data_3H0G
# 
_entry.id   3H0G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H0G         
RCSB  RCSB052535   
WWPDB D_1000052535 
# 
_pdbx_database_status.entry_id                        3H0G 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-09 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Spahr, H.'      1 
'Calero, G.'     2 
'Bushnell, D.A.' 3 
'Kornberg, R.D.' 4 
# 
_citation.id                        primary 
_citation.title                     'Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                9185 
_citation.page_last                 9190 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19458260 
_citation.pdbx_database_id_DOI      10.1073/pnas.0903361106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Spahr, H.'      1 
primary 'Calero, G.'     2 
primary 'Bushnell, D.A.' 3 
primary 'Kornberg, R.D.' 4 
# 
_cell.length_a           163.034 
_cell.length_b           202.684 
_cell.length_c           391.258 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3H0G 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3H0G 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit rpb1'                194372.625 2  2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138027.188 2  2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                33748.816  2  ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit rpb4'                15379.490  2  ?       ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 23954.504  2  ?       ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 15742.497  2  ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II subunit rpb7'                19121.982  2  ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 14317.318  2  ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                13192.771  2  ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8286.801   2  ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               14143.276  2  ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7216.495   2  ?       ? ? ? 
13 non-polymer syn 'ZINC ION'                                                   65.409     16 ?       ? ? ? 
14 non-polymer syn 'MAGNESIUM ION'                                              24.305     2  ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'RNA polymerase II subunit B1, RNA polymerase II subunit 1, DNA-directed RNA polymerase III largest subunit' 
2  'RNA polymerase II subunit B2, RNA polymerase II subunit 2, DNA-directed RNA polymerase II 138 kDa polypeptide' 
3  'RNA polymerase II subunit B3, RNA polymerase II subunit 3, DNA-directed RNA polymerase II 33 kDa polypeptide' 
4  'RNA polymerase II subunit B4' 
5  'RNA polymerases I, II, and III subunit ABC1, RPC24B' 
6  'RNA polymerases I, II, and III subunit ABC2, DNA-directed RNA polymerases I, II, and III 15 kDa polypeptide, RPC16' 
7  'RNA polymerase II subunit B7' 
8  'RNA polymerases I, II, and III subunit ABC3, DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide, RPC14' 
9  'RNA polymerase II subunit B9, DNA-directed RNA polymerase II subunit 9, DNA-directed RNA polymerase II 13.2 kDa polypeptide' 
10 
'RNA polymerases I, II, and III subunit ABC5, DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide, ABC10-beta, RPC8' 
11 'RNA polymerase II subunit B11, DNA-directed RNA polymerase II 14.1 kDa polypeptide' 
12 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MSGIQFSPSSVPLRRVEEVQFGILSPEEIRSMSVAKIEFPETMDESGQRPRVGGLLDPRLGTIDRQFKCQTCGETMADCP
GHFGHIELAKPVFHIGFLSKIKKILECVCWNCGKLKIDSSNPKFNDTQRYRDPKNRLNAVWNVCKTKMVCDTGLSAGSDN
FDLSNPSANMGHGGCGAAQPTIRKDGLRLWGSWKRGKDESDLPEKRLLSPLEVHTIFTHISSEDLAHLGLNEQYARPDWM
IITVLPVPPPSVRPSISVDGTSRGEDDLTHKLSDIIKANANVRRCEQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPQA
LQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSARTVITGDPNLSLDELGVPRSIAKTLTYPETVTPYNIYQLQELVRN
GPDEHPGAKYIIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVIFNRQPSLHKMSMMGHRIRVMPYSTFRLNLSV
TSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVSPQSNKPVMGIVQDTLAGVRKFSLRDNFLTRNAVMNIMLWVP
DWDGILPPPVILKPKVLWTGKQILSLIIPKGINLIRDDDKQSLSNPTDSGMLIENGEIIYGVVDKKTVGASQGGLVHTIW
KEKGPEICKGFFNGIQRVVNYWLLHNGFSIGIGDTIADADTMKEVTRTVKEARRQVAECIQDAQHNRLKPEPGMTLRESF
EAKVSRILNQARDNAGRSAEHSLKDSNNVKQMVAAGSKGSFINISQMSACVGQQIVEGKRIPFGFKYRTLPHFPKDDDSP
ESRGFIENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMVRYDGTVRNAMGDIIQFAYGEDGLD
ATLVEYQVFDSLRLSTKQFEKKYRIDLMEDRSLSLYMENSIENDSSVQDLLDEEYTQLVADRELLCKFIFPKGDARWPLP
VNVQRIIQNALQIFHLEAKKPTDLLPSDIINGLNELIAKLTIFRGSDRITRDVQNNATLLFQILLRSKFAVKRVIMEYRL
NKVAFEWIMGEVEARFQQAVVSPGEMVGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPSLT
IYLMPWIAANMDLAKNVQTQIEHTTLSTVTSATEIHYDPDPQDTVIEEDKDFVEAFFAIPDEEVEENLYKQSPWLLRLEL
DRAKMLDKKLSMSDVAGKIAESFERDLFTIWSEDNADKLIIRCRIIRDDDRKAEDDDNMIEEDVFLKTIEGHMLESISLR
GVPNITRVYMMEHKIVRQIEDGTFERADEWVLETDGINLTEAMTVEGVDATRTYSNSFVEILQILGIEATRSALLKELRN
VIEFDGSYVNYRHLALLCDVMTSRGHLMAITRHGINRAETGALMRCSFEETVEILMDAAASGEKDDCKGISENIMLGQLA
PMGTGAFDIYLDQDMLMNYSLGTAVPTLAGSGMGTSQLPEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFG
DYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
;
;MSGIQFSPSSVPLRRVEEVQFGILSPEEIRSMSVAKIEFPETMDESGQRPRVGGLLDPRLGTIDRQFKCQTCGETMADCP
GHFGHIELAKPVFHIGFLSKIKKILECVCWNCGKLKIDSSNPKFNDTQRYRDPKNRLNAVWNVCKTKMVCDTGLSAGSDN
FDLSNPSANMGHGGCGAAQPTIRKDGLRLWGSWKRGKDESDLPEKRLLSPLEVHTIFTHISSEDLAHLGLNEQYARPDWM
IITVLPVPPPSVRPSISVDGTSRGEDDLTHKLSDIIKANANVRRCEQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPQA
LQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSARTVITGDPNLSLDELGVPRSIAKTLTYPETVTPYNIYQLQELVRN
GPDEHPGAKYIIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVIFNRQPSLHKMSMMGHRIRVMPYSTFRLNLSV
TSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVSPQSNKPVMGIVQDTLAGVRKFSLRDNFLTRNAVMNIMLWVP
DWDGILPPPVILKPKVLWTGKQILSLIIPKGINLIRDDDKQSLSNPTDSGMLIENGEIIYGVVDKKTVGASQGGLVHTIW
KEKGPEICKGFFNGIQRVVNYWLLHNGFSIGIGDTIADADTMKEVTRTVKEARRQVAECIQDAQHNRLKPEPGMTLRESF
EAKVSRILNQARDNAGRSAEHSLKDSNNVKQMVAAGSKGSFINISQMSACVGQQIVEGKRIPFGFKYRTLPHFPKDDDSP
ESRGFIENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMVRYDGTVRNAMGDIIQFAYGEDGLD
ATLVEYQVFDSLRLSTKQFEKKYRIDLMEDRSLSLYMENSIENDSSVQDLLDEEYTQLVADRELLCKFIFPKGDARWPLP
VNVQRIIQNALQIFHLEAKKPTDLLPSDIINGLNELIAKLTIFRGSDRITRDVQNNATLLFQILLRSKFAVKRVIMEYRL
NKVAFEWIMGEVEARFQQAVVSPGEMVGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPSLT
IYLMPWIAANMDLAKNVQTQIEHTTLSTVTSATEIHYDPDPQDTVIEEDKDFVEAFFAIPDEEVEENLYKQSPWLLRLEL
DRAKMLDKKLSMSDVAGKIAESFERDLFTIWSEDNADKLIIRCRIIRDDDRKAEDDDNMIEEDVFLKTIEGHMLESISLR
GVPNITRVYMMEHKIVRQIEDGTFERADEWVLETDGINLTEAMTVEGVDATRTYSNSFVEILQILGIEATRSALLKELRN
VIEFDGSYVNYRHLALLCDVMTSRGHLMAITRHGINRAETGALMRCSFEETVEILMDAAASGEKDDCKGISENIMLGQLA
PMGTGAFDIYLDQDMLMNYSLGTAVPTLAGSGMGTSQLPEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFG
DYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
;
A,M ? 
2  'polypeptide(L)' no no 
;MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQNTMQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFG
QIYLSRPTMTEADGSTTTMFPQEARLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLR
STFCILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSPIAYVAEIRSALERGSRLISSMQ
IKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALGVVPDRDILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYI
GKRGSTTGVTREKRLRYAHDILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRLDLAGPLLA
SLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATGNWGDQKRSMVNRVGVSQVLNRYTFASTLSH
LRRTNTPIGRDGKLAKPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSAS
PNATKVFVNGVWLGVHRDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLFIVDNNPNSERRGELCI
RKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEEETVMIAMSPEDLEASRQMQAGYEVKEELDPAQRVKPAP
NPHVHAWTHCEIHPAMILGILASIIPFPDHNQSPRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEY
LKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTTLRMKHGTYD
KLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRST
RIPQIGDKFASRHGQKGTIGMTYRHEDMPFSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFEGDATPFTDVT
VEAVSKLLRSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLVDDKIHARARGPVQILTRQPVEGRSRDGGLRFG
EMERDCQISHGCSSVLRERLFDCSDAYRVIVCDICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNI
APRLFTKNHK
;
;MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQNTMQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFG
QIYLSRPTMTEADGSTTTMFPQEARLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLR
STFCILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSPIAYVAEIRSALERGSRLISSMQ
IKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALGVVPDRDILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYI
GKRGSTTGVTREKRLRYAHDILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRLDLAGPLLA
SLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATGNWGDQKRSMVNRVGVSQVLNRYTFASTLSH
LRRTNTPIGRDGKLAKPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSAS
PNATKVFVNGVWLGVHRDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLFIVDNNPNSERRGELCI
RKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEEETVMIAMSPEDLEASRQMQAGYEVKEELDPAQRVKPAP
NPHVHAWTHCEIHPAMILGILASIIPFPDHNQSPRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEY
LKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTTLRMKHGTYD
KLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRST
RIPQIGDKFASRHGQKGTIGMTYRHEDMPFSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFEGDATPFTDVT
VEAVSKLLRSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLVDDKIHARARGPVQILTRQPVEGRSRDGGLRFG
EMERDCQISHGCSSVLRERLFDCSDAYRVIVCDICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNI
APRLFTKNHK
;
B,N ? 
3  'polypeptide(L)' no no 
;MDSETHITIRNISKNSVDFVLTNTSLAVANSLRRVVLAEIPTVAIDLVEINVNTSVMPDEFLAHRLGMIPLDSSNIDEPP
PVGLEYTRNCDCDQYCPKCSVELFLNAKCTGEGTMEIYARDLVVSSNSSLGHPILADPKSRGPLICKLRKEQEISLRCIA
KKGIAKEHAKWSPTSAVAFEYDPWNKLQHTDYWFENDADAEWPKSKNADWEEPPREGEPFNFQEEPRRFYMDVESVGSIP
PNEIMVQGLRILQEKLAVLVRDLDEEQPTQLSANELNMEENAEMNWSPYQNGEENTW
;
;MDSETHITIRNISKNSVDFVLTNTSLAVANSLRRVVLAEIPTVAIDLVEINVNTSVMPDEFLAHRLGMIPLDSSNIDEPP
PVGLEYTRNCDCDQYCPKCSVELFLNAKCTGEGTMEIYARDLVVSSNSSLGHPILADPKSRGPLICKLRKEQEISLRCIA
KKGIAKEHAKWSPTSAVAFEYDPWNKLQHTDYWFENDADAEWPKSKNADWEEPPREGEPFNFQEEPRRFYMDVESVGSIP
PNEIMVQGLRILQEKLAVLVRDLDEEQPTQLSANELNMEENAEMNWSPYQNGEENTW
;
C,O ? 
4  'polypeptide(L)' no no 
;MPRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARETNGEIPMTDVMKKTVAYFNVFARFKTAEATYACERI
LGNRFHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDELSTLRKFQD
;
;MPRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARETNGEIPMTDVMKKTVAYFNVFARFKTAEATYACERI
LGNRFHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDELSTLRKFQD
;
D,P ? 
5  'polypeptide(L)' no no 
;MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEP
SVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELL
DRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA
;
;MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEP
SVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELL
DRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA
;
E,Q ? 
6  'polypeptide(L)' no no 
;MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYER
ARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI
;
;MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYER
ARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI
;
F,R ? 
7  'polypeptide(L)' no no 
;MPFFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLW
RPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFA
IATMKEDYLGVL
;
;MPFFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLW
RPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFA
IATMKEDYLGVL
;
G,S ? 
8  'polypeptide(L)' no no 
;MSESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKV
YRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR
;
;MSESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKV
YRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR
;
H,T ? 
9  'polypeptide(L)' no no 
;MSNFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVSHDASTDPTLPRSDKECPRCHQ
HEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEEQ
;
;MSNFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVSHDASTDPTLPRSDKECPRCHQ
HEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEEQ
;
I,U ? 
10 'polypeptide(L)' no no MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPLSKQKNL 
MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPLSKQKNL J,V ? 
11 'polypeptide(L)' no no 
;MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDC
SPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVEMEFS
;
;MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDC
SPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVEMEFS
;
K,W ? 
12 'polypeptide(L)' no no MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR 
MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR L,X ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    SER n 
1  3    GLY n 
1  4    ILE n 
1  5    GLN n 
1  6    PHE n 
1  7    SER n 
1  8    PRO n 
1  9    SER n 
1  10   SER n 
1  11   VAL n 
1  12   PRO n 
1  13   LEU n 
1  14   ARG n 
1  15   ARG n 
1  16   VAL n 
1  17   GLU n 
1  18   GLU n 
1  19   VAL n 
1  20   GLN n 
1  21   PHE n 
1  22   GLY n 
1  23   ILE n 
1  24   LEU n 
1  25   SER n 
1  26   PRO n 
1  27   GLU n 
1  28   GLU n 
1  29   ILE n 
1  30   ARG n 
1  31   SER n 
1  32   MET n 
1  33   SER n 
1  34   VAL n 
1  35   ALA n 
1  36   LYS n 
1  37   ILE n 
1  38   GLU n 
1  39   PHE n 
1  40   PRO n 
1  41   GLU n 
1  42   THR n 
1  43   MET n 
1  44   ASP n 
1  45   GLU n 
1  46   SER n 
1  47   GLY n 
1  48   GLN n 
1  49   ARG n 
1  50   PRO n 
1  51   ARG n 
1  52   VAL n 
1  53   GLY n 
1  54   GLY n 
1  55   LEU n 
1  56   LEU n 
1  57   ASP n 
1  58   PRO n 
1  59   ARG n 
1  60   LEU n 
1  61   GLY n 
1  62   THR n 
1  63   ILE n 
1  64   ASP n 
1  65   ARG n 
1  66   GLN n 
1  67   PHE n 
1  68   LYS n 
1  69   CYS n 
1  70   GLN n 
1  71   THR n 
1  72   CYS n 
1  73   GLY n 
1  74   GLU n 
1  75   THR n 
1  76   MET n 
1  77   ALA n 
1  78   ASP n 
1  79   CYS n 
1  80   PRO n 
1  81   GLY n 
1  82   HIS n 
1  83   PHE n 
1  84   GLY n 
1  85   HIS n 
1  86   ILE n 
1  87   GLU n 
1  88   LEU n 
1  89   ALA n 
1  90   LYS n 
1  91   PRO n 
1  92   VAL n 
1  93   PHE n 
1  94   HIS n 
1  95   ILE n 
1  96   GLY n 
1  97   PHE n 
1  98   LEU n 
1  99   SER n 
1  100  LYS n 
1  101  ILE n 
1  102  LYS n 
1  103  LYS n 
1  104  ILE n 
1  105  LEU n 
1  106  GLU n 
1  107  CYS n 
1  108  VAL n 
1  109  CYS n 
1  110  TRP n 
1  111  ASN n 
1  112  CYS n 
1  113  GLY n 
1  114  LYS n 
1  115  LEU n 
1  116  LYS n 
1  117  ILE n 
1  118  ASP n 
1  119  SER n 
1  120  SER n 
1  121  ASN n 
1  122  PRO n 
1  123  LYS n 
1  124  PHE n 
1  125  ASN n 
1  126  ASP n 
1  127  THR n 
1  128  GLN n 
1  129  ARG n 
1  130  TYR n 
1  131  ARG n 
1  132  ASP n 
1  133  PRO n 
1  134  LYS n 
1  135  ASN n 
1  136  ARG n 
1  137  LEU n 
1  138  ASN n 
1  139  ALA n 
1  140  VAL n 
1  141  TRP n 
1  142  ASN n 
1  143  VAL n 
1  144  CYS n 
1  145  LYS n 
1  146  THR n 
1  147  LYS n 
1  148  MET n 
1  149  VAL n 
1  150  CYS n 
1  151  ASP n 
1  152  THR n 
1  153  GLY n 
1  154  LEU n 
1  155  SER n 
1  156  ALA n 
1  157  GLY n 
1  158  SER n 
1  159  ASP n 
1  160  ASN n 
1  161  PHE n 
1  162  ASP n 
1  163  LEU n 
1  164  SER n 
1  165  ASN n 
1  166  PRO n 
1  167  SER n 
1  168  ALA n 
1  169  ASN n 
1  170  MET n 
1  171  GLY n 
1  172  HIS n 
1  173  GLY n 
1  174  GLY n 
1  175  CYS n 
1  176  GLY n 
1  177  ALA n 
1  178  ALA n 
1  179  GLN n 
1  180  PRO n 
1  181  THR n 
1  182  ILE n 
1  183  ARG n 
1  184  LYS n 
1  185  ASP n 
1  186  GLY n 
1  187  LEU n 
1  188  ARG n 
1  189  LEU n 
1  190  TRP n 
1  191  GLY n 
1  192  SER n 
1  193  TRP n 
1  194  LYS n 
1  195  ARG n 
1  196  GLY n 
1  197  LYS n 
1  198  ASP n 
1  199  GLU n 
1  200  SER n 
1  201  ASP n 
1  202  LEU n 
1  203  PRO n 
1  204  GLU n 
1  205  LYS n 
1  206  ARG n 
1  207  LEU n 
1  208  LEU n 
1  209  SER n 
1  210  PRO n 
1  211  LEU n 
1  212  GLU n 
1  213  VAL n 
1  214  HIS n 
1  215  THR n 
1  216  ILE n 
1  217  PHE n 
1  218  THR n 
1  219  HIS n 
1  220  ILE n 
1  221  SER n 
1  222  SER n 
1  223  GLU n 
1  224  ASP n 
1  225  LEU n 
1  226  ALA n 
1  227  HIS n 
1  228  LEU n 
1  229  GLY n 
1  230  LEU n 
1  231  ASN n 
1  232  GLU n 
1  233  GLN n 
1  234  TYR n 
1  235  ALA n 
1  236  ARG n 
1  237  PRO n 
1  238  ASP n 
1  239  TRP n 
1  240  MET n 
1  241  ILE n 
1  242  ILE n 
1  243  THR n 
1  244  VAL n 
1  245  LEU n 
1  246  PRO n 
1  247  VAL n 
1  248  PRO n 
1  249  PRO n 
1  250  PRO n 
1  251  SER n 
1  252  VAL n 
1  253  ARG n 
1  254  PRO n 
1  255  SER n 
1  256  ILE n 
1  257  SER n 
1  258  VAL n 
1  259  ASP n 
1  260  GLY n 
1  261  THR n 
1  262  SER n 
1  263  ARG n 
1  264  GLY n 
1  265  GLU n 
1  266  ASP n 
1  267  ASP n 
1  268  LEU n 
1  269  THR n 
1  270  HIS n 
1  271  LYS n 
1  272  LEU n 
1  273  SER n 
1  274  ASP n 
1  275  ILE n 
1  276  ILE n 
1  277  LYS n 
1  278  ALA n 
1  279  ASN n 
1  280  ALA n 
1  281  ASN n 
1  282  VAL n 
1  283  ARG n 
1  284  ARG n 
1  285  CYS n 
1  286  GLU n 
1  287  GLN n 
1  288  GLU n 
1  289  GLY n 
1  290  ALA n 
1  291  PRO n 
1  292  ALA n 
1  293  HIS n 
1  294  ILE n 
1  295  VAL n 
1  296  SER n 
1  297  GLU n 
1  298  TYR n 
1  299  GLU n 
1  300  GLN n 
1  301  LEU n 
1  302  LEU n 
1  303  GLN n 
1  304  PHE n 
1  305  HIS n 
1  306  VAL n 
1  307  ALA n 
1  308  THR n 
1  309  TYR n 
1  310  MET n 
1  311  ASP n 
1  312  ASN n 
1  313  GLU n 
1  314  ILE n 
1  315  ALA n 
1  316  GLY n 
1  317  GLN n 
1  318  PRO n 
1  319  GLN n 
1  320  ALA n 
1  321  LEU n 
1  322  GLN n 
1  323  LYS n 
1  324  SER n 
1  325  GLY n 
1  326  ARG n 
1  327  PRO n 
1  328  LEU n 
1  329  LYS n 
1  330  SER n 
1  331  ILE n 
1  332  ARG n 
1  333  ALA n 
1  334  ARG n 
1  335  LEU n 
1  336  LYS n 
1  337  GLY n 
1  338  LYS n 
1  339  GLU n 
1  340  GLY n 
1  341  ARG n 
1  342  LEU n 
1  343  ARG n 
1  344  GLY n 
1  345  ASN n 
1  346  LEU n 
1  347  MET n 
1  348  GLY n 
1  349  LYS n 
1  350  ARG n 
1  351  VAL n 
1  352  ASP n 
1  353  PHE n 
1  354  SER n 
1  355  ALA n 
1  356  ARG n 
1  357  THR n 
1  358  VAL n 
1  359  ILE n 
1  360  THR n 
1  361  GLY n 
1  362  ASP n 
1  363  PRO n 
1  364  ASN n 
1  365  LEU n 
1  366  SER n 
1  367  LEU n 
1  368  ASP n 
1  369  GLU n 
1  370  LEU n 
1  371  GLY n 
1  372  VAL n 
1  373  PRO n 
1  374  ARG n 
1  375  SER n 
1  376  ILE n 
1  377  ALA n 
1  378  LYS n 
1  379  THR n 
1  380  LEU n 
1  381  THR n 
1  382  TYR n 
1  383  PRO n 
1  384  GLU n 
1  385  THR n 
1  386  VAL n 
1  387  THR n 
1  388  PRO n 
1  389  TYR n 
1  390  ASN n 
1  391  ILE n 
1  392  TYR n 
1  393  GLN n 
1  394  LEU n 
1  395  GLN n 
1  396  GLU n 
1  397  LEU n 
1  398  VAL n 
1  399  ARG n 
1  400  ASN n 
1  401  GLY n 
1  402  PRO n 
1  403  ASP n 
1  404  GLU n 
1  405  HIS n 
1  406  PRO n 
1  407  GLY n 
1  408  ALA n 
1  409  LYS n 
1  410  TYR n 
1  411  ILE n 
1  412  ILE n 
1  413  ARG n 
1  414  ASP n 
1  415  THR n 
1  416  GLY n 
1  417  GLU n 
1  418  ARG n 
1  419  ILE n 
1  420  ASP n 
1  421  LEU n 
1  422  ARG n 
1  423  TYR n 
1  424  HIS n 
1  425  LYS n 
1  426  ARG n 
1  427  ALA n 
1  428  GLY n 
1  429  ASP n 
1  430  ILE n 
1  431  PRO n 
1  432  LEU n 
1  433  ARG n 
1  434  TYR n 
1  435  GLY n 
1  436  TRP n 
1  437  ARG n 
1  438  VAL n 
1  439  GLU n 
1  440  ARG n 
1  441  HIS n 
1  442  ILE n 
1  443  ARG n 
1  444  ASP n 
1  445  GLY n 
1  446  ASP n 
1  447  VAL n 
1  448  VAL n 
1  449  ILE n 
1  450  PHE n 
1  451  ASN n 
1  452  ARG n 
1  453  GLN n 
1  454  PRO n 
1  455  SER n 
1  456  LEU n 
1  457  HIS n 
1  458  LYS n 
1  459  MET n 
1  460  SER n 
1  461  MET n 
1  462  MET n 
1  463  GLY n 
1  464  HIS n 
1  465  ARG n 
1  466  ILE n 
1  467  ARG n 
1  468  VAL n 
1  469  MET n 
1  470  PRO n 
1  471  TYR n 
1  472  SER n 
1  473  THR n 
1  474  PHE n 
1  475  ARG n 
1  476  LEU n 
1  477  ASN n 
1  478  LEU n 
1  479  SER n 
1  480  VAL n 
1  481  THR n 
1  482  SER n 
1  483  PRO n 
1  484  TYR n 
1  485  ASN n 
1  486  ALA n 
1  487  ASP n 
1  488  PHE n 
1  489  ASP n 
1  490  GLY n 
1  491  ASP n 
1  492  GLU n 
1  493  MET n 
1  494  ASN n 
1  495  MET n 
1  496  HIS n 
1  497  VAL n 
1  498  PRO n 
1  499  GLN n 
1  500  SER n 
1  501  GLU n 
1  502  GLU n 
1  503  THR n 
1  504  ARG n 
1  505  ALA n 
1  506  GLU n 
1  507  ILE n 
1  508  GLN n 
1  509  GLU n 
1  510  ILE n 
1  511  THR n 
1  512  MET n 
1  513  VAL n 
1  514  PRO n 
1  515  LYS n 
1  516  GLN n 
1  517  ILE n 
1  518  VAL n 
1  519  SER n 
1  520  PRO n 
1  521  GLN n 
1  522  SER n 
1  523  ASN n 
1  524  LYS n 
1  525  PRO n 
1  526  VAL n 
1  527  MET n 
1  528  GLY n 
1  529  ILE n 
1  530  VAL n 
1  531  GLN n 
1  532  ASP n 
1  533  THR n 
1  534  LEU n 
1  535  ALA n 
1  536  GLY n 
1  537  VAL n 
1  538  ARG n 
1  539  LYS n 
1  540  PHE n 
1  541  SER n 
1  542  LEU n 
1  543  ARG n 
1  544  ASP n 
1  545  ASN n 
1  546  PHE n 
1  547  LEU n 
1  548  THR n 
1  549  ARG n 
1  550  ASN n 
1  551  ALA n 
1  552  VAL n 
1  553  MET n 
1  554  ASN n 
1  555  ILE n 
1  556  MET n 
1  557  LEU n 
1  558  TRP n 
1  559  VAL n 
1  560  PRO n 
1  561  ASP n 
1  562  TRP n 
1  563  ASP n 
1  564  GLY n 
1  565  ILE n 
1  566  LEU n 
1  567  PRO n 
1  568  PRO n 
1  569  PRO n 
1  570  VAL n 
1  571  ILE n 
1  572  LEU n 
1  573  LYS n 
1  574  PRO n 
1  575  LYS n 
1  576  VAL n 
1  577  LEU n 
1  578  TRP n 
1  579  THR n 
1  580  GLY n 
1  581  LYS n 
1  582  GLN n 
1  583  ILE n 
1  584  LEU n 
1  585  SER n 
1  586  LEU n 
1  587  ILE n 
1  588  ILE n 
1  589  PRO n 
1  590  LYS n 
1  591  GLY n 
1  592  ILE n 
1  593  ASN n 
1  594  LEU n 
1  595  ILE n 
1  596  ARG n 
1  597  ASP n 
1  598  ASP n 
1  599  ASP n 
1  600  LYS n 
1  601  GLN n 
1  602  SER n 
1  603  LEU n 
1  604  SER n 
1  605  ASN n 
1  606  PRO n 
1  607  THR n 
1  608  ASP n 
1  609  SER n 
1  610  GLY n 
1  611  MET n 
1  612  LEU n 
1  613  ILE n 
1  614  GLU n 
1  615  ASN n 
1  616  GLY n 
1  617  GLU n 
1  618  ILE n 
1  619  ILE n 
1  620  TYR n 
1  621  GLY n 
1  622  VAL n 
1  623  VAL n 
1  624  ASP n 
1  625  LYS n 
1  626  LYS n 
1  627  THR n 
1  628  VAL n 
1  629  GLY n 
1  630  ALA n 
1  631  SER n 
1  632  GLN n 
1  633  GLY n 
1  634  GLY n 
1  635  LEU n 
1  636  VAL n 
1  637  HIS n 
1  638  THR n 
1  639  ILE n 
1  640  TRP n 
1  641  LYS n 
1  642  GLU n 
1  643  LYS n 
1  644  GLY n 
1  645  PRO n 
1  646  GLU n 
1  647  ILE n 
1  648  CYS n 
1  649  LYS n 
1  650  GLY n 
1  651  PHE n 
1  652  PHE n 
1  653  ASN n 
1  654  GLY n 
1  655  ILE n 
1  656  GLN n 
1  657  ARG n 
1  658  VAL n 
1  659  VAL n 
1  660  ASN n 
1  661  TYR n 
1  662  TRP n 
1  663  LEU n 
1  664  LEU n 
1  665  HIS n 
1  666  ASN n 
1  667  GLY n 
1  668  PHE n 
1  669  SER n 
1  670  ILE n 
1  671  GLY n 
1  672  ILE n 
1  673  GLY n 
1  674  ASP n 
1  675  THR n 
1  676  ILE n 
1  677  ALA n 
1  678  ASP n 
1  679  ALA n 
1  680  ASP n 
1  681  THR n 
1  682  MET n 
1  683  LYS n 
1  684  GLU n 
1  685  VAL n 
1  686  THR n 
1  687  ARG n 
1  688  THR n 
1  689  VAL n 
1  690  LYS n 
1  691  GLU n 
1  692  ALA n 
1  693  ARG n 
1  694  ARG n 
1  695  GLN n 
1  696  VAL n 
1  697  ALA n 
1  698  GLU n 
1  699  CYS n 
1  700  ILE n 
1  701  GLN n 
1  702  ASP n 
1  703  ALA n 
1  704  GLN n 
1  705  HIS n 
1  706  ASN n 
1  707  ARG n 
1  708  LEU n 
1  709  LYS n 
1  710  PRO n 
1  711  GLU n 
1  712  PRO n 
1  713  GLY n 
1  714  MET n 
1  715  THR n 
1  716  LEU n 
1  717  ARG n 
1  718  GLU n 
1  719  SER n 
1  720  PHE n 
1  721  GLU n 
1  722  ALA n 
1  723  LYS n 
1  724  VAL n 
1  725  SER n 
1  726  ARG n 
1  727  ILE n 
1  728  LEU n 
1  729  ASN n 
1  730  GLN n 
1  731  ALA n 
1  732  ARG n 
1  733  ASP n 
1  734  ASN n 
1  735  ALA n 
1  736  GLY n 
1  737  ARG n 
1  738  SER n 
1  739  ALA n 
1  740  GLU n 
1  741  HIS n 
1  742  SER n 
1  743  LEU n 
1  744  LYS n 
1  745  ASP n 
1  746  SER n 
1  747  ASN n 
1  748  ASN n 
1  749  VAL n 
1  750  LYS n 
1  751  GLN n 
1  752  MET n 
1  753  VAL n 
1  754  ALA n 
1  755  ALA n 
1  756  GLY n 
1  757  SER n 
1  758  LYS n 
1  759  GLY n 
1  760  SER n 
1  761  PHE n 
1  762  ILE n 
1  763  ASN n 
1  764  ILE n 
1  765  SER n 
1  766  GLN n 
1  767  MET n 
1  768  SER n 
1  769  ALA n 
1  770  CYS n 
1  771  VAL n 
1  772  GLY n 
1  773  GLN n 
1  774  GLN n 
1  775  ILE n 
1  776  VAL n 
1  777  GLU n 
1  778  GLY n 
1  779  LYS n 
1  780  ARG n 
1  781  ILE n 
1  782  PRO n 
1  783  PHE n 
1  784  GLY n 
1  785  PHE n 
1  786  LYS n 
1  787  TYR n 
1  788  ARG n 
1  789  THR n 
1  790  LEU n 
1  791  PRO n 
1  792  HIS n 
1  793  PHE n 
1  794  PRO n 
1  795  LYS n 
1  796  ASP n 
1  797  ASP n 
1  798  ASP n 
1  799  SER n 
1  800  PRO n 
1  801  GLU n 
1  802  SER n 
1  803  ARG n 
1  804  GLY n 
1  805  PHE n 
1  806  ILE n 
1  807  GLU n 
1  808  ASN n 
1  809  SER n 
1  810  TYR n 
1  811  LEU n 
1  812  ARG n 
1  813  GLY n 
1  814  LEU n 
1  815  THR n 
1  816  PRO n 
1  817  GLN n 
1  818  GLU n 
1  819  PHE n 
1  820  PHE n 
1  821  PHE n 
1  822  HIS n 
1  823  ALA n 
1  824  MET n 
1  825  ALA n 
1  826  GLY n 
1  827  ARG n 
1  828  GLU n 
1  829  GLY n 
1  830  LEU n 
1  831  ILE n 
1  832  ASP n 
1  833  THR n 
1  834  ALA n 
1  835  VAL n 
1  836  LYS n 
1  837  THR n 
1  838  ALA n 
1  839  GLU n 
1  840  THR n 
1  841  GLY n 
1  842  TYR n 
1  843  ILE n 
1  844  GLN n 
1  845  ARG n 
1  846  ARG n 
1  847  LEU n 
1  848  VAL n 
1  849  LYS n 
1  850  ALA n 
1  851  MET n 
1  852  GLU n 
1  853  ASP n 
1  854  VAL n 
1  855  MET n 
1  856  VAL n 
1  857  ARG n 
1  858  TYR n 
1  859  ASP n 
1  860  GLY n 
1  861  THR n 
1  862  VAL n 
1  863  ARG n 
1  864  ASN n 
1  865  ALA n 
1  866  MET n 
1  867  GLY n 
1  868  ASP n 
1  869  ILE n 
1  870  ILE n 
1  871  GLN n 
1  872  PHE n 
1  873  ALA n 
1  874  TYR n 
1  875  GLY n 
1  876  GLU n 
1  877  ASP n 
1  878  GLY n 
1  879  LEU n 
1  880  ASP n 
1  881  ALA n 
1  882  THR n 
1  883  LEU n 
1  884  VAL n 
1  885  GLU n 
1  886  TYR n 
1  887  GLN n 
1  888  VAL n 
1  889  PHE n 
1  890  ASP n 
1  891  SER n 
1  892  LEU n 
1  893  ARG n 
1  894  LEU n 
1  895  SER n 
1  896  THR n 
1  897  LYS n 
1  898  GLN n 
1  899  PHE n 
1  900  GLU n 
1  901  LYS n 
1  902  LYS n 
1  903  TYR n 
1  904  ARG n 
1  905  ILE n 
1  906  ASP n 
1  907  LEU n 
1  908  MET n 
1  909  GLU n 
1  910  ASP n 
1  911  ARG n 
1  912  SER n 
1  913  LEU n 
1  914  SER n 
1  915  LEU n 
1  916  TYR n 
1  917  MET n 
1  918  GLU n 
1  919  ASN n 
1  920  SER n 
1  921  ILE n 
1  922  GLU n 
1  923  ASN n 
1  924  ASP n 
1  925  SER n 
1  926  SER n 
1  927  VAL n 
1  928  GLN n 
1  929  ASP n 
1  930  LEU n 
1  931  LEU n 
1  932  ASP n 
1  933  GLU n 
1  934  GLU n 
1  935  TYR n 
1  936  THR n 
1  937  GLN n 
1  938  LEU n 
1  939  VAL n 
1  940  ALA n 
1  941  ASP n 
1  942  ARG n 
1  943  GLU n 
1  944  LEU n 
1  945  LEU n 
1  946  CYS n 
1  947  LYS n 
1  948  PHE n 
1  949  ILE n 
1  950  PHE n 
1  951  PRO n 
1  952  LYS n 
1  953  GLY n 
1  954  ASP n 
1  955  ALA n 
1  956  ARG n 
1  957  TRP n 
1  958  PRO n 
1  959  LEU n 
1  960  PRO n 
1  961  VAL n 
1  962  ASN n 
1  963  VAL n 
1  964  GLN n 
1  965  ARG n 
1  966  ILE n 
1  967  ILE n 
1  968  GLN n 
1  969  ASN n 
1  970  ALA n 
1  971  LEU n 
1  972  GLN n 
1  973  ILE n 
1  974  PHE n 
1  975  HIS n 
1  976  LEU n 
1  977  GLU n 
1  978  ALA n 
1  979  LYS n 
1  980  LYS n 
1  981  PRO n 
1  982  THR n 
1  983  ASP n 
1  984  LEU n 
1  985  LEU n 
1  986  PRO n 
1  987  SER n 
1  988  ASP n 
1  989  ILE n 
1  990  ILE n 
1  991  ASN n 
1  992  GLY n 
1  993  LEU n 
1  994  ASN n 
1  995  GLU n 
1  996  LEU n 
1  997  ILE n 
1  998  ALA n 
1  999  LYS n 
1  1000 LEU n 
1  1001 THR n 
1  1002 ILE n 
1  1003 PHE n 
1  1004 ARG n 
1  1005 GLY n 
1  1006 SER n 
1  1007 ASP n 
1  1008 ARG n 
1  1009 ILE n 
1  1010 THR n 
1  1011 ARG n 
1  1012 ASP n 
1  1013 VAL n 
1  1014 GLN n 
1  1015 ASN n 
1  1016 ASN n 
1  1017 ALA n 
1  1018 THR n 
1  1019 LEU n 
1  1020 LEU n 
1  1021 PHE n 
1  1022 GLN n 
1  1023 ILE n 
1  1024 LEU n 
1  1025 LEU n 
1  1026 ARG n 
1  1027 SER n 
1  1028 LYS n 
1  1029 PHE n 
1  1030 ALA n 
1  1031 VAL n 
1  1032 LYS n 
1  1033 ARG n 
1  1034 VAL n 
1  1035 ILE n 
1  1036 MET n 
1  1037 GLU n 
1  1038 TYR n 
1  1039 ARG n 
1  1040 LEU n 
1  1041 ASN n 
1  1042 LYS n 
1  1043 VAL n 
1  1044 ALA n 
1  1045 PHE n 
1  1046 GLU n 
1  1047 TRP n 
1  1048 ILE n 
1  1049 MET n 
1  1050 GLY n 
1  1051 GLU n 
1  1052 VAL n 
1  1053 GLU n 
1  1054 ALA n 
1  1055 ARG n 
1  1056 PHE n 
1  1057 GLN n 
1  1058 GLN n 
1  1059 ALA n 
1  1060 VAL n 
1  1061 VAL n 
1  1062 SER n 
1  1063 PRO n 
1  1064 GLY n 
1  1065 GLU n 
1  1066 MET n 
1  1067 VAL n 
1  1068 GLY n 
1  1069 THR n 
1  1070 LEU n 
1  1071 ALA n 
1  1072 ALA n 
1  1073 GLN n 
1  1074 SER n 
1  1075 ILE n 
1  1076 GLY n 
1  1077 GLU n 
1  1078 PRO n 
1  1079 ALA n 
1  1080 THR n 
1  1081 GLN n 
1  1082 MET n 
1  1083 THR n 
1  1084 LEU n 
1  1085 ASN n 
1  1086 THR n 
1  1087 PHE n 
1  1088 HIS n 
1  1089 TYR n 
1  1090 ALA n 
1  1091 GLY n 
1  1092 VAL n 
1  1093 SER n 
1  1094 SER n 
1  1095 LYS n 
1  1096 ASN n 
1  1097 VAL n 
1  1098 THR n 
1  1099 LEU n 
1  1100 GLY n 
1  1101 VAL n 
1  1102 PRO n 
1  1103 ARG n 
1  1104 LEU n 
1  1105 LYS n 
1  1106 GLU n 
1  1107 ILE n 
1  1108 LEU n 
1  1109 ASN n 
1  1110 VAL n 
1  1111 ALA n 
1  1112 LYS n 
1  1113 ASN n 
1  1114 ILE n 
1  1115 LYS n 
1  1116 THR n 
1  1117 PRO n 
1  1118 SER n 
1  1119 LEU n 
1  1120 THR n 
1  1121 ILE n 
1  1122 TYR n 
1  1123 LEU n 
1  1124 MET n 
1  1125 PRO n 
1  1126 TRP n 
1  1127 ILE n 
1  1128 ALA n 
1  1129 ALA n 
1  1130 ASN n 
1  1131 MET n 
1  1132 ASP n 
1  1133 LEU n 
1  1134 ALA n 
1  1135 LYS n 
1  1136 ASN n 
1  1137 VAL n 
1  1138 GLN n 
1  1139 THR n 
1  1140 GLN n 
1  1141 ILE n 
1  1142 GLU n 
1  1143 HIS n 
1  1144 THR n 
1  1145 THR n 
1  1146 LEU n 
1  1147 SER n 
1  1148 THR n 
1  1149 VAL n 
1  1150 THR n 
1  1151 SER n 
1  1152 ALA n 
1  1153 THR n 
1  1154 GLU n 
1  1155 ILE n 
1  1156 HIS n 
1  1157 TYR n 
1  1158 ASP n 
1  1159 PRO n 
1  1160 ASP n 
1  1161 PRO n 
1  1162 GLN n 
1  1163 ASP n 
1  1164 THR n 
1  1165 VAL n 
1  1166 ILE n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ASP n 
1  1170 LYS n 
1  1171 ASP n 
1  1172 PHE n 
1  1173 VAL n 
1  1174 GLU n 
1  1175 ALA n 
1  1176 PHE n 
1  1177 PHE n 
1  1178 ALA n 
1  1179 ILE n 
1  1180 PRO n 
1  1181 ASP n 
1  1182 GLU n 
1  1183 GLU n 
1  1184 VAL n 
1  1185 GLU n 
1  1186 GLU n 
1  1187 ASN n 
1  1188 LEU n 
1  1189 TYR n 
1  1190 LYS n 
1  1191 GLN n 
1  1192 SER n 
1  1193 PRO n 
1  1194 TRP n 
1  1195 LEU n 
1  1196 LEU n 
1  1197 ARG n 
1  1198 LEU n 
1  1199 GLU n 
1  1200 LEU n 
1  1201 ASP n 
1  1202 ARG n 
1  1203 ALA n 
1  1204 LYS n 
1  1205 MET n 
1  1206 LEU n 
1  1207 ASP n 
1  1208 LYS n 
1  1209 LYS n 
1  1210 LEU n 
1  1211 SER n 
1  1212 MET n 
1  1213 SER n 
1  1214 ASP n 
1  1215 VAL n 
1  1216 ALA n 
1  1217 GLY n 
1  1218 LYS n 
1  1219 ILE n 
1  1220 ALA n 
1  1221 GLU n 
1  1222 SER n 
1  1223 PHE n 
1  1224 GLU n 
1  1225 ARG n 
1  1226 ASP n 
1  1227 LEU n 
1  1228 PHE n 
1  1229 THR n 
1  1230 ILE n 
1  1231 TRP n 
1  1232 SER n 
1  1233 GLU n 
1  1234 ASP n 
1  1235 ASN n 
1  1236 ALA n 
1  1237 ASP n 
1  1238 LYS n 
1  1239 LEU n 
1  1240 ILE n 
1  1241 ILE n 
1  1242 ARG n 
1  1243 CYS n 
1  1244 ARG n 
1  1245 ILE n 
1  1246 ILE n 
1  1247 ARG n 
1  1248 ASP n 
1  1249 ASP n 
1  1250 ASP n 
1  1251 ARG n 
1  1252 LYS n 
1  1253 ALA n 
1  1254 GLU n 
1  1255 ASP n 
1  1256 ASP n 
1  1257 ASP n 
1  1258 ASN n 
1  1259 MET n 
1  1260 ILE n 
1  1261 GLU n 
1  1262 GLU n 
1  1263 ASP n 
1  1264 VAL n 
1  1265 PHE n 
1  1266 LEU n 
1  1267 LYS n 
1  1268 THR n 
1  1269 ILE n 
1  1270 GLU n 
1  1271 GLY n 
1  1272 HIS n 
1  1273 MET n 
1  1274 LEU n 
1  1275 GLU n 
1  1276 SER n 
1  1277 ILE n 
1  1278 SER n 
1  1279 LEU n 
1  1280 ARG n 
1  1281 GLY n 
1  1282 VAL n 
1  1283 PRO n 
1  1284 ASN n 
1  1285 ILE n 
1  1286 THR n 
1  1287 ARG n 
1  1288 VAL n 
1  1289 TYR n 
1  1290 MET n 
1  1291 MET n 
1  1292 GLU n 
1  1293 HIS n 
1  1294 LYS n 
1  1295 ILE n 
1  1296 VAL n 
1  1297 ARG n 
1  1298 GLN n 
1  1299 ILE n 
1  1300 GLU n 
1  1301 ASP n 
1  1302 GLY n 
1  1303 THR n 
1  1304 PHE n 
1  1305 GLU n 
1  1306 ARG n 
1  1307 ALA n 
1  1308 ASP n 
1  1309 GLU n 
1  1310 TRP n 
1  1311 VAL n 
1  1312 LEU n 
1  1313 GLU n 
1  1314 THR n 
1  1315 ASP n 
1  1316 GLY n 
1  1317 ILE n 
1  1318 ASN n 
1  1319 LEU n 
1  1320 THR n 
1  1321 GLU n 
1  1322 ALA n 
1  1323 MET n 
1  1324 THR n 
1  1325 VAL n 
1  1326 GLU n 
1  1327 GLY n 
1  1328 VAL n 
1  1329 ASP n 
1  1330 ALA n 
1  1331 THR n 
1  1332 ARG n 
1  1333 THR n 
1  1334 TYR n 
1  1335 SER n 
1  1336 ASN n 
1  1337 SER n 
1  1338 PHE n 
1  1339 VAL n 
1  1340 GLU n 
1  1341 ILE n 
1  1342 LEU n 
1  1343 GLN n 
1  1344 ILE n 
1  1345 LEU n 
1  1346 GLY n 
1  1347 ILE n 
1  1348 GLU n 
1  1349 ALA n 
1  1350 THR n 
1  1351 ARG n 
1  1352 SER n 
1  1353 ALA n 
1  1354 LEU n 
1  1355 LEU n 
1  1356 LYS n 
1  1357 GLU n 
1  1358 LEU n 
1  1359 ARG n 
1  1360 ASN n 
1  1361 VAL n 
1  1362 ILE n 
1  1363 GLU n 
1  1364 PHE n 
1  1365 ASP n 
1  1366 GLY n 
1  1367 SER n 
1  1368 TYR n 
1  1369 VAL n 
1  1370 ASN n 
1  1371 TYR n 
1  1372 ARG n 
1  1373 HIS n 
1  1374 LEU n 
1  1375 ALA n 
1  1376 LEU n 
1  1377 LEU n 
1  1378 CYS n 
1  1379 ASP n 
1  1380 VAL n 
1  1381 MET n 
1  1382 THR n 
1  1383 SER n 
1  1384 ARG n 
1  1385 GLY n 
1  1386 HIS n 
1  1387 LEU n 
1  1388 MET n 
1  1389 ALA n 
1  1390 ILE n 
1  1391 THR n 
1  1392 ARG n 
1  1393 HIS n 
1  1394 GLY n 
1  1395 ILE n 
1  1396 ASN n 
1  1397 ARG n 
1  1398 ALA n 
1  1399 GLU n 
1  1400 THR n 
1  1401 GLY n 
1  1402 ALA n 
1  1403 LEU n 
1  1404 MET n 
1  1405 ARG n 
1  1406 CYS n 
1  1407 SER n 
1  1408 PHE n 
1  1409 GLU n 
1  1410 GLU n 
1  1411 THR n 
1  1412 VAL n 
1  1413 GLU n 
1  1414 ILE n 
1  1415 LEU n 
1  1416 MET n 
1  1417 ASP n 
1  1418 ALA n 
1  1419 ALA n 
1  1420 ALA n 
1  1421 SER n 
1  1422 GLY n 
1  1423 GLU n 
1  1424 LYS n 
1  1425 ASP n 
1  1426 ASP n 
1  1427 CYS n 
1  1428 LYS n 
1  1429 GLY n 
1  1430 ILE n 
1  1431 SER n 
1  1432 GLU n 
1  1433 ASN n 
1  1434 ILE n 
1  1435 MET n 
1  1436 LEU n 
1  1437 GLY n 
1  1438 GLN n 
1  1439 LEU n 
1  1440 ALA n 
1  1441 PRO n 
1  1442 MET n 
1  1443 GLY n 
1  1444 THR n 
1  1445 GLY n 
1  1446 ALA n 
1  1447 PHE n 
1  1448 ASP n 
1  1449 ILE n 
1  1450 TYR n 
1  1451 LEU n 
1  1452 ASP n 
1  1453 GLN n 
1  1454 ASP n 
1  1455 MET n 
1  1456 LEU n 
1  1457 MET n 
1  1458 ASN n 
1  1459 TYR n 
1  1460 SER n 
1  1461 LEU n 
1  1462 GLY n 
1  1463 THR n 
1  1464 ALA n 
1  1465 VAL n 
1  1466 PRO n 
1  1467 THR n 
1  1468 LEU n 
1  1469 ALA n 
1  1470 GLY n 
1  1471 SER n 
1  1472 GLY n 
1  1473 MET n 
1  1474 GLY n 
1  1475 THR n 
1  1476 SER n 
1  1477 GLN n 
1  1478 LEU n 
1  1479 PRO n 
1  1480 GLU n 
1  1481 GLY n 
1  1482 ALA n 
1  1483 GLY n 
1  1484 THR n 
1  1485 PRO n 
1  1486 TYR n 
1  1487 GLU n 
1  1488 ARG n 
1  1489 SER n 
1  1490 PRO n 
1  1491 MET n 
1  1492 VAL n 
1  1493 ASP n 
1  1494 SER n 
1  1495 GLY n 
1  1496 PHE n 
1  1497 VAL n 
1  1498 GLY n 
1  1499 SER n 
1  1500 PRO n 
1  1501 ASP n 
1  1502 ALA n 
1  1503 ALA n 
1  1504 ALA n 
1  1505 PHE n 
1  1506 SER n 
1  1507 PRO n 
1  1508 LEU n 
1  1509 VAL n 
1  1510 GLN n 
1  1511 GLY n 
1  1512 GLY n 
1  1513 SER n 
1  1514 GLU n 
1  1515 GLY n 
1  1516 ARG n 
1  1517 GLU n 
1  1518 GLY n 
1  1519 PHE n 
1  1520 GLY n 
1  1521 ASP n 
1  1522 TYR n 
1  1523 GLY n 
1  1524 LEU n 
1  1525 LEU n 
1  1526 GLY n 
1  1527 ALA n 
1  1528 ALA n 
1  1529 SER n 
1  1530 PRO n 
1  1531 TYR n 
1  1532 LYS n 
1  1533 GLY n 
1  1534 VAL n 
1  1535 GLN n 
1  1536 SER n 
1  1537 PRO n 
1  1538 GLY n 
1  1539 TYR n 
1  1540 THR n 
1  1541 SER n 
1  1542 PRO n 
1  1543 PHE n 
1  1544 SER n 
1  1545 SER n 
1  1546 ALA n 
1  1547 MET n 
1  1548 SER n 
1  1549 PRO n 
1  1550 GLY n 
1  1551 TYR n 
1  1552 GLY n 
1  1553 LEU n 
1  1554 THR n 
1  1555 SER n 
1  1556 PRO n 
1  1557 SER n 
1  1558 TYR n 
1  1559 SER n 
1  1560 PRO n 
1  1561 SER n 
1  1562 SER n 
1  1563 PRO n 
1  1564 GLY n 
1  1565 TYR n 
1  1566 SER n 
1  1567 THR n 
1  1568 SER n 
1  1569 PRO n 
1  1570 ALA n 
1  1571 TYR n 
1  1572 MET n 
1  1573 PRO n 
1  1574 SER n 
1  1575 SER n 
1  1576 PRO n 
1  1577 SER n 
1  1578 TYR n 
1  1579 SER n 
1  1580 PRO n 
1  1581 THR n 
1  1582 SER n 
1  1583 PRO n 
1  1584 SER n 
1  1585 TYR n 
1  1586 SER n 
1  1587 PRO n 
1  1588 THR n 
1  1589 SER n 
1  1590 PRO n 
1  1591 SER n 
1  1592 TYR n 
1  1593 SER n 
1  1594 PRO n 
1  1595 THR n 
1  1596 SER n 
1  1597 PRO n 
1  1598 SER n 
1  1599 TYR n 
1  1600 SER n 
1  1601 PRO n 
1  1602 THR n 
1  1603 SER n 
1  1604 PRO n 
1  1605 SER n 
1  1606 TYR n 
1  1607 SER n 
1  1608 ALA n 
1  1609 THR n 
1  1610 SER n 
1  1611 PRO n 
1  1612 SER n 
1  1613 TYR n 
1  1614 SER n 
1  1615 PRO n 
1  1616 THR n 
1  1617 SER n 
1  1618 PRO n 
1  1619 SER n 
1  1620 TYR n 
1  1621 SER n 
1  1622 PRO n 
1  1623 THR n 
1  1624 SER n 
1  1625 PRO n 
1  1626 SER n 
1  1627 TYR n 
1  1628 SER n 
1  1629 PRO n 
1  1630 THR n 
1  1631 SER n 
1  1632 PRO n 
1  1633 SER n 
1  1634 TYR n 
1  1635 SER n 
1  1636 PRO n 
1  1637 THR n 
1  1638 SER n 
1  1639 PRO n 
1  1640 SER n 
1  1641 TYR n 
1  1642 SER n 
1  1643 PRO n 
1  1644 THR n 
1  1645 SER n 
1  1646 PRO n 
1  1647 SER n 
1  1648 TYR n 
1  1649 SER n 
1  1650 PRO n 
1  1651 THR n 
1  1652 SER n 
1  1653 PRO n 
1  1654 SER n 
1  1655 TYR n 
1  1656 SER n 
1  1657 PRO n 
1  1658 THR n 
1  1659 SER n 
1  1660 PRO n 
1  1661 SER n 
1  1662 TYR n 
1  1663 SER n 
1  1664 PRO n 
1  1665 THR n 
1  1666 SER n 
1  1667 PRO n 
1  1668 SER n 
1  1669 TYR n 
1  1670 SER n 
1  1671 PRO n 
1  1672 THR n 
1  1673 SER n 
1  1674 PRO n 
1  1675 SER n 
1  1676 TYR n 
1  1677 SER n 
1  1678 PRO n 
1  1679 THR n 
1  1680 SER n 
1  1681 PRO n 
1  1682 SER n 
1  1683 TYR n 
1  1684 SER n 
1  1685 PRO n 
1  1686 THR n 
1  1687 SER n 
1  1688 PRO n 
1  1689 SER n 
1  1690 TYR n 
1  1691 SER n 
1  1692 PRO n 
1  1693 THR n 
1  1694 SER n 
1  1695 PRO n 
1  1696 SER n 
1  1697 TYR n 
1  1698 SER n 
1  1699 PRO n 
1  1700 THR n 
1  1701 SER n 
1  1702 PRO n 
1  1703 SER n 
1  1704 TYR n 
1  1705 SER n 
1  1706 PRO n 
1  1707 THR n 
1  1708 SER n 
1  1709 PRO n 
1  1710 SER n 
1  1711 TYR n 
1  1712 SER n 
1  1713 PRO n 
1  1714 THR n 
1  1715 SER n 
1  1716 PRO n 
1  1717 SER n 
1  1718 TYR n 
1  1719 SER n 
1  1720 PRO n 
1  1721 THR n 
1  1722 SER n 
1  1723 PRO n 
1  1724 SER n 
1  1725 TYR n 
1  1726 SER n 
1  1727 PRO n 
1  1728 THR n 
1  1729 SER n 
1  1730 PRO n 
1  1731 SER n 
1  1732 TYR n 
1  1733 SER n 
1  1734 PRO n 
1  1735 THR n 
1  1736 SER n 
1  1737 PRO n 
1  1738 SER n 
1  1739 TYR n 
1  1740 SER n 
1  1741 PRO n 
1  1742 THR n 
1  1743 SER n 
1  1744 PRO n 
1  1745 SER n 
1  1746 TYR n 
1  1747 SER n 
1  1748 PRO n 
1  1749 THR n 
1  1750 SER n 
1  1751 PRO n 
1  1752 SER n 
2  1    MET n 
2  2    SER n 
2  3    TYR n 
2  4    GLU n 
2  5    ASP n 
2  6    TYR n 
2  7    GLN n 
2  8    TYR n 
2  9    ASN n 
2  10   GLU n 
2  11   THR n 
2  12   LEU n 
2  13   THR n 
2  14   GLN n 
2  15   GLU n 
2  16   ASP n 
2  17   CYS n 
2  18   TRP n 
2  19   THR n 
2  20   VAL n 
2  21   ILE n 
2  22   SER n 
2  23   SER n 
2  24   PHE n 
2  25   PHE n 
2  26   GLU n 
2  27   GLU n 
2  28   THR n 
2  29   SER n 
2  30   LEU n 
2  31   ALA n 
2  32   ARG n 
2  33   GLN n 
2  34   GLN n 
2  35   LEU n 
2  36   PHE n 
2  37   SER n 
2  38   PHE n 
2  39   ASP n 
2  40   GLU n 
2  41   PHE n 
2  42   VAL n 
2  43   GLN n 
2  44   ASN n 
2  45   THR n 
2  46   MET n 
2  47   GLN n 
2  48   GLU n 
2  49   ILE n 
2  50   VAL n 
2  51   ASP n 
2  52   ASP n 
2  53   ASP n 
2  54   SER n 
2  55   THR n 
2  56   LEU n 
2  57   THR n 
2  58   LEU n 
2  59   ASP n 
2  60   GLN n 
2  61   TYR n 
2  62   ALA n 
2  63   GLN n 
2  64   HIS n 
2  65   THR n 
2  66   GLY n 
2  67   ALA n 
2  68   GLN n 
2  69   GLY n 
2  70   ASP n 
2  71   VAL n 
2  72   THR n 
2  73   ARG n 
2  74   ARG n 
2  75   TYR n 
2  76   GLU n 
2  77   ILE n 
2  78   ASN n 
2  79   PHE n 
2  80   GLY n 
2  81   GLN n 
2  82   ILE n 
2  83   TYR n 
2  84   LEU n 
2  85   SER n 
2  86   ARG n 
2  87   PRO n 
2  88   THR n 
2  89   MET n 
2  90   THR n 
2  91   GLU n 
2  92   ALA n 
2  93   ASP n 
2  94   GLY n 
2  95   SER n 
2  96   THR n 
2  97   THR n 
2  98   THR n 
2  99   MET n 
2  100  PHE n 
2  101  PRO n 
2  102  GLN n 
2  103  GLU n 
2  104  ALA n 
2  105  ARG n 
2  106  LEU n 
2  107  ARG n 
2  108  ASN n 
2  109  LEU n 
2  110  THR n 
2  111  TYR n 
2  112  SER n 
2  113  SER n 
2  114  PRO n 
2  115  LEU n 
2  116  TYR n 
2  117  VAL n 
2  118  ASP n 
2  119  MET n 
2  120  ARG n 
2  121  LYS n 
2  122  LYS n 
2  123  VAL n 
2  124  MET n 
2  125  VAL n 
2  126  ALA n 
2  127  ALA n 
2  128  ASP n 
2  129  SER n 
2  130  ASN n 
2  131  VAL n 
2  132  PRO n 
2  133  ILE n 
2  134  GLY n 
2  135  GLU n 
2  136  GLU n 
2  137  GLU n 
2  138  TRP n 
2  139  LEU n 
2  140  VAL n 
2  141  GLU n 
2  142  GLU n 
2  143  GLU n 
2  144  ASP n 
2  145  GLU n 
2  146  GLU n 
2  147  PRO n 
2  148  SER n 
2  149  LYS n 
2  150  VAL n 
2  151  PHE n 
2  152  ILE n 
2  153  GLY n 
2  154  LYS n 
2  155  ILE n 
2  156  PRO n 
2  157  ILE n 
2  158  MET n 
2  159  LEU n 
2  160  ARG n 
2  161  SER n 
2  162  THR n 
2  163  PHE n 
2  164  CYS n 
2  165  ILE n 
2  166  LEU n 
2  167  ASN n 
2  168  GLY n 
2  169  VAL n 
2  170  SER n 
2  171  ASP n 
2  172  SER n 
2  173  GLU n 
2  174  LEU n 
2  175  TYR n 
2  176  ASP n 
