 224 LYS B N   1 
ATOM   2313 C CA  . LYS B 1 18  ? 15.162  -6.773  22.126  1.00 51.46  ? 224 LYS B CA  1 
ATOM   2314 C C   . LYS B 1 18  ? 14.004  -7.452  21.405  1.00 51.96  ? 224 LYS B C   1 
ATOM   2315 O O   . LYS B 1 18  ? 14.188  -8.485  20.760  1.00 54.08  ? 224 LYS B O   1 
ATOM   2316 C CB  . LYS B 1 18  ? 15.978  -7.832  22.873  1.00 53.02  ? 224 LYS B CB  1 
ATOM   2317 C CG  . LYS B 1 18  ? 15.163  -8.864  23.630  1.00 56.81  ? 224 LYS B CG  1 
ATOM   2318 C CD  . LYS B 1 18  ? 16.071  -9.884  24.316  1.00 61.68  ? 224 LYS B CD  1 
ATOM   2319 C CE  . LYS B 1 18  ? 16.993  -9.223  25.351  1.00 64.67  ? 224 LYS B CE  1 
ATOM   2320 N NZ  . LYS B 1 18  ? 17.786  -10.215 26.138  1.00 66.11  ? 224 LYS B NZ  1 
ATOM   2321 N N   . ASN B 1 19  ? 12.814  -6.875  21.495  1.00 49.59  ? 225 ASN B N   1 
ATOM   2322 C CA  . ASN B 1 19  ? 11.662  -7.469  20.840  1.00 47.75  ? 225 ASN B CA  1 
ATOM   2323 C C   . ASN B 1 19  ? 10.992  -6.535  19.862  1.00 47.34  ? 225 ASN B C   1 
ATOM   2324 O O   . ASN B 1 19  ? 10.159  -6.965  19.077  1.00 49.75  ? 225 ASN B O   1 
ATOM   2325 C CB  . ASN B 1 19  ? 10.651  -7.943  21.881  1.00 46.13  ? 225 ASN B CB  1 
ATOM   2326 C CG  . ASN B 1 19  ? 11.021  -9.286  22.472  1.00 47.50  ? 225 ASN B CG  1 
ATOM   2327 O OD1 . ASN B 1 19  ? 11.122  -10.274 21.747  1.00 49.13  ? 225 ASN B OD1 1 
ATOM   2328 N ND2 . ASN B 1 19  ? 11.233  -9.332  23.786  1.00 45.26  ? 225 ASN B ND2 1 
ATOM   2329 N N   . PHE B 1 20  ? 11.360  -5.261  19.920  1.00 47.85  ? 226 PHE B N   1 
ATOM   2330 C CA  . PHE B 1 20  ? 10.810  -4.235  19.045  1.00 48.33  ? 226 PHE B CA  1 
ATOM   2331 C C   . PHE B 1 20  ? 11.958  -3.566  18.305  1.00 51.05  ? 226 PHE B C   1 
ATOM   2332 O O   . PHE B 1 20  ? 12.781  -2.884  18.910  1.00 53.35  ? 226 PHE B O   1 
ATOM   2333 C CB  . PHE B 1 20  ? 10.033  -3.203  19.865  1.00 45.39  ? 226 PHE B CB  1 
ATOM   2334 C CG  . PHE B 1 20  ? 8.771   -3.743  20.470  1.00 46.25  ? 226 PHE B CG  1 
ATOM   2335 C CD1 . PHE B 1 20  ? 7.781   -4.297  19.659  1.00 42.57  ? 226 PHE B CD1 1 
ATOM   2336 C CD2 . PHE B 1 20  ? 8.579   -3.723  21.857  1.00 49.56  ? 226 PHE B CD2 1 
ATOM   2337 C CE1 . PHE B 1 20  ? 6.611   -4.827  20.208  1.00 43.53  ? 226 PHE B CE1 1 
ATOM   2338 C CE2 . PHE B 1 20  ? 7.411   -4.250  22.431  1.00 49.54  ? 226 PHE B CE2 1 
ATOM   2339 C CZ  . PHE B 1 20  ? 6.421   -4.807  21.597  1.00 49.24  ? 226 PHE B CZ  1 
ATOM   2340 N N   . ASN B 1 21  ? 12.000  -3.759  16.992  1.00 56.69  ? 227 ASN B N   1 
ATOM   2341 C CA  . ASN B 1 21  ? 13.072  -3.210  16.157  1.00 60.67  ? 227 ASN B CA  1 
ATOM   2342 C C   . ASN B 1 21  ? 13.136  -1.681  16.110  1.00 59.81  ? 227 ASN B C   1 
ATOM   2343 O O   . ASN B 1 21  ? 14.222  -1.107  16.175  1.00 61.83  ? 227 ASN B O   1 
ATOM   2344 C CB  . ASN B 1 21  ? 12.965  -3.780  14.731  1.00 63.28  ? 227 ASN B CB  1 
ATOM   2345 C CG  . ASN B 1 21  ? 14.322  -3.897  14.038  1.00 67.15  ? 227 ASN B CG  1 
ATOM   2346 O OD1 . ASN B 1 21  ? 14.426  -4.455  12.944  1.00 67.46  ? 227 ASN B OD1 1 
ATOM   2347 N ND2 . ASN B 1 21  ? 15.364  -3.373  14.676  1.00 66.20  ? 227 ASN B ND2 1 
ATOM   2348 N N   . MET B 1 22  ? 11.988  -1.022  15.996  1.00 58.28  ? 228 MET B N   1 
ATOM   2349 C CA  . MET B 1 22  ? 11.963  0.437   15.941  1.00 59.61  ? 228 MET B CA  1 
ATOM   2350 C C   . MET B 1 22  ? 11.490  1.028   17.277  1.00 61.17  ? 228 MET B C   1 
ATOM   2351 O O   . MET B 1 22  ? 10.336  0.855   17.679  1.00 59.64  ? 228 MET B O   1 
ATOM   2352 C CB  . MET B 1 22  ? 11.059  0.898   14.787  1.00 58.05  ? 228 MET B CB  1 
ATOM   2353 C CG  . MET B 1 22  ? 10.917  2.409   14.623  1.00 57.74  ? 228 MET B CG  1 
ATOM   2354 S SD  . MET B 1 22  ? 12.449  3.298   14.235  1.00 64.06  ? 228 MET B SD  1 
ATOM   2355 C CE  . MET B 1 22  ? 12.419  3.356   12.489  1.00 58.92  ? 228 MET B CE  1 
ATOM   2356 N N   . THR B 1 23  ? 12.395  1.732   17.954  1.00 61.18  ? 229 THR B N   1 
ATOM   2357 C CA  . THR B 1 23  ? 12.106  2.338   19.250  1.00 62.52  ? 229 THR B CA  1 
ATOM   2358 C C   . THR B 1 23  ? 11.802  3.810   19.091  1.00 61.79  ? 229 THR B C   1 
ATOM   2359 O O   . THR B 1 23  ? 12.355  4.459   18.216  1.00 63.04  ? 229 THR B O   1 
ATOM   2360 C CB  . THR B 1 23  ? 13.299  2.189   20.195  1.00 63.49  ? 229 THR B CB  1 
ATOM   2361 O OG1 . THR B 1 23  ? 14.382  3.002   19.729  1.00 61.74  ? 229 THR B OG1 1 
ATOM   2362 C CG2 . THR B 1 23  ? 13.749  0.726   20.248  1.00 61.86  ? 229 THR B CG2 1 
ATOM   2363 N N   . LYS B 1 24  ? 10.937  4.338   19.950  1.00 61.46  ? 230 LYS B N   1 
ATOM   2364 C CA  . LYS B 1 24  ? 10.551  5.741   19.866  1.00 60.74  ? 230 LYS B CA  1 
ATOM   2365 C C   . LYS B 1 24  ? 11.699  6.683   19.583  1.00 62.50  ? 230 LYS B C   1 
ATOM   2366 O O   . LYS B 1 24  ? 11.596  7.542   18.719  1.00 65.32  ? 230 LYS B O   1 
ATOM   2367 C CB  . LYS B 1 24  ? 9.852   6.214   21.143  1.00 57.71  ? 230 LYS B CB  1 
ATOM   2368 C CG  . LYS B 1 24  ? 9.354   7.653   21.013  1.00 54.39  ? 230 LYS B CG  1 
ATOM   2369 C CD  . LYS B 1 24  ? 8.509   8.097   22.180  1.00 50.67  ? 230 LYS B CD  1 
ATOM   2370 C CE  . LYS B 1 24  ? 7.748   9.369   21.844  1.00 50.23  ? 230 LYS B CE  1 
ATOM   2371 N NZ  . LYS B 1 24  ? 6.933   9.876   22.996  1.00 51.06  ? 230 LYS B NZ  1 
ATOM   2372 N N   . LYS B 1 25  ? 12.797  6.538   20.307  1.00 64.64  ? 231 LYS B N   1 
ATOM   2373 C CA  . LYS B 1 25  ? 13.919  7.435   20.095  1.00 67.54  ? 231 LYS B CA  1 
ATOM   2374 C C   . LYS B 1 25  ? 14.663  7.153   18.797  1.00 69.60  ? 231 LYS B C   1 
ATOM   2375 O O   . LYS B 1 25  ? 15.120  8.074   18.126  1.00 70.77  ? 231 LYS B O   1 
ATOM   2376 C CB  . LYS B 1 25  ? 14.851  7.393   21.311  1.00 66.16  ? 231 LYS B CB  1 
ATOM   2377 C CG  . LYS B 1 25  ? 14.152  7.931   22.570  1.00 64.45  ? 231 LYS B CG  1 
ATOM   2378 C CD  . LYS B 1 25  ? 13.480  9.280   22.262  1.00 58.71  ? 231 LYS B CD  1 
ATOM   2379 C CE  . LYS B 1 25  ? 12.423  9.643   23.274  1.00 51.80  ? 231 LYS B CE  1 
ATOM   2380 N NZ  . LYS B 1 25  ? 11.656  10.838  22.843  1.00 49.27  ? 231 LYS B NZ  1 
ATOM   2381 N N   . LYS B 1 26  ? 14.767  5.880   18.438  1.00 71.52  ? 232 LYS B N   1 
ATOM   2382 C CA  . LYS B 1 26  ? 15.428  5.485   17.203  1.00 72.21  ? 232 LYS B CA  1 
ATOM   2383 C C   . LYS B 1 26  ? 14.573  5.989   16.033  1.00 72.41  ? 232 LYS B C   1 
ATOM   2384 O O   . LYS B 1 26  ? 15.054  6.143   14.912  1.00 71.82  ? 232 LYS B O   1 
ATOM   2385 C CB  . LYS B 1 26  ? 15.551  3.957   17.161  1.00 73.64  ? 232 LYS B CB  1 
ATOM   2386 C CG  . LYS B 1 26  ? 16.299  3.401   15.963  1.00 75.72  ? 232 LYS B CG  1 
ATOM   2387 C CD  . LYS B 1 26  ? 16.588  1.914   16.144  1.00 73.89  ? 232 LYS B CD  1 
ATOM   2388 C CE  . LYS B 1 26  ? 17.253  1.334   14.906  1.00 75.42  ? 232 LYS B CE  1 
ATOM   2389 N NZ  . LYS B 1 26  ? 18.471  2.102   14.516  1.00 75.13  ? 232 LYS B NZ  1 
ATOM   2390 N N   . ALA B 1 27  ? 13.304  6.258   16.325  1.00 71.41  ? 233 ALA B N   1 
ATOM   2391 C CA  . ALA B 1 27  ? 12.350  6.732   15.336  1.00 69.40  ? 233 ALA B CA  1 
ATOM   2392 C C   . ALA B 1 27  ? 12.148  8.236   15.437  1.00 68.47  ? 233 ALA B C   1 
ATOM   2393 O O   . ALA B 1 27  ? 11.860  8.900   14.446  1.00 68.33  ? 233 ALA B O   1 
ATOM   2394 C CB  . ALA B 1 27  ? 11.022  6.021   15.524  1.00 70.36  ? 233 ALA B CB  1 
ATOM   2395 N N   . ARG B 1 28  ? 12.280  8.774   16.643  1.00 68.98  ? 234 ARG B N   1 
ATOM   2396 C CA  . ARG B 1 28  ? 12.113  10.210  16.845  1.00 68.61  ? 234 ARG B CA  1 
ATOM   2397 C C   . ARG B 1 28  ? 13.296  10.851  16.138  1.00 67.97  ? 234 ARG B C   1 
ATOM   2398 O O   . ARG B 1 28  ? 13.279  12.029  15.794  1.00 66.71  ? 234 ARG B O   1 
ATOM   2399 C CB  . ARG B 1 28  ? 12.147  10.548  18.337  1.00 67.40  ? 234 ARG B CB  1 
ATOM   2400 C CG  . ARG B 1 28  ? 11.311  11.752  18.729  1.00 69.78  ? 234 ARG B CG  1 
ATOM   2401 C CD  . ARG B 1 28  ? 9.833   11.394  18.873  1.00 70.74  ? 234 ARG B CD  1 
ATOM   2402 N NE  . ARG B 1 28  ? 9.233   10.899  17.634  1.00 72.76  ? 234 ARG B NE  1 
ATOM   2403 C CZ  . ARG B 1 28  ? 7.972   10.481  17.528  1.00 73.59  ? 234 ARG B CZ  1 
ATOM   2404 N NH1 . ARG B 1 28  ? 7.171   10.496  18.584  1.00 74.62  ? 234 ARG B NH1 1 
ATOM   2405 N NH2 . ARG B 1 28  ? 7.512   10.036  16.368  1.00 75.15  ? 234 ARG B NH2 1 
ATOM   2406 N N   . SER B 1 29  ? 14.318  10.033  15.923  1.00 69.38  ? 235 SER B N   1 
ATOM   2407 C CA  . SER B 1 29  ? 15.544  10.434  15.252  1.00 71.04  ? 235 SER B CA  1 
ATOM   2408 C C   . SER B 1 29  ? 15.244  10.838  13.804  1.00 72.05  ? 235 SER B C   1 
ATOM   2409 O O   . SER B 1 29  ? 15.452  11.993  13.420  1.00 73.02  ? 235 SER B O   1 
ATOM   2410 C CB  . SER B 1 29  ? 16.539  9.269   15.279  1.00 70.05  ? 235 SER B CB  1 
ATOM   2411 O OG  . SER B 1 29  ? 17.776  9.630   14.701  1.00 72.94  ? 235 SER B OG  1 
ATOM   2412 N N   . ILE B 1 30  ? 14.756  9.885   13.009  1.00 71.19  ? 236 ILE B N   1 
ATOM   2413 C CA  . ILE B 1 30  ? 14.426  10.142  11.612  1.00 69.64  ? 236 ILE B CA  1 
ATOM   2414 C C   . ILE B 1 30  ? 13.509  11.358  11.461  1.00 71.58  ? 236 ILE B C   1 
ATOM   2415 O O   . ILE B 1 30  ? 13.875  12.348  10.829  1.00 71.68  ? 236 ILE B O   1 
ATOM   2416 C CB  . ILE B 1 30  ? 13.731  8.923   10.953  1.00 67.49  ? 236 ILE B CB  1 
ATOM   2417 C CG1 . ILE B 1 30  ? 14.711  7.762   10.787  1.00 64.26  ? 236 ILE B CG1 1 
ATOM   2418 C CG2 . ILE B 1 30  ? 13.217  9.306   9.576   1.00 66.95  ? 236 ILE B CG2 1 
ATOM   2419 C CD1 . ILE B 1 30  ? 15.202  7.180   12.062  1.00 64.26  ? 236 ILE B CD1 1 
ATOM   2420 N N   . LEU B 1 31  ? 12.317  11.280  12.040  1.00 73.71  ? 237 LEU B N   1 
ATOM   2421 C CA  . LEU B 1 31  ? 11.350  12.369  11.965  1.00 77.61  ? 237 LEU B CA  1 
ATOM   2422 C C   . LEU B 1 31  ? 11.910  13.733  12.381  1.00 81.27  ? 237 LEU B C   1 
ATOM   2423 O O   . LEU B 1 31  ? 11.321  14.765  12.060  1.00 81.77  ? 237 LEU B O   1 
ATOM   2424 C CB  . LEU B 1 31  ? 10.131  12.043  12.834  1.00 77.71  ? 237 LEU B CB  1 
ATOM   2425 C CG  . LEU B 1 31  ? 9.182   10.922  12.397  1.00 77.70  ? 237 LEU B CG  1 
ATOM   2426 C CD1 . LEU B 1 31  ? 8.446   11.342  11.144  1.00 78.25  ? 237 LEU B CD1 1 
ATOM   2427 C CD2 . LEU B 1 31  ? 9.951   9.645   12.167  1.00 76.73  ? 237 LEU B CD2 1 
ATOM   2428 N N   . THR B 1 32  ? 13.035  13.737  13.095  1.00 84.85  ? 238 THR B N   1 
ATOM   2429 C CA  . THR B 1 32  ? 13.652  14.982  13.558  1.00 88.90  ? 238 THR B CA  1 
ATOM   2430 C C   . THR B 1 32  ? 13.680  16.061  12.474  1.00 91.19  ? 238 THR B C   1 
ATOM   2431 O O   . THR B 1 32  ? 12.714  16.813  12.320  1.00 91.16  ? 238 THR B O   1 
ATOM   2432 C CB  . THR B 1 32  ? 15.095  14.735  14.074  1.00 90.13  ? 238 THR B CB  1 
ATOM   2433 O OG1 . THR B 1 32  ? 15.051  13.884  15.226  1.00 89.92  ? 238 THR B OG1 1 
ATOM   2434 C CG2 . THR B 1 32  ? 15.765  16.047  14.462  1.00 92.64  ? 238 THR B CG2 1 
ATOM   2435 N N   . GLY B 1 33  ? 14.779  16.147  11.729  1.00 93.44  ? 239 GLY B N   1 
ATOM   2436 C CA  . GLY B 1 33  ? 14.865  17.148  10.681  1.00 96.82  ? 239 GLY B CA  1 
ATOM   2437 C C   . GLY B 1 33  ? 16.242  17.754  10.477  1.00 99.09  ? 239 GLY B C   1 
ATOM   2438 O O   . GLY B 1 33  ? 16.494  18.395  9.454   1.00 99.71  ? 239 GLY B O   1 
ATOM   2439 N N   . LYS B 1 34  ? 17.129  17.557  11.448  1.00 100.92 ? 240 LYS B N   1 
ATOM   2440 C CA  . LYS B 1 34  ? 18.491  18.081  11.371  1.00 101.78 ? 240 LYS B CA  1 
ATOM   2441 C C   . LYS B 1 34  ? 19.475  16.952  11.076  1.00 102.71 ? 240 LYS B C   1 
ATOM   2442 O O   . LYS B 1 34  ? 20.491  17.161  10.415  1.00 102.59 ? 240 LYS B O   1 
ATOM   2443 C CB  . LYS B 1 34  ? 18.874  18.760  12.689  1.00 101.91 ? 240 LYS B CB  1 
ATOM   2444 C CG  . LYS B 1 34  ? 17.966  19.920  13.086  1.00 102.79 ? 240 LYS B CG  1 
ATOM   2445 C CD  . LYS B 1 34  ? 18.429  20.584  14.378  1.00 103.02 ? 240 LYS B CD  1 
ATOM   2446 C CE  . LYS B 1 34  ? 18.417  19.612  15.548  1.00 102.80 ? 240 LYS B CE  1 
ATOM   2447 N NZ  . LYS B 1 34  ? 18.838  20.275  16.815  1.00 102.63 ? 240 LYS B NZ  1 
ATOM   2448 N N   . ALA B 1 35  ? 19.159  15.757  11.571  1.00 104.30 ? 241 ALA B N   1 
ATOM   2449 C CA  . ALA B 1 35  ? 19.996  14.574  11.378  1.00 104.84 ? 241 ALA B CA  1 
ATOM   2450 C C   . ALA B 1 35  ? 19.624  13.837  10.093  1.00 105.25 ? 241 ALA B C   1 
ATOM   2451 O O   . ALA B 1 35  ? 18.651  13.080  10.065  1.00 105.62 ? 241 ALA B O   1 
ATOM   2452 C CB  . ALA B 1 35  ? 19.850  13.635  12.576  1.00 104.29 ? 241 ALA B CB  1 
ATOM   2453 N N   . SER B 1 36  ? 20.403  14.053  9.035   1.00 105.23 ? 242 SER B N   1 
ATOM   2454 C CA  . SER B 1 36  ? 20.142  13.410  7.751   1.00 105.59 ? 242 SER B CA  1 
ATOM   2455 C C   . SER B 1 36  ? 20.636  11.963  7.714   1.00 106.13 ? 242 SER B C   1 
ATOM   2456 O O   . SER B 1 36  ? 20.852  11.397  6.638   1.00 105.15 ? 242 SER B O   1 
ATOM   2457 C CB  . SER B 1 36  ? 20.790  14.211  6.618   1.00 104.50 ? 242 SER B CB  1 
ATOM   2458 O OG  . SER B 1 36  ? 20.199  15.496  6.500   1.00 103.31 ? 242 SER B OG  1 
ATOM   2459 N N   . HIS B 1 37  ? 20.802  11.369  8.894   1.00 106.36 ? 243 HIS B N   1 
ATOM   2460 C CA  . HIS B 1 37  ? 21.263  9.989   9.011   1.00 106.00 ? 243 HIS B CA  1 
ATOM   2461 C C   . HIS B 1 37  ? 20.309  9.036   8.301   1.00 104.52 ? 243 HIS B C   1 
ATOM   2462 O O   . HIS B 1 37  ? 20.692  7.940   7.893   1.00 104.36 ? 243 HIS B O   1 
ATOM   2463 C CB  . HIS B 1 37  ? 21.378  9.597   10.485  1.00 107.69 ? 243 HIS B CB  1 
ATOM   2464 C CG  . HIS B 1 37  ? 22.367  10.416  11.253  1.00 110.40 ? 243 HIS B CG  1 
ATOM   2465 N ND1 . HIS B 1 37  ? 22.575  10.255  12.606  1.00 111.53 ? 243 HIS B ND1 1 
ATOM   2466 C CD2 . HIS B 1 37  ? 23.211  11.398  10.857  1.00 111.47 ? 243 HIS B CD2 1 
ATOM   2467 C CE1 . HIS B 1 37  ? 23.504  11.103  13.011  1.00 112.41 ? 243 HIS B CE1 1 
ATOM   2468 N NE2 . HIS B 1 37  ? 23.906  11.809  11.970  1.00 112.98 ? 243 HIS B NE2 1 
ATOM   2469 N N   . THR B 1 38  ? 19.059  9.459   8.160   1.00 103.24 ? 244 THR B N   1 
ATOM   2470 C CA  . THR B 1 38  ? 18.046  8.648   7.494   1.00 101.31 ? 244 THR B CA  1 
ATOM   2471 C C   . THR B 1 38  ? 16.926  9.548   6.964   1.00 99.85  ? 244 THR B C   1 
ATOM   2472 O O   . THR B 1 38  ? 16.101  10.044  7.733   1.00 100.01 ? 244 THR B O   1 
ATOM   2473 C CB  . THR B 1 38  ? 17.450  7.592   8.468   1.00 100.09 ? 244 THR B CB  1 
ATOM   2474 O OG1 . THR B 1 38  ? 18.501  6.760   8.978   1.00 98.05  ? 244 THR B OG1 1 
ATOM   2475 C CG2 . THR B 1 38  ? 16.430  6.715   7.750   1.00 99.07  ? 244 THR B CG2 1 
ATOM   2476 N N   . ALA B 1 39  ? 16.911  9.769   5.652   1.00 96.86  ? 245 ALA B N   1 
ATOM   2477 C CA  . ALA B 1 39  ? 15.889  10.604  5.039   1.00 95.08  ? 245 ALA B CA  1 
ATOM   2478 C C   . ALA B 1 39  ? 14.792  9.713   4.469   1.00 93.78  ? 245 ALA B C   1 
ATOM   2479 O O   . ALA B 1 39  ? 14.943  9.149   3.387   1.00 94.00  ? 245 ALA B O   1 
ATOM   2480 C CB  . ALA B 1 39  ? 16.500  11.452  3.943   1.00 94.82  ? 245 ALA B CB  1 
ATOM   2481 N N   . PRO B 1 40  ? 13.665  9.583   5.192   1.00 91.74  ? 246 PRO B N   1 
ATOM   2482 C CA  . PRO B 1 40  ? 12.534  8.754   4.763   1.00 89.42  ? 246 PRO B CA  1 
ATOM   2483 C C   . PRO B 1 40  ? 11.877  9.222   3.465   1.00 87.68  ? 246 PRO B C   1 
ATOM   2484 O O   . PRO B 1 40  ? 11.483  10.386  3.342   1.00 86.96  ? 246 PRO B O   1 
ATOM   2485 C CB  . PRO B 1 40  ? 11.585  8.840   5.951   1.00 88.47  ? 246 PRO B CB  1 
ATOM   2486 C CG  . PRO B 1 40  ? 11.801  10.238  6.425   1.00 89.58  ? 246 PRO B CG  1 
ATOM   2487 C CD  . PRO B 1 40  ? 13.309  10.350  6.401   1.00 91.21  ? 246 PRO B CD  1 
ATOM   2488 N N   . PHE B 1 41  ? 11.770  8.310   2.500   1.00 84.67  ? 247 PHE B N   1 
ATOM   2489 C CA  . PHE B 1 41  ? 11.146  8.618   1.219   1.00 81.54  ? 247 PHE B CA  1 
ATOM   2490 C C   . PHE B 1 41  ? 9.667   8.927   1.455   1.00 78.24  ? 247 PHE B C   1 
ATOM   2491 O O   . PHE B 1 41  ? 8.902   8.064   1.883   1.00 78.37  ? 247 PHE B O   1 
ATOM   2492 C CB  . PHE B 1 41  ? 11.296  7.431   0.268   1.00 83.79  ? 247 PHE B CB  1 
ATOM   2493 C CG  . PHE B 1 41  ? 10.667  7.646   -1.078  1.00 86.53  ? 247 PHE B CG  1 
ATOM   2494 C CD1 . PHE B 1 41  ? 11.072  8.701   -1.886  1.00 87.18  ? 247 PHE B CD1 1 
ATOM   2495 C CD2 . PHE B 1 41  ? 9.664   6.792   -1.537  1.00 87.48  ? 247 PHE B CD2 1 
ATOM   2496 C CE1 . PHE B 1 41  ? 10.487  8.905   -3.138  1.00 89.49  ? 247 PHE B CE1 1 
ATOM   2497 C CE2 . PHE B 1 41  ? 9.074   6.983   -2.780  1.00 88.60  ? 247 PHE B CE2 1 
ATOM   2498 C CZ  . PHE B 1 41  ? 9.485   8.042   -3.585  1.00 89.52  ? 247 PHE B CZ  1 
ATOM   2499 N N   . VAL B 1 42  ? 9.276   10.166  1.184   1.00 74.37  ? 248 VAL B N   1 
ATOM   2500 C CA  . VAL B 1 42  ? 7.901   10.600  1.384   1.00 72.01  ? 248 VAL B CA  1 
ATOM   2501 C C   . VAL B 1 42  ? 6.998   10.057  0.294   1.00 72.55  ? 248 VAL B C   1 
ATOM   2502 O O   . VAL B 1 42  ? 7.441   9.848   -0.834  1.00 73.40  ? 248 VAL B O   1 
ATOM   2503 C CB  . VAL B 1 42  ? 7.801   12.149  1.390   1.00 69.56  ? 248 VAL B CB  1 
ATOM   2504 C CG1 . VAL B 1 42  ? 6.369   12.587  1.622   1.00 66.09  ? 248 VAL B CG1 1 
ATOM   2505 C CG2 . VAL B 1 42  ? 8.706   12.721  2.473   1.00 69.97  ? 248 VAL B CG2 1 
ATOM   2506 N N   . ILE B 1 43  ? 5.736   9.820   0.645   1.00 73.04  ? 249 ILE B N   1 
ATOM   2507 C CA  . ILE B 1 43  ? 4.745   9.327   -0.305  1.00 72.58  ? 249 ILE B CA  1 
ATOM   2508 C C   . ILE B 1 43  ? 3.813   10.484  -0.684  1.00 72.54  ? 249 ILE B C   1 
ATOM   2509 O O   . ILE B 1 43  ? 4.192   11.347  -1.468  1.00 73.19  ? 249 ILE B O   1 
ATOM   2510 C CB  . ILE B 1 43  ? 3.933   8.151   0.291   1.00 71.73  ? 249 ILE B CB  1 
ATOM   2511 C CG1 . ILE B 1 43  ? 4.835   6.925   0.442   1.00 71.67  ? 249 ILE B CG1 1 
ATOM   2512 C CG2 . ILE B 1 43  ? 2.769   7.791   -0.614  1.00 72.19  ? 249 ILE B CG2 1 
ATOM   2513 C CD1 . ILE B 1 43  ? 5.892   7.066   1.529   1.00 75.03  ? 249 ILE B CD1 1 
ATOM   2514 N N   . HIS B 1 44  ? 2.611   10.486  -0.116  1.00 72.19  ? 250 HIS B N   1 
ATOM   2515 C CA  . HIS B 1 44  ? 1.583   11.511  -0.327  1.00 70.64  ? 250 HIS B CA  1 
ATOM   2516 C C   . HIS B 1 44  ? 0.643   11.292  -1.515  1.00 68.94  ? 250 HIS B C   1 
ATOM   2517 O O   . HIS B 1 44  ? -0.383  11.973  -1.627  1.00 68.28  ? 250 HIS B O   1 
ATOM   2518 C CB  . HIS B 1 44  ? 2.201   12.923  -0.371  1.00 69.43  ? 250 HIS B CB  1 
ATOM   2519 C CG  . HIS B 1 44  ? 2.361   13.487  -1.748  1.00 72.24  ? 250 HIS B CG  1 
ATOM   2520 N ND1 . HIS B 1 44  ? 3.423   13.173  -2.567  1.00 70.84  ? 250 HIS B ND1 1 
ATOM   2521 C CD2 . HIS B 1 44  ? 1.587   14.348  -2.449  1.00 72.56  ? 250 HIS B CD2 1 
ATOM   2522 C CE1 . HIS B 1 44  ? 3.299   13.816  -3.713  1.00 71.48  ? 250 HIS B CE1 1 
ATOM   2523 N NE2 . HIS B 1 44  ? 2.193   14.536  -3.667  1.00 74.44  ? 250 HIS B NE2 1 
ATOM   2524 N N   . ASP B 1 45  ? 0.978   10.346  -2.392  1.00 66.68  ? 251 ASP B N   1 
ATOM   2525 C CA  . ASP B 1 45  ? 0.107   10.034  -3.533  1.00 63.68  ? 251 ASP B CA  1 
ATOM   2526 C C   . ASP B 1 45  ? 0.431   8.694   -4.209  1.00 62.85  ? 251 ASP B C   1 
ATOM   2527 O O   . ASP B 1 45  ? 1.470   8.079   -3.953  1.00 62.41  ? 251 ASP B O   1 
ATOM   2528 C CB  . ASP B 1 45  ? 0.126   11.173  -4.562  1.00 61.34  ? 251 ASP B CB  1 
ATOM   2529 C CG  . ASP B 1 45  ? 1.509   11.445  -5.115  1.00 61.85  ? 251 ASP B CG  1 
ATOM   2530 O OD1 . ASP B 1 45  ? 1.657   12.425  -5.875  1.00 62.21  ? 251 ASP B OD1 1 
ATOM   2531 O OD2 . ASP B 1 45  ? 2.447   10.683  -4.798  1.00 57.60  ? 251 ASP B OD2 1 
ATOM   2532 N N   . ILE B 1 46  ? -0.477  8.252   -5.072  1.00 61.39  ? 252 ILE B N   1 
ATOM   2533 C CA  . ILE B 1 46  ? -0.343  6.984   -5.786  1.00 59.35  ? 252 ILE B CA  1 
ATOM   2534 C C   . ILE B 1 46  ? 0.980   6.740   -6.510  1.00 61.48  ? 252 ILE B C   1 
ATOM   2535 O O   . ILE B 1 46  ? 1.473   5.607   -6.533  1.00 62.21  ? 252 ILE B O   1 
ATOM   2536 C CB  . ILE B 1 46  ? -1.483  6.831   -6.811  1.00 56.24  ? 252 ILE B CB  1 
ATOM   2537 C CG1 . ILE B 1 46  ? -2.836  6.936   -6.098  1.00 54.90  ? 252 ILE B CG1 1 
ATOM   2538 C CG2 . ILE B 1 46  ? -1.340  5.523   -7.561  1.00 51.94  ? 252 ILE B CG2 1 
ATOM   2539 C CD1 . ILE B 1 46  ? -4.020  7.012   -7.047  1.00 51.70  ? 252 ILE B CD1 1 
ATOM   2540 N N   . GLU B 1 47  ? 1.550   7.787   -7.103  1.00 62.89  ? 253 GLU B N   1 
ATOM   2541 C CA  . GLU B 1 47  ? 2.800   7.662   -7.854  1.00 63.99  ? 253 GLU B CA  1 
ATOM   2542 C C   . GLU B 1 47  ? 3.997   7.256   -7.009  1.00 62.92  ? 253 GLU B C   1 
ATOM   2543 O O   . GLU B 1 47  ? 4.714   6.305   -7.334  1.00 62.20  ? 253 GLU B O   1 
ATOM   2544 C CB  . GLU B 1 47  ? 3.132   8.972   -8.572  1.00 67.29  ? 253 GLU B CB  1 
ATOM   2545 C CG  . GLU B 1 47  ? 4.431   8.898   -9.378  1.00 73.33  ? 253 GLU B CG  1 
ATOM   2546 C CD  . GLU B 1 47  ? 4.911   10.253  -9.870  1.00 76.62  ? 253 GLU B CD  1 
ATOM   2547 O OE1 . GLU B 1 47  ? 4.179   10.908  -10.648 1.00 76.86  ? 253 GLU B OE1 1 
ATOM   2548 O OE2 . GLU B 1 47  ? 6.026   10.658  -9.474  1.00 78.04  ? 253 GLU B OE2 1 
ATOM   2549 N N   . THR B 1 48  ? 4.221   8.000   -5.934  1.00 62.15  ? 254 THR B N   1 
ATOM   2550 C CA  . THR B 1 48  ? 5.334   7.725   -5.040  1.00 61.85  ? 254 THR B CA  1 
ATOM   2551 C C   . THR B 1 48  ? 5.091   6.443   -4.267  1.00 59.27  ? 254 THR B C   1 
ATOM   2552 O O   . THR B 1 48  ? 6.027   5.763   -3.866  1.00 59.93  ? 254 THR B O   1 
ATOM   2553 C CB  . THR B 1 48  ? 5.529   8.857   -4.052  1.00 64.05  ? 254 THR B CB  1 
ATOM   2554 O OG1 . THR B 1 48  ? 6.466   8.447   -3.051  1.00 70.47  ? 254 THR B OG1 1 
ATOM   2555 C CG2 . THR B 1 48  ? 4.214   9.207   -3.405  1.00 63.62  ? 254 THR B CG2 1 
ATOM   2556 N N   . LEU B 1 49  ? 3.821   6.130   -4.046  1.00 58.29  ? 255 LEU B N   1 
ATOM   2557 C CA  . LEU B 1 49  ? 3.443   4.915   -3.352  1.00 56.09  ? 255 LEU B CA  1 
ATOM   2558 C C   . LEU B 1 49  ? 3.812   3.762   -4.276  1.00 56.49  ? 255 LEU B C   1 
ATOM   2559 O O   . LEU B 1 49  ? 4.295   2.723   -3.829  1.00 55.77  ? 255 LEU B O   1 
ATOM   2560 C CB  . LEU B 1 49  ? 1.935   4.928   -3.063  1.00 56.50  ? 255 LEU B CB  1 
ATOM   2561 C CG  . LEU B 1 49  ? 1.220   3.718   -2.434  1.00 56.85  ? 255 LEU B CG  1 
ATOM   2562 C CD1 . LEU B 1 49  ? 0.878   2.713   -3.515  1.00 58.68  ? 255 LEU B CD1 1 
ATOM   2563 C CD2 . LEU B 1 49  ? 2.078   3.086   -1.353  1.00 53.53  ? 255 LEU B CD2 1 
ATOM   2564 N N   . TRP B 1 50  ? 3.604   3.960   -5.573  1.00 55.86  ? 256 TRP B N   1 
ATOM   2565 C CA  . TRP B 1 50  ? 3.927   2.926   -6.538  1.00 56.63  ? 256 TRP B CA  1 
ATOM   2566 C C   . TRP B 1 50  ? 5.437   2.681   -6.612  1.00 57.87  ? 256 TRP B C   1 
ATOM   2567 O O   . TRP B 1 50  ? 5.890   1.533   -6.626  1.00 55.33  ? 256 TRP B O   1 
ATOM   2568 C CB  . TRP B 1 50  ? 3.396   3.303   -7.923  1.00 56.01  ? 256 TRP B CB  1 
ATOM   2569 C CG  . TRP B 1 50  ? 3.829   2.337   -8.999  1.00 54.59  ? 256 TRP B CG  1 
ATOM   2570 C CD1 . TRP B 1 50  ? 3.318   1.097   -9.244  1.00 53.29  ? 256 TRP B CD1 1 
ATOM   2571 C CD2 . TRP B 1 50  ? 4.884   2.530   -9.948  1.00 53.33  ? 256 TRP B CD2 1 
ATOM   2572 N NE1 . TRP B 1 50  ? 3.988   0.506   -10.287 1.00 52.87  ? 256 TRP B NE1 1 
ATOM   2573 C CE2 . TRP B 1 50  ? 4.958   1.367   -10.739 1.00 53.35  ? 256 TRP B CE2 1 
ATOM   2574 C CE3 . TRP B 1 50  ? 5.781   3.579   -10.206 1.00 52.86  ? 256 TRP B CE3 1 
ATOM   2575 C CZ2 . TRP B 1 50  ? 5.885   1.219   -11.775 1.00 54.36  ? 256 TRP B CZ2 1 
ATOM   2576 C CZ3 . TRP B 1 50  ? 6.706   3.435   -11.237 1.00 54.01  ? 256 TRP B CZ3 1 
ATOM   2577 C CH2 . TRP B 1 50  ? 6.752   2.260   -12.008 1.00 55.20  ? 256 TRP B CH2 1 
ATOM   2578 N N   . GLN B 1 51  ? 6.225   3.749   -6.659  1.00 58.43  ? 257 GLN B N   1 
ATOM   2579 C CA  . GLN B 1 51  ? 7.665   3.565   -6.737  1.00 61.99  ? 257 GLN B CA  1 
ATOM   2580 C C   . GLN B 1 51  ? 8.218   3.060   -5.419  1.00 64.46  ? 257 GLN B C   1 
ATOM   2581 O O   . GLN B 1 51  ? 9.095   2.192   -5.405  1.00 65.32  ? 257 GLN B O   1 
ATOM   2582 C CB  . GLN B 1 51  ? 8.351   4.862   -7.139  1.00 63.36  ? 257 GLN B CB  1 
ATOM   2583 C CG  . GLN B 1 51  ? 7.968   6.042   -6.313  1.00 65.89  ? 257 GLN B CG  1 
ATOM   2584 C CD  . GLN B 1 51  ? 8.316   7.342   -7.001  1.00 68.74  ? 257 GLN B CD  1 
ATOM   2585 O OE1 . GLN B 1 51  ? 8.176   8.417   -6.419  1.00 72.53  ? 257 GLN B OE1 1 
ATOM   2586 N NE2 . GLN B 1 51  ? 8.766   7.253   -8.252  1.00 66.32  ? 257 GLN B NE2 1 
ATOM   2587 N N   . ALA B 1 52  ? 7.695   3.601   -4.320  1.00 65.33  ? 258 ALA B N   1 
ATOM   2588 C CA  . ALA B 1 52  ? 8.118   3.190   -2.987  1.00 65.21  ? 258 ALA B CA  1 
ATOM   2589 C C   . ALA B 1 52  ? 8.063   1.671   -2.919  1.00 66.19  ? 258 ALA B C   1 
ATOM   2590 O O   . ALA B 1 52  ? 8.895   1.045   -2.274  1.00 66.52  ? 258 ALA B O   1 
ATOM   2591 C CB  . ALA B 1 52  ? 7.198   3.793   -1.930  1.00 63.96  ? 258 ALA B CB  1 
ATOM   2592 N N   . GLU B 1 53  ? 7.085   1.084   -3.603  1.00 68.56  ? 259 GLU B N   1 
ATOM   2593 C CA  . GLU B 1 53  ? 6.911   -0.363  -3.628  1.00 70.01  ? 259 GLU B CA  1 
ATOM   2594 C C   . GLU B 1 53  ? 8.086   -1.002  -4.352  1.00 73.53  ? 259 GLU B C   1 
ATOM   2595 O O   . GLU B 1 53  ? 7.997   -2.128  -4.840  1.00 74.37  ? 259 GLU B O   1 
ATOM   2596 C CB  . GLU B 1 53  ? 5.615   -0.725  -4.344  1.00 67.78  ? 259 GLU B CB  1 
ATOM   2597 C CG  . GLU B 1 53  ? 4.941   -1.954  -3.791  1.00 67.92  ? 259 GLU B CG  1 
ATOM   2598 C CD  . GLU B 1 53  ? 4.308   -1.710  -2.434  1.00 67.33  ? 259 GLU B CD  1 
ATOM   2599 O OE1 . GLU B 1 53  ? 3.778   -2.669  -1.841  1.00 68.20  ? 259 GLU B OE1 1 
ATOM   2600 O OE2 . GLU B 1 53  ? 4.334   -0.558  -1.960  1.00 66.02  ? 259 GLU B OE2 1 
ATOM   2601 N N   . LYS B 1 54  ? 9.185   -0.256  -4.419  1.00 77.41  ? 260 LYS B N   1 
ATOM   2602 C CA  . LYS B 1 54  ? 10.413  -0.700  -5.065  1.00 80.34  ? 260 LYS B CA  1 
ATOM   2603 C C   . LYS B 1 54  ? 11.599  -0.074  -4.322  1.00 82.23  ? 260 LYS B C   1 
ATOM   2604 O O   . LYS B 1 54  ? 12.473  -0.783  -3.819  1.00 82.22  ? 260 LYS B O   1 
ATOM   2605 C CB  . LYS B 1 54  ? 10.417  -0.258  -6.527  1.00 79.31  ? 260 LYS B CB  1 
ATOM   2606 C CG  . LYS B 1 54  ? 9.187   -0.688  -7.304  1.00 79.37  ? 260 LYS B CG  1 
ATOM   2607 C CD  . LYS B 1 54  ? 9.233   -0.156  -8.726  1.00 79.15  ? 260 LYS B CD  1 
ATOM   2608 C CE  . LYS B 1 54  ? 8.062   -0.645  -9.555  1.00 77.71  ? 260 LYS B CE  1 
ATOM   2609 N NZ  . LYS B 1 54  ? 8.236   -0.259  -10.980 1.00 78.07  ? 260 LYS B NZ  1 
ATOM   2610 N N   . GLY B 1 55  ? 11.612  1.256   -4.249  1.00 84.30  ? 261 GLY B N   1 
ATOM   2611 C CA  . GLY B 1 55  ? 12.677  1.965   -3.558  1.00 86.65  ? 261 GLY B CA  1 
ATOM   2612 C C   . GLY B 1 55  ? 12.734  1.660   -2.069  1.00 88.84  ? 261 GLY B C   1 
ATOM   2613 O O   . GLY B 1 55  ? 13.723  1.965   -1.403  1.00 89.66  ? 261 GLY B O   1 
ATOM   2614 N N   . LEU B 1 56  ? 11.664  1.069   -1.546  1.00 90.86  ? 262 LEU B N   1 
ATOM   2615 C CA  . LEU B 1 56  ? 11.576  0.693   -0.137  1.00 91.91  ? 262 LEU B CA  1 
ATOM   2616 C C   . LEU B 1 56  ? 11.415  -0.818  -0.062  1.00 95.17  ? 262 LEU B C   1 
ATOM   2617 O O   . LEU B 1 56  ? 11.639  -1.422  0.985   1.00 96.07  ? 262 LEU B O   1 
ATOM   2618 C CB  . LEU B 1 56  ? 10.373  1.362   0.529   1.00 88.05  ? 262 LEU B CB  1 
ATOM   2619 C CG  . LEU B 1 56  ? 10.438  2.864   0.808   1.00 86.14  ? 262 LEU B CG  1 
ATOM   2620 C CD1 . LEU B 1 56  ? 10.644  3.650   -0.468  1.00 85.20  ? 262 LEU B CD1 1 
ATOM   2621 C CD2 . LEU B 1 56  ? 9.156   3.285   1.480   1.00 84.84  ? 262 LEU B CD2 1 
ATOM   2622 N N   . VAL B 1 57  ? 11.019  -1.405  -1.191  1.00 99.27  ? 263 VAL B N   1 
ATOM   2623 C CA  . VAL B 1 57  ? 10.813  -2.846  -1.340  1.00 103.13 ? 263 VAL B CA  1 
ATOM   2624 C C   . VAL B 1 57  ? 9.768   -3.431  -0.391  1.00 105.35 ? 263 VAL B C   1 
ATOM   2625 O O   . VAL B 1 57  ? 9.562   -2.929  0.715   1.00 105.08 ? 263 VAL B O   1 