2  177  LEU n 
2  178  ASN n 
2  179  GLU n 
2  180  CYS n 
2  181  PRO n 
2  182  TYR n 
2  183  ASP n 
2  184  GLN n 
2  185  GLY n 
2  186  GLY n 
2  187  TYR n 
2  188  PHE n 
2  189  ILE n 
2  190  ILE n 
2  191  ASN n 
2  192  GLY n 
2  193  SER n 
2  194  GLU n 
2  195  LYS n 
2  196  VAL n 
2  197  ILE n 
2  198  ILE n 
2  199  ALA n 
2  200  GLN n 
2  201  GLU n 
2  202  ARG n 
2  203  SER n 
2  204  ALA n 
2  205  ALA n 
2  206  ASN n 
2  207  ILE n 
2  208  VAL n 
2  209  GLN n 
2  210  VAL n 
2  211  PHE n 
2  212  LYS n 
2  213  LYS n 
2  214  ALA n 
2  215  ALA n 
2  216  PRO n 
2  217  SER n 
2  218  PRO n 
2  219  ILE n 
2  220  ALA n 
2  221  TYR n 
2  222  VAL n 
2  223  ALA n 
2  224  GLU n 
2  225  ILE n 
2  226  ARG n 
2  227  SER n 
2  228  ALA n 
2  229  LEU n 
2  230  GLU n 
2  231  ARG n 
2  232  GLY n 
2  233  SER n 
2  234  ARG n 
2  235  LEU n 
2  236  ILE n 
2  237  SER n 
2  238  SER n 
2  239  MET n 
2  240  GLN n 
2  241  ILE n 
2  242  LYS n 
2  243  LEU n 
2  244  MET n 
2  245  ALA n 
2  246  ARG n 
2  247  ASN n 
2  248  THR n 
2  249  GLU n 
2  250  ASN n 
2  251  SER n 
2  252  GLY n 
2  253  GLN n 
2  254  THR n 
2  255  ILE n 
2  256  ARG n 
2  257  ALA n 
2  258  THR n 
2  259  LEU n 
2  260  PRO n 
2  261  TYR n 
2  262  ILE n 
2  263  ARG n 
2  264  SER n 
2  265  ASP n 
2  266  ILE n 
2  267  PRO n 
2  268  ILE n 
2  269  VAL n 
2  270  ILE n 
2  271  VAL n 
2  272  PHE n 
2  273  ARG n 
2  274  ALA n 
2  275  LEU n 
2  276  GLY n 
2  277  VAL n 
2  278  VAL n 
2  279  PRO n 
2  280  ASP n 
2  281  ARG n 
2  282  ASP n 
2  283  ILE n 
2  284  LEU n 
2  285  GLU n 
2  286  HIS n 
2  287  ILE n 
2  288  CYS n 
2  289  TYR n 
2  290  ASP n 
2  291  PRO n 
2  292  ASN n 
2  293  ASP n 
2  294  PHE n 
2  295  GLN n 
2  296  MET n 
2  297  LEU n 
2  298  GLU n 
2  299  MET n 
2  300  MET n 
2  301  LYS n 
2  302  PRO n 
2  303  CYS n 
2  304  ILE n 
2  305  GLU n 
2  306  GLU n 
2  307  ALA n 
2  308  PHE n 
2  309  VAL n 
2  310  ILE n 
2  311  GLN n 
2  312  ASP n 
2  313  LYS n 
2  314  ASP n 
2  315  ILE n 
2  316  ALA n 
2  317  LEU n 
2  318  ASP n 
2  319  TYR n 
2  320  ILE n 
2  321  GLY n 
2  322  LYS n 
2  323  ARG n 
2  324  GLY n 
2  325  SER n 
2  326  THR n 
2  327  THR n 
2  328  GLY n 
2  329  VAL n 
2  330  THR n 
2  331  ARG n 
2  332  GLU n 
2  333  LYS n 
2  334  ARG n 
2  335  LEU n 
2  336  ARG n 
2  337  TYR n 
2  338  ALA n 
2  339  HIS n 
2  340  ASP n 
2  341  ILE n 
2  342  LEU n 
2  343  GLN n 
2  344  LYS n 
2  345  GLU n 
2  346  LEU n 
2  347  LEU n 
2  348  PRO n 
2  349  HIS n 
2  350  ILE n 
2  351  THR n 
2  352  THR n 
2  353  MET n 
2  354  GLU n 
2  355  GLY n 
2  356  PHE n 
2  357  GLU n 
2  358  THR n 
2  359  ARG n 
2  360  LYS n 
2  361  ALA n 
2  362  PHE n 
2  363  PHE n 
2  364  LEU n 
2  365  GLY n 
2  366  TYR n 
2  367  MET n 
2  368  ILE n 
2  369  HIS n 
2  370  ARG n 
2  371  MET n 
2  372  LEU n 
2  373  LEU n 
2  374  CYS n 
2  375  ALA n 
2  376  LEU n 
2  377  GLU n 
2  378  ARG n 
2  379  ARG n 
2  380  GLU n 
2  381  PRO n 
2  382  ASP n 
2  383  ASP n 
2  384  ARG n 
2  385  ASP n 
2  386  HIS n 
2  387  PHE n 
2  388  GLY n 
2  389  LYS n 
2  390  LYS n 
2  391  ARG n 
2  392  LEU n 
2  393  ASP n 
2  394  LEU n 
2  395  ALA n 
2  396  GLY n 
2  397  PRO n 
2  398  LEU n 
2  399  LEU n 
2  400  ALA n 
2  401  SER n 
2  402  LEU n 
2  403  PHE n 
2  404  ARG n 
2  405  MET n 
2  406  LEU n 
2  407  PHE n 
2  408  ARG n 
2  409  LYS n 
2  410  MET n 
2  411  THR n 
2  412  ARG n 
2  413  ASP n 
2  414  VAL n 
2  415  TYR n 
2  416  LYS n 
2  417  TYR n 
2  418  MET n 
2  419  GLN n 
2  420  LYS n 
2  421  CYS n 
2  422  VAL n 
2  423  GLU n 
2  424  THR n 
2  425  ASN n 
2  426  ARG n 
2  427  GLU n 
2  428  PHE n 
2  429  ASN n 
2  430  LEU n 
2  431  THR n 
2  432  LEU n 
2  433  ALA n 
2  434  VAL n 
2  435  LYS n 
2  436  SER n 
2  437  ASN n 
2  438  ILE n 
2  439  ILE n 
2  440  THR n 
2  441  ASN n 
2  442  GLY n 
2  443  LEU n 
2  444  ARG n 
2  445  TYR n 
2  446  SER n 
2  447  LEU n 
2  448  ALA n 
2  449  THR n 
2  450  GLY n 
2  451  ASN n 
2  452  TRP n 
2  453  GLY n 
2  454  ASP n 
2  455  GLN n 
2  456  LYS n 
2  457  ARG n 
2  458  SER n 
2  459  MET n 
2  460  VAL n 
2  461  ASN n 
2  462  ARG n 
2  463  VAL n 
2  464  GLY n 
2  465  VAL n 
2  466  SER n 
2  467  GLN n 
2  468  VAL n 
2  469  LEU n 
2  470  ASN n 
2  471  ARG n 
2  472  TYR n 
2  473  THR n 
2  474  PHE n 
2  475  ALA n 
2  476  SER n 
2  477  THR n 
2  478  LEU n 
2  479  SER n 
2  480  HIS n 
2  481  LEU n 
2  482  ARG n 
2  483  ARG n 
2  484  THR n 
2  485  ASN n 
2  486  THR n 
2  487  PRO n 
2  488  ILE n 
2  489  GLY n 
2  490  ARG n 
2  491  ASP n 
2  492  GLY n 
2  493  LYS n 
2  494  LEU n 
2  495  ALA n 
2  496  LYS n 
2  497  PRO n 
2  498  ARG n 
2  499  GLN n 
2  500  LEU n 
2  501  HIS n 
2  502  ASN n 
2  503  THR n 
2  504  HIS n 
2  505  TRP n 
2  506  GLY n 
2  507  MET n 
2  508  VAL n 
2  509  CYS n 
2  510  PRO n 
2  511  ALA n 
2  512  GLU n 
2  513  THR n 
2  514  PRO n 
2  515  GLU n 
2  516  GLY n 
2  517  GLN n 
2  518  ALA n 
2  519  CYS n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  LYS n 
2  524  ASN n 
2  525  LEU n 
2  526  SER n 
2  527  LEU n 
2  528  MET n 
2  529  SER n 
2  530  TYR n 
2  531  VAL n 
2  532  SER n 
2  533  VAL n 
2  534  GLY n 
2  535  SER n 
2  536  PRO n 
2  537  SER n 
2  538  ALA n 
2  539  PRO n 
2  540  ILE n 
2  541  ILE n 
2  542  GLU n 
2  543  PHE n 
2  544  LEU n 
2  545  GLU n 
2  546  GLU n 
2  547  TRP n 
2  548  GLY n 
2  549  LEU n 
2  550  GLU n 
2  551  THR n 
2  552  LEU n 
2  553  GLU n 
2  554  ASP n 
2  555  TYR n 
2  556  ASN n 
2  557  PRO n 
2  558  SER n 
2  559  ALA n 
2  560  SER n 
2  561  PRO n 
2  562  ASN n 
2  563  ALA n 
2  564  THR n 
2  565  LYS n 
2  566  VAL n 
2  567  PHE n 
2  568  VAL n 
2  569  ASN n 
2  570  GLY n 
2  571  VAL n 
2  572  TRP n 
2  573  LEU n 
2  574  GLY n 
2  575  VAL n 
2  576  HIS n 
2  577  ARG n 
2  578  ASP n 
2  579  PRO n 
2  580  ALA n 
2  581  HIS n 
2  582  LEU n 
2  583  THR n 
2  584  GLU n 
2  585  THR n 
2  586  LEU n 
2  587  ARG n 
2  588  SER n 
2  589  LEU n 
2  590  ARG n 
2  591  ARG n 
2  592  ARG n 
2  593  LEU n 
2  594  ASP n 
2  595  ILE n 
2  596  SER n 
2  597  ALA n 
2  598  GLU n 
2  599  VAL n 
2  600  SER n 
2  601  ILE n 
2  602  VAL n 
2  603  ARG n 
2  604  ASP n 
2  605  ILE n 
2  606  ARG n 
2  607  GLU n 
2  608  LYS n 
2  609  GLU n 
2  610  LEU n 
2  611  ARG n 
2  612  LEU n 
2  613  PHE n 
2  614  THR n 
2  615  ASP n 
2  616  ALA n 
2  617  GLY n 
2  618  ARG n 
2  619  ILE n 
2  620  CYS n 
2  621  ARG n 
2  622  PRO n 
2  623  LEU n 
2  624  PHE n 
2  625  ILE n 
2  626  VAL n 
2  627  ASP n 
2  628  ASN n 
2  629  ASN n 
2  630  PRO n 
2  631  ASN n 
2  632  SER n 
2  633  GLU n 
2  634  ARG n 
2  635  ARG n 
2  636  GLY n 
2  637  GLU n 
2  638  LEU n 
2  639  CYS n 
2  640  ILE n 
2  641  ARG n 
2  642  LYS n 
2  643  GLU n 
2  644  HIS n 
2  645  ILE n 
2  646  GLN n 
2  647  GLN n 
2  648  LEU n 
2  649  ILE n 
2  650  GLU n 
2  651  ASP n 
2  652  LYS n 
2  653  ASP n 
2  654  ARG n 
2  655  TYR n 
2  656  ASP n 
2  657  ILE n 
2  658  ASP n 
2  659  PRO n 
2  660  GLU n 
2  661  GLN n 
2  662  ARG n 
2  663  PHE n 
2  664  GLY n 
2  665  TRP n 
2  666  THR n 
2  667  ALA n 
2  668  LEU n 
2  669  VAL n 
2  670  SER n 
2  671  SER n 
2  672  GLY n 
2  673  LEU n 
2  674  ILE n 
2  675  GLU n 
2  676  TYR n 
2  677  LEU n 
2  678  ASP n 
2  679  ALA n 
2  680  GLU n 
2  681  GLU n 
2  682  GLU n 
2  683  GLU n 
2  684  THR n 
2  685  VAL n 
2  686  MET n 
2  687  ILE n 
2  688  ALA n 
2  689  MET n 
2  690  SER n 
2  691  PRO n 
2  692  GLU n 
2  693  ASP n 
2  694  LEU n 
2  695  GLU n 
2  696  ALA n 
2  697  SER n 
2  698  ARG n 
2  699  GLN n 
2  700  MET n 
2  701  GLN n 
2  702  ALA n 
2  703  GLY n 
2  704  TYR n 
2  705  GLU n 
2  706  VAL n 
2  707  LYS n 
2  708  GLU n 
2  709  GLU n 
2  710  LEU n 
2  711  ASP n 
2  712  PRO n 
2  713  ALA n 
2  714  GLN n 
2  715  ARG n 
2  716  VAL n 
2  717  LYS n 
2  718  PRO n 
2  719  ALA n 
2  720  PRO n 
2  721  ASN n 
2  722  PRO n 
2  723  HIS n 
2  724  VAL n 
2  725  HIS n 
2  726  ALA n 
2  727  TRP n 
2  728  THR n 
2  729  HIS n 
2  730  CYS n 
2  731  GLU n 
2  732  ILE n 
2  733  HIS n 
2  734  PRO n 
2  735  ALA n 
2  736  MET n 
2  737  ILE n 
2  738  LEU n 
2  739  GLY n 
2  740  ILE n 
2  741  LEU n 
2  742  ALA n 
2  743  SER n 
2  744  ILE n 
2  745  ILE n 
2  746  PRO n 
2  747  PHE n 
2  748  PRO n 
2  749  ASP n 
2  750  HIS n 
2  751  ASN n 
2  752  GLN n 
2  753  SER n 
2  754  PRO n 
2  755  ARG n 
2  756  ASN n 
2  757  THR n 
2  758  TYR n 
2  759  GLN n 
2  760  SER n 
2  761  ALA n 
2  762  MET n 
2  763  GLY n 
2  764  LYS n 
2  765  GLN n 
2  766  ALA n 
2  767  MET n 
2  768  GLY n 
2  769  VAL n 
2  770  TYR n 
2  771  LEU n 
2  772  THR n 
2  773  ASN n 
2  774  TYR n 
2  775  GLN n 
2  776  VAL n 
2  777  ARG n 
2  778  MET n 
2  779  ASP n 
2  780  THR n 
2  781  MET n 
2  782  ALA n 
2  783  ASN n 
2  784  ILE n 
2  785  LEU n 
2  786  TYR n 
2  787  TYR n 
2  788  PRO n 
2  789  GLN n 
2  790  LYS n 
2  791  PRO n 
2  792  LEU n 
2  793  ALA n 
2  794  THR n 
2  795  THR n 
2  796  ARG n 
2  797  SER n 
2  798  MET n 
2  799  GLU n 
2  800  TYR n 
2  801  LEU n 
2  802  LYS n 
2  803  PHE n 
2  804  ARG n 
2  805  GLU n 
2  806  LEU n 
2  807  PRO n 
2  808  ALA n 
2  809  GLY n 
2  810  GLN n 
2  811  ASN n 
2  812  ALA n 
2  813  ILE n 
2  814  VAL n 
2  815  ALA n 
2  816  ILE n 
2  817  LEU n 
2  818  CYS n 
2  819  TYR n 
2  820  SER n 
2  821  GLY n 
2  822  TYR n 
2  823  ASN n 
2  824  GLN n 
2  825  GLU n 
2  826  ASP n 
2  827  SER n 
2  828  ILE n 
2  829  ILE n 
2  830  MET n 
2  831  ASN n 
2  832  GLN n 
2  833  ALA n 
2  834  SER n 
2  835  ILE n 
2  836  ASP n 
2  837  ARG n 
2  838  GLY n 
2  839  LEU n 
2  840  PHE n 
2  841  ARG n 
2  842  SER n 
2  843  ILE n 
2  844  PHE n 
2  845  TYR n 
2  846  ARG n 
2  847  THR n 
2  848  TYR n 
2  849  THR n 
2  850  ASP n 
2  851  GLN n 
2  852  GLU n 
2  853  LYS n 
2  854  LYS n 
2  855  ILE n 
2  856  GLY n 
2  857  MET n 
2  858  THR n 
2  859  VAL n 
2  860  MET n 
2  861  GLU n 
2  862  GLU n 
2  863  PHE n 
2  864  GLU n 
2  865  ARG n 
2  866  PRO n 
2  867  VAL n 
2  868  ARG n 
2  869  SER n 
2  870  THR n 
2  871  THR n 
2  872  LEU n 
2  873  ARG n 
2  874  MET n 
2  875  LYS n 
2  876  HIS n 
2  877  GLY n 
2  878  THR n 
2  879  TYR n 
2  880  ASP n 
2  881  LYS n 
2  882  LEU n 
2  883  GLU n 
2  884  ASP n 
2  885  ASP n 
2  886  GLY n 
2  887  LEU n 
2  888  ILE n 
2  889  ALA n 
2  890  PRO n 
2  891  GLY n 
2  892  THR n 
2  893  ARG n 
2  894  VAL n 
2  895  SER n 
2  896  GLY n 
2  897  GLU n 
2  898  ASP n 
2  899  ILE n 
2  900  ILE n 
2  901  ILE n 
2  902  GLY n 
2  903  LYS n 
2  904  THR n 
2  905  ALA n 
2  906  PRO n 
2  907  ILE n 
2  908  PRO n 
2  909  LEU n 
2  910  ASP n 
2  911  HIS n 
2  912  GLU n 
2  913  GLU n 
2  914  LEU n 
2  915  GLY n 
2  916  GLN n 
2  917  ARG n 
2  918  THR n 
2  919  GLN n 
2  920  LEU n 
2  921  HIS n 
2  922  ALA n 
2  923  LYS n 
2  924  ARG n 
2  925  ASP n 
2  926  VAL n 
2  927  SER n 
2  928  THR n 
2  929  PRO n 
2  930  LEU n 
2  931  ARG n 
2  932  SER n 
2  933  THR n 
2  934  GLU n 
2  935  SER n 
2  936  GLY n 
2  937  ILE n 
2  938  VAL n 
2  939  ASP n 
2  940  GLN n 
2  941  VAL n 
2  942  MET n 
2  943  VAL n 
2  944  THR n 
2  945  THR n 
2  946  ASN n 
2  947  GLN n 
2  948  GLU n 
2  949  GLY n 
2  950  LEU n 
2  951  LYS n 
2  952  PHE n 
2  953  VAL n 
2  954  LYS n 
2  955  VAL n 
2  956  ARG n 
2  957  MET n 
2  958  ARG n 
2  959  SER n 
2  960  THR n 
2  961  ARG n 
2  962  ILE n 
2  963  PRO n 
2  964  GLN n 
2  965  ILE n 
2  966  GLY n 
2  967  ASP n 
2  968  LYS n 
2  969  PHE n 
2  970  ALA n 
2  971  SER n 
2  972  ARG n 
2  973  HIS n 
2  974  GLY n 
2  975  GLN n 
2  976  LYS n 
2  977  GLY n 
2  978  THR n 
2  979  ILE n 
2  980  GLY n 
2  981  MET n 
2  982  THR n 
2  983  TYR n 
2  984  ARG n 
2  985  HIS n 
2  986  GLU n 
2  987  ASP n 
2  988  MET n 
2  989  PRO n 
2  990  PHE n 
2  991  SER n 
2  992  ALA n 
2  993  GLN n 
2  994  GLY n 
2  995  ILE n 
2  996  VAL n 
2  997  PRO n 
2  998  ASP n 
2  999  ILE n 
2  1000 ILE n 
2  1001 ILE n 
2  1002 ASN n 
2  1003 PRO n 
2  1004 HIS n 
2  1005 ALA n 
2  1006 ILE n 
2  1007 PRO n 
2  1008 SER n 
2  1009 ARG n 
2  1010 MET n 
2  1011 THR n 
2  1012 VAL n 
2  1013 ALA n 
2  1014 HIS n 
2  1015 LEU n 
2  1016 VAL n 
2  1017 GLU n 
2  1018 CYS n 
2  1019 GLN n 
2  1020 LEU n 
2  1021 SER n 
2  1022 LYS n 
2  1023 VAL n 
2  1024 SER n 
2  1025 ALA n 
2  1026 LEU n 
2  1027 SER n 
2  1028 GLY n 
2  1029 PHE n 
2  1030 GLU n 
2  1031 GLY n 
2  1032 ASP n 
2  1033 ALA n 
2  1034 THR n 
2  1035 PRO n 
2  1036 PHE n 
2  1037 THR n 
2  1038 ASP n 
2  1039 VAL n 
2  1040 THR n 
2  1041 VAL n 
2  1042 GLU n 
2  1043 ALA n 
2  1044 VAL n 
2  1045 SER n 
2  1046 LYS n 
2  1047 LEU n 
2  1048 LEU n 
2  1049 ARG n 
2  1050 SER n 
2  1051 HIS n 
2  1052 GLY n 
2  1053 PHE n 
2  1054 GLN n 
2  1055 SER n 
2  1056 ARG n 
2  1057 GLY n 
2  1058 PHE n 
2  1059 GLU n 
2  1060 VAL n 
2  1061 MET n 
2  1062 TYR n 
2  1063 HIS n 
2  1064 GLY n 
2  1065 HIS n 
2  1066 THR n 
2  1067 GLY n 
2  1068 ARG n 
2  1069 LYS n 
2  1070 LEU n 
2  1071 VAL n 
2  1072 ALA n 
2  1073 GLN n 
2  1074 VAL n 
2  1075 PHE n 
2  1076 LEU n 
2  1077 GLY n 
2  1078 PRO n 
2  1079 THR n 
2  1080 TYR n 
2  1081 TYR n 
2  1082 GLN n 
2  1083 ARG n 
2  1084 LEU n 
2  1085 LYS n 
2  1086 HIS n 
2  1087 LEU n 
2  1088 VAL n 
2  1089 ASP n 
2  1090 ASP n 
2  1091 LYS n 
2  1092 ILE n 
2  1093 HIS n 
2  1094 ALA n 
2  1095 ARG n 
2  1096 ALA n 
2  1097 ARG n 
2  1098 GLY n 
2  1099 PRO n 
2  1100 VAL n 
2  1101 GLN n 
2  1102 ILE n 
2  1103 LEU n 
2  1104 THR n 
2  1105 ARG n 
2  1106 GLN n 
2  1107 PRO n 
2  1108 VAL n 
2  1109 GLU n 
2  1110 GLY n 
2  1111 ARG n 
2  1112 SER n 
2  1113 ARG n 
2  1114 ASP n 
2  1115 GLY n 
2  1116 GLY n 
2  1117 LEU n 
2  1118 ARG n 
2  1119 PHE n 
2  1120 GLY n 
2  1121 GLU n 
2  1122 MET n 
2  1123 GLU n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 CYS n 
2  1127 GLN n 
2  1128 ILE n 
2  1129 SER n 
2  1130 HIS n 
2  1131 GLY n 
2  1132 CYS n 
2  1133 SER n 
2  1134 SER n 
2  1135 VAL n 
2  1136 LEU n 
2  1137 ARG n 
2  1138 GLU n 
2  1139 ARG n 
2  1140 LEU n 
2  1141 PHE n 
2  1142 ASP n 
2  1143 CYS n 
2  1144 SER n 
2  1145 ASP n 
2  1146 ALA n 
2  1147 TYR n 
2  1148 ARG n 
2  1149 VAL n 
2  1150 ILE n 
2  1151 VAL n 
2  1152 CYS n 
2  1153 ASP n 
2  1154 ILE n 
2  1155 CYS n 
2  1156 GLY n 
2  1157 LEU n 
2  1158 ILE n 
2  1159 ALA n 
2  1160 ILE n 
2  1161 ALA n 
2  1162 SER n 
2  1163 TYR n 
2  1164 LYS n 
2  1165 LYS n 
2  1166 ASP n 
2  1167 SER n 
2  1168 TYR n 
2  1169 GLU n 
2  1170 CYS n 
2  1171 ARG n 
2  1172 SER n 
2  1173 CYS n 
2  1174 GLN n 
2  1175 ASN n 
2  1176 ARG n 
2  1177 THR n 
2  1178 ARG n 
2  1179 PHE n 
2  1180 SER n 
2  1181 GLN n 
2  1182 VAL n 
2  1183 TYR n 
2  1184 LEU n 
2  1185 PRO n 
2  1186 TYR n 
2  1187 ALA n 
2  1188 ALA n 
2  1189 LYS n 
2  1190 LEU n 
2  1191 LEU n 
2  1192 PHE n 
2  1193 GLN n 
2  1194 GLU n 
2  1195 LEU n 
2  1196 MET n 
2  1197 SER n 
2  1198 MET n 
2  1199 ASN n 
2  1200 ILE n 
2  1201 ALA n 
2  1202 PRO n 
2  1203 ARG n 
2  1204 LEU n 
2  1205 PHE n 
2  1206 THR n 
2  1207 LYS n 
2  1208 ASN n 
2  1209 HIS n 
2  1210 LYS n 
3  1    MET n 
3  2    ASP n 
3  3    SER n 
3  4    GLU n 
3  5    THR n 
3  6    HIS n 
3  7    ILE n 
3  8    THR n 
3  9    ILE n 
3  10   ARG n 
3  11   ASN n 
3  12   ILE n 
3  13   SER n 
3  14   LYS n 
3  15   ASN n 
3  16   SER n 
3  17   VAL n 
3  18   ASP n 
3  19   PHE n 
3  20   VAL n 
3  21   LEU n 
3  22   THR n 
3  23   ASN n 
3  24   THR n 
3  25   SER n 
3  26   LEU n 
3  27   ALA n 
3  28   VAL n 
3  29   ALA n 
3  30   ASN n 
3  31   SER n 
3  32   LEU n 
3  33   ARG n 
3  34   ARG n 
3  35   VAL n 
3  36   VAL n 
3  37   LEU n 
3  38   ALA n 
3  39   GLU n 
3  40   ILE n 
3  41   PRO n 
3  42   THR n 
3  43   VAL n 
3  44   ALA n 
3  45   ILE n 
3  46   ASP n 
3  47   LEU n 
3  48   VAL n 
3  49   GLU n 
3  50   ILE n 
3  51   ASN n 
3  52   VAL n 
3  53   ASN n 
3  54   THR n 
3  55   SER n 
3  56   VAL n 
3  57   MET n 
3  58   PRO n 
3  59   ASP n 
3  60   GLU n 
3  61   PHE n 
3  62   LEU n 
3  63   ALA n 
3  64   HIS n 
3  65   ARG n 
3  66   LEU n 
3  67   GLY n 
3  68   MET n 
3  69   ILE n 
3  70   PRO n 
3  71   LEU n 
3  72   ASP n 
3  73   SER n 
3  74   SER n 
3  75   ASN n 
3  76   ILE n 
3  77   ASP n 
3  78   GLU n 
3  79   PRO n 
3  80   PRO n 
3  81   PRO n 
3  82   VAL n 
3  83   GLY n 
3  84   LEU n 
3  85   GLU n 
3  86   TYR n 
3  87   THR n 
3  88   ARG n 
3  89   ASN n 
3  90   CYS n 
3  91   ASP n 
3  92   CYS n 
3  93   ASP n 
3  94   GLN n 
3  95   TYR n 
3  96   CYS n 
3  97   PRO n 
3  98   LYS n 
3  99   CYS n 
3  100  SER n 
3  101  VAL n 
3  102  GLU n 
3  103  LEU n 
3  104  PHE n 
3  105  LEU n 
3  106  ASN n 
3  107  ALA n 
3  108  LYS n 
3  109  CYS n 
3  110  THR n 
3  111  GLY n 
3  112  GLU n 
3  113  GLY n 
3  114  THR n 
3  115  MET n 
3  116  GLU n 
3  117  ILE n 
3  118  TYR n 
3  119  ALA n 
3  120  ARG n 
3  121  ASP n 
3  122  LEU n 
3  123  VAL n 
3  124  VAL n 
3  125  SER n 
3  126  SER n 
3  127  ASN n 
3  128  SER n 
3  129  SER n 
3  130  LEU n 
3  131  GLY n 
3  132  HIS n 
3  133  PRO n 
3  134  ILE n 
3  135  LEU n 
3  136  ALA n 
3  137  ASP n 
3  138  PRO n 
3  139  LYS n 
3  140  SER n 
3  141  ARG n 
3  142  GLY n 
3  143  PRO n 
3  144  LEU n 
3  145  ILE n 
3  146  CYS n 
3  147  LYS n 
3  148  LEU n 
3  149  ARG n 
3  150  LYS n 
3  151  GLU n 
3  152  GLN n 
3  153  GLU n 
3  154  ILE n 
3  155  SER n 
3  156  LEU n 
3  157  ARG n 
3  158  CYS n 
3  159  ILE n 
3  160  ALA n 
3  161  LYS n 
3  162  LYS n 
3  163  GLY n 
3  164  ILE n 
3  165  ALA n 
3  166  LYS n 
3  167  GLU n 
3  168  HIS n 
3  169  ALA n 
3  170  LYS n 
3  171  TRP n 
3  172  SER n 
3  173  PRO n 
3  174  THR n 
3  175  SER n 
3  176  ALA n 
3  177  VAL n 
3  178  ALA n 
3  179  PHE n 
3  180  GLU n 
3  181  TYR n 
3  182  ASP n 
3  183  PRO n 
3  184  TRP n 
3  185  ASN n 
3  186  LYS n 
3  187  LEU n 
3  188  GLN n 
3  189  HIS n 
3  190  THR n 
3  191  ASP n 
3  192  TYR n 
3  193  TRP n 
3  194  PHE n 
3  195  GLU n 
3  196  ASN n 
3  197  ASP n 
3  198  ALA n 
3  199  ASP n 
3  200  ALA n 
3  201  GLU n 
3  202  TRP n 
3  203  PRO n 
3  204  LYS n 
3  205  SER n 
3  206  LYS n 
3  207  ASN n 
3  208  ALA n 
3  209  ASP n 
3  210  TRP n 
3  211  GLU n 
3  212  GLU n 
3  213  PRO n 
3  214  PRO n 
3  215  ARG n 
3  216  GLU n 
3  217  GLY n 
3  218  GLU n 
3  219  PRO n 
3  220  PHE n 
3  221  ASN n 
3  222  PHE n 
3  223  GLN n 
3  224  GLU n 
3  225  GLU n 
3  226  PRO n 
3  227  ARG n 
3  228  ARG n 
3  229  PHE n 
3  230  TYR n 
3  231  MET n 
3  232  ASP n 
3  233  VAL n 
3  234  GLU n 
3  235  SER n 
3  236  VAL n 
3  237  GLY n 
3  238  SER n 
3  239  ILE n 
3  240  PRO n 
3  241  PRO n 
3  242  ASN n 
3  243  GLU n 
3  244  ILE n 
3  245  MET n 
3  246  VAL n 
3  247  GLN n 
3  248  GLY n 
3  249  LEU n 
3  250  ARG n 
3  251  ILE n 
3  252  LEU n 
3  253  GLN n 
3  254  GLU n 
3  255  LYS n 
3  256  LEU n 
3  257  ALA n 
3  258  VAL n 
3  259  LEU n 
3  260  VAL n 
3  261  ARG n 
3  262  ASP n 
3  263  LEU n 
3  264  ASP n 
3  265  GLU n 
3  266  GLU n 
3  267  GLN n 
3  268  PRO n 
3  269  THR n 
3  270  GLN n 
3  271  LEU n 
3  272  SER n 
3  273  ALA n 
3  274  ASN n 
3  275  GLU n 
3  276  LEU n 
3  277  ASN n 
3  278  MET n 
3  279  GLU n 
3  280  GLU n 
3  281  ASN n 
3  282  ALA n 
3  283  GLU n 
3  284  MET n 
3  285  ASN n 
3  286  TRP n 
3  287  SER n 
3  288  PRO n 
3  289  TYR n 
3  290  GLN n 
3  291  ASN n 
3  292  GLY n 
3  293  GLU n 
3  294  GLU n 
3  295  ASN n 
3  296  THR n 
3  297  TRP n 
4  1    MET n 
4  2    PRO n 
4  3    ARG n 
4  4    ALA n 
4  5    ILE n 
4  6    PHE n 
4  7    GLU n 
4  8    GLU n 
4  9    ASP n 
4  10   ALA n 
4  11   ALA n 
4  12   GLN n 
4  13   LEU n 
4  14   LYS n 
4  15   LEU n 
4  16   GLY n 
4  17   PRO n 
4  18   GLU n 
4  19   PHE n 
4  20   GLU n 
4  21   ASN n 
4  22   GLU n 
4  23   ASP n 
4  24   MET n 
4  25   LEU n 
4  26   THR n 
4  27   VAL n 
4  28   SER n 
4  29   GLU n 
4  30   ALA n 
4  31   LYS n 
4  32   ILE n 
4  33   LEU n 
4  34   ILE n 
4  35   GLU n 
4  36   THR n 
4  37   VAL n 
4  38   LEU n 
4  39   ALA n 
4  40   GLN n 
4  41   ARG n 
4  42   ALA n 
4  43   ARG n 
4  44   GLU n 
4  45   THR n 
4  46   ASN n 
4  47   GLY n 
4  48   GLU n 
4  49   ILE n 
4  50   PRO n 
4  51   MET n 
4  52   THR n 
4  53   ASP n 
4  54   VAL n 
4  55   MET n 
4  56   LYS n 
4  57   LYS n 
4  58   THR n 
4  59   VAL n 
4  60   ALA n 
4  61   TYR n 
4  62   PHE n 
4  63   ASN n 
4  64   VAL n 
4  65   PHE n 
4  66   ALA n 
4  67   ARG n 
4  68   PHE n 
4  69   LYS n 
4  70   THR n 
4  71   ALA n 
4  72   GLU n 
4  73   ALA n 
4  74   THR n 
4  75   TYR n 
4  76   ALA n 
4  77   CYS n 
4  78   GLU n 
4  79   ARG n 
4  80   ILE n 
4  81   LEU n 
4  82   GLY n 
4  83   ASN n 
4  84   ARG n 
4  85   PHE n 
4  86   HIS n 
4  87   LYS n 
4  88   PHE n 
4  89   GLU n 
4  90   ARG n 
4  91   ALA n 
4  92   GLN n 
4  93   LEU n 
4  94   GLY n 
4  95   THR n 
4  96   LEU n 
4  97   CYS n 
4  98   CYS n 
4  99   GLU n 
4  100  ASP n 
4  101  ALA n 
4  102  GLU n 
4  103  GLU n 
4  104  ALA n 
4  105  ARG n 
4  106  THR n 
4  107  LEU n 
4  108  ILE n 
4  109  PRO n 
4  110  SER n 
4  111  LEU n 
4  112  ALA n 
4  113  ASN n 
4  114  LYS n 
4  115  ILE n 
4  116  ASP n 
4  117  ASP n 
4  118  GLN n 
4  119  ASN n 
4  120  LEU n 
4  121  GLN n 
4  122  GLY n 
4  123  ILE n 
4  124  LEU n 
4  125  ASP n 
4  126  GLU n 
4  127  LEU n 
4  128  SER n 
4  129  THR n 
4  130  LEU n 
4  131  ARG n 
4  132  LYS n 
4  133  PHE n 
4  134  GLN n 
4  135  ASP n 
5  1    MET n 
5  2    SER n 
5  3    ALA n 
5  4    GLU n 
5  5    GLU n 
5  6    LYS n 
5  7    ASN n 
5  8    ILE n 
5  9    VAL n 
5  10   ARG n 
5  11   VAL n 
5  12   PHE n 
5  13   ARG n 
5  14   ALA n 
5  15   TRP n 
5  16   LYS n 
5  17   THR n 
5  18   ALA n 
5  19   HIS n 
5  20   GLN n 
5  21   LEU n 
5  22   VAL n 
5  23   HIS n 
5  24   ASP n 
5  25   ARG n 
5  26   GLY n 
5  27   TYR n 
5  28   GLY n 
5  29   VAL n 
5  30   SER n 
5  31   GLN n 
5  32   ALA n 
5  33   GLU n 
5  34   LEU n 
5  35   ASP n 
5  36   LEU n 
5  37   THR n 
5  38   LEU n 
5  39   ASP n 
5  40   GLN n 
5  41   PHE n 
5  42   LYS n 
5  43   ALA n 
5  44   MET n 
5  45   HIS n 
5  46   CYS n 
5  47   GLY n 
5  48   MET n 
5  49   GLY n 
5  50   ARG n 
5  51   ASN n 
5  52   LEU n 
5  53   ASP n 
5  54   ARG n 
5  55   THR n 
5  56   THR n 
5  57   LEU n 
5  58   SER n 
5  59   PHE n 
5  60   TYR n 
5  61   ALA n 
5  62   LYS n 
5  63   PRO n 
5  64   SER n 
5  65   ASN n 
5  66   ASP n 
5  67   SER n 
5  68   ASN n 
5  69   LYS n 
5  70   GLY n 
5  71   THR n 
5  72   ILE n 
5  73   TYR n 
5  74   ILE n 
5  75   GLU n 
5  76   PHE n 
5  77   ALA n 
5  78   LYS n 
5  79   GLU n 
5  80   PRO n 
5  81   SER n 
5  82   VAL n 
5  83   GLY n 
5  84   ILE n 
5  85   LYS n 
5  86   GLU n 
5  87   MET n 
5  88   ARG n 
5  89   THR n 
5  90   PHE n 
5  91   VAL n 
5  92   HIS n 
5  93   THR n 
5  94   LEU n 
5  95   GLY n 
5  96   ASP n 
5  97   HIS n 
5  98   ASN n 
5  99   HIS n 
5  100  LYS n 
5  101  THR n 
5  102  GLY n 
5  103  ILE n 
5  104  LEU n 
5  105  ILE n 
5  106  TYR n 
5  107  ALA n 
5  108  ASN n 
5  109  SER n 
5  110  MET n 
5  111  THR n 
5  112  PRO n 
5  113  SER n 
5  114  ALA n 
5  115  ALA n 
5  116  LYS n 
5  117  ILE n 
5  118  ILE n 
5  119  ALA n 
5  120  THR n 
5  121  VAL n 
5  122  THR n 
5  123  GLY n 
5  124  GLN n 
5  125  PHE n 
5  126  THR n 
5  127  ILE n 
5  128  GLU n 
5  129  THR n 
5  130  PHE n 
5  131  GLN n 
5  132  GLU n 
5  133  SER n 
5  134  ASP n 
5  135  LEU n 
5  136  ILE n 
5  137  VAL n 
5  138  ASN n 
5  139  ILE n 
5  140  THR n 
5  141  HIS n 
5  142  HIS n 
5  143  GLU n 
5  144  LEU n 
5  145  VAL n 
5  146  PRO n 
5  147  LYS n 
5  148  HIS n 
5  149  ILE n 
5  150  LEU n 
5  151  LEU n 
5  152  SER n 
5  153  PRO n 
5  154  ASP n 
5  155  GLU n 
5  156  LYS n 
5  157  LYS n 
5  158  GLU n 
5  159  LEU n 
5  160  LEU n 
5  161  ASP n 
5  162  ARG n 
5  163  TYR n 
5  164  LYS n 
5  165  LEU n 
5  166  ARG n 
5  167  GLU n 
5  168  THR n 
5  169  GLN n 
5  170  LEU n 
5  171  PRO n 
5  172  ARG n 
5  173  ILE n 
5  174  GLN n 
5  175  LEU n 
5  176  ALA n 
5  177  ASP n 
5  178  PRO n 
5  179  VAL n 
5  180  ALA n 
5  181  ARG n 
5  182  TYR n 
5  183  LEU n 
5  184  GLY n 
5  185  LEU n 
5  186  LYS n 
5  187  ARG n 
5  188  GLY n 
5  189  GLU n 
5  190  VAL n 
5  191  VAL n 
5  192  LYS n 
5  193  ILE n 
5  194  VAL n 
5  195  ARG n 
5  196  ARG n 
5  197  SER n 
5  198  GLU n 
5  199  THR n 
5  200  SER n 
5  201  GLY n 
5  202  ARG n 
5  203  TYR n 
5  204  ASN n 
5  205  SER n 
5  206  TYR n 
5  207  ARG n 
5  208  ILE n 
5  209  CYS n 
5  210  ALA n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ASP n 
6  8    GLU n 
6  9    ALA n 
6  10   PHE n 
6  11   GLY n 
6  12   MET n 
6  13   ASP n 
6  14   GLY n 
6  15   ALA n 
6  16   VAL n 
6  17   MET n 
6  18   GLU n 
6  19   GLU n 
6  20   GLU n 
6  21   VAL n 
6  22   ASP n 
6  23   GLU n 
6  24   LEU n 
6  25   GLU n 
6  26   MET n 
6  27   ILE n 
6  28   ASP n 
6  29   GLU n 
6  30   ASN n 
6  31   GLY n 
6  32   GLN n 
6  33   SER n 
6  34   GLN n 
6  35   GLN n 
6  36   GLY n 
6  37   VAL n 
6  38   SER n 
6  39   HIS n 
6  40   PRO n 
6  41   GLY n 
6  42   GLU n 
6  43   PRO n 
6  44   SER n 
6  45   THR n 
6  46   THR n 
6  47   VAL n 
6  48   ILE n 
6  49   THR n 
6  50   GLU n 
6  51   ASP n 
6  52   VAL n 
6  53   ALA n 
6  54   SER n 
6  55   SER n 
6  56   LYS n 
6  57   THR n 
6  58   ALA n 
6  59   GLN n 
6  60   SER n 
6  61   GLY n 
6  62   LYS n 
6  63   ALA n 
6  64   VAL n 
6  65   ALA n 
6  66   LYS n 
6  67   GLU n 
6  68   ASP n 
6  69   ARG n 
6  70   THR n 
6  71   THR n 
6  72   THR n 
6  73   PRO n 
6  74   TYR n 
6  75   MET n 
6  76   THR n 
6  77   LYS n 
6  78   TYR n 
6  79   GLU n 
6  80   ARG n 
6  81   ALA n 
6  82   ARG n 
6  83   ILE n 
6  84   LEU n 
6  85   GLY n 
6  86   THR n 
6  87   ARG n 
6  88   ALA n 
6  89   LEU n 
6  90   GLN n 
6  91   ILE n 
6  92   SER n 
6  93   MET n 
6  94   ASN n 
6  95   ALA n 
6  96   PRO n 
6  97   VAL n 
6  98   LEU n 
6  99   VAL n 
6  100  ASP n 
6  101  LEU n 
6  102  GLU n 
6  103  GLY n 
6  104  GLU n 
6  105  THR n 
6  106  ASP n 
6  107  PRO n 
6  108  LEU n 
6  109  GLN n 
6  110  ILE n 
6  111  ALA n 
6  112  MET n 
6  113  LYS n 
6  114  GLU n 
6  115  LEU n 
6  116  ALA n 
6  117  GLN n 
6  118  LYS n 
6  119  LYS n 
6  120  ILE n 
6  121  PRO n 
6  122  LEU n 
6  123  LEU n 
6  124  VAL n 
6  125  ARG n 
6  126  ARG n 
6  127  TYR n 
6  128  LEU n 
6  129  PRO n 
6  130  ASP n 
6  131  GLY n 
6  132  SER n 
6  133  TYR n 
6  134  GLU n 
6  135  ASP n 
6  136  TRP n 
6  137  SER n 
6  138  VAL n 
6  139  ALA n 
6  140  GLU n 
6  141  LEU n 
6  142  ILE n 
7  1    MET n 
7  2    PRO n 
7  3    PHE n 
7  4    PHE n 
7  5    LEU n 
7  6    LYS n 
7  7    GLU n 
7  8    LEU n 
7  9    SER n 
7  10   LEU n 
7  11   THR n 
7  12   ILE n 
7  13   SER n 
7  14   LEU n 
7  15   HIS n 
7  16   PRO n 
7  17   SER n 
7  18   TYR n 
7  19   PHE n 
7  20   GLY n 
7  21   PRO n 
7  22   ARG n 
7  23   MET n 
7  24   GLN n 
7  25   ASP n 
7  26   TYR n 
7  27   LEU n 
7  28   LYS n 
7  29   ALA n 
7  30   LYS n 
7  31   LEU n 
7  32   LEU n 
7  33   ALA n 
7  34   ASP n 
7  35   VAL n 
7  36   GLU n 
7  37   GLY n 
7  38   THR n 
7  39   CYS n 
7  40   SER n 
7  41   GLY n 
7  42   GLN n 
7  43   TYR n 
7  44   GLY n 
7  45   TYR n 
7  46   ILE n 
7  47   ILE n 
7  48   CYS n 
7  49   VAL n 
7  50   LEU n 
7  51   ASP n 
7  52   SER n 
7  53   ASN n 
7  54   THR n 
7  55   ILE n 
7  56   ASP n 
7  57   ILE n 
7  58   ASP n 
7  59   LYS n 
7  60   GLY n 
7  61   ARG n 
7  62   VAL n 
7  63   VAL n 
7  64   PRO n 
7  65   GLY n 
7  66   GLN n 
7  67   GLY n 
7  68   PHE n 
7  69   ALA n 
7  70   GLU n 
7  71   PHE n 
7  72   GLU n 
7  73   VAL n 
7  74   LYS n 
7  75   TYR n 
7  76   ARG n 
7  77   ALA n 
7  78   VAL n 
7  79   LEU n 
7  80   TRP n 
7  81   ARG n 
7  82   PRO n 
7  83   PHE n 
7  84   ARG n 
7  85   GLY n 
7  86   GLU n 
7  87   VAL n 
7  88   VAL n 
7  89   ASP n 
7  90   ALA n 
7  91   ILE n 
7  92   VAL n 
7  93   THR n 
7  94   THR n 
7  95   VAL n 
7  96   ASN n 
7  97   LYS n 
7  98   MET n 
7  99   GLY n 
7  100  PHE n 
7  101  PHE n 
7  102  ALA n 
7  103  ASN n 
7  104  ILE n 
7  105  GLY n 
7  106  PRO n 
7  107  LEU n 
7  108  ASN n 
7  109  VAL n 
7  110  PHE n 
7  111  VAL n 
7  112  SER n 
7  113  SER n 
7  114  HIS n 
7  115  LEU n 
7  116  VAL n 
7  117  PRO n 
7  118  PRO n 
7  119  ASP n 
7  120  MET n 
7  121  LYS n 
7  122  PHE n 
7  123  ASP n 
7  124  PRO n 
7  125  THR n 
7  126  ALA n 
7  127  ASN n 
7  128  PRO n 
7  129  PRO n 
7  130  ASN n 
7  131  TYR n 
7  132  SER n 
7  133  GLY n 
7  134  GLU n 
7  135  ASP n 
7  136  GLN n 
7  137  VAL n 
7  138  ILE n 
7  139  GLU n 
7  140  LYS n 
7  141  GLY n 
7  142  SER n 
7  143  ASN n 
7  144  VAL n 
7  145  ARG n 
7  146  LEU n 
7  147  LYS n 
7  148  ILE n 
7  149  VAL n 
7  150  GLY n 
7  151  THR n 
7  152  ARG n 
7  153  THR n 
7  154  ASP n 
7  155  ALA n 
7  156  THR n 
7  157  GLU n 
7  158  ILE n 
7  159  PHE n 
7  160  ALA n 
7  161  ILE n 
7  162  ALA n 
7  163  THR n 
7  164  MET n 
7  165  LYS n 
7  166  GLU n 
7  167  ASP n 
7  168  TYR n 
7  169  LEU n 
7  170  GLY n 
7  171  VAL n 
7  172  LEU n 
8  1    MET n 
8  2    SER n 
8  3    GLU n 
8  4    SER n 
8  5    VAL n 
8  6    LEU n 
8  7    LEU n 
8  8    ASP n 
8  9    GLU n 
8  10   ILE n 
8  11   PHE n 
8  12   THR n 
8  13   VAL n 
8  14   THR n 
8  15   SER n 
8  16   VAL n 
8  17   ASP n 
8  18   LYS n 
8  19   GLN n 
8  20   LYS n 
8  21   TYR n 
8  22   GLN n 
8  23   ARG n 
8  24   VAL n 
8  25   SER n 
8  26   ARG n 
8  27   ILE n 
8  28   THR n 
8  29   ALA n 
8  30   VAL n 
8  31   SER n 
8  32   GLY n 
8  33   GLN n 
8  34   ASN n 
8  35   ASP n 
8  36   MET n 
8  37   ASN n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   SER n 
8  45   GLN n 
8  46   ILE n 
8  47   TYR n 
8  48   PRO n 
8  49   LEU n 
8  50   GLU n 
8  51   LYS n 
8  52   ASP n 
8  53   ALA n 
8  54   THR n 
8  55   PHE n 
8  56   SER n 
8  57   LEU n 
8  58   GLN n 
8  59   ILE n 
8  60   THR n 
8  61   SER n 
8  62   ASN n 
8  63   LEU n 
8  64   ASN n 
8  65   SER n 
8  66   PRO n 
8  67   ASP n 
8  68   LEU n 
8  69   LYS n 
8  70   GLU n 
8  71   ALA n 
8  72   ALA n 
8  73   ASP n 
8  74   TYR n 
8  75   ILE n 
8  76   MET n 
8  77   TYR n 
8  78   GLY n 
8  79   LYS n 
8  80   VAL n 
8  81   TYR n 
8  82   ARG n 
8  83   VAL n 
8  84   GLU n 
8  85   GLU n 
8  86   ALA n 
8  87   LYS n 
8  88   ASP n 
8  89   GLU n 
8  90   LYS n 
8  91   VAL n 
8  92   SER n 
8  93   VAL n 
8  94   TYR n 
8  95   VAL n 
8  96   SER n 
8  97   PHE n 
8  98   GLY n 
8  99   GLY n 
8  100  LEU n 
8  101  LEU n 
8  102  MET n 
8  103  ALA n 
8  104  ILE n 
8  105  GLU n 
8  106  GLY n 
8  107  SER n 
8  108  HIS n 
8  109  ARG n 
8  110  LYS n 
8  111  LEU n 
8  112  TYR n 
8  113  ARG n 
8  114  LEU n 
8  115  SER n 
8  116  LEU n 
8  117  ASP n 
8  118  HIS n 
8  119  VAL n 
8  120  TYR n 
8  121  LEU n 
8  122  LEU n 
8  123  LEU n 
8  124  ARG n 
8  125  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ASN n 
9  4    PHE n 
9  5    GLN n 
9  6    TYR n 
9  7    CYS n 
9  8    ILE n 
9  9    GLU n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   VAL n 
9  22   ASP n 
9  23   ARG n 
9  24   VAL n 
9  25   LEU n 
9  26   ARG n 
9  27   LEU n 
9  28   ALA n 
9  29   CYS n 
9  30   ARG n 
9  31   ASN n 
9  32   CYS n 
9  33   ASP n 
9  34   TYR n 
9  35   SER n 
9  36   GLU n 
9  37   ILE n 
9  38   ALA n 
9  39   ALA n 
9  40   THR n 
9  41   SER n 
9  42   LYS n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   GLN n 
9  50   SER n 
9  51   SER n 
9  52   ASN n 
9  53   VAL n 
9  54   GLU n 
9  55   ASN n 
9  56   THR n 
9  57   THR n 
9  58   VAL n 
9  59   SER n 
9  60   HIS n 
9  61   ASP n 
9  62   ALA n 
9  63   SER n 
9  64   THR n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   LYS n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   ARG n 
9  78   CYS n 
9  79   HIS n 
9  80   GLN n 
9  81   HIS n 
9  82   GLU n 
9  83   ALA n 
9  84   VAL n 
9  85   PHE n 
9  86   TYR n 
9  87   GLN n 
9  88   THR n 
9  89   HIS n 
9  90   SER n 
9  91   ARG n 
9  92   ARG n 
9  93   GLY n 
9  94   ASP n 
9  95   THR n 
9  96   MET n 
9  97   MET n 
9  98   THR n 
9  99   LEU n 
9  100  ILE n 
9  101  TYR n 
9  102  VAL n 
9  103  CYS n 
9  104  VAL n 
9  105  HIS n 
9  106  CYS n 
9  107  GLY n 
9  108  PHE n 
9  109  ALA n 
9  110  PHE n 
9  111  GLU n 
9  112  GLU n 
9  113  GLN n 
10 1    MET n 
10 2    ILE n 
10 3    ILE n 
10 4    PRO n 
10 5    ILE n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   ILE n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   ASP n 
10 20   THR n 
10 21   TYR n 
10 22   LEU n 
10 23   THR n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   ASN n 
10 30   THR n 
10 31   GLU n 
10 32   GLY n 
10 33   GLU n 
10 34   ALA n 
10 35   LEU n 
10 36   ASP n 
10 37   LYS n 
10 38   LEU n 
10 39   GLY n 
10 40   LEU n 
10 41   GLN n 
10 42   ARG n 
10 43   TYR n 
10 44   CYS n 
10 45   CYS n 
10 46   ARG n 
10 47   ARG n 
10 48   MET n 
10 49   ILE n 
10 50   LEU n 
10 51   THR n 
10 52   HIS n 
10 53   VAL n 
10 54   ASP n 
10 55   LEU n 
10 56   ILE n 
10 57   GLU n 
10 58   LYS n 
10 59   LEU n 
10 60   LEU n 
10 61   CYS n 
10 62   TYR n 
10 63   ASN n 
10 64   PRO n 
10 65   LEU n 
10 66   SER n 
10 67   LYS n 
10 68   GLN n 
10 69   LYS n 
10 70   ASN n 
10 71   LEU n 
11 1    MET n 
11 2    ASN n 
11 3    GLN n 
11 4    PRO n 
11 5    GLU n 
11 6    ARG n 
11 7    TYR n 
11 8    GLU n 
11 9    LEU n 
11 10   ILE n 
11 11   GLU n 
11 12   LEU n 
11 13   MET n 
11 14   GLY n 
11 15   LEU n 
11 16   PRO n 
11 17   LYS n 
11 18   VAL n 
11 19   THR n 
11 20   TYR n 
11 21   GLU n 
11 22   LEU n 
11 23   ASP n 
11 24   SER n 
11 25   LYS n 
11 26   SER n 
11 27   PRO n 
11 28   ASN n 
11 29   ALA n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   THR n 
11 34   LEU n 
11 35   GLU n 
11 36   LYS n 
11 37   GLU n 
11 38   ASP n 
11 39   HIS n 
11 40   THR n 
11 41   LEU n 
11 42   ALA n 
11 43   ASN n 
11 44   MET n 
11 45   LEU n 
11 46   ALA n 
11 47   ASN n 
11 48   GLN n 
11 49   LEU n 
11 50   LEU n 
11 51   SER n 
11 52   ASP n 
11 53   GLU n 
11 54   ARG n 
11 55   VAL n 
11 56   LEU n 
11 57   PHE n 
11 58   ALA n 
11 59   GLY n 
11 60   TYR n 
11 61   LYS n 
11 62   VAL n 
11 63   PRO n 
11 64   HIS n 
11 65   PRO n 
11 66   LEU n 
11 67   ASN n 
11 68   HIS n 
11 69   ASN n 
11 70   PHE n 
11 71   ILE n 
11 72   LEU n 
11 73   ARG n 
11 74   VAL n 
11 75   GLN n 
11 76   THR n 
11 77   VAL n 
11 78   GLU n 
11 79   ASP n 
11 80   CYS n 
11 81   SER n 
11 82   PRO n 
11 83   LYS n 
11 84   GLN n 
11 85   VAL n 
11 86   ILE n 
11 87   VAL n 
11 88   ASP n 
11 89   ALA n 
11 90   ALA n 
11 91   LYS n 
11 92   SER n 
11 93   LEU n 
11 94   ILE n 
11 95   THR n 
11 96   HIS n 
11 97   LEU n 
11 98   GLU n 
11 99   GLU n 
11 100  ILE n 
11 101  LYS n 
11 102  VAL n 
11 103  ASN n 
11 104  PHE n 
11 105  MET n 
11 106  ARG n 
11 107  GLU n 
11 108  TRP n 
11 109  GLU n 
11 110  LEU n 
11 111  LYS n 
11 112  MET n 
11 113  ILE n 
11 114  SER n 
11 115  VAL n 
11 116  GLU n 
11 117  GLY n 
11 118  VAL n 
11 119  GLU n 
11 120  MET n 
11 121  GLU n 
11 122  PHE n 
11 123  SER n 
12 1    MET n 
12 2    ASN n 
12 3    HIS n 
12 4    PRO n 
12 5    THR n 
12 6    SER n 
12 7    THR n 
12 8    GLY n 
12 9    GLY n 
12 10   THR n 
12 11   ALA n 
12 12   PHE n 
12 13   ASN n 
12 14   PRO n 
12 15   PRO n 
12 16   ARG n 
12 17   PRO n 
12 18   ALA n 
12 19   THR n 
12 20   MET n 
12 21   ILE n 
12 22   TYR n 
12 23   LEU n 
12 24   CYS n 
12 25   ALA n 
12 26   ASP n 
12 27   CYS n 
12 28   GLY n 
12 29   ALA n 
12 30   ARG n 
12 31   ASN n 
12 32   THR n 
12 33   ILE n 
12 34   GLN n 
12 35   ALA n 
12 36   LYS n 
12 37   GLU n 
12 38   VAL n 
12 39   ILE n 
12 40   ARG n 
12 41   CYS n 
12 42   ARG n 
12 43   GLU n 
12 44   CYS n 
12 45   GLY n 
12 46   HIS n 
12 47   ARG n 
12 48   VAL n 
12 49   MET n 
12 50   TYR n 
12 51   LYS n 
12 52   MET n 
12 53   ARG n 
12 54   THR n 
12 55   LYS n 
12 56   ARG n 
12 57   MET n 
12 58   VAL n 
12 59   GLN n 
12 60   PHE n 
12 61   GLU n 
12 62   ALA n 
12 63   ARG n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Schizosaccharomyces pombe' 284812 ? ? 972h- ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_SCHPO  P36594 1  
;MSGIQFSPSSVPLRRVEEVQFGILSPEEIRSMSVAKIEFPETMDESGQRPRVGGLLDPRLGTIDRQFKCQTCGETMADCP
GHFGHIELAKPVFHIGFLSKIKKILECVCWNCGKLKIDSSNPKFNDTQRYRDPKNRLNAVWNVCKTKMVCDTGLSAGSDN
FDLSNPSANMGHGGCGAAQPTIRKDGLRLWGSWKRGKDESDLPEKRLLSPLEVHTIFTHISSEDLAHLGLNEQYARPDWM
IITVLPVPPPSVRPSISVDGTSRGEDDLTHKLSDIIKANANVRRCEQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPQA
LQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSARTVITGDPNLSLDELGVPRSIAKTLTYPETVTPYNIYQLQELVRN
GPDEHPGAKYIIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVIFNRQPSLHKMSMMGHRIRVMPYSTFRLNLSV
TSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVSPQSNKPVMGIVQDTLAGVRKFSLRDNFLTRNAVMNIMLWVP
DWDGILPPPVILKPKVLWTGKQILSLIIPKGINLIRDDDKQSLSNPTDSGMLIENGEIIYGVVDKKTVGASQGGLVHTIW
KEKGPEICKGFFNGIQRVVNYWLLHNGFSIGIGDTIADADTMKEVTRTVKEARRQVAECIQDAQHNRLKPEPGMTLRESF
EAKVSRILNQARDNAGRSAEHSLKDSNNVKQMVAAGSKGSFINISQMSACVGQQIVEGKRIPFGFKYRTLPHFPKDDDSP
ESRGFIENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMVRYDGTVRNAMGDIIQFAYGEDGLD
ATLVEYQVFDSLRLSTKQFEKKYRIDLMEDRSLSLYMENSIENDSSVQDLLDEEYTQLVADRELLCKFIFPKGDARWPLP
VNVQRIIQNALQIFHLEAKKPTDLLPSDIINGLNELIAKLTIFRGSDRITRDVQNNATLLFQILLRSKFAVKRVIMEYRL
NKVAFEWIMGEVEARFQQAVVSPGEMVGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPSLT
IYLMPWIAANMDLAKNVQTQIEHTTLSTVTSATEIHYDPDPQDTVIEEDKDFVEAFFAIPDEEVEENLYKQSPWLLRLEL
DRAKMLDKKLSMSDVAGKIAESFERDLFTIWSEDNADKLIIRCRIIRDDDRKAEDDDNMIEEDVFLKTIEGHMLESISLR
GVPNITRVYMMEHKIVRQIEDGTFERADEWVLETDGINLTEAMTVEGVDATRTYSNSFVEILQILGIEATRSALLKELRN
VIEFDGSYVNYRHLALLCDVMTSRGHLMAITRHGINRAETGALMRCSFEETVEILMDAAASGEKDDCKGISENIMLGQLA
PMGTGAFDIYLDQDMLMNYSLGTAVPTLAGSGMGTSQLPEGAGTPYERSPMVDSGFVGSPDAAAFSPLVQGGSEGREGFG
DYGLLGAASPYKGVQSPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
;
1 ? 
2  UNP RPB2_SCHPO  Q02061 2  
;MSYEDYQYNETLTQEDCWTVISSFFEETSLARQQLFSFDEFVQNTMQEIVDDDSTLTLDQYAQHTGAQGDVTRRYEINFG
QIYLSRPTMTEADGSTTTMFPQEARLRNLTYSSPLYVDMRKKVMVAADSNVPIGEEEWLVEEEDEEPSKVFIGKIPIMLR
STFCILNGVSDSELYDLNECPYDQGGYFIINGSEKVIIAQERSAANIVQVFKKAAPSPIAYVAEIRSALERGSRLISSMQ
IKLMARNTENSGQTIRATLPYIRSDIPIVIVFRALGVVPDRDILEHICYDPNDFQMLEMMKPCIEEAFVIQDKDIALDYI
GKRGSTTGVTREKRLRYAHDILQKELLPHITTMEGFETRKAFFLGYMIHRMLLCALERREPDDRDHFGKKRLDLAGPLLA
SLFRMLFRKMTRDVYKYMQKCVETNREFNLTLAVKSNIITNGLRYSLATGNWGDQKRSMVNRVGVSQVLNRYTFASTLSH
LRRTNTPIGRDGKLAKPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMSYVSVGSPSAPIIEFLEEWGLETLEDYNPSAS
PNATKVFVNGVWLGVHRDPAHLTETLRSLRRRLDISAEVSIVRDIREKELRLFTDAGRICRPLFIVDNNPNSERRGELCI
RKEHIQQLIEDKDRYDIDPEQRFGWTALVSSGLIEYLDAEEEETVMIAMSPEDLEASRQMQAGYEVKEELDPAQRVKPAP
NPHVHAWTHCEIHPAMILGILASIIPFPDHNQSPRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEY
LKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTTLRMKHGTYD
KLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRST
RIPQIGDKFASRHGQKGTIGMTYRHEDMPFSAQGIVPDIIINPHAIPSRMTVAHLVECQLSKVSALSGFEGDATPFTDVT
VEAVSKLLRSHGFQSRGFEVMYHGHTGRKLVAQVFLGPTYYQRLKHLVDDKIHARARGPVQILTRQPVEGRSRDGGLRFG
EMERDCQISHGCSSVLRERLFDCSDAYRVIVCDICGLIAIASYKKDSYECRSCQNRTRFSQVYLPYAAKLLFQELMSMNI
APRLFTKNHK
;
1 ? 
3  UNP RPB3_SCHPO  P37382 3  
;MDSETHITIRNISKNSVDFVLTNTSLAVANSLRRVVLAEIPTVAIDLVEINVNTSVMPDEFLAHRLGMIPLDSSNIDEPP
PVGLEYTRNCDCDQYCPKCSVELFLNAKCTGEGTMEIYARDLVVSSNSSLGHPILADPKSRGPLICKLRKEQEISLRCIA
KKGIAKEHAKWSPTSAVAFEYDPWNKLQHTDYWFENDADAEWPKSKNADWEEPPREGEPFNFQEEPRRFYMDVESVGSIP
PNEIMVQGLRILQEKLAVLVRDLDEEQPTQLSANELNMEENAEMNWSPYQNGEENTW
;
1 ? 
4  UNP RPB4_SCHPO  O74825 4  
;MPRAIFEEDAAQLKLGPEFENEDMLTVSEAKILIETVLAQRARETNGEIPMTDVMKKTVAYFNVFARFKTAEATYACERI
LGNRFHKFERAQLGTLCCEDAEEARTLIPSLANKIDDQNLQGILDELSTLRKFQD
;
1 ? 
5  UNP RPAB1_SCHPO Q09191 5  
;MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFYAKPSNDSNKGTIYIEFAKEP
SVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIATVTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELL
DRYKLRETQLPRIQLADPVARYLGLKRGEVVKIVRRSETSGRYNSYRICA
;
1 ? 
6  UNP RPAB2_SCHPO P36595 6  
;MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYER
ARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI
;
1 ? 
7  UNP RPB7_SCHPO  O14459 7  
;MPFFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLW
RPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFA
IATMKEDYLGVL
;
1 ? 
8  UNP RPAB3_SCHPO Q92399 8  
;MSESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKV
YRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR
;
1 ? 
9  UNP RPB9_SCHPO  O74635 9  
;MSNFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVSHDASTDPTLPRSDKECPRCHQ
HEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEEQ
;
1 ? 
10 UNP RPAB5_SCHPO O13877 10 MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNPLSKQKNL 1 ? 
11 UNP RPB11_SCHPO P87123 11 
;MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDC
SPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVEMEFS
;
1 ? 
12 UNP RPAB4_SCHPO P48011 12 MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3H0G A 1 ? 1752 ? P36594 1 ? 1752 ? 1 1752 
2  2  3H0G B 1 ? 1210 ? Q02061 1 ? 1210 ? 1 1210 
3  3  3H0G C 1 ? 297  ? P37382 1 ? 297  ? 1 297  
4  4  3H0G D 1 ? 135  ? O74825 1 ? 135  ? 1 135  
5  5  3H0G E 1 ? 210  ? Q09191 1 ? 210  ? 1 210  
6  6  3H0G F 1 ? 142  ? P36595 1 ? 142  ? 1 142  
7  7  3H0G G 1 ? 172  ? O14459 1 ? 172  ? 1 172  
8  8  3H0G H 1 ? 125  ? Q92399 1 ? 125  ? 1 125  
9  9  3H0G I 1 ? 113  ? O74635 1 ? 113  ? 1 113  
10 10 3H0G J 1 ? 71   ? O13877 1 ? 71   ? 1 71   
11 11 3H0G K 1 ? 123  ? P87123 1 ? 123  ? 1 123  
12 12 3H0G L 1 ? 63   ? P48011 1 ? 63   ? 1 63   
13 1  3H0G M 1 ? 1752 ? P36594 1 ? 1752 ? 1 1752 
14 2  3H0G N 1 ? 1210 ? Q02061 1 ? 1210 ? 1 1210 
15 3  3H0G O 1 ? 297  ? P37382 1 ? 297  ? 1 297  
16 4  3H0G P 1 ? 135  ? O74825 1 ? 135  ? 1 135  
17 5  3H0G Q 1 ? 210  ? Q09191 1 ? 210  ? 1 210  
18 6  3H0G R 1 ? 142  ? P36595 1 ? 142  ? 1 142  
19 7  3H0G S 1 ? 172  ? O14459 1 ? 172  ? 1 172  
20 8  3H0G T 1 ? 125  ? Q92399 1 ? 125  ? 1 125  
21 9  3H0G U 1 ? 113  ? O74635 1 ? 113  ? 1 113  
22 10 3H0G V 1 ? 71   ? O13877 1 ? 71   ? 1 71   
23 11 3H0G W 1 ? 123  ? P87123 1 ? 123  ? 1 123  
24 12 3H0G X 1 ? 63   ? P48011 1 ? 63   ? 1 63   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3H0G 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.25 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    
;50mM MES pH 6.3, 300mM ammonium acetate, 5-6.5% (w/v) PEG 4000, 10mM DTT, 7.1mM C8E5, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-06-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
# 
_reflns.entry_id                     3H0G 
_reflns.d_resolution_high            3.650 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   138872 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_netI_over_sigmaI        6.702 
_reflns.pdbx_Rsym_value              0.085 
_reflns.pdbx_redundancy              3.200 
_reflns.percent_possible_obs         96.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.65 
_reflns_shell.d_res_low              3.85 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    45357 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.600 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_Rsym_value        0.600 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        2.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      19808 
_reflns_shell.percent_possible_all   95.20 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3H0G 
_refine.ls_d_res_high                            3.650 
_refine.ls_d_res_low                             48.695 
_refine.pdbx_ls_sigma_F                          0.97 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.770 
_refine.ls_number_reflns_obs                     138803 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.297 
_refine.ls_R_factor_R_work                       0.297 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.321 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 1.440 
_refine.ls_number_reflns_R_free                  3725 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               203.114 
_refine.solvent_model_param_bsol                 102.890 
_refine.solvent_model_param_ksol                 0.246 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            40.084 
_refine.aniso_B[2][2]                            -72.284 
_refine.aniso_B[3][3]                            32.200 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.730 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1WCM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                676.43 
_refine.B_iso_min                                20.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        62852 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               62870 
_refine_hist.d_res_high                       3.650 
_refine_hist.d_res_low                        48.695 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           64027 0.008  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          86539 1.117  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     9676  0.067  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      11264 0.011  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 24123 17.256 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1 1 POSITIONAL A 10171 0.527 ? 1  ? ? ? 
'X-RAY DIFFRACTION' 1 2 POSITIONAL M 10171 0.527 ? 2  ? ? ? 
'X-RAY DIFFRACTION' 2 1 POSITIONAL B 8982  0.272 ? 3  ? ? ? 
'X-RAY DIFFRACTION' 2 2 POSITIONAL N 8982  0.272 ? 4  ? ? ? 
'X-RAY DIFFRACTION' 3 1 POSITIONAL C 2088  0.053 ? 5  ? ? ? 
'X-RAY DIFFRACTION' 3 2 POSITIONAL O 2088  0.053 ? 6  ? ? ? 
'X-RAY DIFFRACTION' 4 1 POSITIONAL E 1663  0.001 ? 7  ? ? ? 
'X-RAY DIFFRACTION' 4 2 POSITIONAL Q 1663  0.001 ? 8  ? ? ? 
'X-RAY DIFFRACTION' 5 1 POSITIONAL G 1294  0.002 ? 9  ? ? ? 
'X-RAY DIFFRACTION' 5 2 POSITIONAL S 1294  0.002 ? 10 ? ? ? 
'X-RAY DIFFRACTION' 6 1 POSITIONAL D 1028  0.181 ? 11 ? ? ? 
'X-RAY DIFFRACTION' 6 2 POSITIONAL P 1028  0.181 ? 12 ? ? ? 
'X-RAY DIFFRACTION' 7 1 POSITIONAL H 996   0.001 ? 13 ? ? ? 
'X-RAY DIFFRACTION' 7 2 POSITIONAL T 996   0.001 ? 14 ? ? ? 
'X-RAY DIFFRACTION' 8 1 POSITIONAL K 904   0.080 ? 15 ? ? ? 
'X-RAY DIFFRACTION' 8 2 POSITIONAL W 904   0.080 ? 16 ? ? ? 
'X-RAY DIFFRACTION' 9 1 POSITIONAL F 632   0.060 ? 17 ? ? ? 
'X-RAY DIFFRACTION' 9 2 POSITIONAL R 632   0.060 ? 18 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.650  3.696  27 88.000 9048 . 0.427 0.489 . 129 . 9177 . . 'X-RAY DIFFRACTION' 
3.696  3.745  27 89.000 8976 . 0.394 0.373 . 127 . 9103 . . 'X-RAY DIFFRACTION' 
3.745  3.796  27 90.000 9134 . 0.374 0.352 . 137 . 9271 . . 'X-RAY DIFFRACTION' 
3.796  3.850  27 90.000 9069 . 0.374 0.419 . 136 . 9205 . . 'X-RAY DIFFRACTION' 
3.850  3.908  27 90.000 9148 . 0.395 0.430 . 130 . 9278 . . 'X-RAY DIFFRACTION' 
3.908  3.969  27 90.000 9213 . 0.370 0.384 . 135 . 9348 . . 'X-RAY DIFFRACTION' 
3.969  4.034  27 91.000 9173 . 0.348 0.347 . 130 . 9303 . . 'X-RAY DIFFRACTION' 
4.034  4.103  27 91.000 9162 . 0.327 0.315 . 136 . 9298 . . 'X-RAY DIFFRACTION' 
4.103  4.178  27 91.000 9304 . 0.324 0.310 . 138 . 9442 . . 'X-RAY DIFFRACTION' 
4.178  4.258  27 92.000 9271 . 0.320 0.316 . 139 . 9410 . . 'X-RAY DIFFRACTION' 
4.258  4.345  27 92.000 9361 . 0.304 0.326 . 137 . 9498 . . 'X-RAY DIFFRACTION' 
4.345  4.439  27 92.000 9328 . 0.298 0.321 . 135 . 9463 . . 'X-RAY DIFFRACTION' 
4.439  4.543  27 93.000 9480 . 0.283 0.275 . 134 . 9614 . . 'X-RAY DIFFRACTION' 
4.543  4.656  27 94.000 9573 . 0.275 0.334 . 144 . 9717 . . 'X-RAY DIFFRACTION' 
4.656  4.782  27 95.000 9642 . 0.276 0.309 . 145 . 9787 . . 'X-RAY DIFFRACTION' 
4.782  4.923  27 96.000 9747 . 0.268 0.310 . 144 . 9891 . . 'X-RAY DIFFRACTION' 
4.923  5.081  27 96.000 9773 . 0.276 0.286 . 144 . 9917 . . 'X-RAY DIFFRACTION' 
5.081  5.263  27 96.000 9726 . 0.279 0.311 . 141 . 9867 . . 'X-RAY DIFFRACTION' 
5.263  5.473  27 96.000 9733 . 0.281 0.295 . 145 . 9878 . . 'X-RAY DIFFRACTION' 
5.473  5.722  27 96.000 9702 . 0.286 0.283 . 141 . 9843 . . 'X-RAY DIFFRACTION' 
5.722  6.023  27 95.000 9748 . 0.295 0.331 . 142 . 9890 . . 'X-RAY DIFFRACTION' 
6.023  6.400  27 95.000 9610 . 0.307 0.313 . 145 . 9755 . . 'X-RAY DIFFRACTION' 
6.400  6.892  27 95.000 9578 . 0.297 0.394 . 141 . 9719 . . 'X-RAY DIFFRACTION' 
6.892  7.584  27 94.000 9580 . 0.270 0.290 . 137 . 9717 . . 'X-RAY DIFFRACTION' 
7.584  8.676  27 94.000 9561 . 0.217 0.262 . 138 . 9699 . . 'X-RAY DIFFRACTION' 
8.676  10.910 27 94.000 9547 . 0.186 0.185 . 143 . 9690 . . 'X-RAY DIFFRACTION' 
10.910 48.699 27 92.000 9309 . 0.286 0.319 . 132 . 9441 . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 M 
2 1 B 
2 2 N 
3 1 C 
3 2 O 
4 1 E 
4 2 Q 
5 1 G 
5 2 S 
6 1 D 
6 2 P 
7 1 H 
7 2 T 
8 1 K 
8 2 W 
9 1 F 
9 2 R 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 3    A 127  
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 2 ? A 132  A 151  
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 3 ? A 174  A 193  
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 4 ? A 212  A 257  
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 5 ? A 262  A 1086 
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 6 ? A 1093 A 1149 
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 1 7 ? A 1265 A 1459 
;chain A and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 1 ? M 3    M 127  
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 2 ? M 132  M 151  
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 3 ? M 174  M 193  
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 4 ? M 212  M 257  
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 5 ? M 262  M 1086 
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 6 ? M 1093 M 1149 
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
1 2 7 ? M 1265 M 1459 
;chain M and (resseq 3:127 or resseq 132:151 or resseq 174:193 or resseq 212:257 or resseq 262:1086 or resseq 1093:1149 or resseq 1265:1459 )
;
? ? ? ? ? ? ? ? 
2 1 1 ? B 10   B 57   
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 1 2 ? B 77   B 121  
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 1 3 ? B 149  B 324  
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 1 4 ? B 332  B 489  
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 1 5 ? B 495  B 905  
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 1 6 ? B 923  B 1209 
'chain B and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 1 ? N 10   N 57   
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 2 ? N 77   N 121  
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 3 ? N 149  N 324  
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 4 ? N 332  N 489  
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 5 ? N 495  N 905  
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
2 2 6 ? N 923  N 1209 
'chain N and (resseq 10:57 or resseq 77:121 or resseq 149:324 or resseq 332:489 or resseq 495:905 or resseq 923:1209 )' ? ? ? ? ? 
? ? ? 
3 1 1 ? C 4    C 266  'chain C and (resseq 4:266 )' ? ? ? ? ? ? ? ? 
3 2 1 ? O 4    O 266  'chain O and (resseq 4:266 )' ? ? ? ? ? ? ? ? 
4 1 1 ? E 4    E 210  'chain E and (resseq 4:210 )' ? ? ? ? ? ? ? ? 
4 2 1 ? Q 4    Q 210  'chain Q and (resseq 4:210 )' ? ? ? ? ? ? ? ? 
5 1 1 ? G 4    G 40   'chain G and (resseq 4:40 or resseq 44:172 )' ? ? ? ? ? ? ? ? 
5 1 2 ? G 44   G 172  'chain G and (resseq 4:40 or resseq 44:172 )' ? ? ? ? ? ? ? ? 
5 2 1 ? S 4    S 40   'chain S and (resseq 4:40 or resseq 44:172 )' ? ? ? ? ? ? ? ? 
5 2 2 ? S 44   S 172  'chain S and (resseq 4:40 or resseq 44:172 )' ? ? ? ? ? ? ? ? 
6 1 1 ? D 6    D 134  'chain D and (resseq 6:134 )' ? ? ? ? ? ? ? ? 
6 2 1 ? P 6    P 134  'chain P and (resseq 6:134 )' ? ? ? ? ? ? ? ? 
7 1 1 ? H 2    H 125  'chain H and (resseq 2:125 )' ? ? ? ? ? ? ? ? 
7 2 1 ? T 2    T 125  'chain T and (resseq 2:125 )' ? ? ? ? ? ? ? ? 
8 1 1 ? K 1    K 112  'chain K and (resseq 1:112 )' ? ? ? ? ? ? ? ? 
8 2 1 ? W 1    W 112  'chain W and (resseq 1:112 )' ? ? ? ? ? ? ? ? 
9 1 1 ? F 64   F 142  'chain F and (resseq 64:142 )' ? ? ? ? ? ? ? ? 
9 2 1 ? R 64   R 142  'chain R and (resseq 64:142 )' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
7 ? 
8 ? 
9 ? 
# 
_struct.entry_id                  3H0G 
_struct.title                     'RNA Polymerase II from Schizosaccharomyces pombe' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase II subunit rpb1 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB2 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerase II subunit rpb4, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase II subunit rpb7, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H0G 
_struct_keywords.text            
;Transcription, Multi-protein complex, Polymerase, DNA-binding, DNA-directed RNA polymerase, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Transferase, Zinc-finger
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 1  ? 
N  N N 2  ? 
O  N N 3  ? 
P  N N 4  ? 
Q  N N 5  ? 
R  N N 6  ? 
S  N N 7  ? 
T  N N 8  ? 
U  N N 9  ? 
V  N N 10 ? 
W  N N 11 ? 
X  N N 12 ? 
Y  N N 13 ? 
Z  N N 13 ? 
AA N N 14 ? 
BA N N 13 ? 
CA N N 13 ? 
DA N N 13 ? 
EA N N 13 ? 
FA N N 13 ? 
GA N N 13 ? 
HA N N 13 ? 
IA N N 13 ? 
JA N N 14 ? 
KA N N 13 ? 
LA N N 13 ? 
MA N N 13 ? 
NA N N 13 ? 
OA N N 13 ? 
PA N N 13 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 25   ? SER A 33   ? SER A 25   SER A 33   1 ? 9  
HELX_P HELX_P2   2   HIS A 94   ? LEU A 105  ? HIS A 94   LEU A 105  1 ? 12 
HELX_P HELX_P3   3   ASN A 121  ? TYR A 130  ? ASN A 121  TYR A 130  1 ? 10 
HELX_P HELX_P4   4   ARG A 136  ? LYS A 147  ? ARG A 136  LYS A 147  1 ? 12 
HELX_P HELX_P5   5   SER A 209  ? ILE A 220  ? SER A 209  ILE A 220  1 ? 12 
HELX_P HELX_P6   6   SER A 221  ? LEU A 228  ? SER A 221  LEU A 228  1 ? 8  
HELX_P HELX_P7   7   ARG A 236  ? MET A 240  ? ARG A 236  MET A 240  5 ? 5  
HELX_P HELX_P8   8   PRO A 249  ? ARG A 253  ? PRO A 249  ARG A 253  5 ? 5  
HELX_P HELX_P9   9   HIS A 270  ? ARG A 284  ? HIS A 270  ARG A 284  1 ? 15 
HELX_P HELX_P10  10  CYS A 285  ? GLU A 288  ? CYS A 285  GLU A 288  5 ? 4  
HELX_P HELX_P11  11  ILE A 294  ? TYR A 309  ? ILE A 294  TYR A 309  1 ? 16 
HELX_P HELX_P12  12  SER A 330  ? LYS A 336  ? SER A 330  LYS A 336  1 ? 7  
HELX_P HELX_P13  13  PRO A 373  ? LYS A 378  ? PRO A 373  LYS A 378  1 ? 6  
HELX_P HELX_P14  14  ASN A 390  ? GLY A 401  ? ASN A 390  GLY A 401  1 ? 12 
HELX_P HELX_P15  15  HIS A 457  ? MET A 459  ? HIS A 457  MET A 459  5 ? 3  
HELX_P HELX_P16  16  SER A 479  ? ASN A 485  ? SER A 479  ASN A 485  5 ? 7  
HELX_P HELX_P17  17  GLU A 502  ? ILE A 510  ? GLU A 502  ILE A 510  1 ? 9  
HELX_P HELX_P18  18  GLN A 531  ? LYS A 539  ? GLN A 531  LYS A 539  1 ? 9  
HELX_P HELX_P19  19  ARG A 549  ? ASN A 554  ? ARG A 549  ASN A 554  1 ? 6  
HELX_P HELX_P20  20  ILE A 555  ? TRP A 558  ? ILE A 555  TRP A 558  5 ? 4  
HELX_P HELX_P21  21  LYS A 581  ? LEU A 586  ? LYS A 581  LEU A 586  1 ? 6  
HELX_P HELX_P22  22  ASP A 624  ? GLY A 629  ? ASP A 624  GLY A 629  1 ? 6  
HELX_P HELX_P23  23  GLY A 634  ? ILE A 639  ? GLY A 634  ILE A 639  1 ? 6  
HELX_P HELX_P24  24  ILE A 647  ? GLY A 667  ? ILE A 647  GLY A 667  1 ? 21 
HELX_P HELX_P25  25  GLY A 671  ? ILE A 676  ? GLY A 671  ILE A 676  5 ? 6  
HELX_P HELX_P26  26  ALA A 679  ? GLU A 691  ? ALA A 679  GLU A 691  1 ? 13 
HELX_P HELX_P27  27  ARG A 693  ? GLN A 701  ? ARG A 693  GLN A 701  1 ? 9  
HELX_P HELX_P28  28  ARG A 717  ? HIS A 741  ? ARG A 717  HIS A 741  1 ? 25 
HELX_P HELX_P29  29  LYS A 750  ? GLY A 756  ? LYS A 750  GLY A 756  1 ? 7  
HELX_P HELX_P30  30  SER A 760  ? ALA A 769  ? SER A 760  ALA A 769  1 ? 10 
HELX_P HELX_P31  31  THR A 815  ? ARG A 827  ? THR A 815  ARG A 827  1 ? 13 
HELX_P HELX_P32  32  ILE A 831  ? LYS A 836  ? ILE A 831  LYS A 836  1 ? 6  
HELX_P HELX_P33  33  ALA A 838  ? GLU A 852  ? ALA A 838  GLU A 852  1 ? 15 
HELX_P HELX_P34  34  ASP A 880  ? THR A 882  ? ASP A 880  THR A 882  5 ? 3  
HELX_P HELX_P35  35  SER A 895  ? GLU A 900  ? SER A 895  GLU A 900  1 ? 6  
HELX_P HELX_P36  36  SER A 912  ? TYR A 916  ? SER A 912  TYR A 916  5 ? 5  
HELX_P HELX_P37  37  GLN A 928  ? GLU A 943  ? GLN A 928  GLU A 943  1 ? 16 
HELX_P HELX_P38  38  ASN A 962  ? ILE A 967  ? ASN A 962  ILE A 967  1 ? 6  
HELX_P HELX_P39  39  LEU A 985  ? ALA A 998  ? LEU A 985  ALA A 998  1 ? 14 
HELX_P HELX_P40  40  ARG A 1011 ? ASN A 1016 ? ARG A 1011 ASN A 1016 1 ? 6  
HELX_P HELX_P41  41  THR A 1018 ? ARG A 1026 ? THR A 1018 ARG A 1026 1 ? 9  
HELX_P HELX_P42  42  ALA A 1030 ? GLU A 1037 ? ALA A 1030 GLU A 1037 1 ? 8  
HELX_P HELX_P43  43  ASN A 1041 ? GLN A 1058 ? ASN A 1041 GLN A 1058 1 ? 18 
HELX_P HELX_P44  44  MET A 1066 ? THR A 1086 ? MET A 1066 THR A 1086 1 ? 21 
HELX_P HELX_P45  45  GLY A 1100 ? PRO A 1102 ? GLY A 1100 PRO A 1102 5 ? 3  
HELX_P HELX_P46  46  ARG A 1103 ? ASN A 1109 ? ARG A 1103 ASN A 1109 1 ? 7  
HELX_P HELX_P47  47  ALA A 1134 ? THR A 1139 ? ALA A 1134 THR A 1139 1 ? 6  
HELX_P HELX_P48  48  ASP A 1171 ? ILE A 1179 ? ASP A 1171 ILE A 1179 1 ? 9  
HELX_P HELX_P49  49  SER A 1211 ? ALA A 1216 ? SER A 1211 ALA A 1216 1 ? 6  
HELX_P HELX_P50  50  LYS A 1218 ? SER A 1222 ? LYS A 1218 SER A 1222 5 ? 5  
HELX_P HELX_P51  51  ASP A 1263 ? LEU A 1274 ? ASP A 1263 LEU A 1274 1 ? 12 
HELX_P HELX_P52  52  SER A 1337 ? LEU A 1345 ? SER A 1337 LEU A 1345 1 ? 9  
HELX_P HELX_P53  53  GLY A 1346 ? ASN A 1360 ? GLY A 1346 ASN A 1360 1 ? 15 
HELX_P HELX_P54  54  ASN A 1370 ? THR A 1382 ? ASN A 1370 THR A 1382 1 ? 13 
HELX_P HELX_P55  55  THR A 1400 ? GLU A 1409 ? THR A 1400 GLU A 1409 1 ? 10 
HELX_P HELX_P56  56  VAL A 1412 ? ALA A 1419 ? VAL A 1412 ALA A 1419 1 ? 8  
HELX_P HELX_P57  57  ALA A 1420 ? GLY A 1422 ? ALA A 1420 GLY A 1422 5 ? 3  
HELX_P HELX_P58  58  GLU A 1432 ? LEU A 1436 ? GLU A 1432 LEU A 1436 5 ? 5  
HELX_P HELX_P59  59  ASP A 1452 ? TYR A 1459 ? ASP A 1452 TYR A 1459 1 ? 8  
HELX_P HELX_P60  60  PRO A 1466 ? SER A 1471 ? PRO A 1466 SER A 1471 5 ? 6  
HELX_P HELX_P61  61  MET A 1491 ? VAL A 1497 ? MET A 1491 VAL A 1497 1 ? 7  
HELX_P HELX_P62  62  THR B 13   ? THR B 28   ? THR B 13   THR B 28   1 ? 16 
HELX_P HELX_P63  63  THR B 45   ? VAL B 50   ? THR B 45   VAL B 50   1 ? 6  
HELX_P HELX_P64  64  SER B 170  ? LEU B 177  ? SER B 170  LEU B 177  1 ? 8  
HELX_P HELX_P65  65  ILE B 189  ? SER B 193  ? ILE B 189  SER B 193  5 ? 5  
HELX_P HELX_P66  66  ILE B 268  ? ARG B 273  ? ILE B 268  ARG B 273  1 ? 6  
HELX_P HELX_P67  67  ARG B 281  ? CYS B 288  ? ARG B 281  CYS B 288  1 ? 8  
HELX_P HELX_P68  68  ASP B 293  ? MET B 299  ? ASP B 293  MET B 299  1 ? 7  
HELX_P HELX_P69  69  MET B 299  ? GLU B 306  ? MET B 299  GLU B 306  1 ? 8  
HELX_P HELX_P70  70  LYS B 313  ? TYR B 319  ? LYS B 313  TYR B 319  1 ? 7  
HELX_P HELX_P71  71  THR B 330  ? GLN B 343  ? THR B 330  GLN B 343  1 ? 14 
HELX_P HELX_P72  72  ARG B 359  ? LEU B 376  ? ARG B 359  LEU B 376  1 ? 18 
HELX_P HELX_P73  73  LEU B 394  ? GLU B 423  ? LEU B 394  GLU B 423  1 ? 30 
HELX_P HELX_P74  74  THR B 440  ? ALA B 448  ? THR B 440  ALA B 448  1 ? 9  
HELX_P HELX_P75  75  THR B 473  ? LEU B 481  ? THR B 473  LEU B 481  1 ? 9  
HELX_P HELX_P76  76  HIS B 501  ? TRP B 505  ? HIS B 501  TRP B 505  5 ? 5  
HELX_P HELX_P77  77  ALA B 538  ? GLU B 546  ? ALA B 538  GLU B 546  1 ? 9  
HELX_P HELX_P78  78  ASP B 578  ? ARG B 591  ? ASP B 578  ARG B 591  1 ? 14 
HELX_P HELX_P79  79  ARG B 641  ? ASP B 653  ? ARG B 641  ASP B 653  1 ? 13 
HELX_P HELX_P80  80  GLU B 681  ? VAL B 685  ? GLU B 681  VAL B 685  5 ? 5  
HELX_P HELX_P81  81  SER B 690  ? GLN B 701  ? SER B 690  GLN B 701  1 ? 12 
HELX_P HELX_P82  82  HIS B 733  ? ILE B 737  ? HIS B 733  ILE B 737  5 ? 5  
HELX_P HELX_P83  83  SER B 753  ? LYS B 764  ? SER B 753  LYS B 764  1 ? 12 
HELX_P HELX_P84  84  GLN B 832  ? ASP B 836  ? GLN B 832  ASP B 836  1 ? 5  
HELX_P HELX_P85  85  THR B 878  ? LEU B 882  ? THR B 878  LEU B 882  5 ? 5  
HELX_P HELX_P86  86  ASN B 1002 ? ILE B 1006 ? ASN B 1002 ILE B 1006 5 ? 5  
HELX_P HELX_P87  87  THR B 1011 ? SER B 1024 ? THR B 1011 SER B 1024 1 ? 14 
HELX_P HELX_P88  88  THR B 1040 ? SER B 1050 ? THR B 1040 SER B 1050 1 ? 11 
HELX_P HELX_P89  89  GLY B 1120 ? GLY B 1131 ? GLY B 1120 GLY B 1131 1 ? 12 
HELX_P HELX_P90  90  CYS B 1132 ? ASP B 1142 ? CYS B 1132 ASP B 1142 1 ? 11 
HELX_P HELX_P91  91  PRO B 1185 ? SER B 1197 ? PRO B 1185 SER B 1197 1 ? 13 
HELX_P HELX_P92  92  SER C 25   ? ALA C 38   ? SER C 25   ALA C 38   1 ? 14 
HELX_P HELX_P93  93  PRO C 58   ? ILE C 69   ? PRO C 58   ILE C 69   1 ? 12 
HELX_P HELX_P94  94  CYS C 96   ? SER C 100  ? CYS C 96   SER C 100  5 ? 5  
HELX_P HELX_P95  95  ARG C 120  ? LEU C 122  ? ARG C 120  LEU C 122  5 ? 3  
HELX_P HELX_P96  96  ILE C 164  ? HIS C 168  ? ILE C 164  HIS C 168  5 ? 5  
HELX_P HELX_P97  97  SER C 205  ? ASP C 209  ? SER C 205  ASP C 209  5 ? 5  
HELX_P HELX_P98  98  MET C 245  ? GLU C 265  ? MET C 245  GLU C 265  1 ? 21 
HELX_P HELX_P99  99  GLY D 16   ? GLU D 22   ? GLY D 16   GLU D 22   1 ? 7  
HELX_P HELX_P100 100 THR D 26   ? ARG D 43   ? THR D 26   ARG D 43   1 ? 18 
HELX_P HELX_P101 101 ASP D 53   ? VAL D 64   ? ASP D 53   VAL D 64   1 ? 12 
HELX_P HELX_P102 102 THR D 70   ? LEU D 81   ? THR D 70   LEU D 81   1 ? 12 
HELX_P HELX_P103 103 HIS D 86   ? CYS D 97   ? HIS D 86   CYS D 97   1 ? 12 
HELX_P HELX_P104 104 ASP D 100  ? ILE D 108  ? ASP D 100  ILE D 108  1 ? 9  
HELX_P HELX_P105 105 PRO D 109  ? ALA D 112  ? PRO D 109  ALA D 112  5 ? 4  
HELX_P HELX_P106 106 ASP D 117  ? ARG D 131  ? ASP D 117  ARG D 131  1 ? 15 
HELX_P HELX_P107 107 GLU E 5    ? ARG E 13   ? GLU E 5    ARG E 13   1 ? 9  
HELX_P HELX_P108 108 ALA E 14   ? LYS E 16   ? ALA E 14   LYS E 16   5 ? 3  
HELX_P HELX_P109 109 THR E 37   ? HIS E 45   ? THR E 37   HIS E 45   1 ? 9  
HELX_P HELX_P110 110 MET E 87   ? PHE E 90   ? MET E 87   PHE E 90   5 ? 4  
HELX_P HELX_P111 111 VAL E 91   ? HIS E 97   ? VAL E 91   HIS E 97   1 ? 7  
HELX_P HELX_P112 112 PRO E 112  ? ILE E 117  ? PRO E 112  ILE E 117  1 ? 6  
HELX_P HELX_P113 113 SER E 152  ? TYR E 163  ? SER E 152  TYR E 163  1 ? 12 
HELX_P HELX_P114 114 ASP E 177  ? GLY E 184  ? ASP E 177  GLY E 184  1 ? 8  
HELX_P HELX_P115 115 THR F 76   ? MET F 93   ? THR F 76   MET F 93   1 ? 18 
HELX_P HELX_P116 116 LEU F 108  ? GLN F 117  ? LEU F 108  GLN F 117  1 ? 10 
HELX_P HELX_P117 117 HIS G 15   ? PHE G 19   ? HIS G 15   PHE G 19   5 ? 5  
HELX_P HELX_P118 118 ARG G 22   ? GLU G 36   ? ARG G 22   GLU G 36   1 ? 15 
HELX_P HELX_P119 119 HIS G 114  ? VAL G 116  ? HIS G 114  VAL G 116  5 ? 3  
HELX_P HELX_P120 120 PRO H 66   ? ALA H 71   ? PRO H 66   ALA H 71   1 ? 6  
HELX_P HELX_P121 121 TYR J 21   ? GLN J 26   ? TYR J 21   GLN J 26   1 ? 6  
HELX_P HELX_P122 122 GLU J 31   ? GLY J 39   ? GLU J 31   GLY J 39   5 ? 9  
HELX_P HELX_P123 123 CYS J 45   ? THR J 51   ? CYS J 45   THR J 51   1 ? 7  
HELX_P HELX_P124 124 ILE J 56   ? CYS J 61   ? ILE J 56   CYS J 61   1 ? 6  
HELX_P HELX_P125 125 GLU K 5    ? LEU K 9    ? GLU K 5    LEU K 9    5 ? 5  
HELX_P HELX_P126 126 THR K 40   ? GLN K 48   ? THR K 40   GLN K 48   1 ? 9  
HELX_P HELX_P127 127 LEU K 49   ? ASP K 52   ? LEU K 49   ASP K 52   5 ? 4  
HELX_P HELX_P128 128 PRO K 82   ? TRP K 108  ? PRO K 82   TRP K 108  1 ? 27 
HELX_P HELX_P129 129 SER M 25   ? SER M 33   ? SER M 25   SER M 33   1 ? 9  
HELX_P HELX_P130 130 HIS M 94   ? LEU M 105  ? HIS M 94   LEU M 105  1 ? 12 
HELX_P HELX_P131 131 ASN M 121  ? TYR M 130  ? ASN M 121  TYR M 130  1 ? 10 
HELX_P HELX_P132 132 ARG M 136  ? LYS M 147  ? ARG M 136  LYS M 147  1 ? 12 
HELX_P HELX_P133 133 SER M 209  ? ILE M 220  ? SER M 209  ILE M 220  1 ? 12 
HELX_P HELX_P134 134 SER M 221  ? LEU M 228  ? SER M 221  LEU M 228  1 ? 8  
HELX_P HELX_P135 135 ARG M 236  ? MET M 240  ? ARG M 236  MET M 240  5 ? 5  
HELX_P HELX_P136 136 PRO M 249  ? ARG M 253  ? PRO M 249  ARG M 253  5 ? 5  
HELX_P HELX_P137 137 HIS M 270  ? ARG M 284  ? HIS M 270  ARG M 284  1 ? 15 
HELX_P HELX_P138 138 CYS M 285  ? GLU M 288  ? CYS M 285  GLU M 288  5 ? 4  
HELX_P HELX_P139 139 ILE M 294  ? TYR M 309  ? ILE M 294  TYR M 309  1 ? 16 
HELX_P HELX_P140 140 SER M 330  ? LYS M 336  ? SER M 330  LYS M 336  1 ? 7  
HELX_P HELX_P141 141 PRO M 373  ? LYS M 378  ? PRO M 373  LYS M 378  1 ? 6  
HELX_P HELX_P142 142 ASN M 390  ? GLY M 401  ? ASN M 390  GLY M 401  1 ? 12 
HELX_P HELX_P143 143 HIS M 457  ? MET M 459  ? HIS M 457  MET M 459  5 ? 3  
HELX_P HELX_P144 144 SER M 479  ? ASN M 485  ? SER M 479  ASN M 485  5 ? 7  
HELX_P HELX_P145 145 GLU M 502  ? ILE M 510  ? GLU M 502  ILE M 510  1 ? 9  
HELX_P HELX_P146 146 GLN M 531  ? LYS M 539  ? GLN M 531  LYS M 539  1 ? 9  
HELX_P HELX_P147 147 ARG M 549  ? ASN M 554  ? ARG M 549  ASN M 554  1 ? 6  
HELX_P HELX_P148 148 ILE M 555  ? TRP M 558  ? ILE M 555  TRP M 558  5 ? 4  
HELX_P HELX_P149 149 LYS M 581  ? LEU M 586  ? LYS M 581  LEU M 586  1 ? 6  
HELX_P HELX_P150 150 ASP M 624  ? GLY M 629  ? ASP M 624  GLY M 629  1 ? 6  
HELX_P HELX_P151 151 GLY M 634  ? ILE M 639  ? GLY M 634  ILE M 639  1 ? 6  
HELX_P HELX_P152 152 ILE M 647  ? GLY M 667  ? ILE M 647  GLY M 667  1 ? 21 
HELX_P HELX_P153 153 GLY M 671  ? ILE M 676  ? GLY M 671  ILE M 676  5 ? 6  
HELX_P HELX_P154 154 ALA M 679  ? GLU M 691  ? ALA M 679  GLU M 691  1 ? 13 
HELX_P HELX_P155 155 ARG M 693  ? GLN M 701  ? ARG M 693  GLN M 701  1 ? 9  
HELX_P HELX_P156 156 ARG M 717  ? HIS M 741  ? ARG M 717  HIS M 741  1 ? 25 
HELX_P HELX_P157 157 LYS M 750  ? GLY M 756  ? LYS M 750  GLY M 756  1 ? 7  
HELX_P HELX_P158 158 SER M 760  ? ALA M 769  ? SER M 760  ALA M 769  1 ? 10 
HELX_P HELX_P159 159 THR M 815  ? ARG M 827  ? THR M 815  ARG M 827  1 ? 13 
HELX_P HELX_P160 160 ILE M 831  ? LYS M 836  ? ILE M 831  LYS M 836  1 ? 6  
HELX_P HELX_P161 161 ALA M 838  ? GLU M 852  ? ALA M 838  GLU M 852  1 ? 15 
HELX_P HELX_P162 162 ASP M 880  ? THR M 882  ? ASP M 880  THR M 882  5 ? 3  
HELX_P HELX_P163 163 SER M 895  ? GLU M 900  ? SER M 895  GLU M 900  1 ? 6  
HELX_P HELX_P164 164 SER M 912  ? TYR M 916  ? SER M 912  TYR M 916  5 ? 5  
HELX_P HELX_P165 165 GLN M 928  ? GLU M 943  ? GLN M 928  GLU M 943  1 ? 16 
HELX_P HELX_P166 166 ASN M 962  ? ILE M 967  ? ASN M 962  ILE M 967  1 ? 6  
HELX_P HELX_P167 167 LEU M 985  ? ALA M 998  ? LEU M 985  ALA M 998  1 ? 14 
HELX_P HELX_P168 168 ARG M 1011 ? ASN M 1016 ? ARG M 1011 ASN M 1016 1 ? 6  
HELX_P HELX_P169 169 THR M 1018 ? ARG M 1026 ? THR M 1018 ARG M 1026 1 ? 9  
HELX_P HELX_P170 170 ALA M 1030 ? GLU M 1037 ? ALA M 1030 GLU M 1037 1 ? 8  
HELX_P HELX_P171 171 ASN M 1041 ? GLN M 1058 ? ASN M 1041 GLN M 1058 1 ? 18 
HELX_P HELX_P172 172 MET M 1066 ? THR M 1086 ? MET M 1066 THR M 1086 1 ? 21 
HELX_P HELX_P173 173 GLY M 1100 ? PRO M 1102 ? GLY M 1100 PRO M 1102 5 ? 3  
HELX_P HELX_P174 174 ARG M 1103 ? ASN M 1109 ? ARG M 1103 ASN M 1109 1 ? 7  
HELX_P HELX_P175 175 ALA M 1134 ? THR M 1139 ? ALA M 1134 THR M 1139 1 ? 6  
HELX_P HELX_P176 176 ASP M 1171 ? ILE M 1179 ? ASP M 1171 ILE M 1179 1 ? 9  
HELX_P HELX_P177 177 SER M 1211 ? ALA M 1216 ? SER M 1211 ALA M 1216 1 ? 6  
HELX_P HELX_P178 178 LYS M 1218 ? SER M 1222 ? LYS M 1218 SER M 1222 5 ? 5  
HELX_P HELX_P179 179 ASP M 1263 ? GLU M 1275 ? ASP M 1263 GLU M 1275 1 ? 13 
HELX_P HELX_P180 180 SER M 1337 ? LEU M 1345 ? SER M 1337 LEU M 1345 1 ? 9  
HELX_P HELX_P181 181 GLY M 1346 ? ASN M 1360 ? GLY M 1346 ASN M 1360 1 ? 15 
HELX_P HELX_P182 182 ASN M 1370 ? THR M 1382 ? ASN M 1370 THR M 1382 1 ? 13 
HELX_P HELX_P183 183 THR M 1400 ? GLU M 1409 ? THR M 1400 GLU M 1409 1 ? 10 
HELX_P HELX_P184 184 VAL M 1412 ? ALA M 1419 ? VAL M 1412 ALA M 1419 1 ? 8  
HELX_P HELX_P185 185 ALA M 1420 ? GLY M 1422 ? ALA M 1420 GLY M 1422 5 ? 3  
HELX_P HELX_P186 186 GLU M 1432 ? LEU M 1436 ? GLU M 1432 LEU M 1436 5 ? 5  
HELX_P HELX_P187 187 ASP M 1452 ? TYR M 1459 ? ASP M 1452 TYR M 1459 1 ? 8  
HELX_P HELX_P188 188 MET M 1491 ? VAL M 1497 ? MET M 1491 VAL M 1497 1 ? 7  
HELX_P HELX_P189 189 ASP M 1501 ? PHE M 1505 ? ASP M 1501 PHE M 1505 5 ? 5  
HELX_P HELX_P190 190 THR N 13   ? THR N 28   ? THR N 13   THR N 28   1 ? 16 
HELX_P HELX_P191 191 THR N 45   ? VAL N 50   ? THR N 45   VAL N 50   1 ? 6  
HELX_P HELX_P192 192 SER N 170  ? LEU N 177  ? SER N 170  LEU N 177  1 ? 8  
HELX_P HELX_P193 193 ILE N 189  ? SER N 193  ? ILE N 189  SER N 193  5 ? 5  
HELX_P HELX_P194 194 ILE N 268  ? ARG N 273  ? ILE N 268  ARG N 273  1 ? 6  
HELX_P HELX_P195 195 ARG N 281  ? CYS N 288  ? ARG N 281  CYS N 288  1 ? 8  
HELX_P HELX_P196 196 ASP N 293  ? MET N 299  ? ASP N 293  MET N 299  1 ? 7  
HELX_P HELX_P197 197 MET N 299  ? GLU N 306  ? MET N 299  GLU N 306  1 ? 8  
HELX_P HELX_P198 198 LYS N 313  ? TYR N 319  ? LYS N 313  TYR N 319  1 ? 7  
HELX_P HELX_P199 199 THR N 330  ? GLN N 343  ? THR N 330  GLN N 343  1 ? 14 
HELX_P HELX_P200 200 ARG N 359  ? LEU N 376  ? ARG N 359  LEU N 376  1 ? 18 
HELX_P HELX_P201 201 LEU N 394  ? GLU N 423  ? LEU N 394  GLU N 423  1 ? 30 
HELX_P HELX_P202 202 THR N 440  ? ALA N 448  ? THR N 440  ALA N 448  1 ? 9  
HELX_P HELX_P203 203 THR N 473  ? LEU N 481  ? THR N 473  LEU N 481  1 ? 9  
HELX_P HELX_P204 204 HIS N 501  ? TRP N 505  ? HIS N 501  TRP N 505  5 ? 5  
HELX_P HELX_P205 205 ALA N 538  ? GLU N 546  ? ALA N 538  GLU N 546  1 ? 9  
HELX_P HELX_P206 206 ASP N 578  ? ARG N 591  ? ASP N 578  ARG N 591  1 ? 14 
HELX_P HELX_P207 207 ARG N 641  ? ASP N 653  ? ARG N 641  ASP N 653  1 ? 13 
HELX_P HELX_P208 208 GLU N 681  ? VAL N 685  ? GLU N 681  VAL N 685  5 ? 5  
HELX_P HELX_P209 209 SER N 690  ? GLN N 701  ? SER N 690  GLN N 701  1 ? 12 
HELX_P HELX_P210 210 HIS N 733  ? ILE N 737  ? HIS N 733  ILE N 737  5 ? 5  
HELX_P HELX_P211 211 SER N 753  ? LYS N 764  ? SER N 753  LYS N 764  1 ? 12 
HELX_P HELX_P212 212 GLN N 832  ? ASP N 836  ? GLN N 832  ASP N 836  1 ? 5  
HELX_P HELX_P213 213 THR N 878  ? LEU N 882  ? THR N 878  LEU N 882  5 ? 5  
HELX_P HELX_P214 214 ASN N 1002 ? ILE N 1006 ? ASN N 1002 ILE N 1006 5 ? 5  
HELX_P HELX_P215 215 THR N 1011 ? SER N 1024 ? THR N 1011 SER N 1024 1 ? 14 
HELX_P HELX_P216 216 THR N 1040 ? SER N 1050 ? THR N 1040 SER N 1050 1 ? 11 
HELX_P HELX_P217 217 GLY N 1120 ? GLY N 1131 ? GLY N 1120 GLY N 1131 1 ? 12 
HELX_P HELX_P218 218 CYS N 1132 ? ASP N 1142 ? CYS N 1132 ASP N 1142 1 ? 11 
HELX_P HELX_P219 219 PRO N 1185 ? SER N 1197 ? PRO N 1185 SER N 1197 1 ? 13 
HELX_P HELX_P220 220 SER O 25   ? ALA O 38   ? SER O 25   ALA O 38   1 ? 14 
HELX_P HELX_P221 221 PRO O 58   ? ILE O 69   ? PRO O 58   ILE O 69   1 ? 12 
HELX_P HELX_P222 222 CYS O 96   ? SER O 100  ? CYS O 96   SER O 100  5 ? 5  
HELX_P HELX_P223 223 ARG O 120  ? LEU O 122  ? ARG O 120  LEU O 122  5 ? 3  
HELX_P HELX_P224 224 ILE O 164  ? HIS O 168  ? ILE O 164  HIS O 168  5 ? 5  
HELX_P HELX_P225 225 SER O 205  ? ASP O 209  ? SER O 205  ASP O 209  5 ? 5  
HELX_P HELX_P226 226 MET O 245  ? GLU O 265  ? MET O 245  GLU O 265  1 ? 21 
HELX_P HELX_P227 227 GLY P 16   ? GLU P 22   ? GLY P 16   GLU P 22   1 ? 7  
HELX_P HELX_P228 228 THR P 26   ? ARG P 43   ? THR P 26   ARG P 43   1 ? 18 
HELX_P HELX_P229 229 ASP P 53   ? VAL P 64   ? ASP P 53   VAL P 64   1 ? 12 
HELX_P HELX_P230 230 THR P 70   ? LEU P 81   ? THR P 70   LEU P 81   1 ? 12 
HELX_P HELX_P231 231 HIS P 86   ? CYS P 97   ? HIS P 86   CYS P 97   1 ? 12 
HELX_P HELX_P232 232 ASP P 100  ? ILE P 108  ? ASP P 100  ILE P 108  1 ? 9  
HELX_P HELX_P233 233 PRO P 109  ? ALA P 112  ? PRO P 109  ALA P 112  5 ? 4  
HELX_P HELX_P234 234 ASP P 117  ? ARG P 131  ? ASP P 117  ARG P 131  1 ? 15 
HELX_P HELX_P235 235 GLU Q 5    ? ARG Q 13   ? GLU Q 5    ARG Q 13   1 ? 9  
HELX_P HELX_P236 236 ALA Q 14   ? LYS Q 16   ? ALA Q 14   LYS Q 16   5 ? 3  
HELX_P HELX_P237 237 THR Q 37   ? HIS Q 45   ? THR Q 37   HIS Q 45   1 ? 9  
HELX_P HELX_P238 238 MET Q 87   ? PHE Q 90   ? MET Q 87   PHE Q 90   5 ? 4  
HELX_P HELX_P239 239 VAL Q 91   ? HIS Q 97   ? VAL Q 91   HIS Q 97   1 ? 7  
HELX_P HELX_P240 240 PRO Q 112  ? ILE Q 117  ? PRO Q 112  ILE Q 117  1 ? 6  
HELX_P HELX_P241 241 SER Q 152  ? TYR Q 163  ? SER Q 152  TYR Q 163  1 ? 12 
HELX_P HELX_P242 242 ASP Q 177  ? GLY Q 184  ? ASP Q 177  GLY Q 184  1 ? 8  
HELX_P HELX_P243 243 THR R 76   ? MET R 93   ? THR R 76   MET R 93   1 ? 18 
HELX_P HELX_P244 244 LEU R 108  ? GLN R 117  ? LEU R 108  GLN R 117  1 ? 10 
HELX_P HELX_P245 245 HIS S 15   ? PHE S 19   ? HIS S 15   PHE S 19   5 ? 5  
HELX_P HELX_P246 246 ARG S 22   ? GLU S 36   ? ARG S 22   GLU S 36   1 ? 15 
HELX_P HELX_P247 247 HIS S 114  ? VAL S 116  ? HIS S 114  VAL S 116  5 ? 3  
HELX_P HELX_P248 248 PRO T 66   ? ALA T 71   ? PRO T 66   ALA T 71   1 ? 6  
HELX_P HELX_P249 249 TYR V 21   ? GLN V 26   ? TYR V 21   GLN V 26   1 ? 6  
HELX_P HELX_P250 250 GLU V 31   ? GLY V 39   ? GLU V 31   GLY V 39   5 ? 9  
HELX_P HELX_P251 251 CYS V 45   ? THR V 51   ? CYS V 45   THR V 51   1 ? 7  
HELX_P HELX_P252 252 ILE V 56   ? CYS V 61   ? ILE V 56   CYS V 61   1 ? 6  
HELX_P HELX_P253 253 GLU W 5    ? LEU W 9    ? GLU W 5    LEU W 9    5 ? 5  
HELX_P HELX_P254 254 THR W 40   ? GLN W 48   ? THR W 40   GLN W 48   1 ? 9  
HELX_P HELX_P255 255 LEU W 49   ? ASP W 52   ? LEU W 49   ASP W 52   5 ? 4  
HELX_P HELX_P256 256 GLN W 84   ? TRP W 108  ? GLN W 84   TRP W 108  1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 1155 SG ? ? ? 1_555 B  CYS 1173 SG ? ? B CYS 1155 B CYS 1173 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2  disulf ? ? C CYS 90   SG ? ? ? 1_555 C  CYS 99   SG ? ? C CYS 90   C CYS 99   1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf3  disulf ? ? N CYS 1155 SG ? ? ? 1_555 N  CYS 1173 SG ? ? N CYS 1155 N CYS 1173 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4  disulf ? ? O CYS 90   SG ? ? ? 1_555 O  CYS 99   SG ? ? O CYS 90   O CYS 99   1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc1  metalc ? ? A CYS 69   SG ? ? ? 1_555 Z  ZN  .    ZN ? ? A CYS 69   A ZN  2457 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc2  metalc ? ? A CYS 79   SG ? ? ? 1_555 Z  ZN  .    ZN ? ? A CYS 79   A ZN  2457 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc3  metalc ? ? A CYS 109  SG ? ? ? 1_555 Y  ZN  .    ZN ? ? A CYS 109  A ZN  2456 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc4  metalc ? ? A CYS 112  SG ? ? ? 1_555 Y  ZN  .    ZN ? ? A CYS 112  A ZN  2456 1_555 ? ? ? ? ? ? ? 2.901 ? 
metalc5  metalc ? ? A CYS 150  SG ? ? ? 1_555 Y  ZN  .    ZN ? ? A CYS 150  A ZN  2456 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc6  metalc ? ? B CYS 1152 SG ? ? ? 1_555 BA ZN  .    ZN ? ? B CYS 1152 B ZN  2225 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc7  metalc ? ? B CYS 1155 SG ? ? ? 1_555 BA ZN  .    ZN ? ? B CYS 1155 B ZN  2225 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc8  metalc ? ? B CYS 1173 SG ? ? ? 1_555 BA ZN  .    ZN ? ? B CYS 1173 B ZN  2225 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc9  metalc ? ? C CYS 90   SG ? ? ? 1_555 CA ZN  .    ZN ? ? C CYS 90   C ZN  1269 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc10 metalc ? ? I CYS 10   SG ? ? ? 1_555 DA ZN  .    ZN ? ? I CYS 10   I ZN  1121 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc11 metalc ? ? I CYS 29   SG ? ? ? 1_555 DA ZN  .    ZN ? ? I CYS 29   I ZN  1121 1_555 ? ? ? ? ? ? ? 3.000 ? 
metalc12 metalc ? ? I CYS 32   SG ? ? ? 1_555 DA ZN  .    ZN ? ? I CYS 32   I ZN  1121 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc13 metalc ? ? I CYS 103  SG ? ? ? 1_555 EA ZN  .    ZN ? ? I CYS 103  I ZN  1122 1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc14 metalc ? ? I CYS 106  SG ? ? ? 1_555 EA ZN  .    ZN ? ? I CYS 106  I ZN  1122 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc15 metalc ? ? J CYS 7    SG ? ? ? 1_555 FA ZN  .    ZN ? ? J CYS 7    J ZN  1066 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc16 metalc ? ? J CYS 10   SG ? ? ? 1_555 FA ZN  .    ZN ? ? J CYS 10   J ZN  1066 1_555 ? ? ? ? ? ? ? 2.922 ? 
metalc17 metalc ? ? J CYS 44   SG ? ? ? 1_555 FA ZN  .    ZN ? ? J CYS 44   J ZN  1066 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc18 metalc ? ? J CYS 45   SG ? ? ? 1_555 FA ZN  .    ZN ? ? J CYS 45   J ZN  1066 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc19 metalc ? ? L CYS 24   SG ? ? ? 1_555 GA ZN  .    ZN ? ? L CYS 24   L ZN  1071 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc20 metalc ? ? L CYS 27   SG ? ? ? 1_555 GA ZN  .    ZN ? ? L CYS 27   L ZN  1071 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc21 metalc ? ? L CYS 44   SG ? ? ? 1_555 GA ZN  .    ZN ? ? L CYS 44   L ZN  1071 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc22 metalc ? ? M CYS 69   SG ? ? ? 1_555 IA ZN  .    ZN ? ? M CYS 69   M ZN  2457 1_555 ? ? ? ? ? ? ? 2.917 ? 
metalc23 metalc ? ? M CYS 79   SG ? ? ? 1_555 IA ZN  .    ZN ? ? M CYS 79   M ZN  2457 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc24 metalc ? ? N CYS 1152 SG ? ? ? 1_555 KA ZN  .    ZN ? ? N CYS 1152 N ZN  2225 1_555 ? ? ? ? ? ? ? 2.875 ? 
metalc25 metalc ? ? N CYS 1155 SG ? ? ? 1_555 KA ZN  .    ZN ? ? N CYS 1155 N ZN  2225 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc26 metalc ? ? N CYS 1173 SG ? ? ? 1_555 KA ZN  .    ZN ? ? N CYS 1173 N ZN  2225 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc27 metalc ? ? O CYS 90   SG ? ? ? 1_555 LA ZN  .    ZN ? ? O CYS 90   O ZN  1269 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc28 metalc ? ? U CYS 10   SG ? ? ? 1_555 MA ZN  .    ZN ? ? U CYS 10   U ZN  1121 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc29 metalc ? ? U CYS 29   SG ? ? ? 1_555 MA ZN  .    ZN ? ? U CYS 29   U ZN  1121 1_555 ? ? ? ? ? ? ? 2.924 ? 
metalc30 metalc ? ? U CYS 32   SG ? ? ? 1_555 MA ZN  .    ZN ? ? U CYS 32   U ZN  1121 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc31 metalc ? ? U CYS 78   SG ? ? ? 1_555 NA ZN  .    ZN ? ? U CYS 78   U ZN  1122 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc32 metalc ? ? U CYS 103  SG ? ? ? 1_555 NA ZN  .    ZN ? ? U CYS 103  U ZN  1122 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc33 metalc ? ? U CYS 106  SG ? ? ? 1_555 NA ZN  .    ZN ? ? U CYS 106  U ZN  1122 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc34 metalc ? ? V CYS 7    SG ? ? ? 1_555 OA ZN  .    ZN ? ? V CYS 7    V ZN  1066 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc35 metalc ? ? V CYS 10   SG ? ? ? 1_555 OA ZN  .    ZN ? ? V CYS 10   V ZN  1066 1_555 ? ? ? ? ? ? ? 2.921 ? 