ATOM   2626 C CB  . VAL B 1 57  ? 12.147  -3.621  -1.164  1.00 104.26 ? 263 VAL B CB  1 
ATOM   2627 C CG1 . VAL B 1 57  ? 11.914  -5.122  -1.325  1.00 103.82 ? 263 VAL B CG1 1 
ATOM   2628 C CG2 . VAL B 1 57  ? 13.170  -3.133  -2.186  1.00 104.17 ? 263 VAL B CG2 1 
ATOM   2629 N N   . TRP B 1 58  ? 9.110   -4.494  -0.848  1.00 108.51 ? 264 TRP B N   1 
ATOM   2630 C CA  . TRP B 1 58  ? 8.082   -5.191  -0.073  1.00 111.59 ? 264 TRP B CA  1 
ATOM   2631 C C   . TRP B 1 58  ? 7.678   -6.508  -0.745  1.00 113.16 ? 264 TRP B C   1 
ATOM   2632 O O   . TRP B 1 58  ? 7.259   -6.526  -1.906  1.00 113.88 ? 264 TRP B O   1 
ATOM   2633 C CB  . TRP B 1 58  ? 6.845   -4.303  0.109   1.00 111.88 ? 264 TRP B CB  1 
ATOM   2634 C CG  . TRP B 1 58  ? 6.871   -3.456  1.357   1.00 111.70 ? 264 TRP B CG  1 
ATOM   2635 C CD1 . TRP B 1 58  ? 7.184   -3.871  2.619   1.00 111.88 ? 264 TRP B CD1 1 
ATOM   2636 C CD2 . TRP B 1 58  ? 6.483   -2.074  1.474   1.00 111.22 ? 264 TRP B CD2 1 
ATOM   2637 N NE1 . TRP B 1 58  ? 7.008   -2.840  3.514   1.00 112.29 ? 264 TRP B NE1 1 
ATOM   2638 C CE2 . TRP B 1 58  ? 6.578   -1.732  2.840   1.00 110.81 ? 264 TRP B CE2 1 
ATOM   2639 C CE3 . TRP B 1 58  ? 6.060   -1.101  0.559   1.00 110.76 ? 264 TRP B CE3 1 
ATOM   2640 C CZ2 . TRP B 1 58  ? 6.261   -0.447  3.311   1.00 110.11 ? 264 TRP B CZ2 1 
ATOM   2641 C CZ3 . TRP B 1 58  ? 5.745   0.176   1.032   1.00 109.47 ? 264 TRP B CZ3 1 
ATOM   2642 C CH2 . TRP B 1 58  ? 5.846   0.486   2.395   1.00 108.69 ? 264 TRP B CH2 1 
ATOM   2643 N N   . LYS B 1 59  ? 7.802   -7.603  0.001   1.00 113.97 ? 265 LYS B N   1 
ATOM   2644 C CA  . LYS B 1 59  ? 7.479   -8.943  -0.486  1.00 114.16 ? 265 LYS B CA  1 
ATOM   2645 C C   . LYS B 1 59  ? 6.030   -9.181  -0.930  1.00 114.18 ? 265 LYS B C   1 
ATOM   2646 O O   . LYS B 1 59  ? 5.296   -9.939  -0.297  1.00 114.22 ? 265 LYS B O   1 
ATOM   2647 C CB  . LYS B 1 59  ? 7.867   -9.967  0.586   1.00 114.74 ? 265 LYS B CB  1 
ATOM   2648 C CG  . LYS B 1 59  ? 7.621   -9.525  2.038   1.00 115.29 ? 265 LYS B CG  1 
ATOM   2649 C CD  . LYS B 1 59  ? 6.136   -9.436  2.414   1.00 116.50 ? 265 LYS B CD  1 
ATOM   2650 C CE  . LYS B 1 59  ? 5.509   -8.095  2.040   1.00 116.37 ? 265 LYS B CE  1 
ATOM   2651 N NZ  . LYS B 1 59  ? 6.107   -6.967  2.807   1.00 116.97 ? 265 LYS B NZ  1 
ATOM   2652 N N   . GLN B 1 60  ? 5.624   -8.554  -2.028  1.00 114.39 ? 266 GLN B N   1 
ATOM   2653 C CA  . GLN B 1 60  ? 4.262   -8.720  -2.530  1.00 115.41 ? 266 GLN B CA  1 
ATOM   2654 C C   . GLN B 1 60  ? 4.156   -8.290  -3.987  1.00 115.36 ? 266 GLN B C   1 
ATOM   2655 O O   . GLN B 1 60  ? 3.077   -7.909  -4.451  1.00 115.50 ? 266 GLN B O   1 
ATOM   2656 C CB  . GLN B 1 60  ? 3.284   -7.882  -1.704  1.00 116.84 ? 266 GLN B CB  1 
ATOM   2657 C CG  . GLN B 1 60  ? 3.544   -6.379  -1.792  1.00 118.50 ? 266 GLN B CG  1 
ATOM   2658 C CD  . GLN B 1 60  ? 2.277   -5.569  -2.024  1.00 119.28 ? 266 GLN B CD  1 
ATOM   2659 O OE1 . GLN B 1 60  ? 1.617   -5.707  -3.058  1.00 119.58 ? 266 GLN B OE1 1 
ATOM   2660 N NE2 . GLN B 1 60  ? 1.932   -4.721  -1.062  1.00 119.81 ? 266 GLN B NE2 1 
ATOM   2661 N N   . LEU B 1 61  ? 5.277   -8.357  -4.701  1.00 115.08 ? 267 LEU B N   1 
ATOM   2662 C CA  . LEU B 1 61  ? 5.335   -7.956  -6.107  1.00 115.42 ? 267 LEU B CA  1 
ATOM   2663 C C   . LEU B 1 61  ? 5.264   -6.431  -6.213  1.00 115.40 ? 267 LEU B C   1 
ATOM   2664 O O   . LEU B 1 61  ? 4.764   -5.755  -5.304  1.00 115.33 ? 267 LEU B O   1 
ATOM   2665 C CB  . LEU B 1 61  ? 4.181   -8.580  -6.906  1.00 114.24 ? 267 LEU B CB  1 
ATOM   2666 C CG  . LEU B 1 61  ? 4.117   -8.200  -8.390  1.00 113.77 ? 267 LEU B CG  1 
ATOM   2667 C CD1 . LEU B 1 61  ? 5.352   -8.733  -9.100  1.00 112.71 ? 267 LEU B CD1 1 
ATOM   2668 C CD2 . LEU B 1 61  ? 2.849   -8.760  -9.022  1.00 113.49 ? 267 LEU B CD2 1 
ATOM   2669 N N   . VAL B 1 62  ? 5.773   -5.895  -7.320  1.00 114.45 ? 268 VAL B N   1 
ATOM   2670 C CA  . VAL B 1 62  ? 5.764   -4.453  -7.551  1.00 113.49 ? 268 VAL B CA  1 
ATOM   2671 C C   . VAL B 1 62  ? 4.335   -3.894  -7.502  1.00 113.00 ? 268 VAL B C   1 
ATOM   2672 O O   . VAL B 1 62  ? 3.596   -3.973  -8.489  1.00 113.60 ? 268 VAL B O   1 
ATOM   2673 C CB  . VAL B 1 62  ? 6.408   -4.113  -8.924  1.00 113.52 ? 268 VAL B CB  1 
ATOM   2674 C CG1 . VAL B 1 62  ? 7.901   -4.428  -8.891  1.00 113.05 ? 268 VAL B CG1 1 
ATOM   2675 C CG2 . VAL B 1 62  ? 5.735   -4.914  -10.033 1.00 112.95 ? 268 VAL B CG2 1 
ATOM   2676 N N   . ASN B 1 63  ? 3.956   -3.338  -6.349  1.00 111.07 ? 269 ASN B N   1 
ATOM   2677 C CA  . ASN B 1 63  ? 2.620   -2.765  -6.141  1.00 109.36 ? 269 ASN B CA  1 
ATOM   2678 C C   . ASN B 1 63  ? 1.527   -3.820  -6.337  1.00 108.82 ? 269 ASN B C   1 
ATOM   2679 O O   . ASN B 1 63  ? 1.582   -4.907  -5.753  1.00 107.62 ? 269 ASN B O   1 
ATOM   2680 C CB  . ASN B 1 63  ? 2.390   -1.583  -7.101  1.00 108.38 ? 269 ASN B CB  1 
ATOM   2681 C CG  . ASN B 1 63  ? 1.123   -0.791  -6.782  1.00 106.67 ? 269 ASN B CG  1 
ATOM   2682 O OD1 . ASN B 1 63  ? 0.809   0.187   -7.457  1.00 104.83 ? 269 ASN B OD1 1 
ATOM   2683 N ND2 . ASN B 1 63  ? 0.396   -1.213  -5.752  1.00 105.82 ? 269 ASN B ND2 1 
ATOM   2684 N N   . GLY B 1 64  ? 0.533   -3.493  -7.156  1.00 108.36 ? 270 GLY B N   1 
ATOM   2685 C CA  . GLY B 1 64  ? -0.543  -4.430  -7.410  1.00 108.79 ? 270 GLY B CA  1 
ATOM   2686 C C   . GLY B 1 64  ? -1.912  -3.944  -6.970  1.00 108.58 ? 270 GLY B C   1 
ATOM   2687 O O   . GLY B 1 64  ? -2.376  -4.261  -5.875  1.00 107.49 ? 270 GLY B O   1 
ATOM   2688 N N   . LEU B 1 65  ? -2.565  -3.173  -7.830  1.00 108.38 ? 271 LEU B N   1 
ATOM   2689 C CA  . LEU B 1 65  ? -3.892  -2.660  -7.529  1.00 107.90 ? 271 LEU B CA  1 
ATOM   2690 C C   . LEU B 1 65  ? -4.848  -3.034  -8.655  1.00 109.93 ? 271 LEU B C   1 
ATOM   2691 O O   . LEU B 1 65  ? -5.504  -2.168  -9.242  1.00 111.24 ? 271 LEU B O   1 
ATOM   2692 C CB  . LEU B 1 65  ? -3.856  -1.142  -7.367  1.00 105.17 ? 271 LEU B CB  1 
ATOM   2693 C CG  . LEU B 1 65  ? -2.760  -0.581  -6.462  1.00 104.32 ? 271 LEU B CG  1 
ATOM   2694 C CD1 . LEU B 1 65  ? -3.083  0.866   -6.111  1.00 102.05 ? 271 LEU B CD1 1 
ATOM   2695 C CD2 . LEU B 1 65  ? -2.650  -1.421  -5.211  1.00 102.82 ? 271 LEU B CD2 1 
ATOM   2696 N N   . PRO B 1 66  ? -4.955  -4.339  -8.959  1.00 110.96 ? 272 PRO B N   1 
ATOM   2697 C CA  . PRO B 1 66  ? -5.835  -4.840  -10.021 1.00 111.05 ? 272 PRO B CA  1 
ATOM   2698 C C   . PRO B 1 66  ? -7.325  -4.551  -9.793  1.00 111.05 ? 272 PRO B C   1 
ATOM   2699 O O   . PRO B 1 66  ? -7.729  -4.024  -8.754  1.00 111.29 ? 272 PRO B O   1 
ATOM   2700 C CB  . PRO B 1 66  ? -5.540  -6.338  -10.029 1.00 111.36 ? 272 PRO B CB  1 
ATOM   2701 C CG  . PRO B 1 66  ? -5.251  -6.624  -8.588  1.00 111.69 ? 272 PRO B CG  1 
ATOM   2702 C CD  . PRO B 1 66  ? -4.341  -5.465  -8.224  1.00 111.23 ? 272 PRO B CD  1 
ATOM   2703 N N   . PRO B 1 67  ? -8.163  -4.881  -10.783 1.00 110.15 ? 273 PRO B N   1 
ATOM   2704 C CA  . PRO B 1 67  ? -9.595  -4.633  -10.601 1.00 108.04 ? 273 PRO B CA  1 
ATOM   2705 C C   . PRO B 1 67  ? -10.144 -5.381  -9.378  1.00 105.50 ? 273 PRO B C   1 
ATOM   2706 O O   . PRO B 1 67  ? -11.205 -5.040  -8.858  1.00 105.02 ? 273 PRO B O   1 
ATOM   2707 C CB  . PRO B 1 67  ? -10.188 -5.126  -11.916 1.00 109.73 ? 273 PRO B CB  1 
ATOM   2708 C CG  . PRO B 1 67  ? -9.095  -4.778  -12.912 1.00 108.98 ? 273 PRO B CG  1 
ATOM   2709 C CD  . PRO B 1 67  ? -7.852  -5.229  -12.183 1.00 109.45 ? 273 PRO B CD  1 
ATOM   2710 N N   . TYR B 1 68  ? -9.408  -6.398  -8.929  1.00 103.17 ? 274 TYR B N   1 
ATOM   2711 C CA  . TYR B 1 68  ? -9.790  -7.206  -7.765  1.00 100.74 ? 274 TYR B CA  1 
ATOM   2712 C C   . TYR B 1 68  ? -9.251  -6.627  -6.445  1.00 97.66  ? 274 TYR B C   1 
ATOM   2713 O O   . TYR B 1 68  ? -9.700  -6.999  -5.353  1.00 97.86  ? 274 TYR B O   1 
ATOM   2714 C CB  . TYR B 1 68  ? -9.275  -8.642  -7.925  1.00 102.27 ? 274 TYR B CB  1 
ATOM   2715 C CG  . TYR B 1 68  ? -10.155 -9.547  -8.756  1.00 103.72 ? 274 TYR B CG  1 
ATOM   2716 C CD1 . TYR B 1 68  ? -11.474 -9.811  -8.376  1.00 104.49 ? 274 TYR B CD1 1 
ATOM   2717 C CD2 . TYR B 1 68  ? -9.663  -10.169 -9.904  1.00 104.10 ? 274 TYR B CD2 1 
ATOM   2718 C CE1 . TYR B 1 68  ? -12.282 -10.677 -9.117  1.00 105.22 ? 274 TYR B CE1 1 
ATOM   2719 C CE2 . TYR B 1 68  ? -10.463 -11.040 -10.656 1.00 104.78 ? 274 TYR B CE2 1 
ATOM   2720 C CZ  . TYR B 1 68  ? -11.772 -11.287 -10.256 1.00 105.69 ? 274 TYR B CZ  1 
ATOM   2721 O OH  . TYR B 1 68  ? -12.574 -12.135 -10.993 1.00 104.53 ? 274 TYR B OH  1 
ATOM   2722 N N   . LYS B 1 69  ? -8.279  -5.729  -6.559  1.00 91.34  ? 275 LYS B N   1 
ATOM   2723 C CA  . LYS B 1 69  ? -7.668  -5.085  -5.407  1.00 83.99  ? 275 LYS B CA  1 
ATOM   2724 C C   . LYS B 1 69  ? -7.303  -3.677  -5.852  1.00 79.25  ? 275 LYS B C   1 
ATOM   2725 O O   . LYS B 1 69  ? -6.641  -3.504  -6.855  1.00 79.40  ? 275 LYS B O   1 
ATOM   2726 C CB  . LYS B 1 69  ? -6.418  -5.851  -4.982  1.00 83.82  ? 275 LYS B CB  1 
ATOM   2727 N N   . GLU B 1 70  ? -7.736  -2.668  -5.114  1.00 74.61  ? 276 GLU B N   1 
ATOM   2728 C CA  . GLU B 1 70  ? -7.435  -1.292  -5.484  1.00 68.98  ? 276 GLU B CA  1 
ATOM   2729 C C   . GLU B 1 70  ? -6.426  -0.665  -4.540  1.00 66.87  ? 276 GLU B C   1 
ATOM   2730 O O   . GLU B 1 70  ? -5.890  -1.334  -3.657  1.00 67.26  ? 276 GLU B O   1 
ATOM   2731 C CB  . GLU B 1 70  ? -8.708  -0.462  -5.466  1.00 68.39  ? 276 GLU B CB  1 
ATOM   2732 C CG  . GLU B 1 70  ? -9.461  -0.586  -4.166  1.00 67.75  ? 276 GLU B CG  1 
ATOM   2733 C CD  . GLU B 1 70  ? -10.492 0.495   -3.999  1.00 70.00  ? 276 GLU B CD  1 
ATOM   2734 O OE1 . GLU B 1 70  ? -10.100 1.671   -3.820  1.00 70.81  ? 276 GLU B OE1 1 
ATOM   2735 O OE2 . GLU B 1 70  ? -11.693 0.164   -4.052  1.00 69.47  ? 276 GLU B OE2 1 
ATOM   2736 N N   . ILE B 1 71  ? -6.190  0.631   -4.731  1.00 62.36  ? 277 ILE B N   1 
ATOM   2737 C CA  . ILE B 1 71  ? -5.253  1.415   -3.924  1.00 59.30  ? 277 ILE B CA  1 
ATOM   2738 C C   . ILE B 1 71  ? -5.533  1.340   -2.424  1.00 55.98  ? 277 ILE B C   1 
ATOM   2739 O O   . ILE B 1 71  ? -4.771  0.737   -1.666  1.00 52.29  ? 277 ILE B O   1 
ATOM   2740 C CB  . ILE B 1 71  ? -5.285  2.911   -4.369  1.00 63.08  ? 277 ILE B CB  1 
ATOM   2741 C CG1 . ILE B 1 71  ? -4.490  3.790   -3.395  1.00 60.67  ? 277 ILE B CG1 1 
ATOM   2742 C CG2 . ILE B 1 71  ? -6.737  3.395   -4.459  1.00 64.09  ? 277 ILE B CG2 1 
ATOM   2743 C CD1 . ILE B 1 71  ? -3.001  3.494   -3.364  1.00 63.25  ? 277 ILE B CD1 1 
ATOM   2744 N N   . SER B 1 72  ? -6.631  1.966   -2.013  1.00 53.26  ? 278 SER B N   1 
ATOM   2745 C CA  . SER B 1 72  ? -7.040  1.999   -0.623  1.00 50.47  ? 278 SER B CA  1 
ATOM   2746 C C   . SER B 1 72  ? -6.993  0.626   0.047   1.00 50.86  ? 278 SER B C   1 
ATOM   2747 O O   . SER B 1 72  ? -6.554  0.510   1.202   1.00 51.70  ? 278 SER B O   1 
ATOM   2748 C CB  . SER B 1 72  ? -8.446  2.583   -0.513  1.00 50.85  ? 278 SER B CB  1 
ATOM   2749 O OG  . SER B 1 72  ? -8.543  3.837   -1.172  1.00 49.77  ? 278 SER B OG  1 
ATOM   2750 N N   . VAL B 1 73  ? -7.440  -0.414  -0.653  1.00 48.09  ? 279 VAL B N   1 
ATOM   2751 C CA  . VAL B 1 73  ? -7.401  -1.746  -0.058  1.00 46.39  ? 279 VAL B CA  1 
ATOM   2752 C C   . VAL B 1 73  ? -5.942  -2.199  0.141   1.00 44.47  ? 279 VAL B C   1 
ATOM   2753 O O   . VAL B 1 73  ? -5.615  -2.842  1.140   1.00 47.73  ? 279 VAL B O   1 
ATOM   2754 C CB  . VAL B 1 73  ? -8.211  -2.777  -0.918  1.00 45.89  ? 279 VAL B CB  1 
ATOM   2755 C CG1 . VAL B 1 73  ? -8.016  -4.213  -0.393  1.00 43.93  ? 279 VAL B CG1 1 
ATOM   2756 C CG2 . VAL B 1 73  ? -9.689  -2.431  -0.866  1.00 40.69  ? 279 VAL B CG2 1 
ATOM   2757 N N   . HIS B 1 74  ? -5.068  -1.831  -0.793  1.00 42.85  ? 280 HIS B N   1 
ATOM   2758 C CA  . HIS B 1 74  ? -3.647  -2.183  -0.729  1.00 42.42  ? 280 HIS B CA  1 
ATOM   2759 C C   . HIS B 1 74  ? -2.998  -1.554  0.503   1.00 43.55  ? 280 HIS B C   1 
ATOM   2760 O O   . HIS B 1 74  ? -2.064  -2.106  1.081   1.00 40.64  ? 280 HIS B O   1 
ATOM   2761 C CB  . HIS B 1 74  ? -2.931  -1.704  -1.993  1.00 41.56  ? 280 HIS B CB  1 
ATOM   2762 C CG  . HIS B 1 74  ? -1.466  -2.001  -2.011  1.00 43.77  ? 280 HIS B CG  1 
ATOM   2763 N ND1 . HIS B 1 74  ? -0.511  -1.049  -1.721  1.00 42.52  ? 280 HIS B ND1 1 
ATOM   2764 C CD2 . HIS B 1 74  ? -0.788  -3.151  -2.253  1.00 46.02  ? 280 HIS B CD2 1 
ATOM   2765 C CE1 . HIS B 1 74  ? 0.690   -1.600  -1.780  1.00 45.46  ? 280 HIS B CE1 1 
ATOM   2766 N NE2 . HIS B 1 74  ? 0.549   -2.875  -2.103  1.00 45.49  ? 280 HIS B NE2 1 
ATOM   2767 N N   . VAL B 1 75  ? -3.482  -0.379  0.886   1.00 43.36  ? 281 VAL B N   1 
ATOM   2768 C CA  . VAL B 1 75  ? -2.963  0.280   2.075   1.00 47.21  ? 281 VAL B CA  1 
ATOM   2769 C C   . VAL B 1 75  ? -3.452  -0.583  3.239   1.00 47.59  ? 281 VAL B C   1 
ATOM   2770 O O   . VAL B 1 75  ? -2.693  -0.937  4.143   1.00 46.19  ? 281 VAL B O   1 
ATOM   2771 C CB  . VAL B 1 75  ? -3.526  1.724   2.216   1.00 47.45  ? 281 VAL B CB  1 
ATOM   2772 C CG1 . VAL B 1 75  ? -3.165  2.301   3.592   1.00 45.68  ? 281 VAL B CG1 1 
ATOM   2773 C CG2 . VAL B 1 75  ? -2.966  2.612   1.103   1.00 44.91  ? 281 VAL B CG2 1 
ATOM   2774 N N   . PHE B 1 76  ? -4.733  -0.931  3.188   1.00 48.74  ? 282 PHE B N   1 
ATOM   2775 C CA  . PHE B 1 76  ? -5.332  -1.757  4.219   1.00 48.16  ? 282 PHE B CA  1 
ATOM   2776 C C   . PHE B 1 76  ? -4.529  -3.042  4.422   1.00 46.85  ? 282 PHE B C   1 
ATOM   2777 O O   . PHE B 1 76  ? -4.142  -3.351  5.540   1.00 44.83  ? 282 PHE B O   1 
ATOM   2778 C CB  . PHE B 1 76  ? -6.771  -2.095  3.843   1.00 48.86  ? 282 PHE B CB  1 
ATOM   2779 C CG  . PHE B 1 76  ? -7.547  -2.732  4.955   1.00 49.58  ? 282 PHE B CG  1 
ATOM   2780 C CD1 . PHE B 1 76  ? -7.731  -2.055  6.154   1.00 44.29  ? 282 PHE B CD1 1 
ATOM   2781 C CD2 . PHE B 1 76  ? -8.089  -4.018  4.808   1.00 50.89  ? 282 PHE B CD2 1 
ATOM   2782 C CE1 . PHE B 1 76  ? -8.434  -2.638  7.185   1.00 44.90  ? 282 PHE B CE1 1 
ATOM   2783 C CE2 . PHE B 1 76  ? -8.801  -4.616  5.846   1.00 47.55  ? 282 PHE B CE2 1 
ATOM   2784 C CZ  . PHE B 1 76  ? -8.972  -3.923  7.036   1.00 48.29  ? 282 PHE B CZ  1 
ATOM   2785 N N   . TYR B 1 77  ? -4.280  -3.787  3.349   1.00 45.87  ? 283 TYR B N   1 
ATOM   2786 C CA  . TYR B 1 77  ? -3.509  -5.020  3.463   1.00 47.44  ? 283 TYR B CA  1 
ATOM   2787 C C   . TYR B 1 77  ? -2.141  -4.716  4.050   1.00 48.14  ? 283 TYR B C   1 
ATOM   2788 O O   . TYR B 1 77  ? -1.595  -5.489  4.830   1.00 46.67  ? 283 TYR B O   1 
ATOM   2789 C CB  . TYR B 1 77  ? -3.298  -5.686  2.095   1.00 46.27  ? 283 TYR B CB  1 
ATOM   2790 C CG  . TYR B 1 77  ? -4.511  -6.350  1.494   1.00 47.73  ? 283 TYR B CG  1 
ATOM   2791 C CD1 . TYR B 1 77  ? -5.532  -6.836  2.296   1.00 47.59  ? 283 TYR B CD1 1 
ATOM   2792 C CD2 . TYR B 1 77  ? -4.606  -6.548  0.119   1.00 47.72  ? 283 TYR B CD2 1 
ATOM   2793 C CE1 . TYR B 1 77  ? -6.618  -7.506  1.748   1.00 48.87  ? 283 TYR B CE1 1 
ATOM   2794 C CE2 . TYR B 1 77  ? -5.687  -7.221  -0.438  1.00 46.02  ? 283 TYR B CE2 1 
ATOM   2795 C CZ  . TYR B 1 77  ? -6.687  -7.696  0.384   1.00 48.47  ? 283 TYR B CZ  1 
ATOM   2796 O OH  . TYR B 1 77  ? -7.751  -8.378  -0.154  1.00 51.95  ? 283 TYR B OH  1 
ATOM   2797 N N   . ARG B 1 78  ? -1.579  -3.588  3.631   1.00 51.56  ? 284 ARG B N   1 
ATOM   2798 C CA  . ARG B 1 78  ? -0.260  -3.151  4.084   1.00 52.97  ? 284 ARG B CA  1 
ATOM   2799 C C   . ARG B 1 78  ? -0.330  -2.984  5.592   1.00 50.83  ? 284 ARG B C   1 
ATOM   2800 O O   . ARG B 1 78  ? 0.514   -3.474  6.337   1.00 45.94  ? 284 ARG B O   1 
ATOM   2801 C CB  . ARG B 1 78  ? 0.081   -1.807  3.432   1.00 58.19  ? 284 ARG B CB  1 
ATOM   2802 C CG  . ARG B 1 78  ? 1.509   -1.329  3.626   1.00 63.90  ? 284 ARG B CG  1 
ATOM   2803 C CD  . ARG B 1 78  ? 2.405   -1.738  2.462   1.00 65.19  ? 284 ARG B CD  1 
ATOM   2804 N NE  . ARG B 1 78  ? 2.540   -3.181  2.337   1.00 67.89  ? 284 ARG B NE  1 
ATOM   2805 C CZ  . ARG B 1 78  ? 3.262   -3.772  1.393   1.00 71.79  ? 284 ARG B CZ  1 
ATOM   2806 N NH1 . ARG B 1 78  ? 3.901   -3.036  0.501   1.00 71.93  ? 284 ARG B NH1 1 
ATOM   2807 N NH2 . ARG B 1 78  ? 3.357   -5.094  1.340   1.00 75.52  ? 284 ARG B NH2 1 
ATOM   2808 N N   . CYS B 1 79  ? -1.368  -2.284  6.026   1.00 50.62  ? 285 CYS B N   1 
ATOM   2809 C CA  . CYS B 1 79  ? -1.583  -2.034  7.433   1.00 51.19  ? 285 CYS B CA  1 
ATOM   2810 C C   . CYS B 1 79  ? -1.799  -3.294  8.264   1.00 50.40  ? 285 CYS B C   1 
ATOM   2811 O O   . CYS B 1 79  ? -1.250  -3.409  9.363   1.00 47.74  ? 285 CYS B O   1 
ATOM   2812 C CB  . CYS B 1 79  ? -2.770  -1.092  7.616   1.00 51.09  ? 285 CYS B CB  1 
ATOM   2813 S SG  . CYS B 1 79  ? -2.405  0.639   7.283   1.00 58.81  ? 285 CYS B SG  1 
ATOM   2814 N N   . GLN B 1 80  ? -2.572  -4.252  7.753   1.00 48.74  ? 286 GLN B N   1 
ATOM   2815 C CA  . GLN B 1 80  ? -2.833  -5.443  8.548   1.00 48.88  ? 286 GLN B CA  1 
ATOM   2816 C C   . GLN B 1 80  ? -1.679  -6.418  8.571   1.00 47.81  ? 286 GLN B C   1 
ATOM   2817 O O   . GLN B 1 80  ? -1.594  -7.271  9.451   1.00 48.30  ? 286 GLN B O   1 
ATOM   2818 C CB  . GLN B 1 80  ? -4.135  -6.131  8.112   1.00 43.87  ? 286 GLN B CB  1 
ATOM   2819 C CG  . GLN B 1 80  ? -4.048  -7.101  6.998   1.00 45.31  ? 286 GLN B CG  1 
ATOM   2820 C CD  . GLN B 1 80  ? -5.354  -7.859  6.832   1.00 49.60  ? 286 GLN B CD  1 
ATOM   2821 O OE1 . GLN B 1 80  ? -5.558  -8.907  7.436   1.00 48.05  ? 286 GLN B OE1 1 
ATOM   2822 N NE2 . GLN B 1 80  ? -6.259  -7.309  6.030   1.00 50.77  ? 286 GLN B NE2 1 
ATOM   2823 N N   . CYS B 1 81  ? -0.775  -6.277  7.616   1.00 48.56  ? 287 CYS B N   1 
ATOM   2824 C CA  . CYS B 1 81  ? 0.393   -7.132  7.569   1.00 49.97  ? 287 CYS B CA  1 
ATOM   2825 C C   . CYS B 1 81  ? 1.310   -6.659  8.713   1.00 48.24  ? 287 CYS B C   1 
ATOM   2826 O O   . CYS B 1 81  ? 1.860   -7.466  9.460   1.00 47.89  ? 287 CYS B O   1 
ATOM   2827 C CB  . CYS B 1 81  ? 1.078   -6.991  6.208   1.00 54.17  ? 287 CYS B CB  1 
ATOM   2828 S SG  . CYS B 1 81  ? 2.399   -8.175  5.902   1.00 68.95  ? 287 CYS B SG  1 
ATOM   2829 N N   . THR B 1 82  ? 1.445   -5.344  8.862   1.00 45.54  ? 288 THR B N   1 
ATOM   2830 C CA  . THR B 1 82  ? 2.273   -4.771  9.925   1.00 44.74  ? 288 THR B CA  1 
ATOM   2831 C C   . THR B 1 82  ? 1.716   -5.187  11.284  1.00 43.68  ? 288 THR B C   1 
ATOM   2832 O O   . THR B 1 82  ? 2.447   -5.662  12.144  1.00 43.56  ? 288 THR B O   1 
ATOM   2833 C CB  . THR B 1 82  ? 2.306   -3.219  9.870   1.00 42.88  ? 288 THR B CB  1 
ATOM   2834 O OG1 . THR B 1 82  ? 3.003   -2.786  8.699   1.00 40.89  ? 288 THR B OG1 1 
ATOM   2835 C CG2 . THR B 1 82  ? 3.029   -2.668  11.083  1.00 43.74  ? 288 THR B CG2 1 
ATOM   2836 N N   . THR B 1 83  ? 0.416   -4.983  11.462  1.00 42.76  ? 289 THR B N   1 
ATOM   2837 C CA  . THR B 1 83  ? -0.281  -5.346  12.689  1.00 44.07  ? 289 THR B CA  1 
ATOM   2838 C C   . THR B 1 83  ? -0.050  -6.796  13.103  1.00 44.56  ? 289 THR B C   1 
ATOM   2839 O O   . THR B 1 83  ? 0.152   -7.077  14.288  1.00 45.92  ? 289 THR B O   1 
ATOM   2840 C CB  . THR B 1 83  ? -1.785  -5.137  12.536  1.00 43.41  ? 289 THR B CB  1 
ATOM   2841 O OG1 . THR B 1 83  ? -2.048  -3.738  12.412  1.00 50.48  ? 289 THR B OG1 1 
ATOM   2842 C CG2 . THR B 1 83  ? -2.528  -5.689  13.727  1.00 44.94  ? 289 THR B CG2 1 
ATOM   2843 N N   . VAL B 1 84  ? -0.102  -7.708  12.131  1.00 42.94  ? 290 VAL B N   1 
ATOM   2844 C CA  . VAL B 1 84  ? 0.103   -9.121  12.405  1.00 41.81  ? 290 VAL B CA  1 
ATOM   2845 C C   . VAL B 1 84  ? 1.513   -9.369  12.931  1.00 42.86  ? 290 VAL B C   1 
ATOM   2846 O O   . VAL B 1 84  ? 1.729   -10.244 13.767  1.00 43.37  ? 290 VAL B O   1 
ATOM   2847 C CB  . VAL B 1 84  ? -0.123  -9.987  11.144  1.00 37.96  ? 290 VAL B CB  1 
ATOM   2848 C CG1 . VAL B 1 84  ? 0.383   -11.395 11.394  1.00 40.62  ? 290 VAL B CG1 1 
ATOM   2849 C CG2 . VAL B 1 84  ? -1.594  -10.054 10.820  1.00 36.23  ? 290 VAL B CG2 1 
ATOM   2850 N N   . GLU B 1 85  ? 2.464   -8.588  12.429  1.00 43.99  ? 291 GLU B N   1 
ATOM   2851 C CA  . GLU B 1 85  ? 3.861   -8.692  12.825  1.00 43.73  ? 291 GLU B CA  1 
ATOM   2852 C C   . GLU B 1 85  ? 4.049   -8.095  14.220  1.00 42.42  ? 291 GLU B C   1 
ATOM   2853 O O   . GLU B 1 85  ? 4.763   -8.666  15.052  1.00 45.74  ? 291 GLU B O   1 
ATOM   2854 C CB  . GLU B 1 85  ? 4.753   -7.953  11.818  1.00 47.61  ? 291 GLU B CB  1 
ATOM   2855 C CG  . GLU B 1 85  ? 6.083   -8.642  11.504  1.00 56.59  ? 291 GLU B CG  1 
ATOM   2856 C CD  . GLU B 1 85  ? 6.891   -9.000  12.750  1.00 64.81  ? 291 GLU B CD  1 
ATOM   2857 O OE1 . GLU B 1 85  ? 7.345   -8.083  13.473  1.00 69.41  ? 291 GLU B OE1 1 
ATOM   2858 O OE2 . GLU B 1 85  ? 7.071   -10.211 13.009  1.00 68.42  ? 291 GLU B OE2 1 
ATOM   2859 N N   . THR B 1 86  ? 3.417   -6.952  14.482  1.00 35.42  ? 292 THR B N   1 
ATOM   2860 C CA  . THR B 1 86  ? 3.548   -6.340  15.792  1.00 34.97  ? 292 THR B CA  1 
ATOM   2861 C C   . THR B 1 86  ? 2.973   -7.270  16.846  1.00 35.51  ? 292 THR B C   1 
ATOM   2862 O O   . THR B 1 86  ? 3.443   -7.280  17.988  1.00 33.54  ? 292 THR B O   1 
ATOM   2863 C CB  . THR B 1 86  ? 2.824   -4.998  15.891  1.00 34.43  ? 292 THR B CB  1 
ATOM   2864 O OG1 . THR B 1 86  ? 3.247   -4.144  14.823  1.00 34.24  ? 292 THR B OG1 1 
ATOM   2865 C CG2 . THR B 1 86  ? 3.165   -4.327  17.208  1.00 30.79  ? 292 THR B CG2 1 
ATOM   2866 N N   . VAL B 1 87  ? 1.955   -8.041  16.460  1.00 35.33  ? 293 VAL B N   1 
ATOM   2867 C CA  . VAL B 1 87  ? 1.336   -8.997  17.366  1.00 35.54  ? 293 VAL B CA  1 
ATOM   2868 C C   . VAL B 1 87  ? 2.380   -10.042 17.754  1.00 37.44  ? 293 VAL B C   1 
ATOM   2869 O O   . VAL B 1 87  ? 2.445   -10.461 18.908  1.00 39.62  ? 293 VAL B O   1 
ATOM   2870 C CB  . VAL B 1 87  ? 0.108   -9.696  16.717  1.00 38.23  ? 293 VAL B CB  1 
ATOM   2871 C CG1 . VAL B 1 87  ? -0.281  -10.926 17.537  1.00 31.22  ? 293 VAL B CG1 1 
ATOM   2872 C CG2 . VAL B 1 87  ? -1.082  -8.721  16.637  1.00 33.04  ? 293 VAL B CG2 1 
ATOM   2873 N N   . ARG B 1 88  ? 3.220   -10.433 16.796  1.00 39.94  ? 294 ARG B N   1 
ATOM   2874 C CA  . ARG B 1 88  ? 4.277   -11.410 17.059  1.00 43.64  ? 294 ARG B CA  1 
ATOM   2875 C C   . ARG B 1 88  ? 5.311   -10.903 18.072  1.00 41.72  ? 294 ARG B C   1 
ATOM   2876 O O   . ARG B 1 88  ? 5.700   -11.623 18.993  1.00 40.69  ? 294 ARG B O   1 
ATOM   2877 C CB  . ARG B 1 88  ? 4.995   -11.804 15.761  1.00 45.93  ? 294 ARG B CB  1 
ATOM   2878 C CG  . ARG B 1 88  ? 4.211   -12.759 14.864  1.00 53.35  ? 294 ARG B CG  1 
ATOM   2879 C CD  . ARG B 1 88  ? 5.147   -13.595 13.997  1.00 58.00  ? 294 ARG B CD  1 
ATOM   2880 N NE  . ARG B 1 88  ? 4.491   -14.127 12.798  1.00 62.07  ? 294 ARG B NE  1 
ATOM   2881 C CZ  . ARG B 1 88  ? 4.222   -13.410 11.704  1.00 64.64  ? 294 ARG B CZ  1 
ATOM   2882 N NH1 . ARG B 1 88  ? 4.550   -12.125 11.647  1.00 67.08  ? 294 ARG B NH1 1 
ATOM   2883 N NH2 . ARG B 1 88  ? 3.630   -13.977 10.656  1.00 60.72  ? 294 ARG B NH2 1 
ATOM   2884 N N   . GLU B 1 89  ? 5.755   -9.663  17.897  1.00 41.01  ? 295 GLU B N   1 
ATOM   2885 C CA  . GLU B 1 89  ? 6.738   -9.085  18.791  1.00 39.78  ? 295 GLU B CA  1 
ATOM   2886 C C   . GLU B 1 89  ? 6.103   -8.946  20.161  1.00 39.90  ? 295 GLU B C   1 
ATOM   2887 O O   . GLU B 1 89  ? 6.738   -9.233  21.163  1.00 41.28  ? 295 GLU B O   1 
ATOM   2888 C CB  . GLU B 1 89  ? 7.199   -7.723  18.265  1.00 41.96  ? 295 GLU B CB  1 
ATOM   2889 C CG  . GLU B 1 89  ? 7.432   -7.690  16.756  1.00 51.60  ? 295 GLU B CG  1 
ATOM   2890 C CD  . GLU B 1 89  ? 8.033   -6.378  16.268  1.00 56.97  ? 295 GLU B CD  1 
ATOM   2891 O OE1 . GLU B 1 89  ? 9.263   -6.212  16.398  1.00 61.14  ? 295 GLU B OE1 1 
ATOM   2892 O OE2 . GLU B 1 89  ? 7.282   -5.511  15.760  1.00 56.61  ? 295 GLU B OE2 1 
ATOM   2893 N N   . LEU B 1 90  ? 4.842   -8.521  20.202  1.00 41.37  ? 296 LEU B N   1 
ATOM   2894 C CA  . LEU B 1 90  ? 4.132   -8.358  21.471  1.00 38.64  ? 296 LEU B CA  1 
ATOM   2895 C C   . LEU B 1 90  ? 4.002   -9.688  22.195  1.00 40.18  ? 296 LEU B C   1 
ATOM   2896 O O   . LEU B 1 90  ? 4.020   -9.736  23.428  1.00 45.12  ? 296 LEU B O   1 
ATOM   2897 C CB  . LEU B 1 90  ? 2.745   -7.741  21.244  1.00 34.31  ? 296 LEU B CB  1 
ATOM   2898 C CG  . LEU B 1 90  ? 2.804   -6.236  20.967  1.00 32.74  ? 296 LEU B CG  1 
ATOM   2899 C CD1 . LEU B 1 90  ? 1.490   -5.743  20.439  1.00 38.45  ? 296 LEU B CD1 1 
ATOM   2900 C CD2 . LEU B 1 90  ? 3.178   -5.496  22.258  1.00 37.15  ? 296 LEU B CD2 1 
ATOM   2901 N N   . THR B 1 91  ? 3.872   -10.770 21.437  1.00 38.83  ? 297 THR B N   1 
ATOM   2902 C CA  . THR B 1 91  ? 3.769   -12.092 22.040  1.00 36.09  ? 297 THR B CA  1 
ATOM   2903 C C   . THR B 1 91  ? 5.120   -12.438 22.658  1.00 38.67  ? 297 THR B C   1 
ATOM   2904 O O   . THR B 1 91  ? 5.198   -12.880 23.803  1.00 41.94  ? 297 THR B O   1 
ATOM   2905 C CB  . THR B 1 91  ? 3.410   -13.153 20.995  1.00 35.06  ? 297 THR B CB  1 
ATOM   2906 O OG1 . THR B 1 91  ? 2.100   -12.892 20.487  1.00 25.40  ? 297 THR B OG1 1 
ATOM   2907 C CG2 . THR B 1 91  ? 3.444   -14.551 21.614  1.00 34.78  ? 297 THR B CG2 1 
ATOM   2908 N N   . GLU B 1 92  ? 6.188   -12.234 21.898  1.00 37.74  ? 298 GLU B N   1 
ATOM   2909 C CA  . GLU B 1 92  ? 7.530   -12.506 22.401  1.00 38.91  ? 298 GLU B CA  1 
ATOM   2910 C C   . GLU B 1 92  ? 7.888   -11.570 23.548  1.00 38.54  ? 298 GLU B C   1 
ATOM   2911 O O   . GLU B 1 92  ? 8.564   -11.965 24.495  1.00 40.31  ? 298 GLU B O   1 
ATOM   2912 C CB  . GLU B 1 92  ? 8.552   -12.355 21.277  1.00 39.86  ? 298 GLU B CB  1 
ATOM   2913 C CG  . GLU B 1 92  ? 8.550   -13.518 20.319  1.00 43.69  ? 298 GLU B CG  1 
ATOM   2914 C CD  . GLU B 1 92  ? 8.696   -14.836 21.040  1.00 48.23  ? 298 GLU B CD  1 
ATOM   2915 O OE1 . GLU B 1 92  ? 9.726   -15.023 21.716  1.00 52.23  ? 298 GLU B OE1 1 
ATOM   2916 O OE2 . GLU B 1 92  ? 7.779   -15.681 20.940  1.00 52.37  ? 298 GLU B OE2 1 
ATOM   2917 N N   . PHE B 1 93  ? 7.437   -10.327 23.454  1.00 36.79  ? 299 PHE B N   1 
ATOM   2918 C CA  . PHE B 1 93  ? 7.704   -9.350  24.485  1.00 37.44  ? 299 PHE B CA  1 
ATOM   2919 C C   . PHE B 1 93  ? 7.092   -9.798  25.810  1.00 39.89  ? 299 PHE B C   1 
ATOM   2920 O O   . PHE B 1 93  ? 7.770   -9.828  26.835  1.00 40.20  ? 299 PHE B O   1 
ATOM   2921 C CB  . PHE B 1 93  ? 7.131   -7.993  24.079  1.00 37.11  ? 299 PHE B CB  1 
ATOM   2922 C CG  . PHE B 1 93  ? 7.053   -7.012  25.210  1.00 38.59  ? 299 PHE B CG  1 
ATOM   2923 C CD1 . PHE B 1 93  ? 5.827   -6.462  25.584  1.00 34.14  ? 299 PHE B CD1 1 
ATOM   2924 C CD2 . PHE B 1 93  ? 8.205   -6.654  25.928  1.00 37.31  ? 299 PHE B CD2 1 
ATOM   2925 C CE1 . PHE B 1 93  ? 5.744   -5.571  26.653  1.00 35.21  ? 299 PHE B CE1 1 
ATOM   2926 C CE2 . PHE B 1 93  ? 8.130   -5.764  27.000  1.00 35.40  ? 299 PHE B CE2 1 
ATOM   2927 C CZ  . PHE B 1 93  ? 6.897   -5.222  27.363  1.00 35.56  ? 299 PHE B CZ  1 
ATOM   2928 N N   . ALA B 1 94  ? 5.807   -10.138 25.785  1.00 40.98  ? 300 ALA B N   1 
ATOM   2929 C CA  . ALA B 1 94  ? 5.122   -10.579 26.989  1.00 40.08  ? 300 ALA B CA  1 
ATOM   2930 C C   . ALA B 1 94  ? 5.748   -11.850 27.555  1.00 43.21  ? 300 ALA B C   1 
ATOM   2931 O O   . ALA B 1 94  ? 5.893   -11.988 28.766  1.00 44.68  ? 300 ALA B O   1 
ATOM   2932 C CB  . ALA B 1 94  ? 3.648   -10.805 26.698  1.00 33.10  ? 300 ALA B CB  1 
ATOM   2933 N N   . LYS B 1 95  ? 6.113   -12.787 26.687  1.00 48.07  ? 301 LYS B N   1 
ATOM   2934 C CA  . LYS B 1 95  ? 6.707   -14.033 27.155  1.00 52.14  ? 301 LYS B CA  1 
ATOM   2935 C C   . LYS B 1 95  ? 7.997   -13.754 27.922  1.00 55.93  ? 301 LYS B C   1 
ATOM   2936 O O   . LYS B 1 95  ? 8.487   -14.613 28.661  1.00 56.04  ? 301 LYS B O   1 
ATOM   2937 C CB  . LYS B 1 95  ? 6.960   -14.979 25.978  1.00 51.08  ? 301 LYS B CB  1 
ATOM   2938 C CG  . LYS B 1 95  ? 5.687   -15.353 25.237  1.00 53.18  ? 301 LYS B CG  1 
ATOM   2939 C CD  . LYS B 1 95  ? 5.939   -16.323 24.093  1.00 57.82  ? 301 LYS B CD  1 
ATOM   2940 C CE  . LYS B 1 95  ? 6.370   -17.688 24.602  1.00 63.46  ? 301 LYS B CE  1 
ATOM   2941 N NZ  . LYS B 1 95  ? 5.328   -18.330 25.472  1.00 65.94  ? 301 LYS B NZ  1 
ATOM   2942 N N   . SER B 1 96  ? 8.534   -12.546 27.760  1.00 56.98  ? 302 SER B N   1 
ATOM   2943 C CA  . SER B 1 96  ? 9.758   -12.169 28.457  1.00 57.39  ? 302 SER B CA  1 
ATOM   2944 C C   . SER B 1 96  ? 9.420   -11.498 29.780  1.00 58.91  ? 302 SER B C   1 
ATOM   2945 O O   . SER B 1 96  ? 10.262  -11.421 30.669  1.00 61.89  ? 302 SER B O   1 
ATOM   2946 C CB  . SER B 1 96  ? 10.607  -11.226 27.603  1.00 57.23  ? 302 SER B CB  1 
ATOM   2947 O OG  . SER B 1 96  ? 11.048  -11.853 26.410  1.00 56.78  ? 302 SER B OG  1 
ATOM   2948 N N   . ILE B 1 97  ? 8.189   -11.007 29.908  1.00 59.83  ? 303 ILE B N   1 
ATOM   2949 C CA  . ILE B 1 97  ? 7.750   -10.366 31.152  1.00 61.40  ? 303 ILE B CA  1 
ATOM   2950 C C   . ILE B 1 97  ? 7.788   -11.384 32.291  1.00 64.21  ? 303 ILE B C   1 
ATOM   2951 O O   . ILE B 1 97  ? 7.376   -12.539 32.120  1.00 63.19  ? 303 ILE B O   1 
ATOM   2952 C CB  . ILE B 1 97  ? 6.305   -9.799  31.042  1.00 59.98  ? 303 ILE B CB  1 
ATOM   2953 C CG1 . ILE B 1 97  ? 6.325   -8.389  30.447  1.00 55.03  ? 303 ILE B CG1 1 
ATOM   2954 C CG2 . ILE B 1 97  ? 5.647   -9.759  32.420  1.00 59.94  ? 303 ILE B CG2 1 
ATOM   2955 C CD1 . ILE B 1 97  ? 6.977   -8.282  29.112  1.00 54.38  ? 303 ILE B CD1 1 
ATOM   2956 N N   . PRO B 1 98  ? 8.264   -10.956 33.478  1.00 66.70  ? 304 PRO B N   1 
ATOM   2957 C CA  . PRO B 1 98  ? 8.392   -11.779 34.690  1.00 67.99  ? 304 PRO B CA  1 
ATOM   2958 C C   . PRO B 1 98  ? 7.398   -12.928 34.861  1.00 67.69  ? 304 PRO B C   1 
ATOM   2959 O O   . PRO B 1 98  ? 7.624   -14.045 34.377  1.00 68.10  ? 304 PRO B O   1 
ATOM   2960 C CB  . PRO B 1 98  ? 8.292   -10.749 35.811  1.00 67.40  ? 304 PRO B CB  1 
ATOM   2961 C CG  . PRO B 1 98  ? 9.041   -9.596  35.229  1.00 68.49  ? 304 PRO B CG  1 
ATOM   2962 C CD  . PRO B 1 98  ? 8.519   -9.536  33.793  1.00 67.19  ? 304 PRO B CD  1 
ATOM   2963 N N   . SER B 1 99  ? 6.296   -12.651 35.541  1.00 64.34  ? 305 SER B N   1 
ATOM   2964 C CA  . SER B 1 99  ? 5.304   -13.676 35.793  1.00 63.58  ? 305 SER B CA  1 
ATOM   2965 C C   . SER B 1 99  ? 4.312   -13.938 34.673  1.00 61.67  ? 305 SER B C   1 
ATOM   2966 O O   . SER B 1 99  ? 3.286   -14.564 34.911  1.00 61.58  ? 305 SER B O   1 
ATOM   2967 C CB  . SER B 1 99  ? 4.551   -13.332 37.067  1.00 67.55  ? 305 SER B CB  1 
ATOM   2968 O OG  . SER B 1 99  ? 4.091   -11.998 37.000  1.00 71.84  ? 305 SER B OG  1 
ATOM   2969 N N   . PHE B 1 100 ? 4.607   -13.483 33.456  1.00 60.64  ? 306 PHE B N   1 
ATOM   2970 C CA  . PHE B 1 100 ? 3.687   -13.709 32.344  1.00 57.49  ? 306 PHE B CA  1 
ATOM   2971 C C   . PHE B 1 100 ? 3.658   -15.171 31.896  1.00 57.45  ? 306 PHE B C   1 
ATOM   2972 O O   . PHE B 1 100 ? 2.591   -15.782 31.830  1.00 55.49  ? 306 PHE B O   1 
ATOM   2973 C CB  . PHE B 1 100 ? 4.028   -12.805 31.152  1.00 55.08  ? 306 PHE B CB  1 
ATOM   2974 C CG  . PHE B 1 100 ? 3.039   -12.905 30.019  1.00 52.38  ? 306 PHE B CG  1 
ATOM   2975 C CD1 . PHE B 1 100 ? 3.269   -13.771 28.945  1.00 51.91  ? 306 PHE B CD1 1 
ATOM   2976 C CD2 . PHE B 1 100 ? 1.849   -12.166 30.044  1.00 52.02  ? 306 PHE B CD2 1 
ATOM   2977 C CE1 . PHE B 1 100 ? 2.323   -13.903 27.905  1.00 50.51  ? 306 PHE B CE1 1 
ATOM   2978 C CE2 . PHE B 1 100 ? 0.898   -12.289 29.017  1.00 49.05  ? 306 PHE B CE2 1 
ATOM   2979 C CZ  . PHE B 1 100 ? 1.137   -13.160 27.943  1.00 48.78  ? 306 PHE B CZ  1 
ATOM   2980 N N   . SER B 1 101 ? 4.826   -15.731 31.596  1.00 57.52  ? 307 SER B N   1 
ATOM   2981 C CA  . SER B 1 101 ? 4.915   -17.124 31.164  1.00 58.25  ? 307 SER B CA  1 
ATOM   2982 C C   . SER B 1 101 ? 4.452   -18.104 32.239  1.00 58.02  ? 307 SER B C   1 
ATOM   2983 O O   . SER B 1 101 ? 4.315   -19.296 31.976  1.00 57.08  ? 307 SER B O   1 
ATOM   2984 C CB  . SER B 1 101 ? 6.346   -17.456 30.742  1.00 60.43  ? 307 SER B CB  1 
ATOM   2985 O OG  . SER B 1 101 ? 6.707   -16.707 29.596  1.00 64.10  ? 307 SER B OG  1 
ATOM   2986 N N   . SER B 1 102 ? 4.228   -17.597 33.450  1.00 56.36  ? 308 SER B N   1 
ATOM   2987 C CA  . SER B 1 102 ? 3.750   -18.413 34.560  1.00 55.44  ? 308 SER B CA  1 
ATOM   2988 C C   . SER B 1 102 ? 2.311   -18.828 34.291  1.00 51.97  ? 308 SER B C   1 
ATOM   2989 O O   . SER B 1 102 ? 1.920   -19.968 34.536  1.00 53.44  ? 308 SER B O   1 
ATOM   2990 C CB  . SER B 1 102 ? 3.796   -17.620 35.864  1.00 59.85  ? 308 SER B CB  1 
ATOM   2991 O OG  . SER B 1 102 ? 5.129   -17.330 36.240  1.00 70.09  ? 308 SER B OG  1 
ATOM   2992 N N   . LEU B 1 103 ? 1.524   -17.881 33.797  1.00 48.47  ? 309 LEU B N   1 
ATOM   2993 C CA  . LEU B 1 103 ? 0.124   -18.132 33.479  1.00 44.37  ? 309 LEU B CA  1 
ATOM   2994 C C   . LEU B 1 103 ? -0.011  -19.310 32.516  1.00 41.54  ? 309 LEU B C   1 
ATOM   2995 O O   . LEU B 1 103 ? 0.942   -19.693 31.846  1.00 38.00  ? 309 LEU B O   1 
ATOM   2996 C CB  . LEU B 1 103 ? -0.495  -16.879 32.852  1.00 43.34  ? 309 LEU B CB  1 
ATOM   2997 C CG  . LEU B 1 103 ? -0.622  -15.673 33.785  1.00 45.39  ? 309 LEU B CG  1 
ATOM   2998 C CD1 . LEU B 1 103 ? -0.923  -14.411 32.986  1.00 42.18  ? 309 LEU B CD1 1 
ATOM   2999 C CD2 . LEU B 1 103 ? -1.722  -15.953 34.798  1.00 42.83  ? 309 LEU B CD2 1 
ATOM   3000 N N   . PHE B 1 104 ? -1.197  -19.898 32.463  1.00 40.73  ? 310 PHE B N   1 
ATOM   3001 C CA  . PHE B 1 104 ? -1.435  -21.005 31.556  1.00 42.49  ? 310 PHE B CA  1 
ATOM   3002 C C   . PHE B 1 104 ? -1.558  -20.446 30.141  1.00 42.91  ? 310 PHE B C   1 
ATOM   3003 O O   . PHE B 1 104 ? -1.973  -19.301 29.953  1.00 44.89  ? 310 PHE B O   1 
ATOM   3004 C CB  . PHE B 1 104 ? -2.701  -21.755 31.969  1.00 44.40  ? 310 PHE B CB  1 
ATOM   3005 C CG  . PHE B 1 104 ? -2.456  -22.810 33.005  1.00 44.69  ? 310 PHE B CG  1 
ATOM   3006 C CD1 . PHE B 1 104 ? -1.717  -23.946 32.688  1.00 41.81  ? 310 PHE B CD1 1 
ATOM   3007 C CD2 . PHE B 1 104 ? -2.923  -22.651 34.305  1.00 48.99  ? 310 PHE B CD2 1 
ATOM   3008 C CE1 . PHE B 1 104 ? -1.442  -24.908 33.644  1.00 45.35  ? 310 PHE B CE1 1 
ATOM   3009 C CE2 . PHE B 1 104 ? -2.653  -23.615 35.285  1.00 49.72  ? 310 PHE B CE2 1 
ATOM   3010 C CZ  . PHE B 1 104 ? -1.909  -24.745 34.950  1.00 51.30  ? 310 PHE B CZ  1 
ATOM   3011 N N   . LEU B 1 105 ? -1.189  -21.247 29.148  1.00 42.53  ? 311 LEU B N   1 
ATOM   3012 C CA  . LEU B 1 105 ? -1.245  -20.787 27.766  1.00 41.87  ? 311 LEU B CA  1 
ATOM   3013 C C   . LEU B 1 105 ? -2.531  -20.067 27.433  1.00 40.36  ? 311 LEU B C   1 
ATOM   3014 O O   . LEU B 1 105 ? -2.508  -18.977 26.860  1.00 38.53  ? 311 LEU B O   1 
ATOM   3015 C CB  . LEU B 1 105 ? -1.062  -21.946 26.790  1.00 43.78  ? 311 LEU B CB  1 
ATOM   3016 C CG  . LEU B 1 105 ? 0.385   -22.179 26.388  1.00 45.99  ? 311 LEU B CG  1 
ATOM   3017 C CD1 . LEU B 1 105 ? 0.408   -22.966 25.097  1.00 47.94  ? 311 LEU B CD1 1 
ATOM   3018 C CD2 . LEU B 1 105 ? 1.086   -20.841 26.203  1.00 46.93  ? 311 LEU B CD2 1 
ATOM   3019 N N   . ASN B 1 106 ? -3.651  -20.685 27.788  1.00 35.97  ? 312 ASN B N   1 
ATOM   3020 C CA  . ASN B 1 106 ? -4.944  -20.097 27.515  1.00 35.64  ? 312 ASN B CA  1 
ATOM   3021 C C   . ASN B 1 106 ? -5.056  -18.700 28.110  1.00 35.67  ? 312 ASN B C   1 
ATOM   3022 O O   . ASN B 1 106 ? -5.609  -17.803 27.496  1.00 37.54  ? 312 ASN B O   1 
ATOM   3023 C CB  . ASN B 1 106 ? -6.066  -20.992 28.041  1.00 34.93  ? 312 ASN B CB  1 
ATOM   3024 C CG  . ASN B 1 106 ? -5.860  -21.414 29.486  1.00 39.26  ? 312 ASN B CG  1 
ATOM   3025 O OD1 . ASN B 1 106 ? -6.824  -21.623 30.218  1.00 40.77  ? 312 ASN B OD1 1 
ATOM   3026 N ND2 . ASN B 1 106 ? -4.606  -21.559 29.895  1.00 37.35  ? 312 ASN B ND2 1 
ATOM   3027 N N   . ASP B 1 107 ? -4.539  -18.492 29.307  1.00 34.23  ? 313 ASP B N   1 
ATOM   3028 C CA  . ASP B 1 107 ? -4.646  -17.162 29.846  1.00 36.52  ? 313 ASP B CA  1 
ATOM   3029 C C   . ASP B 1 107 ? -3.721  -16.177 29.147  1.00 37.35  ? 313 ASP B C   1 
ATOM   3030 O O   . ASP B 1 107 ? -4.024  -14.990 29.086  1.00 39.49  ? 313 ASP B O   1 
ATOM   3031 C CB  . ASP B 1 107 ? -4.420  -17.161 31.346  1.00 33.19  ? 313 ASP B CB  1 
ATOM   3032 C CG  . ASP B 1 107 ? -5.704  -17.413 32.111  1.00 38.43  ? 313 ASP B CG  1 
ATOM   3033 O OD1 . ASP B 1 107 ? -6.789  -17.207 31.519  1.00 36.49  ? 313 ASP B OD1 1 
ATOM   3034 O OD2 . ASP B 1 107 ? -5.639  -17.804 33.303  1.00 45.89  ? 313 ASP B OD2 1 
ATOM   3035 N N   . GLN B 1 108 ? -2.609  -16.654 28.597  1.00 35.37  ? 314 GLN B N   1 
ATOM   3036 C CA  . GLN B 1 108 ? -1.713  -15.747 27.895  1.00 36.21  ? 314 GLN B CA  1 
ATOM   3037 C C   . GLN B 1 108 ? -2.402  -15.315 26.599  1.00 36.24  ? 314 GLN B C   1 
ATOM   3038 O O   . GLN B 1 108 ? -2.333  -14.157 26.186  1.00 35.47  ? 314 GLN B O   1 
ATOM   3039 C CB  . GLN B 1 108 ? -0.380  -16.436 27.587  1.00 32.07  ? 314 GLN B CB  1 
ATOM   3040 C CG  . GLN B 1 108 ? 0.321   -16.913 28.804  1.00 29.53  ? 314 GLN B CG  1 
ATOM   3041 C CD  . GLN B 1 108 ? 1.675   -17.541 28.516  1.00 37.75  ? 314 GLN B CD  1 
ATOM   3042 O OE1 . GLN B 1 108 ? 2.228   -18.225 29.380  1.00 40.04  ? 314 GLN B OE1 1 
ATOM   3043 N NE2 . GLN B 1 108 ? 2.228   -17.303 27.316  1.00 33.89  ? 314 GLN B NE2 1 
ATOM   3044 N N   . VAL B 1 109 ? -3.083  -16.267 25.975  1.00 37.36  ? 315 VAL B N   1 
ATOM   3045 C CA  . VAL B 1 109 ? -3.792  -16.024 24.732  1.00 35.77  ? 315 VAL B CA  1 
ATOM   3046 C C   . VAL B 1 109 ? -4.909  -15.022 24.955  1.00 34.10  ? 315 VAL B C   1 
ATOM   3047 O O   . VAL B 1 109 ? -5.167  -14.175 24.112  1.00 36.93  ? 315 VAL B O   1 
ATOM   3048 C CB  . VAL B 1 109 ? -4.366  -17.337 24.173  1.00 34.85  ? 315 VAL B CB  1 
ATOM   3049 C CG1 . VAL B 1 109 ? -5.243  -17.059 22.957  1.00 33.79  ? 315 VAL B CG1 1 
ATOM   3050 C CG2 . VAL B 1 109 ? -3.219  -18.265 23.787  1.00 34.71  ? 315 VAL B CG2 1 
ATOM   3051 N N   . THR B 1 110 ? -5.551  -15.095 26.107  1.00 33.84  ? 316 THR B N   1 
ATOM   3052 C CA  . THR B 1 110 ? -6.638  -14.174 26.392  1.00 34.83  ? 316 THR B CA  1 
ATOM   3053 C C   . THR B 1 110 ? -6.142  -12.741 26.599  1.00 36.54  ? 316 THR B C   1 
ATOM   3054 O O   . THR B 1 110 ? -6.792  -11.780 26.177  1.00 34.34  ? 316 THR B O   1 
ATOM   3055 C CB  . THR B 1 110 ? -7.435  -14.672 27.597  1.00 32.84  ? 316 THR B CB  1 
ATOM   3056 O OG1 . THR B 1 110 ? -8.053  -15.916 27.238  1.00 34.25  ? 316 THR B OG1 1 
ATOM   3057 C CG2 . THR B 1 110 ? -8.523  -13.658 28.016  1.00 31.81  ? 316 THR B CG2 1 
ATOM   3058 N N   . LEU B 1 111 ? -4.977  -12.599 27.224  1.00 37.42  ? 317 LEU B N   1 
ATOM   3059 C CA  . LEU B 1 111 ? -4.404  -11.279 27.460  1.00 35.79  ? 317 LEU B CA  1 
ATOM   3060 C C   . LEU B 1 111 ? -3.937  -10.641 26.148  1.00 35.67  ? 317 LEU B C   1 
ATOM   3061 O O   . LEU B 1 111 ? -4.210  -9.477  25.892  1.00 36.61  ? 317 LEU B O   1 
ATOM   3062 C CB  . LEU B 1 111 ? -3.245  -11.383 28.458  1.00 31.77  ? 317 LEU B CB  1 
ATOM   3063 C CG  . LEU B 1 111 ? -3.724  -11.666 29.885  1.00 28.94  ? 317 LEU B CG  1 
ATOM   3064 C CD1 . LEU B 1 111 ? -2.549  -11.736 30.798  1.00 27.67  ? 317 LEU B CD1 1 
ATOM   3065 C CD2 . LEU B 1 111 ? -4.702  -10.580 30.339  1.00 27.45  ? 317 LEU B CD2 1 
ATOM   3066 N N   . LEU B 1 112 ? -3.240  -11.411 25.321  1.00 33.39  ? 318 LEU B N   1 
ATOM   3067 C CA  . LEU B 1 112 ? -2.774  -10.904 24.049  1.00 35.42  ? 318 LEU B CA  1 
ATOM   3068 C C   . LEU B 1 112 ? -3.988  -10.553 23.186  1.00 37.70  ? 318 LEU B C   1 
ATOM   3069 O O   . LEU B 1 112 ? -4.105  -9.431  22.674  1.00 41.15  ? 318 LEU B O   1 
ATOM   3070 C CB  . LEU B 1 112 ? -1.877  -11.943 23.367  1.00 29.69  ? 318 LEU B CB  1 
ATOM   3071 C CG  . LEU B 1 112 ? -0.514  -12.055 24.059  1.00 28.42  ? 318 LEU B CG  1 
ATOM   3072 C CD1 . LEU B 1 112 ? 0.270   -13.225 23.513  1.00 24.00  ? 318 LEU B CD1 1 
ATOM   3073 C CD2 . LEU B 1 112 ? 0.264   -10.762 23.873  1.00 23.42  ? 318 LEU B CD2 1 
ATOM   3074 N N   . LYS B 1 113 ? -4.899  -11.505 23.038  1.00 35.63  ? 319 LYS B N   1 
ATOM   3075 C CA  . LYS B 1 113 ? -6.105  -11.274 22.258  1.00 33.40  ? 319 LYS B CA  1 
ATOM   3076 C C   . LYS B 1 113 ? -6.801  -9.939  22.574  1.00 32.56  ? 319 LYS B C   1 
ATOM   3077 O O   . LYS B 1 113 ? -7.272  -9.263  21.680  1.00 27.59  ? 319 LYS B O   1 
ATOM   3078 C CB  . LYS B 1 113 ? -7.104  -12.401 22.502  1.00 33.61  ? 319 LYS B CB  1 
ATOM   3079 C CG  . LYS B 1 113 ? -8.417  -12.204 21.770  1.00 34.36  ? 319 LYS B CG  1 
ATOM   3080 C CD  . LYS B 1 113 ? -9.475  -13.072 22.367  1.00 39.48  ? 319 LYS B CD  1 
ATOM   3081 C CE  . LYS B 1 113 ? -10.765 -13.006 21.584  1.00 40.06  ? 319 LYS B CE  1 
ATOM   3082 N NZ  . LYS B 1 113 ? -11.797 -13.839 22.261  1.00 43.56  ? 319 LYS B NZ  1 
ATOM   3083 N N   . TYR B 1 114 ? -6.875  -9.564  23.845  1.00 30.10  ? 320 TYR B N   1 
ATOM   3084 C CA  . TYR B 1 114 ? -7.555  -8.322  24.192  1.00 36.52  ? 320 TYR B CA  1 
ATOM   3085 C C   . TYR B 1 114 ? -6.673  -7.076  24.387  1.00 39.07  ? 320 TYR B C   1 
ATOM   3086 O O   . TYR B 1 114 ? -7.187  -5.946  24.417  1.00 36.21  ? 320 TYR B O   1 
ATOM   3087 C CB  . TYR B 1 114 ? -8.430  -8.551  25.430  1.00 39.73  ? 320 TYR B CB  1 
ATOM   3088 C CG  . TYR B 1 114 ? -9.671  -9.368  25.144  1.00 43.60  ? 320 TYR B CG  1 
ATOM   3089 C CD1 . TYR B 1 114 ? -10.767 -8.802  24.490  1.00 46.99  ? 320 TYR B CD1 1 
ATOM   3090 C CD2 . TYR B 1 114 ? -9.743  -10.709 25.507  1.00 42.55  ? 320 TYR B CD2 1 
ATOM   3091 C CE1 . TYR B 1 114 ? -11.903 -9.551  24.202  1.00 48.59  ? 320 TYR B CE1 1 
ATOM   3092 C CE2 . TYR B 1 114 ? -10.870 -11.465 25.225  1.00 49.65  ? 320 TYR B CE2 1 
ATOM   3093 C CZ  . TYR B 1 114 ? -11.948 -10.880 24.572  1.00 51.85  ? 320 TYR B CZ  1 
ATOM   3094 O OH  . TYR B 1 114 ? -13.074 -11.623 24.295  1.00 55.71  ? 320 TYR B OH  1 
ATOM   3095 N N   . GLY B 1 115 ? -5.356  -7.262  24.479  1.00 39.25  ? 321 GLY B N   1 
ATOM   3096 C CA  . GLY B 1 115 ? -4.486  -6.115  24.671  1.00 39.25  ? 321 GLY B CA  1 
ATOM   3097 C C   . GLY B 1 115 ? -3.544  -5.778  23.530  1.00 38.04  ? 321 GLY B C   1 
ATOM   3098 O O   . GLY B 1 115 ? -3.012  -4.674  23.473  1.00 38.73  ? 321 GLY B O   1 
ATOM   3099 N N   . VAL B 1 116 ? -3.336  -6.711  22.610  1.00 38.01  ? 322 VAL B N   1 
ATOM   3100 C CA  . VAL B 1 116 ? -2.407  -6.458  21.513  1.00 39.86  ? 322 VAL B CA  1 
ATOM   3101 C C   . VAL B 1 116 ? -2.725  -5.197  20.682  1.00 39.97  ? 322 VAL B C   1 
ATOM   3102 O O   . VAL B 1 116 ? -1.808  -4.481  20.295  1.00 42.79  ? 322 VAL B O   1 
ATOM   3103 C CB  . VAL B 1 116 ? -2.267  -7.716  20.605  1.00 39.55  ? 322 VAL B CB  1 
ATOM   3104 C CG1 . VAL B 1 116 ? -3.418  -7.811  19.614  1.00 38.93  ? 322 VAL B CG1 1 
ATOM   3105 C CG2 . VAL B 1 116 ? -0.940  -7.692  19.905  1.00 41.70  ? 322 VAL B CG2 1 
ATOM   3106 N N   . HIS B 1 117 ? -3.998  -4.908  20.413  1.00 37.47  ? 323 HIS B N   1 
ATOM   3107 C CA  . HIS B 1 117 ? -4.330  -3.700  19.659  1.00 40.08  ? 323 HIS B CA  1 
ATOM   3108 C C   . HIS B 1 117 ? -4.173  -2.432  20.508  1.00 43.71  ? 323 HIS B C   1 
ATOM   3109 O O   . HIS B 1 117 ? -3.845  -1.365  19.970  1.00 42.40  ? 323 HIS B O   1 
ATOM   3110 C CB  . HIS B 1 117 ? -5.757  -3.745  19.097  1.00 37.39  ? 323 HIS B CB  1 
ATOM   3111 C CG  . HIS B 1 117 ? -5.877  -4.492  17.807  1.00 35.82  ? 323 HIS B CG  1 
ATOM   3112 N ND1 . HIS B 1 117 ? -6.422  -5.755  17.726  1.00 34.83  ? 323 HIS B ND1 1 
ATOM   3113 C CD2 . HIS B 1 117 ? -5.462  -4.180  16.555  1.00 38.69  ? 323 HIS B CD2 1 
ATOM   3114 C CE1 . HIS B 1 117 ? -6.334  -6.190  16.481  1.00 41.17  ? 323 HIS B CE1 1 
ATOM   3115 N NE2 . HIS B 1 117 ? -5.753  -5.255  15.751  1.00 38.11  ? 323 HIS B NE2 1 
ATOM   3116 N N   . GLU B 1 118 ? -4.407  -2.531  21.821  1.00 44.12  ? 324 GLU B N   1 
ATOM   3117 C CA  . GLU B 1 118 ? -4.251  -1.355  22.680  1.00 44.03  ? 324 GLU B CA  1 
ATOM   3118 C C   . GLU B 1 118 ? -2.791  -0.997  22.757  1.00 42.96  ? 324 GLU B C   1 
ATOM   3119 O O   . GLU B 1 118 ? -2.428  0.179   22.761  1.00 44.86  ? 324 GLU B O   1 
ATOM   3120 C CB  . GLU B 1 118 ? -4.743  -1.600  24.098  1.00 43.49  ? 324 GLU B CB  1 
ATOM   3121 C CG  . GLU B 1 118 ? -6.209  -1.847  24.224  1.00 45.74  ? 324 GLU B CG  1 
ATOM   3122 C CD  . GLU B 1 118 ? -6.597  -2.026  25.660  1.00 50.43  ? 324 GLU B CD  1 
ATOM   3123 O OE1 . GLU B 1 118 ? -5.670  -2.174  26.493  1.00 48.29  ? 324 GLU B OE1 1 
ATOM   3124 O OE2 . GLU B 1 118 ? -7.816  -2.028  25.951  1.00 53.23  ? 324 GLU B OE2 1 
ATOM   3125 N N   . ALA B 1 119 ? -1.945  -2.013  22.830  1.00 42.56  ? 325 ALA B N   1 
ATOM   3126 C CA  . ALA B 1 119 ? -0.516  -1.761  22.904  1.00 42.70  ? 325 ALA B CA  1 
ATOM   3127 C C   . ALA B 1 119 ? -0.046  -1.236  21.556  1.00 42.11  ? 325 ALA B C   1 
ATOM   3128 O O   . ALA B 1 119 ? 0.749   -0.295  21.481  1.00 45.21  ? 325 ALA B O   1 
ATOM   3129 C CB  . ALA B 1 119 ? 0.240   -3.039  23.277  1.00 42.11  ? 325 ALA B CB  1 
ATOM   3130 N N   . ILE B 1 120 ? -0.558  -1.839  20.492  1.00 38.60  ? 326 ILE B N   1 
ATOM   3131 C CA  . ILE B 1 120 ? -0.176  -1.427  19.162  1.00 38.63  ? 326 ILE B CA  1 
ATOM   3132 C C   . ILE B 1 120 ? -0.486  0.046   18.938  1.00 39.43  ? 326 ILE B C   1 
ATOM   3133 O O   . ILE B 1 120 ? 0.401   0.826   18.601  1.00 41.76  ? 326 ILE B O   1 
ATOM   3134 C CB  . ILE B 1 120 ? -0.881  -2.283  18.090  1.00 36.31  ? 326 ILE B CB  1 
ATOM   3135 C CG1 . ILE B 1 120 ? -0.266  -3.680  18.078  1.00 33.42  ? 326 ILE B CG1 1 
ATOM   3136 C CG2 . ILE B 1 120 ? -0.779  -1.611  16.722  1.00 32.24  ? 326 ILE B CG2 1 
ATOM   3137 C CD1 . ILE B 1 120 ? -0.784  -4.570  16.978  1.00 32.42  ? 326 ILE B CD1 1 
ATOM   3138 N N   . PHE B 1 121 ? -1.729  0.450   19.153  1.00 36.70  ? 327 PHE B N   1 
ATOM   3139 C CA  . PHE B 1 121 ? -2.054  1.847   18.927  1.00 38.34  ? 327 PHE B CA  1 
ATOM   3140 C C   . PHE B 1 121 ? -1.276  2.815   19.819  1.00 40.56  ? 327 PHE B C   1 
ATOM   3141 O O   . PHE B 1 121 ? -1.209  4.004   19.528  1.00 42.26  ? 327 PHE B O   1 
ATOM   3142 C CB  . PHE B 1 121 ? -3.565  2.061   19.048  1.00 34.17  ? 327 PHE B CB  1 
ATOM   3143 C CG  . PHE B 1 121 ? -4.358  1.274   18.039  1.00 34.67  ? 327 PHE B CG  1 
ATOM   3144 C CD1 . PHE B 1 121 ? -3.815  0.977   16.792  1.00 30.04  ? 327 PHE B CD1 1 
ATOM   3145 C CD2 . PHE B 1 121 ? -5.635  0.821   18.334  1.00 31.76  ? 327 PHE B CD2 1 
ATOM   3146 C CE1 . PHE B 1 121 ? -4.527  0.241   15.868  1.00 31.55  ? 327 PHE B CE1 1 
ATOM   3147 C CE2 . PHE B 1 121 ? -6.352  0.082   17.406  1.00 24.10  ? 327 PHE B CE2 1 
ATOM   3148 C CZ  . PHE B 1 121 ? -5.803  -0.207  16.181  1.00 30.36  ? 327 PHE B CZ  1 
ATOM   3149 N N   . ALA B 1 122 ? -0.676  2.302   20.892  1.00 42.35  ? 328 ALA B N   1 
ATOM   3150 C CA  . ALA B 1 122 ? 0.123   3.132   21.799  1.00 42.92  ? 328 ALA B CA  1 
ATOM   3151 C C   . ALA B 1 122 ? 1.526   3.312   21.221  1.00 41.41  ? 328 ALA B C   1 
ATOM   3152 O O   . ALA B 1 122 ? 2.091   4.411   21.258  1.00 38.78  ? 328 ALA B O   1 
ATOM   3153 C CB  . ALA B 1 122 ? 0.214   2.480   23.199  1.00 42.37  ? 328 ALA B CB  1 
ATOM   3154 N N   . MET B 1 123 ? 2.083   2.226   20.690  1.00 40.11  ? 329 MET B N   1 
ATOM   3155 C CA  . MET B 1 123 ? 3.414   2.270   20.109  1.00 39.13  ? 329 MET B CA  1 
ATOM   3156 C C   . MET B 1 123 ? 3.376   3.098   18.837  1.00 39.56  ? 329 MET B C   1 
ATOM   3157 O O   . MET B 1 123 ? 4.378   3.713   18.454  1.00 35.49  ? 329 MET B O   1 
ATOM   3158 C CB  . MET B 1 123 ? 3.910   0.851   19.814  1.00 38.41  ? 329 MET B CB  1 
ATOM   3159 C CG  . MET B 1 123 ? 4.001   -0.011  21.056  1.00 41.66  ? 329 MET B CG  1 
ATOM   3160 S SD  . MET B 1 123 ? 4.736   -1.632  20.816  1.00 46.99  ? 329 MET B SD  1 
ATOM   3161 C CE  . MET B 1 123 ? 6.442   -1.225  20.942  1.00 42.98  ? 329 MET B CE  1 
ATOM   3162 N N   . LEU B 1 124 ? 2.203   3.127   18.209  1.00 41.94  ? 330 LEU B N   1 
ATOM   3163 C CA  . LEU B 1 124 ? 1.995   3.869   16.971  1.00 44.91  ? 330 LEU B CA  1 
ATOM   3164 C C   . LEU B 1 124 ? 2.414   5.336   17.058  1.00 45.44  ? 330 LEU B C   1 
ATOM   3165 O O   . LEU B 1 124 ? 2.873   5.918   16.072  1.00 45.35  ? 330 LEU B O   1 
ATOM   3166 C CB  . LEU B 1 124 ? 0.523   3.794   16.559  1.00 45.64  ? 330 LEU B CB  1 
ATOM   3167 C CG  . LEU B 1 124 ? 0.221   4.473   15.221  1.00 46.43  ? 330 LEU B CG  1 
ATOM   3168 C CD1 . LEU B 1 124 ? 1.041   3.808   14.115  1.00 49.82  ? 330 LEU B CD1 1 
ATOM   3169 C CD2 . LEU B 1 124 ? -1.261  4.384   14.921  1.00 46.50  ? 330 LEU B CD2 1 
ATOM   3170 N N   . ALA B 1 125 ? 2.235   5.930   18.233  1.00 44.01  ? 331 ALA B N   1 
ATOM   3171 C CA  . ALA B 1 125 ? 2.590   7.324   18.463  1.00 44.23  ? 331 ALA B CA  1 
ATOM   3172 C C   . ALA B 1 125 ? 4.097   7.530   18.396  1.00 44.25  ? 331 ALA B C   1 
ATOM   3173 O O   . ALA B 1 125 ? 4.570   8.615   18.070  1.00 48.11  ? 331 ALA B O   1 
ATOM   3174 C CB  . ALA B 1 125 ? 2.066   7.778   19.826  1.00 39.78  ? 331 ALA B CB  1 
ATOM   3175 N N   . SER B 1 126 ? 4.848   6.480   18.703  1.00 43.58  ? 332 SER B N   1 
ATOM   3176 C CA  . SER B 1 126 ? 6.304   6.558   18.693  1.00 43.38  ? 332 SER B CA  1 
ATOM   3177 C C   . SER B 1 126 ? 6.881   6.765   17.298  1.00 43.55  ? 332 SER B C   1 
ATOM   3178 O O   . SER B 1 126 ? 7.968   7.317   17.153  1.00 45.62  ? 332 SER B O   1 
ATOM   3179 C CB  . SER B 1 126 ? 6.899   5.293   19.300  1.00 41.51  ? 332 SER B CB  1 
ATOM   3180 O OG  . SER B 1 126 ? 6.353   5.047   20.578  1.00 39.90  ? 332 SER B OG  1 
ATOM   3181 N N   . ILE B 1 127 ? 6.160   6.315   16.275  1.00 44.14  ? 333 ILE B N   1 
ATOM   3182 C CA  . ILE B 1 127 ? 6.619   6.453   14.892  1.00 42.13  ? 333 ILE B CA  1 
ATOM   3183 C C   . ILE B 1 127 ? 5.798   7.468   14.098  1.00 42.41  ? 333 ILE B C   1 
ATOM   3184 O O   . ILE B 1 127 ? 6.062   7.712   12.919  1.00 39.09  ? 333 ILE B O   1 
ATOM   3185 C CB  . ILE B 1 127 ? 6.552   5.113   14.147  1.00 38.88  ? 333 ILE B CB  1 
ATOM   3186 C CG1 . ILE B 1 127 ? 5.122   4.567   14.181  1.00 38.43  ? 333 ILE B CG1 1 
ATOM   3187 C CG2 . ILE B 1 127 ? 7.505   4.134   14.772  1.00 41.54  ? 333 ILE B CG2 1 
ATOM   3188 C CD1 . ILE B 1 127 ? 4.861   3.460   13.172  1.00 35.34  ? 333 ILE B CD1 1 
ATOM   3189 N N   . VAL B 1 128 ? 4.813   8.064   14.757  1.00 42.86  ? 334 VAL B N   1 
ATOM   3190 C CA  . VAL B 1 128 ? 3.949   9.016   14.105  1.00 47.58  ? 334 VAL B CA  1 
ATOM   3191 C C   . VAL B 1 128 ? 4.424   10.455  14.187  1.00 54.62  ? 334 VAL B C   1 
ATOM   3192 O O   . VAL B 1 128 ? 5.390   10.780  14.876  1.00 56.63  ? 334 VAL B O   1 
ATOM   3193 C CB  . VAL B 1 128 ? 2.507   8.902   14.638  1.00 44.97  ? 334 VAL B CB  1 
ATOM   3194 C CG1 . VAL B 1 128 ? 2.047   10.214  15.270  1.00 41.94  ? 334 VAL B CG1 1 
ATOM   3195 C CG2 . VAL B 1 128 ? 1.596   8.514   13.501  1.00 40.35  ? 334 VAL B CG2 1 
ATOM   3196 N N   . ASN B 1 129 ? 3.722   11.308  13.451  1.00 59.41  ? 335 ASN B N   1 
ATOM   3197 C CA  . ASN B 1 129 ? 4.027   12.721  13.361  1.00 62.24  ? 335 ASN B CA  1 
ATOM   3198 C C   . ASN B 1 129 ? 2.727   13.488  13.105  1.00 63.00  ? 335 ASN B C   1 
ATOM   3199 O O   . ASN B 1 129 ? 1.717   12.907  12.703  1.00 63.70  ? 335 ASN B O   1 
ATOM   3200 C CB  . ASN B 1 129 ? 5.006   12.920  12.205  1.00 64.51  ? 335 ASN B CB  1 
ATOM   3201 C CG  . ASN B 1 129 ? 5.304   14.360  11.934  1.00 63.67  ? 335 ASN B CG  1 
ATOM   3202 O OD1 . ASN B 1 129 ? 4.411   15.138  11.613  1.00 61.81  ? 335 ASN B OD1 1 
ATOM   3203 N ND2 . ASN B 1 129 ? 6.571   14.729  12.056  1.00 64.74  ? 335 ASN B ND2 1 
ATOM   3204 N N   . LYS B 1 130 ? 2.748   14.792  13.345  1.00 62.26  ? 336 LYS B N   1 
ATOM   3205 C CA  . LYS B 1 130 ? 1.564   15.604  13.125  1.00 62.99  ? 336 LYS B CA  1 
ATOM   3206 C C   . LYS B 1 130 ? 1.168   15.591  11.653  1.00 63.13  ? 336 LYS B C   1 
ATOM   3207 O O   . LYS B 1 130 ? -0.001  15.772  11.314  1.00 61.99  ? 336 LYS B O   1 
ATOM   3208 C CB  . LYS B 1 130 ? 1.824   17.038  13.587  1.00 64.67  ? 336 LYS B CB  1 
ATOM   3209 N N   . ASP B 1 131 ? 2.149   15.364  10.784  1.00 64.18  ? 337 ASP B N   1 
ATOM   3210 C CA  . ASP B 1 131 ? 1.917   15.353  9.341   1.00 66.28  ? 337 ASP B CA  1 
ATOM   3211 C C   . ASP B 1 131 ? 2.197   14.020  8.629   1.00 66.40  ? 337 ASP B C   1 
ATOM   3212 O O   . ASP B 1 131 ? 2.340   13.987  7.406   1.00 68.09  ? 337 ASP B O   1 
ATOM   3213 C CB  . ASP B 1 131 ? 2.746   16.469  8.681   1.00 66.82  ? 337 ASP B CB  1 
ATOM   3214 C CG  . ASP B 1 131 ? 2.196   17.851  8.969   1.00 68.07  ? 337 ASP B CG  1 
ATOM   3215 O OD1 . ASP B 1 131 ? 1.068   18.131  8.521   1.00 68.49  ? 337 ASP B OD1 1 
ATOM   3216 O OD2 . ASP B 1 131 ? 2.877   18.655  9.641   1.00 69.15  ? 337 ASP B OD2 1 
ATOM   3217 N N   . GLY B 1 132 ? 2.276   12.924  9.375   1.00 64.87  ? 338 GLY B N   1 
ATOM   3218 C CA  . GLY B 1 132 ? 2.537   11.645  8.735   1.00 62.37  ? 338 GLY B CA  1 
ATOM   3219 C C   . GLY B 1 132 ? 2.992   10.522  9.648   1.00 58.93  ? 338 GLY B C   1 
ATOM   3220 O O   . GLY B 1 132 ? 3.173   10.708  10.843  1.00 58.89  ? 338 GLY B O   1 
ATOM   3221 N N   . LEU B 1 133 ? 3.186   9.349   9.062   1.00 57.58  ? 339 LEU B N   1 
ATOM   3222 C CA  . LEU B 1 133 ? 3.603   8.165   9.793   1.00 56.07  ? 339 LEU B CA  1 
ATOM   3223 C C   . LEU B 1 133 ? 4.869   7.595   9.185   1.00 54.88  ? 339 LEU B C   1 
ATOM   3224 O O   . LEU B 1 133 ? 5.034   7.594   7.974   1.00 57.28  ? 339 LEU B O   1 
ATOM   3225 C CB  . LEU B 1 133 ? 2.500   7.097   9.742   1.00 57.70  ? 339 LEU B CB  1 
ATOM   3226 C CG  . LEU B 1 133 ? 2.878   5.762   10.399  1.00 58.88  ? 339 LEU B CG  1 
ATOM   3227 C CD1 . LEU B 1 133 ? 3.091   5.966   11.888  1.00 59.81  ? 339 LEU B CD1 1 
ATOM   3228 C CD2 . LEU B 1 133 ? 1.795   4.741   10.177  1.00 60.03  ? 339 LEU B CD2 1 
ATOM   3229 N N   . LEU B 1 134 ? 5.757   7.100   10.032  1.00 54.96  ? 340 LEU B N   1 
ATOM   3230 C CA  . LEU B 1 134 ? 7.011   6.506   9.579   1.00 55.07  ? 340 LEU B CA  1 
ATOM   3231 C C   . LEU B 1 134 ? 6.756   5.038   9.252   1.00 54.44  ? 340 LEU B C   1 
ATOM   3232 O O   . LEU B 1 134 ? 6.226   4.312   10.082  1.00 55.47  ? 340 LEU B O   1 
ATOM   3233 C CB  . LEU B 1 134 ? 8.049   6.608   10.697  1.00 56.23  ? 340 LEU B CB  1 
ATOM   3234 C CG  . LEU B 1 134 ? 9.539   6.557   10.366  1.00 56.35  ? 340 LEU B CG  1 
ATOM   3235 C CD1 . LEU B 1 134 ? 9.911   7.789   9.549   1.00 56.97  ? 340 LEU B CD1 1 
ATOM   3236 C CD2 . LEU B 1 134 ? 10.350  6.514   11.649  1.00 53.73  ? 340 LEU B CD2 1 
ATOM   3237 N N   . VAL B 1 135 ? 7.115   4.596   8.054   1.00 53.69  ? 341 VAL B N   1 
ATOM   3238 C CA  . VAL B 1 135 ? 6.902   3.198   7.694   1.00 54.45  ? 341 VAL B CA  1 
ATOM   3239 C C   . VAL B 1 135 ? 8.131   2.528   7.108   1.00 55.41  ? 341 VAL B C   1 
ATOM   3240 O O   . VAL B 1 135 ? 9.174   3.149   6.928   1.00 53.22  ? 341 VAL B O   1 
ATOM   3241 C CB  . VAL B 1 135 ? 5.774   3.038   6.668   1.00 56.17  ? 341 VAL B CB  1 
ATOM   3242 C CG1 . VAL B 1 135 ? 4.510   3.680   7.195   1.00 58.70  ? 341 VAL B CG1 1 
ATOM   3243 C CG2 . VAL B 1 135 ? 6.188   3.649   5.326   1.00 56.14  ? 341 VAL B CG2 1 
ATOM   3244 N N   . ALA B 1 136 ? 7.996   1.245   6.801   1.00 57.69  ? 342 ALA B N   1 
ATOM   3245 C CA  . ALA B 1 136 ? 9.094   0.499   6.217   1.00 60.24  ? 342 ALA B CA  1 
ATOM   3246 C C   . ALA B 1 136 ? 10.346  0.681   7.061   1.00 61.73  ? 342 ALA B C   1 
ATOM   3247 O O   . ALA B 1 136 ? 11.326  1.287   6.628   1.00 63.24  ? 342 ALA B O   1 
ATOM   3248 C CB  . ALA B 1 136 ? 9.352   0.974   4.787   1.00 58.41  ? 342 ALA B CB  1 
ATOM   3249 N N   . ASN B 1 137 ? 10.289  0.167   8.282   1.00 64.21  ? 343 ASN B N   1 
ATOM   3250 C CA  . ASN B 1 137 ? 11.413  0.226   9.206   1.00 63.59  ? 343 ASN B CA  1 
ATOM   3251 C C   . ASN B 1 137 ? 12.236  1.512   9.115   1.00 61.22  ? 343 ASN B C   1 
ATOM   3252 O O   . ASN B 1 137 ? 13.454  1.472   8.934   1.00 58.45  ? 343 ASN B O   1 