metalc36 metalc ? ? V CYS 44   SG ? ? ? 1_555 OA ZN  .    ZN ? ? V CYS 44   V ZN  1066 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc37 metalc ? ? V CYS 45   SG ? ? ? 1_555 OA ZN  .    ZN ? ? V CYS 45   V ZN  1066 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc38 metalc ? ? X CYS 24   SG ? ? ? 1_555 PA ZN  .    ZN ? ? X CYS 24   X ZN  1071 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc39 metalc ? ? X CYS 27   SG ? ? ? 1_555 PA ZN  .    ZN ? ? X CYS 27   X ZN  1071 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc40 metalc ? ? X CYS 44   SG ? ? ? 1_555 PA ZN  .    ZN ? ? X CYS 44   X ZN  1071 1_555 ? ? ? ? ? ? ? 2.912 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   VAL 52   A . ? VAL 52   A GLY 53   A ? GLY 53   A 1 -0.05  
2   PRO 58   A . ? PRO 58   A ARG 59   A ? ARG 59   A 1 -0.07  
3   ARG 59   A . ? ARG 59   A LEU 60   A ? LEU 60   A 1 -0.16  
4   GLY 73   A . ? GLY 73   A GLU 74   A ? GLU 74   A 1 0.14   
5   THR 75   A . ? THR 75   A MET 76   A ? MET 76   A 1 -0.46  
6   TRP 110  A . ? TRP 110  A ASN 111  A ? ASN 111  A 1 -0.14  
7   SER 119  A . ? SER 119  A SER 120  A ? SER 120  A 1 0.28   
8   SER 120  A . ? SER 120  A ASN 121  A ? ASN 121  A 1 -0.04  
9   SER 158  A . ? SER 158  A ASP 159  A ? ASP 159  A 1 -0.06  
10  LEU 163  A . ? LEU 163  A SER 164  A ? SER 164  A 1 0.04   
11  ASN 165  A . ? ASN 165  A PRO 166  A ? PRO 166  A 1 0.06   
12  SER 167  A . ? SER 167  A ALA 168  A ? ALA 168  A 1 -0.01  
13  MET 170  A . ? MET 170  A GLY 171  A ? GLY 171  A 1 -0.04  
14  ALA 177  A . ? ALA 177  A ALA 178  A ? ALA 178  A 1 -0.03  
15  ARG 195  A . ? ARG 195  A GLY 196  A ? GLY 196  A 1 0.04   
16  ASP 259  A . ? ASP 259  A GLY 260  A ? GLY 260  A 1 -0.15  
17  ASP 266  A . ? ASP 266  A ASP 267  A ? ASP 267  A 1 -0.20  
18  ASP 267  A . ? ASP 267  A LEU 268  A ? LEU 268  A 1 0.07   
19  GLU 288  A . ? GLU 288  A GLY 289  A ? GLY 289  A 1 1.63   
20  ALA 290  A . ? ALA 290  A PRO 291  A ? PRO 291  A 1 -2.73  
21  GLY 337  A . ? GLY 337  A LYS 338  A ? LYS 338  A 1 -0.32  
22  THR 381  A . ? THR 381  A TYR 382  A ? TYR 382  A 1 0.10   
23  GLY 445  A . ? GLY 445  A ASP 446  A ? ASP 446  A 1 6.41   
24  GLN 453  A . ? GLN 453  A PRO 454  A ? PRO 454  A 1 5.91   
25  ARG 467  A . ? ARG 467  A VAL 468  A ? VAL 468  A 1 4.43   
26  ALA 551  A . ? ALA 551  A VAL 552  A ? VAL 552  A 1 0.77   
27  VAL 559  A . ? VAL 559  A PRO 560  A ? PRO 560  A 1 -17.68 
28  ASN 605  A . ? ASN 605  A PRO 606  A ? PRO 606  A 1 -15.80 
29  TRP 640  A . ? TRP 640  A LYS 641  A ? LYS 641  A 1 11.76  
30  GLU 642  A . ? GLU 642  A LYS 643  A ? LYS 643  A 1 -0.04  
31  GLU 646  A . ? GLU 646  A ILE 647  A ? ILE 647  A 1 0.02   
32  LEU 708  A . ? LEU 708  A LYS 709  A ? LYS 709  A 1 0.07   
33  GLU 711  A . ? GLU 711  A PRO 712  A ? PRO 712  A 1 0.03   
34  MET 714  A . ? MET 714  A THR 715  A ? THR 715  A 1 0.07   
35  GLY 772  A . ? GLY 772  A GLN 773  A ? GLN 773  A 1 2.37   
36  GLY 784  A . ? GLY 784  A PHE 785  A ? PHE 785  A 1 2.01   
37  ARG 812  A . ? ARG 812  A GLY 813  A ? GLY 813  A 1 -0.07  
38  GLU 918  A . ? GLU 918  A ASN 919  A ? ASN 919  A 1 -0.06  
39  GLU 922  A . ? GLU 922  A ASN 923  A ? ASN 923  A 1 -0.04  
40  CYS 946  A . ? CYS 946  A LYS 947  A ? LYS 947  A 1 0.02   
41  LYS 947  A . ? LYS 947  A PHE 948  A ? PHE 948  A 1 0.04   
42  GLN 968  A . ? GLN 968  A ASN 969  A ? ASN 969  A 1 4.22   
43  ARG 1004 A . ? ARG 1004 A GLY 1005 A ? GLY 1005 A 1 -2.15  
44  SER 1006 A . ? SER 1006 A ASP 1007 A ? ASP 1007 A 1 -1.98  
45  SER 1062 A . ? SER 1062 A PRO 1063 A ? PRO 1063 A 1 -6.32  
46  GLY 1064 A . ? GLY 1064 A GLU 1065 A ? GLU 1065 A 1 0.17   
47  TYR 1089 A . ? TYR 1089 A ALA 1090 A ? ALA 1090 A 1 0.06   
48  GLY 1091 A . ? GLY 1091 A VAL 1092 A ? VAL 1092 A 1 0.05   
49  MET 1124 A . ? MET 1124 A PRO 1125 A ? PRO 1125 A 1 -19.80 
50  PRO 1125 A . ? PRO 1125 A TRP 1126 A ? TRP 1126 A 1 -9.68  
51  TRP 1126 A . ? TRP 1126 A ILE 1127 A ? ILE 1127 A 1 -1.11  
52  ILE 1127 A . ? ILE 1127 A ALA 1128 A ? ALA 1128 A 1 1.17   
53  SER 1151 A . ? SER 1151 A ALA 1152 A ? ALA 1152 A 1 -0.06  
54  ILE 1166 A . ? ILE 1166 A GLU 1167 A ? GLU 1167 A 1 -0.12  
55  ASP 1248 A . ? ASP 1248 A ASP 1249 A ? ASP 1249 A 1 0.02   
56  ALA 1253 A . ? ALA 1253 A GLU 1254 A ? GLU 1254 A 1 0.00   
57  ILE 1260 A . ? ILE 1260 A GLU 1261 A ? GLU 1261 A 1 -0.07  
58  SER 1276 A . ? SER 1276 A ILE 1277 A ? ILE 1277 A 1 -0.01  
59  ILE 1317 A . ? ILE 1317 A ASN 1318 A ? ASN 1318 A 1 -0.01  
60  GLY 1327 A . ? GLY 1327 A VAL 1328 A ? VAL 1328 A 1 -8.61  
61  VAL 1328 A . ? VAL 1328 A ASP 1329 A ? ASP 1329 A 1 1.54   
62  PHE 1364 A . ? PHE 1364 A ASP 1365 A ? ASP 1365 A 1 1.48   
63  GLU 1409 A . ? GLU 1409 A GLU 1410 A ? GLU 1410 A 1 0.00   
64  LEU 1461 A . ? LEU 1461 A GLY 1462 A ? GLY 1462 A 1 -0.05  
65  VAL 1465 A . ? VAL 1465 A PRO 1466 A ? PRO 1466 A 1 -0.04  
66  GLN 34   B . ? GLN 34   B LEU 35   B ? LEU 35   B 1 0.91   
67  PHE 41   B . ? PHE 41   B VAL 42   B ? VAL 42   B 1 4.87   
68  VAL 42   B . ? VAL 42   B GLN 43   B ? GLN 43   B 1 2.53   
69  GLN 43   B . ? GLN 43   B ASN 44   B ? ASN 44   B 1 -9.61  
70  PRO 101  B . ? PRO 101  B GLN 102  B ? GLN 102  B 1 4.69   
71  ILE 207  B . ? ILE 207  B VAL 208  B ? VAL 208  B 1 15.50  
72  ALA 214  B . ? ALA 214  B ALA 215  B ? ALA 215  B 1 0.11   
73  PRO 216  B . ? PRO 216  B SER 217  B ? SER 217  B 1 0.13   
74  LEU 229  B . ? LEU 229  B GLU 230  B ? GLU 230  B 1 0.14   
75  ASN 250  B . ? ASN 250  B SER 251  B ? SER 251  B 1 0.00   
76  PRO 260  B . ? PRO 260  B TYR 261  B ? TYR 261  B 1 1.09   
77  ILE 262  B . ? ILE 262  B ARG 263  B ? ARG 263  B 1 3.04   
78  ASP 290  B . ? ASP 290  B PRO 291  B ? PRO 291  B 1 -0.12  
79  PRO 291  B . ? PRO 291  B ASN 292  B ? ASN 292  B 1 -0.17  
80  ASN 292  B . ? ASN 292  B ASP 293  B ? ASP 293  B 1 -0.07  
81  ILE 310  B . ? ILE 310  B GLN 311  B ? GLN 311  B 1 0.00   
82  ARG 323  B . ? ARG 323  B GLY 324  B ? GLY 324  B 1 0.11   
83  VAL 329  B . ? VAL 329  B THR 330  B ? THR 330  B 1 -0.03  
84  HIS 386  B . ? HIS 386  B PHE 387  B ? PHE 387  B 1 3.46   
85  ASP 454  B . ? ASP 454  B GLN 455  B ? GLN 455  B 1 0.00   
86  GLY 464  B . ? GLY 464  B VAL 465  B ? VAL 465  B 1 -2.74  
87  PRO 487  B . ? PRO 487  B ILE 488  B ? ILE 488  B 1 -0.01  
88  ILE 488  B . ? ILE 488  B GLY 489  B ? GLY 489  B 1 -0.11  
89  GLY 492  B . ? GLY 492  B LYS 493  B ? LYS 493  B 1 0.01   
90  LYS 496  B . ? LYS 496  B PRO 497  B ? PRO 497  B 1 0.06   
91  VAL 508  B . ? VAL 508  B CYS 509  B ? CYS 509  B 1 11.39  
92  TRP 547  B . ? TRP 547  B GLY 548  B ? GLY 548  B 1 0.16   
93  GLY 548  B . ? GLY 548  B LEU 549  B ? LEU 549  B 1 -3.60  
94  SER 560  B . ? SER 560  B PRO 561  B ? PRO 561  B 1 1.83   
95  PRO 561  B . ? PRO 561  B ASN 562  B ? ASN 562  B 1 2.11   
96  ASN 562  B . ? ASN 562  B ALA 563  B ? ALA 563  B 1 0.08   
97  ASN 629  B . ? ASN 629  B PRO 630  B ? PRO 630  B 1 -4.78  
98  GLY 636  B . ? GLY 636  B GLU 637  B ? GLU 637  B 1 2.80   
99  ARG 654  B . ? ARG 654  B TYR 655  B ? TYR 655  B 1 0.20   
100 PRO 659  B . ? PRO 659  B GLU 660  B ? GLU 660  B 1 -0.10  
101 ALA 719  B . ? ALA 719  B PRO 720  B ? PRO 720  B 1 -2.31  
102 GLY 856  B . ? GLY 856  B MET 857  B ? MET 857  B 1 1.28   
103 LEU 872  B . ? LEU 872  B ARG 873  B ? ARG 873  B 1 0.03   
104 GLY 877  B . ? GLY 877  B THR 878  B ? THR 878  B 1 0.11   
105 PRO 890  B . ? PRO 890  B GLY 891  B ? GLY 891  B 1 -2.48  
106 GLN 919  B . ? GLN 919  B LEU 920  B ? LEU 920  B 1 -3.75  
107 HIS 921  B . ? HIS 921  B ALA 922  B ? ALA 922  B 1 -0.15  
108 GLN 947  B . ? GLN 947  B GLU 948  B ? GLU 948  B 1 -2.40  
109 SER 991  B . ? SER 991  B ALA 992  B ? ALA 992  B 1 -16.66 
110 GLN 993  B . ? GLN 993  B GLY 994  B ? GLY 994  B 1 -5.50  
111 ARG 1113 B . ? ARG 1113 B ASP 1114 B ? ASP 1114 B 1 0.05   
112 GLY 1115 B . ? GLY 1115 B GLY 1116 B ? GLY 1116 B 1 0.00   
113 GLU 4    C . ? GLU 4    C THR 5    C ? THR 5    C 1 -1.35  
114 PRO 79   C . ? PRO 79   C PRO 80   C ? PRO 80   C 1 0.26   
115 SER 129  C . ? SER 129  C LEU 130  C ? LEU 130  C 1 -0.01  
116 LEU 130  C . ? LEU 130  C GLY 131  C ? GLY 131  C 1 -0.09  
117 PHE 194  C . ? PHE 194  C GLU 195  C ? GLU 195  C 1 -4.14  
118 GLU 212  C . ? GLU 212  C PRO 213  C ? PRO 213  C 1 -7.35  
119 GLU 216  C . ? GLU 216  C GLY 217  C ? GLY 217  C 1 1.95   
120 GLU 218  C . ? GLU 218  C PRO 219  C ? PRO 219  C 1 -0.33  
121 ASN 242  C . ? ASN 242  C GLU 243  C ? GLU 243  C 1 -4.11  
122 ALA 11   D . ? ALA 11   D GLN 12   D ? GLN 12   D 1 -0.11  
123 CYS 98   D . ? CYS 98   D GLU 99   D ? GLU 99   D 1 0.06   
124 LYS 132  D . ? LYS 132  D PHE 133  D ? PHE 133  D 1 -0.08  
125 HIS 23   E . ? HIS 23   E ASP 24   E ? ASP 24   E 1 -8.17  
126 GLY 49   E . ? GLY 49   E ARG 50   E ? ARG 50   E 1 -0.19  
127 LYS 69   E . ? LYS 69   E GLY 70   E ? GLY 70   E 1 -1.32  
128 ALA 77   E . ? ALA 77   E LYS 78   E ? LYS 78   E 1 -7.37  
129 VAL 82   E . ? VAL 82   E GLY 83   E ? GLY 83   E 1 -1.57  
130 ALA 107  E . ? ALA 107  E ASN 108  E ? ASN 108  E 1 -2.81  
131 GLU 128  E . ? GLU 128  E THR 129  E ? THR 129  E 1 0.50   
132 GLU 198  E . ? GLU 198  E THR 199  E ? THR 199  E 1 -0.04  
133 THR 199  E . ? THR 199  E SER 200  E ? SER 200  E 1 9.45   
134 LYS 59   G . ? LYS 59   G GLY 60   G ? GLY 60   G 1 0.15   
135 GLY 133  G . ? GLY 133  G GLU 134  G ? GLU 134  G 1 0.12   
136 ASP 17   H . ? ASP 17   H LYS 18   H ? LYS 18   H 1 8.20   
137 ASN 62   H . ? ASN 62   H LEU 63   H ? LEU 63   H 1 0.17   
138 ARG 109  H . ? ARG 109  H LYS 110  H ? LYS 110  H 1 6.25   
139 THR 57   I . ? THR 57   I VAL 58   I ? VAL 58   I 1 -0.21  
140 GLY 93   I . ? GLY 93   I ASP 94   I ? ASP 94   I 1 0.15   
141 TYR 43   J . ? TYR 43   J CYS 44   J ? CYS 44   J 1 0.06   
142 SER 24   K . ? SER 24   K LYS 25   K ? LYS 25   K 1 0.96   
143 LYS 25   K . ? LYS 25   K SER 26   K ? SER 26   K 1 3.44   
144 THR 76   K . ? THR 76   K VAL 77   K ? VAL 77   K 1 4.14   
145 VAL 77   K . ? VAL 77   K GLU 78   K ? GLU 78   K 1 -6.40  
146 CYS 80   K . ? CYS 80   K SER 81   K ? SER 81   K 1 9.15   
147 SER 81   K . ? SER 81   K PRO 82   K ? PRO 82   K 1 2.11   
148 GLY 117  K . ? GLY 117  K VAL 118  K ? VAL 118  K 1 3.12   
149 LYS 55   L . ? LYS 55   L ARG 56   L ? ARG 56   L 1 -4.96  
150 VAL 52   M . ? VAL 52   M GLY 53   M ? GLY 53   M 1 -0.11  
151 PRO 58   M . ? PRO 58   M ARG 59   M ? ARG 59   M 1 -0.23  
152 ARG 59   M . ? ARG 59   M LEU 60   M ? LEU 60   M 1 0.06   
153 GLY 73   M . ? GLY 73   M GLU 74   M ? GLU 74   M 1 0.11   
154 THR 75   M . ? THR 75   M MET 76   M ? MET 76   M 1 -0.45  
155 TRP 110  M . ? TRP 110  M ASN 111  M ? ASN 111  M 1 0.18   
156 SER 119  M . ? SER 119  M SER 120  M ? SER 120  M 1 0.24   
157 SER 120  M . ? SER 120  M ASN 121  M ? ASN 121  M 1 -0.07  
158 SER 158  M . ? SER 158  M ASP 159  M ? ASP 159  M 1 0.02   
159 LEU 163  M . ? LEU 163  M SER 164  M ? SER 164  M 1 -0.07  
160 ASN 165  M . ? ASN 165  M PRO 166  M ? PRO 166  M 1 0.05   
161 SER 167  M . ? SER 167  M ALA 168  M ? ALA 168  M 1 0.04   
162 MET 170  M . ? MET 170  M GLY 171  M ? GLY 171  M 1 0.07   
163 ALA 177  M . ? ALA 177  M ALA 178  M ? ALA 178  M 1 0.07   
164 ARG 195  M . ? ARG 195  M GLY 196  M ? GLY 196  M 1 -0.06  
165 ASP 259  M . ? ASP 259  M GLY 260  M ? GLY 260  M 1 -0.04  
166 ASP 266  M . ? ASP 266  M ASP 267  M ? ASP 267  M 1 -0.11  
167 ASP 267  M . ? ASP 267  M LEU 268  M ? LEU 268  M 1 0.20   
168 GLU 288  M . ? GLU 288  M GLY 289  M ? GLY 289  M 1 1.61   
169 ALA 290  M . ? ALA 290  M PRO 291  M ? PRO 291  M 1 -2.66  
170 GLY 337  M . ? GLY 337  M LYS 338  M ? LYS 338  M 1 -0.35  
171 THR 381  M . ? THR 381  M TYR 382  M ? TYR 382  M 1 0.04   
172 GLY 445  M . ? GLY 445  M ASP 446  M ? ASP 446  M 1 6.40   
173 GLN 453  M . ? GLN 453  M PRO 454  M ? PRO 454  M 1 5.93   
174 ARG 467  M . ? ARG 467  M VAL 468  M ? VAL 468  M 1 4.41   
175 ALA 551  M . ? ALA 551  M VAL 552  M ? VAL 552  M 1 0.78   
176 VAL 559  M . ? VAL 559  M PRO 560  M ? PRO 560  M 1 -17.81 
177 ASN 605  M . ? ASN 605  M PRO 606  M ? PRO 606  M 1 -15.84 
178 TRP 640  M . ? TRP 640  M LYS 641  M ? LYS 641  M 1 11.88  
179 GLU 642  M . ? GLU 642  M LYS 643  M ? LYS 643  M 1 0.16   
180 GLU 646  M . ? GLU 646  M ILE 647  M ? ILE 647  M 1 0.03   
181 LEU 708  M . ? LEU 708  M LYS 709  M ? LYS 709  M 1 -0.02  
182 GLU 711  M . ? GLU 711  M PRO 712  M ? PRO 712  M 1 0.03   
183 MET 714  M . ? MET 714  M THR 715  M ? THR 715  M 1 0.08   
184 GLY 772  M . ? GLY 772  M GLN 773  M ? GLN 773  M 1 2.39   
185 GLY 784  M . ? GLY 784  M PHE 785  M ? PHE 785  M 1 1.92   
186 ARG 812  M . ? ARG 812  M GLY 813  M ? GLY 813  M 1 -0.11  
187 GLU 918  M . ? GLU 918  M ASN 919  M ? ASN 919  M 1 0.10   
188 GLU 922  M . ? GLU 922  M ASN 923  M ? ASN 923  M 1 0.08   
189 CYS 946  M . ? CYS 946  M LYS 947  M ? LYS 947  M 1 0.03   
190 LYS 947  M . ? LYS 947  M PHE 948  M ? PHE 948  M 1 -0.03  
191 GLN 968  M . ? GLN 968  M ASN 969  M ? ASN 969  M 1 4.35   
192 ARG 1004 M . ? ARG 1004 M GLY 1005 M ? GLY 1005 M 1 -1.94  
193 SER 1006 M . ? SER 1006 M ASP 1007 M ? ASP 1007 M 1 -1.97  
194 SER 1062 M . ? SER 1062 M PRO 1063 M ? PRO 1063 M 1 -6.53  
195 GLY 1064 M . ? GLY 1064 M GLU 1065 M ? GLU 1065 M 1 0.20   
196 TYR 1089 M . ? TYR 1089 M ALA 1090 M ? ALA 1090 M 1 -0.06  
197 GLY 1091 M . ? GLY 1091 M VAL 1092 M ? VAL 1092 M 1 0.04   
198 MET 1124 M . ? MET 1124 M PRO 1125 M ? PRO 1125 M 1 -19.75 
199 PRO 1125 M . ? PRO 1125 M TRP 1126 M ? TRP 1126 M 1 -9.82  
200 TRP 1126 M . ? TRP 1126 M ILE 1127 M ? ILE 1127 M 1 -1.09  
201 ILE 1127 M . ? ILE 1127 M ALA 1128 M ? ALA 1128 M 1 1.08   
202 SER 1151 M . ? SER 1151 M ALA 1152 M ? ALA 1152 M 1 -0.17  
203 ILE 1166 M . ? ILE 1166 M GLU 1167 M ? GLU 1167 M 1 0.17   
204 ASP 1248 M . ? ASP 1248 M ASP 1249 M ? ASP 1249 M 1 -0.03  
205 ALA 1253 M . ? ALA 1253 M GLU 1254 M ? GLU 1254 M 1 0.03   
206 ILE 1260 M . ? ILE 1260 M GLU 1261 M ? GLU 1261 M 1 -0.08  
207 SER 1276 M . ? SER 1276 M ILE 1277 M ? ILE 1277 M 1 0.03   
208 ILE 1317 M . ? ILE 1317 M ASN 1318 M ? ASN 1318 M 1 -0.04  
209 GLY 1327 M . ? GLY 1327 M VAL 1328 M ? VAL 1328 M 1 -8.68  
210 VAL 1328 M . ? VAL 1328 M ASP 1329 M ? ASP 1329 M 1 1.57   
211 PHE 1364 M . ? PHE 1364 M ASP 1365 M ? ASP 1365 M 1 1.40   
212 GLU 1409 M . ? GLU 1409 M GLU 1410 M ? GLU 1410 M 1 0.19   
213 GLY 1498 M . ? GLY 1498 M SER 1499 M ? SER 1499 M 1 -0.02  
214 GLN 34   N . ? GLN 34   N LEU 35   N ? LEU 35   N 1 0.66   
215 PHE 41   N . ? PHE 41   N VAL 42   N ? VAL 42   N 1 4.91   
216 VAL 42   N . ? VAL 42   N GLN 43   N ? GLN 43   N 1 2.48   
217 GLN 43   N . ? GLN 43   N ASN 44   N ? ASN 44   N 1 -9.58  
218 PRO 101  N . ? PRO 101  N GLN 102  N ? GLN 102  N 1 4.74   
219 ILE 207  N . ? ILE 207  N VAL 208  N ? VAL 208  N 1 15.55  
220 ALA 214  N . ? ALA 214  N ALA 215  N ? ALA 215  N 1 0.14   
221 PRO 216  N . ? PRO 216  N SER 217  N ? SER 217  N 1 0.05   
222 LEU 229  N . ? LEU 229  N GLU 230  N ? GLU 230  N 1 0.16   
223 ASN 250  N . ? ASN 250  N SER 251  N ? SER 251  N 1 -0.14  
224 PRO 260  N . ? PRO 260  N TYR 261  N ? TYR 261  N 1 1.05   
225 ILE 262  N . ? ILE 262  N ARG 263  N ? ARG 263  N 1 3.05   
226 ASP 290  N . ? ASP 290  N PRO 291  N ? PRO 291  N 1 -0.13  
227 PRO 291  N . ? PRO 291  N ASN 292  N ? ASN 292  N 1 -0.31  
228 ASN 292  N . ? ASN 292  N ASP 293  N ? ASP 293  N 1 0.08   
229 ILE 310  N . ? ILE 310  N GLN 311  N ? GLN 311  N 1 -0.04  
230 ARG 323  N . ? ARG 323  N GLY 324  N ? GLY 324  N 1 -0.09  
231 VAL 329  N . ? VAL 329  N THR 330  N ? THR 330  N 1 -0.06  
232 HIS 386  N . ? HIS 386  N PHE 387  N ? PHE 387  N 1 3.43   
233 ASP 454  N . ? ASP 454  N GLN 455  N ? GLN 455  N 1 -0.10  
234 GLY 464  N . ? GLY 464  N VAL 465  N ? VAL 465  N 1 -2.67  
235 PRO 487  N . ? PRO 487  N ILE 488  N ? ILE 488  N 1 -0.04  
236 ILE 488  N . ? ILE 488  N GLY 489  N ? GLY 489  N 1 -0.01  
237 GLY 492  N . ? GLY 492  N LYS 493  N ? LYS 493  N 1 0.09   
238 LYS 496  N . ? LYS 496  N PRO 497  N ? PRO 497  N 1 -0.05  
239 VAL 508  N . ? VAL 508  N CYS 509  N ? CYS 509  N 1 11.34  
240 TRP 547  N . ? TRP 547  N GLY 548  N ? GLY 548  N 1 0.24   
241 GLY 548  N . ? GLY 548  N LEU 549  N ? LEU 549  N 1 -3.59  
242 SER 560  N . ? SER 560  N PRO 561  N ? PRO 561  N 1 1.61   
243 PRO 561  N . ? PRO 561  N ASN 562  N ? ASN 562  N 1 1.94   
244 ASN 562  N . ? ASN 562  N ALA 563  N ? ALA 563  N 1 -0.01  
245 ASN 629  N . ? ASN 629  N PRO 630  N ? PRO 630  N 1 -4.76  
246 GLY 636  N . ? GLY 636  N GLU 637  N ? GLU 637  N 1 2.83   
247 ARG 654  N . ? ARG 654  N TYR 655  N ? TYR 655  N 1 0.13   
248 PRO 659  N . ? PRO 659  N GLU 660  N ? GLU 660  N 1 -0.01  
249 ALA 719  N . ? ALA 719  N PRO 720  N ? PRO 720  N 1 -2.29  
250 GLY 856  N . ? GLY 856  N MET 857  N ? MET 857  N 1 1.36   
251 LEU 872  N . ? LEU 872  N ARG 873  N ? ARG 873  N 1 0.12   
252 GLY 877  N . ? GLY 877  N THR 878  N ? THR 878  N 1 0.16   
253 PRO 890  N . ? PRO 890  N GLY 891  N ? GLY 891  N 1 -2.41  
254 GLN 919  N . ? GLN 919  N LEU 920  N ? LEU 920  N 1 -3.81  
255 HIS 921  N . ? HIS 921  N ALA 922  N ? ALA 922  N 1 -0.01  
256 GLN 947  N . ? GLN 947  N GLU 948  N ? GLU 948  N 1 -2.49  
257 SER 991  N . ? SER 991  N ALA 992  N ? ALA 992  N 1 -16.69 
258 GLN 993  N . ? GLN 993  N GLY 994  N ? GLY 994  N 1 -5.57  
259 ARG 1113 N . ? ARG 1113 N ASP 1114 N ? ASP 1114 N 1 0.02   
260 GLY 1115 N . ? GLY 1115 N GLY 1116 N ? GLY 1116 N 1 0.01   
261 GLU 4    O . ? GLU 4    O THR 5    O ? THR 5    O 1 -1.29  
262 PRO 79   O . ? PRO 79   O PRO 80   O ? PRO 80   O 1 0.38   
263 SER 129  O . ? SER 129  O LEU 130  O ? LEU 130  O 1 0.01   
264 LEU 130  O . ? LEU 130  O GLY 131  O ? GLY 131  O 1 -0.11  
265 PHE 194  O . ? PHE 194  O GLU 195  O ? GLU 195  O 1 -4.07  
266 GLU 212  O . ? GLU 212  O PRO 213  O ? PRO 213  O 1 -7.51  
267 GLU 216  O . ? GLU 216  O GLY 217  O ? GLY 217  O 1 1.92   
268 GLU 218  O . ? GLU 218  O PRO 219  O ? PRO 219  O 1 -0.38  
269 ASN 242  O . ? ASN 242  O GLU 243  O ? GLU 243  O 1 -4.13  
270 ALA 11   P . ? ALA 11   P GLN 12   P ? GLN 12   P 1 -0.13  
271 CYS 98   P . ? CYS 98   P GLU 99   P ? GLU 99   P 1 -0.03  
272 LYS 132  P . ? LYS 132  P PHE 133  P ? PHE 133  P 1 -0.09  
273 HIS 23   Q . ? HIS 23   Q ASP 24   Q ? ASP 24   Q 1 -8.31  
274 GLY 49   Q . ? GLY 49   Q ARG 50   Q ? ARG 50   Q 1 -0.12  
275 LYS 69   Q . ? LYS 69   Q GLY 70   Q ? GLY 70   Q 1 -1.33  
276 ALA 77   Q . ? ALA 77   Q LYS 78   Q ? LYS 78   Q 1 -7.31  
277 VAL 82   Q . ? VAL 82   Q GLY 83   Q ? GLY 83   Q 1 -1.57  
278 ALA 107  Q . ? ALA 107  Q ASN 108  Q ? ASN 108  Q 1 -2.75  
279 GLU 128  Q . ? GLU 128  Q THR 129  Q ? THR 129  Q 1 0.48   
280 GLU 198  Q . ? GLU 198  Q THR 199  Q ? THR 199  Q 1 -0.04  
281 THR 199  Q . ? THR 199  Q SER 200  Q ? SER 200  Q 1 9.55   
282 LYS 59   S . ? LYS 59   S GLY 60   S ? GLY 60   S 1 0.14   
283 GLY 133  S . ? GLY 133  S GLU 134  S ? GLU 134  S 1 0.00   
284 ASP 17   T . ? ASP 17   T LYS 18   T ? LYS 18   T 1 8.33   
285 ASN 62   T . ? ASN 62   T LEU 63   T ? LEU 63   T 1 -0.04  
286 ARG 109  T . ? ARG 109  T LYS 110  T ? LYS 110  T 1 6.09   
287 THR 57   U . ? THR 57   U VAL 58   U ? VAL 58   U 1 -0.16  
288 GLY 93   U . ? GLY 93   U ASP 94   U ? ASP 94   U 1 0.09   
289 TYR 43   V . ? TYR 43   V CYS 44   V ? CYS 44   V 1 0.04   
290 SER 24   W . ? SER 24   W LYS 25   W ? LYS 25   W 1 0.92   
291 LYS 25   W . ? LYS 25   W SER 26   W ? SER 26   W 1 3.39   
292 THR 76   W . ? THR 76   W VAL 77   W ? VAL 77   W 1 4.17   
293 VAL 77   W . ? VAL 77   W GLU 78   W ? GLU 78   W 1 -6.39  
294 CYS 80   W . ? CYS 80   W SER 81   W ? SER 81   W 1 9.27   
295 SER 81   W . ? SER 81   W PRO 82   W ? PRO 82   W 1 2.22   
296 GLY 117  W . ? GLY 117  W VAL 118  W ? VAL 118  W 1 3.15   
297 LYS 55   X . ? LYS 55   X ARG 56   X ? ARG 56   X 1 -5.00  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 2 ? 
I  ? 3 ? 
J  ? 3 ? 
K  ? 2 ? 
L  ? 3 ? 
M  ? 5 ? 
N  ? 3 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 2 ? 
Y  ? 5 ? 
Z  ? 3 ? 
AA ? 3 ? 
AB ? 4 ? 
AC ? 3 ? 
AD ? 3 ? 
AE ? 3 ? 
AF ? 2 ? 
AG ? 3 ? 
AH ? 3 ? 
AI ? 3 ? 
AJ ? 2 ? 
AK ? 3 ? 
AL ? 2 ? 
AM ? 3 ? 
AN ? 2 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 5 ? 
AR ? 5 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 3 ? 
AW ? 3 ? 
AX ? 2 ? 
AY ? 3 ? 
AZ ? 5 ? 
BA ? 3 ? 
BB ? 3 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 5 ? 
BH ? 2 ? 
BI ? 2 ? 
BJ ? 4 ? 
BK ? 2 ? 
BL ? 5 ? 
BM ? 3 ? 
BN ? 3 ? 
BO ? 4 ? 
BP ? 3 ? 
BQ ? 3 ? 
BR ? 3 ? 
BS ? 2 ? 
BT ? 3 ? 
BU ? 3 ? 
BV ? 3 ? 
BW ? 2 ? 
BX ? 3 ? 
BY ? 2 ? 
BZ ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? parallel      
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? parallel      
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? parallel      
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AR 4 5 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? parallel      
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? parallel      
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? parallel      
BL 4 5 ? parallel      
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BS 1 2 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BW 1 2 ? anti-parallel 
BX 1 2 ? anti-parallel 
BX 2 3 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLN A 20   ? PHE A 21   ? GLN A 20   PHE A 21   
A  2 PRO B 1202 ? ARG B 1203 ? PRO B 1202 ARG B 1203 
B  1 GLY A 84   ? HIS A 85   ? GLY A 84   HIS A 85   
B  2 PRO A 246  ? VAL A 247  ? PRO A 246  VAL A 247  
C  1 ARG A 183  ? ASP A 185  ? ARG A 183  ASP A 185  
C  2 ARG A 188  ? TRP A 190  ? ARG A 188  TRP A 190  
D  1 MET A 461  ? ARG A 465  ? MET A 461  ARG A 465  
D  2 VAL A 447  ? ASN A 451  ? VAL A 447  ASN A 451  
D  3 GLU A 492  ? HIS A 496  ? GLU A 492  HIS A 496  
D  4 SER A 354  ? ASP A 362  ? SER A 354  ASP A 362  
D  5 PHE A 474  ? ASN A 477  ? PHE A 474  ASN A 477  
E  1 MET A 461  ? ARG A 465  ? MET A 461  ARG A 465  
E  2 VAL A 447  ? ASN A 451  ? VAL A 447  ASN A 451  
E  3 GLU A 492  ? HIS A 496  ? GLU A 492  HIS A 496  
E  4 SER A 354  ? ASP A 362  ? SER A 354  ASP A 362  
E  5 HIS B 1093 ? ALA B 1094 ? HIS B 1093 ALA B 1094 
F  1 ALA A 408  ? ILE A 412  ? ALA A 408  ILE A 412  
F  2 ARG A 437  ? ARG A 440  ? ARG A 437  ARG A 440  
G  1 VAL A 518  ? SER A 519  ? VAL A 518  SER A 519  
G  2 LYS A 524  ? PRO A 525  ? LYS A 524  PRO A 525  
H  1 PHE A 546  ? THR A 548  ? PHE A 546  THR A 548  
H  2 LEU A 577  ? THR A 579  ? LEU A 577  THR A 579  
I  1 LEU A 594  ? ILE A 595  ? LEU A 594  ILE A 595  
I  2 MET A 611  ? ILE A 613  ? MET A 611  ILE A 613  
I  3 ILE A 618  ? GLY A 621  ? ILE A 618  GLY A 621  
J  1 MET A 855  ? ARG A 857  ? MET A 855  ARG A 857  
J  2 THR A 861  ? ARG A 863  ? THR A 861  ARG A 863  
J  3 ILE A 869  ? GLN A 871  ? ILE A 869  GLN A 871  
K  1 VAL A 884  ? VAL A 888  ? VAL A 884  VAL A 888  
K  2 ARG A 956  ? PRO A 960  ? ARG A 956  PRO A 960  
L  1 THR A 1120 ? ILE A 1121 ? THR A 1120 ILE A 1121 
L  2 PHE A 1304 ? GLU A 1313 ? PHE A 1304 GLU A 1313 
L  3 MET A 1290 ? GLN A 1298 ? MET A 1290 GLN A 1298 
M  1 THR A 1229 ? ILE A 1230 ? THR A 1229 ILE A 1230 
M  2 ILE A 1240 ? CYS A 1243 ? ILE A 1240 CYS A 1243 
M  3 LEU A 1195 ? GLU A 1199 ? LEU A 1195 GLU A 1199 
M  4 THR A 1153 ? HIS A 1156 ? THR A 1153 HIS A 1156 
M  5 LYS I 42   ? ARG I 45   ? LYS I 42   ARG I 45   
N  1 ASP A 1448 ? ILE A 1449 ? ASP A 1448 ILE A 1449 
N  2 LEU F 123  ? ARG F 125  ? LEU F 123  ARG F 125  
N  3 ASP F 135  ? SER F 137  ? ASP F 135  SER F 137  
O  1 ASN B 78   ? TYR B 83   ? ASN B 78   TYR B 83   
O  2 SER B 112  ? ARG B 120  ? SER B 112  ARG B 120  
O  3 VAL B 150  ? PRO B 156  ? VAL B 150  PRO B 156  
P  1 ILE B 674  ? TYR B 676  ? ILE B 674  TYR B 676  
P  2 PRO B 622  ? ILE B 625  ? PRO B 622  ILE B 625  
P  3 HIS B 729  ? CYS B 730  ? HIS B 729  CYS B 730  
P  4 ILE B 687  ? ALA B 688  ? ILE B 687  ALA B 688  
Q  1 ALA B 782  ? LEU B 785  ? ALA B 782  LEU B 785  
Q  2 SER B 842  ? ASP B 850  ? SER B 842  ASP B 850  
Q  3 LYS B 951  ? MET B 957  ? LYS B 951  MET B 957  
Q  4 GLN B 940  ? THR B 945  ? GLN B 940  THR B 945  
R  1 ASN B 811  ? ALA B 812  ? ASN B 811  ALA B 812  
R  2 THR B 1079 ? TYR B 1080 ? THR B 1079 TYR B 1080 
S  1 ALA B 815  ? ILE B 816  ? ALA B 815  ILE B 816  
S  2 PHE B 1075 ? LEU B 1076 ? PHE B 1075 LEU B 1076 
T  1 ILE B 999  ? ILE B 1000 ? ILE B 999  ILE B 1000 
T  2 ILE B 828  ? ASN B 831  ? ILE B 828  ASN B 831  
T  3 GLY B 977  ? TYR B 983  ? GLY B 977  TYR B 983  
T  4 LYS B 968  ? ALA B 970  ? LYS B 968  ALA B 970  
T  5 GLN B 1082 ? ARG B 1083 ? GLN B 1082 ARG B 1083 
U  1 ARG B 1148 ? CYS B 1152 ? ARG B 1148 CYS B 1152 
U  2 PHE B 1179 ? TYR B 1183 ? PHE B 1179 TYR B 1183 
V  1 SER C 16   ? LEU C 21   ? SER C 16   LEU C 21   
V  2 PHE C 229  ? GLU C 234  ? PHE C 229  GLU C 234  
W  1 GLU C 102  ? ALA C 107  ? GLU C 102  ALA C 107  
W  2 ILE C 154  ? GLY C 163  ? ILE C 154  GLY C 163  
W  3 THR C 42   ? ASN C 53   ? THR C 42   ASN C 53   
W  4 VAL L 58   ? PHE L 60   ? VAL L 58   PHE L 60   
X  1 MET C 115  ? TYR C 118  ? MET C 115  TYR C 118  
X  2 LEU C 144  ? LEU C 148  ? LEU C 144  LEU C 148  
Y  1 TYR E 27   ? GLY E 28   ? TYR E 27   GLY E 28   
Y  2 TYR E 60   ? PRO E 63   ? TYR E 60   PRO E 63   
Y  3 ILE E 72   ? GLU E 75   ? ILE E 72   GLU E 75   
Y  4 THR E 101  ? LEU E 104  ? THR E 101  LEU E 104  
Y  5 THR E 126  ? ILE E 127  ? THR E 126  ILE E 127  
Z  1 HIS E 148  ? ILE E 149  ? HIS E 148  ILE E 149  
Z  2 VAL E 190  ? VAL E 194  ? VAL E 190  VAL E 194  
Z  3 ASN E 204  ? ILE E 208  ? ASN E 204  ILE E 208  
AA 1 PHE G 4    ? SER G 13   ? PHE G 4    SER G 13   
AA 2 ALA G 69   ? TRP G 80   ? ALA G 69   TRP G 80   
AA 3 ILE G 55   ? ILE G 57   ? ILE G 55   ILE G 57   
AB 1 CYS G 39   ? SER G 40   ? CYS G 39   SER G 40   
AB 2 GLY G 44   ? VAL G 49   ? GLY G 44   VAL G 49   
AB 3 ALA G 69   ? TRP G 80   ? ALA G 69   TRP G 80   
AB 4 ARG G 61   ? VAL G 62   ? ARG G 61   VAL G 62   
AC 1 VAL G 87   ? ASP G 89   ? VAL G 87   ASP G 89   
AC 2 VAL G 144  ? THR G 153  ? VAL G 144  THR G 153  
AC 3 ILE G 158  ? THR G 163  ? ILE G 158  THR G 163  
AD 1 VAL G 87   ? ASP G 89   ? VAL G 87   ASP G 89   
AD 2 VAL G 144  ? THR G 153  ? VAL G 144  THR G 153  
AD 3 GLY G 170  ? VAL G 171  ? GLY G 170  VAL G 171  
AE 1 THR G 94   ? ASN G 96   ? THR G 94   ASN G 96   
AE 2 GLY G 99   ? PHE G 101  ? GLY G 99   PHE G 101  
AE 3 PHE G 110  ? SER G 112  ? PHE G 110  SER G 112  
AF 1 TYR G 131  ? SER G 132  ? TYR G 131  SER G 132  
AF 2 VAL G 137  ? ILE G 138  ? VAL G 137  ILE G 138  
AG 1 VAL H 16   ? ASP H 17   ? VAL H 16   ASP H 17   
AG 2 ARG H 26   ? THR H 28   ? ARG H 26   THR H 28   
AG 3 THR H 39   ? ASP H 41   ? THR H 39   ASP H 41   
AH 1 LEU H 57   ? GLN H 58   ? LEU H 57   GLN H 58   
AH 2 LEU H 121  ? LEU H 123  ? LEU H 121  LEU H 123  
AH 3 TYR H 74   ? MET H 76   ? TYR H 74   MET H 76   
AI 1 VAL H 83   ? GLU H 84   ? VAL H 83   GLU H 84   
AI 2 VAL H 91   ? VAL H 93   ? VAL H 91   VAL H 93   
AI 3 ILE H 104  ? GLY H 106  ? ILE H 104  GLY H 106  
AJ 1 SER H 96   ? PHE H 97   ? SER H 96   PHE H 97   
AJ 2 LEU H 100  ? LEU H 101  ? LEU H 100  LEU H 101  
AK 1 TYR I 15   ? PRO I 16   ? TYR I 15   PRO I 16   
AK 2 LEU I 27   ? ALA I 28   ? LEU I 27   ALA I 28   
AK 3 SER I 35   ? GLU I 36   ? SER I 35   GLU I 36   
AL 1 ALA I 83   ? TYR I 86   ? ALA I 83   TYR I 86   
AL 2 ILE I 100  ? CYS I 103  ? ILE I 100  CYS I 103  
AM 1 TYR K 20   ? LEU K 22   ? TYR K 20   LEU K 22   
AM 2 ALA K 29   ? GLU K 35   ? ALA K 29   GLU K 35   
AM 3 ASN K 69   ? GLN K 75   ? ASN K 69   GLN K 75   
AN 1 GLN M 20   ? PHE M 21   ? GLN M 20   PHE M 21   
AN 2 PRO N 1202 ? ARG N 1203 ? PRO N 1202 ARG N 1203 
AO 1 GLY M 84   ? HIS M 85   ? GLY M 84   HIS M 85   
AO 2 PRO M 246  ? VAL M 247  ? PRO M 246  VAL M 247  
AP 1 ILE M 182  ? LYS M 184  ? ILE M 182  LYS M 184  
AP 2 LEU M 189  ? GLY M 191  ? LEU M 189  GLY M 191  
AQ 1 MET M 461  ? ARG M 465  ? MET M 461  ARG M 465  
AQ 2 VAL M 447  ? ASN M 451  ? VAL M 447  ASN M 451  
AQ 3 GLU M 492  ? HIS M 496  ? GLU M 492  HIS M 496  
AQ 4 SER M 354  ? ASP M 362  ? SER M 354  ASP M 362  
AQ 5 PHE M 474  ? ASN M 477  ? PHE M 474  ASN M 477  
AR 1 MET M 461  ? ARG M 465  ? MET M 461  ARG M 465  
AR 2 VAL M 447  ? ASN M 451  ? VAL M 447  ASN M 451  
AR 3 GLU M 492  ? HIS M 496  ? GLU M 492  HIS M 496  
AR 4 SER M 354  ? ASP M 362  ? SER M 354  ASP M 362  
AR 5 HIS N 1093 ? ALA N 1094 ? HIS N 1093 ALA N 1094 
AS 1 ALA M 408  ? ILE M 412  ? ALA M 408  ILE M 412  
AS 2 ARG M 437  ? ARG M 440  ? ARG M 437  ARG M 440  
AT 1 VAL M 518  ? SER M 519  ? VAL M 518  SER M 519  
AT 2 LYS M 524  ? PRO M 525  ? LYS M 524  PRO M 525  
AU 1 PHE M 546  ? THR M 548  ? PHE M 546  THR M 548  
AU 2 LEU M 577  ? THR M 579  ? LEU M 577  THR M 579  
AV 1 LEU M 594  ? ILE M 595  ? LEU M 594  ILE M 595  
AV 2 MET M 611  ? ILE M 613  ? MET M 611  ILE M 613  
AV 3 ILE M 618  ? GLY M 621  ? ILE M 618  GLY M 621  
AW 1 MET M 855  ? ARG M 857  ? MET M 855  ARG M 857  
AW 2 THR M 861  ? ARG M 863  ? THR M 861  ARG M 863  
AW 3 ILE M 869  ? GLN M 871  ? ILE M 869  GLN M 871  
AX 1 VAL M 884  ? VAL M 888  ? VAL M 884  VAL M 888  
AX 2 ARG M 956  ? PRO M 960  ? ARG M 956  PRO M 960  
AY 1 THR M 1120 ? ILE M 1121 ? THR M 1120 ILE M 1121 
AY 2 PHE M 1304 ? GLU M 1313 ? PHE M 1304 GLU M 1313 
AY 3 MET M 1290 ? GLN M 1298 ? MET M 1290 GLN M 1298 
AZ 1 THR M 1229 ? ILE M 1230 ? THR M 1229 ILE M 1230 
AZ 2 ILE M 1240 ? CYS M 1243 ? ILE M 1240 CYS M 1243 
AZ 3 LEU M 1195 ? GLU M 1199 ? LEU M 1195 GLU M 1199 
AZ 4 THR M 1153 ? HIS M 1156 ? THR M 1153 HIS M 1156 
AZ 5 TYR U 44   ? ARG U 45   ? TYR U 44   ARG U 45   
BA 1 ASP M 1448 ? ILE M 1449 ? ASP M 1448 ILE M 1449 
BA 2 LEU R 123  ? ARG R 125  ? LEU R 123  ARG R 125  
BA 3 ASP R 135  ? SER R 137  ? ASP R 135  SER R 137  
BB 1 ASN N 78   ? TYR N 83   ? ASN N 78   TYR N 83   
BB 2 SER N 112  ? ARG N 120  ? SER N 112  ARG N 120  
BB 3 VAL N 150  ? PRO N 156  ? VAL N 150  PRO N 156  
BC 1 ILE N 674  ? TYR N 676  ? ILE N 674  TYR N 676  
BC 2 PRO N 622  ? ILE N 625  ? PRO N 622  ILE N 625  
BC 3 HIS N 729  ? CYS N 730  ? HIS N 729  CYS N 730  
BC 4 ILE N 687  ? ALA N 688  ? ILE N 687  ALA N 688  
BD 1 ALA N 782  ? LEU N 785  ? ALA N 782  LEU N 785  
BD 2 SER N 842  ? ASP N 850  ? SER N 842  ASP N 850  
BD 3 LYS N 951  ? MET N 957  ? LYS N 951  MET N 957  
BD 4 GLN N 940  ? THR N 945  ? GLN N 940  THR N 945  
BE 1 ASN N 811  ? ALA N 812  ? ASN N 811  ALA N 812  
BE 2 THR N 1079 ? TYR N 1080 ? THR N 1079 TYR N 1080 
BF 1 ALA N 815  ? ILE N 816  ? ALA N 815  ILE N 816  
BF 2 PHE N 1075 ? LEU N 1076 ? PHE N 1075 LEU N 1076 
BG 1 ILE N 999  ? ILE N 1000 ? ILE N 999  ILE N 1000 
BG 2 ILE N 828  ? ASN N 831  ? ILE N 828  ASN N 831  
BG 3 GLY N 977  ? TYR N 983  ? GLY N 977  TYR N 983  
BG 4 LYS N 968  ? ALA N 970  ? LYS N 968  ALA N 970  
BG 5 GLN N 1082 ? ARG N 1083 ? GLN N 1082 ARG N 1083 
BH 1 ARG N 1148 ? CYS N 1152 ? ARG N 1148 CYS N 1152 
BH 2 PHE N 1179 ? TYR N 1183 ? PHE N 1179 TYR N 1183 
BI 1 SER O 16   ? LEU O 21   ? SER O 16   LEU O 21   
BI 2 PHE O 229  ? GLU O 234  ? PHE O 229  GLU O 234  
BJ 1 GLU O 102  ? ALA O 107  ? GLU O 102  ALA O 107  
BJ 2 ILE O 154  ? GLY O 163  ? ILE O 154  GLY O 163  
BJ 3 THR O 42   ? ASN O 53   ? THR O 42   ASN O 53   
BJ 4 VAL X 58   ? PHE X 60   ? VAL X 58   PHE X 60   
BK 1 MET O 115  ? TYR O 118  ? MET O 115  TYR O 118  
BK 2 LEU O 144  ? LEU O 148  ? LEU O 144  LEU O 148  
BL 1 TYR Q 27   ? GLY Q 28   ? TYR Q 27   GLY Q 28   
BL 2 TYR Q 60   ? PRO Q 63   ? TYR Q 60   PRO Q 63   
BL 3 ILE Q 72   ? GLU Q 75   ? ILE Q 72   GLU Q 75   
BL 4 THR Q 101  ? LEU Q 104  ? THR Q 101  LEU Q 104  
BL 5 THR Q 126  ? ILE Q 127  ? THR Q 126  ILE Q 127  
BM 1 HIS Q 148  ? ILE Q 149  ? HIS Q 148  ILE Q 149  
BM 2 VAL Q 190  ? VAL Q 194  ? VAL Q 190  VAL Q 194  
BM 3 ASN Q 204  ? ILE Q 208  ? ASN Q 204  ILE Q 208  
BN 1 PHE S 4    ? SER S 13   ? PHE S 4    SER S 13   
BN 2 ALA S 69   ? TRP S 80   ? ALA S 69   TRP S 80   
BN 3 ILE S 55   ? ILE S 57   ? ILE S 55   ILE S 57   
BO 1 CYS S 39   ? SER S 40   ? CYS S 39   SER S 40   
BO 2 GLY S 44   ? VAL S 49   ? GLY S 44   VAL S 49   
BO 3 ALA S 69   ? TRP S 80   ? ALA S 69   TRP S 80   
BO 4 ARG S 61   ? VAL S 62   ? ARG S 61   VAL S 62   
BP 1 VAL S 87   ? ASP S 89   ? VAL S 87   ASP S 89   
BP 2 VAL S 144  ? THR S 153  ? VAL S 144  THR S 153  
BP 3 ILE S 158  ? THR S 163  ? ILE S 158  THR S 163  
BQ 1 VAL S 87   ? ASP S 89   ? VAL S 87   ASP S 89   
BQ 2 VAL S 144  ? THR S 153  ? VAL S 144  THR S 153  
BQ 3 GLY S 170  ? VAL S 171  ? GLY S 170  VAL S 171  
BR 1 THR S 94   ? ASN S 96   ? THR S 94   ASN S 96   
BR 2 GLY S 99   ? PHE S 101  ? GLY S 99   PHE S 101  
BR 3 PHE S 110  ? SER S 112  ? PHE S 110  SER S 112  
BS 1 TYR S 131  ? SER S 132  ? TYR S 131  SER S 132  
BS 2 VAL S 137  ? ILE S 138  ? VAL S 137  ILE S 138  
BT 1 VAL T 16   ? ASP T 17   ? VAL T 16   ASP T 17   
BT 2 ARG T 26   ? THR T 28   ? ARG T 26   THR T 28   
BT 3 THR T 39   ? ASP T 41   ? THR T 39   ASP T 41   
BU 1 LEU T 57   ? GLN T 58   ? LEU T 57   GLN T 58   
BU 2 LEU T 121  ? LEU T 123  ? LEU T 121  LEU T 123  
BU 3 TYR T 74   ? MET T 76   ? TYR T 74   MET T 76   
BV 1 VAL T 83   ? GLU T 84   ? VAL T 83   GLU T 84   
BV 2 VAL T 91   ? VAL T 93   ? VAL T 91   VAL T 93   
BV 3 ILE T 104  ? GLY T 106  ? ILE T 104  GLY T 106  
BW 1 SER T 96   ? PHE T 97   ? SER T 96   PHE T 97   
BW 2 LEU T 100  ? LEU T 101  ? LEU T 100  LEU T 101  
BX 1 TYR U 15   ? PRO U 16   ? TYR U 15   PRO U 16   
BX 2 LEU U 27   ? ALA U 28   ? LEU U 27   ALA U 28   
BX 3 SER U 35   ? GLU U 36   ? SER U 35   GLU U 36   
BY 1 ALA U 83   ? TYR U 86   ? ALA U 83   TYR U 86   
BY 2 ILE U 100  ? CYS U 103  ? ILE U 100  CYS U 103  
BZ 1 TYR W 20   ? LEU W 22   ? TYR W 20   LEU W 22   
BZ 2 ALA W 29   ? GLU W 35   ? ALA W 29   GLU W 35   
BZ 3 ASN W 69   ? GLN W 75   ? ASN W 69   GLN W 75   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N GLN A 20   ? N GLN A 20   O ARG B 1203 ? O ARG B 1203 
B  1 2 N GLY A 84   ? N GLY A 84   O VAL A 247  ? O VAL A 247  
C  1 2 N ASP A 185  ? N ASP A 185  O ARG A 188  ? O ARG A 188  
D  1 2 O MET A 462  ? O MET A 462  N PHE A 450  ? N PHE A 450  
D  2 3 N ILE A 449  ? N ILE A 449  O HIS A 496  ? O HIS A 496  
D  3 4 O MET A 495  ? O MET A 495  N ALA A 355  ? N ALA A 355  
D  4 5 N THR A 360  ? N THR A 360  O PHE A 474  ? O PHE A 474  
E  1 2 O MET A 462  ? O MET A 462  N PHE A 450  ? N PHE A 450  
E  2 3 N ILE A 449  ? N ILE A 449  O HIS A 496  ? O HIS A 496  
E  3 4 O MET A 495  ? O MET A 495  N ALA A 355  ? N ALA A 355  
E  4 5 N ARG A 356  ? N ARG A 356  O HIS B 1093 ? O HIS B 1093 
F  1 2 N ILE A 412  ? N ILE A 412  O ARG A 437  ? O ARG A 437  
G  1 2 N SER A 519  ? N SER A 519  O LYS A 524  ? O LYS A 524  
H  1 2 N LEU A 547  ? N LEU A 547  O TRP A 578  ? O TRP A 578  
I  1 2 N LEU A 594  ? N LEU A 594  O ILE A 613  ? O ILE A 613  
I  2 3 N LEU A 612  ? N LEU A 612  O ILE A 619  ? O ILE A 619  
J  1 2 N ARG A 857  ? N ARG A 857  O THR A 861  ? O THR A 861  
J  2 3 N VAL A 862  ? N VAL A 862  O ILE A 870  ? O ILE A 870  
K  1 2 N GLN A 887  ? N GLN A 887  O TRP A 957  ? O TRP A 957  
L  1 2 N ILE A 1121 ? N ILE A 1121 O LEU A 1312 ? O LEU A 1312 
L  2 3 O GLU A 1305 ? O GLU A 1305 N ARG A 1297 ? N ARG A 1297 
M  1 2 N ILE A 1230 ? N ILE A 1230 O ARG A 1242 ? O ARG A 1242 
M  2 3 O ILE A 1241 ? O ILE A 1241 N LEU A 1198 ? N LEU A 1198 
M  3 4 O LEU A 1195 ? O LEU A 1195 N HIS A 1156 ? N HIS A 1156 
M  4 5 N ILE A 1155 ? N ILE A 1155 O TYR I 44   ? O TYR I 44   
N  1 2 N ASP A 1448 ? N ASP A 1448 O ARG F 125  ? O ARG F 125  
N  2 3 N VAL F 124  ? N VAL F 124  O TRP F 136  ? O TRP F 136  
O  1 2 N GLY B 80   ? N GLY B 80   O ASP B 118  ? O ASP B 118  
O  2 3 N SER B 113  ? N SER B 113  O ILE B 155  ? O ILE B 155  
P  1 2 O GLU B 675  ? O GLU B 675  N LEU B 623  ? N LEU B 623  
P  2 3 N PHE B 624  ? N PHE B 624  O CYS B 730  ? O CYS B 730  
P  3 4 O HIS B 729  ? O HIS B 729  N ALA B 688  ? N ALA B 688  
Q  1 2 N ALA B 782  ? N ALA B 782  O TYR B 845  ? O TYR B 845  
Q  2 3 N TYR B 848  ? N TYR B 848  O VAL B 955  ? O VAL B 955  
Q  3 4 O PHE B 952  ? O PHE B 952  N THR B 944  ? N THR B 944  
R  1 2 N ALA B 812  ? N ALA B 812  O THR B 1079 ? O THR B 1079 
S  1 2 N ILE B 816  ? N ILE B 816  O PHE B 1075 ? O PHE B 1075 
T  1 2 O ILE B 1000 ? O ILE B 1000 N ILE B 829  ? N ILE B 829  
T  2 3 N ILE B 828  ? N ILE B 828  O THR B 978  ? O THR B 978  
T  3 4 O GLY B 977  ? O GLY B 977  N PHE B 969  ? N PHE B 969  
T  4 5 N ALA B 970  ? N ALA B 970  O GLN B 1082 ? O GLN B 1082 
U  1 2 N VAL B 1149 ? N VAL B 1149 O VAL B 1182 ? O VAL B 1182 
V  1 2 N VAL C 17   ? N VAL C 17   O VAL C 233  ? O VAL C 233  
W  1 2 N LEU C 103  ? N LEU C 103  O CYS C 158  ? O CYS C 158  
W  2 3 O SER C 155  ? O SER C 155  N VAL C 52   ? N VAL C 52   
W  3 4 N VAL C 48   ? N VAL C 48   O PHE L 60   ? O PHE L 60   
X  1 2 N MET C 115  ? N MET C 115  O LEU C 148  ? O LEU C 148  
Y  1 2 N GLY E 28   ? N GLY E 28   O LYS E 62   ? O LYS E 62   
Y  2 3 N ALA E 61   ? N ALA E 61   O ILE E 72   ? O ILE E 72   
Y  3 4 N TYR E 73   ? N TYR E 73   O ILE E 103  ? O ILE E 103  
Y  4 5 N GLY E 102  ? N GLY E 102  O THR E 126  ? O THR E 126  
Z  1 2 N ILE E 149  ? N ILE E 149  O LYS E 192  ? O LYS E 192  
Z  2 3 N VAL E 191  ? N VAL E 191  O ARG E 207  ? O ARG E 207  
AA 1 2 N ILE G 12   ? N ILE G 12   O PHE G 71   ? O PHE G 71   
AA 2 3 O LYS G 74   ? O LYS G 74   N ASP G 56   ? N ASP G 56   
AB 1 2 N SER G 40   ? N SER G 40   O GLY G 44   ? O GLY G 44   
AB 2 3 N CYS G 48   ? N CYS G 48   O VAL G 78   ? O VAL G 78   
AB 3 4 O GLU G 70   ? O GLU G 70   N ARG G 61   ? N ARG G 61   
AC 1 2 N VAL G 88   ? N VAL G 88   O LEU G 146  ? O LEU G 146  
AC 2 3 N ARG G 152  ? N ARG G 152  O PHE G 159  ? O PHE G 159  
AD 1 2 N VAL G 88   ? N VAL G 88   O LEU G 146  ? O LEU G 146  
AD 2 3 N ARG G 145  ? N ARG G 145  O GLY G 170  ? O GLY G 170  
AE 1 2 N ASN G 96   ? N ASN G 96   O GLY G 99   ? O GLY G 99   
AE 2 3 N PHE G 100  ? N PHE G 100  O VAL G 111  ? O VAL G 111  
AF 1 2 N TYR G 131  ? N TYR G 131  O ILE G 138  ? O ILE G 138  
AG 1 2 N ASP H 17   ? N ASP H 17   O ARG H 26   ? O ARG H 26   
AG 2 3 N ILE H 27   ? N ILE H 27   O LEU H 40   ? O LEU H 40   
AH 1 2 N GLN H 58   ? N GLN H 58   O LEU H 122  ? O LEU H 122  
AH 2 3 O LEU H 123  ? O LEU H 123  N TYR H 74   ? N TYR H 74   
AI 1 2 N GLU H 84   ? N GLU H 84   O SER H 92   ? O SER H 92   
AI 2 3 N VAL H 91   ? N VAL H 91   O GLY H 106  ? O GLY H 106  
AJ 1 2 N PHE H 97   ? N PHE H 97   O LEU H 100  ? O LEU H 100  
AK 1 2 N TYR I 15   ? N TYR I 15   O ALA I 28   ? O ALA I 28   
AK 2 3 N LEU I 27   ? N LEU I 27   O GLU I 36   ? O GLU I 36   
AL 1 2 N VAL I 84   ? N VAL I 84   O VAL I 102  ? O VAL I 102  
AM 1 2 N GLU K 21   ? N GLU K 21   O VAL K 31   ? O VAL K 31   
AM 2 3 N VAL K 32   ? N VAL K 32   O LEU K 72   ? O LEU K 72   
AN 1 2 N GLN M 20   ? N GLN M 20   O ARG N 1203 ? O ARG N 1203 
AO 1 2 N GLY M 84   ? N GLY M 84   O VAL M 247  ? O VAL M 247  
AP 1 2 N ARG M 183  ? N ARG M 183  O TRP M 190  ? O TRP M 190  
AQ 1 2 O MET M 462  ? O MET M 462  N PHE M 450  ? N PHE M 450  
AQ 2 3 N ILE M 449  ? N ILE M 449  O HIS M 496  ? O HIS M 496  
AQ 3 4 O MET M 495  ? O MET M 495  N ALA M 355  ? N ALA M 355  
AQ 4 5 N THR M 360  ? N THR M 360  O PHE M 474  ? O PHE M 474  
AR 1 2 O MET M 462  ? O MET M 462  N PHE M 450  ? N PHE M 450  
AR 2 3 N ILE M 449  ? N ILE M 449  O HIS M 496  ? O HIS M 496  
AR 3 4 O MET M 495  ? O MET M 495  N ALA M 355  ? N ALA M 355  
AR 4 5 N ARG M 356  ? N ARG M 356  O HIS N 1093 ? O HIS N 1093 
AS 1 2 N ILE M 412  ? N ILE M 412  O ARG M 437  ? O ARG M 437  
AT 1 2 N SER M 519  ? N SER M 519  O LYS M 524  ? O LYS M 524  
AU 1 2 N LEU M 547  ? N LEU M 547  O TRP M 578  ? O TRP M 578  
AV 1 2 N LEU M 594  ? N LEU M 594  O ILE M 613  ? O ILE M 613  
AV 2 3 N LEU M 612  ? N LEU M 612  O ILE M 619  ? O ILE M 619  
AW 1 2 N ARG M 857  ? N ARG M 857  O THR M 861  ? O THR M 861  
AW 2 3 N VAL M 862  ? N VAL M 862  O ILE M 870  ? O ILE M 870  
AX 1 2 N GLN M 887  ? N GLN M 887  O TRP M 957  ? O TRP M 957  
AY 1 2 N ILE M 1121 ? N ILE M 1121 O LEU M 1312 ? O LEU M 1312 
AY 2 3 O VAL M 1311 ? O VAL M 1311 N MET M 1291 ? N MET M 1291 
AZ 1 2 N ILE M 1230 ? N ILE M 1230 O ARG M 1242 ? O ARG M 1242 
AZ 2 3 O ILE M 1241 ? O ILE M 1241 N LEU M 1198 ? N LEU M 1198 
AZ 3 4 O LEU M 1195 ? O LEU M 1195 N HIS M 1156 ? N HIS M 1156 
AZ 4 5 N ILE M 1155 ? N ILE M 1155 O TYR U 44   ? O TYR U 44   
BA 1 2 N ASP M 1448 ? N ASP M 1448 O ARG R 125  ? O ARG R 125  
BA 2 3 N VAL R 124  ? N VAL R 124  O TRP R 136  ? O TRP R 136  
BB 1 2 N GLY N 80   ? N GLY N 80   O ASP N 118  ? O ASP N 118  
BB 2 3 N SER N 113  ? N SER N 113  O ILE N 155  ? O ILE N 155  
BC 1 2 O GLU N 675  ? O GLU N 675  N LEU N 623  ? N LEU N 623  
BC 2 3 N PHE N 624  ? N PHE N 624  O CYS N 730  ? O CYS N 730  
BC 3 4 O HIS N 729  ? O HIS N 729  N ALA N 688  ? N ALA N 688  
BD 1 2 N ALA N 782  ? N ALA N 782  O TYR N 845  ? O TYR N 845  
BD 2 3 N TYR N 848  ? N TYR N 848  O VAL N 955  ? O VAL N 955  
BD 3 4 O PHE N 952  ? O PHE N 952  N THR N 944  ? N THR N 944  
BE 1 2 N ALA N 812  ? N ALA N 812  O THR N 1079 ? O THR N 1079 
BF 1 2 N ILE N 816  ? N ILE N 816  O PHE N 1075 ? O PHE N 1075 
BG 1 2 O ILE N 1000 ? O ILE N 1000 N ILE N 829  ? N ILE N 829  
BG 2 3 N ILE N 828  ? N ILE N 828  O THR N 978  ? O THR N 978  
BG 3 4 O GLY N 977  ? O GLY N 977  N PHE N 969  ? N PHE N 969  
BG 4 5 N ALA N 970  ? N ALA N 970  O GLN N 1082 ? O GLN N 1082 
BH 1 2 N VAL N 1151 ? N VAL N 1151 O SER N 1180 ? O SER N 1180 
BI 1 2 N VAL O 17   ? N VAL O 17   O VAL O 233  ? O VAL O 233  
BJ 1 2 N LEU O 103  ? N LEU O 103  O CYS O 158  ? O CYS O 158  
BJ 2 3 O SER O 155  ? O SER O 155  N VAL O 52   ? N VAL O 52   
BJ 3 4 N VAL O 48   ? N VAL O 48   O PHE X 60   ? O PHE X 60   
BK 1 2 N MET O 115  ? N MET O 115  O LEU O 148  ? O LEU O 148  
BL 1 2 N GLY Q 28   ? N GLY Q 28   O LYS Q 62   ? O LYS Q 62   
BL 2 3 N ALA Q 61   ? N ALA Q 61   O ILE Q 72   ? O ILE Q 72   
BL 3 4 N TYR Q 73   ? N TYR Q 73   O ILE Q 103  ? O ILE Q 103  
BL 4 5 N GLY Q 102  ? N GLY Q 102  O THR Q 126  ? O THR Q 126  
BM 1 2 N ILE Q 149  ? N ILE Q 149  O LYS Q 192  ? O LYS Q 192  
BM 2 3 N VAL Q 191  ? N VAL Q 191  O ARG Q 207  ? O ARG Q 207  
BN 1 2 N ILE S 12   ? N ILE S 12   O PHE S 71   ? O PHE S 71   
BN 2 3 O LYS S 74   ? O LYS S 74   N ASP S 56   ? N ASP S 56   
BO 1 2 N SER S 40   ? N SER S 40   O GLY S 44   ? O GLY S 44   
BO 2 3 N CYS S 48   ? N CYS S 48   O VAL S 78   ? O VAL S 78   
BO 3 4 O GLU S 70   ? O GLU S 70   N ARG S 61   ? N ARG S 61   
BP 1 2 N VAL S 88   ? N VAL S 88   O LEU S 146  ? O LEU S 146  
BP 2 3 N ARG S 152  ? N ARG S 152  O PHE S 159  ? O PHE S 159  
BQ 1 2 N VAL S 88   ? N VAL S 88   O LEU S 146  ? O LEU S 146  
BQ 2 3 N ARG S 145  ? N ARG S 145  O GLY S 170  ? O GLY S 170  
BR 1 2 N ASN S 96   ? N ASN S 96   O GLY S 99   ? O GLY S 99   
BR 2 3 N PHE S 100  ? N PHE S 100  O VAL S 111  ? O VAL S 111  
BS 1 2 N TYR S 131  ? N TYR S 131  O ILE S 138  ? O ILE S 138  
BT 1 2 N ASP T 17   ? N ASP T 17   O ARG T 26   ? O ARG T 26   
BT 2 3 N ILE T 27   ? N ILE T 27   O LEU T 40   ? O LEU T 40   
BU 1 2 N GLN T 58   ? N GLN T 58   O LEU T 122  ? O LEU T 122  
BU 2 3 O LEU T 123  ? O LEU T 123  N TYR T 74   ? N TYR T 74   
BV 1 2 N GLU T 84   ? N GLU T 84   O SER T 92   ? O SER T 92   
BV 2 3 N VAL T 91   ? N VAL T 91   O GLY T 106  ? O GLY T 106  
BW 1 2 N PHE T 97   ? N PHE T 97   O LEU T 100  ? O LEU T 100  
BX 1 2 N TYR U 15   ? N TYR U 15   O ALA U 28   ? O ALA U 28   
BX 2 3 N LEU U 27   ? N LEU U 27   O GLU U 36   ? O GLU U 36   
BY 1 2 N VAL U 84   ? N VAL U 84   O VAL U 102  ? O VAL U 102  
BZ 1 2 N GLU W 21   ? N GLU W 21   O VAL W 31   ? O VAL W 31   
BZ 2 3 N VAL W 32   ? N VAL W 32   O LEU W 72   ? O LEU W 72   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2456' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2457' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2225' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1269' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1121' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN I 1122' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN J 1066' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 1071' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN M 2456' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN M 2457' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2225' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN O 1269' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN U 1121' 
BC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN U 1122' 
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN V 1066' 
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN X 1071' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 109  ? CYS A 109  . ? 1_555 ? 