ATOM   3253 C CB  . ASN B 1 137 ? 12.309  -0.986  8.964   1.00 64.93  ? 343 ASN B CB  1 
ATOM   3254 C CG  . ASN B 1 137 ? 13.471  -1.033  9.902   1.00 65.32  ? 343 ASN B CG  1 
ATOM   3255 O OD1 . ASN B 1 137 ? 13.296  -1.123  11.114  1.00 70.23  ? 343 ASN B OD1 1 
ATOM   3256 N ND2 . ASN B 1 137 ? 14.676  -0.969  9.353   1.00 67.61  ? 343 ASN B ND2 1 
ATOM   3257 N N   . GLY B 1 138 ? 11.562  2.650   9.236   1.00 59.51  ? 344 GLY B N   1 
ATOM   3258 C CA  . GLY B 1 138 ? 12.243  3.931   9.187   1.00 59.70  ? 344 GLY B CA  1 
ATOM   3259 C C   . GLY B 1 138 ? 12.621  4.455   7.816   1.00 60.62  ? 344 GLY B C   1 
ATOM   3260 O O   . GLY B 1 138 ? 12.715  5.669   7.636   1.00 60.67  ? 344 GLY B O   1 
ATOM   3261 N N   . SER B 1 139 ? 12.834  3.561   6.851   1.00 60.74  ? 345 SER B N   1 
ATOM   3262 C CA  . SER B 1 139 ? 13.226  3.970   5.499   1.00 62.92  ? 345 SER B CA  1 
ATOM   3263 C C   . SER B 1 139 ? 12.195  4.833   4.774   1.00 62.76  ? 345 SER B C   1 
ATOM   3264 O O   . SER B 1 139 ? 12.562  5.705   3.990   1.00 63.09  ? 345 SER B O   1 
ATOM   3265 C CB  . SER B 1 139 ? 13.542  2.745   4.634   1.00 63.33  ? 345 SER B CB  1 
ATOM   3266 O OG  . SER B 1 139 ? 12.366  2.040   4.290   1.00 63.61  ? 345 SER B OG  1 
ATOM   3267 N N   . GLY B 1 140 ? 10.912  4.594   5.034   1.00 61.50  ? 346 GLY B N   1 
ATOM   3268 C CA  . GLY B 1 140 ? 9.875   5.370   4.378   1.00 59.26  ? 346 GLY B CA  1 
ATOM   3269 C C   . GLY B 1 140 ? 9.068   6.254   5.309   1.00 59.47  ? 346 GLY B C   1 
ATOM   3270 O O   . GLY B 1 140 ? 9.198   6.189   6.530   1.00 60.65  ? 346 GLY B O   1 
ATOM   3271 N N   . PHE B 1 141 ? 8.227   7.094   4.723   1.00 59.85  ? 347 PHE B N   1 
ATOM   3272 C CA  . PHE B 1 141 ? 7.377   7.987   5.497   1.00 59.81  ? 347 PHE B CA  1 
ATOM   3273 C C   . PHE B 1 141 ? 6.172   8.419   4.664   1.00 61.23  ? 347 PHE B C   1 
ATOM   3274 O O   . PHE B 1 141 ? 6.298   9.220   3.733   1.00 60.99  ? 347 PHE B O   1 
ATOM   3275 C CB  . PHE B 1 141 ? 8.151   9.222   5.940   1.00 59.12  ? 347 PHE B CB  1 
ATOM   3276 C CG  . PHE B 1 141 ? 7.315   10.208  6.694   1.00 56.84  ? 347 PHE B CG  1 
ATOM   3277 C CD1 . PHE B 1 141 ? 6.982   9.984   8.018   1.00 54.82  ? 347 PHE B CD1 1 
ATOM   3278 C CD2 . PHE B 1 141 ? 6.824   11.338  6.068   1.00 55.74  ? 347 PHE B CD2 1 
ATOM   3279 C CE1 . PHE B 1 141 ? 6.167   10.881  8.704   1.00 56.68  ? 347 PHE B CE1 1 
ATOM   3280 C CE2 . PHE B 1 141 ? 6.010   12.236  6.748   1.00 55.44  ? 347 PHE B CE2 1 
ATOM   3281 C CZ  . PHE B 1 141 ? 5.682   12.007  8.064   1.00 54.87  ? 347 PHE B CZ  1 
ATOM   3282 N N   . VAL B 1 142 ? 5.006   7.880   5.012   1.00 60.66  ? 348 VAL B N   1 
ATOM   3283 C CA  . VAL B 1 142 ? 3.764   8.186   4.316   1.00 57.35  ? 348 VAL B CA  1 
ATOM   3284 C C   . VAL B 1 142 ? 3.067   9.355   4.988   1.00 56.52  ? 348 VAL B C   1 
ATOM   3285 O O   . VAL B 1 142 ? 2.879   9.365   6.206   1.00 54.53  ? 348 VAL B O   1 
ATOM   3286 C CB  . VAL B 1 142 ? 2.807   6.977   4.336   1.00 56.79  ? 348 VAL B CB  1 
ATOM   3287 C CG1 . VAL B 1 142 ? 1.466   7.350   3.708   1.00 55.43  ? 348 VAL B CG1 1 
ATOM   3288 C CG2 . VAL B 1 142 ? 3.438   5.815   3.604   1.00 56.77  ? 348 VAL B CG2 1 
ATOM   3289 N N   . THR B 1 143 ? 2.677   10.339  4.190   1.00 55.82  ? 349 THR B N   1 
ATOM   3290 C CA  . THR B 1 143 ? 2.000   11.503  4.734   1.00 55.36  ? 349 THR B CA  1 
ATOM   3291 C C   . THR B 1 143 ? 0.597   11.173  5.202   1.00 53.75  ? 349 THR B C   1 
ATOM   3292 O O   . THR B 1 143 ? -0.047  10.261  4.693   1.00 52.62  ? 349 THR B O   1 
ATOM   3293 C CB  . THR B 1 143 ? 1.913   12.628  3.708   1.00 53.96  ? 349 THR B CB  1 
ATOM   3294 O OG1 . THR B 1 143 ? 1.217   12.154  2.551   1.00 57.46  ? 349 THR B OG1 1 
ATOM   3295 C CG2 . THR B 1 143 ? 3.309   13.090  3.317   1.00 55.65  ? 349 THR B CG2 1 
ATOM   3296 N N   . ARG B 1 144 ? 0.143   11.942  6.183   1.00 56.56  ? 350 ARG B N   1 
ATOM   3297 C CA  . ARG B 1 144 ? -1.175  11.794  6.779   1.00 57.22  ? 350 ARG B CA  1 
ATOM   3298 C C   . ARG B 1 144 ? -2.250  12.230  5.784   1.00 56.92  ? 350 ARG B C   1 
ATOM   3299 O O   . ARG B 1 144 ? -3.365  11.723  5.790   1.00 56.55  ? 350 ARG B O   1 
ATOM   3300 C CB  . ARG B 1 144 ? -1.221  12.645  8.057   1.00 57.33  ? 350 ARG B CB  1 
ATOM   3301 C CG  . ARG B 1 144 ? -2.491  12.558  8.869   1.00 57.93  ? 350 ARG B CG  1 
ATOM   3302 C CD  . ARG B 1 144 ? -2.375  13.423  10.117  1.00 59.43  ? 350 ARG B CD  1 
ATOM   3303 N NE  . ARG B 1 144 ? -3.646  13.505  10.825  1.00 60.94  ? 350 ARG B NE  1 
ATOM   3304 C CZ  . ARG B 1 144 ? -3.828  14.140  11.976  1.00 62.36  ? 350 ARG B CZ  1 
ATOM   3305 N NH1 . ARG B 1 144 ? -2.818  14.765  12.568  1.00 60.26  ? 350 ARG B NH1 1 
ATOM   3306 N NH2 . ARG B 1 144 ? -5.029  14.133  12.541  1.00 65.05  ? 350 ARG B NH2 1 
ATOM   3307 N N   . GLU B 1 145 ? -1.902  13.173  4.921   1.00 61.24  ? 351 GLU B N   1 
ATOM   3308 C CA  . GLU B 1 145 ? -2.836  13.666  3.920   1.00 62.41  ? 351 GLU B CA  1 
ATOM   3309 C C   . GLU B 1 145 ? -3.227  12.549  2.970   1.00 61.80  ? 351 GLU B C   1 
ATOM   3310 O O   . GLU B 1 145 ? -4.411  12.345  2.685   1.00 59.93  ? 351 GLU B O   1 
ATOM   3311 C CB  . GLU B 1 145 ? -2.202  14.815  3.144   1.00 67.17  ? 351 GLU B CB  1 
ATOM   3312 C CG  . GLU B 1 145 ? -2.005  16.047  3.996   1.00 69.78  ? 351 GLU B CG  1 
ATOM   3313 C CD  . GLU B 1 145 ? -3.301  16.502  4.634   1.00 70.91  ? 351 GLU B CD  1 
ATOM   3314 O OE1 . GLU B 1 145 ? -4.258  16.823  3.893   1.00 71.73  ? 351 GLU B OE1 1 
ATOM   3315 O OE2 . GLU B 1 145 ? -3.359  16.531  5.881   1.00 71.45  ? 351 GLU B OE2 1 
ATOM   3316 N N   . PHE B 1 146 ? -2.220  11.826  2.485   1.00 60.13  ? 352 PHE B N   1 
ATOM   3317 C CA  . PHE B 1 146 ? -2.445  10.712  1.572   1.00 57.58  ? 352 PHE B CA  1 
ATOM   3318 C C   . PHE B 1 146 ? -3.452  9.741   2.166   1.00 56.44  ? 352 PHE B C   1 
ATOM   3319 O O   . PHE B 1 146 ? -4.437  9.390   1.527   1.00 57.98  ? 352 PHE B O   1 
ATOM   3320 C CB  . PHE B 1 146 ? -1.128  9.976   1.287   1.00 56.97  ? 352 PHE B CB  1 
ATOM   3321 C CG  . PHE B 1 146 ? -1.285  8.761   0.400   1.00 59.11  ? 352 PHE B CG  1 
ATOM   3322 C CD1 . PHE B 1 146 ? -1.859  8.872   -0.865  1.00 56.38  ? 352 PHE B CD1 1 
ATOM   3323 C CD2 . PHE B 1 146 ? -0.863  7.505   0.834   1.00 59.23  ? 352 PHE B CD2 1 
ATOM   3324 C CE1 . PHE B 1 146 ? -2.013  7.753   -1.682  1.00 56.92  ? 352 PHE B CE1 1 
ATOM   3325 C CE2 . PHE B 1 146 ? -1.013  6.380   0.024   1.00 58.24  ? 352 PHE B CE2 1 
ATOM   3326 C CZ  . PHE B 1 146 ? -1.590  6.507   -1.237  1.00 59.72  ? 352 PHE B CZ  1 
ATOM   3327 N N   . LEU B 1 147 ? -3.204  9.317   3.398   1.00 56.06  ? 353 LEU B N   1 
ATOM   3328 C CA  . LEU B 1 147 ? -4.087  8.376   4.059   1.00 54.98  ? 353 LEU B CA  1 
ATOM   3329 C C   . LEU B 1 147 ? -5.519  8.887   4.185   1.00 57.70  ? 353 LEU B C   1 
ATOM   3330 O O   . LEU B 1 147 ? -6.476  8.113   4.098   1.00 57.23  ? 353 LEU B O   1 
ATOM   3331 C CB  . LEU B 1 147 ? -3.508  8.024   5.419   1.00 49.18  ? 353 LEU B CB  1 
ATOM   3332 C CG  . LEU B 1 147 ? -2.167  7.308   5.265   1.00 44.79  ? 353 LEU B CG  1 
ATOM   3333 C CD1 . LEU B 1 147 ? -1.531  7.093   6.619   1.00 45.49  ? 353 LEU B CD1 1 
ATOM   3334 C CD2 . LEU B 1 147 ? -2.376  5.981   4.553   1.00 45.94  ? 353 LEU B CD2 1 
ATOM   3335 N N   . ARG B 1 148 ? -5.673  10.192  4.375   1.00 59.40  ? 354 ARG B N   1 
ATOM   3336 C CA  . ARG B 1 148 ? -7.003  10.786  4.486   1.00 61.38  ? 354 ARG B CA  1 
ATOM   3337 C C   . ARG B 1 148 ? -7.680  10.801  3.114   1.00 60.41  ? 354 ARG B C   1 
ATOM   3338 O O   . ARG B 1 148 ? -8.905  10.842  3.011   1.00 59.39  ? 354 ARG B O   1 
ATOM   3339 C CB  . ARG B 1 148 ? -6.889  12.214  5.034   1.00 63.82  ? 354 ARG B CB  1 
ATOM   3340 C CG  . ARG B 1 148 ? -6.368  12.275  6.465   1.00 69.03  ? 354 ARG B CG  1 
ATOM   3341 C CD  . ARG B 1 148 ? -6.009  13.685  6.881   1.00 72.44  ? 354 ARG B CD  1 
ATOM   3342 N NE  . ARG B 1 148 ? -7.094  14.624  6.623   1.00 73.74  ? 354 ARG B NE  1 
ATOM   3343 C CZ  . ARG B 1 148 ? -8.290  14.568  7.197   1.00 75.93  ? 354 ARG B CZ  1 
ATOM   3344 N NH1 . ARG B 1 148 ? -8.566  13.611  8.074   1.00 74.80  ? 354 ARG B NH1 1 
ATOM   3345 N NH2 . ARG B 1 148 ? -9.209  15.477  6.896   1.00 78.45  ? 354 ARG B NH2 1 
ATOM   3346 N N   . SER B 1 149 ? -6.852  10.752  2.071   1.00 60.08  ? 355 SER B N   1 
ATOM   3347 C CA  . SER B 1 149 ? -7.293  10.775  0.682   1.00 60.92  ? 355 SER B CA  1 
ATOM   3348 C C   . SER B 1 149 ? -7.645  9.387   0.176   1.00 62.89  ? 355 SER B C   1 
ATOM   3349 O O   . SER B 1 149 ? -7.628  9.140   -1.035  1.00 61.17  ? 355 SER B O   1 
ATOM   3350 C CB  . SER B 1 149 ? -6.181  11.340  -0.203  1.00 61.95  ? 355 SER B CB  1 
ATOM   3351 O OG  . SER B 1 149 ? -5.708  12.580  0.292   1.00 65.67  ? 355 SER B OG  1 
ATOM   3352 N N   . LEU B 1 150 ? -7.949  8.480   1.099   1.00 64.11  ? 356 LEU B N   1 
ATOM   3353 C CA  . LEU B 1 150 ? -8.282  7.118   0.726   1.00 64.06  ? 356 LEU B CA  1 
ATOM   3354 C C   . LEU B 1 150 ? -9.787  6.969   0.597   1.00 65.65  ? 356 LEU B C   1 
ATOM   3355 O O   . LEU B 1 150 ? -10.533 7.868   0.974   1.00 68.68  ? 356 LEU B O   1 
ATOM   3356 C CB  . LEU B 1 150 ? -7.720  6.136   1.761   1.00 63.64  ? 356 LEU B CB  1 
ATOM   3357 C CG  . LEU B 1 150 ? -6.187  6.163   1.913   1.00 66.24  ? 356 LEU B CG  1 
ATOM   3358 C CD1 . LEU B 1 150 ? -5.710  5.035   2.827   1.00 65.70  ? 356 LEU B CD1 1 
ATOM   3359 C CD2 . LEU B 1 150 ? -5.535  6.028   0.531   1.00 66.79  ? 356 LEU B CD2 1 
ATOM   3360 N N   . ARG B 1 151 ? -10.226 5.841   0.050   1.00 65.61  ? 357 ARG B N   1 
ATOM   3361 C CA  . ARG B 1 151 ? -11.646 5.581   -0.131  1.00 65.66  ? 357 ARG B CA  1 
ATOM   3362 C C   . ARG B 1 151 ? -12.480 5.885   1.104   1.00 68.01  ? 357 ARG B C   1 
ATOM   3363 O O   . ARG B 1 151 ? -11.966 6.113   2.191   1.00 66.30  ? 357 ARG B O   1 
ATOM   3364 C CB  . ARG B 1 151 ? -11.876 4.124   -0.525  1.00 62.71  ? 357 ARG B CB  1 
ATOM   3365 C CG  . ARG B 1 151 ? -12.283 3.904   -1.959  1.00 55.00  ? 357 ARG B CG  1 
ATOM   3366 C CD  . ARG B 1 151 ? -12.480 2.417   -2.214  1.00 52.57  ? 357 ARG B CD  1 
ATOM   3367 N NE  . ARG B 1 151 ? -13.633 1.889   -1.495  1.00 47.00  ? 357 ARG B NE  1 
ATOM   3368 C CZ  . ARG B 1 151 ? -13.930 0.598   -1.410  1.00 47.60  ? 357 ARG B CZ  1 
ATOM   3369 N NH1 . ARG B 1 151 ? -13.157 -0.303  -1.994  1.00 41.95  ? 357 ARG B NH1 1 
ATOM   3370 N NH2 . ARG B 1 151 ? -15.006 0.207   -0.742  1.00 50.78  ? 357 ARG B NH2 1 
ATOM   3371 N N   . LYS B 1 152 ? -13.790 5.849   0.913   1.00 72.57  ? 358 LYS B N   1 
ATOM   3372 C CA  . LYS B 1 152 ? -14.741 6.131   1.968   1.00 74.88  ? 358 LYS B CA  1 
ATOM   3373 C C   . LYS B 1 152 ? -14.753 5.116   3.111   1.00 75.13  ? 358 LYS B C   1 
ATOM   3374 O O   . LYS B 1 152 ? -14.588 5.495   4.268   1.00 77.81  ? 358 LYS B O   1 
ATOM   3375 C CB  . LYS B 1 152 ? -16.141 6.266   1.354   1.00 78.19  ? 358 LYS B CB  1 
ATOM   3376 C CG  . LYS B 1 152 ? -16.209 7.259   0.191   1.00 77.34  ? 358 LYS B CG  1 
ATOM   3377 C CD  . LYS B 1 152 ? -15.659 8.622   0.598   1.00 79.77  ? 358 LYS B CD  1 
ATOM   3378 C CE  . LYS B 1 152 ? -15.713 9.618   -0.548  1.00 82.80  ? 358 LYS B CE  1 
ATOM   3379 N NZ  . LYS B 1 152 ? -15.111 10.932  -0.170  1.00 82.62  ? 358 LYS B NZ  1 
ATOM   3380 N N   . PRO B 1 153 ? -14.934 3.815   2.807   1.00 74.29  ? 359 PRO B N   1 
ATOM   3381 C CA  . PRO B 1 153 ? -14.959 2.809   3.878   1.00 72.05  ? 359 PRO B CA  1 
ATOM   3382 C C   . PRO B 1 153 ? -13.739 2.849   4.785   1.00 70.67  ? 359 PRO B C   1 
ATOM   3383 O O   . PRO B 1 153 ? -13.858 3.081   5.982   1.00 73.18  ? 359 PRO B O   1 
ATOM   3384 C CB  . PRO B 1 153 ? -15.086 1.489   3.118   1.00 71.65  ? 359 PRO B CB  1 
ATOM   3385 C CG  . PRO B 1 153 ? -14.429 1.786   1.809   1.00 73.25  ? 359 PRO B CG  1 
ATOM   3386 C CD  . PRO B 1 153 ? -14.934 3.168   1.483   1.00 73.38  ? 359 PRO B CD  1 
ATOM   3387 N N   . PHE B 1 154 ? -12.563 2.625   4.217   1.00 69.31  ? 360 PHE B N   1 
ATOM   3388 C CA  . PHE B 1 154 ? -11.338 2.652   4.998   1.00 66.01  ? 360 PHE B CA  1 
ATOM   3389 C C   . PHE B 1 154 ? -11.109 4.062   5.522   1.00 66.71  ? 360 PHE B C   1 
ATOM   3390 O O   . PHE B 1 154 ? -11.906 4.577   6.306   1.00 64.99  ? 360 PHE B O   1 
ATOM   3391 C CB  . PHE B 1 154 ? -10.164 2.220   4.124   1.00 63.34  ? 360 PHE B CB  1 
ATOM   3392 C CG  . PHE B 1 154 ? -10.394 0.924   3.424   1.00 59.90  ? 360 PHE B CG  1 
ATOM   3393 C CD1 . PHE B 1 154 ? -11.073 0.891   2.218   1.00 58.09  ? 360 PHE B CD1 1 
ATOM   3394 C CD2 . PHE B 1 154 ? -9.991  -0.273  4.003   1.00 56.72  ? 360 PHE B CD2 1 
ATOM   3395 C CE1 . PHE B 1 154 ? -11.352 -0.325  1.593   1.00 58.44  ? 360 PHE B CE1 1 
ATOM   3396 C CE2 . PHE B 1 154 ? -10.262 -1.488  3.394   1.00 57.29  ? 360 PHE B CE2 1 
ATOM   3397 C CZ  . PHE B 1 154 ? -10.947 -1.519  2.185   1.00 58.88  ? 360 PHE B CZ  1 
ATOM   3398 N N   . SER B 1 155 ? -10.011 4.666   5.077   1.00 66.25  ? 361 SER B N   1 
ATOM   3399 C CA  . SER B 1 155 ? -9.623  6.026   5.431   1.00 68.34  ? 361 SER B CA  1 
ATOM   3400 C C   . SER B 1 155 ? -9.952  6.522   6.840   1.00 69.08  ? 361 SER B C   1 
ATOM   3401 O O   . SER B 1 155 ? -9.048  6.910   7.579   1.00 70.72  ? 361 SER B O   1 
ATOM   3402 C CB  . SER B 1 155 ? -10.196 7.016   4.402   1.00 69.72  ? 361 SER B CB  1 
ATOM   3403 O OG  . SER B 1 155 ? -11.605 7.143   4.516   1.00 71.74  ? 361 SER B OG  1 
ATOM   3404 N N   . ASP B 1 156 ? -11.234 6.545   7.203   1.00 69.26  ? 362 ASP B N   1 
ATOM   3405 C CA  . ASP B 1 156 ? -11.640 7.014   8.528   1.00 70.18  ? 362 ASP B CA  1 
ATOM   3406 C C   . ASP B 1 156 ? -11.464 5.968   9.632   1.00 68.10  ? 362 ASP B C   1 
ATOM   3407 O O   . ASP B 1 156 ? -12.157 5.985   10.651  1.00 68.85  ? 362 ASP B O   1 
ATOM   3408 C CB  . ASP B 1 156 ? -13.087 7.527   8.487   1.00 71.72  ? 362 ASP B CB  1 
ATOM   3409 C CG  . ASP B 1 156 ? -13.981 6.694   7.594   1.00 73.49  ? 362 ASP B CG  1 
ATOM   3410 O OD1 . ASP B 1 156 ? -14.240 5.518   7.925   1.00 74.90  ? 362 ASP B OD1 1 
ATOM   3411 O OD2 . ASP B 1 156 ? -14.422 7.223   6.554   1.00 73.36  ? 362 ASP B OD2 1 
ATOM   3412 N N   . ILE B 1 157 ? -10.516 5.065   9.417   1.00 66.13  ? 363 ILE B N   1 
ATOM   3413 C CA  . ILE B 1 157 ? -10.203 4.021   10.382  1.00 64.60  ? 363 ILE B CA  1 
ATOM   3414 C C   . ILE B 1 157 ? -8.781  4.248   10.907  1.00 64.24  ? 363 ILE B C   1 
ATOM   3415 O O   . ILE B 1 157 ? -8.359  3.642   11.889  1.00 61.68  ? 363 ILE B O   1 
ATOM   3416 C CB  . ILE B 1 157 ? -10.257 2.641   9.736   1.00 63.50  ? 363 ILE B CB  1 
ATOM   3417 C CG1 . ILE B 1 157 ? -10.090 1.571   10.812  1.00 62.18  ? 363 ILE B CG1 1 
ATOM   3418 C CG2 . ILE B 1 157 ? -9.153  2.514   8.687   1.00 63.75  ? 363 ILE B CG2 1 
ATOM   3419 C CD1 . ILE B 1 157 ? -10.060 0.179   10.275  1.00 56.20  ? 363 ILE B CD1 1 
ATOM   3420 N N   . ILE B 1 158 ? -8.047  5.122   10.225  1.00 63.96  ? 364 ILE B N   1 
ATOM   3421 C CA  . ILE B 1 158 ? -6.680  5.452   10.603  1.00 62.77  ? 364 ILE B CA  1 
ATOM   3422 C C   . ILE B 1 158 ? -6.622  6.865   11.180  1.00 60.57  ? 364 ILE B C   1 
ATOM   3423 O O   . ILE B 1 158 ? -5.752  7.180   11.982  1.00 62.10  ? 364 ILE B O   1 
ATOM   3424 C CB  . ILE B 1 158 ? -5.726  5.365   9.381   1.00 63.49  ? 364 ILE B CB  1 
ATOM   3425 C CG1 . ILE B 1 158 ? -6.233  6.263   8.260   1.00 64.15  ? 364 ILE B CG1 1 
ATOM   3426 C CG2 . ILE B 1 158 ? -5.666  3.955   8.850   1.00 62.54  ? 364 ILE B CG2 1 
ATOM   3427 C CD1 . ILE B 1 158 ? -5.553  6.024   6.942   1.00 66.36  ? 364 ILE B CD1 1 
ATOM   3428 N N   . GLU B 1 159 ? -7.560  7.714   10.782  1.00 58.48  ? 365 GLU B N   1 
ATOM   3429 C CA  . GLU B 1 159 ? -7.580  9.087   11.262  1.00 57.03  ? 365 GLU B CA  1 
ATOM   3430 C C   . GLU B 1 159 ? -7.680  9.151   12.783  1.00 57.75  ? 365 GLU B C   1 
ATOM   3431 O O   . GLU B 1 159 ? -6.829  9.752   13.437  1.00 60.19  ? 365 GLU B O   1 
ATOM   3432 C CB  . GLU B 1 159 ? -8.746  9.857   10.628  1.00 56.77  ? 365 GLU B CB  1 
ATOM   3433 C CG  . GLU B 1 159 ? -8.361  11.195  10.005  1.00 52.05  ? 365 GLU B CG  1 
ATOM   3434 C CD  . GLU B 1 159 ? -7.834  12.191  11.017  1.00 51.39  ? 365 GLU B CD  1 
ATOM   3435 O OE1 . GLU B 1 159 ? -8.552  12.475  11.994  1.00 51.08  ? 365 GLU B OE1 1 
ATOM   3436 O OE2 . GLU B 1 159 ? -6.709  12.698  10.834  1.00 46.10  ? 365 GLU B OE2 1 
ATOM   3437 N N   . PRO B 1 160 ? -8.717  8.523   13.370  1.00 56.67  ? 366 PRO B N   1 
ATOM   3438 C CA  . PRO B 1 160 ? -8.876  8.549   14.829  1.00 54.18  ? 366 PRO B CA  1 
ATOM   3439 C C   . PRO B 1 160 ? -7.619  8.172   15.619  1.00 52.72  ? 366 PRO B C   1 
ATOM   3440 O O   . PRO B 1 160 ? -7.424  8.618   16.751  1.00 51.47  ? 366 PRO B O   1 
ATOM   3441 C CB  . PRO B 1 160 ? -10.043 7.589   15.065  1.00 54.13  ? 366 PRO B CB  1 
ATOM   3442 C CG  . PRO B 1 160 ? -9.986  6.672   13.887  1.00 55.70  ? 366 PRO B CG  1 
ATOM   3443 C CD  . PRO B 1 160 ? -9.703  7.614   12.760  1.00 53.70  ? 366 PRO B CD  1 
ATOM   3444 N N   . LYS B 1 161 ? -6.761  7.362   15.013  1.00 50.52  ? 367 LYS B N   1 
ATOM   3445 C CA  . LYS B 1 161 ? -5.539  6.946   15.674  1.00 50.84  ? 367 LYS B CA  1 
ATOM   3446 C C   . LYS B 1 161 ? -4.583  8.128   15.771  1.00 51.70  ? 367 LYS B C   1 
ATOM   3447 O O   . LYS B 1 161 ? -4.055  8.414   16.841  1.00 53.12  ? 367 LYS B O   1 
ATOM   3448 C CB  . LYS B 1 161 ? -4.902  5.802   14.902  1.00 49.44  ? 367 LYS B CB  1 
ATOM   3449 C CG  . LYS B 1 161 ? -5.887  4.725   14.490  1.00 48.67  ? 367 LYS B CG  1 
ATOM   3450 C CD  . LYS B 1 161 ? -6.336  3.886   15.649  1.00 49.15  ? 367 LYS B CD  1 
ATOM   3451 C CE  . LYS B 1 161 ? -7.035  2.619   15.159  1.00 50.20  ? 367 LYS B CE  1 
ATOM   3452 N NZ  . LYS B 1 161 ? -8.288  2.857   14.418  1.00 44.21  ? 367 LYS B NZ  1 
ATOM   3453 N N   . PHE B 1 162 ? -4.358  8.814   14.653  1.00 53.47  ? 368 PHE B N   1 
ATOM   3454 C CA  . PHE B 1 162 ? -3.487  9.991   14.644  1.00 51.94  ? 368 PHE B CA  1 
ATOM   3455 C C   . PHE B 1 162 ? -3.896  10.917  15.780  1.00 54.17  ? 368 PHE B C   1 
ATOM   3456 O O   . PHE B 1 162 ? -3.044  11.417  16.514  1.00 52.92  ? 368 PHE B O   1 
ATOM   3457 C CB  . PHE B 1 162 ? -3.593  10.728  13.306  1.00 46.07  ? 368 PHE B CB  1 
ATOM   3458 C CG  . PHE B 1 162 ? -2.530  10.338  12.325  1.00 43.85  ? 368 PHE B CG  1 
ATOM   3459 C CD1 . PHE B 1 162 ? -1.221  10.801  12.479  1.00 39.45  ? 368 PHE B CD1 1 
ATOM   3460 C CD2 . PHE B 1 162 ? -2.818  9.465   11.281  1.00 41.10  ? 368 PHE B CD2 1 
ATOM   3461 C CE1 . PHE B 1 162 ? -0.214  10.398  11.612  1.00 35.72  ? 368 PHE B CE1 1 
ATOM   3462 C CE2 . PHE B 1 162 ? -1.819  9.048   10.400  1.00 36.24  ? 368 PHE B CE2 1 
ATOM   3463 C CZ  . PHE B 1 162 ? -0.512  9.513   10.564  1.00 39.16  ? 368 PHE B CZ  1 
ATOM   3464 N N   . GLU B 1 163 ? -5.208  11.126  15.921  1.00 55.24  ? 369 GLU B N   1 
ATOM   3465 C CA  . GLU B 1 163 ? -5.751  11.976  16.970  1.00 55.01  ? 369 GLU B CA  1 
ATOM   3466 C C   . GLU B 1 163 ? -5.181  11.514  18.299  1.00 54.05  ? 369 GLU B C   1 
ATOM   3467 O O   . GLU B 1 163 ? -4.773  12.328  19.129  1.00 55.15  ? 369 GLU B O   1 
ATOM   3468 C CB  . GLU B 1 163 ? -7.279  11.878  17.005  1.00 58.59  ? 369 GLU B CB  1 
ATOM   3469 C CG  . GLU B 1 163 ? -7.984  12.396  15.745  1.00 66.53  ? 369 GLU B CG  1 
ATOM   3470 C CD  . GLU B 1 163 ? -9.497  12.156  15.760  1.00 70.45  ? 369 GLU B CD  1 
ATOM   3471 O OE1 . GLU B 1 163 ? -10.151 12.584  16.739  1.00 73.18  ? 369 GLU B OE1 1 
ATOM   3472 O OE2 . GLU B 1 163 ? -10.030 11.549  14.797  1.00 66.90  ? 369 GLU B OE2 1 
ATOM   3473 N N   . PHE B 1 164 ? -5.144  10.199  18.493  1.00 52.20  ? 370 PHE B N   1 
ATOM   3474 C CA  . PHE B 1 164 ? -4.616  9.634   19.724  1.00 46.46  ? 370 PHE B CA  1 
ATOM   3475 C C   . PHE B 1 164 ? -3.122  9.890   19.798  1.00 46.12  ? 370 PHE B C   1 
ATOM   3476 O O   . PHE B 1 164 ? -2.626  10.483  20.748  1.00 47.30  ? 370 PHE B O   1 
ATOM   3477 C CB  . PHE B 1 164 ? -4.863  8.128   19.784  1.00 43.92  ? 370 PHE B CB  1 
ATOM   3478 C CG  . PHE B 1 164 ? -4.424  7.507   21.076  1.00 48.25  ? 370 PHE B CG  1 
ATOM   3479 C CD1 . PHE B 1 164 ? -5.253  7.533   22.188  1.00 44.21  ? 370 PHE B CD1 1 
ATOM   3480 C CD2 . PHE B 1 164 ? -3.145  6.981   21.210  1.00 46.73  ? 370 PHE B CD2 1 
ATOM   3481 C CE1 . PHE B 1 164 ? -4.821  7.058   23.404  1.00 43.04  ? 370 PHE B CE1 1 
ATOM   3482 C CE2 . PHE B 1 164 ? -2.704  6.501   22.430  1.00 47.31  ? 370 PHE B CE2 1 
ATOM   3483 C CZ  . PHE B 1 164 ? -3.548  6.544   23.532  1.00 47.43  ? 370 PHE B CZ  1 
ATOM   3484 N N   . ALA B 1 165 ? -2.403  9.435   18.785  1.00 47.18  ? 371 ALA B N   1 
ATOM   3485 C CA  . ALA B 1 165 ? -0.960  9.615   18.741  1.00 49.60  ? 371 ALA B CA  1 
ATOM   3486 C C   . ALA B 1 165 ? -0.529  11.062  19.025  1.00 51.49  ? 371 ALA B C   1 
ATOM   3487 O O   . ALA B 1 165 ? 0.508   11.302  19.648  1.00 49.62  ? 371 ALA B O   1 
ATOM   3488 C CB  . ALA B 1 165 ? -0.438  9.174   17.385  1.00 47.45  ? 371 ALA B CB  1 
ATOM   3489 N N   . VAL B 1 166 ? -1.321  12.027  18.568  1.00 54.37  ? 372 VAL B N   1 
ATOM   3490 C CA  . VAL B 1 166 ? -0.988  13.429  18.777  1.00 58.74  ? 372 VAL B CA  1 
ATOM   3491 C C   . VAL B 1 166 ? -0.932  13.745  20.266  1.00 58.91  ? 372 VAL B C   1 
ATOM   3492 O O   . VAL B 1 166 ? 0.136   14.048  20.807  1.00 58.97  ? 372 VAL B O   1 
ATOM   3493 C CB  . VAL B 1 166 ? -2.026  14.367  18.114  1.00 62.45  ? 372 VAL B CB  1 
ATOM   3494 C CG1 . VAL B 1 166 ? -1.625  15.828  18.326  1.00 64.92  ? 372 VAL B CG1 1 
ATOM   3495 C CG2 . VAL B 1 166 ? -2.128  14.067  16.633  1.00 64.96  ? 372 VAL B CG2 1 
ATOM   3496 N N   . LYS B 1 167 ? -2.092  13.663  20.913  1.00 58.22  ? 373 LYS B N   1 
ATOM   3497 C CA  . LYS B 1 167 ? -2.224  13.934  22.339  1.00 57.50  ? 373 LYS B CA  1 
ATOM   3498 C C   . LYS B 1 167 ? -1.275  13.075  23.166  1.00 58.10  ? 373 LYS B C   1 
ATOM   3499 O O   . LYS B 1 167 ? -0.611  13.564  24.086  1.00 60.52  ? 373 LYS B O   1 
ATOM   3500 C CB  . LYS B 1 167 ? -3.657  13.662  22.795  1.00 56.79  ? 373 LYS B CB  1 
ATOM   3501 C CG  . LYS B 1 167 ? -4.720  14.395  21.995  1.00 57.62  ? 373 LYS B CG  1 
ATOM   3502 C CD  . LYS B 1 167 ? -6.122  13.931  22.389  1.00 56.99  ? 373 LYS B CD  1 
ATOM   3503 C CE  . LYS B 1 167 ? -7.182  14.485  21.453  1.00 54.98  ? 373 LYS B CE  1 
ATOM   3504 N NZ  . LYS B 1 167 ? -8.508  13.868  21.706  1.00 56.42  ? 373 LYS B NZ  1 
ATOM   3505 N N   . PHE B 1 168 ? -1.213  11.794  22.830  1.00 54.30  ? 374 PHE B N   1 
ATOM   3506 C CA  . PHE B 1 168 ? -0.365  10.871  23.558  1.00 52.33  ? 374 PHE B CA  1 
ATOM   3507 C C   . PHE B 1 168 ? 1.111   11.242  23.512  1.00 51.70  ? 374 PHE B C   1 
ATOM   3508 O O   . PHE B 1 168 ? 1.853   10.924  24.433  1.00 52.88  ? 374 PHE B O   1 
ATOM   3509 C CB  . PHE B 1 168 ? -0.583  9.445   23.040  1.00 49.19  ? 374 PHE B CB  1 
ATOM   3510 C CG  . PHE B 1 168 ? 0.134   8.396   23.839  1.00 49.17  ? 374 PHE B CG  1 
ATOM   3511 C CD1 . PHE B 1 168 ? 1.432   8.018   23.513  1.00 46.84  ? 374 PHE B CD1 1 
ATOM   3512 C CD2 . PHE B 1 168 ? -0.472  7.822   24.955  1.00 49.47  ? 374 PHE B CD2 1 
ATOM   3513 C CE1 . PHE B 1 168 ? 2.121   7.084   24.287  1.00 46.04  ? 374 PHE B CE1 1 
ATOM   3514 C CE2 . PHE B 1 168 ? 0.215   6.882   25.741  1.00 48.14  ? 374 PHE B CE2 1 
ATOM   3515 C CZ  . PHE B 1 168 ? 1.512   6.517   25.403  1.00 45.74  ? 374 PHE B CZ  1 
ATOM   3516 N N   . ASN B 1 169 ? 1.552   11.915  22.456  1.00 52.80  ? 375 ASN B N   1 
ATOM   3517 C CA  . ASN B 1 169 ? 2.962   12.301  22.375  1.00 54.74  ? 375 ASN B CA  1 
ATOM   3518 C C   . ASN B 1 169 ? 3.250   13.610  23.104  1.00 54.90  ? 375 ASN B C   1 
ATOM   3519 O O   . ASN B 1 169 ? 4.403   14.035  23.218  1.00 51.60  ? 375 ASN B O   1 
ATOM   3520 C CB  . ASN B 1 169 ? 3.425   12.398  20.922  1.00 55.09  ? 375 ASN B CB  1 
ATOM   3521 C CG  . ASN B 1 169 ? 3.810   11.053  20.352  1.00 56.32  ? 375 ASN B CG  1 
ATOM   3522 O OD1 . ASN B 1 169 ? 4.561   10.298  20.968  1.00 59.89  ? 375 ASN B OD1 1 
ATOM   3523 N ND2 . ASN B 1 169 ? 3.307   10.746  19.167  1.00 54.90  ? 375 ASN B ND2 1 
ATOM   3524 N N   . ALA B 1 170 ? 2.189   14.231  23.604  1.00 55.36  ? 376 ALA B N   1 
ATOM   3525 C CA  . ALA B 1 170 ? 2.310   15.462  24.359  1.00 58.07  ? 376 ALA B CA  1 
ATOM   3526 C C   . ALA B 1 170 ? 2.948   15.137  25.717  1.00 59.71  ? 376 ALA B C   1 
ATOM   3527 O O   . ALA B 1 170 ? 3.714   15.936  26.265  1.00 61.19  ? 376 ALA B O   1 
ATOM   3528 C CB  . ALA B 1 170 ? 0.937   16.074  24.557  1.00 56.30  ? 376 ALA B CB  1 
ATOM   3529 N N   . LEU B 1 171 ? 2.634   13.953  26.242  1.00 59.98  ? 377 LEU B N   1 
ATOM   3530 C CA  . LEU B 1 171 ? 3.151   13.506  27.538  1.00 60.53  ? 377 LEU B CA  1 
ATOM   3531 C C   . LEU B 1 171 ? 4.664   13.317  27.541  1.00 61.23  ? 377 LEU B C   1 
ATOM   3532 O O   . LEU B 1 171 ? 5.272   13.198  28.599  1.00 64.21  ? 377 LEU B O   1 
ATOM   3533 C CB  . LEU B 1 171 ? 2.483   12.195  27.936  1.00 60.18  ? 377 LEU B CB  1 
ATOM   3534 C CG  . LEU B 1 171 ? 0.956   12.152  27.834  1.00 60.93  ? 377 LEU B CG  1 
ATOM   3535 C CD1 . LEU B 1 171 ? 0.480   10.744  28.133  1.00 62.11  ? 377 LEU B CD1 1 
ATOM   3536 C CD2 . LEU B 1 171 ? 0.329   13.147  28.807  1.00 61.28  ? 377 LEU B CD2 1 
ATOM   3537 N N   . GLU B 1 172 ? 5.255   13.265  26.352  1.00 60.75  ? 378 GLU B N   1 
ATOM   3538 C CA  . GLU B 1 172 ? 6.699   13.117  26.181  1.00 61.52  ? 378 GLU B CA  1 
ATOM   3539 C C   . GLU B 1 172 ? 7.360   11.910  26.849  1.00 57.61  ? 378 GLU B C   1 
ATOM   3540 O O   . GLU B 1 172 ? 8.396   12.045  27.481  1.00 57.34  ? 378 GLU B O   1 
ATOM   3541 C CB  . GLU B 1 172 ? 7.404   14.402  26.637  1.00 66.98  ? 378 GLU B CB  1 
ATOM   3542 C CG  . GLU B 1 172 ? 6.978   15.649  25.857  1.00 75.64  ? 378 GLU B CG  1 
ATOM   3543 C CD  . GLU B 1 172 ? 7.683   16.916  26.321  1.00 79.66  ? 378 GLU B CD  1 
ATOM   3544 O OE1 . GLU B 1 172 ? 7.473   17.321  27.489  1.00 80.71  ? 378 GLU B OE1 1 
ATOM   3545 O OE2 . GLU B 1 172 ? 8.447   17.503  25.516  1.00 81.41  ? 378 GLU B OE2 1 
ATOM   3546 N N   . LEU B 1 173 ? 6.779   10.728  26.696  1.00 55.35  ? 379 LEU B N   1 
ATOM   3547 C CA  . LEU B 1 173 ? 7.352   9.522   27.296  1.00 51.81  ? 379 LEU B CA  1 
ATOM   3548 C C   . LEU B 1 173 ? 8.534   9.007   26.496  1.00 49.63  ? 379 LEU B C   1 
ATOM   3549 O O   . LEU B 1 173 ? 8.703   9.365   25.332  1.00 49.04  ? 379 LEU B O   1 
ATOM   3550 C CB  . LEU B 1 173 ? 6.301   8.413   27.368  1.00 50.17  ? 379 LEU B CB  1 
ATOM   3551 C CG  . LEU B 1 173 ? 5.004   8.728   28.120  1.00 48.07  ? 379 LEU B CG  1 
ATOM   3552 C CD1 . LEU B 1 173 ? 4.063   7.553   27.967  1.00 41.97  ? 379 LEU B CD1 1 
ATOM   3553 C CD2 . LEU B 1 173 ? 5.299   9.018   29.594  1.00 48.44  ? 379 LEU B CD2 1 
ATOM   3554 N N   . ASP B 1 174 ? 9.363   8.180   27.125  1.00 49.60  ? 380 ASP B N   1 
ATOM   3555 C CA  . ASP B 1 174 ? 10.496  7.583   26.422  1.00 53.02  ? 380 ASP B CA  1 
ATOM   3556 C C   . ASP B 1 174 ? 10.363  6.055   26.464  1.00 54.06  ? 380 ASP B C   1 
ATOM   3557 O O   . ASP B 1 174 ? 9.548   5.509   27.220  1.00 55.07  ? 380 ASP B O   1 
ATOM   3558 C CB  . ASP B 1 174 ? 11.842  8.030   27.010  1.00 52.84  ? 380 ASP B CB  1 
ATOM   3559 C CG  . ASP B 1 174 ? 12.093  7.485   28.394  1.00 55.52  ? 380 ASP B CG  1 
ATOM   3560 O OD1 . ASP B 1 174 ? 11.776  6.304   28.642  1.00 55.91  ? 380 ASP B OD1 1 
ATOM   3561 O OD2 . ASP B 1 174 ? 12.628  8.233   29.235  1.00 58.46  ? 380 ASP B OD2 1 
ATOM   3562 N N   . ASP B 1 175 ? 11.155  5.362   25.658  1.00 51.98  ? 381 ASP B N   1 
ATOM   3563 C CA  . ASP B 1 175 ? 11.051  3.918   25.604  1.00 50.41  ? 381 ASP B CA  1 
ATOM   3564 C C   . ASP B 1 175 ? 11.074  3.208   26.950  1.00 51.39  ? 381 ASP B C   1 
ATOM   3565 O O   . ASP B 1 175 ? 10.421  2.173   27.097  1.00 51.08  ? 381 ASP B O   1 
ATOM   3566 C CB  . ASP B 1 175 ? 12.117  3.356   24.673  1.00 47.50  ? 381 ASP B CB  1 