2  AC1 4 CYS A 112  ? CYS A 112  . ? 1_555 ? 
3  AC1 4 CYS A 150  ? CYS A 150  . ? 1_555 ? 
4  AC1 4 CYS A 175  ? CYS A 175  . ? 1_555 ? 
5  AC2 4 GLY A 61   ? GLY A 61   . ? 1_555 ? 
6  AC2 4 CYS A 69   ? CYS A 69   . ? 1_555 ? 
7  AC2 4 CYS A 79   ? CYS A 79   . ? 1_555 ? 
8  AC2 4 HIS A 82   ? HIS A 82   . ? 1_555 ? 
9  AC3 4 CYS B 1152 ? CYS B 1152 . ? 1_555 ? 
10 AC3 4 CYS B 1155 ? CYS B 1155 . ? 1_555 ? 
11 AC3 4 SER B 1172 ? SER B 1172 . ? 1_555 ? 
12 AC3 4 CYS B 1173 ? CYS B 1173 . ? 1_555 ? 
13 AC4 4 CYS C 90   ? CYS C 90   . ? 1_555 ? 
14 AC4 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
15 AC4 4 CYS C 96   ? CYS C 96   . ? 1_555 ? 
16 AC4 4 CYS C 99   ? CYS C 99   . ? 1_555 ? 
17 AC5 4 CYS I 7    ? CYS I 7    . ? 1_555 ? 
18 AC5 4 CYS I 10   ? CYS I 10   . ? 1_555 ? 
19 AC5 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
20 AC5 4 CYS I 32   ? CYS I 32   . ? 1_555 ? 
21 AC6 5 CYS I 75   ? CYS I 75   . ? 1_555 ? 
22 AC6 5 CYS I 78   ? CYS I 78   . ? 1_555 ? 
23 AC6 5 HIS I 79   ? HIS I 79   . ? 1_555 ? 
24 AC6 5 CYS I 103  ? CYS I 103  . ? 1_555 ? 
25 AC6 5 CYS I 106  ? CYS I 106  . ? 1_555 ? 
26 AC7 5 CYS J 7    ? CYS J 7    . ? 1_555 ? 
27 AC7 5 SER J 9    ? SER J 9    . ? 1_555 ? 
28 AC7 5 CYS J 10   ? CYS J 10   . ? 1_555 ? 
29 AC7 5 CYS J 44   ? CYS J 44   . ? 1_555 ? 
30 AC7 5 CYS J 45   ? CYS J 45   . ? 1_555 ? 
31 AC8 4 CYS L 24   ? CYS L 24   . ? 1_555 ? 
32 AC8 4 CYS L 27   ? CYS L 27   . ? 1_555 ? 
33 AC8 4 CYS L 41   ? CYS L 41   . ? 1_555 ? 
34 AC8 4 CYS L 44   ? CYS L 44   . ? 1_555 ? 
35 AC9 5 CYS M 109  ? CYS M 109  . ? 1_555 ? 
36 AC9 5 CYS M 150  ? CYS M 150  . ? 1_555 ? 
37 AC9 5 CYS M 175  ? CYS M 175  . ? 1_555 ? 
38 AC9 5 GLY M 176  ? GLY M 176  . ? 1_555 ? 
39 AC9 5 ALA M 177  ? ALA M 177  . ? 1_555 ? 
40 BC1 4 GLY M 61   ? GLY M 61   . ? 1_555 ? 
41 BC1 4 CYS M 69   ? CYS M 69   . ? 1_555 ? 
42 BC1 4 CYS M 79   ? CYS M 79   . ? 1_555 ? 
43 BC1 4 HIS M 82   ? HIS M 82   . ? 1_555 ? 
44 BC2 4 CYS N 1152 ? CYS N 1152 . ? 1_555 ? 
45 BC2 4 CYS N 1155 ? CYS N 1155 . ? 1_555 ? 
46 BC2 4 SER N 1172 ? SER N 1172 . ? 1_555 ? 
47 BC2 4 CYS N 1173 ? CYS N 1173 . ? 1_555 ? 
48 BC3 4 CYS O 90   ? CYS O 90   . ? 1_555 ? 
49 BC3 4 CYS O 92   ? CYS O 92   . ? 1_555 ? 
50 BC3 4 CYS O 96   ? CYS O 96   . ? 1_555 ? 
51 BC3 4 CYS O 99   ? CYS O 99   . ? 1_555 ? 
52 BC4 4 CYS U 10   ? CYS U 10   . ? 1_555 ? 
53 BC4 4 CYS U 29   ? CYS U 29   . ? 1_555 ? 
54 BC4 4 ASN U 31   ? ASN U 31   . ? 1_555 ? 
55 BC4 4 CYS U 32   ? CYS U 32   . ? 1_555 ? 
56 BC5 5 CYS U 75   ? CYS U 75   . ? 1_555 ? 
57 BC5 5 CYS U 78   ? CYS U 78   . ? 1_555 ? 
58 BC5 5 HIS U 79   ? HIS U 79   . ? 1_555 ? 
59 BC5 5 CYS U 103  ? CYS U 103  . ? 1_555 ? 
60 BC5 5 CYS U 106  ? CYS U 106  . ? 1_555 ? 
61 BC6 5 CYS V 7    ? CYS V 7    . ? 1_555 ? 
62 BC6 5 SER V 9    ? SER V 9    . ? 1_555 ? 
63 BC6 5 CYS V 10   ? CYS V 10   . ? 1_555 ? 
64 BC6 5 CYS V 44   ? CYS V 44   . ? 1_555 ? 
65 BC6 5 CYS V 45   ? CYS V 45   . ? 1_555 ? 
66 BC7 4 CYS X 24   ? CYS X 24   . ? 1_555 ? 
67 BC7 4 CYS X 27   ? CYS X 27   . ? 1_555 ? 
68 BC7 4 CYS X 41   ? CYS X 41   . ? 1_555 ? 
69 BC7 4 CYS X 44   ? CYS X 44   . ? 1_555 ? 
# 
_atom_sites.entry_id                    3H0G 
_atom_sites.fract_transf_matrix[1][1]   0.006134 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004934 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002556 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1  2    ? 18.949  -17.312  -54.840  1.00 185.83 ? 2    SER A N   1 
ATOM   2     C  CA  . SER A  1  2    ? 18.821  -18.344  -55.862  1.00 180.32 ? 2    SER A CA  1 
ATOM   3     C  C   . SER A  1  2    ? 20.147  -18.577  -56.578  1.00 179.13 ? 2    SER A C   1 
ATOM   4     O  O   . SER A  1  2    ? 20.325  -19.585  -57.261  1.00 170.35 ? 2    SER A O   1 
ATOM   5     C  CB  . SER A  1  2    ? 17.736  -17.968  -56.872  1.00 188.36 ? 2    SER A CB  1 
ATOM   6     O  OG  . SER A  1  2    ? 17.521  -19.014  -57.804  1.00 181.87 ? 2    SER A OG  1 
ATOM   7     N  N   . GLY A  1  3    ? 21.075  -17.639  -56.417  1.00 151.01 ? 3    GLY A N   1 
ATOM   8     C  CA  . GLY A  1  3    ? 22.378  -17.740  -57.045  1.00 123.75 ? 3    GLY A CA  1 
ATOM   9     C  C   . GLY A  1  3    ? 22.446  -16.997  -58.365  1.00 151.78 ? 3    GLY A C   1 
ATOM   10    O  O   . GLY A  1  3    ? 21.568  -16.193  -58.681  1.00 175.35 ? 3    GLY A O   1 
ATOM   11    N  N   . ILE A  1  4    ? 23.493  -17.265  -59.136  1.00 146.95 ? 4    ILE A N   1 
ATOM   12    C  CA  . ILE A  1  4    ? 23.678  -16.618  -60.430  1.00 173.63 ? 4    ILE A CA  1 
ATOM   13    C  C   . ILE A  1  4    ? 23.749  -17.645  -61.555  1.00 164.12 ? 4    ILE A C   1 
ATOM   14    O  O   . ILE A  1  4    ? 24.113  -18.800  -61.334  1.00 116.69 ? 4    ILE A O   1 
ATOM   15    C  CB  . ILE A  1  4    ? 24.953  -15.756  -60.453  1.00 190.17 ? 4    ILE A CB  1 
ATOM   16    C  CG1 . ILE A  1  4    ? 25.998  -16.322  -59.488  1.00 180.10 ? 4    ILE A CG1 1 
ATOM   17    C  CG2 . ILE A  1  4    ? 24.627  -14.312  -60.103  1.00 174.90 ? 4    ILE A CG2 1 
ATOM   18    C  CD1 . ILE A  1  4    ? 26.714  -17.546  -60.015  1.00 131.06 ? 4    ILE A CD1 1 
ATOM   19    N  N   . GLN A  1  5    ? 23.401  -17.216  -62.764  1.00 192.80 ? 5    GLN A N   1 
ATOM   20    C  CA  . GLN A  1  5    ? 23.425  -18.095  -63.926  1.00 177.05 ? 5    GLN A CA  1 
ATOM   21    C  C   . GLN A  1  5    ? 23.646  -17.305  -65.212  1.00 213.58 ? 5    GLN A C   1 
ATOM   22    O  O   . GLN A  1  5    ? 22.784  -17.275  -66.088  1.00 200.15 ? 5    GLN A O   1 
ATOM   23    C  CB  . GLN A  1  5    ? 22.123  -18.895  -64.017  1.00 130.89 ? 5    GLN A CB  1 
ATOM   24    C  CG  . GLN A  1  5    ? 22.037  -20.055  -63.038  1.00 111.36 ? 5    GLN A CG  1 
ATOM   25    C  CD  . GLN A  1  5    ? 23.294  -20.900  -63.023  1.00 127.49 ? 5    GLN A CD  1 
ATOM   26    O  OE1 . GLN A  1  5    ? 23.731  -21.365  -61.970  1.00 159.58 ? 5    GLN A OE1 1 
ATOM   27    N  NE2 . GLN A  1  5    ? 23.885  -21.103  -64.195  1.00 125.93 ? 5    GLN A NE2 1 
ATOM   28    N  N   . PHE A  1  6    ? 24.809  -16.671  -65.317  1.00 253.53 ? 6    PHE A N   1 
ATOM   29    C  CA  . PHE A  1  6    ? 25.147  -15.881  -66.494  1.00 280.45 ? 6    PHE A CA  1 
ATOM   30    C  C   . PHE A  1  6    ? 24.147  -14.748  -66.701  1.00 276.52 ? 6    PHE A C   1 
ATOM   31    O  O   . PHE A  1  6    ? 23.686  -14.512  -67.819  1.00 246.12 ? 6    PHE A O   1 
ATOM   32    C  CB  . PHE A  1  6    ? 25.199  -16.769  -67.738  1.00 274.25 ? 6    PHE A CB  1 
ATOM   33    C  CG  . PHE A  1  6    ? 26.280  -17.814  -67.692  1.00 268.12 ? 6    PHE A CG  1 
ATOM   34    C  CD1 . PHE A  1  6    ? 27.580  -17.499  -68.047  1.00 272.50 ? 6    PHE A CD1 1 
ATOM   35    C  CD2 . PHE A  1  6    ? 25.991  -19.108  -67.297  1.00 241.83 ? 6    PHE A CD2 1 
ATOM   36    C  CE1 . PHE A  1  6    ? 28.576  -18.456  -68.007  1.00 238.50 ? 6    PHE A CE1 1 
ATOM   37    C  CE2 . PHE A  1  6    ? 26.984  -20.070  -67.253  1.00 211.53 ? 6    PHE A CE2 1 
ATOM   38    C  CZ  . PHE A  1  6    ? 28.277  -19.744  -67.609  1.00 206.93 ? 6    PHE A CZ  1 
ATOM   39    N  N   . SER A  1  7    ? 23.821  -14.046  -65.619  1.00 210.28 ? 7    SER A N   1 
ATOM   40    C  CA  . SER A  1  7    ? 22.878  -12.936  -65.681  1.00 195.78 ? 7    SER A CA  1 
ATOM   41    C  C   . SER A  1  7    ? 22.052  -12.986  -66.962  1.00 178.41 ? 7    SER A C   1 
ATOM   42    O  O   . SER A  1  7    ? 21.930  -11.988  -67.674  1.00 182.22 ? 7    SER A O   1 
ATOM   43    C  CB  . SER A  1  7    ? 23.615  -11.600  -65.583  1.00 173.39 ? 7    SER A CB  1 
ATOM   44    O  OG  . SER A  1  7    ? 24.976  -11.741  -65.956  1.00 197.68 ? 7    SER A OG  1 
ATOM   45    N  N   . PRO A  1  8    ? 21.485  -14.153  -67.250  1.00 329.92 ? 8    PRO A N   1 
ATOM   46    C  CA  . PRO A  1  8    ? 20.665  -14.336  -68.453  1.00 314.67 ? 8    PRO A CA  1 
ATOM   47    C  C   . PRO A  1  8    ? 19.689  -13.181  -68.653  1.00 417.49 ? 8    PRO A C   1 
ATOM   48    O  O   . PRO A  1  8    ? 19.534  -12.694  -69.773  1.00 455.34 ? 8    PRO A O   1 
ATOM   49    C  CB  . PRO A  1  8    ? 19.900  -15.626  -68.155  1.00 271.20 ? 8    PRO A CB  1 
ATOM   50    C  CG  . PRO A  1  8    ? 20.787  -16.381  -67.233  1.00 292.86 ? 8    PRO A CG  1 
ATOM   51    C  CD  . PRO A  1  8    ? 21.475  -15.347  -66.385  1.00 317.50 ? 8    PRO A CD  1 
ATOM   52    N  N   . SER A  1  9    ? 19.042  -12.755  -67.573  1.00 145.00 ? 9    SER A N   1 
ATOM   53    C  CA  . SER A  1  9    ? 18.082  -11.657  -67.640  1.00 197.16 ? 9    SER A CA  1 
ATOM   54    C  C   . SER A  1  9    ? 16.991  -11.939  -68.667  1.00 191.04 ? 9    SER A C   1 
ATOM   55    O  O   . SER A  1  9    ? 15.972  -12.550  -68.350  1.00 179.97 ? 9    SER A O   1 
ATOM   56    C  CB  . SER A  1  9    ? 18.792  -10.344  -67.974  1.00 235.87 ? 9    SER A CB  1 
ATOM   57    O  OG  . SER A  1  9    ? 19.582  -10.476  -69.144  1.00 233.21 ? 9    SER A OG  1 
ATOM   58    N  N   . SER A  1  10   ? 17.212  -11.489  -69.897  1.00 249.03 ? 10   SER A N   1 
ATOM   59    C  CA  . SER A  1  10   ? 16.249  -11.692  -70.972  1.00 227.49 ? 10   SER A CA  1 
ATOM   60    C  C   . SER A  1  10   ? 14.888  -12.103  -70.423  1.00 188.11 ? 10   SER A C   1 
ATOM   61    O  O   . SER A  1  10   ? 14.323  -11.427  -69.564  1.00 175.07 ? 10   SER A O   1 
ATOM   62    C  CB  . SER A  1  10   ? 16.760  -12.746  -71.957  1.00 213.38 ? 10   SER A CB  1 
ATOM   63    O  OG  . SER A  1  10   ? 17.825  -13.494  -71.397  1.00 188.24 ? 10   SER A OG  1 
ATOM   64    N  N   . VAL A  1  11   ? 14.365  -13.218  -70.925  1.00 141.91 ? 11   VAL A N   1 
ATOM   65    C  CA  . VAL A  1  11   ? 13.068  -13.721  -70.487  1.00 136.72 ? 11   VAL A CA  1 
ATOM   66    C  C   . VAL A  1  11   ? 12.955  -13.705  -68.966  1.00 138.47 ? 11   VAL A C   1 
ATOM   67    O  O   . VAL A  1  11   ? 13.322  -14.671  -68.297  1.00 132.52 ? 11   VAL A O   1 
ATOM   68    C  CB  . VAL A  1  11   ? 12.817  -15.153  -70.996  1.00 124.62 ? 11   VAL A CB  1 
ATOM   69    C  CG1 . VAL A  1  11   ? 12.533  -15.142  -72.490  1.00 132.77 ? 11   VAL A CG1 1 
ATOM   70    C  CG2 . VAL A  1  11   ? 14.008  -16.045  -70.680  1.00 114.05 ? 11   VAL A CG2 1 
ATOM   71    N  N   . PRO A  1  12   ? 12.445  -12.604  -68.428  1.00 132.05 ? 12   PRO A N   1 
ATOM   72    C  CA  . PRO A  1  12   ? 12.281  -12.459  -66.978  1.00 167.26 ? 12   PRO A CA  1 
ATOM   73    C  C   . PRO A  1  12   ? 12.649  -13.738  -66.234  1.00 180.90 ? 12   PRO A C   1 
ATOM   74    O  O   . PRO A  1  12   ? 13.829  -14.076  -66.133  1.00 172.43 ? 12   PRO A O   1 
ATOM   75    C  CB  . PRO A  1  12   ? 10.786  -12.174  -66.827  1.00 128.61 ? 12   PRO A CB  1 
ATOM   76    C  CG  . PRO A  1  12   ? 10.401  -11.524  -68.107  1.00 166.69 ? 12   PRO A CG  1 
ATOM   77    C  CD  . PRO A  1  12   ? 11.245  -12.175  -69.167  1.00 156.98 ? 12   PRO A CD  1 
ATOM   78    N  N   . LEU A  1  13   ? 11.643  -14.439  -65.721  1.00 294.81 ? 13   LEU A N   1 
ATOM   79    C  CA  . LEU A  1  13   ? 11.869  -15.681  -64.989  1.00 227.67 ? 13   LEU A CA  1 
ATOM   80    C  C   . LEU A  1  13   ? 10.610  -16.540  -64.959  1.00 169.39 ? 13   LEU A C   1 
ATOM   81    O  O   . LEU A  1  13   ? 10.494  -17.517  -65.699  1.00 148.27 ? 13   LEU A O   1 
ATOM   82    C  CB  . LEU A  1  13   ? 12.337  -15.383  -63.563  1.00 218.37 ? 13   LEU A CB  1 
ATOM   83    C  CG  . LEU A  1  13   ? 13.394  -14.286  -63.411  1.00 243.03 ? 13   LEU A CG  1 
ATOM   84    C  CD1 . LEU A  1  13   ? 13.622  -13.961  -61.943  1.00 259.01 ? 13   LEU A CD1 1 
ATOM   85    C  CD2 . LEU A  1  13   ? 14.696  -14.697  -64.083  1.00 240.86 ? 13   LEU A CD2 1 
ATOM   86    N  N   . ARG A  1  14   ? 9.668   -16.170  -64.097  1.00 228.30 ? 14   ARG A N   1 
ATOM   87    C  CA  . ARG A  1  14   ? 8.416   -16.906  -63.968  1.00 227.87 ? 14   ARG A CA  1 
ATOM   88    C  C   . ARG A  1  14   ? 8.669   -18.403  -63.816  1.00 217.46 ? 14   ARG A C   1 
ATOM   89    O  O   . ARG A  1  14   ? 8.909   -19.104  -64.799  1.00 213.38 ? 14   ARG A O   1 
ATOM   90    C  CB  . ARG A  1  14   ? 7.514   -16.645  -65.176  1.00 188.57 ? 14   ARG A CB  1 
ATOM   91    C  CG  . ARG A  1  14   ? 7.063   -15.200  -65.314  1.00 198.16 ? 14   ARG A CG  1 
ATOM   92    C  CD  . ARG A  1  14   ? 5.639   -15.016  -64.814  1.00 204.68 ? 14   ARG A CD  1 
ATOM   93    N  NE  . ARG A  1  14   ? 5.220   -13.618  -64.861  1.00 214.57 ? 14   ARG A NE  1 
ATOM   94    C  CZ  . ARG A  1  14   ? 4.022   -13.211  -65.268  1.00 221.53 ? 14   ARG A CZ  1 
ATOM   95    N  NH1 . ARG A  1  14   ? 3.118   -14.097  -65.665  1.00 219.51 ? 14   ARG A NH1 1 
ATOM   96    N  NH2 . ARG A  1  14   ? 3.727   -11.918  -65.278  1.00 231.21 ? 14   ARG A NH2 1 
ATOM   97    N  N   . ARG A  1  15   ? 8.615   -18.884  -62.579  1.00 196.17 ? 15   ARG A N   1 
ATOM   98    C  CA  . ARG A  1  15   ? 8.838   -20.296  -62.297  1.00 186.89 ? 15   ARG A CA  1 
ATOM   99    C  C   . ARG A  1  15   ? 7.782   -21.167  -62.967  1.00 184.27 ? 15   ARG A C   1 
ATOM   100   O  O   . ARG A  1  15   ? 6.687   -20.700  -63.285  1.00 191.19 ? 15   ARG A O   1 
ATOM   101   C  CB  . ARG A  1  15   ? 8.845   -20.547  -60.787  1.00 149.44 ? 15   ARG A CB  1 
ATOM   102   C  CG  . ARG A  1  15   ? 8.609   -19.300  -59.950  1.00 150.61 ? 15   ARG A CG  1 
ATOM   103   C  CD  . ARG A  1  15   ? 8.124   -19.654  -58.554  1.00 152.55 ? 15   ARG A CD  1 
ATOM   104   N  NE  . ARG A  1  15   ? 9.061   -19.219  -57.523  1.00 153.02 ? 15   ARG A NE  1 
ATOM   105   C  CZ  . ARG A  1  15   ? 8.850   -19.354  -56.218  1.00 155.29 ? 15   ARG A CZ  1 
ATOM   106   N  NH1 . ARG A  1  15   ? 7.733   -19.916  -55.778  1.00 157.20 ? 15   ARG A NH1 1 
ATOM   107   N  NH2 . ARG A  1  15   ? 9.759   -18.929  -55.350  1.00 156.04 ? 15   ARG A NH2 1 
ATOM   108   N  N   . VAL A  1  16   ? 8.115   -22.436  -63.180  1.00 166.97 ? 16   VAL A N   1 
ATOM   109   C  CA  . VAL A  1  16   ? 7.198   -23.373  -63.811  1.00 165.78 ? 16   VAL A CA  1 
ATOM   110   C  C   . VAL A  1  16   ? 5.975   -23.472  -62.930  1.00 169.85 ? 16   VAL A C   1 
ATOM   111   O  O   . VAL A  1  16   ? 6.106   -23.672  -61.736  1.00 168.81 ? 16   VAL A O   1 
ATOM   112   C  CB  . VAL A  1  16   ? 7.823   -24.768  -64.005  1.00 142.85 ? 16   VAL A CB  1 
ATOM   113   C  CG1 . VAL A  1  16   ? 6.779   -25.754  -64.511  1.00 144.53 ? 16   VAL A CG1 1 
ATOM   114   C  CG2 . VAL A  1  16   ? 9.004   -24.694  -64.960  1.00 139.09 ? 16   VAL A CG2 1 
ATOM   115   N  N   . GLU A  1  17   ? 4.793   -23.349  -63.515  1.00 240.17 ? 17   GLU A N   1 
ATOM   116   C  CA  . GLU A  1  17   ? 3.560   -23.392  -62.742  1.00 247.32 ? 17   GLU A CA  1 
ATOM   117   C  C   . GLU A  1  17   ? 2.695   -24.608  -63.028  1.00 249.51 ? 17   GLU A C   1 
ATOM   118   O  O   . GLU A  1  17   ? 2.032   -25.121  -62.121  1.00 252.02 ? 17   GLU A O   1 
ATOM   119   C  CB  . GLU A  1  17   ? 2.750   -22.120  -62.999  1.00 223.77 ? 17   GLU A CB  1 
ATOM   120   C  CG  . GLU A  1  17   ? 3.410   -20.848  -62.491  1.00 225.09 ? 17   GLU A CG  1 
ATOM   121   C  CD  . GLU A  1  17   ? 2.611   -19.604  -62.826  1.00 234.05 ? 17   GLU A CD  1 
ATOM   122   O  OE1 . GLU A  1  17   ? 1.647   -19.709  -63.612  1.00 238.70 ? 17   GLU A OE1 1 
ATOM   123   O  OE2 . GLU A  1  17   ? 2.949   -18.520  -62.304  1.00 237.04 ? 17   GLU A OE2 1 
ATOM   124   N  N   . GLU A  1  18   ? 2.670   -25.046  -64.286  1.00 173.34 ? 18   GLU A N   1 
ATOM   125   C  CA  . GLU A  1  18   ? 1.900   -26.225  -64.674  1.00 175.75 ? 18   GLU A CA  1 
ATOM   126   C  C   . GLU A  1  18   ? 2.825   -27.070  -65.514  1.00 169.69 ? 18   GLU A C   1 
ATOM   127   O  O   . GLU A  1  18   ? 3.784   -26.558  -66.098  1.00 165.94 ? 18   GLU A O   1 
ATOM   128   C  CB  . GLU A  1  18   ? 0.630   -25.851  -65.441  1.00 148.03 ? 18   GLU A CB  1 
ATOM   129   C  CG  . GLU A  1  18   ? -0.427  -25.162  -64.594  1.00 155.13 ? 18   GLU A CG  1 
ATOM   130   C  CD  . GLU A  1  18   ? -1.637  -24.742  -65.406  1.00 163.40 ? 18   GLU A CD  1 
ATOM   131   O  OE1 . GLU A  1  18   ? -1.574  -24.813  -66.653  1.00 163.32 ? 18   GLU A OE1 1 
ATOM   132   O  OE2 . GLU A  1  18   ? -2.652  -24.337  -64.801  1.00 170.32 ? 18   GLU A OE2 1 
ATOM   133   N  N   . VAL A  1  19   ? 2.518   -28.359  -65.594  1.00 103.48 ? 19   VAL A N   1 
ATOM   134   C  CA  . VAL A  1  19   ? 3.293   -29.281  -66.414  1.00 99.22  ? 19   VAL A CA  1 
ATOM   135   C  C   . VAL A  1  19   ? 2.308   -30.042  -67.312  1.00 103.61 ? 19   VAL A C   1 
ATOM   136   O  O   . VAL A  1  19   ? 1.487   -30.819  -66.799  1.00 107.42 ? 19   VAL A O   1 
ATOM   137   C  CB  . VAL A  1  19   ? 4.111   -30.274  -65.570  1.00 93.76  ? 19   VAL A CB  1 
ATOM   138   C  CG1 . VAL A  1  19   ? 4.772   -31.316  -66.462  1.00 90.27  ? 19   VAL A CG1 1 
ATOM   139   C  CG2 . VAL A  1  19   ? 5.154   -29.537  -64.742  1.00 89.76  ? 19   VAL A CG2 1 
ATOM   140   N  N   . GLN A  1  20   ? 2.386   -29.813  -68.619  1.00 276.73 ? 20   GLN A N   1 
ATOM   141   C  CA  . GLN A  1  20   ? 1.475   -30.449  -69.564  1.00 280.41 ? 20   GLN A CA  1 
ATOM   142   C  C   . GLN A  1  20   ? 2.094   -31.694  -70.191  1.00 276.07 ? 20   GLN A C   1 
ATOM   143   O  O   . GLN A  1  20   ? 3.033   -31.602  -70.983  1.00 270.70 ? 20   GLN A O   1 
ATOM   144   C  CB  . GLN A  1  20   ? 1.062   -29.461  -70.655  1.00 249.50 ? 20   GLN A CB  1 
ATOM   145   C  CG  . GLN A  1  20   ? -0.173  -28.643  -70.317  1.00 255.49 ? 20   GLN A CG  1 
ATOM   146   C  CD  . GLN A  1  20   ? -0.534  -27.653  -71.405  1.00 259.65 ? 20   GLN A CD  1 
ATOM   147   O  OE1 . GLN A  1  20   ? 0.121   -27.591  -72.447  1.00 256.45 ? 20   GLN A OE1 1 
ATOM   148   N  NE2 . GLN A  1  20   ? -1.581  -26.869  -71.171  1.00 267.32 ? 20   GLN A NE2 1 
ATOM   149   N  N   . PHE A  1  21   ? 1.560   -32.856  -69.835  1.00 184.63 ? 21   PHE A N   1 
ATOM   150   C  CA  . PHE A  1  21   ? 2.055   -34.122  -70.365  1.00 182.20 ? 21   PHE A CA  1 
ATOM   151   C  C   . PHE A  1  21   ? 1.335   -34.496  -71.656  1.00 188.05 ? 21   PHE A C   1 
ATOM   152   O  O   . PHE A  1  21   ? 0.169   -34.889  -71.637  1.00 196.51 ? 21   PHE A O   1 
ATOM   153   C  CB  . PHE A  1  21   ? 1.891   -35.237  -69.331  1.00 149.42 ? 21   PHE A CB  1 
ATOM   154   C  CG  . PHE A  1  21   ? 2.702   -35.031  -68.083  1.00 144.82 ? 21   PHE A CG  1 
ATOM   155   C  CD1 . PHE A  1  21   ? 4.039   -35.391  -68.043  1.00 138.74 ? 21   PHE A CD1 1 
ATOM   156   C  CD2 . PHE A  1  21   ? 2.129   -34.476  -66.952  1.00 147.20 ? 21   PHE A CD2 1 
ATOM   157   C  CE1 . PHE A  1  21   ? 4.788   -35.201  -66.897  1.00 135.13 ? 21   PHE A CE1 1 
ATOM   158   C  CE2 . PHE A  1  21   ? 2.872   -34.285  -65.803  1.00 143.35 ? 21   PHE A CE2 1 
ATOM   159   C  CZ  . PHE A  1  21   ? 4.204   -34.648  -65.775  1.00 137.31 ? 21   PHE A CZ  1 
ATOM   160   N  N   . GLY A  1  22   ? 2.038   -34.371  -72.778  1.00 191.11 ? 22   GLY A N   1 
ATOM   161   C  CA  . GLY A  1  22   ? 1.470   -34.692  -74.074  1.00 196.56 ? 22   GLY A CA  1 
ATOM   162   C  C   . GLY A  1  22   ? 2.135   -35.892  -74.719  1.00 194.39 ? 22   GLY A C   1 
ATOM   163   O  O   . GLY A  1  22   ? 2.902   -36.609  -74.076  1.00 190.74 ? 22   GLY A O   1 
ATOM   164   N  N   . ILE A  1  23   ? 1.838   -36.111  -75.995  1.00 195.08 ? 23   ILE A N   1 
ATOM   165   C  CA  . ILE A  1  23   ? 2.410   -37.230  -76.734  1.00 192.07 ? 23   ILE A CA  1 
ATOM   166   C  C   . ILE A  1  23   ? 3.059   -36.757  -78.032  1.00 188.58 ? 23   ILE A C   1 
ATOM   167   O  O   . ILE A  1  23   ? 2.375   -36.512  -79.025  1.00 191.09 ? 23   ILE A O   1 
ATOM   168   C  CB  . ILE A  1  23   ? 1.349   -38.295  -77.060  1.00 160.89 ? 23   ILE A CB  1 
ATOM   169   C  CG1 . ILE A  1  23   ? 1.026   -39.125  -75.816  1.00 164.35 ? 23   ILE A CG1 1 
ATOM   170   C  CG2 . ILE A  1  23   ? 1.821   -39.188  -78.196  1.00 159.62 ? 23   ILE A CG2 1 
ATOM   171   C  CD1 . ILE A  1  23   ? -0.096  -40.120  -76.019  1.00 173.57 ? 23   ILE A CD1 1 
ATOM   172   N  N   . LEU A  1  24   ? 4.382   -36.633  -78.015  1.00 170.55 ? 24   LEU A N   1 
ATOM   173   C  CA  . LEU A  1  24   ? 5.125   -36.191  -79.190  1.00 170.03 ? 24   LEU A CA  1 
ATOM   174   C  C   . LEU A  1  24   ? 4.434   -36.629  -80.476  1.00 175.19 ? 24   LEU A C   1 
ATOM   175   O  O   . LEU A  1  24   ? 3.774   -37.666  -80.516  1.00 178.16 ? 24   LEU A O   1 
ATOM   176   C  CB  . LEU A  1  24   ? 6.556   -36.729  -79.152  1.00 121.58 ? 24   LEU A CB  1 
ATOM   177   C  CG  . LEU A  1  24   ? 7.572   -35.897  -78.365  1.00 117.58 ? 24   LEU A CG  1 
ATOM   178   C  CD1 . LEU A  1  24   ? 8.993   -36.273  -78.757  1.00 112.56 ? 24   LEU A CD1 1 
ATOM   179   C  CD2 . LEU A  1  24   ? 7.328   -34.410  -78.575  1.00 117.45 ? 24   LEU A CD2 1 
ATOM   180   N  N   . SER A  1  25   ? 4.591   -35.832  -81.528  1.00 206.87 ? 25   SER A N   1 
ATOM   181   C  CA  . SER A  1  25   ? 3.983   -36.135  -82.818  1.00 211.52 ? 25   SER A CA  1 
ATOM   182   C  C   . SER A  1  25   ? 5.003   -36.027  -83.947  1.00 207.54 ? 25   SER A C   1 
ATOM   183   O  O   . SER A  1  25   ? 5.810   -35.097  -83.981  1.00 202.99 ? 25   SER A O   1 
ATOM   184   C  CB  . SER A  1  25   ? 2.801   -35.202  -83.087  1.00 170.19 ? 25   SER A CB  1 
ATOM   185   O  OG  . SER A  1  25   ? 3.208   -33.845  -83.070  1.00 167.02 ? 25   SER A OG  1 
ATOM   186   N  N   . PRO A  1  26   ? 4.960   -36.983  -84.870  1.00 188.55 ? 26   PRO A N   1 
ATOM   187   C  CA  . PRO A  1  26   ? 5.884   -36.996  -86.008  1.00 185.47 ? 26   PRO A CA  1 
ATOM   188   C  C   . PRO A  1  26   ? 6.083   -35.602  -86.594  1.00 185.20 ? 26   PRO A C   1 
ATOM   189   O  O   . PRO A  1  26   ? 7.220   -35.162  -86.766  1.00 180.54 ? 26   PRO A O   1 
ATOM   190   C  CB  . PRO A  1  26   ? 5.172   -37.895  -87.021  1.00 140.01 ? 26   PRO A CB  1 
ATOM   191   C  CG  . PRO A  1  26   ? 3.729   -37.740  -86.701  1.00 146.95 ? 26   PRO A CG  1 
ATOM   192   C  CD  . PRO A  1  26   ? 3.653   -37.570  -85.210  1.00 145.78 ? 26   PRO A CD  1 
ATOM   193   N  N   . GLU A  1  27   ? 4.982   -34.919  -86.894  1.00 248.79 ? 27   GLU A N   1 
ATOM   194   C  CA  . GLU A  1  27   ? 5.045   -33.576  -87.458  1.00 252.07 ? 27   GLU A CA  1 
ATOM   195   C  C   . GLU A  1  27   ? 5.863   -32.644  -86.571  1.00 248.18 ? 27   GLU A C   1 
ATOM   196   O  O   . GLU A  1  27   ? 6.777   -31.969  -87.043  1.00 245.51 ? 27   GLU A O   1 
ATOM   197   C  CB  . GLU A  1  27   ? 3.636   -33.013  -87.654  1.00 202.59 ? 27   GLU A CB  1 
ATOM   198   C  CG  . GLU A  1  27   ? 2.762   -33.837  -88.586  1.00 207.48 ? 27   GLU A CG  1 
ATOM   199   C  CD  . GLU A  1  27   ? 1.342   -33.312  -88.667  1.00 215.05 ? 27   GLU A CD  1 
ATOM   200   O  OE1 . GLU A  1  27   ? 0.968   -32.467  -87.826  1.00 216.77 ? 27   GLU A OE1 1 
ATOM   201   O  OE2 . GLU A  1  27   ? 0.596   -33.748  -89.571  1.00 219.73 ? 27   GLU A OE2 1 
ATOM   202   N  N   . GLU A  1  28   ? 5.531   -32.615  -85.285  1.00 312.89 ? 28   GLU A N   1 
ATOM   203   C  CA  . GLU A  1  28   ? 6.235   -31.768  -84.331  1.00 307.99 ? 28   GLU A CA  1 
ATOM   204   C  C   . GLU A  1  28   ? 7.695   -32.188  -84.196  1.00 300.60 ? 28   GLU A C   1 
ATOM   205   O  O   . GLU A  1  28   ? 8.597   -31.351  -84.221  1.00 296.39 ? 28   GLU A O   1 
ATOM   206   C  CB  . GLU A  1  28   ? 5.547   -31.809  -82.966  1.00 256.00 ? 28   GLU A CB  1 
ATOM   207   C  CG  . GLU A  1  28   ? 4.344   -30.887  -82.849  1.00 262.29 ? 28   GLU A CG  1 
ATOM   208   C  CD  . GLU A  1  28   ? 3.752   -30.875  -81.454  1.00 264.46 ? 28   GLU A CD  1 
ATOM   209   O  OE1 . GLU A  1  28   ? 4.302   -31.562  -80.567  1.00 260.95 ? 28   GLU A OE1 1 
ATOM   210   O  OE2 . GLU A  1  28   ? 2.737   -30.179  -81.242  1.00 270.06 ? 28   GLU A OE2 1 
ATOM   211   N  N   . ILE A  1  29   ? 7.919   -33.490  -84.052  1.00 159.47 ? 29   ILE A N   1 
ATOM   212   C  CA  . ILE A  1  29   ? 9.269   -34.024  -83.914  1.00 155.12 ? 29   ILE A CA  1 
ATOM   213   C  C   . ILE A  1  29   ? 10.176  -33.516  -85.030  1.00 154.39 ? 29   ILE A C   1 
ATOM   214   O  O   . ILE A  1  29   ? 11.346  -33.210  -84.801  1.00 150.48 ? 29   ILE A O   1 
ATOM   215   C  CB  . ILE A  1  29   ? 9.271   -35.564  -83.923  1.00 118.43 ? 29   ILE A CB  1 
ATOM   216   C  CG1 . ILE A  1  29   ? 8.559   -36.106  -82.682  1.00 120.81 ? 29   ILE A CG1 1 
ATOM   217   C  CG2 . ILE A  1  29   ? 10.694  -36.094  -84.003  1.00 113.97 ? 29   ILE A CG2 1 
ATOM   218   C  CD1 . ILE A  1  29   ? 8.175   -37.564  -82.787  1.00 123.67 ? 29   ILE A CD1 1 
ATOM   219   N  N   . ARG A  1  30   ? 9.627   -33.429  -86.238  1.00 218.08 ? 30   ARG A N   1 
ATOM   220   C  CA  . ARG A  1  30   ? 10.384  -32.954  -87.391  1.00 219.77 ? 30   ARG A CA  1 
ATOM   221   C  C   . ARG A  1  30   ? 10.670  -31.461  -87.282  1.00 218.64 ? 30   ARG A C   1 
ATOM   222   O  O   . ARG A  1  30   ? 11.809  -31.024  -87.447  1.00 216.18 ? 30   ARG A O   1 
ATOM   223   C  CB  . ARG A  1  30   ? 9.628   -33.252  -88.687  1.00 161.63 ? 30   ARG A CB  1 
ATOM   224   C  CG  . ARG A  1  30   ? 9.860   -34.651  -89.233  1.00 162.36 ? 30   ARG A CG  1 
ATOM   225   C  CD  . ARG A  1  30   ? 9.290   -34.798  -90.635  1.00 165.92 ? 30   ARG A CD  1 
ATOM   226   N  NE  . ARG A  1  30   ? 9.046   -36.195  -90.983  1.00 167.45 ? 30   ARG A NE  1 
ATOM   227   C  CZ  . ARG A  1  30   ? 8.327   -36.589  -92.028  1.00 171.15 ? 30   ARG A CZ  1 
ATOM   228   N  NH1 . ARG A  1  30   ? 7.776   -35.692  -92.834  1.00 173.51 ? 30   ARG A NH1 1 
ATOM   229   N  NH2 . ARG A  1  30   ? 8.156   -37.882  -92.268  1.00 173.04 ? 30   ARG A NH2 1 
ATOM   230   N  N   . SER A  1  31   ? 9.630   -30.683  -87.003  1.00 238.89 ? 31   SER A N   1 
ATOM   231   C  CA  . SER A  1  31   ? 9.768   -29.238  -86.868  1.00 238.23 ? 31   SER A CA  1 
ATOM   232   C  C   . SER A  1  31   ? 10.791  -28.883  -85.794  1.00 233.09 ? 31   SER A C   1 
ATOM   233   O  O   . SER A  1  31   ? 11.746  -28.149  -86.050  1.00 231.26 ? 31   SER A O   1 
ATOM   234   C  CB  . SER A  1  31   ? 8.417   -28.597  -86.541  1.00 186.87 ? 31   SER A CB  1 
ATOM   235   O  OG  . SER A  1  31   ? 7.912   -29.076  -85.306  1.00 187.26 ? 31   SER A OG  1 
ATOM   236   N  N   . MET A  1  32   ? 10.585  -29.409  -84.591  1.00 251.30 ? 32   MET A N   1 
ATOM   237   C  CA  . MET A  1  32   ? 11.491  -29.153  -83.477  1.00 246.24 ? 32   MET A CA  1 
ATOM   238   C  C   . MET A  1  32   ? 12.941  -29.386  -83.887  1.00 241.22 ? 32   MET A C   1 
ATOM   239   O  O   . MET A  1  32   ? 13.791  -28.511  -83.720  1.00 239.72 ? 32   MET A O   1 
ATOM   240   C  CB  . MET A  1  32   ? 11.133  -30.036  -82.280  1.00 194.35 ? 32   MET A CB  1 
ATOM   241   C  CG  . MET A  1  32   ? 9.852   -29.629  -81.570  1.00 198.58 ? 32   MET A CG  1 
ATOM   242   S  SD  . MET A  1  32   ? 9.790   -27.865  -81.206  1.00 201.48 ? 32   MET A SD  1 
ATOM   243   C  CE  . MET A  1  32   ? 11.066  -27.731  -79.957  1.00 197.07 ? 32   MET A CE  1 
ATOM   244   N  N   . SER A  1  33   ? 13.216  -30.570  -84.425  1.00 216.40 ? 33   SER A N   1 
ATOM   245   C  CA  . SER A  1  33   ? 14.561  -30.917  -84.866  1.00 211.84 ? 33   SER A CA  1 
ATOM   246   C  C   . SER A  1  33   ? 15.007  -30.023  -86.018  1.00 211.92 ? 33   SER A C   1 
ATOM   247   O  O   . SER A  1  33   ? 14.217  -29.691  -86.901  1.00 216.19 ? 33   SER A O   1 
ATOM   248   C  CB  . SER A  1  33   ? 14.626  -32.387  -85.284  1.00 162.53 ? 33   SER A CB  1 
ATOM   249   O  OG  . SER A  1  33   ? 14.169  -32.558  -86.615  1.00 164.43 ? 33   SER A OG  1 
ATOM   250   N  N   . VAL A  1  34   ? 16.279  -29.636  -86.003  1.00 187.76 ? 34   VAL A N   1 
ATOM   251   C  CA  . VAL A  1  34   ? 16.827  -28.773  -87.043  1.00 193.80 ? 34   VAL A CA  1 
ATOM   252   C  C   . VAL A  1  34   ? 17.991  -29.446  -87.765  1.00 189.39 ? 34   VAL A C   1 
ATOM   253   O  O   . VAL A  1  34   ? 18.705  -28.807  -88.537  1.00 193.35 ? 34   VAL A O   1 
ATOM   254   C  CB  . VAL A  1  34   ? 17.303  -27.427  -86.467  1.00 199.02 ? 34   VAL A CB  1 
ATOM   255   C  CG1 . VAL A  1  34   ? 16.111  -26.542  -86.137  1.00 209.55 ? 34   VAL A CG1 1 
ATOM   256   C  CG2 . VAL A  1  34   ? 18.166  -27.651  -85.236  1.00 191.89 ? 34   VAL A CG2 1 
ATOM   257   N  N   . ALA A  1  35   ? 18.176  -30.737  -87.508  1.00 219.83 ? 35   ALA A N   1 
ATOM   258   C  CA  . ALA A  1  35   ? 19.253  -31.493  -88.137  1.00 217.61 ? 35   ALA A CA  1 
ATOM   259   C  C   . ALA A  1  35   ? 18.705  -32.522  -89.120  1.00 218.75 ? 35   ALA A C   1 
ATOM   260   O  O   . ALA A  1  35   ? 17.492  -32.684  -89.251  1.00 221.02 ? 35   ALA A O   1 
ATOM   261   C  CB  . ALA A  1  35   ? 20.113  -32.171  -87.079  1.00 211.74 ? 35   ALA A CB  1 
ATOM   262   N  N   . LYS A  1  36   ? 19.608  -33.215  -89.808  1.00 212.09 ? 36   LYS A N   1 
ATOM   263   C  CA  . LYS A  1  36   ? 19.216  -34.228  -90.779  1.00 214.78 ? 36   LYS A CA  1 
ATOM   264   C  C   . LYS A  1  36   ? 19.398  -35.634  -90.213  1.00 212.76 ? 36   LYS A C   1 
ATOM   265   O  O   . LYS A  1  36   ? 18.467  -36.214  -89.655  1.00 213.99 ? 36   LYS A O   1 
ATOM   266   C  CB  . LYS A  1  36   ? 20.022  -34.074  -92.070  1.00 218.15 ? 36   LYS A CB  1 
ATOM   267   C  CG  . LYS A  1  36   ? 20.280  -32.630  -92.471  1.00 222.77 ? 36   LYS A CG  1 
ATOM   268   C  CD  . LYS A  1  36   ? 21.499  -32.069  -91.757  1.00 224.50 ? 36   LYS A CD  1 
ATOM   269   C  CE  . LYS A  1  36   ? 22.010  -30.812  -92.442  1.00 232.61 ? 36   LYS A CE  1 
ATOM   270   N  NZ  . LYS A  1  36   ? 21.418  -29.579  -91.853  1.00 237.84 ? 36   LYS A NZ  1 
ATOM   271   N  N   . ILE A  1  37   ? 20.603  -36.174  -90.362  1.00 195.73 ? 37   ILE A N   1 
ATOM   272   C  CA  . ILE A  1  37   ? 20.909  -37.511  -89.867  1.00 196.25 ? 37   ILE A CA  1 
ATOM   273   C  C   . ILE A  1  37   ? 20.765  -38.553  -90.970  1.00 201.66 ? 37   ILE A C   1 
ATOM   274   O  O   . ILE A  1  37   ? 19.878  -39.404  -90.921  1.00 204.12 ? 37   ILE A O   1 
ATOM   275   C  CB  . ILE A  1  37   ? 19.999  -37.898  -88.686  1.00 193.64 ? 37   ILE A CB  1 
ATOM   276   C  CG1 . ILE A  1  37   ? 20.160  -36.899  -87.539  1.00 189.74 ? 37   ILE A CG1 1 
ATOM   277   C  CG2 . ILE A  1  37   ? 20.309  -39.311  -88.215  1.00 195.14 ? 37   ILE A CG2 1 
ATOM   278   C  CD1 . ILE A  1  37   ? 19.243  -37.163  -86.366  1.00 187.26 ? 37   ILE A CD1 1 
ATOM   279   N  N   . GLU A  1  38   ? 21.645  -38.482  -91.963  1.00 294.02 ? 38   GLU A N   1 
ATOM   280   C  CA  . GLU A  1  38   ? 21.620  -39.419  -93.079  1.00 300.28 ? 38   GLU A CA  1 
ATOM   281   C  C   . GLU A  1  38   ? 22.842  -40.331  -93.065  1.00 305.24 ? 38   GLU A C   1 
ATOM   282   O  O   . GLU A  1  38   ? 22.930  -41.279  -93.844  1.00 312.30 ? 38   GLU A O   1 
ATOM   283   C  CB  . GLU A  1  38   ? 21.541  -38.667  -94.409  1.00 169.49 ? 38   GLU A CB  1 
ATOM   284   C  CG  . GLU A  1  38   ? 20.887  -37.298  -94.311  1.00 166.85 ? 38   GLU A CG  1 
ATOM   285   C  CD  . GLU A  1  38   ? 21.012  -36.498  -95.593  1.00 170.07 ? 38   GLU A CD  1 
ATOM   286   O  OE1 . GLU A  1  38   ? 22.042  -36.640  -96.285  1.00 172.25 ? 38   GLU A OE1 1 
ATOM   287   O  OE2 . GLU A  1  38   ? 20.082  -35.726  -95.906  1.00 171.61 ? 38   GLU A OE2 1 
ATOM   288   N  N   . PHE A  1  39   ? 23.782  -40.036  -92.174  1.00 193.55 ? 39   PHE A N   1 
ATOM   289   C  CA  . PHE A  1  39   ? 25.001  -40.827  -92.055  1.00 200.45 ? 39   PHE A CA  1 
ATOM   290   C  C   . PHE A  1  39   ? 24.887  -41.853  -90.932  1.00 202.01 ? 39   PHE A C   1 
ATOM   291   O  O   . PHE A  1  39   ? 25.688  -41.855  -89.997  1.00 200.60 ? 39   PHE A O   1 
ATOM   292   C  CB  . PHE A  1  39   ? 26.208  -39.919  -91.817  1.00 201.15 ? 39   PHE A CB  1 
ATOM   293   C  CG  . PHE A  1  39   ? 27.413  -40.283  -92.637  1.00 209.47 ? 39   PHE A CG  1 
ATOM   294   C  CD1 . PHE A  1  39   ? 27.296  -41.140  -93.718  1.00 212.70 ? 39   PHE A CD1 1 
ATOM   295   C  CD2 . PHE A  1  39   ? 28.660  -39.769  -92.327  1.00 215.86 ? 39   PHE A CD2 1 
ATOM   296   C  CE1 . PHE A  1  39   ? 28.403  -41.477  -94.475  1.00 221.71 ? 39   PHE A CE1 1 
ATOM   297   C  CE2 . PHE A  1  39   ? 29.770  -40.103  -93.079  1.00 225.53 ? 39   PHE A CE2 1 
ATOM   298   C  CZ  . PHE A  1  39   ? 29.641  -40.958  -94.156  1.00 228.29 ? 39   PHE A CZ  1 
ATOM   299   N  N   . PRO A  1  40   ? 23.885  -42.722  -91.030  1.00 178.39 ? 40   PRO A N   1 
ATOM   300   C  CA  . PRO A  1  40   ? 23.664  -43.759  -90.017  1.00 182.24 ? 40   PRO A CA  1 
ATOM   301   C  C   . PRO A  1  40   ? 24.932  -44.050  -89.220  1.00 185.84 ? 40   PRO A C   1 
ATOM   302   O  O   . PRO A  1  40   ? 25.034  -43.652  -88.060  1.00 183.16 ? 40   PRO A O   1 
ATOM   303   C  CB  . PRO A  1  40   ? 23.278  -44.980  -90.854  1.00 193.06 ? 40   PRO A CB  1 
ATOM   304   C  CG  . PRO A  1  40   ? 22.663  -44.408  -92.081  1.00 192.09 ? 40   PRO A CG  1 
ATOM   305   C  CD  . PRO A  1  40   ? 23.412  -43.136  -92.362  1.00 184.50 ? 40   PRO A CD  1 
ATOM   306   N  N   . GLU A  1  41   ? 25.883  -44.738  -89.842  1.00 337.58 ? 41   GLU A N   1 
ATOM   307   C  CA  . GLU A  1  41   ? 27.139  -45.074  -89.184  1.00 342.71 ? 41   GLU A CA  1 
ATOM   308   C  C   . GLU A  1  41   ? 28.050  -43.856  -89.080  1.00 340.24 ? 41   GLU A C   1 
ATOM   309   O  O   . GLU A  1  41   ? 29.208  -43.896  -89.495  1.00 345.93 ? 41   GLU A O   1 
ATOM   310   C  CB  . GLU A  1  41   ? 27.852  -46.200  -89.934  1.00 352.96 ? 41   GLU A CB  1 
ATOM   311   C  CG  . GLU A  1  41   ? 28.668  -45.731  -91.128  1.00 355.09 ? 41   GLU A CG  1 
ATOM   312   C  CD  . GLU A  1  41   ? 29.428  -46.860  -91.794  1.00 367.03 ? 41   GLU A CD  1 
ATOM   313   O  OE1 . GLU A  1  41   ? 29.718  -47.868  -91.115  1.00 375.01 ? 41   GLU A OE1 1 
ATOM   314   O  OE2 . GLU A  1  41   ? 29.739  -46.741  -92.998  1.00 369.37 ? 41   GLU A OE2 1 
ATOM   315   N  N   . THR A  1  42   ? 27.517  -42.772  -88.524  1.00 481.08 ? 42   THR A N   1 
ATOM   316   C  CA  . THR A  1  42   ? 28.279  -41.538  -88.366  1.00 477.83 ? 42   THR A CA  1 
ATOM   317   C  C   . THR A  1  42   ? 29.509  -41.753  -87.493  1.00 484.82 ? 42   THR A C   1 
ATOM   318   O  O   . THR A  1  42   ? 30.385  -42.552  -87.824  1.00 489.82 ? 42   THR A O   1 
ATOM   319   C  CB  . THR A  1  42   ? 27.415  -40.418  -87.756  1.00 471.73 ? 42   THR A CB  1 
ATOM   320   O  OG1 . THR A  1  42   ? 26.504  -39.921  -88.743  1.00 468.27 ? 42   THR A OG1 1 
ATOM   321   C  CG2 . THR A  1  42   ? 28.294  -39.278  -87.265  1.00 469.86 ? 42   THR A CG2 1 
ATOM   322   N  N   . MET A  1  43   ? 29.566  -41.039  -86.374  1.00 230.39 ? 43   MET A N   1 
ATOM   323   C  CA  . MET A  1  43   ? 30.690  -41.146  -85.451  1.00 237.70 ? 43   MET A CA  1 
ATOM   324   C  C   . MET A  1  43   ? 31.937  -40.476  -86.021  1.00 242.80 ? 43   MET A C   1 
ATOM   325   O  O   . MET A  1  43   ? 33.060  -40.875  -85.721  1.00 245.51 ? 43   MET A O   1 
ATOM   326   C  CB  . MET A  1  43   ? 30.982  -42.613  -85.132  1.00 246.40 ? 43   MET A CB  1 
ATOM   327   C  CG  . MET A  1  43   ? 32.187  -43.182  -85.866  1.00 254.93 ? 43   MET A CG  1 
ATOM   328   S  SD  . MET A  1  43   ? 31.729  -44.395  -87.118  1.00 259.05 ? 43   MET A SD  1 
ATOM   329   C  CE  . MET A  1  43   ? 30.179  -44.999  -86.454  1.00 251.72 ? 43   MET A CE  1 
ATOM   330   N  N   . ASP A  1  44   ? 31.726  -39.456  -86.847  1.00 322.06 ? 44   ASP A N   1 
ATOM   331   C  CA  . ASP A  1  44   ? 32.832  -38.729  -87.463  1.00 322.17 ? 44   ASP A CA  1 
ATOM   332   C  C   . ASP A  1  44   ? 33.614  -39.624  -88.418  1.00 322.11 ? 44   ASP A C   1 
ATOM   333   O  O   . ASP A  1  44   ? 34.773  -39.350  -88.730  1.00 321.97 ? 44   ASP A O   1 
ATOM   334   C  CB  . ASP A  1  44   ? 33.763  -38.163  -86.390  1.00 321.52 ? 44   ASP A CB  1 
ATOM   335   C  CG  . ASP A  1  44   ? 33.024  -37.341  -85.351  1.00 321.53 ? 44   ASP A CG  1 
ATOM   336   O  OD1 . ASP A  1  44   ? 31.785  -37.227  -85.453  1.00 322.07 ? 44   ASP A OD1 1 
ATOM   337   O  OD2 . ASP A  1  44   ? 33.684  -36.809  -84.434  1.00 321.04 ? 44   ASP A OD2 1 
ATOM   338   N  N   . GLU A  1  45   ? 32.972  -40.693  -88.879  1.00 533.73 ? 45   GLU A N   1 
ATOM   339   C  CA  . GLU A  1  45   ? 33.607  -41.628  -89.799  1.00 533.06 ? 45   GLU A CA  1 
ATOM   340   C  C   . GLU A  1  45   ? 33.731  -41.031  -91.197  1.00 534.40 ? 45   GLU A C   1 
ATOM   341   O  O   . GLU A  1  45   ? 33.215  -41.585  -92.168  1.00 534.58 ? 45   GLU A O   1 
ATOM   342   C  CB  . GLU A  1  45   ? 32.820  -42.941  -89.856  1.00 532.72 ? 45   GLU A CB  1 
ATOM   343   C  CG  . GLU A  1  45   ? 33.450  -44.004  -90.740  1.00 531.85 ? 45   GLU A CG  1 
ATOM   344   C  CD  . GLU A  1  45   ? 32.670  -45.303  -90.734  1.00 531.85 ? 45   GLU A CD  1 
ATOM   345   O  OE1 . GLU A  1  45   ? 31.615  -45.362  -90.069  1.00 532.00 ? 45   GLU A OE1 1 
ATOM   346   O  OE2 . GLU A  1  45   ? 33.113  -46.268  -91.394  1.00 532.00 ? 45   GLU A OE2 1 
ATOM   347   N  N   . SER A  1  46   ? 34.416  -39.896  -91.291  1.00 371.65 ? 46   SER A N   1 
ATOM   348   C  CA  . SER A  1  46   ? 34.610  -39.220  -92.568  1.00 383.20 ? 46   SER A CA  1 
ATOM   349   C  C   . SER A  1  46   ? 36.046  -39.370  -93.059  1.00 400.79 ? 46   SER A C   1 
ATOM   350   O  O   . SER A  1  46   ? 36.411  -38.842  -94.110  1.00 413.33 ? 46   SER A O   1 
ATOM   351   C  CB  . SER A  1  46   ? 34.244  -37.740  -92.453  1.00 238.49 ? 46   SER A CB  1 
ATOM   352   O  OG  . SER A  1  46   ? 35.332  -36.915  -92.832  1.00 243.07 ? 46   SER A OG  1 
ATOM   353   N  N   . GLY A  1  47   ? 36.856  -40.092  -92.292  1.00 194.15 ? 47   GLY A N   1 
ATOM   354   C  CA  . GLY A  1  47   ? 38.247  -40.309  -92.645  1.00 212.93 ? 47   GLY A CA  1 
ATOM   355   C  C   . GLY A  1  47   ? 39.186  -39.375  -91.909  1.00 222.25 ? 47   GLY A C   1 
ATOM   356   O  O   . GLY A  1  47   ? 40.406  -39.490  -92.020  1.00 242.77 ? 47   GLY A O   1 
ATOM   357   N  N   . GLN A  1  48   ? 38.612  -38.443  -91.153  1.00 405.67 ? 48   GLN A N   1 
ATOM   358   C  CA  . GLN A  1  48   ? 39.401  -37.481  -90.393  1.00 414.91 ? 48   GLN A CA  1 
ATOM   359   C  C   . GLN A  1  48   ? 38.841  -37.297  -88.986  1.00 403.57 ? 48   GLN A C   1 
ATOM   360   O  O   . GLN A  1  48   ? 38.029  -38.098  -88.522  1.00 391.39 ? 48   GLN A O   1 
ATOM   361   C  CB  . GLN A  1  48   ? 39.452  -36.136  -91.119  1.00 267.52 ? 48   GLN A CB  1 
ATOM   362   C  CG  . GLN A  1  48   ? 38.108  -35.673  -91.663  1.00 250.65 ? 48   GLN A CG  1 
ATOM   363   C  CD  . GLN A  1  48   ? 38.095  -35.575  -93.175  1.00 255.17 ? 48   GLN A CD  1 
ATOM   364   O  OE1 . GLN A  1  48   ? 37.033  -35.534  -93.797  1.00 241.13 ? 48   GLN A OE1 1 
ATOM   365   N  NE2 . GLN A  1  48   ? 39.278  -35.535  -93.776  1.00 276.26 ? 48   GLN A NE2 1 
ATOM   366   N  N   . ARG A  1  49   ? 39.280  -36.238  -88.314  1.00 240.52 ? 49   ARG A N   1 
ATOM   367   C  CA  . ARG A  1  49   ? 38.823  -35.945  -86.961  1.00 231.83 ? 49   ARG A CA  1 
ATOM   368   C  C   . ARG A  1  49   ? 37.952  -34.694  -86.931  1.00 220.21 ? 49   ARG A C   1 
ATOM   369   O  O   . ARG A  1  49   ? 38.123  -33.828  -86.072  1.00 224.66 ? 49   ARG A O   1 
ATOM   370   C  CB  . ARG A  1  49   ? 40.015  -35.780  -86.017  1.00 249.77 ? 49   ARG A CB  1 
ATOM   371   C  CG  . ARG A  1  49   ? 41.210  -36.650  -86.369  1.00 265.73 ? 49   ARG A CG  1 
ATOM   372   C  CD  . ARG A  1  49   ? 42.390  -35.809  -86.830  1.00 288.90 ? 49   ARG A CD  1 
ATOM   373   N  NE  . ARG A  1  49   ? 43.527  -36.633  -87.227  1.00 310.68 ? 49   ARG A NE  1 
ATOM   374   C  CZ  . ARG A  1  49   ? 44.700  -36.147  -87.624  1.00 335.78 ? 49   ARG A CZ  1 
ATOM   375   N  NH1 . ARG A  1  49   ? 44.892  -34.836  -87.676  1.00 340.98 ? 49   ARG A NH1 1 
ATOM   376   N  NH2 . ARG A  1  49   ? 45.680  -36.971  -87.966  1.00 357.53 ? 49   ARG A NH2 1 
ATOM   377   N  N   . PRO A  1  50   ? 37.019  -34.604  -87.873  1.00 405.17 ? 50   PRO A N   1 
ATOM   378   C  CA  . PRO A  1  50   ? 36.117  -33.452  -87.955  1.00 397.80 ? 50   PRO A CA  1 
ATOM   379   C  C   . PRO A  1  50   ? 34.700  -33.809  -87.516  1.00 381.73 ? 50   PRO A C   1 
ATOM   380   O  O   . PRO A  1  50   ? 34.408  -33.810  -86.320  1.00 378.65 ? 50   PRO A O   1 
ATOM   381   C  CB  . PRO A  1  50   ? 36.134  -33.107  -89.445  1.00 257.41 ? 50   PRO A CB  1 
ATOM   382   C  CG  . PRO A  1  50   ? 36.431  -34.398  -90.122  1.00 259.79 ? 50   PRO A CG  1 
ATOM   383   C  CD  . PRO A  1  50   ? 37.362  -35.137  -89.203  1.00 269.71 ? 50   PRO A CD  1 
ATOM   384   N  N   . ARG A  1  51   ? 33.835  -34.111  -88.479  1.00 413.18 ? 51   ARG A N   1 
ATOM   385   C  CA  . ARG A  1  51   ? 32.454  -34.470  -88.184  1.00 398.16 ? 51   ARG A CA  1 
ATOM   386   C  C   . ARG A  1  51   ? 31.555  -34.248  -89.395  1.00 392.22 ? 51   ARG A C   1 
ATOM   387   O  O   . ARG A  1  51   ? 32.001  -33.747  -90.427  1.00 391.64 ? 51   ARG A O   1 
ATOM   388   C  CB  . ARG A  1  51   ? 31.935  -33.669  -86.989  1.00 245.53 ? 51   ARG A CB  1 
ATOM   389   C  CG  . ARG A  1  51   ? 32.807  -32.482  -86.612  1.00 253.67 ? 51   ARG A CG  1 
ATOM   390   C  CD  . ARG A  1  51   ? 32.148  -31.635  -85.536  1.00 251.19 ? 51   ARG A CD  1 
ATOM   391   N  NE  . ARG A  1  51   ? 33.128  -30.872  -84.768  1.00 256.36 ? 51   ARG A NE  1 
ATOM   392   C  CZ  . ARG A  1  51   ? 32.941  -29.623  -84.349  1.00 254.03 ? 51   ARG A CZ  1 
ATOM   393   N  NH1 . ARG A  1  51   ? 31.807  -28.992  -84.626  1.00 247.60 ? 51   ARG A NH1 1 
ATOM   394   N  NH2 . ARG A  1  51   ? 33.887  -29.005  -83.655  1.00 259.57 ? 51   ARG A NH2 1 
ATOM   395   N  N   . VAL A  1  52   ? 30.287  -34.624  -89.262  1.00 284.51 ? 52   VAL A N   1 
ATOM   396   C  CA  . VAL A  1  52   ? 29.324  -34.466  -90.345  1.00 280.57 ? 52   VAL A CA  1 