ATOM   3567 C CG  . ASP B 1 175 ? 11.884  3.764   23.238  1.00 46.88  ? 381 ASP B CG  1 
ATOM   3568 O OD1 . ASP B 1 175 ? 10.844  3.385   22.679  1.00 44.99  ? 381 ASP B OD1 1 
ATOM   3569 O OD2 . ASP B 1 175 ? 12.727  4.476   22.665  1.00 50.98  ? 381 ASP B OD2 1 
ATOM   3570 N N   . SER B 1 176 ? 11.793  3.762   27.929  1.00 51.89  ? 382 SER B N   1 
ATOM   3571 C CA  . SER B 1 176 ? 11.875  3.147   29.260  1.00 49.68  ? 382 SER B CA  1 
ATOM   3572 C C   . SER B 1 176 ? 10.518  3.147   29.945  1.00 48.93  ? 382 SER B C   1 
ATOM   3573 O O   . SER B 1 176 ? 10.136  2.170   30.589  1.00 50.18  ? 382 SER B O   1 
ATOM   3574 C CB  . SER B 1 176 ? 12.869  3.893   30.142  1.00 48.47  ? 382 SER B CB  1 
ATOM   3575 O OG  . SER B 1 176 ? 12.293  5.084   30.635  1.00 52.56  ? 382 SER B OG  1 
ATOM   3576 N N   . ASP B 1 177 ? 9.794   4.254   29.812  1.00 48.15  ? 383 ASP B N   1 
ATOM   3577 C CA  . ASP B 1 177 ? 8.469   4.367   30.412  1.00 50.31  ? 383 ASP B CA  1 
ATOM   3578 C C   . ASP B 1 177 ? 7.507   3.529   29.583  1.00 48.42  ? 383 ASP B C   1 
ATOM   3579 O O   . ASP B 1 177 ? 6.669   2.801   30.119  1.00 47.54  ? 383 ASP B O   1 
ATOM   3580 C CB  . ASP B 1 177 ? 7.995   5.826   30.410  1.00 54.21  ? 383 ASP B CB  1 
ATOM   3581 C CG  . ASP B 1 177 ? 9.087   6.792   30.811  1.00 57.95  ? 383 ASP B CG  1 
ATOM   3582 O OD1 . ASP B 1 177 ? 9.751   6.535   31.833  1.00 60.59  ? 383 ASP B OD1 1 
ATOM   3583 O OD2 . ASP B 1 177 ? 9.283   7.807   30.113  1.00 59.77  ? 383 ASP B OD2 1 
ATOM   3584 N N   . LEU B 1 178 ? 7.659   3.641   28.266  1.00 48.03  ? 384 LEU B N   1 
ATOM   3585 C CA  . LEU B 1 178 ? 6.833   2.937   27.295  1.00 44.71  ? 384 LEU B CA  1 
ATOM   3586 C C   . LEU B 1 178 ? 6.822   1.432   27.523  1.00 41.96  ? 384 LEU B C   1 
ATOM   3587 O O   . LEU B 1 178 ? 5.784   0.778   27.412  1.00 41.32  ? 384 LEU B O   1 
ATOM   3588 C CB  . LEU B 1 178 ? 7.346   3.255   25.903  1.00 45.66  ? 384 LEU B CB  1 
ATOM   3589 C CG  . LEU B 1 178 ? 6.331   3.533   24.803  1.00 46.21  ? 384 LEU B CG  1 
ATOM   3590 C CD1 . LEU B 1 178 ? 5.199   4.462   25.284  1.00 38.89  ? 384 LEU B CD1 1 
ATOM   3591 C CD2 . LEU B 1 178 ? 7.124   4.132   23.642  1.00 41.65  ? 384 LEU B CD2 1 
ATOM   3592 N N   . ALA B 1 179 ? 7.984   0.889   27.851  1.00 40.90  ? 385 ALA B N   1 
ATOM   3593 C CA  . ALA B 1 179 ? 8.102   -0.535  28.119  1.00 41.84  ? 385 ALA B CA  1 
ATOM   3594 C C   . ALA B 1 179 ? 7.219   -0.934  29.288  1.00 42.27  ? 385 ALA B C   1 
ATOM   3595 O O   . ALA B 1 179 ? 6.597   -1.989  29.257  1.00 44.23  ? 385 ALA B O   1 
ATOM   3596 C CB  . ALA B 1 179 ? 9.567   -0.902  28.418  1.00 45.85  ? 385 ALA B CB  1 
ATOM   3597 N N   . LEU B 1 180 ? 7.163   -0.093  30.319  1.00 42.51  ? 386 LEU B N   1 
ATOM   3598 C CA  . LEU B 1 180 ? 6.349   -0.394  31.493  1.00 42.09  ? 386 LEU B CA  1 
ATOM   3599 C C   . LEU B 1 180 ? 4.876   -0.191  31.192  1.00 41.81  ? 386 LEU B C   1 
ATOM   3600 O O   . LEU B 1 180 ? 4.023   -0.906  31.707  1.00 37.49  ? 386 LEU B O   1 
ATOM   3601 C CB  . LEU B 1 180 ? 6.760   0.488   32.683  1.00 43.49  ? 386 LEU B CB  1 
ATOM   3602 C CG  . LEU B 1 180 ? 8.172   0.278   33.256  1.00 45.97  ? 386 LEU B CG  1 
ATOM   3603 C CD1 . LEU B 1 180 ? 8.438   1.290   34.345  1.00 39.66  ? 386 LEU B CD1 1 
ATOM   3604 C CD2 . LEU B 1 180 ? 8.320   -1.139  33.795  1.00 41.20  ? 386 LEU B CD2 1 
ATOM   3605 N N   . PHE B 1 181 ? 4.595   0.789   30.342  1.00 41.96  ? 387 PHE B N   1 
ATOM   3606 C CA  . PHE B 1 181 ? 3.233   1.112   29.957  1.00 41.55  ? 387 PHE B CA  1 
ATOM   3607 C C   . PHE B 1 181 ? 2.645   -0.030  29.136  1.00 40.66  ? 387 PHE B C   1 
ATOM   3608 O O   . PHE B 1 181 ? 1.499   -0.412  29.331  1.00 39.38  ? 387 PHE B O   1 
ATOM   3609 C CB  . PHE B 1 181 ? 3.231   2.414   29.153  1.00 42.82  ? 387 PHE B CB  1 
ATOM   3610 C CG  . PHE B 1 181 ? 1.865   2.973   28.901  1.00 40.68  ? 387 PHE B CG  1 
ATOM   3611 C CD1 . PHE B 1 181 ? 1.305   2.921   27.635  1.00 41.03  ? 387 PHE B CD1 1 
ATOM   3612 C CD2 . PHE B 1 181 ? 1.132   3.539   29.930  1.00 41.06  ? 387 PHE B CD2 1 
ATOM   3613 C CE1 . PHE B 1 181 ? 0.031   3.429   27.400  1.00 43.69  ? 387 PHE B CE1 1 
ATOM   3614 C CE2 . PHE B 1 181 ? -0.146  4.048   29.702  1.00 39.41  ? 387 PHE B CE2 1 
ATOM   3615 C CZ  . PHE B 1 181 ? -0.693  3.993   28.442  1.00 43.17  ? 387 PHE B CZ  1 
ATOM   3616 N N   . ILE B 1 182 ? 3.430   -0.586  28.222  1.00 39.10  ? 388 ILE B N   1 
ATOM   3617 C CA  . ILE B 1 182 ? 2.937   -1.692  27.401  1.00 39.45  ? 388 ILE B CA  1 
ATOM   3618 C C   . ILE B 1 182 ? 2.672   -2.943  28.270  1.00 39.00  ? 388 ILE B C   1 
ATOM   3619 O O   . ILE B 1 182 ? 1.597   -3.529  28.197  1.00 37.53  ? 388 ILE B O   1 
ATOM   3620 C CB  . ILE B 1 182 ? 3.929   -2.031  26.251  1.00 41.22  ? 388 ILE B CB  1 
ATOM   3621 C CG1 . ILE B 1 182 ? 4.066   -0.839  25.292  1.00 44.33  ? 388 ILE B CG1 1 
ATOM   3622 C CG2 . ILE B 1 182 ? 3.455   -3.252  25.494  1.00 40.04  ? 388 ILE B CG2 1 
ATOM   3623 C CD1 . ILE B 1 182 ? 2.771   -0.381  24.636  1.00 42.30  ? 388 ILE B CD1 1 
ATOM   3624 N N   . ALA B 1 183 ? 3.641   -3.336  29.097  1.00 37.86  ? 389 ALA B N   1 
ATOM   3625 C CA  . ALA B 1 183 ? 3.478   -4.500  29.980  1.00 38.18  ? 389 ALA B CA  1 
ATOM   3626 C C   . ALA B 1 183 ? 2.202   -4.388  30.795  1.00 37.61  ? 389 ALA B C   1 
ATOM   3627 O O   . ALA B 1 183 ? 1.508   -5.386  31.034  1.00 37.33  ? 389 ALA B O   1 
ATOM   3628 C CB  . ALA B 1 183 ? 4.654   -4.614  30.925  1.00 36.16  ? 389 ALA B CB  1 
ATOM   3629 N N   . ALA B 1 184 ? 1.901   -3.162  31.223  1.00 38.67  ? 390 ALA B N   1 
ATOM   3630 C CA  . ALA B 1 184 ? 0.710   -2.890  32.023  1.00 37.40  ? 390 ALA B CA  1 
ATOM   3631 C C   . ALA B 1 184 ? -0.574  -3.106  31.231  1.00 39.47  ? 390 ALA B C   1 
ATOM   3632 O O   . ALA B 1 184 ? -1.528  -3.679  31.755  1.00 38.26  ? 390 ALA B O   1 
ATOM   3633 C CB  . ALA B 1 184 ? 0.751   -1.477  32.564  1.00 36.42  ? 390 ALA B CB  1 
ATOM   3634 N N   . ILE B 1 185 ? -0.615  -2.665  29.975  1.00 39.62  ? 391 ILE B N   1 
ATOM   3635 C CA  . ILE B 1 185 ? -1.829  -2.874  29.209  1.00 41.06  ? 391 ILE B CA  1 
ATOM   3636 C C   . ILE B 1 185 ? -2.004  -4.358  28.859  1.00 38.72  ? 391 ILE B C   1 
ATOM   3637 O O   . ILE B 1 185 ? -3.106  -4.877  28.943  1.00 36.94  ? 391 ILE B O   1 
ATOM   3638 C CB  . ILE B 1 185 ? -1.893  -1.968  27.929  1.00 44.32  ? 391 ILE B CB  1 
ATOM   3639 C CG1 . ILE B 1 185 ? -1.295  -2.672  26.720  1.00 47.00  ? 391 ILE B CG1 1 
ATOM   3640 C CG2 . ILE B 1 185 ? -1.173  -0.650  28.181  1.00 47.75  ? 391 ILE B CG2 1 
ATOM   3641 C CD1 . ILE B 1 185 ? -2.340  -3.253  25.808  1.00 47.62  ? 391 ILE B CD1 1 
ATOM   3642 N N   . ILE B 1 186 ? -0.929  -5.051  28.493  1.00 41.15  ? 392 ILE B N   1 
ATOM   3643 C CA  . ILE B 1 186 ? -1.050  -6.471  28.159  1.00 42.11  ? 392 ILE B CA  1 
ATOM   3644 C C   . ILE B 1 186 ? -1.545  -7.253  29.372  1.00 44.39  ? 392 ILE B C   1 
ATOM   3645 O O   . ILE B 1 186 ? -2.459  -8.069  29.242  1.00 45.66  ? 392 ILE B O   1 
ATOM   3646 C CB  . ILE B 1 186 ? 0.296   -7.118  27.687  1.00 39.58  ? 392 ILE B CB  1 
ATOM   3647 C CG1 . ILE B 1 186 ? 0.577   -6.829  26.212  1.00 40.67  ? 392 ILE B CG1 1 
ATOM   3648 C CG2 . ILE B 1 186 ? 0.181   -8.623  27.756  1.00 37.48  ? 392 ILE B CG2 1 
ATOM   3649 C CD1 . ILE B 1 186 ? 0.743   -5.394  25.866  1.00 48.18  ? 392 ILE B CD1 1 
ATOM   3650 N N   . LEU B 1 187 ? -0.943  -7.004  30.540  1.00 46.07  ? 393 LEU B N   1 
ATOM   3651 C CA  . LEU B 1 187 ? -1.320  -7.685  31.789  1.00 46.82  ? 393 LEU B CA  1 
ATOM   3652 C C   . LEU B 1 187 ? -2.491  -7.007  32.477  1.00 45.90  ? 393 LEU B C   1 
ATOM   3653 O O   . LEU B 1 187 ? -2.369  -6.421  33.548  1.00 45.42  ? 393 LEU B O   1 
ATOM   3654 C CB  . LEU B 1 187 ? -0.138  -7.733  32.746  1.00 47.70  ? 393 LEU B CB  1 
ATOM   3655 C CG  . LEU B 1 187 ? 0.942   -8.715  32.316  1.00 48.94  ? 393 LEU B CG  1 
ATOM   3656 C CD1 . LEU B 1 187 ? 2.186   -8.456  33.136  1.00 56.33  ? 393 LEU B CD1 1 
ATOM   3657 C CD2 . LEU B 1 187 ? 0.450   -10.136 32.488  1.00 45.46  ? 393 LEU B CD2 1 
ATOM   3658 N N   . CYS B 1 188 ? -3.644  -7.116  31.845  1.00 46.00  ? 394 CYS B N   1 
ATOM   3659 C CA  . CYS B 1 188 ? -4.851  -6.497  32.346  1.00 46.20  ? 394 CYS B CA  1 
ATOM   3660 C C   . CYS B 1 188 ? -5.795  -7.539  32.938  1.00 44.32  ? 394 CYS B C   1 
ATOM   3661 O O   . CYS B 1 188 ? -6.054  -8.575  32.334  1.00 45.97  ? 394 CYS B O   1 
ATOM   3662 C CB  . CYS B 1 188 ? -5.498  -5.729  31.199  1.00 43.30  ? 394 CYS B CB  1 
ATOM   3663 S SG  . CYS B 1 188 ? -7.012  -4.957  31.616  1.00 53.35  ? 394 CYS B SG  1 
ATOM   3664 N N   . GLY B 1 189 ? -6.306  -7.262  34.130  1.00 43.04  ? 395 GLY B N   1 
ATOM   3665 C CA  . GLY B 1 189 ? -7.189  -8.208  34.780  1.00 38.99  ? 395 GLY B CA  1 
ATOM   3666 C C   . GLY B 1 189 ? -8.635  -8.162  34.352  1.00 37.48  ? 395 GLY B C   1 
ATOM   3667 O O   . GLY B 1 189 ? -9.409  -9.016  34.745  1.00 37.28  ? 395 GLY B O   1 
ATOM   3668 N N   . ASP B 1 190 ? -9.009  -7.184  33.539  1.00 40.78  ? 396 ASP B N   1 
ATOM   3669 C CA  . ASP B 1 190 ? -10.398 -7.072  33.098  1.00 41.81  ? 396 ASP B CA  1 
ATOM   3670 C C   . ASP B 1 190 ? -10.759 -7.785  31.804  1.00 41.22  ? 396 ASP B C   1 
ATOM   3671 O O   . ASP B 1 190 ? -11.899 -7.687  31.367  1.00 41.03  ? 396 ASP B O   1 
ATOM   3672 C CB  . ASP B 1 190 ? -10.791 -5.610  32.936  1.00 46.72  ? 396 ASP B CB  1 
ATOM   3673 C CG  . ASP B 1 190 ? -10.328 -4.761  34.085  1.00 55.84  ? 396 ASP B CG  1 
ATOM   3674 O OD1 . ASP B 1 190 ? -10.493 -5.197  35.247  1.00 60.86  ? 396 ASP B OD1 1 
ATOM   3675 O OD2 . ASP B 1 190 ? -9.810  -3.650  33.821  1.00 58.87  ? 396 ASP B OD2 1 
ATOM   3676 N N   . ARG B 1 191 ? -9.811  -8.484  31.186  1.00 42.46  ? 397 ARG B N   1 
ATOM   3677 C CA  . ARG B 1 191 ? -10.097 -9.187  29.928  1.00 42.77  ? 397 ARG B CA  1 
ATOM   3678 C C   . ARG B 1 191 ? -11.107 -10.325 30.105  1.00 44.89  ? 397 ARG B C   1 
ATOM   3679 O O   . ARG B 1 191 ? -11.001 -11.134 31.026  1.00 46.73  ? 397 ARG B O   1 
ATOM   3680 C CB  . ARG B 1 191 ? -8.805  -9.735  29.312  1.00 38.92  ? 397 ARG B CB  1 
ATOM   3681 C CG  . ARG B 1 191 ? -7.693  -8.716  29.222  1.00 37.03  ? 397 ARG B CG  1 
ATOM   3682 C CD  . ARG B 1 191 ? -8.158  -7.424  28.568  1.00 40.05  ? 397 ARG B CD  1 
ATOM   3683 N NE  . ARG B 1 191 ? -7.027  -6.540  28.318  1.00 38.77  ? 397 ARG B NE  1 
ATOM   3684 C CZ  . ARG B 1 191 ? -7.125  -5.319  27.811  1.00 39.64  ? 397 ARG B CZ  1 
ATOM   3685 N NH1 . ARG B 1 191 ? -8.315  -4.823  27.498  1.00 39.47  ? 397 ARG B NH1 1 
ATOM   3686 N NH2 . ARG B 1 191 ? -6.026  -4.601  27.611  1.00 37.27  ? 397 ARG B NH2 1 
ATOM   3687 N N   . PRO B 1 192 ? -12.106 -10.391 29.217  1.00 45.73  ? 398 PRO B N   1 
ATOM   3688 C CA  . PRO B 1 192 ? -13.177 -11.396 29.205  1.00 46.96  ? 398 PRO B CA  1 
ATOM   3689 C C   . PRO B 1 192 ? -12.711 -12.847 29.057  1.00 47.38  ? 398 PRO B C   1 
ATOM   3690 O O   . PRO B 1 192 ? -11.934 -13.178 28.155  1.00 49.26  ? 398 PRO B O   1 
ATOM   3691 C CB  . PRO B 1 192 ? -14.039 -10.961 28.019  1.00 45.59  ? 398 PRO B CB  1 
ATOM   3692 C CG  . PRO B 1 192 ? -13.839 -9.488  27.981  1.00 46.00  ? 398 PRO B CG  1 
ATOM   3693 C CD  . PRO B 1 192 ? -12.361 -9.354  28.203  1.00 45.64  ? 398 PRO B CD  1 
ATOM   3694 N N   . GLY B 1 193 ? -13.208 -13.707 29.938  1.00 46.50  ? 399 GLY B N   1 
ATOM   3695 C CA  . GLY B 1 193 ? -12.857 -15.115 29.889  1.00 44.47  ? 399 GLY B CA  1 
ATOM   3696 C C   . GLY B 1 193 ? -11.519 -15.432 30.520  1.00 44.56  ? 399 GLY B C   1 
ATOM   3697 O O   . GLY B 1 193 ? -10.956 -16.509 30.285  1.00 43.60  ? 399 GLY B O   1 
ATOM   3698 N N   . LEU B 1 194 ? -10.996 -14.495 31.309  1.00 42.47  ? 400 LEU B N   1 
ATOM   3699 C CA  . LEU B 1 194 ? -9.715  -14.705 31.972  1.00 40.82  ? 400 LEU B CA  1 
ATOM   3700 C C   . LEU B 1 194 ? -9.953  -15.745 33.062  1.00 39.59  ? 400 LEU B C   1 
ATOM   3701 O O   . LEU B 1 194 ? -10.970 -15.702 33.743  1.00 38.52  ? 400 LEU B O   1 
ATOM   3702 C CB  . LEU B 1 194 ? -9.202  -13.383 32.560  1.00 37.48  ? 400 LEU B CB  1 
ATOM   3703 C CG  . LEU B 1 194 ? -7.696  -13.275 32.824  1.00 36.78  ? 400 LEU B CG  1 
ATOM   3704 C CD1 . LEU B 1 194 ? -6.909  -13.742 31.587  1.00 36.31  ? 400 LEU B CD1 1 
ATOM   3705 C CD2 . LEU B 1 194 ? -7.345  -11.841 33.168  1.00 36.42  ? 400 LEU B CD2 1 
ATOM   3706 N N   . MET B 1 195 ? -9.022  -16.682 33.216  1.00 39.97  ? 401 MET B N   1 
ATOM   3707 C CA  . MET B 1 195 ? -9.168  -17.753 34.201  1.00 40.47  ? 401 MET B CA  1 
ATOM   3708 C C   . MET B 1 195 ? -8.644  -17.430 35.615  1.00 40.43  ? 401 MET B C   1 
ATOM   3709 O O   . MET B 1 195 ? -9.392  -17.516 36.582  1.00 38.89  ? 401 MET B O   1 
ATOM   3710 C CB  . MET B 1 195 ? -8.509  -19.029 33.652  1.00 42.62  ? 401 MET B CB  1 
ATOM   3711 C CG  . MET B 1 195 ? -8.823  -20.308 34.439  1.00 46.98  ? 401 MET B CG  1 
ATOM   3712 S SD  . MET B 1 195 ? -8.024  -21.773 33.734  1.00 47.74  ? 401 MET B SD  1 
ATOM   3713 C CE  . MET B 1 195 ? -6.299  -21.486 34.175  1.00 44.29  ? 401 MET B CE  1 
ATOM   3714 N N   . ASN B 1 196 ? -7.365  -17.087 35.740  1.00 40.08  ? 402 ASN B N   1 
ATOM   3715 C CA  . ASN B 1 196 ? -6.798  -16.737 37.036  1.00 40.19  ? 402 ASN B CA  1 
ATOM   3716 C C   . ASN B 1 196 ? -6.719  -15.202 37.167  1.00 42.21  ? 402 ASN B C   1 
ATOM   3717 O O   . ASN B 1 196 ? -5.633  -14.611 37.152  1.00 40.44  ? 402 ASN B O   1 
ATOM   3718 C CB  . ASN B 1 196 ? -5.393  -17.342 37.185  1.00 42.79  ? 402 ASN B CB  1 
ATOM   3719 C CG  . ASN B 1 196 ? -4.867  -17.299 38.634  1.00 41.83  ? 402 ASN B CG  1 
ATOM   3720 O OD1 . ASN B 1 196 ? -5.209  -16.410 39.416  1.00 44.43  ? 402 ASN B OD1 1 
ATOM   3721 N ND2 . ASN B 1 196 ? -4.019  -18.255 38.979  1.00 42.05  ? 402 ASN B ND2 1 
ATOM   3722 N N   . VAL B 1 197 ? -7.880  -14.566 37.288  1.00 43.12  ? 403 VAL B N   1 
ATOM   3723 C CA  . VAL B 1 197 ? -7.959  -13.115 37.452  1.00 43.30  ? 403 VAL B CA  1 
ATOM   3724 C C   . VAL B 1 197 ? -7.142  -12.616 38.652  1.00 44.03  ? 403 VAL B C   1 
ATOM   3725 O O   . VAL B 1 197 ? -6.372  -11.662 38.535  1.00 44.82  ? 403 VAL B O   1 
ATOM   3726 C CB  . VAL B 1 197 ? -9.428  -12.646 37.649  1.00 42.44  ? 403 VAL B CB  1 
ATOM   3727 C CG1 . VAL B 1 197 ? -9.465  -11.174 38.084  1.00 35.17  ? 403 VAL B CG1 1 
ATOM   3728 C CG2 . VAL B 1 197 ? -10.204 -12.839 36.365  1.00 40.28  ? 403 VAL B CG2 1 
ATOM   3729 N N   . PRO B 1 198 ? -7.313  -13.243 39.823  1.00 40.90  ? 404 PRO B N   1 
ATOM   3730 C CA  . PRO B 1 198 ? -6.537  -12.769 40.967  1.00 44.15  ? 404 PRO B CA  1 
ATOM   3731 C C   . PRO B 1 198 ? -5.050  -12.714 40.651  1.00 44.58  ? 404 PRO B C   1 
ATOM   3732 O O   . PRO B 1 198 ? -4.365  -11.763 41.034  1.00 48.49  ? 404 PRO B O   1 
ATOM   3733 C CB  . PRO B 1 198 ? -6.893  -13.776 42.062  1.00 39.46  ? 404 PRO B CB  1 
ATOM   3734 C CG  . PRO B 1 198 ? -8.316  -14.049 41.766  1.00 39.55  ? 404 PRO B CG  1 
ATOM   3735 C CD  . PRO B 1 198 ? -8.281  -14.264 40.250  1.00 39.12  ? 404 PRO B CD  1 
ATOM   3736 N N   . ARG B 1 199 ? -4.554  -13.713 39.932  1.00 45.35  ? 405 ARG B N   1 
ATOM   3737 C CA  . ARG B 1 199 ? -3.139  -13.734 39.575  1.00 45.84  ? 405 ARG B CA  1 
ATOM   3738 C C   . ARG B 1 199 ? -2.774  -12.556 38.674  1.00 46.50  ? 405 ARG B C   1 
ATOM   3739 O O   . ARG B 1 199 ? -1.828  -11.821 38.948  1.00 44.43  ? 405 ARG B O   1 
ATOM   3740 C CB  . ARG B 1 199 ? -2.784  -15.028 38.860  1.00 45.36  ? 405 ARG B CB  1 
ATOM   3741 C CG  . ARG B 1 199 ? -1.332  -15.101 38.462  1.00 53.91  ? 405 ARG B CG  1 
ATOM   3742 C CD  . ARG B 1 199 ? -0.440  -15.192 39.683  1.00 60.96  ? 405 ARG B CD  1 
ATOM   3743 N NE  . ARG B 1 199 ? -0.661  -16.437 40.418  1.00 68.23  ? 405 ARG B NE  1 
ATOM   3744 C CZ  . ARG B 1 199 ? -0.507  -17.652 39.895  1.00 68.58  ? 405 ARG B CZ  1 
ATOM   3745 N NH1 . ARG B 1 199 ? -0.131  -17.791 38.627  1.00 65.32  ? 405 ARG B NH1 1 
ATOM   3746 N NH2 . ARG B 1 199 ? -0.723  -18.727 40.643  1.00 67.58  ? 405 ARG B NH2 1 
ATOM   3747 N N   . VAL B 1 200 ? -3.529  -12.381 37.593  1.00 47.05  ? 406 VAL B N   1 
ATOM   3748 C CA  . VAL B 1 200 ? -3.264  -11.296 36.664  1.00 45.36  ? 406 VAL B CA  1 
ATOM   3749 C C   . VAL B 1 200 ? -3.337  -9.968  37.381  1.00 44.26  ? 406 VAL B C   1 
ATOM   3750 O O   . VAL B 1 200 ? -2.397  -9.188  37.318  1.00 44.64  ? 406 VAL B O   1 
ATOM   3751 C CB  . VAL B 1 200 ? -4.261  -11.286 35.491  1.00 46.71  ? 406 VAL B CB  1 
ATOM   3752 C CG1 . VAL B 1 200 ? -3.885  -10.201 34.502  1.00 44.14  ? 406 VAL B CG1 1 
ATOM   3753 C CG2 . VAL B 1 200 ? -4.269  -12.636 34.809  1.00 46.17  ? 406 VAL B CG2 1 
ATOM   3754 N N   . GLU B 1 201 ? -4.442  -9.717  38.076  1.00 43.50  ? 407 GLU B N   1 
ATOM   3755 C CA  . GLU B 1 201 ? -4.610  -8.461  38.797  1.00 42.42  ? 407 GLU B CA  1 
ATOM   3756 C C   . GLU B 1 201 ? -3.407  -8.158  39.671  1.00 43.20  ? 407 GLU B C   1 
ATOM   3757 O O   . GLU B 1 201 ? -2.992  -6.999  39.790  1.00 41.14  ? 407 GLU B O   1 
ATOM   3758 C CB  . GLU B 1 201 ? -5.864  -8.504  39.660  1.00 45.04  ? 407 GLU B CB  1 
ATOM   3759 C CG  . GLU B 1 201 ? -7.139  -8.548  38.859  1.00 54.43  ? 407 GLU B CG  1 
ATOM   3760 C CD  . GLU B 1 201 ? -8.370  -8.350  39.715  1.00 58.36  ? 407 GLU B CD  1 
ATOM   3761 O OE1 . GLU B 1 201 ? -9.476  -8.189  39.151  1.00 63.27  ? 407 GLU B OE1 1 
ATOM   3762 O OE2 . GLU B 1 201 ? -8.234  -8.356  40.950  1.00 57.77  ? 407 GLU B OE2 1 
ATOM   3763 N N   . ALA B 1 202 ? -2.841  -9.203  40.272  1.00 41.59  ? 408 ALA B N   1 
ATOM   3764 C CA  . ALA B 1 202 ? -1.685  -9.038  41.136  1.00 41.61  ? 408 ALA B CA  1 
ATOM   3765 C C   . ALA B 1 202 ? -0.453  -8.655  40.340  1.00 43.28  ? 408 ALA B C   1 
ATOM   3766 O O   . ALA B 1 202 ? 0.278   -7.750  40.735  1.00 48.02  ? 408 ALA B O   1 
ATOM   3767 C CB  . ALA B 1 202 ? -1.423  -10.311 41.923  1.00 37.06  ? 408 ALA B CB  1 
ATOM   3768 N N   . ILE B 1 203 ? -0.205  -9.336  39.225  1.00 44.17  ? 409 ILE B N   1 
ATOM   3769 C CA  . ILE B 1 203 ? 0.968   -9.005  38.415  1.00 42.85  ? 409 ILE B CA  1 
ATOM   3770 C C   . ILE B 1 203 ? 0.822   -7.603  37.827  1.00 40.62  ? 409 ILE B C   1 
ATOM   3771 O O   . ILE B 1 203 ? 1.802   -6.895  37.651  1.00 42.12  ? 409 ILE B O   1 
ATOM   3772 C CB  . ILE B 1 203 ? 1.166   -9.983  37.252  1.00 42.45  ? 409 ILE B CB  1 
ATOM   3773 C CG1 . ILE B 1 203 ? 1.109   -11.421 37.761  1.00 43.02  ? 409 ILE B CG1 1 
ATOM   3774 C CG2 . ILE B 1 203 ? 2.508   -9.716  36.586  1.00 40.11  ? 409 ILE B CG2 1 
ATOM   3775 C CD1 . ILE B 1 203 ? 1.115   -12.469 36.645  1.00 41.13  ? 409 ILE B CD1 1 
ATOM   3776 N N   . GLN B 1 204 ? -0.405  -7.206  37.524  1.00 39.09  ? 410 GLN B N   1 
ATOM   3777 C CA  . GLN B 1 204 ? -0.640  -5.891  36.967  1.00 40.68  ? 410 GLN B CA  1 
ATOM   3778 C C   . GLN B 1 204 ? -0.291  -4.812  37.978  1.00 41.55  ? 410 GLN B C   1 
ATOM   3779 O O   . GLN B 1 204 ? 0.359   -3.819  37.644  1.00 42.20  ? 410 GLN B O   1 
ATOM   3780 C CB  . GLN B 1 204 ? -2.098  -5.732  36.528  1.00 39.19  ? 410 GLN B CB  1 
ATOM   3781 C CG  . GLN B 1 204 ? -2.425  -4.272  36.170  1.00 48.80  ? 410 GLN B CG  1 
ATOM   3782 C CD  . GLN B 1 204 ? -3.795  -4.069  35.555  1.00 52.31  ? 410 GLN B CD  1 
ATOM   3783 O OE1 . GLN B 1 204 ? -4.807  -4.550  36.074  1.00 56.40  ? 410 GLN B OE1 1 
ATOM   3784 N NE2 . GLN B 1 204 ? -3.836  -3.334  34.445  1.00 51.97  ? 410 GLN B NE2 1 
ATOM   3785 N N   . ASP B 1 205 ? -0.719  -5.016  39.216  1.00 42.70  ? 411 ASP B N   1 
ATOM   3786 C CA  . ASP B 1 205 ? -0.462  -4.051  40.277  1.00 44.13  ? 411 ASP B CA  1 
ATOM   3787 C C   . ASP B 1 205 ? 1.019   -3.670  40.401  1.00 43.14  ? 411 ASP B C   1 
ATOM   3788 O O   . ASP B 1 205 ? 1.354   -2.481  40.451  1.00 41.74  ? 411 ASP B O   1 
ATOM   3789 C CB  . ASP B 1 205 ? -0.978  -4.594  41.618  1.00 44.46  ? 411 ASP B CB  1 
ATOM   3790 C CG  . ASP B 1 205 ? -1.077  -3.514  42.691  1.00 47.28  ? 411 ASP B CG  1 
ATOM   3791 O OD1 . ASP B 1 205 ? -1.883  -2.566  42.531  1.00 44.92  ? 411 ASP B OD1 1 
ATOM   3792 O OD2 . ASP B 1 205 ? -0.344  -3.618  43.697  1.00 49.34  ? 411 ASP B OD2 1 
ATOM   3793 N N   . THR B 1 206 ? 1.909   -4.655  40.451  1.00 41.13  ? 412 THR B N   1 
ATOM   3794 C CA  . THR B 1 206 ? 3.317   -4.319  40.580  1.00 43.66  ? 412 THR B CA  1 
ATOM   3795 C C   . THR B 1 206 ? 3.815   -3.610  39.319  1.00 44.60  ? 412 THR B C   1 
ATOM   3796 O O   . THR B 1 206 ? 4.677   -2.738  39.403  1.00 47.87  ? 412 THR B O   1 
ATOM   3797 C CB  . THR B 1 206 ? 4.191   -5.564  40.893  1.00 43.83  ? 412 THR B CB  1 
ATOM   3798 O OG1 . THR B 1 206 ? 4.901   -5.969  39.724  1.00 44.19  ? 412 THR B OG1 1 
ATOM   3799 C CG2 . THR B 1 206 ? 3.320   -6.712  41.400  1.00 42.06  ? 412 THR B CG2 1 
ATOM   3800 N N   . ILE B 1 207 ? 3.273   -3.970  38.155  1.00 42.67  ? 413 ILE B N   1 
ATOM   3801 C CA  . ILE B 1 207 ? 3.667   -3.298  36.921  1.00 41.43  ? 413 ILE B CA  1 
ATOM   3802 C C   . ILE B 1 207 ? 3.382   -1.805  37.120  1.00 41.09  ? 413 ILE B C   1 
ATOM   3803 O O   . ILE B 1 207 ? 4.261   -0.966  36.928  1.00 38.91  ? 413 ILE B O   1 
ATOM   3804 C CB  . ILE B 1 207 ? 2.844   -3.786  35.677  1.00 43.38  ? 413 ILE B CB  1 
ATOM   3805 C CG1 . ILE B 1 207 ? 3.176   -5.241  35.326  1.00 42.43  ? 413 ILE B CG1 1 
ATOM   3806 C CG2 . ILE B 1 207 ? 3.126   -2.895  34.489  1.00 29.68  ? 413 ILE B CG2 1 
ATOM   3807 C CD1 . ILE B 1 207 ? 4.596   -5.473  34.938  1.00 48.51  ? 413 ILE B CD1 1 
ATOM   3808 N N   . LEU B 1 208 ? 2.146   -1.487  37.499  1.00 40.66  ? 414 LEU B N   1 
ATOM   3809 C CA  . LEU B 1 208 ? 1.739   -0.098  37.724  1.00 44.89  ? 414 LEU B CA  1 
ATOM   3810 C C   . LEU B 1 208 ? 2.528   0.608   38.832  1.00 45.84  ? 414 LEU B C   1 
ATOM   3811 O O   . LEU B 1 208 ? 2.790   1.804   38.739  1.00 44.04  ? 414 LEU B O   1 
ATOM   3812 C CB  . LEU B 1 208 ? 0.244   -0.021  38.046  1.00 42.84  ? 414 LEU B CB  1 
ATOM   3813 C CG  . LEU B 1 208 ? -0.703  -0.240  36.874  1.00 41.99  ? 414 LEU B CG  1 
ATOM   3814 C CD1 . LEU B 1 208 ? -2.147  -0.205  37.369  1.00 44.13  ? 414 LEU B CD1 1 
ATOM   3815 C CD2 . LEU B 1 208 ? -0.463  0.828   35.835  1.00 37.53  ? 414 LEU B CD2 1 
ATOM   3816 N N   . ARG B 1 209 ? 2.887   -0.121  39.886  1.00 46.63  ? 415 ARG B N   1 
ATOM   3817 C CA  . ARG B 1 209 ? 3.649   0.483   40.970  1.00 49.88  ? 415 ARG B CA  1 
ATOM   3818 C C   . ARG B 1 209 ? 5.063   0.758   40.472  1.00 50.24  ? 415 ARG B C   1 
ATOM   3819 O O   . ARG B 1 209 ? 5.694   1.744   40.865  1.00 47.81  ? 415 ARG B O   1 
ATOM   3820 C CB  . ARG B 1 209 ? 3.678   -0.437  42.194  1.00 51.51  ? 415 ARG B CB  1 
ATOM   3821 C CG  . ARG B 1 209 ? 2.364   -0.478  42.965  1.00 56.00  ? 415 ARG B CG  1 
ATOM   3822 C CD  . ARG B 1 209 ? 2.358   -1.601  43.990  1.00 58.15  ? 415 ARG B CD  1 
ATOM   3823 N NE  . ARG B 1 209 ? 1.049   -1.753  44.620  1.00 64.58  ? 415 ARG B NE  1 
ATOM   3824 C CZ  . ARG B 1 209 ? 0.530   -0.889  45.489  1.00 69.48  ? 415 ARG B CZ  1 
ATOM   3825 N NH1 . ARG B 1 209 ? -0.673  -1.108  46.011  1.00 68.03  ? 415 ARG B NH1 1 
ATOM   3826 N NH2 . ARG B 1 209 ? 1.214   0.191   45.846  1.00 70.39  ? 415 ARG B NH2 1 
ATOM   3827 N N   . ALA B 1 210 ? 5.558   -0.120  39.605  1.00 51.72  ? 416 ALA B N   1 
ATOM   3828 C CA  . ALA B 1 210 ? 6.889   0.054   39.025  1.00 52.46  ? 416 ALA B CA  1 
ATOM   3829 C C   . ALA B 1 210 ? 6.847   1.284   38.112  1.00 51.97  ? 416 ALA B C   1 
ATOM   3830 O O   . ALA B 1 210 ? 7.744   2.121   38.133  1.00 52.55  ? 416 ALA B O   1 
ATOM   3831 C CB  . ALA B 1 210 ? 7.286   -1.183  38.229  1.00 48.73  ? 416 ALA B CB  1 
ATOM   3832 N N   . LEU B 1 211 ? 5.791   1.383   37.313  1.00 51.83  ? 417 LEU B N   1 
ATOM   3833 C CA  . LEU B 1 211 ? 5.621   2.513   36.422  1.00 53.37  ? 417 LEU B CA  1 
ATOM   3834 C C   . LEU B 1 211 ? 5.630   3.759   37.285  1.00 55.65  ? 417 LEU B C   1 
ATOM   3835 O O   . LEU B 1 211 ? 6.388   4.692   37.049  1.00 56.17  ? 417 LEU B O   1 
ATOM   3836 C CB  . LEU B 1 211 ? 4.290   2.386   35.694  1.00 50.71  ? 417 LEU B CB  1 
ATOM   3837 C CG  . LEU B 1 211 ? 3.764   3.591   34.925  1.00 48.69  ? 417 LEU B CG  1 
ATOM   3838 C CD1 . LEU B 1 211 ? 4.783   4.099   33.918  1.00 42.44  ? 417 LEU B CD1 1 
ATOM   3839 C CD2 . LEU B 1 211 ? 2.472   3.170   34.256  1.00 45.20  ? 417 LEU B CD2 1 
ATOM   3840 N N   . GLU B 1 212 ? 4.778   3.737   38.301  1.00 59.47  ? 418 GLU B N   1 
ATOM   3841 C CA  . GLU B 1 212 ? 4.627   4.816   39.273  1.00 61.86  ? 418 GLU B CA  1 
ATOM   3842 C C   . GLU B 1 212 ? 5.949   5.466   39.711  1.00 62.37  ? 418 GLU B C   1 
ATOM   3843 O O   . GLU B 1 212 ? 6.154   6.671   39.526  1.00 57.70  ? 418 GLU B O   1 
ATOM   3844 C CB  . GLU B 1 212 ? 3.895   4.256   40.495  1.00 63.10  ? 418 GLU B CB  1 
ATOM   3845 C CG  . GLU B 1 212 ? 3.833   5.180   41.681  1.00 66.91  ? 418 GLU B CG  1 
ATOM   3846 C CD  . GLU B 1 212 ? 3.009   6.400   41.406  1.00 65.48  ? 418 GLU B CD  1 
ATOM   3847 O OE1 . GLU B 1 212 ? 3.310   7.109   40.429  1.00 67.20  ? 418 GLU B OE1 1 
ATOM   3848 O OE2 . GLU B 1 212 ? 2.063   6.647   42.173  1.00 66.50  ? 418 GLU B OE2 1 
ATOM   3849 N N   . PHE B 1 213 ? 6.830   4.660   40.301  1.00 64.65  ? 419 PHE B N   1 
ATOM   3850 C CA  . PHE B 1 213 ? 8.123   5.139   40.771  1.00 66.46  ? 419 PHE B CA  1 
ATOM   3851 C C   . PHE B 1 213 ? 9.000   5.559   39.602  1.00 65.71  ? 419 PHE B C   1 
ATOM   3852 O O   . PHE B 1 213 ? 9.698   6.575   39.675  1.00 66.71  ? 419 PHE B O   1 
ATOM   3853 C CB  . PHE B 1 213 ? 8.850   4.057   41.589  1.00 69.82  ? 419 PHE B CB  1 
ATOM   3854 C CG  . PHE B 1 213 ? 8.261   3.820   42.958  1.00 72.84  ? 419 PHE B CG  1 
ATOM   3855 C CD1 . PHE B 1 213 ? 7.061   3.130   43.112  1.00 73.38  ? 419 PHE B CD1 1 
ATOM   3856 C CD2 . PHE B 1 213 ? 8.909   4.297   44.099  1.00 75.72  ? 419 PHE B CD2 1 
ATOM   3857 C CE1 . PHE B 1 213 ? 6.513   2.916   44.381  1.00 72.77  ? 419 PHE B CE1 1 
ATOM   3858 C CE2 . PHE B 1 213 ? 8.368   4.090   45.377  1.00 74.90  ? 419 PHE B CE2 1 
ATOM   3859 C CZ  . PHE B 1 213 ? 7.169   3.399   45.514  1.00 73.28  ? 419 PHE B CZ  1 
ATOM   3860 N N   . HIS B 1 214 ? 8.961   4.774   38.528  1.00 63.04  ? 420 HIS B N   1 
ATOM   3861 C CA  . HIS B 1 214 ? 9.763   5.061   37.346  1.00 58.43  ? 420 HIS B CA  1 
ATOM   3862 C C   . HIS B 1 214 ? 9.489   6.463   36.822  1.00 56.67  ? 420 HIS B C   1 
ATOM   3863 O O   . HIS B 1 214 ? 10.394  7.140   36.355  1.00 56.12  ? 420 HIS B O   1 
ATOM   3864 C CB  . HIS B 1 214 ? 9.484   4.046   36.242  1.00 57.65  ? 420 HIS B CB  1 
ATOM   3865 C CG  . HIS B 1 214 ? 10.405  4.175   35.069  1.00 59.78  ? 420 HIS B CG  1 
ATOM   3866 N ND1 . HIS B 1 214 ? 11.741  3.841   35.132  1.00 58.67  ? 420 HIS B ND1 1 
ATOM   3867 C CD2 . HIS B 1 214 ? 10.191  4.635   33.813  1.00 57.81  ? 420 HIS B CD2 1 
ATOM   3868 C CE1 . HIS B 1 214 ? 12.311  4.092   33.967  1.00 55.33  ? 420 HIS B CE1 1 
ATOM   3869 N NE2 . HIS B 1 214 ? 11.393  4.575   33.149  1.00 57.55  ? 420 HIS B NE2 1 
ATOM   3870 N N   . LEU B 1 215 ? 8.243   6.906   36.899  1.00 56.43  ? 421 LEU B N   1 
ATOM   3871 C CA  . LEU B 1 215 ? 7.917   8.240   36.429  1.00 57.90  ? 421 LEU B CA  1 
ATOM   3872 C C   . LEU B 1 215 ? 8.470   9.262   37.405  1.00 59.97  ? 421 LEU B C   1 
ATOM   3873 O O   . LEU B 1 215 ? 8.682   10.422  37.050  1.00 60.66  ? 421 LEU B O   1 
ATOM   3874 C CB  . LEU B 1 215 ? 6.409   8.428   36.313  1.00 57.91  ? 421 LEU B CB  1 
ATOM   3875 C CG  . LEU B 1 215 ? 5.642   7.454   35.427  1.00 61.09  ? 421 LEU B CG  1 
ATOM   3876 C CD1 . LEU B 1 215 ? 4.232   8.005   35.250  1.00 62.00  ? 421 LEU B CD1 1 
ATOM   3877 C CD2 . LEU B 1 215 ? 6.334   7.279   34.070  1.00 59.19  ? 421 LEU B CD2 1 
ATOM   3878 N N   . GLN B 1 216 ? 8.691   8.840   38.644  1.00 61.49  ? 422 GLN B N   1 
ATOM   3879 C CA  . GLN B 1 216 ? 9.235   9.749   39.639  1.00 63.54  ? 422 GLN B CA  1 
ATOM   3880 C C   . GLN B 1 216 ? 10.697  10.054  39.350  1.00 64.09  ? 422 GLN B C   1 
ATOM   3881 O O   . GLN B 1 216 ? 11.141  11.192  39.485  1.00 64.61  ? 422 GLN B O   1 
ATOM   3882 C CB  . GLN B 1 216 ? 9.079   9.168   41.043  1.00 65.58  ? 422 GLN B CB  1 
ATOM   3883 C CG  . GLN B 1 216 ? 7.717   9.438   41.647  1.00 66.63  ? 422 GLN B CG  1 
ATOM   3884 C CD  . GLN B 1 216 ? 7.585   8.939   43.067  1.00 69.55  ? 422 GLN B CD  1 
ATOM   3885 O OE1 . GLN B 1 216 ? 6.591   9.215   43.731  1.00 70.21  ? 422 GLN B OE1 1 
ATOM   3886 N NE2 . GLN B 1 216 ? 8.583   8.196   43.541  1.00 71.89  ? 422 GLN B NE2 1 
ATOM   3887 N N   . ALA B 1 217 ? 11.439  9.037   38.934  1.00 65.91  ? 423 ALA B N   1 
ATOM   3888 C CA  . ALA B 1 217 ? 12.847  9.211   38.617  1.00 69.14  ? 423 ALA B CA  1 
ATOM   3889 C C   . ALA B 1 217 ? 13.070  9.447   37.124  1.00 72.08  ? 423 ALA B C   1 
ATOM   3890 O O   . ALA B 1 217 ? 14.156  9.179   36.603  1.00 73.01  ? 423 ALA B O   1 
ATOM   3891 C CB  . ALA B 1 217 ? 13.626  7.990   39.067  1.00 70.46  ? 423 ALA B CB  1 
ATOM   3892 N N   . ASN B 1 218 ? 12.052  9.941   36.429  1.00 73.22  ? 424 ASN B N   1 
ATOM   3893 C CA  . ASN B 1 218 ? 12.203  10.188  35.005  1.00 75.96  ? 424 ASN B CA  1 
ATOM   3894 C C   . ASN B 1 218 ? 11.513  11.468  34.558  1.00 77.64  ? 424 ASN B C   1 
ATOM   3895 O O   . ASN B 1 218 ? 12.039  12.195  33.719  1.00 79.07  ? 424 ASN B O   1 
ATOM   3896 C CB  . ASN B 1 218 ? 11.663  9.003   34.201  1.00 79.32  ? 424 ASN B CB  1 
ATOM   3897 C CG  . ASN B 1 218 ? 12.284  8.910   32.815  1.00 82.30  ? 424 ASN B CG  1 
ATOM   3898 O OD1 . ASN B 1 218 ? 12.340  9.892   32.079  1.00 84.45  ? 424 ASN B OD1 1 
ATOM   3899 N ND2 . ASN B 1 218 ? 12.751  7.720   32.454  1.00 83.63  ? 424 ASN B ND2 1 
ATOM   3900 N N   . HIS B 1 219 ? 10.341  11.752  35.111  1.00 77.96  ? 425 HIS B N   1 
ATOM   3901 C CA  . HIS B 1 219 ? 9.621   12.959  34.726  1.00 80.58  ? 425 HIS B CA  1 
ATOM   3902 C C   . HIS B 1 219 ? 9.128   13.759  35.928  1.00 84.13  ? 425 HIS B C   1 
ATOM   3903 O O   . HIS B 1 219 ? 7.924   13.861  36.162  1.00 86.38  ? 425 HIS B O   1 
ATOM   3904 C CB  . HIS B 1 219 ? 8.425   12.601  33.838  1.00 78.34  ? 425 HIS B CB  1 
ATOM   3905 C CG  . HIS B 1 219 ? 8.803   11.948  32.545  1.00 77.13  ? 425 HIS B CG  1 
ATOM   3906 N ND1 . HIS B 1 219 ? 9.390   10.703  32.480  1.00 75.06  ? 425 HIS B ND1 1 
ATOM   3907 C CD2 . HIS B 1 219 ? 8.663   12.365  31.264  1.00 75.44  ? 425 HIS B CD2 1 
ATOM   3908 C CE1 . HIS B 1 219 ? 9.596   10.382  31.216  1.00 74.05  ? 425 HIS B CE1 1 
ATOM   3909 N NE2 . HIS B 1 219 ? 9.164   11.374  30.458  1.00 73.47  ? 425 HIS B NE2 1 
ATOM   3910 N N   . PRO B 1 220 ? 10.050  14.351  36.699  1.00 86.20  ? 426 PRO B N   1 
ATOM   3911 C CA  . PRO B 1 220 ? 9.643   15.132  37.869  1.00 89.15  ? 426 PRO B CA  1 
ATOM   3912 C C   . PRO B 1 220 ? 9.259   16.557  37.505  1.00 91.90  ? 426 PRO B C   1 
ATOM   3913 O O   . PRO B 1 220 ? 10.014  17.483  37.787  1.00 94.91  ? 426 PRO B O   1 
ATOM   3914 C CB  . PRO B 1 220 ? 10.886  15.090  38.739  1.00 87.29  ? 426 PRO B CB  1 
ATOM   3915 C CG  . PRO B 1 220 ? 11.968  15.207  37.718  1.00 85.31  ? 426 PRO B CG  1 
ATOM   3916 C CD  . PRO B 1 220 ? 11.519  14.245  36.631  1.00 85.84  ? 426 PRO B CD  1 
ATOM   3917 N N   . ASP B 1 221 ? 8.094   16.744  36.888  1.00 94.18  ? 427 ASP B N   1 
ATOM   3918 C CA  . ASP B 1 221 ? 7.676   18.090  36.501  1.00 96.04  ? 427 ASP B CA  1 
ATOM   3919 C C   . ASP B 1 221 ? 6.302   18.203  35.830  1.00 96.94  ? 427 ASP B C   1 
ATOM   3920 O O   . ASP B 1 221 ? 6.163   18.884  34.810  1.00 98.13  ? 427 ASP B O   1 
ATOM   3921 C CB  . ASP B 1 221 ? 8.750   18.717  35.592  1.00 96.92  ? 427 ASP B CB  1 
ATOM   3922 C CG  . ASP B 1 221 ? 9.129   17.819  34.415  1.00 97.40  ? 427 ASP B CG  1 
ATOM   3923 O OD1 . ASP B 1 221 ? 8.304   17.668  33.488  1.00 97.67  ? 427 ASP B OD1 1 
ATOM   3924 O OD2 . ASP B 1 221 ? 10.250  17.262  34.418  1.00 95.75  ? 427 ASP B OD2 1 
ATOM   3925 N N   . ALA B 1 222 ? 5.292   17.550  36.403  1.00 97.17  ? 428 ALA B N   1 
ATOM   3926 C CA  . ALA B 1 222 ? 3.932   17.600  35.856  1.00 97.02  ? 428 ALA B CA  1 
ATOM   3927 C C   . ALA B 1 222 ? 2.921   16.938  36.792  1.00 96.37  ? 428 ALA B C   1 
ATOM   3928 O O   . ALA B 1 222 ? 3.156   16.833  37.991  1.00 96.61  ? 428 ALA B O   1 
ATOM   3929 C CB  . ALA B 1 222 ? 3.890   16.928  34.481  1.00 97.10  ? 428 ALA B CB  1 
ATOM   3930 N N   . GLN B 1 223 ? 1.791   16.507  36.238  1.00 96.28  ? 429 GLN B N   1 
ATOM   3931 C CA  . GLN B 1 223 ? 0.750   15.837  37.015  1.00 95.10  ? 429 GLN B CA  1 
ATOM   3932 C C   . GLN B 1 223 ? 0.134   14.709  36.201  1.00 95.07  ? 429 GLN B C   1 
ATOM   3933 O O   . GLN B 1 223 ? -0.585  13.867  36.733  1.00 94.64  ? 429 GLN B O   1 
ATOM   3934 C CB  . GLN B 1 223 ? -0.342  16.824  37.434  1.00 94.80  ? 429 GLN B CB  1 
ATOM   3935 C CG  . GLN B 1 223 ? -1.553  16.163  38.072  1.00 93.40  ? 429 GLN B CG  1 
ATOM   3936 C CD  . GLN B 1 223 ? -2.494  17.150  38.730  1.00 93.92  ? 429 GLN B CD  1 
ATOM   3937 O OE1 . GLN B 1 223 ? -3.576  16.777  39.186  1.00 91.95  ? 429 GLN B OE1 1 
ATOM   3938 N NE2 . GLN B 1 223 ? -2.085  18.415  38.791  1.00 94.01  ? 429 GLN B NE2 1 
ATOM   3939 N N   . TYR B 1 224 ? 0.414   14.707  34.902  1.00 95.39  ? 430 TYR B N   1 
ATOM   3940 C CA  . TYR B 1 224 ? -0.090  13.671  34.003  1.00 94.99  ? 430 TYR B CA  1 
ATOM   3941 C C   . TYR B 1 224 ? 0.407   12.361  34.581  1.00 92.52  ? 430 TYR B C   1 
ATOM   3942 O O   . TYR B 1 224 ? -0.247  11.318  34.498  1.00 90.89  ? 430 TYR B O   1 
ATOM   3943 C CB  . TYR B 1 224 ? 0.500   13.853  32.595  1.00 98.02  ? 430 TYR B CB  1 
ATOM   3944 C CG  . TYR B 1 224 ? 1.960   13.433  32.480  1.00 99.40  ? 430 TYR B CG  1 
ATOM   3945 C CD1 . TYR B 1 224 ? 2.316   12.083  32.371  1.00 97.94  ? 430 TYR B CD1 1 
ATOM   3946 C CD2 . TYR B 1 224 ? 2.985   14.378  32.545  1.00 99.29  ? 430 TYR B CD2 1 
ATOM   3947 C CE1 . TYR B 1 224 ? 3.645   11.690  32.336  1.00 95.74  ? 430 TYR B CE1 1 
ATOM   3948 C CE2 . TYR B 1 224 ? 4.321   13.990  32.510  1.00 97.75  ? 430 TYR B CE2 1 
ATOM   3949 C CZ  . TYR B 1 224 ? 4.637   12.646  32.409  1.00 96.37  ? 430 TYR B CZ  1 
ATOM   3950 O OH  . TYR B 1 224 ? 5.951   12.258  32.403  1.00 96.76  ? 430 TYR B OH  1 
ATOM   3951 N N   . LEU B 1 225 ? 1.601   12.455  35.151  1.00 89.98  ? 431 LEU B N   1 
ATOM   3952 C CA  . LEU B 1 225 ? 2.289   11.342  35.766  1.00 89.29  ? 431 LEU B CA  1 
ATOM   3953 C C   . LEU B 1 225 ? 1.340   10.351  36.428  1.00 86.44  ? 431 LEU B C   1 
ATOM   3954 O O   . LEU B 1 225 ? 0.957   10.530  37.583  1.00 89.16  ? 431 LEU B O   1 
ATOM   3955 C CB  . LEU B 1 225 ? 3.289   11.881  36.794  1.00 92.92  ? 431 LEU B CB  1 
ATOM   3956 C CG  . LEU B 1 225 ? 4.432   12.721  36.213  1.00 96.09  ? 431 LEU B CG  1 
ATOM   3957 C CD1 . LEU B 1 225 ? 5.206   13.423  37.311  1.00 95.57  ? 431 LEU B CD1 1 
ATOM   3958 C CD2 . LEU B 1 225 ? 5.355   11.812  35.417  1.00 99.20  ? 431 LEU B CD2 1 
ATOM   3959 N N   . PHE B 1 226 ? 0.958   9.321   35.680  1.00 79.37  ? 432 PHE B N   1 
ATOM   3960 C CA  . PHE B 1 226 ? 0.087   8.262   36.169  1.00 71.50  ? 432 PHE B CA  1 
ATOM   3961 C C   . PHE B 1 226 ? -1.411  8.466   35.961  1.00 67.07  ? 432 PHE B C   1 
ATOM   3962 O O   . PHE B 1 226 ? -2.037  7.701   35.235  1.00 65.86  ? 432 PHE B O   1 
ATOM   3963 C CB  . PHE B 1 226 ? 0.367   7.984   37.647  1.00 70.99  ? 432 PHE B CB  1 
ATOM   3964 C CG  . PHE B 1 226 ? 0.453   6.532   37.975  1.00 71.53  ? 432 PHE B CG  1 
ATOM   3965 C CD1 . PHE B 1 226 ? 1.597   5.802   37.652  1.00 68.14  ? 432 PHE B CD1 1 
ATOM   3966 C CD2 . PHE B 1 226 ? -0.624  5.877   38.579  1.00 70.59  ? 432 PHE B CD2 1 
ATOM   3967 C CE1 . PHE B 1 226 ? 1.669   4.438   37.926  1.00 68.83  ? 432 PHE B CE1 1 
ATOM   3968 C CE2 . PHE B 1 226 ? -0.567  4.513   38.859  1.00 70.67  ? 432 PHE B CE2 1 
ATOM   3969 C CZ  . PHE B 1 226 ? 0.584   3.788   38.532  1.00 70.54  ? 432 PHE B CZ  1 
ATOM   3970 N N   . PRO B 1 227 ? -2.018  9.482   36.596  1.00 64.02  ? 433 PRO B N   1 
ATOM   3971 C CA  . PRO B 1 227 ? -3.454  9.599   36.340  1.00 62.40  ? 433 PRO B CA  1 
ATOM   3972 C C   . PRO B 1 227 ? -3.762  9.794   34.859  1.00 61.53  ? 433 PRO B C   1 
ATOM   3973 O O   . PRO B 1 227 ? -4.622  9.109   34.303  1.00 61.23  ? 433 PRO B O   1 
ATOM   3974 C CB  . PRO B 1 227 ? -3.860  10.802  37.192  1.00 61.50  ? 433 PRO B CB  1 
ATOM   3975 C CG  . PRO B 1 227 ? -2.910  10.730  38.336  1.00 60.78  ? 433 PRO B CG  1 
ATOM   3976 C CD  . PRO B 1 227 ? -1.604  10.435  37.641  1.00 61.48  ? 433 PRO B CD  1 
ATOM   3977 N N   . LYS B 1 228 ? -3.058  10.724  34.223  1.00 60.73  ? 434 LYS B N   1 
ATOM   3978 C CA  . LYS B 1 228 ? -3.280  10.986  32.810  1.00 61.34  ? 434 LYS B CA  1 
ATOM   3979 C C   . LYS B 1 228 ? -2.859  9.791   31.973  1.00 58.36  ? 434 LYS B C   1 
ATOM   3980 O O   . LYS B 1 228 ? -3.458  9.514   30.935  1.00 59.75  ? 434 LYS B O   1 
ATOM   3981 C CB  . LYS B 1 228 ? -2.526  12.242  32.361  1.00 65.63  ? 434 LYS B CB  1 
ATOM   3982 C CG  . LYS B 1 228 ? -3.162  13.549  32.841  1.00 70.31  ? 434 LYS B CG  1 
ATOM   3983 C CD  . LYS B 1 228 ? -2.572  14.766  32.131  1.00 74.56  ? 434 LYS B CD  1 
ATOM   3984 C CE  . LYS B 1 228 ? -2.793  14.712  30.613  1.00 79.73  ? 434 LYS B CE  1 
ATOM   3985 N NZ  . LYS B 1 228 ? -4.241  14.684  30.216  1.00 81.23  ? 434 LYS B NZ  1 
ATOM   3986 N N   . LEU B 1 229 ? -1.840  9.074   32.434  1.00 53.68  ? 435 LEU B N   1 
ATOM   3987 C CA  . LEU B 1 229 ? -1.361  7.902   31.718  1.00 48.43  ? 435 LEU B CA  1 
ATOM   3988 C C   . LEU B 1 229 ? -2.338  6.749   31.948  1.00 48.82  ? 435 LEU B C   1 
ATOM   3989 O O   . LEU B 1 229 ? -2.501  5.879   31.097  1.00 46.42  ? 435 LEU B O   1 
ATOM   3990 C CB  . LEU B 1 229 ? 0.045   7.545   32.192  1.00 41.38  ? 435 LEU B CB  1 
ATOM   3991 C CG  . LEU B 1 229 ? 0.954   6.871   31.166  1.00 41.70  ? 435 LEU B CG  1 
ATOM   3992 C CD1 . LEU B 1 229 ? 0.816   7.572   29.825  1.00 42.02  ? 435 LEU B CD1 1 
ATOM   3993 C CD2 . LEU B 1 229 ? 2.399   6.902   31.641  1.00 35.87  ? 435 LEU B CD2 1 
ATOM   3994 N N   . LEU B 1 230 ? -3.007  6.766   33.096  1.00 49.84  ? 436 LEU B N   1 
ATOM   3995 C CA  . LEU B 1 230 ? -4.003  5.747   33.423  1.00 51.36  ? 436 LEU B CA  1 
ATOM   3996 C C   . LEU B 1 230 ? -5.275  6.028   32.626  1.00 50.14  ? 436 LEU B C   1 
ATOM   3997 O O   . LEU B 1 230 ? -6.018  5.108   32.284  1.00 48.43  ? 436 LEU B O   1 
ATOM   3998 C CB  . LEU B 1 230 ? -4.331  5.754   34.921  1.00 50.92  ? 436 LEU B CB  1 
ATOM   3999 C CG  . LEU B 1 230 ? -3.935  4.506   35.722  1.00 54.71  ? 436 LEU B CG  1 
ATOM   4000 C CD1 . LEU B 1 230 ? -4.542  3.264   35.075  1.00 56.89  ? 436 LEU B CD1 1 
ATOM   4001 C CD2 . LEU B 1 230 ? -2.428  4.375   35.779  1.00 54.99  ? 436 LEU B CD2 1 
ATOM   4002 N N   . GLN B 1 231 ? -5.517  7.305   32.333  1.00 50.45  ? 437 GLN B N   1 
ATOM   4003 C CA  . GLN B 1 231 ? -6.693  7.699   31.566  1.00 52.34  ? 437 GLN B CA  1 
ATOM   4004 C C   . GLN B 1 231 ? -6.482  7.332   30.098  1.00 52.07  ? 437 GLN B C   1 
ATOM   4005 O O   . GLN B 1 231 ? -7.439  7.011   29.387  1.00 51.50  ? 437 GLN B O   1 
ATOM   4006 C CB  . GLN B 1 231 ? -6.942  9.204   31.701  1.00 53.67  ? 437 GLN B CB  1 
ATOM   4007 C CG  . GLN B 1 231 ? -8.139  9.734   30.901  1.00 58.62  ? 437 GLN B CG  1 
ATOM   4008 C CD  . GLN B 1 231 ? -9.474  9.122   31.312  1.00 61.13  ? 437 GLN B CD  1 
ATOM   4009 O OE1 . GLN B 1 231 ? -9.680  7.911   31.198  1.00 62.92  ? 437 GLN B OE1 1 
ATOM   4010 N NE2 . GLN B 1 231 ? -10.390 9.963   31.786  1.00 63.33  ? 437 GLN B NE2 1 
ATOM   4011 N N   . LYS B 1 232 ? -5.230  7.386   29.647  1.00 50.51  ? 438 LYS B N   1 
ATOM   4012 C CA  . LYS B 1 232 ? -4.900  7.031   28.272  1.00 49.62  ? 438 LYS B CA  1 
ATOM   4013 C C   . LYS B 1 232 ? -5.225  5.560   28.089  1.00 48.81  ? 438 LYS B C   1 
ATOM   4014 O O   . LYS B 1 232 ? -5.819  5.174   27.093  1.00 51.43  ? 438 LYS B O   1 
ATOM   4015 C CB  . LYS B 1 232 ? -3.427  7.279   28.004  1.00 48.62  ? 438 LYS B CB  1 
ATOM   4016 C CG  . LYS B 1 232 ? -3.067  8.750   27.948  1.00 50.82  ? 438 LYS B CG  1 
ATOM   4017 C CD  . LYS B 1 232 ? -3.530  9.368   26.652  1.00 52.10  ? 438 LYS B CD  1 
ATOM   4018 C CE  . LYS B 1 232 ? -3.378  10.872  26.658  1.00 50.58  ? 438 LYS B CE  1 
ATOM   4019 N NZ  . LYS B 1 232 ? -4.415  11.497  27.530  1.00 53.71  ? 438 LYS B NZ  1 
ATOM   4020 N N   . MET B 1 233 ? -4.853  4.744   29.069  1.00 49.94  ? 439 MET B N   1 
ATOM   4021 C CA  . MET B 1 233 ? -5.148  3.316   29.017  1.00 49.31  ? 439 MET B CA  1 
ATOM   4022 C C   . MET B 1 233 ? -6.648  3.151   28.797  1.00 47.02  ? 439 MET B C   1 
ATOM   4023 O O   . MET B 1 233 ? -7.074  2.265   28.065  1.00 50.56  ? 439 MET B O   1 
ATOM   4024 C CB  . MET B 1 233 ? -4.740  2.616   30.323  1.00 51.62  ? 439 MET B CB  1 
ATOM   4025 C CG  . MET B 1 233 ? -3.232  2.544   30.572  1.00 53.26  ? 439 MET B CG  1 
ATOM   4026 S SD  . MET B 1 233 ? -2.806  1.888   32.209  1.00 50.83  ? 439 MET B SD  1 
ATOM   4027 C CE  . MET B 1 233 ? -2.678  0.127   31.826  1.00 54.87  ? 439 MET B CE  1 
ATOM   4028 N N   . ALA B 1 234 ? -7.451  3.997   29.437  1.00 45.36  ? 440 ALA B N   1 
ATOM   4029 C CA  . ALA B 1 234 ? -8.906  3.935   29.265  1.00 43.46  ? 440 ALA B CA  1 
ATOM   4030 C C   . ALA B 1 234 ? -9.267  4.439   27.870  1.00 44.94  ? 440 ALA B C   1 
ATOM   4031 O O   . ALA B 1 234 ? -10.143 3.895   27.204  1.00 45.65  ? 440 ALA B O   1 
ATOM   4032 C CB  . ALA B 1 234 ? -9.599  4.788   30.310  1.00 35.69  ? 440 ALA B CB  1 
ATOM   4033 N N   . ASP B 1 235 ? -8.583  5.489   27.434  1.00 46.36  ? 441 ASP B N   1 
ATOM   4034 C CA  . ASP B 1 235 ? -8.830  6.069   26.128  1.00 49.21  ? 441 ASP B CA  1 
ATOM   4035 C C   . ASP B 1 235 ? -8.574  5.022   25.068  1.00 49.71  ? 441 ASP B C   1 
ATOM   4036 O O   . ASP B 1 235 ? -9.353  4.877   24.123  1.00 49.53  ? 441 ASP B O   1 
ATOM   4037 C CB  . ASP B 1 235 ? -7.910  7.274   25.888  1.00 51.86  ? 441 ASP B CB  1 
ATOM   4038 C CG  . ASP B 1 235 ? -8.062  8.353   26.951  1.00 53.17  ? 441 ASP B CG  1 
ATOM   4039 O OD1 . ASP B 1 235 ? -9.187  8.525   27.471  1.00 51.39  ? 441 ASP B OD1 1 
ATOM   4040 O OD2 . ASP B 1 235 ? -7.057  9.036   27.250  1.00 49.86  ? 441 ASP B OD2 1 
ATOM   4041 N N   . LEU B 1 236 ? -7.466  4.307   25.244  1.00 48.55  ? 442 LEU B N   1 
ATOM   4042 C CA  . LEU B 1 236 ? -7.035  3.240   24.348  1.00 48.40  ? 442 LEU B CA  1 
ATOM   4043 C C   . LEU B 1 236 ? -8.070  2.119   24.282  1.00 49.68  ? 442 LEU B C   1 
ATOM   4044 O O   . LEU B 1 236 ? -8.293  1.521   23.230  1.00 49.26  ? 442 LEU B O   1 
ATOM   4045 C CB  . LEU B 1 236 ? -5.703  2.670   24.841  1.00 46.78  ? 442 LEU B CB  1 
ATOM   4046 C CG  . LEU B 1 236 ? -4.416  3.338   24.365  1.00 45.20  ? 442 LEU B CG  1 
ATOM   4047 C CD1 . LEU B 1 236 ? -3.218  2.736   25.085  1.00 45.16  ? 442 LEU B CD1 1 
ATOM   4048 C CD2 . LEU B 1 236 ? -4.284  3.137   22.873  1.00 38.70  ? 442 LEU B CD2 1 
ATOM   4049 N N   . ARG B 1 237 ? -8.684  1.824   25.420  1.00 49.85  ? 443 ARG B N   1 
ATOM   4050 C CA  . ARG B 1 237 ? -9.689  0.780   25.483  1.00 51.75  ? 443 ARG B CA  1 
ATOM   4051 C C   . ARG B 1 237 ? -10.821 1.100   24.516  1.00 51.59  ? 443 ARG B C   1 
ATOM   4052 O O   . ARG B 1 237 ? -11.336 0.208   23.839  1.00 52.70  ? 443 ARG B O   1 
ATOM   4053 C CB  . ARG B 1 237 ? -10.240 0.667   26.903  1.00 55.81  ? 443 ARG B CB  1 
ATOM   4054 C CG  . ARG B 1 237 ? -11.277 -0.442  27.076  1.00 61.59  ? 443 ARG B CG  1 
ATOM   4055 C CD  . ARG B 1 237 ? -10.628 -1.814  27.130  1.00 65.71  ? 443 ARG B CD  1 
ATOM   4056 N NE  . ARG B 1 237 ? -9.961  -2.050  28.409  1.00 68.09  ? 443 ARG B NE  1 
ATOM   4057 C CZ  . ARG B 1 237 ? -10.598 -2.223  29.564  1.00 69.91  ? 443 ARG B CZ  1 
ATOM   4058 N NH1 . ARG B 1 237 ? -11.924 -2.190  29.607  1.00 72.26  ? 443 ARG B NH1 1 
ATOM   4059 N NH2 . ARG B 1 237 ? -9.910  -2.434  30.678  1.00 68.46  ? 443 ARG B NH2 1 
ATOM   4060 N N   . GLN B 1 238 ? -11.206 2.377   24.463  1.00 51.05  ? 444 GLN B N   1 
ATOM   4061 C CA  . GLN B 1 238 ? -12.281 2.857   23.585  1.00 45.95  ? 444 GLN B CA  1 
ATOM   4062 C C   . GLN B 1 238 ? -11.840 2.877   22.127  1.00 41.92  ? 444 GLN B C   1 
ATOM   4063 O O   . GLN B 1 238 ? -12.600 2.517   21.236  1.00 40.51  ? 444 GLN B O   1 
ATOM   4064 C CB  . GLN B 1 238 ? -12.711 4.272   23.990  1.00 50.25  ? 444 GLN B CB  1 
ATOM   4065 C CG  . GLN B 1 238 ? -13.850 4.869   23.145  1.00 56.79  ? 444 GLN B CG  1 
ATOM   4066 C CD  . GLN B 1 238 ? -13.926 6.393   23.246  1.00 60.32  ? 444 GLN B CD  1 
ATOM   4067 O OE1 . GLN B 1 238 ? -14.889 7.019   22.795  1.00 63.18  ? 444 GLN B OE1 1 
ATOM   4068 N NE2 . GLN B 1 238 ? -12.900 6.994   23.833  1.00 63.78  ? 444 GLN B NE2 1 
ATOM   4069 N N   . LEU B 1 239 ? -10.605 3.303   21.893  1.00 40.32  ? 445 LEU B N   1 
ATOM   4070 C CA  . LEU B 1 239 ? -10.068 3.371   20.543  1.00 40.13  ? 445 LEU B CA  1 
ATOM   4071 C C   . LEU B 1 239 ? -10.177 1.987   19.924  1.00 40.94  ? 445 LEU B C   1 
ATOM   4072 O O   . LEU B 1 239 ? -10.528 1.838   18.753  1.00 43.56  ? 445 LEU B O   1 
ATOM   4073 C CB  . LEU B 1 239 ? -8.601  3.804   20.573  1.00 39.13  ? 445 LEU B CB  1 
ATOM   4074 C CG  . LEU B 1 239 ? -8.003  4.614   19.414  1.00 40.77  ? 445 LEU B CG  1 
ATOM   4075 C CD1 . LEU B 1 239 ? -6.511  4.294   19.347  1.00 44.30  ? 445 LEU B CD1 1 
ATOM   4076 C CD2 . LEU B 1 239 ? -8.657  4.283   18.087  1.00 39.03  ? 445 LEU B CD2 1 
ATOM   4077 N N   . VAL B 1 240 ? -9.871  0.965   20.710  1.00 39.91  ? 446 VAL B N   1 
ATOM   4078 C CA  . VAL B 1 240 ? -9.955  -0.388  20.195  1.00 41.16  ? 446 VAL B CA  1 
ATOM   4079 C C   . VAL B 1 240 ? -11.400 -0.802  19.927  1.00 43.31  ? 446 VAL B C   1 
ATOM   4080 O O   . VAL B 1 240 ? -11.695 -1.342  18.865  1.00 44.76  ? 446 VAL B O   1 
ATOM   4081 C CB  . VAL B 1 240 ? -9.273  -1.398  21.142  1.00 38.06  ? 446 VAL B CB  1 
ATOM   4082 C CG1 . VAL B 1 240 ? -9.680  -2.831  20.779  1.00 37.77  ? 446 VAL B CG1 1 
ATOM   4083 C CG2 . VAL B 1 240 ? -7.770  -1.251  21.027  1.00 34.27  ? 446 VAL B CG2 1 
ATOM   4084 N N   . THR B 1 241 ? -12.296 -0.549  20.874  1.00 45.35  ? 447 THR B N   1 
ATOM   4085 C CA  . THR B 1 241 ? -13.707 -0.891  20.693  1.00 49.46  ? 447 THR B CA  1 
ATOM   4086 C C   . THR B 1 241 ? -14.234 -0.307  19.381  1.00 52.20  ? 447 THR B C   1 
ATOM   4087 O O   . THR B 1 241 ? -14.883 -1.002  18.589  1.00 51.50  ? 447 THR B O   1 
ATOM   4088 C CB  . THR B 1 241 ? -14.556 -0.344  21.852  1.00 51.07  ? 447 THR B CB  1 
ATOM   4089 O OG1 . THR B 1 241 ? -14.477 -1.248  22.961  1.00 54.93  ? 447 THR B OG1 1 
ATOM   4090 C CG2 . THR B 1 241 ? -16.003 -0.168  21.429  1.00 49.81  ? 447 THR B CG2 1 
ATOM   4091 N N   . GLU B 1 242 ? -13.952 0.977   19.174  1.00 51.15  ? 448 GLU B N   1 
ATOM   4092 C CA  . GLU B 1 242 ? -14.353 1.694   17.980  1.00 51.02  ? 448 GLU B CA  1 
ATOM   4093 C C   . GLU B 1 242 ? -13.655 1.036   16.796  1.00 50.84  ? 448 GLU B C   1 
ATOM   4094 O O   . GLU B 1 242 ? -14.240 0.829   15.731  1.00 50.27  ? 448 GLU B O   1 
ATOM   4095 C CB  . GLU B 1 242 ? -13.923 3.156   18.105  1.00 56.24  ? 448 GLU B CB  1 
ATOM   4096 C CG  . GLU B 1 242 ? -13.884 3.923   16.790  1.00 65.97  ? 448 GLU B CG  1 
ATOM   4097 C CD  . GLU B 1 242 ? -13.103 5.232   16.889  1.00 71.00  ? 448 GLU B CD  1 
ATOM   4098 O OE1 . GLU B 1 242 ? -13.605 6.174   17.538  1.00 73.34  ? 448 GLU B OE1 1 
ATOM   4099 O OE2 . GLU B 1 242 ? -11.985 5.318   16.325  1.00 73.56  ? 448 GLU B OE2 1 
ATOM   4100 N N   . HIS B 1 243 ? -12.386 0.710   16.991  1.00 49.47  ? 449 HIS B N   1 
ATOM   4101 C CA  . HIS B 1 243 ? -11.616 0.070   15.941  1.00 45.51  ? 449 HIS B CA  1 
ATOM   4102 C C   . HIS B 1 243 ? -12.238 -1.275  15.565  1.00 43.18  ? 449 HIS B C   1 
ATOM   4103 O O   . HIS B 1 243 ? -12.396 -1.577  14.394  1.00 42.22  ? 449 HIS B O   1 
ATOM   4104 C CB  . HIS B 1 243 ? -10.163 -0.129  16.386  1.00 44.46  ? 449 HIS B CB  1 
ATOM   4105 C CG  . HIS B 1 243 ? -9.289  -0.715  15.322  1.00 44.52  ? 449 HIS B CG  1 
ATOM   4106 N ND1 . HIS B 1 243 ? -9.075  -0.088  14.112  1.00 41.95  ? 449 HIS B ND1 1 
ATOM   4107 C CD2 . HIS B 1 243 ? -8.628  -1.896  15.258  1.00 42.95  ? 449 HIS B CD2 1 
ATOM   4108 C CE1 . HIS B 1 243 ? -8.325  -0.862  13.347  1.00 41.38  ? 449 HIS B CE1 1 
ATOM   4109 N NE2 . HIS B 1 243 ? -8.041  -1.964  14.018  1.00 41.77  ? 449 HIS B NE2 1 
ATOM   4110 N N   . ALA B 1 244 ? -12.588 -2.082  16.557  1.00 43.62  ? 450 ALA B N   1 
ATOM   4111 C CA  . ALA B 1 244 ? -13.181 -3.380  16.281  1.00 44.79  ? 450 ALA B CA  1 
ATOM   4112 C C   . ALA B 1 244 ? -14.501 -3.205  15.547  1.00 46.95  ? 450 ALA B C   1 
ATOM   4113 O O   . ALA B 1 244 ? -14.844 -3.994  14.668  1.00 48.86  ? 450 ALA B O   1 
ATOM   4114 C CB  . ALA B 1 244 ? -13.394 -4.137  17.567  1.00 41.79  ? 450 ALA B CB  1 
ATOM   4115 N N   . GLN B 1 245 ? -15.236 -2.156  15.893  1.00 49.77  ? 451 GLN B N   1 
ATOM   4116 C CA  . GLN B 1 245 ? -16.524 -1.899  15.253  1.00 51.81  ? 451 GLN B CA  1 
ATOM   4117 C C   . GLN B 1 245 ? -16.356 -1.673  13.760  1.00 50.11  ? 451 GLN B C   1 
ATOM   4118 O O   . GLN B 1 245 ? -17.062 -2.272  12.951  1.00 47.12  ? 451 GLN B O   1 
ATOM   4119 C CB  . GLN B 1 245 ? -17.209 -0.698  15.904  1.00 55.01  ? 451 GLN B CB  1 
ATOM   4120 C CG  . GLN B 1 245 ? -17.644 -0.968  17.339  1.00 59.32  ? 451 GLN B CG  1 
ATOM   4121 C CD  . GLN B 1 245 ? -18.264 0.241   18.015  1.00 63.00  ? 451 GLN B CD  1 
ATOM   4122 O OE1 . GLN B 1 245 ? -18.669 0.173   19.175  1.00 64.31  ? 451 GLN B OE1 1 
ATOM   4123 N NE2 . GLN B 1 245 ? -18.339 1.357   17.293  1.00 64.83  ? 451 GLN B NE2 1 
ATOM   4124 N N   . MET B 1 246 ? -15.406 -0.816  13.403  1.00 49.87  ? 452 MET B N   1 
ATOM   4125 C CA  . MET B 1 246 ? -15.126 -0.528  12.005  1.00 50.76  ? 452 MET B CA  1 
ATOM   4126 C C   . MET B 1 246 ? -14.661 -1.796  11.283  1.00 49.96  ? 452 MET B C   1 
ATOM   4127 O O   . MET B 1 246 ? -14.988 -2.006  10.116  1.00 51.04  ? 452 MET B O   1 
ATOM   4128 C CB  . MET B 1 246 ? -14.050 0.561   11.885  1.00 54.27  ? 452 MET B CB  1 
ATOM   4129 C CG  . MET B 1 246 ? -14.525 1.983   12.179  1.00 59.51  ? 452 MET B CG  1 
ATOM   4130 S SD  . MET B 1 246 ? -13.222 3.246   11.962  1.00 67.47  ? 452 MET B SD  1 
ATOM   4131 C CE  . MET B 1 246 ? -13.130 3.955   13.569  1.00 59.63  ? 452 MET B CE  1 
ATOM   4132 N N   . MET B 1 247 ? -13.907 -2.645  11.974  1.00 49.61  ? 453 MET B N   1 
ATOM   4133 C CA  . MET B 1 247 ? -13.417 -3.878  11.361  1.00 53.38  ? 453 MET B CA  1 
ATOM   4134 C C   . MET B 1 247 ? -14.535 -4.824  10.930  1.00 54.54  ? 453 MET B C   1 
ATOM   4135 O O   . MET B 1 247 ? -14.512 -5.333  9.811   1.00 52.68  ? 453 MET B O   1 
ATOM   4136 C CB  . MET B 1 247 ? -12.447 -4.621  12.300  1.00 52.20  ? 453 MET B CB  1 
ATOM   4137 C CG  . MET B 1 247 ? -11.026 -4.047  12.337  1.00 55.24  ? 453 MET B CG  1 
ATOM   4138 S SD  . MET B 1 247 ? -10.166 -4.100  10.735  1.00 58.94  ? 453 MET B SD  1 
ATOM   4139 C CE  . MET B 1 247 ? -10.835 -2.757  9.976   1.00 56.03  ? 453 MET B CE  1 
ATOM   4140 N N   . GLN B 1 248 ? -15.503 -5.066  11.814  1.00 57.29  ? 454 GLN B N   1 
ATOM   4141 C CA  . GLN B 1 248 ? -16.612 -5.960  11.491  1.00 59.98  ? 454 GLN B CA  1 
ATOM   4142 C C   . GLN B 1 248 ? -17.398 -5.448  10.280  1.00 58.48  ? 454 GLN B C   1 
ATOM   4143 O O   . GLN B 1 248 ? -17.641 -6.205  9.341   1.00 55.90  ? 454 GLN B O   1 
ATOM   4144 C CB  . GLN B 1 248 ? -17.547 -6.124  12.700  1.00 65.86  ? 454 GLN B CB  1 
ATOM   4145 C CG  . GLN B 1 248 ? -18.191 -4.827  13.195  1.00 74.43  ? 454 GLN B CG  1 
ATOM   4146 C CD  . GLN B 1 248 ? -19.113 -5.030  14.397  1.00 79.05  ? 454 GLN B CD  1 
ATOM   4147 O OE1 . GLN B 1 248 ? -18.712 -5.603  15.414  1.00 81.50  ? 454 GLN B OE1 1 
ATOM   4148 N NE2 . GLN B 1 248 ? -20.349 -4.548  14.286  1.00 78.91  ? 454 GLN B NE2 1 
ATOM   4149 N N   . ARG B 1 249 ? -17.776 -4.168  10.304  1.00 56.93  ? 455 ARG B N   1 
ATOM   4150 C CA  . ARG B 1 249 ? -18.531 -3.548  9.216   1.00 54.92  ? 455 ARG B CA  1 
ATOM   4151 C C   . ARG B 1 249 ? -17.776 -3.665  7.903   1.00 56.08  ? 455 ARG B C   1 
ATOM   4152 O O   . ARG B 1 249 ? -18.362 -3.998  6.881   1.00 57.56  ? 455 ARG B O   1 
ATOM   4153 C CB  . ARG B 1 249 ? -18.804 -2.092  9.528   1.00 52.77  ? 455 ARG B CB  1 
ATOM   4154 N N   . ILE B 1 250 ? -16.479 -3.377  7.921   1.00 55.54  ? 456 ILE B N   1 
ATOM   4155 C CA  . ILE B 1 250 ? -15.678 -3.503  6.709   1.00 55.43  ? 456 ILE B CA  1 
ATOM   4156 C C   . ILE B 1 250 ? -15.828 -4.937  6.199   1.00 57.48  ? 456 ILE B C   1 
ATOM   4157 O O   . ILE B 1 250 ? -16.108 -5.173  5.026   1.00 58.24  ? 456 ILE B O   1 
ATOM   4158 C CB  . ILE B 1 250 ? -14.183 -3.224  6.997   1.00 55.13  ? 456 ILE B CB  1 
ATOM   4159 C CG1 . ILE B 1 250 ? -13.956 -1.721  7.174   1.00 53.67  ? 456 ILE B CG1 1 
ATOM   4160 C CG2 . ILE B 1 250 ? -13.315 -3.788  5.877   1.00 54.96  ? 456 ILE B CG2 1 
ATOM   4161 C CD1 . ILE B 1 250 ? -12.500 -1.340  7.470   1.00 52.02  ? 456 ILE B CD1 1 
ATOM   4162 N N   . LYS B 1 251 ? -15.658 -5.892  7.101   1.00 58.14  ? 457 LYS B N   1 
ATOM   4163 C CA  . LYS B 1 251 ? -15.766 -7.304  6.771   1.00 60.13  ? 457 LYS B CA  1 
ATOM   4164 C C   . LYS B 1 251 ? -17.148 -7.663  6.237   1.00 61.77  ? 457 LYS B C   1 
ATOM   4165 O O   . LYS B 1 251 ? -17.297 -8.629  5.492   1.00 61.93  ? 457 LYS B O   1 
ATOM   4166 C CB  . LYS B 1 251 ? -15.448 -8.126  8.024   1.00 60.33  ? 457 LYS B CB  1 
ATOM   4167 C CG  . LYS B 1 251 ? -15.606 -9.638  7.898   1.00 58.85  ? 457 LYS B CG  1 
ATOM   4168 C CD  . LYS B 1 251 ? -17.026 -10.074 8.206   1.00 57.87  ? 457 LYS B CD  1 
ATOM   4169 C CE  . LYS B 1 251 ? -17.117 -11.577 8.397   1.00 57.79  ? 457 LYS B CE  1 
ATOM   4170 N NZ  . LYS B 1 251 ? -16.331 -12.031 9.571   1.00 52.78  ? 457 LYS B NZ  1 
ATOM   4171 N N   . LYS B 1 252 ? -18.149 -6.871  6.619   1.00 62.95  ? 458 LYS B N   1 
ATOM   4172 C CA  . LYS B 1 252 ? -19.540 -7.093  6.220   1.00 63.07  ? 458 LYS B CA  1 
ATOM   4173 C C   . LYS B 1 252 ? -19.937 -6.433  4.916   1.00 63.77  ? 458 LYS B C   1 
ATOM   4174 O O   . LYS B 1 252 ? -20.872 -6.884  4.259   1.00 65.12  ? 458 LYS B O   1 
ATOM   4175 C CB  . LYS B 1 252 ? -20.482 -6.612  7.322   1.00 61.46  ? 458 LYS B CB  1 
ATOM   4176 N N   . THR B 1 253 ? -19.243 -5.365  4.541   1.00 63.87  ? 459 THR B N   1 
ATOM   4177 C CA  . THR B 1 253 ? -19.582 -4.660  3.317   1.00 63.38  ? 459 THR B CA  1 
ATOM   4178 C C   . THR B 1 253 ? -18.472 -4.665  2.279   1.00 64.64  ? 459 THR B C   1 
ATOM   4179 O O   . THR B 1 253 ? -18.728 -4.451  1.097   1.00 67.47  ? 459 THR B O   1 
ATOM   4180 C CB  . THR B 1 253 ? -19.982 -3.205  3.619   1.00 59.72  ? 459 THR B CB  1 
ATOM   4181 O OG1 . THR B 1 253 ? -18.857 -2.490  4.143   1.00 60.48  ? 459 THR B OG1 1 
ATOM   4182 C CG2 . THR B 1 253 ? -21.109 -3.179  4.633   1.00 57.38  ? 459 THR B CG2 1 
ATOM   4183 N N   . GLU B 1 254 ? -17.244 -4.916  2.712   1.00 66.33  ? 460 GLU B N   1 
ATOM   4184 C CA  . GLU B 1 254 ? -16.111 -4.934  1.795   1.00 67.56  ? 460 GLU B CA  1 
ATOM   4185 C C   . GLU B 1 254 ? -15.680 -6.344  1.399   1.00 68.33  ? 460 GLU B C   1 
ATOM   4186 O O   . GLU B 1 254 ? -14.489 -6.610  1.220   1.00 67.66  ? 460 GLU B O   1 
ATOM   4187 C CB  . GLU B 1 254 ? -14.926 -4.194  2.415   1.00 67.17  ? 460 GLU B CB  1 
ATOM   4188 C CG  . GLU B 1 254 ? -15.123 -2.711  2.496   1.00 68.16  ? 460 GLU B CG  1 
ATOM   4189 C CD  . GLU B 1 254 ? -15.328 -2.106  1.135   1.00 68.30  ? 460 GLU B CD  1 
ATOM   4190 O OE1 . GLU B 1 254 ? -14.531 -2.432  0.232   1.00 67.65  ? 460 GLU B OE1 1 
ATOM   4191 O OE2 . GLU B 1 254 ? -16.276 -1.307  0.969   1.00 69.00  ? 460 GLU B OE2 1 
ATOM   4192 N N   . THR B 1 255 ? -16.659 -7.233  1.258   1.00 69.80  ? 461 THR B N   1 
ATOM   4193 C CA  . THR B 1 255 ? -16.424 -8.624  0.887   1.00 70.27  ? 461 THR B CA  1 