ATOM   397   C  C   . VAL A  1  52   ? 29.093  -35.785  -91.076  1.00 271.08 ? 52   VAL A C   1 
ATOM   398   O  O   . VAL A  1  52   ? 29.987  -36.629  -91.145  1.00 264.67 ? 52   VAL A O   1 
ATOM   399   C  CB  . VAL A  1  52   ? 29.783  -33.400  -91.358  1.00 131.32 ? 52   VAL A CB  1 
ATOM   400   C  CG1 . VAL A  1  52   ? 29.781  -33.974  -92.768  1.00 140.60 ? 52   VAL A CG1 1 
ATOM   401   C  CG2 . VAL A  1  52   ? 28.892  -32.170  -91.274  1.00 135.19 ? 52   VAL A CG2 1 
ATOM   402   N  N   . GLY A  1  53   ? 27.892  -35.953  -91.620  1.00 265.03 ? 53   GLY A N   1 
ATOM   403   C  CA  . GLY A  1  53   ? 26.862  -34.936  -91.520  1.00 259.52 ? 53   GLY A CA  1 
ATOM   404   C  C   . GLY A  1  53   ? 25.544  -35.495  -91.019  1.00 252.39 ? 53   GLY A C   1 
ATOM   405   O  O   . GLY A  1  53   ? 24.802  -36.129  -91.769  1.00 252.92 ? 53   GLY A O   1 
ATOM   406   N  N   . GLY A  1  54   ? 25.253  -35.257  -89.744  1.00 206.34 ? 54   GLY A N   1 
ATOM   407   C  CA  . GLY A  1  54   ? 24.024  -35.736  -89.141  1.00 201.53 ? 54   GLY A CA  1 
ATOM   408   C  C   . GLY A  1  54   ? 24.275  -36.651  -87.959  1.00 199.76 ? 54   GLY A C   1 
ATOM   409   O  O   . GLY A  1  54   ? 23.696  -37.733  -87.865  1.00 200.82 ? 54   GLY A O   1 
ATOM   410   N  N   . LEU A  1  55   ? 25.144  -36.214  -87.053  1.00 269.27 ? 55   LEU A N   1 
ATOM   411   C  CA  . LEU A  1  55   ? 25.475  -36.997  -85.868  1.00 262.47 ? 55   LEU A CA  1 
ATOM   412   C  C   . LEU A  1  55   ? 26.086  -36.119  -84.781  1.00 234.27 ? 55   LEU A C   1 
ATOM   413   O  O   . LEU A  1  55   ? 25.443  -35.828  -83.772  1.00 210.90 ? 55   LEU A O   1 
ATOM   414   C  CB  . LEU A  1  55   ? 26.435  -38.133  -86.228  1.00 236.96 ? 55   LEU A CB  1 
ATOM   415   C  CG  . LEU A  1  55   ? 26.893  -39.025  -85.074  1.00 167.50 ? 55   LEU A CG  1 
ATOM   416   C  CD1 . LEU A  1  55   ? 27.785  -38.250  -84.116  1.00 142.13 ? 55   LEU A CD1 1 
ATOM   417   C  CD2 . LEU A  1  55   ? 25.697  -39.613  -84.341  1.00 148.45 ? 55   LEU A CD2 1 
ATOM   418   N  N   . LEU A  1  56   ? 27.330  -35.703  -84.992  1.00 254.38 ? 56   LEU A N   1 
ATOM   419   C  CA  . LEU A  1  56   ? 28.030  -34.859  -84.032  1.00 195.09 ? 56   LEU A CA  1 
ATOM   420   C  C   . LEU A  1  56   ? 27.675  -33.389  -84.232  1.00 208.79 ? 56   LEU A C   1 
ATOM   421   O  O   . LEU A  1  56   ? 27.051  -32.768  -83.371  1.00 190.24 ? 56   LEU A O   1 
ATOM   422   C  CB  . LEU A  1  56   ? 29.543  -35.055  -84.148  1.00 229.17 ? 56   LEU A CB  1 
ATOM   423   C  CG  . LEU A  1  56   ? 30.413  -34.154  -83.269  1.00 239.36 ? 56   LEU A CG  1 
ATOM   424   C  CD1 . LEU A  1  56   ? 29.567  -33.455  -82.213  1.00 235.13 ? 56   LEU A CD1 1 
ATOM   425   C  CD2 . LEU A  1  56   ? 31.532  -34.955  -82.621  1.00 211.47 ? 56   LEU A CD2 1 
ATOM   426   N  N   . ASP A  1  57   ? 28.078  -32.837  -85.372  1.00 160.71 ? 57   ASP A N   1 
ATOM   427   C  CA  . ASP A  1  57   ? 27.802  -31.438  -85.687  1.00 234.83 ? 57   ASP A CA  1 
ATOM   428   C  C   . ASP A  1  57   ? 26.298  -31.172  -85.737  1.00 257.77 ? 57   ASP A C   1 
ATOM   429   O  O   . ASP A  1  57   ? 25.584  -31.408  -84.764  1.00 259.27 ? 57   ASP A O   1 
ATOM   430   C  CB  . ASP A  1  57   ? 28.448  -31.054  -87.021  1.00 266.41 ? 57   ASP A CB  1 
ATOM   431   C  CG  . ASP A  1  57   ? 29.632  -30.121  -86.844  1.00 276.32 ? 57   ASP A CG  1 
ATOM   432   O  OD1 . ASP A  1  57   ? 29.900  -29.712  -85.696  1.00 275.25 ? 57   ASP A OD1 1 
ATOM   433   O  OD2 . ASP A  1  57   ? 30.293  -29.802  -87.853  1.00 280.22 ? 57   ASP A OD2 1 
ATOM   434   N  N   . PRO A  1  58   ? 25.829  -30.676  -86.876  1.00 273.77 ? 58   PRO A N   1 
ATOM   435   C  CA  . PRO A  1  58   ? 24.406  -30.371  -87.055  1.00 266.74 ? 58   PRO A CA  1 
ATOM   436   C  C   . PRO A  1  58   ? 23.584  -30.765  -85.830  1.00 249.32 ? 58   PRO A C   1 
ATOM   437   O  O   . PRO A  1  58   ? 22.816  -31.726  -85.886  1.00 264.46 ? 58   PRO A O   1 
ATOM   438   C  CB  . PRO A  1  58   ? 24.015  -31.238  -88.252  1.00 258.58 ? 58   PRO A CB  1 
ATOM   439   C  CG  . PRO A  1  58   ? 25.274  -31.379  -89.032  1.00 266.19 ? 58   PRO A CG  1 
ATOM   440   C  CD  . PRO A  1  58   ? 26.386  -31.418  -88.023  1.00 277.99 ? 58   PRO A CD  1 
ATOM   441   N  N   . ARG A  1  59   ? 23.750  -30.024  -84.736  1.00 229.21 ? 59   ARG A N   1 
ATOM   442   C  CA  . ARG A  1  59   ? 24.670  -28.896  -84.709  1.00 202.52 ? 59   ARG A CA  1 
ATOM   443   C  C   . ARG A  1  59   ? 25.939  -29.239  -83.934  1.00 196.33 ? 59   ARG A C   1 
ATOM   444   O  O   . ARG A  1  59   ? 27.051  -29.005  -84.409  1.00 176.38 ? 59   ARG A O   1 
ATOM   445   C  CB  . ARG A  1  59   ? 23.995  -27.668  -84.096  1.00 182.11 ? 59   ARG A CB  1 
ATOM   446   C  CG  . ARG A  1  59   ? 22.775  -27.186  -84.860  1.00 153.39 ? 59   ARG A CG  1 
ATOM   447   C  CD  . ARG A  1  59   ? 22.902  -25.717  -85.235  1.00 184.23 ? 59   ARG A CD  1 
ATOM   448   N  NE  . ARG A  1  59   ? 21.780  -25.262  -86.049  1.00 209.58 ? 59   ARG A NE  1 
ATOM   449   C  CZ  . ARG A  1  59   ? 21.806  -25.170  -87.375  1.00 211.24 ? 59   ARG A CZ  1 
ATOM   450   N  NH1 . ARG A  1  59   ? 22.905  -25.501  -88.043  1.00 230.17 ? 59   ARG A NH1 1 
ATOM   451   N  NH2 . ARG A  1  59   ? 20.739  -24.745  -88.036  1.00 187.63 ? 59   ARG A NH2 1 
ATOM   452   N  N   . LEU A  1  60   ? 25.765  -29.796  -82.744  1.00 266.74 ? 60   LEU A N   1 
ATOM   453   C  CA  . LEU A  1  60   ? 24.433  -30.061  -82.208  1.00 235.67 ? 60   LEU A CA  1 
ATOM   454   C  C   . LEU A  1  60   ? 24.234  -29.371  -80.865  1.00 221.86 ? 60   LEU A C   1 
ATOM   455   O  O   . LEU A  1  60   ? 23.217  -28.714  -80.641  1.00 211.96 ? 60   LEU A O   1 
ATOM   456   C  CB  . LEU A  1  60   ? 24.207  -31.567  -82.064  1.00 204.75 ? 60   LEU A CB  1 
ATOM   457   C  CG  . LEU A  1  60   ? 23.364  -32.233  -83.156  1.00 168.66 ? 60   LEU A CG  1 
ATOM   458   C  CD1 . LEU A  1  60   ? 23.460  -33.747  -83.060  1.00 187.77 ? 60   LEU A CD1 1 
ATOM   459   C  CD2 . LEU A  1  60   ? 21.916  -31.775  -83.070  1.00 185.93 ? 60   LEU A CD2 1 
ATOM   460   N  N   . GLY A  1  61   ? 25.204  -29.524  -79.972  1.00 115.80 ? 61   GLY A N   1 
ATOM   461   C  CA  . GLY A  1  61   ? 25.135  -28.920  -78.659  1.00 115.86 ? 61   GLY A CA  1 
ATOM   462   C  C   . GLY A  1  61   ? 26.513  -28.822  -78.041  1.00 126.59 ? 61   GLY A C   1 
ATOM   463   O  O   . GLY A  1  61   ? 26.655  -28.474  -76.872  1.00 129.51 ? 61   GLY A O   1 
ATOM   464   N  N   . THR A  1  62   ? 27.534  -29.135  -78.833  1.00 291.98 ? 62   THR A N   1 
ATOM   465   C  CA  . THR A  1  62   ? 28.913  -29.086  -78.360  1.00 298.13 ? 62   THR A CA  1 
ATOM   466   C  C   . THR A  1  62   ? 29.204  -30.242  -77.404  1.00 285.20 ? 62   THR A C   1 
ATOM   467   O  O   . THR A  1  62   ? 28.286  -30.845  -76.847  1.00 291.06 ? 62   THR A O   1 
ATOM   468   C  CB  . THR A  1  62   ? 29.222  -27.759  -77.652  1.00 326.75 ? 62   THR A CB  1 
ATOM   469   O  OG1 . THR A  1  62   ? 29.207  -26.689  -78.602  1.00 353.28 ? 62   THR A OG1 1 
ATOM   470   C  CG2 . THR A  1  62   ? 30.583  -27.815  -76.978  1.00 330.32 ? 62   THR A CG2 1 
ATOM   471   N  N   . ILE A  1  63   ? 30.484  -30.544  -77.220  1.00 184.93 ? 63   ILE A N   1 
ATOM   472   C  CA  . ILE A  1  63   ? 30.896  -31.628  -76.334  1.00 190.78 ? 63   ILE A CA  1 
ATOM   473   C  C   . ILE A  1  63   ? 32.197  -31.287  -75.614  1.00 218.94 ? 63   ILE A C   1 
ATOM   474   O  O   . ILE A  1  63   ? 32.607  -31.989  -74.691  1.00 201.05 ? 63   ILE A O   1 
ATOM   475   C  CB  . ILE A  1  63   ? 31.078  -32.949  -77.106  1.00 157.04 ? 63   ILE A CB  1 
ATOM   476   C  CG1 . ILE A  1  63   ? 31.766  -33.993  -76.223  1.00 163.85 ? 63   ILE A CG1 1 
ATOM   477   C  CG2 . ILE A  1  63   ? 31.871  -32.717  -78.384  1.00 112.76 ? 63   ILE A CG2 1 
ATOM   478   C  CD1 . ILE A  1  63   ? 31.869  -35.360  -76.860  1.00 155.94 ? 63   ILE A CD1 1 
ATOM   479   N  N   . ASP A  1  64   ? 32.842  -30.208  -76.043  1.00 254.97 ? 64   ASP A N   1 
ATOM   480   C  CA  . ASP A  1  64   ? 34.098  -29.776  -75.443  1.00 277.48 ? 64   ASP A CA  1 
ATOM   481   C  C   . ASP A  1  64   ? 34.165  -28.257  -75.329  1.00 279.89 ? 64   ASP A C   1 
ATOM   482   O  O   . ASP A  1  64   ? 33.252  -27.551  -75.757  1.00 291.28 ? 64   ASP A O   1 
ATOM   483   C  CB  . ASP A  1  64   ? 35.287  -30.296  -76.255  1.00 297.85 ? 64   ASP A CB  1 
ATOM   484   C  CG  . ASP A  1  64   ? 36.561  -30.375  -75.437  1.00 326.27 ? 64   ASP A CG  1 
ATOM   485   O  OD1 . ASP A  1  64   ? 36.502  -30.119  -74.217  1.00 319.81 ? 64   ASP A OD1 1 
ATOM   486   O  OD2 . ASP A  1  64   ? 37.620  -30.697  -76.015  1.00 351.47 ? 64   ASP A OD2 1 
ATOM   487   N  N   . ARG A  1  65   ? 35.254  -27.760  -74.751  1.00 135.56 ? 65   ARG A N   1 
ATOM   488   C  CA  . ARG A  1  65   ? 35.443  -26.324  -74.580  1.00 125.44 ? 65   ARG A CA  1 
ATOM   489   C  C   . ARG A  1  65   ? 35.509  -25.613  -75.928  1.00 164.80 ? 65   ARG A C   1 
ATOM   490   O  O   . ARG A  1  65   ? 34.545  -24.976  -76.352  1.00 165.62 ? 65   ARG A O   1 
ATOM   491   C  CB  . ARG A  1  65   ? 36.712  -26.044  -73.774  1.00 109.09 ? 65   ARG A CB  1 
ATOM   492   C  CG  . ARG A  1  65   ? 36.706  -24.707  -73.051  1.00 138.38 ? 65   ARG A CG  1 
ATOM   493   C  CD  . ARG A  1  65   ? 36.631  -23.549  -74.032  1.00 179.80 ? 65   ARG A CD  1 
ATOM   494   N  NE  . ARG A  1  65   ? 37.164  -22.313  -73.463  1.00 210.26 ? 65   ARG A NE  1 
ATOM   495   C  CZ  . ARG A  1  65   ? 36.851  -21.096  -73.894  1.00 208.44 ? 65   ARG A CZ  1 
ATOM   496   N  NH1 . ARG A  1  65   ? 36.003  -20.946  -74.902  1.00 221.76 ? 65   ARG A NH1 1 
ATOM   497   N  NH2 . ARG A  1  65   ? 37.384  -20.028  -73.316  1.00 178.29 ? 65   ARG A NH2 1 
ATOM   498   N  N   . GLN A  1  66   ? 36.653  -25.725  -76.595  1.00 269.71 ? 66   GLN A N   1 
ATOM   499   C  CA  . GLN A  1  66   ? 36.847  -25.093  -77.895  1.00 264.83 ? 66   GLN A CA  1 
ATOM   500   C  C   . GLN A  1  66   ? 35.724  -25.460  -78.859  1.00 234.27 ? 66   GLN A C   1 
ATOM   501   O  O   . GLN A  1  66   ? 35.914  -26.264  -79.772  1.00 199.48 ? 66   GLN A O   1 
ATOM   502   C  CB  . GLN A  1  66   ? 38.200  -25.491  -78.487  1.00 274.98 ? 66   GLN A CB  1 
ATOM   503   C  CG  . GLN A  1  66   ? 39.258  -25.829  -77.449  1.00 298.32 ? 66   GLN A CG  1 
ATOM   504   C  CD  . GLN A  1  66   ? 40.156  -24.651  -77.128  1.00 309.89 ? 66   GLN A CD  1 
ATOM   505   O  OE1 . GLN A  1  66   ? 40.748  -24.045  -78.020  1.00 297.25 ? 66   GLN A OE1 1 
ATOM   506   N  NE2 . GLN A  1  66   ? 40.259  -24.319  -75.846  1.00 308.22 ? 66   GLN A NE2 1 
ATOM   507   N  N   . PHE A  1  67   ? 34.554  -24.865  -78.649  1.00 235.12 ? 67   PHE A N   1 
ATOM   508   C  CA  . PHE A  1  67   ? 33.398  -25.129  -79.498  1.00 251.35 ? 67   PHE A CA  1 
ATOM   509   C  C   . PHE A  1  67   ? 32.215  -24.252  -79.103  1.00 244.89 ? 67   PHE A C   1 
ATOM   510   O  O   . PHE A  1  67   ? 31.802  -24.233  -77.944  1.00 230.12 ? 67   PHE A O   1 
ATOM   511   C  CB  . PHE A  1  67   ? 33.004  -26.606  -79.425  1.00 259.95 ? 67   PHE A CB  1 
ATOM   512   C  CG  . PHE A  1  67   ? 34.117  -27.508  -78.975  1.00 252.72 ? 67   PHE A CG  1 
ATOM   513   C  CD1 . PHE A  1  67   ? 34.611  -27.433  -77.683  1.00 237.27 ? 67   PHE A CD1 1 
ATOM   514   C  CD2 . PHE A  1  67   ? 34.672  -28.432  -79.844  1.00 229.80 ? 67   PHE A CD2 1 
ATOM   515   C  CE1 . PHE A  1  67   ? 35.636  -28.260  -77.267  1.00 214.63 ? 67   PHE A CE1 1 
ATOM   516   C  CE2 . PHE A  1  67   ? 35.697  -29.264  -79.435  1.00 204.78 ? 67   PHE A CE2 1 
ATOM   517   C  CZ  . PHE A  1  67   ? 36.179  -29.178  -78.144  1.00 206.10 ? 67   PHE A CZ  1 
ATOM   518   N  N   . LYS A  1  68   ? 31.674  -23.524  -80.076  1.00 264.44 ? 68   LYS A N   1 
ATOM   519   C  CA  . LYS A  1  68   ? 30.540  -22.641  -79.832  1.00 262.11 ? 68   LYS A CA  1 
ATOM   520   C  C   . LYS A  1  68   ? 29.300  -23.109  -80.587  1.00 249.87 ? 68   LYS A C   1 
ATOM   521   O  O   . LYS A  1  68   ? 28.520  -22.297  -81.082  1.00 250.90 ? 68   LYS A O   1 
ATOM   522   C  CB  . LYS A  1  68   ? 30.885  -21.204  -80.227  1.00 276.72 ? 68   LYS A CB  1 
ATOM   523   C  CG  . LYS A  1  68   ? 32.029  -20.598  -79.431  1.00 291.41 ? 68   LYS A CG  1 
ATOM   524   C  CD  . LYS A  1  68   ? 33.306  -20.541  -80.253  1.00 304.47 ? 68   LYS A CD  1 
ATOM   525   C  CE  . LYS A  1  68   ? 34.476  -20.037  -79.424  1.00 320.89 ? 68   LYS A CE  1 
ATOM   526   N  NZ  . LYS A  1  68   ? 35.396  -19.185  -80.224  1.00 339.82 ? 68   LYS A NZ  1 
ATOM   527   N  N   . CYS A  1  69   ? 29.125  -24.424  -80.671  1.00 185.06 ? 69   CYS A N   1 
ATOM   528   C  CA  . CYS A  1  69   ? 27.980  -25.000  -81.363  1.00 171.15 ? 69   CYS A CA  1 
ATOM   529   C  C   . CYS A  1  69   ? 26.922  -23.944  -81.657  1.00 174.53 ? 69   CYS A C   1 
ATOM   530   O  O   . CYS A  1  69   ? 26.012  -23.724  -80.857  1.00 182.11 ? 69   CYS A O   1 
ATOM   531   C  CB  . CYS A  1  69   ? 27.372  -26.138  -80.539  1.00 154.32 ? 69   CYS A CB  1 
ATOM   532   S  SG  . CYS A  1  69   ? 26.339  -25.592  -79.163  1.00 294.60 ? 69   CYS A SG  1 
ATOM   533   N  N   . GLN A  1  70   ? 27.050  -23.289  -82.808  1.00 202.22 ? 70   GLN A N   1 
ATOM   534   C  CA  . GLN A  1  70   ? 26.108  -22.252  -83.206  1.00 220.17 ? 70   GLN A CA  1 
ATOM   535   C  C   . GLN A  1  70   ? 24.698  -22.567  -82.708  1.00 226.77 ? 70   GLN A C   1 
ATOM   536   O  O   . GLN A  1  70   ? 24.286  -23.725  -82.668  1.00 183.59 ? 70   GLN A O   1 
ATOM   537   C  CB  . GLN A  1  70   ? 26.099  -22.092  -84.730  1.00 209.02 ? 70   GLN A CB  1 
ATOM   538   C  CG  . GLN A  1  70   ? 26.666  -20.770  -85.216  1.00 217.65 ? 70   GLN A CG  1 
ATOM   539   C  CD  . GLN A  1  70   ? 26.850  -20.730  -86.719  1.00 243.05 ? 70   GLN A CD  1 
ATOM   540   O  OE1 . GLN A  1  70   ? 26.181  -21.456  -87.457  1.00 230.65 ? 70   GLN A OE1 1 
ATOM   541   N  NE2 . GLN A  1  70   ? 27.759  -19.881  -87.182  1.00 274.81 ? 70   GLN A NE2 1 
ATOM   542   N  N   . THR A  1  71   ? 23.968  -21.522  -82.325  1.00 243.28 ? 71   THR A N   1 
ATOM   543   C  CA  . THR A  1  71   ? 22.608  -21.683  -81.826  1.00 241.87 ? 71   THR A CA  1 
ATOM   544   C  C   . THR A  1  71   ? 22.498  -21.234  -80.376  1.00 218.74 ? 71   THR A C   1 
ATOM   545   O  O   . THR A  1  71   ? 21.426  -20.835  -79.918  1.00 219.83 ? 71   THR A O   1 
ATOM   546   C  CB  . THR A  1  71   ? 22.133  -23.145  -81.939  1.00 239.46 ? 71   THR A CB  1 
ATOM   547   O  OG1 . THR A  1  71   ? 21.670  -23.396  -83.270  1.00 238.18 ? 71   THR A OG1 1 
ATOM   548   C  CG2 . THR A  1  71   ? 21.008  -23.418  -80.952  1.00 229.67 ? 71   THR A CG2 1 
ATOM   549   N  N   . CYS A  1  72   ? 23.611  -21.305  -79.651  1.00 187.13 ? 72   CYS A N   1 
ATOM   550   C  CA  . CYS A  1  72   ? 23.642  -20.902  -78.250  1.00 182.72 ? 72   CYS A CA  1 
ATOM   551   C  C   . CYS A  1  72   ? 25.049  -21.016  -77.676  1.00 179.89 ? 72   CYS A C   1 
ATOM   552   O  O   . CYS A  1  72   ? 26.028  -20.679  -78.341  1.00 178.75 ? 72   CYS A O   1 
ATOM   553   C  CB  . CYS A  1  72   ? 22.668  -21.752  -77.431  1.00 174.07 ? 72   CYS A CB  1 
ATOM   554   S  SG  . CYS A  1  72   ? 21.380  -22.567  -78.403  1.00 178.01 ? 72   CYS A SG  1 
ATOM   555   N  N   . GLY A  1  73   ? 25.142  -21.488  -76.437  1.00 218.55 ? 73   GLY A N   1 
ATOM   556   C  CA  . GLY A  1  73   ? 26.426  -21.646  -75.775  1.00 216.29 ? 73   GLY A CA  1 
ATOM   557   C  C   . GLY A  1  73   ? 26.530  -20.817  -74.511  1.00 209.32 ? 73   GLY A C   1 
ATOM   558   O  O   . GLY A  1  73   ? 25.562  -20.180  -74.094  1.00 185.32 ? 73   GLY A O   1 
ATOM   559   N  N   . GLU A  1  74   ? 27.711  -20.827  -73.901  1.00 168.61 ? 74   GLU A N   1 
ATOM   560   C  CA  . GLU A  1  74   ? 28.838  -21.589  -74.422  1.00 206.71 ? 74   GLU A CA  1 
ATOM   561   C  C   . GLU A  1  74   ? 28.773  -23.043  -73.968  1.00 179.22 ? 74   GLU A C   1 
ATOM   562   O  O   . GLU A  1  74   ? 27.701  -23.562  -73.653  1.00 190.05 ? 74   GLU A O   1 
ATOM   563   C  CB  . GLU A  1  74   ? 30.160  -20.959  -73.988  1.00 264.93 ? 74   GLU A CB  1 
ATOM   564   C  CG  . GLU A  1  74   ? 30.086  -19.460  -73.754  1.00 299.44 ? 74   GLU A CG  1 
ATOM   565   C  CD  . GLU A  1  74   ? 31.252  -18.939  -72.938  1.00 331.34 ? 74   GLU A CD  1 
ATOM   566   O  OE1 . GLU A  1  74   ? 31.881  -19.743  -72.216  1.00 347.56 ? 74   GLU A OE1 1 
ATOM   567   O  OE2 . GLU A  1  74   ? 31.538  -17.726  -73.014  1.00 339.11 ? 74   GLU A OE2 1 
ATOM   568   N  N   . THR A  1  75   ? 29.929  -23.700  -73.930  1.00 289.06 ? 75   THR A N   1 
ATOM   569   C  CA  . THR A  1  75   ? 30.010  -25.092  -73.512  1.00 280.43 ? 75   THR A CA  1 
ATOM   570   C  C   . THR A  1  75   ? 30.896  -25.250  -72.279  1.00 285.80 ? 75   THR A C   1 
ATOM   571   O  O   . THR A  1  75   ? 31.598  -24.316  -71.884  1.00 297.36 ? 75   THR A O   1 
ATOM   572   C  CB  . THR A  1  75   ? 30.548  -25.992  -74.640  1.00 279.31 ? 75   THR A CB  1 
ATOM   573   O  OG1 . THR A  1  75   ? 31.977  -26.049  -74.568  1.00 290.30 ? 75   THR A OG1 1 
ATOM   574   C  CG2 . THR A  1  75   ? 30.135  -25.446  -75.997  1.00 279.89 ? 75   THR A CG2 1 
ATOM   575   N  N   . MET A  1  76   ? 30.862  -26.433  -71.679  1.00 234.08 ? 76   MET A N   1 
ATOM   576   C  CA  . MET A  1  76   ? 30.016  -27.515  -72.168  1.00 208.00 ? 76   MET A CA  1 
ATOM   577   C  C   . MET A  1  76   ? 28.589  -27.375  -71.648  1.00 193.28 ? 76   MET A C   1 
ATOM   578   O  O   . MET A  1  76   ? 27.642  -27.862  -72.266  1.00 168.28 ? 76   MET A O   1 
ATOM   579   C  CB  . MET A  1  76   ? 30.593  -28.873  -71.756  1.00 209.77 ? 76   MET A CB  1 
ATOM   580   C  CG  . MET A  1  76   ? 31.238  -28.882  -70.381  1.00 250.88 ? 76   MET A CG  1 
ATOM   581   S  SD  . MET A  1  76   ? 32.125  -30.415  -70.037  1.00 387.66 ? 76   MET A SD  1 
ATOM   582   C  CE  . MET A  1  76   ? 33.455  -30.313  -71.232  1.00 248.83 ? 76   MET A CE  1 
ATOM   583   N  N   . ALA A  1  77   ? 28.442  -26.704  -70.509  1.00 190.79 ? 77   ALA A N   1 
ATOM   584   C  CA  . ALA A  1  77   ? 27.131  -26.495  -69.908  1.00 178.47 ? 77   ALA A CA  1 
ATOM   585   C  C   . ALA A  1  77   ? 26.405  -25.326  -70.567  1.00 206.87 ? 77   ALA A C   1 
ATOM   586   O  O   . ALA A  1  77   ? 26.771  -24.891  -71.658  1.00 176.26 ? 77   ALA A O   1 
ATOM   587   C  CB  . ALA A  1  77   ? 27.266  -26.265  -68.411  1.00 250.40 ? 77   ALA A CB  1 
ATOM   588   N  N   . ASP A  1  78   ? 25.377  -24.820  -69.894  1.00 174.40 ? 78   ASP A N   1 
ATOM   589   C  CA  . ASP A  1  78   ? 24.599  -23.702  -70.410  1.00 184.42 ? 78   ASP A CA  1 
ATOM   590   C  C   . ASP A  1  78   ? 24.067  -24.005  -71.806  1.00 165.30 ? 78   ASP A C   1 
ATOM   591   O  O   . ASP A  1  78   ? 23.181  -23.309  -72.307  1.00 199.21 ? 78   ASP A O   1 
ATOM   592   C  CB  . ASP A  1  78   ? 25.444  -22.425  -70.433  1.00 213.20 ? 78   ASP A CB  1 
ATOM   593   C  CG  . ASP A  1  78   ? 25.494  -21.735  -69.085  1.00 228.16 ? 78   ASP A CG  1 
ATOM   594   O  OD1 . ASP A  1  78   ? 25.679  -22.432  -68.065  1.00 209.73 ? 78   ASP A OD1 1 
ATOM   595   O  OD2 . ASP A  1  78   ? 25.350  -20.496  -69.045  1.00 254.75 ? 78   ASP A OD2 1 
ATOM   596   N  N   . CYS A  1  79   ? 24.612  -25.042  -72.433  1.00 140.52 ? 79   CYS A N   1 
ATOM   597   C  CA  . CYS A  1  79   ? 24.191  -25.439  -73.772  1.00 201.72 ? 79   CYS A CA  1 
ATOM   598   C  C   . CYS A  1  79   ? 23.466  -26.779  -73.744  1.00 169.18 ? 79   CYS A C   1 
ATOM   599   O  O   . CYS A  1  79   ? 24.097  -27.838  -73.754  1.00 136.16 ? 79   CYS A O   1 
ATOM   600   C  CB  . CYS A  1  79   ? 25.397  -25.511  -74.710  1.00 141.94 ? 79   CYS A CB  1 
ATOM   601   S  SG  . CYS A  1  79   ? 25.016  -25.155  -76.443  1.00 197.57 ? 79   CYS A SG  1 
ATOM   602   N  N   . PRO A  1  80   ? 22.139  -26.728  -73.706  1.00 152.46 ? 80   PRO A N   1 
ATOM   603   C  CA  . PRO A  1  80   ? 21.321  -27.943  -73.672  1.00 148.57 ? 80   PRO A CA  1 
ATOM   604   C  C   . PRO A  1  80   ? 21.364  -28.695  -74.999  1.00 147.86 ? 80   PRO A C   1 
ATOM   605   O  O   . PRO A  1  80   ? 21.664  -28.101  -76.034  1.00 151.97 ? 80   PRO A O   1 
ATOM   606   C  CB  . PRO A  1  80   ? 19.911  -27.405  -73.420  1.00 148.63 ? 80   PRO A CB  1 
ATOM   607   C  CG  . PRO A  1  80   ? 19.929  -26.036  -74.000  1.00 151.19 ? 80   PRO A CG  1 
ATOM   608   C  CD  . PRO A  1  80   ? 21.315  -25.506  -73.761  1.00 153.52 ? 80   PRO A CD  1 
ATOM   609   N  N   . GLY A  1  81   ? 21.066  -29.990  -74.960  1.00 234.51 ? 81   GLY A N   1 
ATOM   610   C  CA  . GLY A  1  81   ? 21.072  -30.809  -76.158  1.00 232.05 ? 81   GLY A CA  1 
ATOM   611   C  C   . GLY A  1  81   ? 20.034  -30.363  -77.170  1.00 231.32 ? 81   GLY A C   1 
ATOM   612   O  O   . GLY A  1  81   ? 18.937  -29.943  -76.803  1.00 234.42 ? 81   GLY A O   1 
ATOM   613   N  N   . HIS A  1  82   ? 20.385  -30.453  -78.448  1.00 191.57 ? 82   HIS A N   1 
ATOM   614   C  CA  . HIS A  1  82   ? 19.480  -30.054  -79.521  1.00 190.75 ? 82   HIS A CA  1 
ATOM   615   C  C   . HIS A  1  82   ? 18.870  -31.271  -80.209  1.00 190.47 ? 82   HIS A C   1 
ATOM   616   O  O   . HIS A  1  82   ? 19.459  -31.833  -81.133  1.00 191.70 ? 82   HIS A O   1 
ATOM   617   C  CB  . HIS A  1  82   ? 20.213  -29.184  -80.544  1.00 188.90 ? 82   HIS A CB  1 
ATOM   618   C  CG  . HIS A  1  82   ? 20.373  -27.757  -80.118  1.00 187.95 ? 82   HIS A CG  1 
ATOM   619   N  ND1 . HIS A  1  82   ? 19.320  -26.994  -79.663  1.00 189.34 ? 82   HIS A ND1 1 
ATOM   620   C  CD2 . HIS A  1  82   ? 21.463  -26.956  -80.079  1.00 186.86 ? 82   HIS A CD2 1 
ATOM   621   C  CE1 . HIS A  1  82   ? 19.754  -25.783  -79.361  1.00 191.41 ? 82   HIS A CE1 1 
ATOM   622   N  NE2 . HIS A  1  82   ? 21.051  -25.733  -79.604  1.00 190.15 ? 82   HIS A NE2 1 
ATOM   623   N  N   . PHE A  1  83   ? 17.688  -31.671  -79.754  1.00 174.05 ? 83   PHE A N   1 
ATOM   624   C  CA  . PHE A  1  83   ? 16.994  -32.818  -80.328  1.00 174.13 ? 83   PHE A CA  1 
ATOM   625   C  C   . PHE A  1  83   ? 16.950  -32.729  -81.848  1.00 175.33 ? 83   PHE A C   1 
ATOM   626   O  O   . PHE A  1  83   ? 17.064  -31.644  -82.419  1.00 177.65 ? 83   PHE A O   1 
ATOM   627   C  CB  . PHE A  1  83   ? 15.575  -32.923  -79.764  1.00 175.52 ? 83   PHE A CB  1 
ATOM   628   C  CG  . PHE A  1  83   ? 15.446  -33.897  -78.629  1.00 177.42 ? 83   PHE A CG  1 
ATOM   629   C  CD1 . PHE A  1  83   ? 16.040  -33.639  -77.406  1.00 176.13 ? 83   PHE A CD1 1 
ATOM   630   C  CD2 . PHE A  1  83   ? 14.728  -35.072  -78.785  1.00 179.83 ? 83   PHE A CD2 1 
ATOM   631   C  CE1 . PHE A  1  83   ? 15.920  -34.533  -76.358  1.00 176.14 ? 83   PHE A CE1 1 
ATOM   632   C  CE2 . PHE A  1  83   ? 14.606  -35.970  -77.741  1.00 179.78 ? 83   PHE A CE2 1 
ATOM   633   C  CZ  . PHE A  1  83   ? 15.204  -35.701  -76.526  1.00 178.58 ? 83   PHE A CZ  1 
ATOM   634   N  N   . GLY A  1  84   ? 16.784  -33.876  -82.500  1.00 266.87 ? 84   GLY A N   1 
ATOM   635   C  CA  . GLY A  1  84   ? 16.727  -33.928  -83.949  1.00 267.06 ? 84   GLY A CA  1 
ATOM   636   C  C   . GLY A  1  84   ? 15.960  -35.132  -84.459  1.00 269.30 ? 84   GLY A C   1 
ATOM   637   O  O   . GLY A  1  84   ? 15.972  -36.196  -83.840  1.00 267.81 ? 84   GLY A O   1 
ATOM   638   N  N   . HIS A  1  85   ? 15.290  -34.961  -85.594  1.00 237.63 ? 85   HIS A N   1 
ATOM   639   C  CA  . HIS A  1  85   ? 14.514  -36.039  -86.195  1.00 241.85 ? 85   HIS A CA  1 
ATOM   640   C  C   . HIS A  1  85   ? 15.405  -36.979  -86.998  1.00 243.45 ? 85   HIS A C   1 
ATOM   641   O  O   . HIS A  1  85   ? 16.513  -36.614  -87.390  1.00 240.65 ? 85   HIS A O   1 
ATOM   642   C  CB  . HIS A  1  85   ? 13.409  -35.471  -87.088  1.00 243.38 ? 85   HIS A CB  1 
ATOM   643   C  CG  . HIS A  1  85   ? 13.795  -35.359  -88.530  1.00 240.35 ? 85   HIS A CG  1 
ATOM   644   N  ND1 . HIS A  1  85   ? 12.985  -35.797  -89.554  1.00 241.72 ? 85   HIS A ND1 1 
ATOM   645   C  CD2 . HIS A  1  85   ? 14.907  -34.858  -89.119  1.00 237.24 ? 85   HIS A CD2 1 
ATOM   646   C  CE1 . HIS A  1  85   ? 13.579  -35.572  -90.712  1.00 240.78 ? 85   HIS A CE1 1 
ATOM   647   N  NE2 . HIS A  1  85   ? 14.747  -35.003  -90.476  1.00 238.57 ? 85   HIS A NE2 1 
ATOM   648   N  N   . ILE A  1  86   ? 14.916  -38.191  -87.239  1.00 180.11 ? 86   ILE A N   1 
ATOM   649   C  CA  . ILE A  1  86   ? 15.667  -39.184  -87.996  1.00 185.08 ? 86   ILE A CA  1 
ATOM   650   C  C   . ILE A  1  86   ? 14.802  -39.825  -89.076  1.00 191.86 ? 86   ILE A C   1 
ATOM   651   O  O   . ILE A  1  86   ? 14.719  -41.049  -89.172  1.00 195.64 ? 86   ILE A O   1 
ATOM   652   C  CB  . ILE A  1  86   ? 16.228  -40.286  -87.079  1.00 185.29 ? 86   ILE A CB  1 
ATOM   653   C  CG1 . ILE A  1  86   ? 17.387  -41.012  -87.765  1.00 185.90 ? 86   ILE A CG1 1 
ATOM   654   C  CG2 . ILE A  1  86   ? 15.132  -41.268  -86.694  1.00 189.19 ? 86   ILE A CG2 1 
ATOM   655   C  CD1 . ILE A  1  86   ? 17.123  -42.480  -88.020  1.00 190.42 ? 86   ILE A CD1 1 
ATOM   656   N  N   . GLU A  1  87   ? 14.159  -38.990  -89.886  1.00 483.03 ? 87   GLU A N   1 
ATOM   657   C  CA  . GLU A  1  87   ? 13.299  -39.475  -90.959  1.00 489.45 ? 87   GLU A CA  1 
ATOM   658   C  C   . GLU A  1  87   ? 12.754  -40.864  -90.645  1.00 493.54 ? 87   GLU A C   1 
ATOM   659   O  O   . GLU A  1  87   ? 12.399  -41.159  -89.505  1.00 494.80 ? 87   GLU A O   1 
ATOM   660   C  CB  . GLU A  1  87   ? 14.060  -39.495  -92.287  1.00 419.12 ? 87   GLU A CB  1 
ATOM   661   C  CG  . GLU A  1  87   ? 15.516  -39.911  -92.161  1.00 416.37 ? 87   GLU A CG  1 
ATOM   662   C  CD  . GLU A  1  87   ? 15.703  -41.412  -92.257  1.00 418.82 ? 87   GLU A CD  1 
ATOM   663   O  OE1 . GLU A  1  87   ? 15.139  -42.138  -91.412  1.00 420.96 ? 87   GLU A OE1 1 
ATOM   664   O  OE2 . GLU A  1  87   ? 16.415  -41.866  -93.177  1.00 419.11 ? 87   GLU A OE2 1 
ATOM   665   N  N   . LEU A  1  88   ? 12.693  -41.714  -91.665  1.00 244.36 ? 88   LEU A N   1 
ATOM   666   C  CA  . LEU A  1  88   ? 12.191  -43.073  -91.501  1.00 249.22 ? 88   LEU A CA  1 
ATOM   667   C  C   . LEU A  1  88   ? 11.774  -43.673  -92.840  1.00 253.22 ? 88   LEU A C   1 
ATOM   668   O  O   . LEU A  1  88   ? 12.560  -44.354  -93.498  1.00 253.34 ? 88   LEU A O   1 
ATOM   669   C  CB  . LEU A  1  88   ? 11.013  -43.096  -90.524  1.00 252.74 ? 88   LEU A CB  1 
ATOM   670   C  CG  . LEU A  1  88   ? 11.355  -43.347  -89.054  1.00 251.51 ? 88   LEU A CG  1 
ATOM   671   C  CD1 . LEU A  1  88   ? 10.584  -44.543  -88.520  1.00 258.13 ? 88   LEU A CD1 1 
ATOM   672   C  CD2 . LEU A  1  88   ? 12.853  -43.548  -88.879  1.00 247.75 ? 88   LEU A CD2 1 
ATOM   673   N  N   . ALA A  1  89   ? 10.533  -43.414  -93.236  1.00 238.94 ? 89   ALA A N   1 
ATOM   674   C  CA  . ALA A  1  89   ? 10.009  -43.924  -94.498  1.00 243.31 ? 89   ALA A CA  1 
ATOM   675   C  C   . ALA A  1  89   ? 9.929   -45.447  -94.488  1.00 249.32 ? 89   ALA A C   1 
ATOM   676   O  O   . ALA A  1  89   ? 10.029  -46.092  -95.532  1.00 252.13 ? 89   ALA A O   1 
ATOM   677   C  CB  . ALA A  1  89   ? 10.864  -43.444  -95.660  1.00 239.17 ? 89   ALA A CB  1 
ATOM   678   N  N   . LYS A  1  90   ? 9.745   -46.016  -93.301  1.00 262.66 ? 90   LYS A N   1 
ATOM   679   C  CA  . LYS A  1  90   ? 9.650   -47.464  -93.152  1.00 238.23 ? 90   LYS A CA  1 
ATOM   680   C  C   . LYS A  1  90   ? 8.824   -47.839  -91.926  1.00 238.31 ? 90   LYS A C   1 
ATOM   681   O  O   . LYS A  1  90   ? 9.350   -48.379  -90.953  1.00 260.73 ? 90   LYS A O   1 
ATOM   682   C  CB  . LYS A  1  90   ? 11.044  -48.086  -93.058  1.00 206.52 ? 90   LYS A CB  1 
ATOM   683   C  CG  . LYS A  1  90   ? 11.749  -48.235  -94.396  1.00 197.65 ? 90   LYS A CG  1 
ATOM   684   C  CD  . LYS A  1  90   ? 11.477  -49.598  -95.014  1.00 215.57 ? 90   LYS A CD  1 
ATOM   685   C  CE  . LYS A  1  90   ? 11.582  -50.705  -93.977  1.00 219.26 ? 90   LYS A CE  1 
ATOM   686   N  NZ  . LYS A  1  90   ? 12.994  -50.957  -93.575  1.00 209.57 ? 90   LYS A NZ  1 
ATOM   687   N  N   . PRO A  1  91   ? 7.529   -47.549  -91.980  1.00 198.63 ? 91   PRO A N   1 
ATOM   688   C  CA  . PRO A  1  91   ? 6.623   -47.856  -90.868  1.00 199.30 ? 91   PRO A CA  1 
ATOM   689   C  C   . PRO A  1  91   ? 7.306   -48.697  -89.795  1.00 186.08 ? 91   PRO A C   1 
ATOM   690   O  O   . PRO A  1  91   ? 7.600   -49.870  -90.024  1.00 180.18 ? 91   PRO A O   1 
ATOM   691   C  CB  . PRO A  1  91   ? 5.512   -48.664  -91.541  1.00 236.93 ? 91   PRO A CB  1 
ATOM   692   C  CG  . PRO A  1  91   ? 5.500   -48.178  -92.946  1.00 246.68 ? 91   PRO A CG  1 
ATOM   693   C  CD  . PRO A  1  91   ? 6.931   -47.870  -93.288  1.00 225.42 ? 91   PRO A CD  1 
ATOM   694   N  N   . VAL A  1  92   ? 7.553   -48.096  -88.635  1.00 224.38 ? 92   VAL A N   1 
ATOM   695   C  CA  . VAL A  1  92   ? 8.198   -48.797  -87.531  1.00 232.18 ? 92   VAL A CA  1 
ATOM   696   C  C   . VAL A  1  92   ? 7.227   -49.021  -86.377  1.00 220.03 ? 92   VAL A C   1 
ATOM   697   O  O   . VAL A  1  92   ? 6.262   -48.272  -86.211  1.00 216.05 ? 92   VAL A O   1 
ATOM   698   C  CB  . VAL A  1  92   ? 9.427   -48.025  -87.015  1.00 244.65 ? 92   VAL A CB  1 
ATOM   699   C  CG1 . VAL A  1  92   ? 10.477  -47.907  -88.107  1.00 256.30 ? 92   VAL A CG1 1 
ATOM   700   C  CG2 . VAL A  1  92   ? 9.014   -46.651  -86.510  1.00 233.97 ? 92   VAL A CG2 1 
ATOM   701   N  N   . PHE A  1  93   ? 7.488   -50.052  -85.581  1.00 151.19 ? 93   PHE A N   1 
ATOM   702   C  CA  . PHE A  1  93   ? 6.636   -50.375  -84.442  1.00 190.49 ? 93   PHE A CA  1 
ATOM   703   C  C   . PHE A  1  93   ? 7.011   -49.546  -83.219  1.00 224.67 ? 93   PHE A C   1 
ATOM   704   O  O   . PHE A  1  93   ? 7.783   -48.589  -83.319  1.00 230.53 ? 93   PHE A O   1 
ATOM   705   C  CB  . PHE A  1  93   ? 6.725   -51.867  -84.114  1.00 207.91 ? 93   PHE A CB  1 
ATOM   706   C  CG  . PHE A  1  93   ? 5.854   -52.731  -84.978  1.00 283.64 ? 93   PHE A CG  1 
ATOM   707   C  CD1 . PHE A  1  93   ? 4.547   -53.005  -84.615  1.00 313.71 ? 93   PHE A CD1 1 
ATOM   708   C  CD2 . PHE A  1  93   ? 6.342   -53.273  -86.157  1.00 312.40 ? 93   PHE A CD2 1 
ATOM   709   C  CE1 . PHE A  1  93   ? 3.742   -53.801  -85.408  1.00 349.55 ? 93   PHE A CE1 1 
ATOM   710   C  CE2 . PHE A  1  93   ? 5.542   -54.068  -86.953  1.00 342.32 ? 93   PHE A CE2 1 
ATOM   711   C  CZ  . PHE A  1  93   ? 4.241   -54.333  -86.579  1.00 357.28 ? 93   PHE A CZ  1 
ATOM   712   N  N   . HIS A  1  94   ? 6.463   -49.918  -82.067  1.00 361.35 ? 94   HIS A N   1 
ATOM   713   C  CA  . HIS A  1  94   ? 6.742   -49.209  -80.823  1.00 320.35 ? 94   HIS A CA  1 
ATOM   714   C  C   . HIS A  1  94   ? 6.233   -49.988  -79.617  1.00 297.36 ? 94   HIS A C   1 
ATOM   715   O  O   . HIS A  1  94   ? 5.113   -49.774  -79.155  1.00 292.37 ? 94   HIS A O   1 
ATOM   716   C  CB  . HIS A  1  94   ? 6.115   -47.813  -80.852  1.00 293.48 ? 94   HIS A CB  1 
ATOM   717   C  CG  . HIS A  1  94   ? 6.629   -46.898  -79.785  1.00 250.99 ? 94   HIS A CG  1 
ATOM   718   N  ND1 . HIS A  1  94   ? 7.960   -46.554  -79.677  1.00 231.98 ? 94   HIS A ND1 1 
ATOM   719   C  CD2 . HIS A  1  94   ? 5.991   -46.257  -78.775  1.00 215.69 ? 94   HIS A CD2 1 
ATOM   720   C  CE1 . HIS A  1  94   ? 8.121   -45.741  -78.648  1.00 188.05 ? 94   HIS A CE1 1 
ATOM   721   N  NE2 . HIS A  1  94   ? 6.943   -45.543  -78.086  1.00 185.42 ? 94   HIS A NE2 1 
ATOM   722   N  N   . ILE A  1  95   ? 7.063   -50.894  -79.109  1.00 311.06 ? 95   ILE A N   1 
ATOM   723   C  CA  . ILE A  1  95   ? 6.698   -51.705  -77.954  1.00 325.17 ? 95   ILE A CA  1 
ATOM   724   C  C   . ILE A  1  95   ? 5.729   -50.957  -77.041  1.00 326.11 ? 95   ILE A C   1 
ATOM   725   O  O   . ILE A  1  95   ? 4.516   -51.011  -77.237  1.00 341.60 ? 95   ILE A O   1 
ATOM   726   C  CB  . ILE A  1  95   ? 7.941   -52.113  -77.140  1.00 317.42 ? 95   ILE A CB  1 
ATOM   727   C  CG1 . ILE A  1  95   ? 8.937   -52.867  -78.024  1.00 311.95 ? 95   ILE A CG1 1 
ATOM   728   C  CG2 . ILE A  1  95   ? 7.538   -52.962  -75.943  1.00 336.51 ? 95   ILE A CG2 1 
ATOM   729   C  CD1 . ILE A  1  95   ? 8.373   -54.121  -78.648  1.00 303.44 ? 95   ILE A CD1 1 
ATOM   730   N  N   . GLY A  1  96   ? 6.274   -50.266  -76.046  1.00 137.32 ? 96   GLY A N   1 
ATOM   731   C  CA  . GLY A  1  96   ? 5.462   -49.514  -75.107  1.00 137.29 ? 96   GLY A CA  1 
ATOM   732   C  C   . GLY A  1  96   ? 4.119   -49.123  -75.692  1.00 148.20 ? 96   GLY A C   1 
ATOM   733   O  O   . GLY A  1  96   ? 3.163   -49.906  -75.653  1.00 169.83 ? 96   GLY A O   1 
ATOM   734   N  N   . PHE A  1  97   ? 4.040   -47.914  -76.232  1.00 258.48 ? 97   PHE A N   1 
ATOM   735   C  CA  . PHE A  1  97   ? 2.805   -47.418  -76.825  1.00 268.21 ? 97   PHE A CA  1 
ATOM   736   C  C   . PHE A  1  97   ? 2.141   -48.490  -77.684  1.00 288.85 ? 97   PHE A C   1 
ATOM   737   O  O   . PHE A  1  97   ? 0.939   -48.434  -77.946  1.00 305.14 ? 97   PHE A O   1 
ATOM   738   C  CB  . PHE A  1  97   ? 3.078   -46.167  -77.664  1.00 252.34 ? 97   PHE A CB  1 
ATOM   739   C  CG  . PHE A  1  97   ? 3.508   -44.978  -76.855  1.00 236.02 ? 97   PHE A CG  1 
ATOM   740   C  CD1 . PHE A  1  97   ? 2.608   -43.977  -76.539  1.00 237.99 ? 97   PHE A CD1 1 
ATOM   741   C  CD2 . PHE A  1  97   ? 4.816   -44.864  -76.411  1.00 220.14 ? 97   PHE A CD2 1 
ATOM   742   C  CE1 . PHE A  1  97   ? 3.000   -42.882  -75.793  1.00 224.31 ? 97   PHE A CE1 1 
ATOM   743   C  CE2 . PHE A  1  97   ? 5.214   -43.771  -75.667  1.00 206.68 ? 97   PHE A CE2 1 
ATOM   744   C  CZ  . PHE A  1  97   ? 4.306   -42.778  -75.355  1.00 208.67 ? 97   PHE A CZ  1 
ATOM   745   N  N   . LEU A  1  98   ? 2.932   -49.464  -78.122  1.00 456.61 ? 98   LEU A N   1 
ATOM   746   C  CA  . LEU A  1  98   ? 2.424   -50.552  -78.948  1.00 477.98 ? 98   LEU A CA  1 
ATOM   747   C  C   . LEU A  1  98   ? 1.369   -51.362  -78.202  1.00 503.99 ? 98   LEU A C   1 
ATOM   748   O  O   . LEU A  1  98   ? 0.308   -51.670  -78.743  1.00 524.18 ? 98   LEU A O   1 
ATOM   749   C  CB  . LEU A  1  98   ? 3.565   -51.461  -79.401  1.00 475.09 ? 98   LEU A CB  1 
ATOM   750   C  CG  . LEU A  1  98   ? 4.193   -51.140  -80.761  1.00 462.79 ? 98   LEU A CG  1 
ATOM   751   C  CD1 . LEU A  1  98   ? 5.107   -52.269  -81.212  1.00 467.13 ? 98   LEU A CD1 1 
ATOM   752   C  CD2 . LEU A  1  98   ? 3.119   -50.865  -81.797  1.00 473.40 ? 98   LEU A CD2 1 
ATOM   753   N  N   . SER A  1  99   ? 1.671   -51.702  -76.955  1.00 207.20 ? 99   SER A N   1 
ATOM   754   C  CA  . SER A  1  99   ? 0.753   -52.479  -76.129  1.00 232.10 ? 99   SER A CA  1 
ATOM   755   C  C   . SER A  1  99   ? -0.646  -51.872  -76.137  1.00 243.82 ? 99   SER A C   1 
ATOM   756   O  O   . SER A  1  99   ? -1.635  -52.569  -76.368  1.00 270.74 ? 99   SER A O   1 
ATOM   757   C  CB  . SER A  1  99   ? 1.274   -52.578  -74.693  1.00 225.93 ? 99   SER A CB  1 
ATOM   758   O  OG  . SER A  1  99   ? 1.214   -51.324  -74.042  1.00 208.77 ? 99   SER A OG  1 
ATOM   759   N  N   . LYS A  1  100  ? -0.720  -50.569  -75.885  1.00 182.92 ? 100  LYS A N   1 
ATOM   760   C  CA  . LYS A  1  100  ? -1.999  -49.866  -75.862  1.00 194.58 ? 100  LYS A CA  1 
ATOM   761   C  C   . LYS A  1  100  ? -2.705  -49.960  -77.209  1.00 208.02 ? 100  LYS A C   1 
ATOM   762   O  O   . LYS A  1  100  ? -3.848  -50.412  -77.290  1.00 233.40 ? 100  LYS A O   1 
ATOM   763   C  CB  . LYS A  1  100  ? -1.796  -48.398  -75.476  1.00 172.40 ? 100  LYS A CB  1 
ATOM   764   C  CG  . LYS A  1  100  ? -3.080  -47.590  -75.414  1.00 184.47 ? 100  LYS A CG  1 
ATOM   765   C  CD  . LYS A  1  100  ? -2.820  -46.179  -74.913  1.00 163.47 ? 100  LYS A CD  1 
ATOM   766   C  CE  . LYS A  1  100  ? -4.110  -45.378  -74.823  1.00 176.99 ? 100  LYS A CE  1 
ATOM   767   N  NZ  . LYS A  1  100  ? -3.861  -43.972  -74.399  1.00 158.19 ? 100  LYS A NZ  1 
ATOM   768   N  N   . ILE A  1  101  ? -2.019  -49.533  -78.264  1.00 182.63 ? 101  ILE A N   1 
ATOM   769   C  CA  . ILE A  1  101  ? -2.582  -49.569  -79.609  1.00 192.95 ? 101  ILE A CA  1 
ATOM   770   C  C   . ILE A  1  101  ? -3.183  -50.935  -79.921  1.00 222.09 ? 101  ILE A C   1 
ATOM   771   O  O   . ILE A  1  101  ? -4.199  -51.034  -80.604  1.00 243.00 ? 101  ILE A O   1 
ATOM   772   C  CB  . ILE A  1  101  ? -1.520  -49.232  -80.672  1.00 170.87 ? 101  ILE A CB  1 
ATOM   773   C  CG1 . ILE A  1  101  ? -2.177  -49.008  -82.033  1.00 148.57 ? 101  ILE A CG1 1 
ATOM   774   C  CG2 . ILE A  1  101  ? -0.479  -50.340  -80.754  1.00 183.30 ? 101  ILE A CG2 1 
ATOM   775   C  CD1 . ILE A  1  101  ? -3.071  -47.790  -82.089  1.00 128.03 ? 101  ILE A CD1 1 
ATOM   776   N  N   . LYS A  1  102  ? -2.549  -51.986  -79.410  1.00 377.78 ? 102  LYS A N   1 
ATOM   777   C  CA  . LYS A  1  102  ? -3.019  -53.349  -79.632  1.00 406.59 ? 102  LYS A CA  1 
ATOM   778   C  C   . LYS A  1  102  ? -4.324  -53.608  -78.887  1.00 434.78 ? 102  LYS A C   1 
ATOM   779   O  O   . LYS A  1  102  ? -5.251  -54.211  -79.431  1.00 462.05 ? 102  LYS A O   1 
ATOM   780   C  CB  . LYS A  1  102  ? -1.957  -54.359  -79.202  1.00 403.40 ? 102  LYS A CB  1 
ATOM   781   C  CG  . LYS A  1  102  ? -0.697  -54.337  -80.053  1.00 383.53 ? 102  LYS A CG  1 
ATOM   782   C  CD  . LYS A  1  102  ? 0.382   -55.235  -79.468  1.00 381.18 ? 102  LYS A CD  1 
ATOM   783   C  CE  . LYS A  1  102  ? 1.623   -55.253  -80.346  1.00 362.76 ? 102  LYS A CE  1 
ATOM   784   N  NZ  . LYS A  1  102  ? 2.658   -56.187  -79.825  1.00 362.95 ? 102  LYS A NZ  1 
ATOM   785   N  N   . LYS A  1  103  ? -4.389  -53.150  -77.641  1.00 208.30 ? 103  LYS A N   1 
ATOM   786   C  CA  . LYS A  1  103  ? -5.579  -53.332  -76.821  1.00 234.25 ? 103  LYS A CA  1 
ATOM   787   C  C   . LYS A  1  103  ? -6.799  -52.688  -77.468  1.00 247.64 ? 103  LYS A C   1 
ATOM   788   O  O   . LYS A  1  103  ? -7.884  -53.274  -77.495  1.00 273.24 ? 103  LYS A O   1 
ATOM   789   C  CB  . LYS A  1  103  ? -5.358  -52.754  -75.421  1.00 221.16 ? 103  LYS A CB  1 
ATOM   790   C  CG  . LYS A  1  103  ? -4.389  -53.553  -74.564  1.00 214.52 ? 103  LYS A CG  1 
ATOM   791   C  CD  . LYS A  1  103  ? -4.247  -52.945  -73.179  1.00 201.76 ? 103  LYS A CD  1 
ATOM   792   C  CE  . LYS A  1  103  ? -3.225  -53.702  -72.346  1.00 195.61 ? 103  LYS A CE  1 
ATOM   793   N  NZ  . LYS A  1  103  ? -3.053  -53.099  -70.996  1.00 182.76 ? 103  LYS A NZ  1 
ATOM   794   N  N   . ILE A  1  104  ? -6.619  -51.479  -77.987  1.00 159.69 ? 104  ILE A N   1 
ATOM   795   C  CA  . ILE A  1  104  ? -7.703  -50.751  -78.635  1.00 170.47 ? 104  ILE A CA  1 
ATOM   796   C  C   . ILE A  1  104  ? -8.470  -51.652  -79.600  1.00 197.69 ? 104  ILE A C   1 
ATOM   797   O  O   . ILE A  1  104  ? -9.635  -51.974  -79.370  1.00 220.71 ? 104  ILE A O   1 
ATOM   798   C  CB  . ILE A  1  104  ? -7.182  -49.522  -79.399  1.00 256.86 ? 104  ILE A CB  1 
ATOM   799   C  CG1 . ILE A  1  104  ? -6.816  -48.402  -78.422  1.00 233.08 ? 104  ILE A CG1 1 
ATOM   800   C  CG2 . ILE A  1  104  ? -8.218  -49.041  -80.405  1.00 156.52 ? 104  ILE A CG2 1 
ATOM   801   C  CD1 . ILE A  1  104  ? -6.360  -47.126  -79.096  1.00 208.54 ? 104  ILE A CD1 1 
ATOM   802   N  N   . LEU A  1  105  ? -7.807  -52.052  -80.680  1.00 265.34 ? 105  LEU A N   1 
ATOM   803   C  CA  . LEU A  1  105  ? -8.423  -52.915  -81.680  1.00 280.62 ? 105  LEU A CA  1 
ATOM   804   C  C   . LEU A  1  105  ? -9.918  -53.075  -81.425  1.00 299.24 ? 105  LEU A C   1 
ATOM   805   O  O   . LEU A  1  105  ? -10.332 -53.883  -80.594  1.00 311.26 ? 105  LEU A O   1 
ATOM   806   C  CB  . LEU A  1  105  ? -7.744  -54.286  -81.699  1.00 177.08 ? 105  LEU A CB  1 
ATOM   807   C  CG  . LEU A  1  105  ? -6.278  -54.309  -82.138  1.00 164.81 ? 105  LEU A CG  1 
ATOM   808   C  CD1 . LEU A  1  105  ? -5.687  -55.700  -81.970  1.00 173.85 ? 105  LEU A CD1 1 
ATOM   809   C  CD2 . LEU A  1  105  ? -6.138  -53.832  -83.576  1.00 154.37 ? 105  LEU A CD2 1 
ATOM   810   N  N   . GLU A  1  106  ? -10.724 -52.301  -82.146  1.00 380.21 ? 106  GLU A N   1 
ATOM   811   C  CA  . GLU A  1  106  ? -12.174 -52.358  -82.000  1.00 395.80 ? 106  GLU A CA  1 
ATOM   812   C  C   . GLU A  1  106  ? -12.727 -51.038  -81.475  1.00 394.97 ? 106  GLU A C   1 
ATOM   813   O  O   . GLU A  1  106  ? -13.812 -50.996  -80.896  1.00 401.96 ? 106  GLU A O   1 
ATOM   814   C  CB  . GLU A  1  106  ? -12.573 -53.503  -81.068  1.00 402.48 ? 106  GLU A CB  1 
ATOM   815   C  CG  . GLU A  1  106  ? -13.212 -54.686  -81.777  1.00 411.07 ? 106  GLU A CG  1 
ATOM   816   C  CD  . GLU A  1  106  ? -12.489 -55.990  -81.503  1.00 418.55 ? 106  GLU A CD  1 
ATOM   817   O  OE1 . GLU A  1  106  ? -12.417 -56.395  -80.323  1.00 421.66 ? 106  GLU A OE1 1 
ATOM   818   O  OE2 . GLU A  1  106  ? -11.994 -56.612  -82.466  1.00 422.12 ? 106  GLU A OE2 1 
ATOM   819   N  N   . CYS A  1  107  ? -11.977 -49.962  -81.683  1.00 574.24 ? 107  CYS A N   1 
ATOM   820   C  CA  . CYS A  1  107  ? -12.392 -48.638  -81.232  1.00 570.45 ? 107  CYS A CA  1 
ATOM   821   C  C   . CYS A  1  107  ? -12.795 -47.758  -82.410  1.00 569.07 ? 107  CYS A C   1 
ATOM   822   O  O   . CYS A  1  107  ? -13.120 -46.583  -82.236  1.00 564.79 ? 107  CYS A O   1 
ATOM   823   C  CB  . CYS A  1  107  ? -11.271 -47.968  -80.434  1.00 558.59 ? 107  CYS A CB  1 
ATOM   824   S  SG  . CYS A  1  107  ? -11.140 -48.526  -78.718  1.00 560.12 ? 107  CYS A SG  1 
ATOM   825   N  N   . VAL A  1  108  ? -12.773 -48.333  -83.608  1.00 413.06 ? 108  VAL A N   1 
ATOM   826   C  CA  . VAL A  1  108  ? -13.137 -47.601  -84.816  1.00 415.62 ? 108  VAL A CA  1 
ATOM   827   C  C   . VAL A  1  108  ? -13.397 -48.552  -85.978  1.00 426.06 ? 108  VAL A C   1 
ATOM   828   O  O   . VAL A  1  108  ? -14.070 -48.195  -86.946  1.00 430.58 ? 108  VAL A O   1 
ATOM   829   C  CB  . VAL A  1  108  ? -12.040 -46.599  -85.221  1.00 397.52 ? 108  VAL A CB  1 
ATOM   830   C  CG1 . VAL A  1  108  ? -12.421 -45.887  -86.510  1.00 397.63 ? 108  VAL A CG1 1 
ATOM   831   C  CG2 . VAL A  1  108  ? -11.797 -45.597  -84.102  1.00 392.45 ? 108  VAL A CG2 1 
ATOM   832   N  N   . CYS A  1  109  ? -12.861 -49.764  -85.876  1.00 371.39 ? 109  CYS A N   1 
ATOM   833   C  CA  . CYS A  1  109  ? -13.035 -50.769  -86.919  1.00 381.54 ? 109  CYS A CA  1 
ATOM   834   C  C   . CYS A  1  109  ? -12.378 -50.329  -88.224  1.00 371.06 ? 109  CYS A C   1 
ATOM   835   O  O   . CYS A  1  109  ? -12.487 -49.171  -88.625  1.00 362.17 ? 109  CYS A O   1 
ATOM   836   C  CB  . CYS A  1  109  ? -14.521 -51.053  -87.149  1.00 401.23 ? 109  CYS A CB  1 
ATOM   837   S  SG  . CYS A  1  109  ? -15.310 -49.968  -88.361  1.00 405.74 ? 109  CYS A SG  1 
ATOM   838   N  N   . TRP A  1  110  ? -11.697 -51.262  -88.880  1.00 338.83 ? 110  TRP A N   1 
ATOM   839   C  CA  . TRP A  1  110  ? -11.021 -50.973  -90.141  1.00 330.58 ? 110  TRP A CA  1 
ATOM   840   C  C   . TRP A  1  110  ? -11.949 -51.200  -91.328  1.00 344.07 ? 110  TRP A C   1 
ATOM   841   O  O   . TRP A  1  110  ? -12.655 -52.207  -91.393  1.00 359.66 ? 110  TRP A O   1 
ATOM   842   C  CB  . TRP A  1  110  ? -9.763  -51.831  -90.283  1.00 193.96 ? 110  TRP A CB  1 
ATOM   843   C  CG  . TRP A  1  110  ? -10.049 -53.296  -90.417  1.00 208.82 ? 110  TRP A CG  1 
ATOM   844   C  CD1 . TRP A  1  110  ? -10.190 -54.001  -91.578  1.00 217.20 ? 110  TRP A CD1 1 
ATOM   845   C  CD2 . TRP A  1  110  ? -10.230 -54.238  -89.352  1.00 217.88 ? 110  TRP A CD2 1 
ATOM   846   N  NE1 . TRP A  1  110  ? -10.446 -55.321  -91.301  1.00 231.36 ? 110  TRP A NE1 1 
ATOM   847   C  CE2 . TRP A  1  110  ? -10.476 -55.494  -89.942  1.00 232.10 ? 110  TRP A CE2 1 
ATOM   848   C  CE3 . TRP A  1  110  ? -10.208 -54.140  -87.958  1.00 215.75 ? 110  TRP A CE3 1 
ATOM   849   C  CZ2 . TRP A  1  110  ? -10.699 -56.643  -89.185  1.00 244.17 ? 110  TRP A CZ2 1 
ATOM   850   C  CZ3 . TRP A  1  110  ? -10.427 -55.281  -87.208  1.00 227.62 ? 110  TRP A CZ3 1 
ATOM   851   C  CH2 . TRP A  1  110  ? -10.670 -56.516  -87.824  1.00 241.40 ? 110  TRP A CH2 1 
ATOM   852   N  N   . ASN A  1  111  ? -11.942 -50.259  -92.267  1.00 425.39 ? 111  ASN A N   1 
ATOM   853   C  CA  . ASN A  1  111  ? -11.095 -49.077  -92.161  1.00 410.45 ? 111  ASN A CA  1 
ATOM   854   C  C   . ASN A  1  111  ? -11.910 -47.795  -92.023  1.00 409.39 ? 111  ASN A C   1 
ATOM   855   O  O   . ASN A  1  111  ? -11.360 -46.723  -91.771  1.00 395.99 ? 111  ASN A O   1 
ATOM   856   C  CB  . ASN A  1  111  ? -10.161 -48.979  -93.368  1.00 262.14 ? 111  ASN A CB  1 
ATOM   857   C  CG  . ASN A  1  111  ? -9.293  -47.736  -93.333  1.00 244.78 ? 111  ASN A CG  1 
ATOM   858   O  OD1 . ASN A  1  111  ? -9.012  -47.192  -92.266  1.00 238.69 ? 111  ASN A OD1 1 
ATOM   859   N  ND2 . ASN A  1  111  ? -8.862  -47.282  -94.504  1.00 237.24 ? 111  ASN A ND2 1 
ATOM   860   N  N   . CYS A  1  112  ? -13.223 -47.913  -92.190  1.00 288.46 ? 112  CYS A N   1 
ATOM   861   C  CA  . CYS A  1  112  ? -14.116 -46.765  -92.083  1.00 289.75 ? 112  CYS A CA  1 
ATOM   862   C  C   . CYS A  1  112  ? -13.719 -45.866  -90.918  1.00 278.78 ? 112  CYS A C   1 
ATOM   863   O  O   . CYS A  1  112  ? -13.935 -44.656  -90.953  1.00 274.77 ? 112  CYS A O   1 
ATOM   864   C  CB  . CYS A  1  112  ? -15.566 -47.226  -91.924  1.00 308.45 ? 112  CYS A CB  1 
ATOM   865   S  SG  . CYS A  1  112  ? -16.058 -47.563  -90.218  1.00 314.26 ? 112  CYS A SG  1 
ATOM   866   N  N   . GLY A  1  113  ? -13.139 -46.467  -89.884  1.00 465.22 ? 113  GLY A N   1 
ATOM   867   C  CA  . GLY A  1  113  ? -12.714 -45.727  -88.712  1.00 454.48 ? 113  GLY A CA  1 
ATOM   868   C  C   . GLY A  1  113  ? -13.853 -44.967  -88.057  1.00 461.29 ? 113  GLY A C   1 
ATOM   869   O  O   . GLY A  1  113  ? -13.911 -43.739  -88.122  1.00 454.84 ? 113  GLY A O   1 
ATOM   870   N  N   . LYS A  1  114  ? -14.761 -45.706  -87.427  1.00 211.93 ? 114  LYS A N   1 
ATOM   871   C  CA  . LYS A  1  114  ? -15.906 -45.101  -86.757  1.00 221.30 ? 114  LYS A CA  1 
ATOM   872   C  C   . LYS A  1  114  ? -16.258 -45.857  -85.479  1.00 229.81 ? 114  LYS A C   1 
ATOM   873   O  O   . LYS A  1  114  ? -16.558 -47.050  -85.515  1.00 240.78 ? 114  LYS A O   1 
ATOM   874   C  CB  . LYS A  1  114  ? -17.115 -45.059  -87.695  1.00 235.59 ? 114  LYS A CB  1 
ATOM   875   C  CG  . LYS A  1  114  ? -18.419 -44.678  -87.012  1.00 249.22 ? 114  LYS A CG  1 
ATOM   876   C  CD  . LYS A  1  114  ? -19.147 -43.589  -87.781  1.00 253.24 ? 114  LYS A CD  1 
ATOM   877   C  CE  . LYS A  1  114  ? -20.162 -42.878  -86.902  1.00 261.36 ? 114  LYS A CE  1 
ATOM   878   N  NZ  . LYS A  1  114  ? -21.446 -42.636  -87.619  1.00 272.85 ? 114  LYS A NZ  1 
ATOM   879   N  N   . LEU A  1  115  ? -16.224 -45.153  -84.353  1.00 197.72 ? 115  LEU A N   1 
ATOM   880   C  CA  . LEU A  1  115  ? -16.536 -45.754  -83.062  1.00 213.65 ? 115  LEU A CA  1 
ATOM   881   C  C   . LEU A  1  115  ? -17.406 -46.995  -83.231  1.00 253.55 ? 115  LEU A C   1 
ATOM   882   O  O   . LEU A  1  115  ? -18.328 -47.017  -84.046  1.00 280.73 ? 115  LEU A O   1 
ATOM   883   C  CB  . LEU A  1  115  ? -17.240 -44.742  -82.157  1.00 221.78 ? 115  LEU A CB  1 
ATOM   884   C  CG  . LEU A  1  115  ? -16.373 -43.597  -81.622  1.00 183.87 ? 115  LEU A CG  1 
ATOM   885   C  CD1 . LEU A  1  115  ? -15.422 -43.098  -82.697  1.00 152.00 ? 115  LEU A CD1 1 
ATOM   886   C  CD2 . LEU A  1  115  ? -17.244 -42.465  -81.098  1.00 200.22 ? 115  LEU A CD2 1 
ATOM   887   N  N   . LYS A  1  116  ? -17.103 -48.033  -82.454  1.00 268.99 ? 116  LYS A N   1 
ATOM   888   C  CA  . LYS A  1  116  ? -17.857 -49.280  -82.517  1.00 303.69 ? 116  LYS A CA  1 
ATOM   889   C  C   . LYS A  1  116  ? -19.315 -49.066  -82.124  1.00 331.57 ? 116  LYS A C   1 
ATOM   890   O  O   . LYS A  1  116  ? -20.223 -49.316  -82.915  1.00 360.13 ? 116  LYS A O   1 
ATOM   891   C  CB  . LYS A  1  116  ? -17.217 -50.335  -81.612  1.00 295.97 ? 116  LYS A CB  1 
ATOM   892   C  CG  . LYS A  1  116  ? -17.000 -49.877  -80.181  1.00 275.90 ? 116  LYS A CG  1 
ATOM   893   C  CD  . LYS A  1  116  ? -15.809 -48.937  -80.077  1.00 262.78 ? 116  LYS A CD  1 
ATOM   894   C  CE  . LYS A  1  116  ? -15.591 -48.476  -78.645  1.00 241.44 ? 116  LYS A CE  1 
ATOM   895   N  NZ  . LYS A  1  116  ? -14.749 -47.251  -78.575  1.00 236.06 ? 116  LYS A NZ  1 
ATOM   896   N  N   . ILE A  1  117  ? -19.529 -48.600  -80.898  1.00 171.09 ? 117  ILE A N   1 
ATOM   897   C  CA  . ILE A  1  117  ? -20.875 -48.351  -80.398  1.00 196.52 ? 117  ILE A CA  1 
ATOM   898   C  C   . ILE A  1  117  ? -21.738 -47.670  -81.454  1.00 208.56 ? 117  ILE A C   1 
ATOM   899   O  O   . ILE A  1  117  ? -21.251 -47.297  -82.521  1.00 194.37 ? 117  ILE A O   1 
ATOM   900   C  CB  . ILE A  1  117  ? -20.855 -47.482  -79.127  1.00 183.60 ? 117  ILE A CB  1 
ATOM   901   C  CG1 . ILE A  1  117  ? -20.303 -48.280  -77.942  1.00 169.55 ? 117  ILE A CG1 1 
ATOM   902   C  CG2 . ILE A  1  117  ? -22.248 -46.956  -78.818  1.00 192.05 ? 117  ILE A CG2 1 
ATOM   903   C  CD1 . ILE A  1  117  ? -20.377 -49.779  -78.132  1.00 182.45 ? 117  ILE A CD1 1 
ATOM   904   N  N   . ASP A  1  118  ? -23.022 -47.511  -81.149  1.00 620.22 ? 118  ASP A N   1 
ATOM   905   C  CA  . ASP A  1  118  ? -23.954 -46.875  -82.074  1.00 620.51 ? 118  ASP A CA  1 
ATOM   906   C  C   . ASP A  1  118  ? -24.513 -45.581  -81.491  1.00 620.73 ? 118  ASP A C   1 
ATOM   907   O  O   . ASP A  1  118  ? -24.028 -44.492  -81.793  1.00 621.41 ? 118  ASP A O   1 
ATOM   908   C  CB  . ASP A  1  118  ? -25.096 -47.831  -82.424  1.00 619.87 ? 118  ASP A CB  1 
ATOM   909   C  CG  . ASP A  1  118  ? -24.647 -49.278  -82.482  1.00 619.36 ? 118  ASP A CG  1 
ATOM   910   O  OD1 . ASP A  1  118  ? -23.425 -49.526  -82.417  1.00 619.57 ? 118  ASP A OD1 1 
ATOM   911   O  OD2 . ASP A  1  118  ? -25.518 -50.169  -82.593  1.00 618.72 ? 118  ASP A OD2 1 
ATOM   912   N  N   . SER A  1  119  ? -25.539 -45.710  -80.656  1.00 222.01 ? 119  SER A N   1 
ATOM   913   C  CA  . SER A  1  119  ? -26.169 -44.552  -80.034  1.00 225.06 ? 119  SER A CA  1 
ATOM   914   C  C   . SER A  1  119  ? -26.849 -44.927  -78.719  1.00 237.78 ? 119  SER A C   1 
ATOM   915   O  O   . SER A  1  119  ? -27.026 -44.083  -77.841  1.00 242.51 ? 119  SER A O   1 
ATOM   916   C  CB  . SER A  1  119  ? -27.182 -43.917  -80.988  1.00 230.46 ? 119  SER A CB  1 
ATOM   917   O  OG  . SER A  1  119  ? -27.265 -42.518  -80.787  1.00 233.57 ? 119  SER A OG  1 
ATOM   918   N  N   . SER A  1  120  ? -27.228 -46.193  -78.593  1.00 605.64 ? 120  SER A N   1 
ATOM   919   C  CA  . SER A  1  120  ? -27.001 -47.173  -79.651  1.00 607.33 ? 120  SER A CA  1 
ATOM   920   C  C   . SER A  1  120  ? -28.138 -48.189  -79.723  1.00 615.05 ? 120  SER A C   1 
ATOM   921   O  O   . SER A  1  120  ? -29.014 -48.086  -80.584  1.00 615.56 ? 120  SER A O   1 
ATOM   922   C  CB  . SER A  1  120  ? -25.664 -47.887  -79.447  1.00 603.03 ? 120  SER A CB  1 
ATOM   923   O  OG  . SER A  1  120  ? -25.471 -48.896  -80.422  1.00 605.18 ? 120  SER A OG  1 
ATOM   924   N  N   . ASN A  1  121  ? -28.124 -49.165  -78.823  1.00 202.38 ? 121  ASN A N   1 
ATOM   925   C  CA  . ASN A  1  121  ? -27.079 -49.276  -77.808  1.00 196.27 ? 121  ASN A CA  1 
ATOM   926   C  C   . ASN A  1  121  ? -26.732 -47.934  -77.174  1.00 189.50 ? 121  ASN A C   1 
ATOM   927   O  O   . ASN A  1  121  ? -25.574 -47.515  -77.179  1.00 181.39 ? 121  ASN A O   1 
ATOM   928   C  CB  . ASN A  1  121  ? -25.823 -49.927  -78.396  1.00 191.32 ? 121  ASN A CB  1 
ATOM   929   C  CG  . ASN A  1  121  ? -26.147 -51.045  -79.366  1.00 197.56 ? 121  ASN A CG  1 
ATOM   930   O  OD1 . ASN A  1  121  ? -25.742 -52.189  -79.171  1.00 199.69 ? 121  ASN A OD1 1 
ATOM   931   N  ND2 . ASN A  1  121  ? -26.880 -50.717  -80.423  1.00 200.94 ? 121  ASN A ND2 1 
ATOM   932   N  N   . PRO A  1  122  ? -27.741 -47.266  -76.625  1.00 334.44 ? 122  PRO A N   1 
ATOM   933   C  CA  . PRO A  1  122  ? -27.546 -45.962  -75.984  1.00 329.14 ? 122  PRO A CA  1 
ATOM   934   C  C   . PRO A  1  122  ? -26.930 -46.100  -74.594  1.00 325.68 ? 122  PRO A C   1 
ATOM   935   O  O   . PRO A  1  122  ? -26.284 -45.170  -74.114  1.00 319.04 ? 122  PRO A O   1 
ATOM   936   C  CB  . PRO A  1  122  ? -28.969 -45.411  -75.877  1.00 336.20 ? 122  PRO A CB  1 
ATOM   937   C  CG  . PRO A  1  122  ? -29.828 -46.622  -75.804  1.00 345.12 ? 122  PRO A CG  1 
ATOM   938   C  CD  . PRO A  1  122  ? -29.161 -47.654  -76.670  1.00 344.37 ? 122  PRO A CD  1 
ATOM   939   N  N   . LYS A  1  123  ? -27.141 -47.249  -73.961  1.00 257.89 ? 123  LYS A N   1 
ATOM   940   C  CA  . LYS A  1  123  ? -26.604 -47.495  -72.627  1.00 255.81 ? 123  LYS A CA  1 
ATOM   941   C  C   . LYS A  1  123  ? -25.102 -47.750  -72.675  1.00 247.98 ? 123  LYS A C   1 
ATOM   942   O  O   . LYS A  1  123  ? -24.328 -47.102  -71.966  1.00 241.51 ? 123  LYS A O   1 
ATOM   943   C  CB  . LYS A  1  123  ? -27.317 -48.680  -71.973  1.00 264.67 ? 123  LYS A CB  1 
ATOM   944   C  CG  . LYS A  1  123  ? -27.215 -49.977  -72.759  1.00 268.88 ? 123  LYS A CG  1 
ATOM   945   C  CD  . LYS A  1  123  ? -27.377 -51.188  -71.853  1.00 275.54 ? 123  LYS A CD  1 
ATOM   946   C  CE  . LYS A  1  123  ? -28.489 -50.972  -70.840  1.00 282.01 ? 123  LYS A CE  1 
ATOM   947   N  NZ  . LYS A  1  123  ? -28.583 -52.097  -69.868  1.00 288.65 ? 123  LYS A NZ  1 
ATOM   948   N  N   . PHE A  1  124  ? -24.692 -48.695  -73.514  1.00 252.54 ? 124  PHE A N   1 
ATOM   949   C  CA  . PHE A  1  124  ? -23.281 -49.036  -73.658  1.00 245.91 ? 124  PHE A CA  1 
ATOM   950   C  C   . PHE A  1  124  ? -22.436 -47.788  -73.897  1.00 236.64 ? 124  PHE A C   1 
ATOM   951   O  O   . PHE A  1  124  ? -21.454 -47.547  -73.197  1.00 230.66 ? 124  PHE A O   1 
ATOM   952   C  CB  . PHE A  1  124  ? -23.085 -50.034  -74.799  1.00 248.41 ? 124  PHE A CB  1 
ATOM   953   C  CG  . PHE A  1  124  ? -23.827 -51.324  -74.612  1.00 257.88 ? 124  PHE A CG  1 
ATOM   954   C  CD1 . PHE A  1  124  ? -23.397 -52.260  -73.686  1.00 260.06 ? 124  PHE A CD1 1 
ATOM   955   C  CD2 . PHE A  1  124  ? -24.958 -51.603  -75.361  1.00 265.20 ? 124  PHE A CD2 1 
ATOM   956   C  CE1 . PHE A  1  124  ? -24.080 -53.448  -73.511  1.00 269.54 ? 124  PHE A CE1 1 
ATOM   957   C  CE2 . PHE A  1  124  ? -25.646 -52.790  -75.190  1.00 274.44 ? 124  PHE A CE2 1 
ATOM   958   C  CZ  . PHE A  1  124  ? -25.205 -53.713  -74.264  1.00 276.71 ? 124  PHE A CZ  1 
ATOM   959   N  N   . ASN A  1  125  ? -22.825 -46.999  -74.893  1.00 394.01 ? 125  ASN A N   1 
ATOM   960   C  CA  . ASN A  1  125  ? -22.106 -45.776  -75.228  1.00 386.34 ? 125  ASN A CA  1 
ATOM   961   C  C   . ASN A  1  125  ? -22.184 -44.739  -74.112  1.00 383.61 ? 125  ASN A C   1 
ATOM   962   O  O   . ASN A  1  125  ? -21.194 -44.077  -73.794  1.00 376.48 ? 125  ASN A O   1 
ATOM   963   C  CB  . ASN A  1  125  ? -22.634 -45.183  -76.535  1.00 387.87 ? 125  ASN A CB  1 
ATOM   964   C  CG  . ASN A  1  125  ? -21.741 -44.083  -77.079  1.00 380.45 ? 125  ASN A CG  1 
ATOM   965   O  OD1 . ASN A  1  125  ? -20.526 -44.102  -76.886  1.00 373.99 ? 125  ASN A OD1 1 
ATOM   966   N  ND2 . ASN A  1  125  ? -22.343 -43.118  -77.765  1.00 381.89 ? 125  ASN A ND2 1 
ATOM   967   N  N   . ASP A  1  126  ? -23.366 -44.605  -73.519  1.00 425.93 ? 126  ASP A N   1 
ATOM   968   C  CA  . ASP A  1  126  ? -23.574 -43.652  -72.437  1.00 424.40 ? 126  ASP A CA  1 
ATOM   969   C  C   . ASP A  1  126  ? -22.822 -44.071  -71.180  1.00 421.53 ? 126  ASP A C   1 
ATOM   970   O  O   . ASP A  1  126  ? -22.268 -43.236  -70.466  1.00 416.27 ? 126  ASP A O   1 
ATOM   971   C  CB  . ASP A  1  126  ? -25.067 -43.504  -72.132  1.00 432.41 ? 126  ASP A CB  1 
ATOM   972   C  CG  . ASP A  1  126  ? -25.831 -42.854  -73.268  1.00 435.25 ? 126  ASP A CG  1 
ATOM   973   O  OD1 . ASP A  1  126  ? -25.188 -42.251  -74.152  1.00 430.35 ? 126  ASP A OD1 1 
ATOM   974   O  OD2 . ASP A  1  126  ? -27.077 -42.945  -73.276  1.00 442.81 ? 126  ASP A OD2 1 
ATOM   975   N  N   . THR A  1  127  ? -22.806 -45.373  -70.913  1.00 268.94 ? 127  THR A N   1 
ATOM   976   C  CA  . THR A  1  127  ? -22.121 -45.908  -69.743  1.00 267.47 ? 127  THR A CA  1 
ATOM   977   C  C   . THR A  1  127  ? -20.620 -45.653  -69.818  1.00 258.62 ? 127  THR A C   1 
ATOM   978   O  O   . THR A  1  127  ? -19.989 -45.291  -68.825  1.00 254.62 ? 127  THR A O   1 
ATOM   979   C  CB  . THR A  1  127  ? -22.365 -47.421  -69.585  1.00 274.34 ? 127  THR A CB  1 
ATOM   980   O  OG1 . THR A  1  127  ? -21.785 -48.121  -70.694  1.00 273.26 ? 127  THR A OG1 1 
ATOM   981   C  CG2 . THR A  1  127  ? -23.858 -47.717  -69.536  1.00 283.70 ? 127  THR A CG2 1 
ATOM   982   N  N   . GLN A  1  128  ? -20.052 -45.840  -71.007  1.00 232.77 ? 128  GLN A N   1 
ATOM   983   C  CA  . GLN A  1  128  ? -18.626 -45.630  -71.216  1.00 224.79 ? 128  GLN A CA  1 
ATOM   984   C  C   . GLN A  1  128  ? -18.246 -44.173  -70.978  1.00 218.42 ? 128  GLN A C   1 
ATOM   985   O  O   . GLN A  1  128  ? -17.116 -43.872  -70.593  1.00 209.99 ? 128  GLN A O   1 
ATOM   986   C  CB  . GLN A  1  128  ? -18.221 -46.056  -72.629  1.00 223.85 ? 128  GLN A CB  1 
ATOM   987   C  CG  . GLN A  1  128  ? -18.872 -47.347  -73.097  1.00 231.34 ? 128  GLN A CG  1 
ATOM   988   C  CD  . GLN A  1  128  ? -18.598 -47.641  -74.560  1.00 230.78 ? 128  GLN A CD  1 
ATOM   989   O  OE1 . GLN A  1  128  ? -18.829 -46.799  -75.428  1.00 229.16 ? 128  GLN A OE1 1 
ATOM   990   N  NE2 . GLN A  1  128  ? -18.100 -48.839  -74.840  1.00 232.59 ? 128  GLN A NE2 1 
ATOM   991   N  N   . ARG A  1  129  ? -19.194 -43.274  -71.211  1.00 197.30 ? 129  ARG A N   1 
ATOM   992   C  CA  . ARG A  1  129  ? -18.962 -41.848  -71.021  1.00 192.48 ? 129  ARG A CA  1 
ATOM   993   C  C   . ARG A  1  129  ? -19.151 -41.447  -69.562  1.00 192.54 ? 129  ARG A C   1 
ATOM   994   O  O   . ARG A  1  129  ? -18.542 -40.489  -69.088  1.00 186.20 ? 129  ARG A O   1 
ATOM   995   C  CB  . ARG A  1  129  ? -19.896 -41.026  -71.915  1.00 195.42 ? 129  ARG A CB  1 
ATOM   996   C  CG  . ARG A  1  129  ? -19.251 -40.536  -73.200  1.00 191.47 ? 129  ARG A CG  1 
ATOM   997   C  CD  . ARG A  1  129  ? -18.795 -39.092  -73.073  1.00 184.74 ? 129  ARG A CD  1 
ATOM   998   N  NE  . ARG A  1  129  ? -18.312 -38.558  -74.342  1.00 179.33 ? 129  ARG A NE  1 
ATOM   999   C  CZ  . ARG A  1  129  ? -17.785 -37.344  -74.489  1.00 171.82 ? 129  ARG A CZ  1 
ATOM   1000  N  NH1 . ARG A  1  129  ? -17.675 -36.536  -73.444  1.00 168.80 ? 129  ARG A NH1 1 
ATOM   1001  N  NH2 . ARG A  1  129  ? -17.372 -36.941  -75.683  1.00 167.73 ? 129  ARG A NH2 1 
ATOM   1002  N  N   . TYR A  1  130  ? -19.996 -42.189  -68.855  1.00 419.23 ? 130  TYR A N   1 
ATOM   1003  C  CA  . TYR A  1  130  ? -20.267 -41.916  -67.448  1.00 420.36 ? 130  TYR A CA  1 
ATOM   1004  C  C   . TYR A  1  130  ? -19.027 -42.161  -66.593  1.00 415.12 ? 130  TYR A C   1 
ATOM   1005  O  O   . TYR A  1  130  ? -19.133 -42.519  -65.419  1.00 417.43 ? 130  TYR A O   1 
ATOM   1006  C  CB  . TYR A  1  130  ? -21.428 -42.774  -66.949  1.00 429.12 ? 130  TYR A CB  1 
ATOM   1007  C  CG  . TYR A  1  130  ? -22.741 -42.494  -67.645  1.00 435.03 ? 130  TYR A CG  1 
ATOM   1008  C  CD1 . TYR A  1  130  ? -23.375 -41.267  -67.504  1.00 435.25 ? 130  TYR A CD1 1 
ATOM   1009  C  CD2 . TYR A  1  130  ? -23.348 -43.455  -68.443  1.00 440.81 ? 130  TYR A CD2 1 
ATOM   1010  C  CE1 . TYR A  1  130  ? -24.576 -41.006  -68.137  1.00 441.13 ? 130  TYR A CE1 1 
ATOM   1011  C  CE2 . TYR A  1  130  ? -24.547 -43.203  -69.081  1.00 446.55 ? 130  TYR A CE2 1 
ATOM   1012  C  CZ  . TYR A  1  130  ? -25.156 -41.976  -68.924  1.00 446.69 ? 130  TYR A CZ  1 
ATOM   1013  O  OH  . TYR A  1  130  ? -26.352 -41.722  -69.557  1.00 452.87 ? 130  TYR A OH  1 
ATOM   1014  N  N   . ARG A  1  131  ? -17.854 -41.964  -67.188  1.00 207.01 ? 131  ARG A N   1 
ATOM   1015  C  CA  . ARG A  1  131  ? -16.595 -42.164  -66.481  1.00 197.02 ? 131  ARG A CA  1 
ATOM   1016  C  C   . ARG A  1  131  ? -15.509 -41.238  -67.019  1.00 184.74 ? 131  ARG A C   1 
ATOM   1017  O  O   . ARG A  1  131  ? -15.256 -41.196  -68.222  1.00 182.59 ? 131  ARG A O   1 
ATOM   1018  C  CB  . ARG A  1  131  ? -16.146 -43.621  -66.591  1.00 199.03 ? 131  ARG A CB  1 
ATOM   1019  C  CG  . ARG A  1  131  ? -14.768 -43.891  -66.002  1.00 188.93 ? 131  ARG A CG  1 
ATOM   1020  C  CD  . ARG A  1  131  ? -14.729 -45.228  -65.281  1.00 194.53 ? 131  ARG A CD  1 
ATOM   1021  N  NE  . ARG A  1  131  ? -13.600 -45.321  -64.360  1.00 186.05 ? 131  ARG A NE  1 
ATOM   1022  C  CZ  . ARG A  1  131  ? -12.957 -46.451  -64.078  1.00 186.45 ? 131  ARG A CZ  1 
ATOM   1023  N  NH1 . ARG A  1  131  ? -13.333 -47.589  -64.644  1.00 195.09 ? 131  ARG A NH1 1 
ATOM   1024  N  NH2 . ARG A  1  131  ? -11.940 -46.442  -63.227  1.00 178.76 ? 131  ARG A NH2 1 
ATOM   1025  N  N   . ASP A  1  132  ? -14.873 -40.497  -66.119  1.00 252.28 ? 132  ASP A N   1 
ATOM   1026  C  CA  . ASP A  1  132  ? -13.814 -39.570  -66.501  1.00 241.09 ? 132  ASP A CA  1 
ATOM   1027  C  C   . ASP A  1  132  ? -12.928 -40.162  -67.592  1.00 236.17 ? 132  ASP A C   1 
ATOM   1028  O  O   . ASP A  1  132  ? -12.887 -41.379  -67.780  1.00 239.85 ? 132  ASP A O   1 
ATOM   1029  C  CB  . ASP A  1  132  ? -12.968 -39.191  -65.285  1.00 233.47 ? 132  ASP A CB  1 
ATOM   1030  C  CG  . ASP A  1  132  ? -13.670 -38.211  -64.368  1.00 236.12 ? 132  ASP A CG  1 
ATOM   1031  O  OD1 . ASP A  1  132  ? -14.890 -38.004  -64.539  1.00 245.10 ? 132  ASP A OD1 1 
ATOM   1032  O  OD2 . ASP A  1  132  ? -13.004 -37.646  -63.475  1.00 229.61 ? 132  ASP A OD2 1 
ATOM   1033  N  N   . PRO A  1  133  ? -12.217 -39.298  -68.307  1.00 203.51 ? 133  PRO A N   1 
ATOM   1034  C  CA  . PRO A  1  133  ? -11.326 -39.736  -69.386  1.00 198.37 ? 133  PRO A CA  1 
ATOM   1035  C  C   . PRO A  1  133  ? -10.153 -40.553  -68.855  1.00 192.42 ? 133  PRO A C   1 
ATOM   1036  O  O   . PRO A  1  133  ? -9.889  -40.541  -67.653  1.00 190.46 ? 133  PRO A O   1 
ATOM   1037  C  CB  . PRO A  1  133  ? -10.826 -38.418  -69.979  1.00 191.25 ? 133  PRO A CB  1 
ATOM   1038  C  CG  . PRO A  1  133  ? -10.889 -37.456  -68.846  1.00 189.25 ? 133  PRO A CG  1 
ATOM   1039  C  CD  . PRO A  1  133  ? -12.086 -37.857  -68.033  1.00 198.74 ? 133  PRO A CD  1 
ATOM   1040  N  N   . LYS A  1  134  ? -9.460  -41.251  -69.748  1.00 296.19 ? 134  LYS A N   1 
ATOM   1041  C  CA  . LYS A  1  134  ? -8.315  -42.068  -69.360  1.00 279.73 ? 134  LYS A CA  1 
ATOM   1042  C  C   . LYS A  1  134  ? -8.763  -43.346  -68.660  1.00 310.60 ? 134  LYS A C   1 
ATOM   1043  O  O   . LYS A  1  134  ? -7.939  -44.101  -68.141  1.00 265.40 ? 134  LYS A O   1 
ATOM   1044  C  CB  . LYS A  1  134  ? -7.373  -41.273  -68.454  1.00 230.66 ? 134  LYS A CB  1 
ATOM   1045  C  CG  . LYS A  1  134  ? -6.113  -42.026  -68.059  1.00 195.02 ? 134  LYS A CG  1 
ATOM   1046  C  CD  . LYS A  1  134  ? -5.201  -41.165  -67.201  1.00 189.79 ? 134  LYS A CD  1 
ATOM   1047  C  CE  . LYS A  1  134  ? -3.951  -41.925  -66.786  1.00 191.58 ? 134  LYS A CE  1 
ATOM   1048  N  NZ  . LYS A  1  134  ? -3.048  -41.092  -65.945  1.00 145.61 ? 134  LYS A NZ  1 
ATOM   1049  N  N   . ASN A  1  135  ? -10.071 -43.585  -68.652  1.00 197.35 ? 135  ASN A N   1 
ATOM   1050  C  CA  . ASN A  1  135  ? -10.627 -44.773  -68.016  1.00 253.98 ? 135  ASN A CA  1 
ATOM   1051  C  C   . ASN A  1  135  ? -11.686 -45.446  -68.881  1.00 319.63 ? 135  ASN A C   1 
ATOM   1052  O  O   . ASN A  1  135  ? -11.749 -46.673  -68.960  1.00 364.53 ? 135  ASN A O   1 
ATOM   1053  C  CB  . ASN A  1  135  ? -11.213 -44.420  -66.646  1.00 248.19 ? 135  ASN A CB  1 
ATOM   1054  C  CG  . ASN A  1  135  ? -10.146 -44.220  -65.588  1.00 200.51 ? 135  ASN A CG  1 
ATOM   1055  O  OD1 . ASN A  1  135  ? -8.959  -44.114  -65.901  1.00 179.18 ? 135  ASN A OD1 1 
ATOM   1056  N  ND2 . ASN A  1  135  ? -10.563 -44.170  -64.329  1.00 184.87 ? 135  ASN A ND2 1 
ATOM   1057  N  N   . ARG A  1  136  ? -12.518 -44.637  -69.528  1.00 155.56 ? 136  ARG A N   1 
ATOM   1058  C  CA  . ARG A  1  136  ? -13.575 -45.154  -70.387  1.00 169.83 ? 136  ARG A CA  1 
ATOM   1059  C  C   . ARG A  1  136  ? -13.085 -46.335  -71.217  1.00 171.82 ? 136  ARG A C   1 
ATOM   1060  O  O   . ARG A  1  136  ? -13.879 -47.065  -71.811  1.00 185.15 ? 136  ARG A O   1 
ATOM   1061  C  CB  . ARG A  1  136  ? -14.106 -44.053  -71.309  1.00 169.40 ? 136  ARG A CB  1 
ATOM   1062  C  CG  . ARG A  1  136  ? -14.808 -42.919  -70.579  1.00 171.06 ? 136  ARG A CG  1 
ATOM   1063  C  CD  . ARG A  1  136  ? -14.500 -41.575  -71.219  1.00 161.27 ? 136  ARG A CD  1 
ATOM   1064  N  NE  . ARG A  1  136  ? -15.269 -40.491  -70.614  1.00 164.94 ? 136  ARG A NE  1 
ATOM   1065  C  CZ  . ARG A  1  136  ? -15.070 -39.202  -70.867  1.00 157.69 ? 136  ARG A CZ  1 
ATOM   1066  N  NH1 . ARG A  1  136  ? -14.119 -38.831  -71.711  1.00 146.15 ? 136  ARG A NH1 1 
ATOM   1067  N  NH2 . ARG A  1  136  ? -15.819 -38.285  -70.272  1.00 162.68 ? 136  ARG A NH2 1 
ATOM   1068  N  N   . LEU A  1  137  ? -11.768 -46.523  -71.251  1.00 232.71 ? 137  LEU A N   1 
ATOM   1069  C  CA  . LEU A  1  137  ? -11.170 -47.617  -72.005  1.00 233.77 ? 137  LEU A CA  1 
ATOM   1070  C  C   . LEU A  1  137  ? -11.866 -48.939  -71.705  1.00 250.16 ? 137  LEU A C   1 
ATOM   1071  O  O   . LEU A  1  137  ? -12.211 -49.691  -72.615  1.00 259.38 ? 137  LEU A O   1 
ATOM   1072  C  CB  . LEU A  1  137  ? -9.674  -47.726  -71.694  1.00 219.56 ? 137  LEU A CB  1 
ATOM   1073  C  CG  . LEU A  1  137  ? -8.844  -46.458  -71.906  1.00 203.37 ? 137  LEU A CG  1 
ATOM   1074  C  CD1 . LEU A  1  137  ? -7.410  -46.675  -71.446  1.00 191.32 ? 137  LEU A CD1 1 
ATOM   1075  C  CD2 . LEU A  1  137  ? -8.885  -46.024  -73.362  1.00 201.26 ? 137  LEU A CD2 1 
ATOM   1076  N  N   . ASN A  1  138  ? -12.068 -49.218  -70.421  1.00 246.72 ? 138  ASN A N   1 
ATOM   1077  C  CA  . ASN A  1  138  ? -12.724 -50.450  -70.000  1.00 263.05 ? 138  ASN A CA  1 
ATOM   1078  C  C   . ASN A  1  138  ? -13.970 -50.748  -70.823  1.00 278.97 ? 138  ASN A C   1 
ATOM   1079  O  O   . ASN A  1  138  ? -14.178 -51.879  -71.266  1.00 290.53 ? 138  ASN A O   1 
ATOM   1080  C  CB  . ASN A  1  138  ? -13.079 -50.385  -68.513  1.00 266.40 ? 138  ASN A CB  1 
ATOM   1081  C  CG  . ASN A  1  138  ? -11.873 -50.580  -67.614  1.00 255.16 ? 138  ASN A CG  1 
ATOM   1082  O  OD1 . ASN A  1  138  ? -10.831 -51.065  -68.056  1.00 248.23 ? 138  ASN A OD1 1 
ATOM   1083  N  ND2 . ASN A  1  138  ? -12.012 -50.204  -66.349  1.00 253.76 ? 138  ASN A ND2 1 
ATOM   1084  N  N   . ALA A  1  139  ? -14.799 -49.728  -71.028  1.00 240.65 ? 139  ALA A N   1 
ATOM   1085  C  CA  . ALA A  1  139  ? -16.025 -49.880  -71.802  1.00 252.69 ? 139  ALA A CA  1 
ATOM   1086  C  C   . ALA A  1  139  ? -15.720 -50.273  -73.244  1.00 251.97 ? 139  ALA A C   1 
ATOM   1087  O  O   . ALA A  1  139  ? -16.377 -51.147  -73.811  1.00 262.28 ? 139  ALA A O   1 
ATOM   1088  C  CB  . ALA A  1  139  ? -16.839 -48.597  -71.761  1.00 251.63 ? 139  ALA A CB  1 
ATOM   1089  N  N   . VAL A  1  140  ? -14.717 -49.625  -73.830  1.00 282.77 ? 140  VAL A N   1 
ATOM   1090  C  CA  . VAL A  1  140  ? -14.323 -49.910  -75.203  1.00 280.64 ? 140  VAL A CA  1 
ATOM   1091  C  C   . VAL A  1  140  ? -13.897 -51.366  -75.366  1.00 287.43 ? 140  VAL A C   1 
ATOM   1092  O  O   . VAL A  1  140  ? -14.373 -52.065  -76.258  1.00 295.44 ? 140  VAL A O   1 
ATOM   1093  C  CB  . VAL A  1  140  ? -13.170 -48.995  -75.660  1.00 261.26 ? 140  VAL A CB  1 
ATOM   1094  C  CG1 . VAL A  1  140  ? -12.794 -49.295  -77.103  1.00 259.60 ? 140  VAL A CG1 1 
ATOM   1095  C  CG2 . VAL A  1  140  ? -13.560 -47.534  -75.497  1.00 255.24 ? 140  VAL A CG2 1 
ATOM   1096  N  N   . TRP A  1  141  ? -12.997 -51.814  -74.495  1.00 227.98 ? 141  TRP A N   1 
ATOM   1097  C  CA  . TRP A  1  141  ? -12.509 -53.187  -74.537  1.00 234.48 ? 141  TRP A CA  1 
ATOM   1098  C  C   . TRP A  1  141  ? -13.663 -54.183  -74.476  1.00 252.06 ? 141  TRP A C   1 
ATOM   1099  O  O   . TRP A  1  141  ? -13.676 -55.178  -75.201  1.00 259.03 ? 141  TRP A O   1 
ATOM   1100  C  CB  . TRP A  1  141  ? -11.532 -53.442  -73.388  1.00 226.35 ? 141  TRP A CB  1 
ATOM   1101  C  CG  . TRP A  1  141  ? -10.946 -54.822  -73.395  1.00 232.87 ? 141  TRP A CG  1 
ATOM   1102  C  CD1 . TRP A  1  141  ? -9.827  -55.235  -74.057  1.00 225.38 ? 141  TRP A CD1 1 
ATOM   1103  C  CD2 . TRP A  1  141  ? -11.453 -55.972  -72.707  1.00 249.24 ? 141  TRP A CD2 1 
ATOM   1104  N  NE1 . TRP A  1  141  ? -9.604  -56.570  -73.824  1.00 236.15 ? 141  TRP A NE1 1 
ATOM   1105  C  CE2 . TRP A  1  141  ? -10.588 -57.046  -72.996  1.00 251.02 ? 141  TRP A CE2 1 
ATOM   1106  C  CE3 . TRP A  1  141  ? -12.551 -56.199  -71.874  1.00 261.57 ? 141  TRP A CE3 1 
ATOM   1107  C  CZ2 . TRP A  1  141  ? -10.789 -58.325  -72.487  1.00 266.29 ? 141  TRP A CZ2 1 
ATOM   1108  C  CZ3 . TRP A  1  141  ? -12.750 -57.470  -71.366  1.00 271.92 ? 141  TRP A CZ3 1 
ATOM   1109  C  CH2 . TRP A  1  141  ? -11.872 -58.517  -71.674  1.00 273.90 ? 141  TRP A CH2 1 
ATOM   1110  N  N   . ASN A  1  142  ? -14.631 -53.905  -73.608  1.00 273.37 ? 142  ASN A N   1 
ATOM   1111  C  CA  . ASN A  1  142  ? -15.789 -54.776  -73.450  1.00 284.22 ? 142  ASN A CA  1 
ATOM   1112  C  C   . ASN A  1  142  ? -16.622 -54.861  -74.726  1.00 287.77 ? 142  ASN A C   1 
ATOM   1113  O  O   . ASN A  1  142  ? -17.160 -55.919  -75.057  1.00 295.25 ? 142  ASN A O   1 
ATOM   1114  C  CB  . ASN A  1  142  ? -16.661 -54.304  -72.285  1.00 286.90 ? 142  ASN A CB  1 
ATOM   1115  C  CG  . ASN A  1  142  ? -16.011 -54.547  -70.937  1.00 286.45 ? 142  ASN A CG  1 
ATOM   1116  O  OD1 . ASN A  1  142  ? -15.147 -55.412  -70.798  1.00 287.22 ? 142  ASN A OD1 1 
ATOM   1117  N  ND2 . ASN A  1  142  ? -16.425 -53.779  -69.935  1.00 285.59 ? 142  ASN A ND2 1 
ATOM   1118  N  N   . VAL A  1  143  ? -16.725 -53.744  -75.437  1.00 276.81 ? 143  VAL A N   1 
ATOM   1119  C  CA  . VAL A  1  143  ? -17.491 -53.690  -76.676  1.00 280.13 ? 143  VAL A CA  1 
ATOM   1120  C  C   . VAL A  1  143  ? -16.781 -54.437  -77.798  1.00 280.00 ? 143  VAL A C   1 
ATOM   1121  O  O   . VAL A  1  143  ? -17.418 -55.072  -78.638  1.00 285.88 ? 143  VAL A O   1 
ATOM   1122  C  CB  . VAL A  1  143  ? -17.747 -52.238  -77.119  1.00 275.57 ? 143  VAL A CB  1 
ATOM   1123  C  CG1 . VAL A  1  143  ? -18.439 -52.211  -78.473  1.00 279.44 ? 143  VAL A CG1 1 
ATOM   1124  C  CG2 . VAL A  1  143  ? -18.572 -51.501  -76.074  1.00 276.52 ? 143  VAL A CG2 1 
ATOM   1125  N  N   . CYS A  1  144  ? -15.453 -54.357  -77.808  1.00 628.51 ? 144  CYS A N   1 
ATOM   1126  C  CA  . CYS A  1  144  ? -14.652 -55.024  -78.826  1.00 628.46 ? 144  CYS A CA  1 
ATOM   1127  C  C   . CYS A  1  144  ? -14.760 -56.540  -78.708  1.00 627.78 ? 144  CYS A C   1 
ATOM   1128  O  O   . CYS A  1  144  ? -14.828 -57.250  -79.712  1.00 627.54 ? 144  CYS A O   1 
ATOM   1129  C  CB  . CYS A  1  144  ? -13.190 -54.590  -78.728  1.00 628.85 ? 144  CYS A CB  1 
ATOM   1130  S  SG  . CYS A  1  144  ? -12.925 -52.809  -78.885  1.00 629.65 ? 144  CYS A SG  1 
ATOM   1131  N  N   . LYS A  1  145  ? -14.771 -57.033  -77.473  1.00 222.21 ? 145  LYS A N   1 
ATOM   1132  C  CA  . LYS A  1  145  ? -14.868 -58.465  -77.218  1.00 229.94 ? 145  LYS A CA  1 
ATOM   1133  C  C   . LYS A  1  145  ? -16.218 -59.014  -77.668  1.00 238.79 ? 145  LYS A C   1 
ATOM   1134  O  O   . LYS A  1  145  ? -16.344 -60.197  -77.983  1.00 245.54 ? 145  LYS A O   1 
ATOM   1135  C  CB  . LYS A  1  145  ? -14.648 -58.763  -75.734  1.00 231.57 ? 145  LYS A CB  1 
ATOM   1136  C  CG  . LYS A  1  145  ? -14.661 -60.244  -75.390  1.00 227.44 ? 145  LYS A CG  1 
ATOM   1137  C  CD  . LYS A  1  145  ? -14.388 -60.470  -73.913  1.00 230.45 ? 145  LYS A CD  1 
ATOM   1138  C  CE  . LYS A  1  145  ? -14.425 -61.948  -73.566  1.00 226.39 ? 145  LYS A CE  1 
ATOM   1139  N  NZ  . LYS A  1  145  ? -14.160 -62.187  -72.120  1.00 228.59 ? 145  LYS A NZ  1 
ATOM   1140  N  N   . THR A  1  146  ? -17.224 -58.148  -77.698  1.00 338.36 ? 146  THR A N   1 
ATOM   1141  C  CA  . THR A  1  146  ? -18.567 -58.543  -78.109  1.00 346.74 ? 146  THR A CA  1 
ATOM   1142  C  C   . THR A  1  146  ? -18.855 -58.109  -79.541  1.00 345.74 ? 146  THR A C   1 
ATOM   1143  O  O   . THR A  1  146  ? -19.888 -58.465  -80.111  1.00 352.62 ? 146  THR A O   1 
ATOM   1144  C  CB  . THR A  1  146  ? -19.639 -57.956  -77.175  1.00 349.51 ? 146  THR A CB  1 
ATOM   1145  O  OG1 . THR A  1  146  ? -19.965 -56.625  -77.594  1.00 344.52 ? 146  THR A OG1 1 
ATOM   1146  C  CG2 . THR A  1  146  ? -19.137 -57.919  -75.739  1.00 347.66 ? 146  THR A CG2 1 
ATOM   1147  N  N   . LYS A  1  147  ? -17.942 -57.334  -80.117  1.00 368.58 ? 147  LYS A N   1 
ATOM   1148  C  CA  . LYS A  1  147  ? -18.098 -56.849  -81.481  1.00 367.64 ? 147  LYS A CA  1 
ATOM   1149  C  C   . LYS A  1  147  ? -17.494 -57.824  -82.487  1.00 369.39 ? 147  LYS A C   1 
ATOM   1150  O  O   . LYS A  1  147  ? -16.978 -58.879  -82.110  1.00 371.48 ? 147  LYS A O   1 
ATOM   1151  C  CB  . LYS A  1  147  ? -17.455 -55.470  -81.635  1.00 358.95 ? 147  LYS A CB  1 
ATOM   1152  C  CG  . LYS A  1  147  ? -17.634 -54.853  -83.013  1.00 358.67 ? 147  LYS A CG  1 
ATOM   1153  C  CD  . LYS A  1  147  ? -17.014 -53.465  -83.083  1.00 350.94 ? 147  LYS A CD  1 
ATOM   1154  C  CE  . LYS A  1  147  ? -17.171 -52.860  -84.469  1.00 349.95 ? 147  LYS A CE  1 
ATOM   1155  N  NZ  . LYS A  1  147  ? -16.568 -51.500  -84.550  1.00 337.33 ? 147  LYS A NZ  1 
ATOM   1156  N  N   . MET A  1  148  ? -17.562 -57.466  -83.764  1.00 208.26 ? 148  MET A N   1 
ATOM   1157  C  CA  . MET A  1  148  ? -17.022 -58.310  -84.824  1.00 189.78 ? 148  MET A CA  1 
ATOM   1158  C  C   . MET A  1  148  ? -17.865 -58.212  -86.091  1.00 195.00 ? 148  MET A C   1 
ATOM   1159  O  O   . MET A  1  148  ? -17.850 -59.113  -86.931  1.00 189.75 ? 148  MET A O   1 
ATOM   1160  C  CB  . MET A  1  148  ? -16.936 -59.766  -84.362  1.00 171.65 ? 148  MET A CB  1 
ATOM   1161  C  CG  . MET A  1  148  ? -15.922 -60.008  -83.256  1.00 145.10 ? 148  MET A CG  1 
ATOM   1162  S  SD  . MET A  1  148  ? -15.915 -61.716  -82.683  1.00 294.70 ? 148  MET A SD  1 
ATOM   1163  C  CE  . MET A  1  148  ? -14.688 -61.631  -81.382  1.00 203.46 ? 148  MET A CE  1 
ATOM   1164  N  N   . VAL A  1  149  ? -18.599 -57.110  -86.223  1.00 235.97 ? 149  VAL A N   1 
ATOM   1165  C  CA  . VAL A  1  149  ? -19.450 -56.891  -87.387  1.00 260.22 ? 149  VAL A CA  1 
ATOM   1166  C  C   . VAL A  1  149  ? -20.011 -55.473  -87.403  1.00 272.31 ? 149  VAL A C   1 
ATOM   1167  O  O   . VAL A  1  149  ? -20.070 -54.809  -86.370  1.00 249.63 ? 149  VAL A O   1 
ATOM   1168  C  CB  . VAL A  1  149  ? -20.616 -57.895  -87.429  1.00 275.89 ? 149  VAL A CB  1 
ATOM   1169  C  CG1 . VAL A  1  149  ? -21.480 -57.652  -88.658  1.00 306.69 ? 149  VAL A CG1 1 
ATOM   1170  C  CG2 . VAL A  1  149  ? -20.090 -59.324  -87.413  1.00 238.88 ? 149  VAL A CG2 1 
ATOM   1171  N  N   . CYS A  1  150  ? -20.415 -55.015  -88.583  1.00 372.30 ? 150  CYS A N   1 
ATOM   1172  C  CA  . CYS A  1  150  ? -20.972 -53.677  -88.735  1.00 387.18 ? 150  CYS A CA  1 
ATOM   1173  C  C   . CYS A  1  150  ? -22.487 -53.723  -88.892  1.00 417.69 ? 150  CYS A C   1 
ATOM   1174  O  O   . CYS A  1  150  ? -23.148 -54.624  -88.376  1.00 427.31 ? 150  CYS A O   1 
ATOM   1175  C  CB  . CYS A  1  150  ? -20.340 -52.966  -89.935  1.00 362.15 ? 150  CYS A CB  1 
ATOM   1176  S  SG  . CYS A  1  150  ? -19.294 -51.559  -89.501  1.00 222.06 ? 150  CYS A SG  1 
ATOM   1177  N  N   . ASP A  1  151  ? -23.033 -52.746  -89.610  1.00 482.88 ? 151  ASP A N   1 
ATOM   1178  C  CA  . ASP A  1  151  ? -24.471 -52.675  -89.839  1.00 490.98 ? 151  ASP A CA  1 
ATOM   1179  C  C   . ASP A  1  151  ? -24.792 -51.862  -91.090  1.00 499.91 ? 151  ASP A C   1 
ATOM   1180  O  O   . ASP A  1  151  ? -24.075 -51.929  -92.087  1.00 502.45 ? 151  ASP A O   1 
ATOM   1181  C  CB  . ASP A  1  151  ? -25.177 -52.069  -88.624  1.00 488.78 ? 151  ASP A CB  1 
ATOM   1182  C  CG  . ASP A  1  151  ? -26.686 -52.056  -88.772  1.00 496.84 ? 151  ASP A CG  1 
ATOM   1183  O  OD1 . ASP A  1  151  ? -27.221 -52.916  -89.505  1.00 501.93 ? 151  ASP A OD1 1 
ATOM   1184  O  OD2 . ASP A  1  151  ? -27.340 -51.185  -88.155  1.00 497.74 ? 151  ASP A OD2 1 
ATOM   1185  N  N   . THR A  1  152  ? -25.876 -51.094  -91.028  1.00 221.05 ? 152  THR A N   1 
ATOM   1186  C  CA  . THR A  1  152  ? -26.292 -50.267  -92.153  1.00 233.96 ? 152  THR A CA  1 
ATOM   1187  C  C   . THR A  1  152  ? -25.262 -49.187  -92.457  1.00 233.49 ? 152  THR A C   1 
ATOM   1188  O  O   . THR A  1  152  ? -24.126 -49.486  -92.829  1.00 230.82 ? 152  THR A O   1 
ATOM   1189  C  CB  . THR A  1  152  ? -27.656 -49.602  -91.889  1.00 241.12 ? 152  THR A CB  1 
ATOM   1190  O  OG1 . THR A  1  152  ? -27.563 -48.752  -90.741  1.00 233.28 ? 152  THR A OG1 1 
ATOM   1191  C  CG2 . THR A  1  152  ? -28.727 -50.655  -91.649  1.00 243.02 ? 152  THR A CG2 1 
ATOM   1192  N  N   . GLY A  1  153  ? -25.662 -47.932  -92.298  1.00 616.19 ? 153  GLY A N   1 
ATOM   1193  C  CA  . GLY A  1  153  ? -24.777 -46.810  -92.554  1.00 617.23 ? 153  GLY A CA  1 
ATOM   1194  C  C   . GLY A  1  153  ? -25.131 -45.588  -91.728  1.00 617.38 ? 153  GLY A C   1 
ATOM   1195  O  O   . GLY A  1  153  ? -26.088 -44.878  -92.034  1.00 617.68 ? 153  GLY A O   1 
ATOM   1196  N  N   . LEU A  1  154  ? -24.358 -45.347  -90.675  1.00 376.24 ? 154  LEU A N   1 
ATOM   1197  C  CA  . LEU A  1  154  ? -24.590 -44.206  -89.799  1.00 371.20 ? 154  LEU A CA  1 
ATOM   1198  C  C   . LEU A  1  154  ? -26.069 -44.064  -89.456  1.00 383.14 ? 154  LEU A C   1 
ATOM   1199  O  O   . LEU A  1  154  ? -26.895 -44.874  -89.879  1.00 388.73 ? 154  LEU A O   1 
ATOM   1200  C  CB  . LEU A  1  154  ? -24.076 -42.919  -90.447  1.00 363.96 ? 154  LEU A CB  1 
ATOM   1201  C  CG  . LEU A  1  154  ? -23.640 -43.026  -91.910  1.00 364.09 ? 154  LEU A CG  1 
ATOM   1202  C  CD1 . LEU A  1  154  ? -23.963 -41.740  -92.661  1.00 367.87 ? 154  LEU A CD1 1 
ATOM   1203  C  CD2 . LEU A  1  154  ? -22.157 -43.349  -92.007  1.00 345.04 ? 154  LEU A CD2 1 
ATOM   1204  N  N   . SER A  1  155  ? -26.399 -43.033  -88.689  1.00 368.13 ? 155  SER A N   1 
ATOM   1205  C  CA  . SER A  1  155  ? -27.778 -42.783  -88.288  1.00 374.12 ? 155  SER A CA  1 
ATOM   1206  C  C   . SER A  1  155  ? -28.425 -41.722  -89.172  1.00 388.79 ? 155  SER A C   1 
ATOM   1207  O  O   . SER A  1  155  ? -28.836 -40.667  -88.693  1.00 390.90 ? 155  SER A O   1 
ATOM   1208  C  CB  . SER A  1  155  ? -27.842 -42.354  -86.821  1.00 364.51 ? 155  SER A CB  1 
ATOM   1209  O  OG  . SER A  1  155  ? -26.617 -41.774  -86.404  1.00 355.04 ? 155  SER A OG  1 
ATOM   1210  N  N   . ALA A  1  156  ? -28.510 -42.010  -90.466  1.00 239.42 ? 156  ALA A N   1 
ATOM   1211  C  CA  . ALA A  1  156  ? -29.106 -41.083  -91.421  1.00 255.60 ? 156  ALA A CA  1 
ATOM   1212  C  C   . ALA A  1  156  ? -30.628 -41.188  -91.415  1.00 264.73 ? 156  ALA A C   1 
ATOM   1213  O  O   . ALA A  1  156  ? -31.195 -42.145  -91.941  1.00 269.58 ? 156  ALA A O   1 
ATOM   1214  C  CB  . ALA A  1  156  ? -28.561 -41.337  -92.819  1.00 261.52 ? 156  ALA A CB  1 
ATOM   1215  N  N   . GLY A  1  157  ? -31.281 -40.196  -90.818  1.00 623.53 ? 157  GLY A N   1 
ATOM   1216  C  CA  . GLY A  1  157  ? -32.730 -40.176  -90.743  1.00 622.96 ? 157  GLY A CA  1 
ATOM   1217  C  C   . GLY A  1  157  ? -33.355 -41.488  -91.175  1.00 622.28 ? 157  GLY A C   1 
ATOM   1218  O  O   . GLY A  1  157  ? -33.054 -42.543  -90.610  1.00 621.50 ? 157  GLY A O   1 
ATOM   1219  N  N   . SER A  1  158  ? -34.223 -41.426  -92.178  1.00 542.35 ? 158  SER A N   1 
ATOM   1220  C  CA  . SER A  1  158  ? -34.890 -42.615  -92.689  1.00 544.33 ? 158  SER A CA  1 
ATOM   1221  C  C   . SER A  1  158  ? -35.802 -43.231  -91.632  1.00 543.30 ? 158  SER A C   1 
ATOM   1222  O  O   . SER A  1  158  ? -35.414 -44.165  -90.930  1.00 541.17 ? 158  SER A O   1 
ATOM   1223  C  CB  . SER A  1  158  ? -33.865 -43.646  -93.162  1.00 544.54 ? 158  SER A CB  1 
ATOM   1224  O  OG  . SER A  1  158  ? -34.242 -44.957  -92.779  1.00 543.55 ? 158  SER A OG  1 
ATOM   1225  N  N   . ASP A  1  159  ? -37.016 -42.703  -91.525  1.00 350.05 ? 159  ASP A N   1 
ATOM   1226  C  CA  . ASP A  1  159  ? -37.449 -41.596  -92.371  1.00 366.31 ? 159  ASP A CA  1 
ATOM   1227  C  C   . ASP A  1  159  ? -36.620 -40.343  -92.104  1.00 365.42 ? 159  ASP A C   1 
ATOM   1228  O  O   . ASP A  1  159  ? -36.142 -40.128  -90.991  1.00 352.57 ? 159  ASP A O   1 
ATOM   1229  C  CB  . ASP A  1  159  ? -38.936 -41.302  -92.151  1.00 370.77 ? 159  ASP A CB  1 
ATOM   1230  C  CG  . ASP A  1  159  ? -39.592 -42.296  -91.214  1.00 362.66 ? 159  ASP A CG  1 
ATOM   1231  O  OD1 . ASP A  1  159  ? -39.202 -43.482  -91.235  1.00 358.60 ? 159  ASP A OD1 1 
ATOM   1232  O  OD2 . ASP A  1  159  ? -40.499 -41.889  -90.458  1.00 360.87 ? 159  ASP A OD2 1 
ATOM   1233  N  N   . ASN A  1  160  ? -36.455 -39.519  -93.134  1.00 336.37 ? 160  ASN A N   1 
ATOM   1234  C  CA  . ASN A  1  160  ? -35.683 -38.288  -93.015  1.00 336.20 ? 160  ASN A CA  1 
ATOM   1235  C  C   . ASN A  1  160  ? -36.450 -37.195  -92.279  1.00 337.04 ? 160  ASN A C   1 
ATOM   1236  O  O   . ASN A  1  160  ? -37.608 -36.917  -92.590  1.00 351.41 ? 160  ASN A O   1 
ATOM   1237  C  CB  . ASN A  1  160  ? -35.252 -37.790  -94.396  1.00 352.16 ? 160  ASN A CB  1 
ATOM   1238  C  CG  . ASN A  1  160  ? -34.912 -36.313  -94.403  1.00 357.50 ? 160  ASN A CG  1 
ATOM   1239  O  OD1 . ASN A  1  160  ? -33.900 -35.894  -93.841  1.00 344.99 ? 160  ASN A OD1 1 
ATOM   1240  N  ND2 . ASN A  1  160  ? -35.759 -35.513  -95.041  1.00 376.83 ? 160  ASN A ND2 1 
ATOM   1241  N  N   . PHE A  1  161  ? -35.795 -36.578  -91.301  1.00 561.47 ? 161  PHE A N   1 
ATOM   1242  C  CA  . PHE A  1  161  ? -36.413 -35.513  -90.518  1.00 560.59 ? 161  PHE A CA  1 
ATOM   1243  C  C   . PHE A  1  161  ? -35.461 -34.993  -89.447  1.00 557.33 ? 161  PHE A C   1 
ATOM   1244  O  O   . PHE A  1  161  ? -34.351 -35.502  -89.288  1.00 555.00 ? 161  PHE A O   1 
ATOM   1245  C  CB  . PHE A  1  161  ? -37.711 -36.006  -89.873  1.00 559.90 ? 161  PHE A CB  1 
ATOM   1246  C  CG  . PHE A  1  161  ? -37.550 -37.271  -89.078  1.00 557.89 ? 161  PHE A CG  1 
ATOM   1247  C  CD1 . PHE A  1  161  ? -37.551 -38.505  -89.706  1.00 559.69 ? 161  PHE A CD1 1 
ATOM   1248  C  CD2 . PHE A  1  161  ? -37.398 -37.225  -87.703  1.00 553.18 ? 161  PHE A CD2 1 
ATOM   1249  C  CE1 . PHE A  1  161  ? -37.405 -39.670  -88.977  1.00 557.01 ? 161  PHE A CE1 1 
ATOM   1250  C  CE2 . PHE A  1  161  ? -37.250 -38.386  -86.968  1.00 549.57 ? 161  PHE A CE2 1 
ATOM   1251  C  CZ  . PHE A  1  161  ? -37.254 -39.610  -87.606  1.00 551.51 ? 161  PHE A CZ  1 
ATOM   1252  N  N   . ASP A  1  162  ? -35.901 -33.975  -88.715  1.00 541.15 ? 162  ASP A N   1 
ATOM   1253  C  CA  . ASP A  1  162  ? -35.088 -33.384  -87.658  1.00 539.48 ? 162  ASP A CA  1 
ATOM   1254  C  C   . ASP A  1  162  ? -35.723 -32.104  -87.124  1.00 539.49 ? 162  ASP A C   1 
ATOM   1255  O  O   . ASP A  1  162  ? -35.572 -31.033  -87.711  1.00 539.35 ? 162  ASP A O   1 
ATOM   1256  C  CB  . ASP A  1  162  ? -33.674 -33.097  -88.167  1.00 538.53 ? 162  ASP A CB  1 
ATOM   1257  C  CG  . ASP A  1  162  ? -33.669 -32.455  -89.540  1.00 538.57 ? 162  ASP A CG  1 