ATOM   4194 C C   . THR B 1 255 ? -15.201 -8.805  0.000   1.00 72.22  ? 461 THR B C   1 
ATOM   4195 O O   . THR B 1 255 ? -14.513 -9.823  0.086   1.00 73.98  ? 461 THR B O   1 
ATOM   4196 C CB  . THR B 1 255 ? -17.623 -9.178  0.149   1.00 70.16  ? 461 THR B CB  1 
ATOM   4197 O OG1 . THR B 1 255 ? -17.898 -8.335  -0.977  1.00 68.91  ? 461 THR B OG1 1 
ATOM   4198 C CG2 . THR B 1 255 ? -18.842 -9.217  1.067   1.00 69.56  ? 461 THR B CG2 1 
ATOM   4199 N N   . GLU B 1 256 ? -14.949 -7.814  -0.855  1.00 72.76  ? 462 GLU B N   1 
ATOM   4200 C CA  . GLU B 1 256 ? -13.813 -7.822  -1.776  1.00 71.21  ? 462 GLU B CA  1 
ATOM   4201 C C   . GLU B 1 256 ? -12.485 -8.052  -1.062  1.00 69.15  ? 462 GLU B C   1 
ATOM   4202 O O   . GLU B 1 256 ? -11.698 -8.918  -1.444  1.00 69.25  ? 462 GLU B O   1 
ATOM   4203 C CB  . GLU B 1 256 ? -13.726 -6.484  -2.522  1.00 74.90  ? 462 GLU B CB  1 
ATOM   4204 C CG  . GLU B 1 256 ? -14.928 -6.137  -3.384  1.00 79.48  ? 462 GLU B CG  1 
ATOM   4205 C CD  . GLU B 1 256 ? -15.024 -6.995  -4.627  1.00 82.44  ? 462 GLU B CD  1 
ATOM   4206 O OE1 . GLU B 1 256 ? -15.142 -8.229  -4.489  1.00 85.58  ? 462 GLU B OE1 1 
ATOM   4207 O OE2 . GLU B 1 256 ? -14.982 -6.435  -5.743  1.00 82.01  ? 462 GLU B OE2 1 
ATOM   4208 N N   . THR B 1 257 ? -12.235 -7.260  -0.026  1.00 65.74  ? 463 THR B N   1 
ATOM   4209 C CA  . THR B 1 257 ? -10.988 -7.355  0.713   1.00 61.49  ? 463 THR B CA  1 
ATOM   4210 C C   . THR B 1 257 ? -10.938 -8.515  1.701   1.00 57.60  ? 463 THR B C   1 
ATOM   4211 O O   . THR B 1 257 ? -11.940 -8.868  2.318   1.00 56.65  ? 463 THR B O   1 
ATOM   4212 C CB  . THR B 1 257 ? -10.684 -6.002  1.419   1.00 62.16  ? 463 THR B CB  1 
ATOM   4213 O OG1 . THR B 1 257 ? -9.953  -6.235  2.629   1.00 68.41  ? 463 THR B OG1 1 
ATOM   4214 C CG2 . THR B 1 257 ? -11.957 -5.246  1.718   1.00 57.61  ? 463 THR B CG2 1 
ATOM   4215 N N   . SER B 1 258 ? -9.761  -9.119  1.835   1.00 54.18  ? 464 SER B N   1 
ATOM   4216 C CA  . SER B 1 258 ? -9.590  -10.245 2.742   1.00 53.86  ? 464 SER B CA  1 
ATOM   4217 C C   . SER B 1 258 ? -9.061  -9.807  4.100   1.00 53.09  ? 464 SER B C   1 
ATOM   4218 O O   . SER B 1 258 ? -8.294  -8.850  4.191   1.00 54.26  ? 464 SER B O   1 
ATOM   4219 C CB  . SER B 1 258 ? -8.625  -11.262 2.142   1.00 54.48  ? 464 SER B CB  1 
ATOM   4220 O OG  . SER B 1 258 ? -7.309  -10.752 2.137   1.00 56.40  ? 464 SER B OG  1 
ATOM   4221 N N   . LEU B 1 259 ? -9.480  -10.504 5.153   1.00 51.79  ? 465 LEU B N   1 
ATOM   4222 C CA  . LEU B 1 259 ? -9.023  -10.201 6.508   1.00 49.53  ? 465 LEU B CA  1 
ATOM   4223 C C   . LEU B 1 259 ? -8.160  -11.368 6.976   1.00 47.15  ? 465 LEU B C   1 
ATOM   4224 O O   . LEU B 1 259 ? -8.526  -12.520 6.791   1.00 50.29  ? 465 LEU B O   1 
ATOM   4225 C CB  . LEU B 1 259 ? -10.218 -10.014 7.456   1.00 48.29  ? 465 LEU B CB  1 
ATOM   4226 C CG  . LEU B 1 259 ? -9.925  -9.708  8.937   1.00 50.21  ? 465 LEU B CG  1 
ATOM   4227 C CD1 . LEU B 1 259 ? -9.200  -8.364  9.107   1.00 50.04  ? 465 LEU B CD1 1 
ATOM   4228 C CD2 . LEU B 1 259 ? -11.228 -9.679  9.701   1.00 48.70  ? 465 LEU B CD2 1 
ATOM   4229 N N   . HIS B 1 260 ? -7.004  -11.071 7.555   1.00 44.67  ? 466 HIS B N   1 
ATOM   4230 C CA  . HIS B 1 260 ? -6.110  -12.114 8.047   1.00 42.92  ? 466 HIS B CA  1 
ATOM   4231 C C   . HIS B 1 260 ? -6.821  -12.929 9.131   1.00 40.84  ? 466 HIS B C   1 
ATOM   4232 O O   . HIS B 1 260 ? -7.404  -12.383 10.072  1.00 39.73  ? 466 HIS B O   1 
ATOM   4233 C CB  . HIS B 1 260 ? -4.835  -11.472 8.598   1.00 42.91  ? 466 HIS B CB  1 
ATOM   4234 C CG  . HIS B 1 260 ? -3.740  -12.445 8.916   1.00 42.55  ? 466 HIS B CG  1 
ATOM   4235 N ND1 . HIS B 1 260 ? -3.791  -13.298 9.997   1.00 42.29  ? 466 HIS B ND1 1 
ATOM   4236 C CD2 . HIS B 1 260 ? -2.537  -12.650 8.329   1.00 37.61  ? 466 HIS B CD2 1 
ATOM   4237 C CE1 . HIS B 1 260 ? -2.662  -13.982 10.065  1.00 42.81  ? 466 HIS B CE1 1 
ATOM   4238 N NE2 . HIS B 1 260 ? -1.884  -13.608 9.066   1.00 38.66  ? 466 HIS B NE2 1 
ATOM   4239 N N   . PRO B 1 261 ? -6.782  -14.257 9.010   1.00 41.77  ? 467 PRO B N   1 
ATOM   4240 C CA  . PRO B 1 261 ? -7.426  -15.157 9.976   1.00 41.70  ? 467 PRO B CA  1 
ATOM   4241 C C   . PRO B 1 261 ? -7.141  -14.845 11.455  1.00 40.63  ? 467 PRO B C   1 
ATOM   4242 O O   . PRO B 1 261 ? -8.009  -15.026 12.301  1.00 40.26  ? 467 PRO B O   1 
ATOM   4243 C CB  . PRO B 1 261 ? -6.907  -16.531 9.566   1.00 40.29  ? 467 PRO B CB  1 
ATOM   4244 C CG  . PRO B 1 261 ? -6.687  -16.383 8.108   1.00 44.14  ? 467 PRO B CG  1 
ATOM   4245 C CD  . PRO B 1 261 ? -6.045  -15.021 7.991   1.00 42.05  ? 467 PRO B CD  1 
ATOM   4246 N N   . LEU B 1 262 ? -5.933  -14.379 11.759  1.00 41.41  ? 468 LEU B N   1 
ATOM   4247 C CA  . LEU B 1 262 ? -5.565  -14.062 13.140  1.00 43.33  ? 468 LEU B CA  1 
ATOM   4248 C C   . LEU B 1 262 ? -6.343  -12.851 13.677  1.00 46.39  ? 468 LEU B C   1 
ATOM   4249 O O   . LEU B 1 262 ? -6.773  -12.833 14.849  1.00 41.34  ? 468 LEU B O   1 
ATOM   4250 C CB  . LEU B 1 262 ? -4.053  -13.801 13.247  1.00 41.34  ? 468 LEU B CB  1 
ATOM   4251 C CG  . LEU B 1 262 ? -3.505  -13.512 14.649  1.00 40.68  ? 468 LEU B CG  1 
ATOM   4252 C CD1 . LEU B 1 262 ? -3.766  -14.698 15.541  1.00 40.73  ? 468 LEU B CD1 1 
ATOM   4253 C CD2 . LEU B 1 262 ? -2.020  -13.230 14.585  1.00 40.49  ? 468 LEU B CD2 1 
ATOM   4254 N N   . LEU B 1 263 ? -6.509  -11.835 12.829  1.00 45.86  ? 469 LEU B N   1 
ATOM   4255 C CA  . LEU B 1 263 ? -7.255  -10.655 13.242  1.00 46.14  ? 469 LEU B CA  1 
ATOM   4256 C C   . LEU B 1 263 ? -8.728  -11.035 13.353  1.00 48.39  ? 469 LEU B C   1 
ATOM   4257 O O   . LEU B 1 263 ? -9.481  -10.423 14.111  1.00 48.79  ? 469 LEU B O   1 
ATOM   4258 C CB  . LEU B 1 263 ? -7.053  -9.522  12.243  1.00 42.14  ? 469 LEU B CB  1 
ATOM   4259 C CG  . LEU B 1 263 ? -5.884  -8.565  12.478  1.00 37.92  ? 469 LEU B CG  1 
ATOM   4260 C CD1 . LEU B 1 263 ? -4.684  -9.243  13.109  1.00 35.15  ? 469 LEU B CD1 1 
ATOM   4261 C CD2 . LEU B 1 263 ? -5.506  -8.031  11.165  1.00 36.74  ? 469 LEU B CD2 1 
ATOM   4262 N N   . GLN B 1 264 ? -9.132  -12.060 12.607  1.00 50.86  ? 470 GLN B N   1 
ATOM   4263 C CA  . GLN B 1 264 ? -10.512 -12.524 12.667  1.00 55.44  ? 470 GLN B CA  1 
ATOM   4264 C C   . GLN B 1 264 ? -10.731 -13.259 13.994  1.00 55.34  ? 470 GLN B C   1 
ATOM   4265 O O   . GLN B 1 264 ? -11.815 -13.216 14.570  1.00 52.02  ? 470 GLN B O   1 
ATOM   4266 C CB  . GLN B 1 264 ? -10.821 -13.457 11.491  1.00 59.21  ? 470 GLN B CB  1 
ATOM   4267 C CG  . GLN B 1 264 ? -11.650 -12.829 10.359  1.00 67.72  ? 470 GLN B CG  1 
ATOM   4268 C CD  . GLN B 1 264 ? -13.066 -12.425 10.782  1.00 73.01  ? 470 GLN B CD  1 
ATOM   4269 O OE1 . GLN B 1 264 ? -13.824 -13.236 11.322  1.00 75.18  ? 470 GLN B OE1 1 
ATOM   4270 N NE2 . GLN B 1 264 ? -13.428 -11.168 10.522  1.00 73.22  ? 470 GLN B NE2 1 
ATOM   4271 N N   . GLU B 1 265 ? -9.687  -13.935 14.467  1.00 56.93  ? 471 GLU B N   1 
ATOM   4272 C CA  . GLU B 1 265 ? -9.747  -14.663 15.730  1.00 58.06  ? 471 GLU B CA  1 
ATOM   4273 C C   . GLU B 1 265 ? -9.869  -13.668 16.877  1.00 57.74  ? 471 GLU B C   1 
ATOM   4274 O O   . GLU B 1 265 ? -10.572 -13.921 17.855  1.00 58.44  ? 471 GLU B O   1 
ATOM   4275 C CB  . GLU B 1 265 ? -8.479  -15.492 15.929  1.00 58.45  ? 471 GLU B CB  1 
ATOM   4276 C CG  . GLU B 1 265 ? -8.238  -16.537 14.868  1.00 64.24  ? 471 GLU B CG  1 
ATOM   4277 C CD  . GLU B 1 265 ? -9.258  -17.660 14.893  1.00 68.58  ? 471 GLU B CD  1 
ATOM   4278 O OE1 . GLU B 1 265 ? -9.161  -18.553 14.020  1.00 70.55  ? 471 GLU B OE1 1 
ATOM   4279 O OE2 . GLU B 1 265 ? -10.146 -17.653 15.778  1.00 68.13  ? 471 GLU B OE2 1 
ATOM   4280 N N   . ILE B 1 266 ? -9.161  -12.546 16.747  1.00 58.17  ? 472 ILE B N   1 
ATOM   4281 C CA  . ILE B 1 266 ? -9.166  -11.480 17.748  1.00 57.18  ? 472 ILE B CA  1 
ATOM   4282 C C   . ILE B 1 266 ? -10.521 -10.783 17.757  1.00 58.45  ? 472 ILE B C   1 
ATOM   4283 O O   . ILE B 1 266 ? -11.032 -10.415 18.808  1.00 54.14  ? 472 ILE B O   1 
ATOM   4284 C CB  . ILE B 1 266 ? -8.083  -10.418 17.439  1.00 56.48  ? 472 ILE B CB  1 
ATOM   4285 C CG1 . ILE B 1 266 ? -6.698  -11.052 17.479  1.00 55.30  ? 472 ILE B CG1 1 
ATOM   4286 C CG2 . ILE B 1 266 ? -8.168  -9.280  18.431  1.00 53.50  ? 472 ILE B CG2 1 
ATOM   4287 C CD1 . ILE B 1 266 ? -5.584  -10.073 17.235  1.00 57.25  ? 472 ILE B CD1 1 
ATOM   4288 N N   . TYR B 1 267 ? -11.090 -10.600 16.570  1.00 61.47  ? 473 TYR B N   1 
ATOM   4289 C CA  . TYR B 1 267 ? -12.384 -9.948  16.433  1.00 63.89  ? 473 TYR B CA  1 
ATOM   4290 C C   . TYR B 1 267 ? -13.488 -10.969 16.238  1.00 66.15  ? 473 TYR B C   1 
ATOM   4291 O O   . TYR B 1 267 ? -13.542 -11.629 15.201  1.00 68.79  ? 473 TYR B O   1 
ATOM   4292 C CB  . TYR B 1 267 ? -12.401 -9.020  15.222  1.00 62.46  ? 473 TYR B CB  1 
ATOM   4293 C CG  . TYR B 1 267 ? -11.346 -7.950  15.204  1.00 60.27  ? 473 TYR B CG  1 
ATOM   4294 C CD1 . TYR B 1 267 ? -11.195 -7.071  16.271  1.00 57.44  ? 473 TYR B CD1 1 
ATOM   4295 C CD2 . TYR B 1 267 ? -10.535 -7.781  14.087  1.00 58.93  ? 473 TYR B CD2 1 
ATOM   4296 C CE1 . TYR B 1 267 ? -10.263 -6.047  16.219  1.00 56.16  ? 473 TYR B CE1 1 
ATOM   4297 C CE2 . TYR B 1 267 ? -9.606  -6.766  14.025  1.00 57.36  ? 473 TYR B CE2 1 
ATOM   4298 C CZ  . TYR B 1 267 ? -9.481  -5.903  15.088  1.00 56.78  ? 473 TYR B CZ  1 
ATOM   4299 O OH  . TYR B 1 267 ? -8.602  -4.862  14.969  1.00 60.81  ? 473 TYR B OH  1 
ATOM   4300 N N   . LYS B 1 268 ? -14.365 -11.090 17.229  1.00 66.71  ? 474 LYS B N   1 
ATOM   4301 C CA  . LYS B 1 268 ? -15.493 -12.007 17.159  1.00 68.50  ? 474 LYS B CA  1 
ATOM   4302 C C   . LYS B 1 268 ? -16.082 -12.208 18.535  1.00 72.23  ? 474 LYS B C   1 
ATOM   4303 O O   . LYS B 1 268 ? -16.910 -13.092 18.748  1.00 74.46  ? 474 LYS B O   1 
ATOM   4304 C CB  . LYS B 1 268 ? -15.090 -13.362 16.558  1.00 65.35  ? 474 LYS B CB  1 
ATOM   4305 C CG  . LYS B 1 268 ? -14.319 -14.317 17.455  1.00 60.84  ? 474 LYS B CG  1 
ATOM   4306 C CD  . LYS B 1 268 ? -14.157 -15.650 16.722  1.00 59.82  ? 474 LYS B CD  1 
ATOM   4307 C CE  . LYS B 1 268 ? -13.475 -16.733 17.553  1.00 58.27  ? 474 LYS B CE  1 
ATOM   4308 N NZ  . LYS B 1 268 ? -14.284 -17.202 18.715  1.00 58.48  ? 474 LYS B NZ  1 
ATOM   4309 N N   . ASP B 1 269 ? -15.651 -11.369 19.468  1.00 75.47  ? 475 ASP B N   1 
ATOM   4310 C CA  . ASP B 1 269 ? -16.138 -11.434 20.836  1.00 78.64  ? 475 ASP B CA  1 
ATOM   4311 C C   . ASP B 1 269 ? -16.102 -10.045 21.449  1.00 78.42  ? 475 ASP B C   1 
ATOM   4312 O O   . ASP B 1 269 ? -16.385 -9.866  22.631  1.00 79.51  ? 475 ASP B O   1 
ATOM   4313 C CB  . ASP B 1 269 ? -15.280 -12.403 21.645  1.00 81.69  ? 475 ASP B CB  1 
ATOM   4314 C CG  . ASP B 1 269 ? -15.300 -13.807 21.069  1.00 85.65  ? 475 ASP B CG  1 
ATOM   4315 O OD1 . ASP B 1 269 ? -16.396 -14.405 21.013  1.00 88.18  ? 475 ASP B OD1 1 
ATOM   4316 O OD2 . ASP B 1 269 ? -14.229 -14.308 20.663  1.00 86.29  ? 475 ASP B OD2 1 
ATOM   4317 N N   . MET B 1 270 ? -15.753 -9.063  20.624  1.00 78.08  ? 476 MET B N   1 
ATOM   4318 C CA  . MET B 1 270 ? -15.673 -7.675  21.058  1.00 76.60  ? 476 MET B CA  1 
ATOM   4319 C C   . MET B 1 270 ? -16.946 -6.946  20.625  1.00 77.11  ? 476 MET B C   1 
ATOM   4320 O O   . MET B 1 270 ? -17.198 -6.764  19.435  1.00 76.75  ? 476 MET B O   1 
ATOM   4321 C CB  . MET B 1 270 ? -14.422 -7.012  20.454  1.00 73.62  ? 476 MET B CB  1 
ATOM   4322 C CG  . MET B 1 270 ? -13.125 -7.788  20.733  1.00 68.99  ? 476 MET B CG  1 
ATOM   4323 S SD  . MET B 1 270 ? -11.578 -7.054  20.126  1.00 66.01  ? 476 MET B SD  1 
ATOM   4324 C CE  . MET B 1 270 ? -10.866 -6.477  21.618  1.00 61.52  ? 476 MET B CE  1 
ATOM   4325 N N   . TYR B 1 271 ? -17.757 -6.552  21.602  1.00 79.08  ? 477 TYR B N   1 
ATOM   4326 C CA  . TYR B 1 271 ? -19.010 -5.855  21.331  1.00 79.62  ? 477 TYR B CA  1 
ATOM   4327 C C   . TYR B 1 271 ? -19.126 -4.601  22.183  1.00 80.77  ? 477 TYR B C   1 
ATOM   4328 O O   . TYR B 1 271 ? -20.147 -4.477  22.892  1.00 81.08  ? 477 TYR B O   1 
ATOM   4329 C CB  . TYR B 1 271 ? -20.185 -6.775  21.612  1.00 78.62  ? 477 TYR B CB  1 
ATOM   4330 O OXT . TYR B 1 271 ? -18.203 -3.763  22.130  1.00 80.55  ? 477 TYR B OXT 1 
HETATM 4331 C C1  A EPA C 2 .   ? 35.273  12.136  61.735  0.50 57.74  ? 1   EPA A C1  1 
HETATM 4332 C C1  B EPA C 2 .   ? 36.572  12.895  60.813  0.50 60.78  ? 1   EPA A C1  1 
HETATM 4333 O OA  A EPA C 2 .   ? 34.485  13.075  61.977  0.50 58.28  ? 1   EPA A OA  1 
HETATM 4334 O OA  B EPA C 2 .   ? 36.020  13.983  61.077  0.50 61.47  ? 1   EPA A OA  1 
HETATM 4335 O OB  A EPA C 2 .   ? 36.231  11.862  62.524  0.50 53.65  ? 1   EPA A OB  1 
HETATM 4336 O OB  B EPA C 2 .   ? 37.189  12.220  61.702  0.50 53.84  ? 1   EPA A OB  1 
HETATM 4337 C C2  A EPA C 2 .   ? 35.062  11.324  60.438  0.50 60.01  ? 1   EPA A C2  1 
HETATM 4338 C C2  B EPA C 2 .   ? 36.484  12.338  59.400  0.50 59.92  ? 1   EPA A C2  1 
HETATM 4339 C C3  A EPA C 2 .   ? 35.253  9.800   60.627  0.50 60.42  ? 1   EPA A C3  1 
HETATM 4340 C C3  B EPA C 2 .   ? 36.855  10.877  59.466  0.50 61.44  ? 1   EPA A C3  1 
HETATM 4341 C C4  A EPA C 2 .   ? 35.024  9.190   59.223  0.50 61.51  ? 1   EPA A C4  1 
HETATM 4342 C C4  B EPA C 2 .   ? 35.799  9.977   58.873  0.50 62.25  ? 1   EPA A C4  1 
HETATM 4343 C C5  A EPA C 2 .   ? 35.222  7.651   59.120  0.50 59.60  ? 1   EPA A C5  1 
HETATM 4344 C C5  B EPA C 2 .   ? 36.401  8.561   59.033  0.50 63.41  ? 1   EPA A C5  1 
HETATM 4345 C C6  A EPA C 2 .   ? 34.224  6.767   59.271  0.50 58.98  ? 1   EPA A C6  1 
HETATM 4346 C C6  B EPA C 2 .   ? 35.850  7.582   59.807  0.50 62.38  ? 1   EPA A C6  1 
HETATM 4347 C C7  A EPA C 2 .   ? 32.857  7.217   59.578  0.50 60.58  ? 1   EPA A C7  1 
HETATM 4348 C C7  B EPA C 2 .   ? 34.559  7.719   60.584  0.50 62.92  ? 1   EPA A C7  1 
HETATM 4349 C C8  A EPA C 2 .   ? 31.896  6.906   58.460  0.50 60.85  ? 1   EPA A C8  1 
HETATM 4350 C C8  B EPA C 2 .   ? 34.252  6.385   61.202  0.50 64.05  ? 1   EPA A C8  1 
HETATM 4351 C C9  A EPA C 2 .   ? 30.587  7.090   58.668  0.50 61.20  ? 1   EPA A C9  1 
HETATM 4352 C C9  B EPA C 2 .   ? 33.275  5.492   60.894  0.50 65.13  ? 1   EPA A C9  1 
HETATM 4353 C C10 A EPA C 2 .   ? 30.059  7.601   59.992  0.50 59.73  ? 1   EPA A C10 1 
HETATM 4354 C C10 B EPA C 2 .   ? 32.199  5.545   59.844  0.50 64.69  ? 1   EPA A C10 1 
HETATM 4355 C C11 A EPA C 2 .   ? 29.135  8.764   59.724  0.50 60.62  ? 1   EPA A C11 1 
HETATM 4356 C C11 B EPA C 2 .   ? 32.136  4.158   59.250  0.50 64.60  ? 1   EPA A C11 1 
HETATM 4357 C C12 A EPA C 2 .   ? 27.858  8.780   60.185  0.50 61.33  ? 1   EPA A C12 1 
HETATM 4358 C C12 B EPA C 2 .   ? 32.128  3.898   57.934  0.50 66.00  ? 1   EPA A C12 1 
HETATM 4359 C C13 A EPA C 2 .   ? 27.202  7.662   60.989  0.50 61.77  ? 1   EPA A C13 1 
HETATM 4360 C C13 B EPA C 2 .   ? 32.171  4.930   56.813  0.50 65.22  ? 1   EPA A C13 1 
HETATM 4361 C C14 A EPA C 2 .   ? 26.450  8.261   62.138  0.50 61.52  ? 1   EPA A C14 1 
HETATM 4362 C C14 B EPA C 2 .   ? 31.782  4.202   55.543  0.50 63.27  ? 1   EPA A C14 1 
HETATM 4363 C C15 A EPA C 2 .   ? 25.197  8.090   62.549  0.50 62.81  ? 1   EPA A C15 1 
HETATM 4364 C C15 B EPA C 2 .   ? 31.564  4.592   54.291  0.50 64.05  ? 1   EPA A C15 1 
HETATM 4365 C C16 A EPA C 2 .   ? 24.094  7.229   61.949  0.50 66.77  ? 1   EPA A C16 1 
HETATM 4366 C C16 B EPA C 2 .   ? 31.621  5.949   53.611  0.50 62.97  ? 1   EPA A C16 1 
HETATM 4367 C C17 A EPA C 2 .   ? 22.755  7.933   61.876  0.50 67.65  ? 1   EPA A C17 1 
HETATM 4368 C C17 B EPA C 2 .   ? 30.596  6.116   52.487  0.50 63.02  ? 1   EPA A C17 1 
HETATM 4369 C C18 A EPA C 2 .   ? 22.413  9.039   61.160  0.50 70.11  ? 1   EPA A C18 1 
HETATM 4370 C C18 B EPA C 2 .   ? 30.542  5.672   51.192  0.50 59.22  ? 1   EPA A C18 1 
HETATM 4371 C C19 A EPA C 2 .   ? 23.255  9.901   60.250  0.50 68.55  ? 1   EPA A C19 1 
HETATM 4372 C C19 B EPA C 2 .   ? 31.497  4.828   50.399  0.50 59.42  ? 1   EPA A C19 1 
HETATM 4373 C C20 A EPA C 2 .   ? 22.911  9.419   58.864  0.50 69.44  ? 1   EPA A C20 1 
HETATM 4374 C C20 B EPA C 2 .   ? 31.369  5.300   48.987  0.50 58.55  ? 1   EPA A C20 1 
HETATM 4375 C C1  A EPA D 2 .   ? -5.612  -4.949  11.728  0.50 87.47  ? 3   EPA B C1  1 
HETATM 4376 C C1  B EPA D 2 .   ? -7.037  -4.515  11.717  0.50 74.03  ? 3   EPA B C1  1 
HETATM 4377 O OA  A EPA D 2 .   ? -6.266  -5.560  10.782  0.50 91.13  ? 3   EPA B OA  1 
HETATM 4378 O OA  B EPA D 2 .   ? -7.849  -5.500  11.809  0.50 72.75  ? 3   EPA B OA  1 
HETATM 4379 O OB  A EPA D 2 .   ? -5.461  -5.418  12.850  0.50 86.14  ? 3   EPA B OB  1 
HETATM 4380 O OB  B EPA D 2 .   ? -6.748  -3.787  12.721  0.50 71.00  ? 3   EPA B OB  1 
HETATM 4381 C C2  A EPA D 2 .   ? -5.030  -3.585  11.456  0.50 87.07  ? 3   EPA B C2  1 
HETATM 4382 C C2  B EPA D 2 .   ? -6.356  -4.242  10.346  0.50 73.42  ? 3   EPA B C2  1 
HETATM 4383 C C3  A EPA D 2 .   ? -6.099  -2.434  11.567  0.50 84.52  ? 3   EPA B C3  1 
HETATM 4384 C C3  B EPA D 2 .   ? -6.593  -2.839  9.889   0.50 72.83  ? 3   EPA B C3  1 
HETATM 4385 C C4  A EPA D 2 .   ? -5.308  -1.241  11.102  0.50 81.77  ? 3   EPA B C4  1 
HETATM 4386 C C4  B EPA D 2 .   ? -5.286  -2.065  9.631   0.50 72.94  ? 3   EPA B C4  1 
HETATM 4387 C C5  A EPA D 2 .   ? -6.096  0.047   11.126  0.50 77.72  ? 3   EPA B C5  1 
HETATM 4388 C C5  B EPA D 2 .   ? -5.802  -0.696  9.107   0.50 74.10  ? 3   EPA B C5  1 
HETATM 4389 C C6  A EPA D 2 .   ? -5.532  1.153   11.549  0.50 73.80  ? 3   EPA B C6  1 
HETATM 4390 C C6  B EPA D 2 .   ? -5.417  0.544   9.515   0.50 73.95  ? 3   EPA B C6  1 
HETATM 4391 C C7  A EPA D 2 .   ? -4.057  1.222   12.028  0.50 72.45  ? 3   EPA B C7  1 
HETATM 4392 C C7  B EPA D 2 .   ? -4.388  0.851   10.567  0.50 73.43  ? 3   EPA B C7  1 
HETATM 4393 C C8  A EPA D 2 .   ? -3.155  1.597   10.837  0.50 71.00  ? 3   EPA B C8  1 
HETATM 4394 C C8  B EPA D 2 .   ? -4.883  2.037   11.388  0.50 72.16  ? 3   EPA B C8  1 
HETATM 4395 C C9  A EPA D 2 .   ? -1.806  1.496   10.858  0.50 67.59  ? 3   EPA B C9  1 
HETATM 4396 C C9  B EPA D 2 .   ? -4.110  3.035   11.901  0.50 72.46  ? 3   EPA B C9  1 
HETATM 4397 C C10 A EPA D 2 .   ? -1.075  0.993   12.085  0.50 65.22  ? 3   EPA B C10 1 
HETATM 4398 C C10 B EPA D 2 .   ? -2.610  3.190   11.758  0.50 73.42  ? 3   EPA B C10 1 
HETATM 4399 C C11 A EPA D 2 .   ? -0.622  -0.458  11.906  0.50 62.05  ? 3   EPA B C11 1 
HETATM 4400 C C11 B EPA D 2 .   ? -2.423  4.464   10.951  0.50 72.70  ? 3   EPA B C11 1 
HETATM 4401 C C12 A EPA D 2 .   ? 0.610   -0.955  12.283  0.50 62.27  ? 3   EPA B C12 1 
HETATM 4402 C C12 B EPA D 2 .   ? -1.781  4.540   9.781   0.50 71.73  ? 3   EPA B C12 1 
HETATM 4403 C C13 A EPA D 2 .   ? 1.772   -0.200  12.934  0.50 64.18  ? 3   EPA B C13 1 
HETATM 4404 C C13 B EPA D 2 .   ? -1.112  3.383   9.028   0.50 70.07  ? 3   EPA B C13 1 
HETATM 4405 C C14 A EPA D 2 .   ? 1.595   -0.190  14.428  0.50 64.49  ? 3   EPA B C14 1 
HETATM 4406 C C14 B EPA D 2 .   ? -0.818  3.895   7.635   0.50 64.93  ? 3   EPA B C14 1 
HETATM 4407 C C15 A EPA D 2 .   ? 2.453   0.105   15.420  0.50 63.45  ? 3   EPA B C15 1 
HETATM 4408 C C15 B EPA D 2 .   ? -0.200  3.387   6.568   0.50 63.92  ? 3   EPA B C15 1 
HETATM 4409 C C16 A EPA D 2 .   ? 3.891   0.518   15.321  0.50 63.47  ? 3   EPA B C16 1 
HETATM 4410 C C16 B EPA D 2 .   ? 0.480   2.048   6.302   0.50 65.23  ? 3   EPA B C16 1 
HETATM 4411 C C17 A EPA D 2 .   ? 4.746   -0.267  16.247  0.50 59.81  ? 3   EPA B C17 1 
HETATM 4412 C C17 B EPA D 2 .   ? 1.778   2.197   5.534   0.50 65.48  ? 3   EPA B C17 1 
HETATM 4413 C C18 A EPA D 2 .   ? 5.724   -1.141  15.991  0.50 61.86  ? 3   EPA B C18 1 
HETATM 4414 C C18 B EPA D 2 .   ? 1.996   2.374   4.212   0.50 66.60  ? 3   EPA B C18 1 
HETATM 4415 C C19 A EPA D 2 .   ? 6.320   -1.658  14.695  0.50 61.81  ? 3   EPA B C19 1 
HETATM 4416 C C19 B EPA D 2 .   ? 1.030   2.467   3.075   0.50 63.62  ? 3   EPA B C19 1 
HETATM 4417 C C20 A EPA D 2 .   ? 7.568   -2.409  15.165  0.50 64.11  ? 3   EPA B C20 1 
HETATM 4418 C C20 B EPA D 2 .   ? 1.781   3.214   2.009   0.50 60.07  ? 3   EPA B C20 1 
HETATM 4419 O O   . HOH E 3 .   ? 14.955  -1.146  66.105  1.00 20.18  ? 478 HOH A O   1 
HETATM 4420 O O   . HOH E 3 .   ? 28.983  7.749   82.632  1.00 38.57  ? 479 HOH A O   1 
HETATM 4421 O O   . HOH E 3 .   ? 41.156  -1.582  67.480  1.00 79.37  ? 480 HOH A O   1 
HETATM 4422 O O   . HOH E 3 .   ? 22.124  6.429   56.187  1.00 36.02  ? 481 HOH A O   1 
HETATM 4423 O O   . HOH E 3 .   ? 42.146  2.516   70.880  1.00 37.44  ? 482 HOH A O   1 
HETATM 4424 O O   . HOH E 3 .   ? 32.867  17.774  53.313  1.00 44.11  ? 483 HOH A O   1 
HETATM 4425 O O   . HOH E 3 .   ? 29.214  -8.354  73.234  1.00 71.11  ? 484 HOH A O   1 
HETATM 4426 O O   . HOH E 3 .   ? 35.748  18.794  52.910  1.00 60.26  ? 485 HOH A O   1 
HETATM 4427 O O   . HOH E 3 .   ? 22.253  -1.875  70.650  1.00 29.37  ? 486 HOH A O   1 
HETATM 4428 O O   . HOH E 3 .   ? 10.219  3.788   84.459  1.00 38.79  ? 487 HOH A O   1 
HETATM 4429 O O   . HOH E 3 .   ? 31.063  -10.719 48.890  1.00 56.94  ? 488 HOH A O   1 
HETATM 4430 O O   . HOH E 3 .   ? 18.691  18.196  86.301  1.00 45.84  ? 489 HOH A O   1 
HETATM 4431 O O   . HOH E 3 .   ? 11.470  5.372   65.710  1.00 53.10  ? 490 HOH A O   1 
HETATM 4432 O O   . HOH E 3 .   ? 20.812  15.400  89.850  1.00 67.50  ? 491 HOH A O   1 
HETATM 4433 O O   . HOH E 3 .   ? 40.994  -6.353  58.791  1.00 45.90  ? 492 HOH A O   1 
HETATM 4434 O O   . HOH E 3 .   ? 23.956  27.657  83.348  1.00 43.67  ? 493 HOH A O   1 
HETATM 4435 O O   . HOH E 3 .   ? 23.806  13.588  55.609  1.00 80.83  ? 494 HOH A O   1 
HETATM 4436 O O   . HOH E 3 .   ? 35.529  25.908  85.508  1.00 48.72  ? 495 HOH A O   1 
HETATM 4437 O O   . HOH E 3 .   ? 36.569  0.564   72.309  1.00 56.71  ? 496 HOH A O   1 
HETATM 4438 O O   . HOH E 3 .   ? 16.073  24.388  67.739  1.00 57.68  ? 497 HOH A O   1 
HETATM 4439 O O   . HOH E 3 .   ? 10.791  -4.407  54.691  1.00 60.76  ? 498 HOH A O   1 
HETATM 4440 O O   . HOH E 3 .   ? 25.964  8.766   53.643  1.00 40.02  ? 499 HOH A O   1 
HETATM 4441 O O   . HOH E 3 .   ? 48.499  8.172   47.229  1.00 66.19  ? 500 HOH A O   1 
HETATM 4442 O O   . HOH E 3 .   ? 38.604  10.074  75.116  1.00 58.93  ? 501 HOH A O   1 
HETATM 4443 O O   . HOH E 3 .   ? 22.637  -7.728  55.328  1.00 55.97  ? 502 HOH A O   1 
HETATM 4444 O O   . HOH E 3 .   ? 20.834  25.591  59.504  1.00 62.32  ? 503 HOH A O   1 
HETATM 4445 O O   . HOH E 3 .   ? 29.127  -12.760 52.241  1.00 69.52  ? 504 HOH A O   1 
HETATM 4446 O O   . HOH E 3 .   ? 20.668  19.575  60.599  1.00 76.13  ? 505 HOH A O   1 
HETATM 4447 O O   . HOH E 3 .   ? 45.895  4.483   66.742  1.00 68.71  ? 506 HOH A O   1 
HETATM 4448 O O   . HOH E 3 .   ? 11.701  3.504   55.781  1.00 74.51  ? 507 HOH A O   1 
HETATM 4449 O O   . HOH E 3 .   ? 26.467  -5.520  43.296  1.00 51.72  ? 508 HOH A O   1 
HETATM 4450 O O   . HOH E 3 .   ? 38.391  13.642  81.166  1.00 62.66  ? 509 HOH A O   1 
HETATM 4451 O O   . HOH E 3 .   ? 8.705   -2.544  75.246  1.00 51.90  ? 510 HOH A O   1 
HETATM 4452 O O   . HOH E 3 .   ? 36.122  13.756  77.148  1.00 36.82  ? 511 HOH A O   1 
HETATM 4453 O O   . HOH E 3 .   ? 17.449  -7.563  74.664  1.00 61.96  ? 512 HOH A O   1 
HETATM 4454 O O   . HOH E 3 .   ? 7.255   8.664   93.682  1.00 47.58  ? 513 HOH A O   1 
HETATM 4455 O O   . HOH E 3 .   ? 33.984  14.616  69.491  1.00 35.94  ? 514 HOH A O   1 
HETATM 4456 O O   . HOH E 3 .   ? 36.728  0.683   77.078  1.00 49.90  ? 515 HOH A O   1 
HETATM 4457 O O   . HOH E 3 .   ? 12.121  0.143   89.397  1.00 84.86  ? 516 HOH A O   1 
HETATM 4458 O O   . HOH E 3 .   ? 20.898  21.688  88.910  1.00 60.14  ? 517 HOH A O   1 
HETATM 4459 O O   . HOH E 3 .   ? 8.674   -10.119 79.623  1.00 52.69  ? 518 HOH A O   1 
HETATM 4460 O O   . HOH E 3 .   ? 21.910  30.687  80.021  1.00 47.86  ? 519 HOH A O   1 
HETATM 4461 O O   . HOH E 3 .   ? 4.962   -4.807  55.448  1.00 70.64  ? 520 HOH A O   1 
HETATM 4462 O O   . HOH E 3 .   ? 19.763  25.386  62.858  1.00 77.49  ? 521 HOH A O   1 
HETATM 4463 O O   . HOH E 3 .   ? 15.203  21.860  86.550  1.00 65.39  ? 522 HOH A O   1 
HETATM 4464 O O   . HOH E 3 .   ? 33.539  6.501   81.842  1.00 69.19  ? 523 HOH A O   1 
HETATM 4465 O O   . HOH E 3 .   ? 21.137  25.498  66.197  1.00 51.72  ? 524 HOH A O   1 
HETATM 4466 O O   . HOH E 3 .   ? 33.801  -8.500  64.004  1.00 56.86  ? 525 HOH A O   1 
HETATM 4467 O O   . HOH E 3 .   ? 25.618  22.459  48.107  1.00 99.20  ? 526 HOH A O   1 
HETATM 4468 O O   . HOH E 3 .   ? 15.568  7.214   51.847  1.00 45.43  ? 527 HOH A O   1 
HETATM 4469 O O   . HOH E 3 .   ? 36.040  21.686  83.657  1.00 43.35  ? 528 HOH A O   1 
HETATM 4470 O O   . HOH F 3 .   ? -21.095 -1.749  13.932  1.00 38.43  ? 478 HOH B O   1 
HETATM 4471 O O   . HOH F 3 .   ? -27.309 -12.996 22.739  1.00 35.73  ? 479 HOH B O   1 
HETATM 4472 O O   . HOH F 3 .   ? 8.534   2.206   11.127  1.00 33.74  ? 480 HOH B O   1 
HETATM 4473 O O   . HOH F 3 .   ? -10.969 -5.868  27.495  1.00 52.15  ? 481 HOH B O   1 
HETATM 4474 O O   . HOH F 3 .   ? -10.652 15.358  22.122  1.00 52.48  ? 482 HOH B O   1 
HETATM 4475 O O   . HOH F 3 .   ? 18.814  2.700   27.361  1.00 51.48  ? 483 HOH B O   1 
HETATM 4476 O O   . HOH F 3 .   ? -6.546  -7.091  20.496  1.00 31.53  ? 484 HOH B O   1 
HETATM 4477 O O   . HOH F 3 .   ? -21.946 -16.231 20.516  1.00 57.92  ? 485 HOH B O   1 
HETATM 4478 O O   . HOH F 3 .   ? -12.617 -17.252 36.105  1.00 45.26  ? 486 HOH B O   1 
HETATM 4479 O O   . HOH F 3 .   ? 0.449   -8.012  44.368  1.00 41.45  ? 487 HOH B O   1 
HETATM 4480 O O   . HOH F 3 .   ? 1.821   -14.136 8.826   1.00 65.77  ? 488 HOH B O   1 
HETATM 4481 O O   . HOH F 3 .   ? 11.784  16.083  7.012   1.00 72.43  ? 489 HOH B O   1 
HETATM 4482 O O   . HOH F 3 .   ? 8.713   -18.295 18.785  1.00 38.14  ? 490 HOH B O   1 
HETATM 4483 O O   . HOH F 3 .   ? 4.775   15.841  30.006  1.00 65.55  ? 491 HOH B O   1 
HETATM 4484 O O   . HOH F 3 .   ? 15.457  -1.854  19.767  1.00 39.39  ? 492 HOH B O   1 
HETATM 4485 O O   . HOH F 3 .   ? 7.260   -10.959 38.922  1.00 61.90  ? 493 HOH B O   1 
HETATM 4486 O O   . HOH F 3 .   ? -3.281  -20.231 41.253  1.00 53.97  ? 494 HOH B O   1 
HETATM 4487 O O   . HOH F 3 .   ? -14.979 -7.764  -8.057  1.00 54.46  ? 495 HOH B O   1 
HETATM 4488 O O   . HOH F 3 .   ? -6.552  17.090  29.060  1.00 67.88  ? 496 HOH B O   1 
HETATM 4489 O O   . HOH F 3 .   ? 14.366  -13.761 26.420  1.00 58.93  ? 497 HOH B O   1 
HETATM 4490 O O   . HOH F 3 .   ? -12.467 9.462   16.493  1.00 39.89  ? 498 HOH B O   1 
HETATM 4491 O O   . HOH F 3 .   ? -10.099 -20.414 12.157  1.00 72.27  ? 499 HOH B O   1 
HETATM 4492 O O   . HOH F 3 .   ? 5.662   -19.539 28.151  1.00 49.13  ? 500 HOH B O   1 
HETATM 4493 O O   . HOH F 3 .   ? 19.117  7.717   18.306  1.00 35.02  ? 501 HOH B O   1 
HETATM 4494 O O   . HOH F 3 .   ? 20.655  0.566   31.404  1.00 60.00  ? 502 HOH B O   1 
HETATM 4495 O O   . HOH F 3 .   ? -5.638  -2.271  31.518  1.00 104.28 ? 503 HOH B O   1 
HETATM 4496 O O   . HOH F 3 .   ? -8.344  18.424  7.614   1.00 56.68  ? 504 HOH B O   1 
HETATM 4497 O O   . HOH F 3 .   ? -9.680  -4.519  24.088  1.00 47.04  ? 505 HOH B O   1 
HETATM 4498 O O   . HOH F 3 .   ? 5.645   16.492  4.880   1.00 63.29  ? 506 HOH B O   1 
HETATM 4499 O O   . HOH F 3 .   ? -4.878  17.964  11.988  1.00 66.52  ? 507 HOH B O   1 
HETATM 4500 O O   . HOH F 3 .   ? 15.051  6.080   34.473  1.00 62.98  ? 508 HOH B O   1 
HETATM 4501 O O   . HOH F 3 .   ? 10.353  -13.259 33.227  1.00 51.15  ? 509 HOH B O   1 
HETATM 4502 O O   . HOH F 3 .   ? 24.623  7.547   13.797  1.00 110.63 ? 510 HOH B O   1 
HETATM 4503 O O   . HOH F 3 .   ? -8.860  11.762  33.097  1.00 63.03  ? 511 HOH B O   1 
HETATM 4504 O O   . HOH F 3 .   ? 7.859   20.183  32.498  1.00 53.72  ? 512 HOH B O   1 
HETATM 4505 O O   . HOH F 3 .   ? 3.502   -9.911  41.357  1.00 57.57  ? 513 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   207 207 GLN GLN A . n 
A 1 2   VAL 2   208 208 VAL VAL A . n 
A 1 3   ALA 3   209 209 ALA ALA A . n 
A 1 4   ASP 4   210 210 ASP ASP A . n 
A 1 5   LEU 5   211 211 LEU LEU A . n 
A 1 6   LYS 6   212 212 LYS LYS A . n 
A 1 7   ALA 7   213 213 ALA ALA A . n 
A 1 8   PHE 8   214 214 PHE PHE A . n 
A 1 9   SER 9   215 215 SER SER A . n 
A 1 10  LYS 10  216 216 LYS LYS A . n 
A 1 11  HIS 11  217 217 HIS HIS A . n 
A 1 12  ILE 12  218 218 ILE ILE A . n 
A 1 13  TYR 13  219 219 TYR TYR A . n 
A 1 14  ASN 14  220 220 ASN ASN A . n 
A 1 15  ALA 15  221 221 ALA ALA A . n 
A 1 16  TYR 16  222 222 TYR TYR A . n 
A 1 17  LEU 17  223 223 LEU LEU A . n 
A 1 18  LYS 18  224 224 LYS LYS A . n 
A 1 19  ASN 19  225 225 ASN ASN A . n 
A 1 20  PHE 20  226 226 PHE PHE A . n 
A 1 21  ASN 21  227 227 ASN ASN A . n 
A 1 22  MET 22  228 228 MET MET A . n 
A 1 23  THR 23  229 229 THR THR A . n 
A 1 24  LYS 24  230 230 LYS LYS A . n 
A 1 25  LYS 25  231 231 LYS LYS A . n 
A 1 26  LYS 26  232 232 LYS LYS A . n 
A 1 27  ALA 27  233 233 ALA ALA A . n 
A 1 28  ARG 28  234 234 ARG ARG A . n 
A 1 29  SER 29  235 235 SER SER A . n 
A 1 30  ILE 30  236 236 ILE ILE A . n 
A 1 31  LEU 31  237 237 LEU LEU A . n 
A 1 32  THR 32  238 238 THR THR A . n 
A 1 33  GLY 33  239 239 GLY GLY A . n 
A 1 34  LYS 34  240 240 LYS LYS A . n 
A 1 35  ALA 35  241 241 ALA ALA A . n 
A 1 36  SER 36  242 242 SER SER A . n 
A 1 37  HIS 37  243 243 HIS HIS A . n 
A 1 38  THR 38  244 244 THR THR A . n 
A 1 39  ALA 39  245 245 ALA ALA A . n 
A 1 40  PRO 40  246 246 PRO PRO A . n 
A 1 41  PHE 41  247 247 PHE PHE A . n 
A 1 42  VAL 42  248 248 VAL VAL A . n 
A 1 43  ILE 43  249 249 ILE ILE A . n 
A 1 44  HIS 44  250 250 HIS HIS A . n 
A 1 45  ASP 45  251 251 ASP ASP A . n 
A 1 46  ILE 46  252 252 ILE ILE A . n 
A 1 47  GLU 47  253 253 GLU GLU A . n 
A 1 48  THR 48  254 254 THR THR A . n 
A 1 49  LEU 49  255 255 LEU LEU A . n 
A 1 50  TRP 50  256 256 TRP TRP A . n 
A 1 51  GLN 51  257 257 GLN GLN A . n 
A 1 52  ALA 52  258 258 ALA ALA A . n 
A 1 53  GLU 53  259 259 GLU GLU A . n 
A 1 54  LYS 54  260 260 LYS LYS A . n 
A 1 55  GLY 55  261 261 GLY GLY A . n 
A 1 56  LEU 56  262 262 LEU LEU A . n 
A 1 57  VAL 57  263 263 VAL VAL A . n 
A 1 58  TRP 58  264 264 TRP TRP A . n 
A 1 59  LYS 59  265 265 LYS LYS A . n 
A 1 60  GLN 60  266 266 GLN GLN A . n 
A 1 61  LEU 61  267 267 LEU LEU A . n 
A 1 62  VAL 62  268 268 VAL VAL A . n 
A 1 63  ASN 63  269 269 ASN ASN A . n 
A 1 64  GLY 64  270 270 GLY GLY A . n 
A 1 65  LEU 65  271 271 LEU LEU A . n 
A 1 66  PRO 66  272 272 PRO PRO A . n 
A 1 67  PRO 67  273 273 PRO PRO A . n 
A 1 68  TYR 68  274 274 TYR TYR A . n 
A 1 69  LYS 69  275 275 LYS LYS A . n 
A 1 70  GLU 70  276 276 GLU GLU A . n 
A 1 71  ILE 71  277 277 ILE ILE A . n 
A 1 72  SER 72  278 278 SER SER A . n 
A 1 73  VAL 73  279 279 VAL VAL A . n 
A 1 74  HIS 74  280 280 HIS HIS A . n 
A 1 75  VAL 75  281 281 VAL VAL A . n 
A 1 76  PHE 76  282 282 PHE PHE A . n 
A 1 77  TYR 77  283 283 TYR TYR A . n 
A 1 78  ARG 78  284 284 ARG ARG A . n 
A 1 79  CYS 79  285 285 CYS CYS A . n 
A 1 80  GLN 80  286 286 GLN GLN A . n 
A 1 81  CYS 81  287 287 CYS CYS A . n 
A 1 82  THR 82  288 288 THR THR A . n 
A 1 83  THR 83  289 289 THR THR A . n 
A 1 84  VAL 84  290 290 VAL VAL A . n 
A 1 85  GLU 85  291 291 GLU GLU A . n 
A 1 86  THR 86  292 292 THR THR A . n 
A 1 87  VAL 87  293 293 VAL VAL A . n 
A 1 88  ARG 88  294 294 ARG ARG A . n 
A 1 89  GLU 89  295 295 GLU GLU A . n 
A 1 90  LEU 90  296 296 LEU LEU A . n 
A 1 91  THR 91  297 297 THR THR A . n 
A 1 92  GLU 92  298 298 GLU GLU A . n 
A 1 93  PHE 93  299 299 PHE PHE A . n 
A 1 94  ALA 94  300 300 ALA ALA A . n 
A 1 95  LYS 95  301 301 LYS LYS A . n 
A 1 96  SER 96  302 302 SER SER A . n 
A 1 97  ILE 97  303 303 ILE ILE A . n 
A 1 98  PRO 98  304 304 PRO PRO A . n 
A 1 99  SER 99  305 305 SER SER A . n 
A 1 100 PHE 100 306 306 PHE PHE A . n 
A 1 101 SER 101 307 307 SER SER A . n 
A 1 102 SER 102 308 308 SER SER A . n 
A 1 103 LEU 103 309 309 LEU LEU A . n 
A 1 104 PHE 104 310 310 PHE PHE A . n 
A 1 105 LEU 105 311 311 LEU LEU A . n 
A 1 106 ASN 106 312 312 ASN ASN A . n 
A 1 107 ASP 107 313 313 ASP ASP A . n 
A 1 108 GLN 108 314 314 GLN GLN A . n 
A 1 109 VAL 109 315 315 VAL VAL A . n 
A 1 110 THR 110 316 316 THR THR A . n 
A 1 111 LEU 111 317 317 LEU LEU A . n 
A 1 112 LEU 112 318 318 LEU LEU A . n 
A 1 113 LYS 113 319 319 LYS LYS A . n 
A 1 114 TYR 114 320 320 TYR TYR A . n 
A 1 115 GLY 115 321 321 GLY GLY A . n 
A 1 116 VAL 116 322 322 VAL VAL A . n 
A 1 117 HIS 117 323 323 HIS HIS A . n 
A 1 118 GLU 118 324 324 GLU GLU A . n 
A 1 119 ALA 119 325 325 ALA ALA A . n 
A 1 120 ILE 120 326 326 ILE ILE A . n 
A 1 121 PHE 121 327 327 PHE PHE A . n 
A 1 122 ALA 122 328 328 ALA ALA A . n 
A 1 123 MET 123 329 329 MET MET A . n 
A 1 124 LEU 124 330 330 LEU LEU A . n 
A 1 125 ALA 125 331 331 ALA ALA A . n 
A 1 126 SER 126 332 332 SER SER A . n 
A 1 127 ILE 127 333 333 ILE ILE A . n 
A 1 128 VAL 128 334 334 VAL VAL A . n 
A 1 129 ASN 129 335 335 ASN ASN A . n 
A 1 130 LYS 130 336 336 LYS LYS A . n 
A 1 131 ASP 131 337 337 ASP ASP A . n 
A 1 132 GLY 132 338 338 GLY GLY A . n 
A 1 133 LEU 133 339 339 LEU LEU A . n 
A 1 134 LEU 134 340 340 LEU LEU A . n 
A 1 135 VAL 135 341 341 VAL VAL A . n 
A 1 136 ALA 136 342 342 ALA ALA A . n 
A 1 137 ASN 137 343 343 ASN ASN A . n 
A 1 138 GLY 138 344 344 GLY GLY A . n 
A 1 139 SER 139 345 345 SER SER A . n 
A 1 140 GLY 140 346 346 GLY GLY A . n 
A 1 141 PHE 141 347 347 PHE PHE A . n 
A 1 142 VAL 142 348 348 VAL VAL A . n 
A 1 143 THR 143 349 349 THR THR A . n 
A 1 144 ARG 144 350 350 ARG ARG A . n 
A 1 145 GLU 145 351 351 GLU GLU A . n 
A 1 146 PHE 146 352 352 PHE PHE A . n 
A 1 147 LEU 147 353 353 LEU LEU A . n 
A 1 148 ARG 148 354 354 ARG ARG A . n 
A 1 149 SER 149 355 355 SER SER A . n 
A 1 150 LEU 150 356 356 LEU LEU A . n 
A 1 151 ARG 151 357 357 ARG ARG A . n 
A 1 152 LYS 152 358 358 LYS LYS A . n 
A 1 153 PRO 153 359 359 PRO PRO A . n 
A 1 154 PHE 154 360 360 PHE PHE A . n 
A 1 155 SER 155 361 361 SER SER A . n 
A 1 156 ASP 156 362 362 ASP ASP A . n 
A 1 157 ILE 157 363 363 ILE ILE A . n 
A 1 158 ILE 158 364 364 ILE ILE A . n 
A 1 159 GLU 159 365 365 GLU GLU A . n 
A 1 160 PRO 160 366 366 PRO PRO A . n 
A 1 161 LYS 161 367 367 LYS LYS A . n 
A 1 162 PHE 162 368 368 PHE PHE A . n 
A 1 163 GLU 163 369 369 GLU GLU A . n 
A 1 164 PHE 164 370 370 PHE PHE A . n 
A 1 165 ALA 165 371 371 ALA ALA A . n 
A 1 166 VAL 166 372 372 VAL VAL A . n 
A 1 167 LYS 167 373 373 LYS LYS A . n 
A 1 168 PHE 168 374 374 PHE PHE A . n 
A 1 169 ASN 169 375 375 ASN ASN A . n 
A 1 170 ALA 170 376 376 ALA ALA A . n 
A 1 171 LEU 171 377 377 LEU LEU A . n 
A 1 172 GLU 172 378 378 GLU GLU A . n 
A 1 173 LEU 173 379 379 LEU LEU A . n 
A 1 174 ASP 174 380 380 ASP ASP A . n 
A 1 175 ASP 175 381 381 ASP ASP A . n 
A 1 176 SER 176 382 382 SER SER A . n 
A 1 177 ASP 177 383 383 ASP ASP A . n 
A 1 178 LEU 178 384 384 LEU LEU A . n 
A 1 179 ALA 179 385 385 ALA ALA A . n 
A 1 180 LEU 180 386 386 LEU LEU A . n 
A 1 181 PHE 181 387 387 PHE PHE A . n 
A 1 182 ILE 182 388 388 ILE ILE A . n 
A 1 183 ALA 183 389 389 ALA ALA A . n 
A 1 184 ALA 184 390 390 ALA ALA A . n 
A 1 185 ILE 185 391 391 ILE ILE A . n 
A 1 186 ILE 186 392 392 ILE ILE A . n 
A 1 187 LEU 187 393 393 LEU LEU A . n 
A 1 188 CYS 188 394 394 CYS CYS A . n 
A 1 189 GLY 189 395 395 GLY GLY A . n 
A 1 190 ASP 190 396 396 ASP ASP A . n 
A 1 191 ARG 191 397 397 ARG ARG A . n 
A 1 192 PRO 192 398 398 PRO PRO A . n 
A 1 193 GLY 193 399 399 GLY GLY A . n 
A 1 194 LEU 194 400 400 LEU LEU A . n 
A 1 195 MET 195 401 401 MET MET A . n 
A 1 196 ASN 196 402 402 ASN ASN A . n 
A 1 197 VAL 197 403 403 VAL VAL A . n 
A 1 198 PRO 198 404 404 PRO PRO A . n 
A 1 199 ARG 199 405 405 ARG ARG A . n 
A 1 200 VAL 200 406 406 VAL VAL A . n 
A 1 201 GLU 201 407 407 GLU GLU A . n 
A 1 202 ALA 202 408 408 ALA ALA A . n 
A 1 203 ILE 203 409 409 ILE ILE A . n 
A 1 204 GLN 204 410 410 GLN GLN A . n 
A 1 205 ASP 205 411 411 ASP ASP A . n 
A 1 206 THR 206 412 412 THR THR A . n 
A 1 207 ILE 207 413 413 ILE ILE A . n 
A 1 208 LEU 208 414 414 LEU LEU A . n 
A 1 209 ARG 209 415 415 ARG ARG A . n 
A 1 210 ALA 210 416 416 ALA ALA A . n 
A 1 211 LEU 211 417 417 LEU LEU A . n 
A 1 212 GLU 212 418 418 GLU GLU A . n 
A 1 213 PHE 213 419 419 PHE PHE A . n 
A 1 214 HIS 214 420 420 HIS HIS A . n 
A 1 215 LEU 215 421 421 LEU LEU A . n 
A 1 216 GLN 216 422 422 GLN GLN A . n 
A 1 217 ALA 217 423 423 ALA ALA A . n 
A 1 218 ASN 218 424 424 ASN ASN A . n 
A 1 219 HIS 219 425 425 HIS HIS A . n 
A 1 220 PRO 220 426 426 PRO PRO A . n 
A 1 221 ASP 221 427 427 ASP ASP A . n 
A 1 222 ALA 222 428 428 ALA ALA A . n 
A 1 223 GLN 223 429 429 GLN GLN A . n 
A 1 224 TYR 224 430 430 TYR TYR A . n 
A 1 225 LEU 225 431 431 LEU LEU A . n 
A 1 226 PHE 226 432 432 PHE PHE A . n 
A 1 227 PRO 227 433 433 PRO PRO A . n 
A 1 228 LYS 228 434 434 LYS LYS A . n 
A 1 229 LEU 229 435 435 LEU LEU A . n 
A 1 230 LEU 230 436 436 LEU LEU A . n 
A 1 231 GLN 231 437 437 GLN GLN A . n 
A 1 232 LYS 232 438 438 LYS LYS A . n 
A 1 233 MET 233 439 439 MET MET A . n 
A 1 234 ALA 234 440 440 ALA ALA A . n 
A 1 235 ASP 235 441 441 ASP ASP A . n 
A 1 236 LEU 236 442 442 LEU LEU A . n 
A 1 237 ARG 237 443 443 ARG ARG A . n 
A 1 238 GLN 238 444 444 GLN GLN A . n 
A 1 239 LEU 239 445 445 LEU LEU A . n 
A 1 240 VAL 240 446 446 VAL VAL A . n 
A 1 241 THR 241 447 447 THR THR A . n 
A 1 242 GLU 242 448 448 GLU GLU A . n 
A 1 243 HIS 243 449 449 HIS HIS A . n 
A 1 244 ALA 244 450 450 ALA ALA A . n 
A 1 245 GLN 245 451 451 GLN GLN A . n 
A 1 246 MET 246 452 452 MET MET A . n 
A 1 247 MET 247 453 453 MET MET A . n 
A 1 248 GLN 248 454 454 GLN GLN A . n 
A 1 249 ARG 249 455 455 ARG ARG A . n 
A 1 250 ILE 250 456 456 ILE ILE A . n 
A 1 251 LYS 251 457 457 LYS LYS A . n 
A 1 252 LYS 252 458 458 LYS LYS A . n 
A 1 253 THR 253 459 459 THR THR A . n 
A 1 254 GLU 254 460 460 GLU GLU A . n 
A 1 255 THR 255 461 461 THR THR A . n 
A 1 256 GLU 256 462 462 GLU GLU A . n 
A 1 257 THR 257 463 463 THR THR A . n 
A 1 258 SER 258 464 464 SER SER A . n 
A 1 259 LEU 259 465 465 LEU LEU A . n 
A 1 260 HIS 260 466 466 HIS HIS A . n 
A 1 261 PRO 261 467 467 PRO PRO A . n 
A 1 262 LEU 262 468 468 LEU LEU A . n 
A 1 263 LEU 263 469 469 LEU LEU A . n 
A 1 264 GLN 264 470 470 GLN GLN A . n 
A 1 265 GLU 265 471 471 GLU GLU A . n 
A 1 266 ILE 266 472 472 ILE ILE A . n 
A 1 267 TYR 267 473 473 TYR TYR A . n 
A 1 268 LYS 268 474 474 LYS LYS A . n 
A 1 269 ASP 269 475 475 ASP ASP A . n 
A 1 270 MET 270 476 476 MET MET A . n 
A 1 271 TYR 271 477 476 TYR MET A . n 
B 1 1   GLN 1   207 207 GLN GLN B . n 
B 1 2   VAL 2   208 208 VAL VAL B . n 
B 1 3   ALA 3   209 209 ALA ALA B . n 
B 1 4   ASP 4   210 210 ASP ASP B . n 
B 1 5   LEU 5   211 211 LEU LEU B . n 
B 1 6   LYS 6   212 212 LYS LYS B . n 
B 1 7   ALA 7   213 213 ALA ALA B . n 
B 1 8   PHE 8   214 214 PHE PHE B . n 
B 1 9   SER 9   215 215 SER ALA B . n 
B 1 10  LYS 10  216 216 LYS LYS B . n 
B 1 11  HIS 11  217 217 HIS HIS B . n 
B 1 12  ILE 12  218 218 ILE ILE B . n 
B 1 13  TYR 13  219 219 TYR TYR B . n 
B 1 14  ASN 14  220 220 ASN ASN B . n 
B 1 15  ALA 15  221 221 ALA ALA B . n 
B 1 16  TYR 16  222 222 TYR TYR B . n 
B 1 17  LEU 17  223 223 LEU LEU B . n 
B 1 18  LYS 18  224 224 LYS LYS B . n 
B 1 19  ASN 19  225 225 ASN ASN B . n 
B 1 20  PHE 20  226 226 PHE PHE B . n 
B 1 21  ASN 21  227 227 ASN ASN B . n 
B 1 22  MET 22  228 228 MET MET B . n 
B 1 23  THR 23  229 229 THR THR B . n 
B 1 24  LYS 24  230 230 LYS LYS B . n 
B 1 25  LYS 25  231 231 LYS LYS B . n 
B 1 26  LYS 26  232 232 LYS LYS B . n 
B 1 27  ALA 27  233 233 ALA ALA B . n 
B 1 28  ARG 28  234 234 ARG ARG B . n 
B 1 29  SER 29  235 235 SER SER B . n 
B 1 30  ILE 30  236 236 ILE ILE B . n 
B 1 31  LEU 31  237 237 LEU LEU B . n 
B 1 32  THR 32  238 238 THR THR B . n 
B 1 33  GLY 33  239 239 GLY GLY B . n 
B 1 34  LYS 34  240 240 LYS LYS B . n 
B 1 35  ALA 35  241 241 ALA ALA B . n 
B 1 36  SER 36  242 242 SER SER B . n 
B 1 37  HIS 37  243 243 HIS HIS B . n 
B 1 38  THR 38  244 244 THR THR B . n 
B 1 39  ALA 39  245 245 ALA ALA B . n 
B 1 40  PRO 40  246 246 PRO PRO B . n 
B 1 41  PHE 41  247 247 PHE PHE B . n 
B 1 42  VAL 42  248 248 VAL VAL B . n 
B 1 43  ILE 43  249 249 ILE ILE B . n 
B 1 44  HIS 44  250 250 HIS HIS B . n 
B 1 45  ASP 45  251 251 ASP ASP B . n 
B 1 46  ILE 46  252 252 ILE ILE B . n 
B 1 47  GLU 47  253 253 GLU GLU B . n 
B 1 48  THR 48  254 254 THR THR B . n 
B 1 49  LEU 49  255 255 LEU LEU B . n 
B 1 50  TRP 50  256 256 TRP TRP B . n 
B 1 51  GLN 51  257 257 GLN GLN B . n 
B 1 52  ALA 52  258 258 ALA ALA B . n 
B 1 53  GLU 53  259 259 GLU GLU B . n 
B 1 54  LYS 54  260 260 LYS LYS B . n 
B 1 55  GLY 55  261 261 GLY GLY B . n 
B 1 56  LEU 56  262 262 LEU LEU B . n 
B 1 57  VAL 57  263 263 VAL VAL B . n 
B 1 58  TRP 58  264 264 TRP TRP B . n 
B 1 59  LYS 59  265 265 LYS LYS B . n 
B 1 60  GLN 60  266 266 GLN GLN B . n 
B 1 61  LEU 61  267 267 LEU LEU B . n 
B 1 62  VAL 62  268 268 VAL VAL B . n 
B 1 63  ASN 63  269 269 ASN ASN B . n 
B 1 64  GLY 64  270 270 GLY GLY B . n 
B 1 65  LEU 65  271 271 LEU LEU B . n 
B 1 66  PRO 66  272 272 PRO PRO B . n 
B 1 67  PRO 67  273 273 PRO PRO B . n 
B 1 68  TYR 68  274 274 TYR TYR B . n 
B 1 69  LYS 69  275 275 LYS ALA B . n 
B 1 70  GLU 70  276 276 GLU GLU B . n 
B 1 71  ILE 71  277 277 ILE ILE B . n 
B 1 72  SER 72  278 278 SER SER B . n 
B 1 73  VAL 73  279 279 VAL VAL B . n 
B 1 74  HIS 74  280 280 HIS HIS B . n 
B 1 75  VAL 75  281 281 VAL VAL B . n 
B 1 76  PHE 76  282 282 PHE PHE B . n 
B 1 77  TYR 77  283 283 TYR TYR B . n 
B 1 78  ARG 78  284 284 ARG ARG B . n 
B 1 79  CYS 79  285 285 CYS CYS B . n 
B 1 80  GLN 80  286 286 GLN GLN B . n 
B 1 81  CYS 81  287 287 CYS CYS B . n 
B 1 82  THR 82  288 288 THR THR B . n 
B 1 83  THR 83  289 289 THR THR B . n 
B 1 84  VAL 84  290 290 VAL VAL B . n 
B 1 85  GLU 85  291 291 GLU GLU B . n 
B 1 86  THR 86  292 292 THR THR B . n 
B 1 87  VAL 87  293 293 VAL VAL B . n 
B 1 88  ARG 88  294 294 ARG ARG B . n 
B 1 89  GLU 89  295 295 GLU GLU B . n 
B 1 90  LEU 90  296 296 LEU LEU B . n 
B 1 91  THR 91  297 297 THR THR B . n 
B 1 92  GLU 92  298 298 GLU GLU B . n 
B 1 93  PHE 93  299 299 PHE PHE B . n 
B 1 94  ALA 94  300 300 ALA ALA B . n 
B 1 95  LYS 95  301 301 LYS LYS B . n 
B 1 96  SER 96  302 302 SER SER B . n 
B 1 97  ILE 97  303 303 ILE ILE B . n 
B 1 98  PRO 98  304 304 PRO PRO B . n 
B 1 99  SER 99  305 305 SER SER B . n 
B 1 100 PHE 100 306 306 PHE PHE B . n 
B 1 101 SER 101 307 307 SER SER B . n 
B 1 102 SER 102 308 308 SER SER B . n 
B 1 103 LEU 103 309 309 LEU LEU B . n 
B 1 104 PHE 104 310 310 PHE PHE B . n 
B 1 105 LEU 105 311 311 LEU LEU B . n 
B 1 106 ASN 106 312 312 ASN ASN B . n 
B 1 107 ASP 107 313 313 ASP ASP B . n 
B 1 108 GLN 108 314 314 GLN GLN B . n 
B 1 109 VAL 109 315 315 VAL VAL B . n 
B 1 110 THR 110 316 316 THR THR B . n 
B 1 111 LEU 111 317 317 LEU LEU B . n 
B 1 112 LEU 112 318 318 LEU LEU B . n 
B 1 113 LYS 113 319 319 LYS LYS B . n 
B 1 114 TYR 114 320 320 TYR TYR B . n 
B 1 115 GLY 115 321 321 GLY GLY B . n 
B 1 116 VAL 116 322 322 VAL VAL B . n 
B 1 117 HIS 117 323 323 HIS HIS B . n 
B 1 118 GLU 118 324 324 GLU GLU B . n 
B 1 119 ALA 119 325 325 ALA ALA B . n 
B 1 120 ILE 120 326 326 ILE ILE B . n 
B 1 121 PHE 121 327 327 PHE PHE B . n 
B 1 122 ALA 122 328 328 ALA ALA B . n 
B 1 123 MET 123 329 329 MET MET B . n 
B 1 124 LEU 124 330 330 LEU LEU B . n 
B 1 125 ALA 125 331 331 ALA ALA B . n 
B 1 126 SER 126 332 332 SER SER B . n 
B 1 127 ILE 127 333 333 ILE ILE B . n 
B 1 128 VAL 128 334 334 VAL VAL B . n 
B 1 129 ASN 129 335 335 ASN ASN B . n 
B 1 130 LYS 130 336 336 LYS ALA B . n 
B 1 131 ASP 131 337 337 ASP ASP B . n 
B 1 132 GLY 132 338 338 GLY GLY B . n 
B 1 133 LEU 133 339 339 LEU LEU B . n 
B 1 134 LEU 134 340 340 LEU LEU B . n 
B 1 135 VAL 135 341 341 VAL VAL B . n 
B 1 136 ALA 136 342 342 ALA ALA B . n 
B 1 137 ASN 137 343 343 ASN ASN B . n 
B 1 138 GLY 138 344 344 GLY GLY B . n 
B 1 139 SER 139 345 345 SER SER B . n 
B 1 140 GLY 140 346 346 GLY GLY B . n 
B 1 141 PHE 141 347 347 PHE PHE B . n 
B 1 142 VAL 142 348 348 VAL VAL B . n 
B 1 143 THR 143 349 349 THR THR B . n 
B 1 144 ARG 144 350 350 ARG ARG B . n 
B 1 145 GLU 145 351 351 GLU GLU B . n 
B 1 146 PHE 146 352 352 PHE PHE B . n 
B 1 147 LEU 147 353 353 LEU LEU B . n 
B 1 148 ARG 148 354 354 ARG ARG B . n 
B 1 149 SER 149 355 355 SER SER B . n 
B 1 150 LEU 150 356 356 LEU LEU B . n 
B 1 151 ARG 151 357 357 ARG ARG B . n 
B 1 152 LYS 152 358 358 LYS LYS B . n 
B 1 153 PRO 153 359 359 PRO PRO B . n 
B 1 154 PHE 154 360 360 PHE PHE B . n 
B 1 155 SER 155 361 361 SER SER B . n 
B 1 156 ASP 156 362 362 ASP ASP B . n 
B 1 157 ILE 157 363 363 ILE ILE B . n 
B 1 158 ILE 158 364 364 ILE ILE B . n 
B 1 159 GLU 159 365 365 GLU GLU B . n 
B 1 160 PRO 160 366 366 PRO PRO B . n 
B 1 161 LYS 161 367 367 LYS LYS B . n 
B 1 162 PHE 162 368 368 PHE PHE B . n 
B 1 163 GLU 163 369 369 GLU GLU B . n 
B 1 164 PHE 164 370 370 PHE PHE B . n 
B 1 165 ALA 165 371 371 ALA ALA B . n 
B 1 166 VAL 166 372 372 VAL VAL B . n 
B 1 167 LYS 167 373 373 LYS LYS B . n 
B 1 168 PHE 168 374 374 PHE PHE B . n 
B 1 169 ASN 169 375 375 ASN ASN B . n 
B 1 170 ALA 170 376 376 ALA ALA B . n 
B 1 171 LEU 171 377 377 LEU LEU B . n 
B 1 172 GLU 172 378 378 GLU GLU B . n 
B 1 173 LEU 173 379 379 LEU LEU B . n 
B 1 174 ASP 174 380 380 ASP ASP B . n 
B 1 175 ASP 175 381 381 ASP ASP B . n 
B 1 176 SER 176 382 382 SER SER B . n 
B 1 177 ASP 177 383 383 ASP ASP B . n 
B 1 178 LEU 178 384 384 LEU LEU B . n 
B 1 179 ALA 179 385 385 ALA ALA B . n 
B 1 180 LEU 180 386 386 LEU LEU B . n 
B 1 181 PHE 181 387 387 PHE PHE B . n 
B 1 182 ILE 182 388 388 ILE ILE B . n 
B 1 183 ALA 183 389 389 ALA ALA B . n 
B 1 184 ALA 184 390 390 ALA ALA B . n 
B 1 185 ILE 185 391 391 ILE ILE B . n 
B 1 186 ILE 186 392 392 ILE ILE B . n 
B 1 187 LEU 187 393 393 LEU LEU B . n 
B 1 188 CYS 188 394 394 CYS CYS B . n 
B 1 189 GLY 189 395 395 GLY GLY B . n 
B 1 190 ASP 190 396 396 ASP ASP B . n 
B 1 191 ARG 191 397 397 ARG ARG B . n 
B 1 192 PRO 192 398 398 PRO PRO B . n 
B 1 193 GLY 193 399 399 GLY GLY B . n 
B 1 194 LEU 194 400 400 LEU LEU B . n 
B 1 195 MET 195 401 401 MET MET B . n 
B 1 196 ASN 196 402 402 ASN ASN B . n 
B 1 197 VAL 197 403 403 VAL VAL B . n 
B 1 198 PRO 198 404 404 PRO PRO B . n 
B 1 199 ARG 199 405 405 ARG ARG B . n 
B 1 200 VAL 200 406 406 VAL VAL B . n 
B 1 201 GLU 201 407 407 GLU GLU B . n 
B 1 202 ALA 202 408 408 ALA ALA B . n 
B 1 203 ILE 203 409 409 ILE ILE B . n 
B 1 204 GLN 204 410 410 GLN GLN B . n 
B 1 205 ASP 205 411 411 ASP ASP B . n 
B 1 206 THR 206 412 412 THR THR B . n 
B 1 207 ILE 207 413 413 ILE ILE B . n 
B 1 208 LEU 208 414 414 LEU LEU B . n 
B 1 209 ARG 209 415 415 ARG ARG B . n 
B 1 210 ALA 210 416 416 ALA ALA B . n 
B 1 211 LEU 211 417 417 LEU LEU B . n 
B 1 212 GLU 212 418 418 GLU GLU B . n 
B 1 213 PHE 213 419 419 PHE PHE B . n 
B 1 214 HIS 214 420 420 HIS HIS B . n 
B 1 215 LEU 215 421 421 LEU LEU B . n 
B 1 216 GLN 216 422 422 GLN GLN B . n 
B 1 217 ALA 217 423 423 ALA ALA B . n 
B 1 218 ASN 218 424 424 ASN ASN B . n 
B 1 219 HIS 219 425 425 HIS HIS B . n 
B 1 220 PRO 220 426 426 PRO PRO B . n 
B 1 221 ASP 221 427 427 ASP ASP B . n 
B 1 222 ALA 222 428 428 ALA ALA B . n 
B 1 223 GLN 223 429 429 GLN GLN B . n 
B 1 224 TYR 224 430 430 TYR TYR B . n 
B 1 225 LEU 225 431 431 LEU LEU B . n 
B 1 226 PHE 226 432 432 PHE PHE B . n 
B 1 227 PRO 227 433 433 PRO PRO B . n 
B 1 228 LYS 228 434 434 LYS LYS B . n 
B 1 229 LEU 229 435 435 LEU LEU B . n 
B 1 230 LEU 230 436 436 LEU LEU B . n 
B 1 231 GLN 231 437 437 GLN GLN B . n 
B 1 232 LYS 232 438 438 LYS LYS B . n 
B 1 233 MET 233 439 439 MET MET B . n 
B 1 234 ALA 234 440 440 ALA ALA B . n 
B 1 235 ASP 235 441 441 ASP ASP B . n 
B 1 236 LEU 236 442 442 LEU LEU B . n 
B 1 237 ARG 237 443 443 ARG ARG B . n 
B 1 238 GLN 238 444 444 GLN GLN B . n 
B 1 239 LEU 239 445 445 LEU LEU B . n 
B 1 240 VAL 240 446 446 VAL VAL B . n 
B 1 241 THR 241 447 447 THR THR B . n 
B 1 242 GLU 242 448 448 GLU GLU B . n 
B 1 243 HIS 243 449 449 HIS HIS B . n 
B 1 244 ALA 244 450 450 ALA ALA B . n 
B 1 245 GLN 245 451 451 GLN GLN B . n 
B 1 246 MET 246 452 452 MET MET B . n 
B 1 247 MET 247 453 453 MET MET B . n 
B 1 248 GLN 248 454 454 GLN GLN B . n 
B 1 249 ARG 249 455 455 ARG ALA B . n 
B 1 250 ILE 250 456 456 ILE ILE B . n 
B 1 251 LYS 251 457 457 LYS LYS B . n 
B 1 252 LYS 252 458 458 LYS ALA B . n 
B 1 253 THR 253 459 459 THR THR B . n 
B 1 254 GLU 254 460 460 GLU GLU B . n 
B 1 255 THR 255 461 461 THR THR B . n 
B 1 256 GLU 256 462 462 GLU GLU B . n 
B 1 257 THR 257 463 463 THR THR B . n 
B 1 258 SER 258 464 464 SER SER B . n 
B 1 259 LEU 259 465 465 LEU LEU B . n 
B 1 260 HIS 260 466 466 HIS HIS B . n 
B 1 261 PRO 261 467 467 PRO PRO B . n 
B 1 262 LEU 262 468 468 LEU LEU B . n 
B 1 263 LEU 263 469 469 LEU LEU B . n 
B 1 264 GLN 264 470 470 GLN GLN B . n 
B 1 265 GLU 265 471 471 GLU GLU B . n 
B 1 266 ILE 266 472 472 ILE ILE B . n 
B 1 267 TYR 267 473 473 TYR TYR B . n 
B 1 268 LYS 268 474 474 LYS LYS B . n 
B 1 269 ASP 269 475 475 ASP ASP B . n 
B 1 270 MET 270 476 476 MET MET B . n 
B 1 271 TYR 271 477 477 TYR ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 EPA 1  1   1   EPA EPA A . 
D 2 EPA 1  3   3   EPA EPA B . 
E 3 HOH 1  478 11  HOH HOH A . 
E 3 HOH 2  479 13  HOH HOH A . 
E 3 HOH 3  480 25  HOH HOH A . 
E 3 HOH 4  481 31  HOH HOH A . 
E 3 HOH 5  482 39  HOH HOH A . 
E 3 HOH 6  483 58  HOH HOH A . 
E 3 HOH 7  484 60  HOH HOH A . 
E 3 HOH 8  485 63  HOH HOH A . 
E 3 HOH 9  486 66  HOH HOH A . 
E 3 HOH 10 487 93  HOH HOH A . 
E 3 HOH 11 488 103 HOH HOH A . 
E 3 HOH 12 489 120 HOH HOH A . 
E 3 HOH 13 490 134 HOH HOH A . 
E 3 HOH 14 491 143 HOH HOH A . 
E 3 HOH 15 492 161 HOH HOH A . 
E 3 HOH 16 493 163 HOH HOH A . 
E 3 HOH 17 494 167 HOH HOH A . 
E 3 HOH 18 495 168 HOH HOH A . 
E 3 HOH 19 496 169 HOH HOH A . 
E 3 HOH 20 497 181 HOH HOH A . 
E 3 HOH 21 498 193 HOH HOH A . 
E 3 HOH 22 499 197 HOH HOH A . 
E 3 HOH 23 500 199 HOH HOH A . 
E 3 HOH 24 501 209 HOH HOH A . 
E 3 HOH 25 502 213 HOH HOH A . 
E 3 HOH 26 503 218 HOH HOH A . 
E 3 HOH 27 504 227 HOH HOH A . 
E 3 HOH 28 505 228 HOH HOH A . 
E 3 HOH 29 506 230 HOH HOH A . 
E 3 HOH 30 507 233 HOH HOH A . 
E 3 HOH 31 508 239 HOH HOH A . 
E 3 HOH 32 509 241 HOH HOH A . 
E 3 HOH 33 510 250 HOH HOH A . 
E 3 HOH 34 511 251 HOH HOH A . 
E 3 HOH 35 512 254 HOH HOH A . 
E 3 HOH 36 513 275 HOH HOH A . 
E 3 HOH 37 514 277 HOH HOH A . 
E 3 HOH 38 515 280 HOH HOH A . 
E 3 HOH 39 516 300 HOH HOH A . 
E 3 HOH 40 517 306 HOH HOH A . 
E 3 HOH 41 518 309 HOH HOH A . 
E 3 HOH 42 519 311 HOH HOH A . 
E 3 HOH 43 520 317 HOH HOH A . 
E 3 HOH 44 521 327 HOH HOH A . 
E 3 HOH 45 522 334 HOH HOH A . 
E 3 HOH 46 523 338 HOH HOH A . 
E 3 HOH 47 524 346 HOH HOH A . 
E 3 HOH 48 525 361 HOH HOH A . 
E 3 HOH 49 526 368 HOH HOH A . 
E 3 HOH 50 527 5   HOH HOH A . 
E 3 HOH 51 528 6   HOH HOH A . 
F 3 HOH 1  478 26  HOH HOH B . 
F 3 HOH 2  479 37  HOH HOH B . 
F 3 HOH 3  480 46  HOH HOH B . 
F 3 HOH 4  481 65  HOH HOH B . 
F 3 HOH 5  482 80  HOH HOH B . 
F 3 HOH 6  483 83  HOH HOH B . 
F 3 HOH 7  484 86  HOH HOH B . 
F 3 HOH 8  485 105 HOH HOH B . 
F 3 HOH 9  486 111 HOH HOH B . 
F 3 HOH 10 487 114 HOH HOH B . 
F 3 HOH 11 488 115 HOH HOH B . 
F 3 HOH 12 489 118 HOH HOH B . 
F 3 HOH 13 490 126 HOH HOH B . 
F 3 HOH 14 491 131 HOH HOH B . 
F 3 HOH 15 492 135 HOH HOH B . 
F 3 HOH 16 493 148 HOH HOH B . 
F 3 HOH 17 494 166 HOH HOH B . 
F 3 HOH 18 495 177 HOH HOH B . 
F 3 HOH 19 496 178 HOH HOH B . 
F 3 HOH 20 497 184 HOH HOH B . 
F 3 HOH 21 498 202 HOH HOH B . 
F 3 HOH 22 499 207 HOH HOH B . 
F 3 HOH 23 500 210 HOH HOH B . 
F 3 HOH 24 501 236 HOH HOH B . 
F 3 HOH 25 502 271 HOH HOH B . 
F 3 HOH 26 503 281 HOH HOH B . 
F 3 HOH 27 504 282 HOH HOH B . 
F 3 HOH 28 505 283 HOH HOH B . 
F 3 HOH 29 506 307 HOH HOH B . 
F 3 HOH 30 507 314 HOH HOH B . 
F 3 HOH 31 508 319 HOH HOH B . 
F 3 HOH 32 509 328 HOH HOH B . 
F 3 HOH 33 510 340 HOH HOH B . 
F 3 HOH 34 511 343 HOH HOH B . 
F 3 HOH 35 512 362 HOH HOH B . 
F 3 HOH 36 513 7   HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-04-26 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.5 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LEU 
_pdbx_validate_close_contact.auth_seq_id_1    271 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   LYS 
_pdbx_validate_close_contact.auth_seq_id_2    275 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 237 ? ? -87.27  39.40   
2  1 LYS A 240 ? ? -151.54 -34.97  
3  1 ALA A 241 ? ? -49.97  102.10  
4  1 HIS A 243 ? ? -53.95  -173.58 
5  1 THR A 244 ? ? -147.90 -44.19  
6  1 ALA A 245 ? ? 50.19   97.13   
7  1 VAL A 263 ? ? 42.76   176.27  
8  1 TRP A 264 ? ? -147.28 -65.88  
9  1 LYS A 265 ? ? 166.55  -118.48 
10 1 GLN A 266 ? ? -53.63  -82.72  
11 1 LEU A 267 ? ? -41.24  90.33   
12 1 LEU A 271 ? ? -131.81 -52.36  
13 1 TYR A 274 ? ? 38.19   10.13   
14 1 LYS A 275 ? ? -176.28 126.23  
15 1 GLU A 276 ? ? -115.38 -164.25 
16 1 ALA A 342 ? ? 50.39   77.27   
17 1 ASN A 343 ? ? 48.08   24.71   
18 1 ALA A 423 ? ? -95.44  37.45   
19 1 ASN A 424 ? ? -148.72 -31.23  
20 1 PRO A 426 ? ? -43.29  -73.42  
21 1 GLN A 429 ? ? -59.86  -147.80 
22 1 GLU A 460 ? ? -101.21 57.66   
23 1 VAL B 208 ? ? -118.57 -109.11 
24 1 THR B 238 ? ? -44.00  -93.53  
25 1 SER B 242 ? ? -79.46  21.36   
26 1 ILE B 249 ? ? -104.95 -103.18 
27 1 HIS B 250 ? ? 87.67   -12.05  
28 1 GLU B 259 ? ? -66.64  20.89   
29 1 LYS B 260 ? ? -147.82 -57.45  
30 1 VAL B 263 ? ? 59.34   150.22  
31 1 TRP B 264 ? ? -170.06 123.67  
32 1 LYS B 265 ? ? -60.63  68.40   
33 1 GLN B 266 ? ? -161.88 25.66   
34 1 LEU B 267 ? ? 72.97   156.67  
35 1 VAL B 268 ? ? -57.54  98.02   
36 1 ASN B 269 ? ? 59.98   -129.25 
37 1 ILE B 277 ? ? -54.58  -70.39  
38 1 PRO B 304 ? ? -29.23  -92.33  
39 1 ASN B 343 ? ? 35.81   53.95   
40 1 ARG B 357 ? ? -46.98  170.47  
41 1 PHE B 360 ? ? -65.16  -116.71 
42 1 SER B 361 ? ? 34.47   -60.02  
43 1 ASN B 402 ? ? -100.02 69.91   
44 1 ASN B 424 ? ? -141.11 -38.78  
45 1 ASP B 427 ? ? -178.42 46.67   
46 1 ALA B 428 ? ? -171.99 -157.27 
47 1 GLN B 429 ? ? -141.71 -13.65  
48 1 LEU B 431 ? ? -33.70  93.44   
49 1 PHE B 432 ? ? 90.94   -64.81  
50 1 THR B 461 ? ? -30.58  -33.95  
51 1 LYS B 474 ? ? 164.63  11.53   
52 1 ASP B 475 ? ? -150.08 5.07    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 477 ? CA  ? A TYR 271 CA  
2  1 Y 1 A TYR 477 ? C   ? A TYR 271 C   
3  1 Y 1 A TYR 477 ? O   ? A TYR 271 O   
4  1 Y 1 A TYR 477 ? CB  ? A TYR 271 CB  
5  1 Y 1 A TYR 477 ? CG  ? A TYR 271 CG  
6  1 Y 1 A TYR 477 ? CD1 ? A TYR 271 CD1 
7  1 Y 1 A TYR 477 ? CD2 ? A TYR 271 CD2 
8  1 Y 1 A TYR 477 ? CE1 ? A TYR 271 CE1 
9  1 Y 1 A TYR 477 ? CE2 ? A TYR 271 CE2 
10 1 Y 1 A TYR 477 ? CZ  ? A TYR 271 CZ  
11 1 Y 1 A TYR 477 ? OH  ? A TYR 271 OH  
12 1 Y 1 B SER 215 ? OG  ? B SER 9   OG  
13 1 Y 1 B LYS 275 ? CG  ? B LYS 69  CG  
14 1 Y 1 B LYS 275 ? CD  ? B LYS 69  CD  
15 1 Y 1 B LYS 275 ? CE  ? B LYS 69  CE  
16 1 Y 1 B LYS 275 ? NZ  ? B LYS 69  NZ  
17 1 Y 1 B LYS 336 ? CG  ? B LYS 130 CG  
18 1 Y 1 B LYS 336 ? CD  ? B LYS 130 CD  
19 1 Y 1 B LYS 336 ? CE  ? B LYS 130 CE  
20 1 Y 1 B LYS 336 ? NZ  ? B LYS 130 NZ  
21 1 Y 1 B ARG 455 ? CG  ? B ARG 249 CG  
22 1 Y 1 B ARG 455 ? CD  ? B ARG 249 CD  
23 1 Y 1 B ARG 455 ? NE  ? B ARG 249 NE  
24 1 Y 1 B ARG 455 ? CZ  ? B ARG 249 CZ  
25 1 Y 1 B ARG 455 ? NH1 ? B ARG 249 NH1 
26 1 Y 1 B ARG 455 ? NH2 ? B ARG 249 NH2 
27 1 Y 1 B LYS 458 ? CG  ? B LYS 252 CG  
28 1 Y 1 B LYS 458 ? CD  ? B LYS 252 CD  
29 1 Y 1 B LYS 458 ? CE  ? B LYS 252 CE  
30 1 Y 1 B LYS 458 ? NZ  ? B LYS 252 NZ  
31 1 Y 1 B TYR 477 ? CG  ? B TYR 271 CG  
32 1 Y 1 B TYR 477 ? CD1 ? B TYR 271 CD1 
33 1 Y 1 B TYR 477 ? CD2 ? B TYR 271 CD2 
34 1 Y 1 B TYR 477 ? CE1 ? B TYR 271 CE1 
35 1 Y 1 B TYR 477 ? CE2 ? B TYR 271 CE2 
36 1 Y 1 B TYR 477 ? CZ  ? B TYR 271 CZ  
37 1 Y 1 B TYR 477 ? OH  ? B TYR 271 OH  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '5,8,11,14,17-EICOSAPENTAENOIC ACID' EPA 
3 water                                HOH 
#