ATOM   1258  O  OD1 . ASP A  1  162  ? -34.745 -32.383  -90.169  1.00 539.92 ? 162  ASP A OD1 1 
ATOM   1259  O  OD2 . ASP A  1  162  ? -32.587 -32.022  -89.991  1.00 536.41 ? 162  ASP A OD2 1 
ATOM   1260  N  N   . LEU A  1  163  ? -36.434 -32.224  -86.008  1.00 401.56 ? 163  LEU A N   1 
ATOM   1261  C  CA  . LEU A  1  163  ? -37.093 -31.077  -85.393  1.00 404.62 ? 163  LEU A CA  1 
ATOM   1262  C  C   . LEU A  1  163  ? -37.803 -31.475  -84.103  1.00 395.59 ? 163  LEU A C   1 
ATOM   1263  O  O   . LEU A  1  163  ? -39.028 -31.402  -84.010  1.00 398.15 ? 163  LEU A O   1 
ATOM   1264  C  CB  . LEU A  1  163  ? -38.089 -30.446  -86.368  1.00 424.20 ? 163  LEU A CB  1 
ATOM   1265  C  CG  . LEU A  1  163  ? -39.515 -31.000  -86.335  1.00 436.05 ? 163  LEU A CG  1 
ATOM   1266  C  CD1 . LEU A  1  163  ? -40.518 -29.928  -86.734  1.00 450.95 ? 163  LEU A CD1 1 
ATOM   1267  C  CD2 . LEU A  1  163  ? -39.639 -32.218  -87.236  1.00 441.78 ? 163  LEU A CD2 1 
ATOM   1268  N  N   . SER A  1  164  ? -37.025 -31.897  -83.111  1.00 571.37 ? 164  SER A N   1 
ATOM   1269  C  CA  . SER A  1  164  ? -35.576 -31.972  -83.254  1.00 569.08 ? 164  SER A CA  1 
ATOM   1270  C  C   . SER A  1  164  ? -35.116 -33.413  -83.452  1.00 568.29 ? 164  SER A C   1 
ATOM   1271  O  O   . SER A  1  164  ? -35.159 -34.221  -82.525  1.00 565.56 ? 164  SER A O   1 
ATOM   1272  C  CB  . SER A  1  164  ? -34.885 -31.362  -82.033  1.00 564.32 ? 164  SER A CB  1 
ATOM   1273  O  OG  . SER A  1  164  ? -34.286 -32.365  -81.232  1.00 560.22 ? 164  SER A OG  1 
ATOM   1274  N  N   . ASN A  1  165  ? -34.673 -33.726  -84.665  1.00 522.85 ? 165  ASN A N   1 
ATOM   1275  C  CA  . ASN A  1  165  ? -34.203 -35.069  -84.986  1.00 521.96 ? 165  ASN A CA  1 
ATOM   1276  C  C   . ASN A  1  165  ? -32.811 -35.060  -85.609  1.00 520.10 ? 165  ASN A C   1 
ATOM   1277  O  O   . ASN A  1  165  ? -32.026 -34.138  -85.380  1.00 517.64 ? 165  ASN A O   1 
ATOM   1278  C  CB  . ASN A  1  165  ? -35.191 -35.773  -85.918  1.00 526.23 ? 165  ASN A CB  1 
ATOM   1279  C  CG  . ASN A  1  165  ? -36.617 -35.715  -85.408  1.00 527.80 ? 165  ASN A CG  1 
ATOM   1280  O  OD1 . ASN A  1  165  ? -37.165 -34.635  -85.185  1.00 528.08 ? 165  ASN A OD1 1 
ATOM   1281  N  ND2 . ASN A  1  165  ? -37.228 -36.880  -85.221  1.00 528.70 ? 165  ASN A ND2 1 
ATOM   1282  N  N   . PRO A  1  166  ? -32.512 -36.088  -86.394  1.00 551.18 ? 166  PRO A N   1 
ATOM   1283  C  CA  . PRO A  1  166  ? -33.471 -37.169  -86.646  1.00 553.20 ? 166  PRO A CA  1 
ATOM   1284  C  C   . PRO A  1  166  ? -33.028 -38.480  -86.003  1.00 552.21 ? 166  PRO A C   1 
ATOM   1285  O  O   . PRO A  1  166  ? -31.841 -38.664  -85.736  1.00 549.92 ? 166  PRO A O   1 
ATOM   1286  C  CB  . PRO A  1  166  ? -33.451 -37.299  -88.170  1.00 554.60 ? 166  PRO A CB  1 
ATOM   1287  C  CG  . PRO A  1  166  ? -32.093 -36.839  -88.564  1.00 552.92 ? 166  PRO A CG  1 
ATOM   1288  C  CD  . PRO A  1  166  ? -31.734 -35.745  -87.598  1.00 550.59 ? 166  PRO A CD  1 
ATOM   1289  N  N   . SER A  1  167  ? -33.980 -39.374  -85.758  1.00 586.03 ? 167  SER A N   1 
ATOM   1290  C  CA  . SER A  1  167  ? -33.679 -40.663  -85.147  1.00 586.35 ? 167  SER A CA  1 
ATOM   1291  C  C   . SER A  1  167  ? -34.606 -41.753  -85.676  1.00 587.36 ? 167  SER A C   1 
ATOM   1292  O  O   . SER A  1  167  ? -35.491 -42.229  -84.965  1.00 586.70 ? 167  SER A O   1 
ATOM   1293  C  CB  . SER A  1  167  ? -33.792 -40.571  -83.624  1.00 584.43 ? 167  SER A CB  1 
ATOM   1294  O  OG  . SER A  1  167  ? -33.225 -41.711  -83.001  1.00 584.09 ? 167  SER A OG  1 
ATOM   1295  N  N   . ALA A  1  168  ? -34.395 -42.145  -86.928  1.00 592.03 ? 168  ALA A N   1 
ATOM   1296  C  CA  . ALA A  1  168  ? -33.335 -41.562  -87.746  1.00 591.90 ? 168  ALA A CA  1 
ATOM   1297  C  C   . ALA A  1  168  ? -31.959 -41.951  -87.228  1.00 592.31 ? 168  ALA A C   1 
ATOM   1298  O  O   . ALA A  1  168  ? -31.311 -41.186  -86.516  1.00 591.73 ? 168  ALA A O   1 
ATOM   1299  C  CB  . ALA A  1  168  ? -33.481 -40.049  -87.794  1.00 590.85 ? 168  ALA A CB  1 
ATOM   1300  N  N   . ASN A  1  169  ? -31.510 -43.150  -87.594  1.00 568.42 ? 169  ASN A N   1 
ATOM   1301  C  CA  . ASN A  1  169  ? -30.208 -43.643  -87.170  1.00 565.08 ? 169  ASN A CA  1 
ATOM   1302  C  C   . ASN A  1  169  ? -30.097 -45.159  -87.293  1.00 563.36 ? 169  ASN A C   1 
ATOM   1303  O  O   . ASN A  1  169  ? -30.691 -45.764  -88.189  1.00 567.39 ? 169  ASN A O   1 
ATOM   1304  C  CB  . ASN A  1  169  ? -29.916 -43.215  -85.730  1.00 559.25 ? 169  ASN A CB  1 
ATOM   1305  C  CG  . ASN A  1  169  ? -30.980 -43.681  -84.753  1.00 558.52 ? 169  ASN A CG  1 
ATOM   1306  O  OD1 . ASN A  1  169  ? -31.098 -43.153  -83.646  1.00 556.07 ? 169  ASN A OD1 1 
ATOM   1307  N  ND2 . ASN A  1  169  ? -31.761 -44.675  -85.163  1.00 560.85 ? 169  ASN A ND2 1 
ATOM   1308  N  N   . MET A  1  170  ? -29.334 -45.771  -86.391  1.00 518.12 ? 170  MET A N   1 
ATOM   1309  C  CA  . MET A  1  170  ? -29.143 -47.216  -86.402  1.00 514.68 ? 170  MET A CA  1 
ATOM   1310  C  C   . MET A  1  170  ? -28.445 -47.673  -87.680  1.00 517.76 ? 170  MET A C   1 
ATOM   1311  O  O   . MET A  1  170  ? -29.056 -47.732  -88.746  1.00 526.23 ? 170  MET A O   1 
ATOM   1312  C  CB  . MET A  1  170  ? -30.487 -47.934  -86.252  1.00 520.26 ? 170  MET A CB  1 
ATOM   1313  C  CG  . MET A  1  170  ? -31.254 -48.095  -87.555  1.00 530.83 ? 170  MET A CG  1 
ATOM   1314  S  SD  . MET A  1  170  ? -32.407 -49.478  -87.519  1.00 531.52 ? 170  MET A SD  1 
ATOM   1315  C  CE  . MET A  1  170  ? -33.960 -48.636  -87.813  1.00 538.50 ? 170  MET A CE  1 
ATOM   1316  N  N   . GLY A  1  171  ? -27.160 -47.996  -87.561  1.00 599.04 ? 171  GLY A N   1 
ATOM   1317  C  CA  . GLY A  1  171  ? -26.469 -47.915  -86.287  1.00 591.75 ? 171  GLY A CA  1 
ATOM   1318  C  C   . GLY A  1  171  ? -24.962 -47.922  -86.444  1.00 587.33 ? 171  GLY A C   1 
ATOM   1319  O  O   . GLY A  1  171  ? -24.433 -48.412  -87.443  1.00 589.86 ? 171  GLY A O   1 
ATOM   1320  N  N   . HIS A  1  172  ? -24.266 -47.373  -85.452  1.00 505.52 ? 172  HIS A N   1 
ATOM   1321  C  CA  . HIS A  1  172  ? -22.811 -47.314  -85.478  1.00 497.97 ? 172  HIS A CA  1 
ATOM   1322  C  C   . HIS A  1  172  ? -22.288 -47.149  -86.901  1.00 500.74 ? 172  HIS A C   1 
ATOM   1323  O  O   . HIS A  1  172  ? -21.410 -47.891  -87.341  1.00 496.23 ? 172  HIS A O   1 
ATOM   1324  C  CB  . HIS A  1  172  ? -22.212 -48.573  -84.841  1.00 490.49 ? 172  HIS A CB  1 
ATOM   1325  C  CG  . HIS A  1  172  ? -22.842 -49.845  -85.314  1.00 495.39 ? 172  HIS A CG  1 
ATOM   1326  N  ND1 . HIS A  1  172  ? -24.026 -50.325  -84.798  1.00 498.98 ? 172  HIS A ND1 1 
ATOM   1327  C  CD2 . HIS A  1  172  ? -22.452 -50.740  -86.253  1.00 497.57 ? 172  HIS A CD2 1 
ATOM   1328  C  CE1 . HIS A  1  172  ? -24.339 -51.459  -85.399  1.00 503.02 ? 172  HIS A CE1 1 
ATOM   1329  N  NE2 . HIS A  1  172  ? -23.400 -51.733  -86.288  1.00 502.18 ? 172  HIS A NE2 1 
ATOM   1330  N  N   . GLY A  1  173  ? -22.834 -46.172  -87.617  1.00 603.26 ? 173  GLY A N   1 
ATOM   1331  C  CA  . GLY A  1  173  ? -22.426 -45.908  -88.984  1.00 604.12 ? 173  GLY A CA  1 
ATOM   1332  C  C   . GLY A  1  173  ? -22.793 -47.036  -89.926  1.00 603.88 ? 173  GLY A C   1 
ATOM   1333  O  O   . GLY A  1  173  ? -23.871 -47.621  -89.821  1.00 603.23 ? 173  GLY A O   1 
ATOM   1334  N  N   . GLY A  1  174  ? -21.889 -47.347  -90.851  1.00 169.43 ? 174  GLY A N   1 
ATOM   1335  C  CA  . GLY A  1  174  ? -22.118 -48.407  -91.814  1.00 180.29 ? 174  GLY A CA  1 
ATOM   1336  C  C   . GLY A  1  174  ? -20.825 -48.979  -92.366  1.00 168.67 ? 174  GLY A C   1 
ATOM   1337  O  O   . GLY A  1  174  ? -19.786 -48.317  -92.344  1.00 151.04 ? 174  GLY A O   1 
ATOM   1338  N  N   . CYS A  1  175  ? -20.891 -50.209  -92.862  1.00 431.20 ? 175  CYS A N   1 
ATOM   1339  C  CA  . CYS A  1  175  ? -19.722 -50.873  -93.423  1.00 404.58 ? 175  CYS A CA  1 
ATOM   1340  C  C   . CYS A  1  175  ? -19.837 -52.388  -93.308  1.00 367.61 ? 175  CYS A C   1 
ATOM   1341  O  O   . CYS A  1  175  ? -20.601 -53.019  -94.041  1.00 292.82 ? 175  CYS A O   1 
ATOM   1342  C  CB  . CYS A  1  175  ? -18.447 -50.389  -92.729  1.00 382.05 ? 175  CYS A CB  1 
ATOM   1343  S  SG  . CYS A  1  175  ? -16.985 -50.345  -93.794  1.00 260.75 ? 175  CYS A SG  1 
ATOM   1344  N  N   . GLY A  1  176  ? -19.080 -52.967  -92.383  1.00 474.63 ? 176  GLY A N   1 
ATOM   1345  C  CA  . GLY A  1  176  ? -19.097 -54.402  -92.169  1.00 478.85 ? 176  GLY A CA  1 
ATOM   1346  C  C   . GLY A  1  176  ? -18.192 -54.830  -91.031  1.00 476.38 ? 176  GLY A C   1 
ATOM   1347  O  O   . GLY A  1  176  ? -18.620 -55.535  -90.114  1.00 480.24 ? 176  GLY A O   1 
ATOM   1348  N  N   . ALA A  1  177  ? -16.934 -54.404  -91.089  1.00 444.31 ? 177  ALA A N   1 
ATOM   1349  C  CA  . ALA A  1  177  ? -15.961 -54.744  -90.058  1.00 439.76 ? 177  ALA A CA  1 
ATOM   1350  C  C   . ALA A  1  177  ? -14.547 -54.786  -90.628  1.00 433.12 ? 177  ALA A C   1 
ATOM   1351  O  O   . ALA A  1  177  ? -14.298 -54.308  -91.735  1.00 431.21 ? 177  ALA A O   1 
ATOM   1352  C  CB  . ALA A  1  177  ? -16.315 -56.075  -89.413  1.00 445.90 ? 177  ALA A CB  1 
ATOM   1353  N  N   . ALA A  1  178  ? -13.623 -55.361  -89.865  1.00 506.62 ? 178  ALA A N   1 
ATOM   1354  C  CA  . ALA A  1  178  ? -13.949 -55.918  -88.557  1.00 509.66 ? 178  ALA A CA  1 
ATOM   1355  C  C   . ALA A  1  178  ? -14.527 -57.324  -88.685  1.00 517.56 ? 178  ALA A C   1 
ATOM   1356  O  O   . ALA A  1  178  ? -14.728 -57.824  -89.791  1.00 520.54 ? 178  ALA A O   1 
ATOM   1357  C  CB  . ALA A  1  178  ? -14.918 -55.010  -87.819  1.00 511.07 ? 178  ALA A CB  1 
ATOM   1358  N  N   . GLN A  1  179  ? -14.793 -57.956  -87.546  1.00 226.09 ? 179  GLN A N   1 
ATOM   1359  C  CA  . GLN A  1  179  ? -15.350 -59.302  -87.528  1.00 232.99 ? 179  GLN A CA  1 
ATOM   1360  C  C   . GLN A  1  179  ? -14.304 -60.327  -87.097  1.00 228.65 ? 179  GLN A C   1 
ATOM   1361  O  O   . GLN A  1  179  ? -14.634 -61.474  -86.795  1.00 227.88 ? 179  GLN A O   1 
ATOM   1362  C  CB  . GLN A  1  179  ? -15.910 -59.669  -88.904  1.00 236.96 ? 179  GLN A CB  1 
ATOM   1363  C  CG  . GLN A  1  179  ? -16.859 -58.633  -89.484  1.00 242.47 ? 179  GLN A CG  1 
ATOM   1364  C  CD  . GLN A  1  179  ? -16.859 -58.628  -91.000  1.00 245.01 ? 179  GLN A CD  1 
ATOM   1365  O  OE1 . GLN A  1  179  ? -17.431 -59.513  -91.636  1.00 246.55 ? 179  GLN A OE1 1 
ATOM   1366  N  NE2 . GLN A  1  179  ? -16.217 -57.625  -91.589  1.00 241.75 ? 179  GLN A NE2 1 
ATOM   1367  N  N   . PRO A  1  180  ? -13.045 -59.904  -87.075  1.00 335.97 ? 180  PRO A N   1 
ATOM   1368  C  CA  . PRO A  1  180  ? -11.943 -60.789  -86.681  1.00 332.17 ? 180  PRO A CA  1 
ATOM   1369  C  C   . PRO A  1  180  ? -11.193 -60.255  -85.466  1.00 328.18 ? 180  PRO A C   1 
ATOM   1370  O  O   . PRO A  1  180  ? -10.664 -59.145  -85.508  1.00 320.31 ? 180  PRO A O   1 
ATOM   1371  C  CB  . PRO A  1  180  ? -11.033 -60.773  -87.910  1.00 328.13 ? 180  PRO A CB  1 
ATOM   1372  C  CG  . PRO A  1  180  ? -11.285 -59.449  -88.539  1.00 323.04 ? 180  PRO A CG  1 
ATOM   1373  C  CD  . PRO A  1  180  ? -12.738 -59.150  -88.302  1.00 329.56 ? 180  PRO A CD  1 
ATOM   1374  N  N   . THR A  1  181  ? -11.152 -61.043  -84.396  1.00 234.41 ? 181  THR A N   1 
ATOM   1375  C  CA  . THR A  1  181  ? -10.462 -60.643  -83.176  1.00 232.64 ? 181  THR A CA  1 
ATOM   1376  C  C   . THR A  1  181  ? -8.950  -60.768  -83.333  1.00 226.63 ? 181  THR A C   1 
ATOM   1377  O  O   . THR A  1  181  ? -8.447  -60.989  -84.434  1.00 224.90 ? 181  THR A O   1 
ATOM   1378  C  CB  . THR A  1  181  ? -10.914 -61.484  -81.969  1.00 237.74 ? 181  THR A CB  1 
ATOM   1379  O  OG1 . THR A  1  181  ? -12.311 -61.782  -82.088  1.00 242.85 ? 181  THR A OG1 1 
ATOM   1380  C  CG2 . THR A  1  181  ? -10.670 -60.730  -80.671  1.00 237.60 ? 181  THR A CG2 1 
ATOM   1381  N  N   . ILE A  1  182  ? -8.231  -60.627  -82.224  1.00 254.25 ? 182  ILE A N   1 
ATOM   1382  C  CA  . ILE A  1  182  ? -6.780  -60.726  -82.239  1.00 247.57 ? 182  ILE A CA  1 
ATOM   1383  C  C   . ILE A  1  182  ? -6.154  -61.134  -80.910  1.00 246.08 ? 182  ILE A C   1 
ATOM   1384  O  O   . ILE A  1  182  ? -6.699  -60.864  -79.836  1.00 247.26 ? 182  ILE A O   1 
ATOM   1385  C  CB  . ILE A  1  182  ? -6.143  -59.405  -82.685  1.00 231.73 ? 182  ILE A CB  1 
ATOM   1386  C  CG1 . ILE A  1  182  ? -6.955  -58.791  -83.823  1.00 231.90 ? 182  ILE A CG1 1 
ATOM   1387  C  CG2 . ILE A  1  182  ? -4.728  -59.662  -83.169  1.00 224.58 ? 182  ILE A CG2 1 
ATOM   1388  C  CD1 . ILE A  1  182  ? -6.461  -57.432  -84.261  1.00 217.76 ? 182  ILE A CD1 1 
ATOM   1389  N  N   . ARG A  1  183  ? -5.000  -61.789  -81.007  1.00 295.79 ? 183  ARG A N   1 
ATOM   1390  C  CA  . ARG A  1  183  ? -4.264  -62.250  -79.841  1.00 293.84 ? 183  ARG A CA  1 
ATOM   1391  C  C   . ARG A  1  183  ? -2.776  -61.932  -79.997  1.00 280.00 ? 183  ARG A C   1 
ATOM   1392  O  O   . ARG A  1  183  ? -2.269  -61.774  -81.111  1.00 275.02 ? 183  ARG A O   1 
ATOM   1393  C  CB  . ARG A  1  183  ? -4.473  -63.759  -79.657  1.00 306.52 ? 183  ARG A CB  1 
ATOM   1394  C  CG  . ARG A  1  183  ? -4.130  -64.578  -80.891  1.00 308.67 ? 183  ARG A CG  1 
ATOM   1395  C  CD  . ARG A  1  183  ? -4.262  -66.082  -80.663  1.00 307.32 ? 183  ARG A CD  1 
ATOM   1396  N  NE  . ARG A  1  183  ? -3.713  -66.834  -81.792  1.00 300.79 ? 183  ARG A NE  1 
ATOM   1397  C  CZ  . ARG A  1  183  ? -3.624  -68.158  -81.851  1.00 294.17 ? 183  ARG A CZ  1 
ATOM   1398  N  NH1 . ARG A  1  183  ? -4.048  -68.903  -80.836  1.00 294.83 ? 183  ARG A NH1 1 
ATOM   1399  N  NH2 . ARG A  1  183  ? -3.100  -68.741  -82.924  1.00 286.06 ? 183  ARG A NH2 1 
ATOM   1400  N  N   . LYS A  1  184  ? -2.083  -61.832  -78.867  1.00 276.69 ? 184  LYS A N   1 
ATOM   1401  C  CA  . LYS A  1  184  ? -0.661  -61.513  -78.850  1.00 263.66 ? 184  LYS A CA  1 
ATOM   1402  C  C   . LYS A  1  184  ? 0.211   -62.752  -78.735  1.00 268.45 ? 184  LYS A C   1 
ATOM   1403  O  O   . LYS A  1  184  ? 0.140   -63.493  -77.754  1.00 275.15 ? 184  LYS A O   1 
ATOM   1404  C  CB  . LYS A  1  184  ? -0.363  -60.569  -77.677  1.00 254.20 ? 184  LYS A CB  1 
ATOM   1405  C  CG  . LYS A  1  184  ? 1.114   -60.262  -77.441  1.00 242.90 ? 184  LYS A CG  1 
ATOM   1406  C  CD  . LYS A  1  184  ? 1.294   -59.362  -76.220  1.00 233.25 ? 184  LYS A CD  1 
ATOM   1407  C  CE  . LYS A  1  184  ? 2.755   -59.067  -75.949  1.00 223.11 ? 184  LYS A CE  1 
ATOM   1408  N  NZ  . LYS A  1  184  ? 2.929   -58.162  -74.783  1.00 215.17 ? 184  LYS A NZ  1 
ATOM   1409  N  N   . ASP A  1  185  ? 1.039   -62.972  -79.750  1.00 436.37 ? 185  ASP A N   1 
ATOM   1410  C  CA  . ASP A  1  185  ? 1.957   -64.103  -79.767  1.00 439.13 ? 185  ASP A CA  1 
ATOM   1411  C  C   . ASP A  1  185  ? 3.340   -63.482  -79.932  1.00 426.97 ? 185  ASP A C   1 
ATOM   1412  O  O   . ASP A  1  185  ? 3.635   -62.892  -80.972  1.00 420.57 ? 185  ASP A O   1 
ATOM   1413  C  CB  . ASP A  1  185  ? 1.639   -65.032  -80.950  1.00 445.97 ? 185  ASP A CB  1 
ATOM   1414  C  CG  . ASP A  1  185  ? 2.370   -66.382  -80.872  1.00 449.94 ? 185  ASP A CG  1 
ATOM   1415  O  OD1 . ASP A  1  185  ? 3.619   -66.397  -80.872  1.00 445.71 ? 185  ASP A OD1 1 
ATOM   1416  O  OD2 . ASP A  1  185  ? 1.687   -67.433  -80.823  1.00 451.54 ? 185  ASP A OD2 1 
ATOM   1417  N  N   . GLY A  1  186  ? 4.176   -63.592  -78.901  1.00 261.63 ? 186  GLY A N   1 
ATOM   1418  C  CA  . GLY A  1  186  ? 5.508   -63.022  -78.976  1.00 247.21 ? 186  GLY A CA  1 
ATOM   1419  C  C   . GLY A  1  186  ? 5.428   -61.564  -79.379  1.00 232.63 ? 186  GLY A C   1 
ATOM   1420  O  O   . GLY A  1  186  ? 4.662   -60.800  -78.796  1.00 229.12 ? 186  GLY A O   1 
ATOM   1421  N  N   . LEU A  1  187  ? 6.203   -61.177  -80.388  1.00 187.97 ? 187  LEU A N   1 
ATOM   1422  C  CA  . LEU A  1  187  ? 6.201   -59.797  -80.858  1.00 175.50 ? 187  LEU A CA  1 
ATOM   1423  C  C   . LEU A  1  187  ? 5.415   -59.609  -82.157  1.00 176.72 ? 187  LEU A C   1 
ATOM   1424  O  O   . LEU A  1  187  ? 5.698   -58.695  -82.938  1.00 167.87 ? 187  LEU A O   1 
ATOM   1425  C  CB  . LEU A  1  187  ? 7.630   -59.303  -81.076  1.00 165.78 ? 187  LEU A CB  1 
ATOM   1426  C  CG  . LEU A  1  187  ? 8.607   -59.394  -79.904  1.00 162.48 ? 187  LEU A CG  1 
ATOM   1427  C  CD1 . LEU A  1  187  ? 9.844   -58.592  -80.255  1.00 151.86 ? 187  LEU A CD1 1 
ATOM   1428  C  CD2 . LEU A  1  187  ? 7.982   -58.855  -78.635  1.00 160.54 ? 187  LEU A CD2 1 
ATOM   1429  N  N   . ARG A  1  188  ? 4.437   -60.480  -82.384  1.00 319.17 ? 188  ARG A N   1 
ATOM   1430  C  CA  . ARG A  1  188  ? 3.627   -60.417  -83.596  1.00 321.66 ? 188  ARG A CA  1 
ATOM   1431  C  C   . ARG A  1  188  ? 2.138   -60.513  -83.280  1.00 328.75 ? 188  ARG A C   1 
ATOM   1432  O  O   . ARG A  1  188  ? 1.744   -61.128  -82.289  1.00 335.49 ? 188  ARG A O   1 
ATOM   1433  C  CB  . ARG A  1  188  ? 4.031   -61.527  -84.567  1.00 213.08 ? 188  ARG A CB  1 
ATOM   1434  C  CG  . ARG A  1  188  ? 5.531   -61.658  -84.772  1.00 207.55 ? 188  ARG A CG  1 
ATOM   1435  C  CD  . ARG A  1  188  ? 5.930   -61.288  -86.189  1.00 202.95 ? 188  ARG A CD  1 
ATOM   1436  N  NE  . ARG A  1  188  ? 7.185   -60.542  -86.229  1.00 191.72 ? 188  ARG A NE  1 
ATOM   1437  C  CZ  . ARG A  1  188  ? 8.235   -60.883  -86.971  1.00 190.60 ? 188  ARG A CZ  1 
ATOM   1438  N  NH1 . ARG A  1  188  ? 8.185   -61.963  -87.738  1.00 199.90 ? 188  ARG A NH1 1 
ATOM   1439  N  NH2 . ARG A  1  188  ? 9.334   -60.144  -86.944  1.00 180.67 ? 188  ARG A NH2 1 
ATOM   1440  N  N   . LEU A  1  189  ? 1.321   -59.901  -84.130  1.00 288.40 ? 189  LEU A N   1 
ATOM   1441  C  CA  . LEU A  1  189  ? -0.122  -59.926  -83.953  1.00 296.68 ? 189  LEU A CA  1 
ATOM   1442  C  C   . LEU A  1  189  ? -0.803  -60.890  -84.915  1.00 310.37 ? 189  LEU A C   1 
ATOM   1443  O  O   . LEU A  1  189  ? -0.543  -60.871  -86.118  1.00 309.19 ? 189  LEU A O   1 
ATOM   1444  C  CB  . LEU A  1  189  ? -0.685  -58.525  -84.152  1.00 286.32 ? 189  LEU A CB  1 
ATOM   1445  C  CG  . LEU A  1  189  ? -0.314  -57.518  -83.073  1.00 274.24 ? 189  LEU A CG  1 
ATOM   1446  C  CD1 . LEU A  1  189  ? -0.727  -56.135  -83.505  1.00 265.50 ? 189  LEU A CD1 1 
ATOM   1447  C  CD2 . LEU A  1  189  ? -0.994  -57.905  -81.776  1.00 279.80 ? 189  LEU A CD2 1 
ATOM   1448  N  N   . TRP A  1  190  ? -1.682  -61.732  -84.378  1.00 491.65 ? 190  TRP A N   1 
ATOM   1449  C  CA  . TRP A  1  190  ? -2.397  -62.705  -85.200  1.00 501.89 ? 190  TRP A CA  1 
ATOM   1450  C  C   . TRP A  1  190  ? -3.897  -62.673  -84.939  1.00 511.10 ? 190  TRP A C   1 
ATOM   1451  O  O   . TRP A  1  190  ? -4.341  -62.364  -83.832  1.00 512.73 ? 190  TRP A O   1 
ATOM   1452  C  CB  . TRP A  1  190  ? -1.854  -64.112  -84.952  1.00 386.98 ? 190  TRP A CB  1 
ATOM   1453  C  CG  . TRP A  1  190  ? -0.436  -64.296  -85.405  1.00 380.22 ? 190  TRP A CG  1 
ATOM   1454  C  CD1 . TRP A  1  190  ? 0.344   -63.384  -86.055  1.00 371.37 ? 190  TRP A CD1 1 
ATOM   1455  C  CD2 . TRP A  1  190  ? 0.373   -65.467  -85.236  1.00 379.30 ? 190  TRP A CD2 1 
ATOM   1456  N  NE1 . TRP A  1  190  ? 1.585   -63.918  -86.306  1.00 367.84 ? 190  TRP A NE1 1 
ATOM   1457  C  CE2 . TRP A  1  190  ? 1.631   -65.193  -85.813  1.00 372.66 ? 190  TRP A CE2 1 
ATOM   1458  C  CE3 . TRP A  1  190  ? 0.162   -66.724  -84.658  1.00 379.86 ? 190  TRP A CE3 1 
ATOM   1459  C  CZ2 . TRP A  1  190  ? 2.667   -66.127  -85.825  1.00 369.77 ? 190  TRP A CZ2 1 
ATOM   1460  C  CZ3 . TRP A  1  190  ? 1.192   -67.646  -84.673  1.00 373.70 ? 190  TRP A CZ3 1 
ATOM   1461  C  CH2 . TRP A  1  190  ? 2.428   -67.343  -85.251  1.00 369.19 ? 190  TRP A CH2 1 
ATOM   1462  N  N   . GLY A  1  191  ? -4.669  -62.999  -85.971  1.00 242.76 ? 191  GLY A N   1 
ATOM   1463  C  CA  . GLY A  1  191  ? -6.111  -63.007  -85.834  1.00 249.02 ? 191  GLY A CA  1 
ATOM   1464  C  C   . GLY A  1  191  ? -6.784  -63.983  -86.778  1.00 249.71 ? 191  GLY A C   1 
ATOM   1465  O  O   . GLY A  1  191  ? -6.249  -64.297  -87.843  1.00 246.03 ? 191  GLY A O   1 
ATOM   1466  N  N   . SER A  1  192  ? -7.963  -64.457  -86.381  1.00 350.26 ? 192  SER A N   1 
ATOM   1467  C  CA  . SER A  1  192  ? -8.743  -65.396  -87.178  1.00 344.51 ? 192  SER A CA  1 
ATOM   1468  C  C   . SER A  1  192  ? -9.912  -64.665  -87.823  1.00 351.47 ? 192  SER A C   1 
ATOM   1469  O  O   . SER A  1  192  ? -10.327 -63.608  -87.354  1.00 360.63 ? 192  SER A O   1 
ATOM   1470  C  CB  . SER A  1  192  ? -9.281  -66.541  -86.303  1.00 335.93 ? 192  SER A CB  1 
ATOM   1471  O  OG  . SER A  1  192  ? -10.347 -66.114  -85.470  1.00 341.54 ? 192  SER A OG  1 
ATOM   1472  N  N   . TRP A  1  193  ? -10.440 -65.236  -88.901  1.00 254.08 ? 193  TRP A N   1 
ATOM   1473  C  CA  . TRP A  1  193  ? -11.565 -64.639  -89.611  1.00 260.62 ? 193  TRP A CA  1 
ATOM   1474  C  C   . TRP A  1  193  ? -12.648 -65.674  -89.895  1.00 250.37 ? 193  TRP A C   1 
ATOM   1475  O  O   . TRP A  1  193  ? -12.530 -66.471  -90.826  1.00 240.40 ? 193  TRP A O   1 
ATOM   1476  C  CB  . TRP A  1  193  ? -11.094 -63.999  -90.918  1.00 266.01 ? 193  TRP A CB  1 
ATOM   1477  C  CG  . TRP A  1  193  ? -10.300 -62.744  -90.720  1.00 274.05 ? 193  TRP A CG  1 
ATOM   1478  C  CD1 . TRP A  1  193  ? -10.785 -61.472  -90.629  1.00 278.38 ? 193  TRP A CD1 1 
ATOM   1479  C  CD2 . TRP A  1  193  ? -8.877  -62.641  -90.589  1.00 271.70 ? 193  TRP A CD2 1 
ATOM   1480  N  NE1 . TRP A  1  193  ? -9.753  -60.583  -90.449  1.00 274.23 ? 193  TRP A NE1 1 
ATOM   1481  C  CE2 . TRP A  1  193  ? -8.571  -61.276  -90.420  1.00 270.90 ? 193  TRP A CE2 1 
ATOM   1482  C  CE3 . TRP A  1  193  ? -7.832  -63.569  -90.597  1.00 267.25 ? 193  TRP A CE3 1 
ATOM   1483  C  CZ2 . TRP A  1  193  ? -7.265  -60.817  -90.263  1.00 265.93 ? 193  TRP A CZ2 1 
ATOM   1484  C  CZ3 . TRP A  1  193  ? -6.536  -63.112  -90.439  1.00 265.62 ? 193  TRP A CZ3 1 
ATOM   1485  C  CH2 . TRP A  1  193  ? -6.265  -61.749  -90.274  1.00 263.95 ? 193  TRP A CH2 1 
ATOM   1486  N  N   . LYS A  1  194  ? -13.702 -65.656  -89.085  1.00 257.63 ? 194  LYS A N   1 
ATOM   1487  C  CA  . LYS A  1  194  ? -14.808 -66.593  -89.247  1.00 248.56 ? 194  LYS A CA  1 
ATOM   1488  C  C   . LYS A  1  194  ? -16.138 -65.861  -89.381  1.00 255.43 ? 194  LYS A C   1 
ATOM   1489  O  O   . LYS A  1  194  ? -16.204 -64.640  -89.236  1.00 267.86 ? 194  LYS A O   1 
ATOM   1490  C  CB  . LYS A  1  194  ? -14.861 -67.569  -88.068  1.00 242.62 ? 194  LYS A CB  1 
ATOM   1491  C  CG  . LYS A  1  194  ? -16.263 -68.030  -87.707  1.00 239.09 ? 194  LYS A CG  1 
ATOM   1492  C  CD  . LYS A  1  194  ? -16.228 -69.179  -86.714  1.00 234.94 ? 194  LYS A CD  1 
ATOM   1493  C  CE  . LYS A  1  194  ? -14.993 -70.044  -86.913  1.00 228.46 ? 194  LYS A CE  1 
ATOM   1494  N  NZ  . LYS A  1  194  ? -14.817 -71.025  -85.807  1.00 227.67 ? 194  LYS A NZ  1 
ATOM   1495  N  N   . ARG A  1  195  ? -17.197 -66.615  -89.659  1.00 245.49 ? 195  ARG A N   1 
ATOM   1496  C  CA  . ARG A  1  195  ? -18.528 -66.039  -89.813  1.00 250.75 ? 195  ARG A CA  1 
ATOM   1497  C  C   . ARG A  1  195  ? -19.570 -66.846  -89.047  1.00 243.49 ? 195  ARG A C   1 
ATOM   1498  O  O   . ARG A  1  195  ? -20.050 -66.420  -87.996  1.00 250.11 ? 195  ARG A O   1 
ATOM   1499  C  CB  . ARG A  1  195  ? -18.910 -65.957  -91.293  1.00 249.07 ? 195  ARG A CB  1 
ATOM   1500  C  CG  . ARG A  1  195  ? -20.404 -66.046  -91.554  1.00 245.87 ? 195  ARG A CG  1 
ATOM   1501  C  CD  . ARG A  1  195  ? -21.143 -64.871  -90.935  1.00 257.65 ? 195  ARG A CD  1 
ATOM   1502  N  NE  . ARG A  1  195  ? -22.340 -64.517  -91.693  1.00 259.84 ? 195  ARG A NE  1 
ATOM   1503  C  CZ  . ARG A  1  195  ? -23.552 -64.398  -91.162  1.00 261.04 ? 195  ARG A CZ  1 
ATOM   1504  N  NH1 . ARG A  1  195  ? -23.733 -64.606  -89.865  1.00 260.69 ? 195  ARG A NH1 1 
ATOM   1505  N  NH2 . ARG A  1  195  ? -24.585 -64.072  -91.926  1.00 263.08 ? 195  ARG A NH2 1 
ATOM   1506  N  N   . GLY A  1  196  ? -19.917 -68.013  -89.581  1.00 212.39 ? 196  GLY A N   1 
ATOM   1507  C  CA  . GLY A  1  196  ? -19.334 -68.488  -90.822  1.00 205.58 ? 196  GLY A CA  1 
ATOM   1508  C  C   . GLY A  1  196  ? -19.946 -69.793  -91.288  1.00 194.36 ? 196  GLY A C   1 
ATOM   1509  O  O   . GLY A  1  196  ? -21.102 -70.091  -90.986  1.00 192.93 ? 196  GLY A O   1 
ATOM   1510  N  N   . LYS A  1  197  ? -19.167 -70.575  -92.028  1.00 169.46 ? 197  LYS A N   1 
ATOM   1511  C  CA  . LYS A  1  197  ? -19.633 -71.857  -92.540  1.00 162.84 ? 197  LYS A CA  1 
ATOM   1512  C  C   . LYS A  1  197  ? -19.446 -71.951  -94.051  1.00 158.39 ? 197  LYS A C   1 
ATOM   1513  O  O   . LYS A  1  197  ? -20.393 -72.220  -94.789  1.00 155.16 ? 197  LYS A O   1 
ATOM   1514  C  CB  . LYS A  1  197  ? -21.104 -72.075  -92.180  1.00 163.21 ? 197  LYS A CB  1 
ATOM   1515  C  CG  . LYS A  1  197  ? -21.343 -73.217  -91.207  1.00 164.49 ? 197  LYS A CG  1 
ATOM   1516  C  CD  . LYS A  1  197  ? -20.442 -73.102  -89.989  1.00 168.56 ? 197  LYS A CD  1 
ATOM   1517  C  CE  . LYS A  1  197  ? -19.625 -74.368  -89.784  1.00 167.33 ? 197  LYS A CE  1 
ATOM   1518  N  NZ  . LYS A  1  197  ? -19.901 -74.999  -88.463  1.00 172.55 ? 197  LYS A NZ  1 
ATOM   1519  N  N   . ASP A  1  198  ? -18.217 -71.726  -94.505  1.00 240.72 ? 198  ASP A N   1 
ATOM   1520  C  CA  . ASP A  1  198  ? -17.901 -71.784  -95.927  1.00 237.34 ? 198  ASP A CA  1 
ATOM   1521  C  C   . ASP A  1  198  ? -16.408 -71.588  -96.169  1.00 237.83 ? 198  ASP A C   1 
ATOM   1522  O  O   . ASP A  1  198  ? -15.904 -71.864  -97.258  1.00 238.52 ? 198  ASP A O   1 
ATOM   1523  C  CB  . ASP A  1  198  ? -18.700 -70.730  -96.694  1.00 240.39 ? 198  ASP A CB  1 
ATOM   1524  C  CG  . ASP A  1  198  ? -18.590 -69.351  -96.079  1.00 240.62 ? 198  ASP A CG  1 
ATOM   1525  O  OD1 . ASP A  1  198  ? -18.133 -69.249  -94.920  1.00 237.02 ? 198  ASP A OD1 1 
ATOM   1526  O  OD2 . ASP A  1  198  ? -18.959 -68.365  -96.752  1.00 247.04 ? 198  ASP A OD2 1 
ATOM   1527  N  N   . GLU A  1  199  ? -15.706 -71.111  -95.147  1.00 265.81 ? 199  GLU A N   1 
ATOM   1528  C  CA  . GLU A  1  199  ? -14.270 -70.878  -95.246  1.00 266.51 ? 199  GLU A CA  1 
ATOM   1529  C  C   . GLU A  1  199  ? -13.852 -69.657  -94.433  1.00 269.61 ? 199  GLU A C   1 
ATOM   1530  O  O   . GLU A  1  199  ? -14.411 -68.572  -94.594  1.00 273.54 ? 199  GLU A O   1 
ATOM   1531  C  CB  . GLU A  1  199  ? -13.855 -70.704  -96.708  1.00 267.09 ? 199  GLU A CB  1 
ATOM   1532  C  CG  . GLU A  1  199  ? -12.396 -71.032  -96.983  1.00 266.49 ? 199  GLU A CG  1 
ATOM   1533  C  CD  . GLU A  1  199  ? -11.895 -70.418  -98.275  1.00 268.41 ? 199  GLU A CD  1 
ATOM   1534  O  OE1 . GLU A  1  199  ? -11.314 -69.313  -98.224  1.00 271.74 ? 199  GLU A OE1 1 
ATOM   1535  O  OE2 . GLU A  1  199  ? -12.080 -71.040  -99.342  1.00 266.96 ? 199  GLU A OE2 1 
ATOM   1536  N  N   . SER A  1  200  ? -12.866 -69.841  -93.562  1.00 237.67 ? 200  SER A N   1 
ATOM   1537  C  CA  . SER A  1  200  ? -12.372 -68.755  -92.723  1.00 248.09 ? 200  SER A CA  1 
ATOM   1538  C  C   . SER A  1  200  ? -10.999 -69.085  -92.146  1.00 248.00 ? 200  SER A C   1 
ATOM   1539  O  O   . SER A  1  200  ? -10.186 -69.746  -92.792  1.00 242.50 ? 200  SER A O   1 
ATOM   1540  C  CB  . SER A  1  200  ? -13.360 -68.458  -91.593  1.00 255.58 ? 200  SER A CB  1 
ATOM   1541  O  OG  . SER A  1  200  ? -14.666 -68.896  -91.929  1.00 253.26 ? 200  SER A OG  1 
ATOM   1542  N  N   . ASP A  1  201  ? -10.749 -68.620  -90.927  1.00 430.89 ? 201  ASP A N   1 
ATOM   1543  C  CA  . ASP A  1  201  ? -9.475  -68.865  -90.260  1.00 431.79 ? 201  ASP A CA  1 
ATOM   1544  C  C   . ASP A  1  201  ? -9.584  -68.626  -88.758  1.00 436.99 ? 201  ASP A C   1 
ATOM   1545  O  O   . ASP A  1  201  ? -10.367 -67.789  -88.307  1.00 446.54 ? 201  ASP A O   1 
ATOM   1546  C  CB  . ASP A  1  201  ? -8.380  -67.979  -90.856  1.00 441.74 ? 201  ASP A CB  1 
ATOM   1547  C  CG  . ASP A  1  201  ? -8.031  -68.361  -92.281  1.00 441.37 ? 201  ASP A CG  1 
ATOM   1548  O  OD1 . ASP A  1  201  ? -7.229  -69.301  -92.466  1.00 438.61 ? 201  ASP A OD1 1 
ATOM   1549  O  OD2 . ASP A  1  201  ? -8.558  -67.721  -93.215  1.00 444.27 ? 201  ASP A OD2 1 
ATOM   1550  N  N   . LEU A  1  202  ? -8.794  -69.367  -87.987  1.00 309.18 ? 202  LEU A N   1 
ATOM   1551  C  CA  . LEU A  1  202  ? -8.801  -69.238  -86.535  1.00 314.39 ? 202  LEU A CA  1 
ATOM   1552  C  C   . LEU A  1  202  ? -7.453  -68.747  -86.018  1.00 319.94 ? 202  LEU A C   1 
ATOM   1553  O  O   . LEU A  1  202  ? -6.810  -67.900  -86.638  1.00 323.86 ? 202  LEU A O   1 
ATOM   1554  C  CB  . LEU A  1  202  ? -9.161  -70.573  -85.880  1.00 307.39 ? 202  LEU A CB  1 
ATOM   1555  C  CG  . LEU A  1  202  ? -10.002 -71.535  -86.720  1.00 300.62 ? 202  LEU A CG  1 
ATOM   1556  C  CD1 . LEU A  1  202  ? -9.110  -72.435  -87.562  1.00 295.20 ? 202  LEU A CD1 1 
ATOM   1557  C  CD2 . LEU A  1  202  ? -10.920 -72.363  -85.833  1.00 302.11 ? 202  LEU A CD2 1 
ATOM   1558  N  N   . PRO A  1  203  ? -7.030  -69.285  -84.879  1.00 375.10 ? 203  PRO A N   1 
ATOM   1559  C  CA  . PRO A  1  203  ? -5.751  -68.901  -84.272  1.00 381.62 ? 203  PRO A CA  1 
ATOM   1560  C  C   . PRO A  1  203  ? -4.594  -69.729  -84.819  1.00 373.00 ? 203  PRO A C   1 
ATOM   1561  O  O   . PRO A  1  203  ? -4.406  -70.874  -84.408  1.00 371.33 ? 203  PRO A O   1 
ATOM   1562  C  CB  . PRO A  1  203  ? -5.966  -69.210  -82.790  1.00 385.79 ? 203  PRO A CB  1 
ATOM   1563  C  CG  . PRO A  1  203  ? -6.970  -70.307  -82.781  1.00 378.35 ? 203  PRO A CG  1 
ATOM   1564  C  CD  . PRO A  1  203  ? -7.886  -70.033  -83.941  1.00 373.93 ? 203  PRO A CD  1 
ATOM   1565  N  N   . GLU A  1  204  ? -3.827  -69.150  -85.737  1.00 285.11 ? 204  GLU A N   1 
ATOM   1566  C  CA  . GLU A  1  204  ? -2.690  -69.840  -86.334  1.00 278.90 ? 204  GLU A CA  1 
ATOM   1567  C  C   . GLU A  1  204  ? -1.712  -68.851  -86.958  1.00 282.93 ? 204  GLU A C   1 
ATOM   1568  O  O   . GLU A  1  204  ? -0.515  -68.882  -86.676  1.00 283.90 ? 204  GLU A O   1 
ATOM   1569  C  CB  . GLU A  1  204  ? -3.163  -70.846  -87.384  1.00 270.16 ? 204  GLU A CB  1 
ATOM   1570  C  CG  . GLU A  1  204  ? -2.836  -72.292  -87.049  1.00 266.86 ? 204  GLU A CG  1 
ATOM   1571  C  CD  . GLU A  1  204  ? -4.068  -73.176  -87.014  1.00 264.86 ? 204  GLU A CD  1 
ATOM   1572  O  OE1 . GLU A  1  204  ? -4.597  -73.503  -88.097  1.00 260.57 ? 204  GLU A OE1 1 
ATOM   1573  O  OE2 . GLU A  1  204  ? -4.507  -73.543  -85.904  1.00 268.02 ? 204  GLU A OE2 1 
ATOM   1574  N  N   . LYS A  1  205  ? -2.231  -67.973  -87.811  1.00 311.73 ? 205  LYS A N   1 
ATOM   1575  C  CA  . LYS A  1  205  ? -1.408  -66.971  -88.476  1.00 319.57 ? 205  LYS A CA  1 
ATOM   1576  C  C   . LYS A  1  205  ? -2.235  -65.751  -88.870  1.00 328.25 ? 205  LYS A C   1 
ATOM   1577  O  O   . LYS A  1  205  ? -3.301  -65.504  -88.307  1.00 331.77 ? 205  LYS A O   1 
ATOM   1578  C  CB  . LYS A  1  205  ? -0.733  -67.567  -89.712  1.00 309.75 ? 205  LYS A CB  1 
ATOM   1579  C  CG  . LYS A  1  205  ? -1.586  -68.575  -90.461  1.00 298.46 ? 205  LYS A CG  1 
ATOM   1580  C  CD  . LYS A  1  205  ? -0.953  -68.958  -91.790  1.00 292.22 ? 205  LYS A CD  1 
ATOM   1581  C  CE  . LYS A  1  205  ? -0.477  -70.401  -91.778  1.00 285.01 ? 205  LYS A CE  1 
ATOM   1582  N  NZ  . LYS A  1  205  ? 0.659   -70.618  -92.717  1.00 284.17 ? 205  LYS A NZ  1 
ATOM   1583  N  N   . ARG A  1  206  ? -1.737  -64.990  -89.839  1.00 389.77 ? 206  ARG A N   1 
ATOM   1584  C  CA  . ARG A  1  206  ? -2.426  -63.794  -90.308  1.00 391.39 ? 206  ARG A CA  1 
ATOM   1585  C  C   . ARG A  1  206  ? -2.042  -62.576  -89.476  1.00 386.08 ? 206  ARG A C   1 
ATOM   1586  O  O   . ARG A  1  206  ? -2.602  -62.341  -88.406  1.00 388.47 ? 206  ARG A O   1 
ATOM   1587  C  CB  . ARG A  1  206  ? -3.941  -64.000  -90.269  1.00 396.94 ? 206  ARG A CB  1 
ATOM   1588  C  CG  . ARG A  1  206  ? -4.393  -65.377  -90.730  1.00 392.73 ? 206  ARG A CG  1 
ATOM   1589  C  CD  . ARG A  1  206  ? -4.607  -66.311  -89.551  1.00 383.13 ? 206  ARG A CD  1 
ATOM   1590  N  NE  . ARG A  1  206  ? -4.116  -67.658  -89.824  1.00 368.08 ? 206  ARG A NE  1 
ATOM   1591  C  CZ  . ARG A  1  206  ? -4.899  -68.711  -90.037  1.00 357.06 ? 206  ARG A CZ  1 
ATOM   1592  N  NH1 . ARG A  1  206  ? -6.218  -68.575  -90.010  1.00 358.07 ? 206  ARG A NH1 1 
ATOM   1593  N  NH2 . ARG A  1  206  ? -4.365  -69.900  -90.278  1.00 346.90 ? 206  ARG A NH2 1 
ATOM   1594  N  N   . LEU A  1  207  ? -1.083  -61.802  -89.977  1.00 430.70 ? 207  LEU A N   1 
ATOM   1595  C  CA  . LEU A  1  207  ? -0.623  -60.607  -89.281  1.00 415.77 ? 207  LEU A CA  1 
ATOM   1596  C  C   . LEU A  1  207  ? -1.258  -59.349  -89.867  1.00 403.72 ? 207  LEU A C   1 
ATOM   1597  O  O   . LEU A  1  207  ? -2.232  -59.426  -90.616  1.00 412.42 ? 207  LEU A O   1 
ATOM   1598  C  CB  . LEU A  1  207  ? 0.903   -60.503  -89.347  1.00 292.89 ? 207  LEU A CB  1 
ATOM   1599  C  CG  . LEU A  1  207  ? 1.614   -61.528  -90.232  1.00 304.81 ? 207  LEU A CG  1 
ATOM   1600  C  CD1 . LEU A  1  207  ? 1.659   -62.888  -89.549  1.00 303.75 ? 207  LEU A CD1 1 
ATOM   1601  C  CD2 . LEU A  1  207  ? 0.939   -61.626  -91.591  1.00 314.35 ? 207  LEU A CD2 1 
ATOM   1602  N  N   . LEU A  1  208  ? -0.699  -58.194  -89.522  1.00 399.16 ? 208  LEU A N   1 
ATOM   1603  C  CA  . LEU A  1  208  ? -1.209  -56.919  -90.013  1.00 387.63 ? 208  LEU A CA  1 
ATOM   1604  C  C   . LEU A  1  208  ? -0.072  -56.012  -90.473  1.00 382.41 ? 208  LEU A C   1 
ATOM   1605  O  O   . LEU A  1  208  ? 0.622   -56.314  -91.443  1.00 381.79 ? 208  LEU A O   1 
ATOM   1606  C  CB  . LEU A  1  208  ? -2.035  -56.221  -88.933  1.00 360.43 ? 208  LEU A CB  1 
ATOM   1607  C  CG  . LEU A  1  208  ? -1.424  -56.183  -87.530  1.00 310.25 ? 208  LEU A CG  1 
ATOM   1608  C  CD1 . LEU A  1  208  ? -0.255  -57.149  -87.426  1.00 281.73 ? 208  LEU A CD1 1 
ATOM   1609  C  CD2 . LEU A  1  208  ? -0.989  -54.770  -87.172  1.00 215.40 ? 208  LEU A CD2 1 
ATOM   1610  N  N   . SER A  1  209  ? 0.111   -54.898  -89.771  1.00 504.73 ? 209  SER A N   1 
ATOM   1611  C  CA  . SER A  1  209  ? 1.161   -53.945  -90.105  1.00 464.62 ? 209  SER A CA  1 
ATOM   1612  C  C   . SER A  1  209  ? 0.919   -52.598  -89.429  1.00 398.48 ? 209  SER A C   1 
ATOM   1613  O  O   . SER A  1  209  ? -0.132  -52.373  -88.831  1.00 403.64 ? 209  SER A O   1 
ATOM   1614  C  CB  . SER A  1  209  ? 1.257   -53.764  -91.621  1.00 450.80 ? 209  SER A CB  1 
ATOM   1615  O  OG  . SER A  1  209  ? -0.030  -53.692  -92.208  1.00 448.28 ? 209  SER A OG  1 
ATOM   1616  N  N   . PRO A  1  210  ? 1.900   -51.708  -89.531  1.00 257.84 ? 210  PRO A N   1 
ATOM   1617  C  CA  . PRO A  1  210  ? 1.795   -50.375  -88.929  1.00 243.93 ? 210  PRO A CA  1 
ATOM   1618  C  C   . PRO A  1  210  ? 1.229   -49.353  -89.910  1.00 240.75 ? 210  PRO A C   1 
ATOM   1619  O  O   . PRO A  1  210  ? 0.272   -48.652  -89.583  1.00 246.18 ? 210  PRO A O   1 
ATOM   1620  C  CB  . PRO A  1  210  ? 3.248   -50.033  -88.593  1.00 147.04 ? 210  PRO A CB  1 
ATOM   1621  C  CG  . PRO A  1  210  ? 4.047   -50.795  -89.589  1.00 147.72 ? 210  PRO A CG  1 
ATOM   1622  C  CD  . PRO A  1  210  ? 3.297   -52.075  -89.824  1.00 164.78 ? 210  PRO A CD  1 
ATOM   1623  N  N   . LEU A  1  211  ? 1.820   -49.275  -91.098  1.00 256.25 ? 211  LEU A N   1 
ATOM   1624  C  CA  . LEU A  1  211  ? 1.368   -48.338  -92.118  1.00 253.37 ? 211  LEU A CA  1 
ATOM   1625  C  C   . LEU A  1  211  ? -0.142  -48.419  -92.311  1.00 271.77 ? 211  LEU A C   1 
ATOM   1626  O  O   . LEU A  1  211  ? -0.800  -47.410  -92.566  1.00 270.51 ? 211  LEU A O   1 
ATOM   1627  C  CB  . LEU A  1  211  ? 2.083   -48.603  -93.444  1.00 171.08 ? 211  LEU A CB  1 
ATOM   1628  C  CG  . LEU A  1  211  ? 1.661   -47.730  -94.628  1.00 154.66 ? 211  LEU A CG  1 
ATOM   1629  C  CD1 . LEU A  1  211  ? 2.065   -46.282  -94.398  1.00 154.06 ? 211  LEU A CD1 1 
ATOM   1630  C  CD2 . LEU A  1  211  ? 2.259   -48.258  -95.923  1.00 139.04 ? 211  LEU A CD2 1 
ATOM   1631  N  N   . GLU A  1  212  ? -0.686  -49.625  -92.188  1.00 267.59 ? 212  GLU A N   1 
ATOM   1632  C  CA  . GLU A  1  212  ? -2.119  -49.841  -92.348  1.00 288.24 ? 212  GLU A CA  1 
ATOM   1633  C  C   . GLU A  1  212  ? -2.900  -49.235  -91.187  1.00 291.26 ? 212  GLU A C   1 
ATOM   1634  O  O   . GLU A  1  212  ? -3.875  -48.513  -91.392  1.00 296.42 ? 212  GLU A O   1 
ATOM   1635  C  CB  . GLU A  1  212  ? -2.426  -51.335  -92.467  1.00 234.81 ? 212  GLU A CB  1 
ATOM   1636  C  CG  . GLU A  1  212  ? -1.768  -52.012  -93.658  1.00 235.12 ? 212  GLU A CG  1 
ATOM   1637  C  CD  . GLU A  1  212  ? -2.016  -53.507  -93.690  1.00 256.71 ? 212  GLU A CD  1 
ATOM   1638  O  OE1 . GLU A  1  212  ? -2.491  -54.054  -92.672  1.00 269.41 ? 212  GLU A OE1 1 
ATOM   1639  O  OE2 . GLU A  1  212  ? -1.737  -54.135  -94.732  1.00 261.72 ? 212  GLU A OE2 1 
ATOM   1640  N  N   . VAL A  1  213  ? -2.465  -49.536  -89.967  1.00 199.39 ? 213  VAL A N   1 
ATOM   1641  C  CA  . VAL A  1  213  ? -3.123  -49.021  -88.772  1.00 202.11 ? 213  VAL A CA  1 
ATOM   1642  C  C   . VAL A  1  213  ? -3.135  -47.496  -88.764  1.00 188.56 ? 213  VAL A C   1 
ATOM   1643  O  O   . VAL A  1  213  ? -4.193  -46.874  -88.667  1.00 198.80 ? 213  VAL A O   1 
ATOM   1644  C  CB  . VAL A  1  213  ? -2.436  -49.527  -87.489  1.00 125.07 ? 213  VAL A CB  1 
ATOM   1645  C  CG1 . VAL A  1  213  ? -3.057  -48.874  -86.263  1.00 126.79 ? 213  VAL A CG1 1 
ATOM   1646  C  CG2 . VAL A  1  213  ? -2.531  -51.042  -87.400  1.00 142.65 ? 213  VAL A CG2 1 
ATOM   1647  N  N   . HIS A  1  214  ? -1.952  -46.899  -88.867  1.00 310.71 ? 214  HIS A N   1 
ATOM   1648  C  CA  . HIS A  1  214  ? -1.826  -45.447  -88.871  1.00 296.58 ? 214  HIS A CA  1 
ATOM   1649  C  C   . HIS A  1  214  ? -2.820  -44.810  -89.837  1.00 306.14 ? 214  HIS A C   1 
ATOM   1650  O  O   . HIS A  1  214  ? -3.553  -43.892  -89.472  1.00 310.07 ? 214  HIS A O   1 
ATOM   1651  C  CB  . HIS A  1  214  ? -0.399  -45.034  -89.240  1.00 202.55 ? 214  HIS A CB  1 
ATOM   1652  C  CG  . HIS A  1  214  ? -0.173  -43.555  -89.215  1.00 189.94 ? 214  HIS A CG  1 
ATOM   1653  N  ND1 . HIS A  1  214  ? -0.341  -42.794  -88.078  1.00 186.36 ? 214  HIS A ND1 1 
ATOM   1654  C  CD2 . HIS A  1  214  ? 0.209   -42.695  -90.189  1.00 180.97 ? 214  HIS A CD2 1 
ATOM   1655  C  CE1 . HIS A  1  214  ? -0.072  -41.530  -88.352  1.00 176.25 ? 214  HIS A CE1 1 
ATOM   1656  N  NE2 . HIS A  1  214  ? 0.264   -41.444  -89.627  1.00 172.88 ? 214  HIS A NE2 1 
ATOM   1657  N  N   . THR A  1  215  ? -2.840  -45.305  -91.070  1.00 262.12 ? 215  THR A N   1 
ATOM   1658  C  CA  . THR A  1  215  ? -3.744  -44.788  -92.090  1.00 269.88 ? 215  THR A CA  1 
ATOM   1659  C  C   . THR A  1  215  ? -5.182  -44.758  -91.584  1.00 288.77 ? 215  THR A C   1 
ATOM   1660  O  O   . THR A  1  215  ? -5.879  -43.751  -91.721  1.00 290.13 ? 215  THR A O   1 
ATOM   1661  C  CB  . THR A  1  215  ? -3.680  -45.626  -93.380  1.00 203.84 ? 215  THR A CB  1 
ATOM   1662  O  OG1 . THR A  1  215  ? -4.146  -46.956  -93.113  1.00 221.07 ? 215  THR A OG1 1 
ATOM   1663  C  CG2 . THR A  1  215  ? -2.253  -45.690  -93.904  1.00 185.28 ? 215  THR A CG2 1 
ATOM   1664  N  N   . ILE A  1  216  ? -5.623  -45.869  -91.001  1.00 265.72 ? 216  ILE A N   1 
ATOM   1665  C  CA  . ILE A  1  216  ? -6.978  -45.971  -90.473  1.00 286.96 ? 216  ILE A CA  1 
ATOM   1666  C  C   . ILE A  1  216  ? -7.228  -44.925  -89.391  1.00 281.69 ? 216  ILE A C   1 
ATOM   1667  O  O   . ILE A  1  216  ? -8.279  -44.285  -89.364  1.00 292.80 ? 216  ILE A O   1 
ATOM   1668  C  CB  . ILE A  1  216  ? -7.254  -47.371  -89.894  1.00 234.59 ? 216  ILE A CB  1 
ATOM   1669  C  CG1 . ILE A  1  216  ? -7.265  -48.417  -91.012  1.00 245.90 ? 216  ILE A CG1 1 
ATOM   1670  C  CG2 . ILE A  1  216  ? -8.571  -47.383  -89.133  1.00 256.57 ? 216  ILE A CG2 1 
ATOM   1671  C  CD1 . ILE A  1  216  ? -7.248  -49.844  -90.510  1.00 261.09 ? 216  ILE A CD1 1 
ATOM   1672  N  N   . PHE A  1  217  ? -6.255  -44.758  -88.502  1.00 327.02 ? 217  PHE A N   1 
ATOM   1673  C  CA  . PHE A  1  217  ? -6.366  -43.790  -87.418  1.00 321.38 ? 217  PHE A CA  1 
ATOM   1674  C  C   . PHE A  1  217  ? -6.524  -42.372  -87.959  1.00 314.65 ? 217  PHE A C   1 
ATOM   1675  O  O   . PHE A  1  217  ? -7.462  -41.662  -87.602  1.00 325.34 ? 217  PHE A O   1 
ATOM   1676  C  CB  . PHE A  1  217  ? -5.144  -43.868  -86.500  1.00 229.65 ? 217  PHE A CB  1 
ATOM   1677  C  CG  . PHE A  1  217  ? -5.019  -45.174  -85.769  1.00 238.12 ? 217  PHE A CG  1 
ATOM   1678  C  CD1 . PHE A  1  217  ? -6.104  -46.025  -85.650  1.00 251.56 ? 217  PHE A CD1 1 
ATOM   1679  C  CD2 . PHE A  1  217  ? -3.813  -45.553  -85.203  1.00 233.61 ? 217  PHE A CD2 1 
ATOM   1680  C  CE1 . PHE A  1  217  ? -5.992  -47.228  -84.979  1.00 260.40 ? 217  PHE A CE1 1 
ATOM   1681  C  CE2 . PHE A  1  217  ? -3.694  -46.754  -84.530  1.00 242.70 ? 217  PHE A CE2 1 
ATOM   1682  C  CZ  . PHE A  1  217  ? -4.785  -47.594  -84.419  1.00 256.16 ? 217  PHE A CZ  1 
ATOM   1683  N  N   . THR A  1  218  ? -5.599  -41.969  -88.824  1.00 347.88 ? 218  THR A N   1 
ATOM   1684  C  CA  . THR A  1  218  ? -5.634  -40.638  -89.418  1.00 343.54 ? 218  THR A CA  1 
ATOM   1685  C  C   . THR A  1  218  ? -7.016  -40.324  -89.982  1.00 364.13 ? 218  THR A C   1 
ATOM   1686  O  O   . THR A  1  218  ? -7.455  -39.174  -89.971  1.00 366.27 ? 218  THR A O   1 
ATOM   1687  C  CB  . THR A  1  218  ? -4.587  -40.491  -90.538  1.00 252.58 ? 218  THR A CB  1 
ATOM   1688  O  OG1 . THR A  1  218  ? -4.955  -41.315  -91.650  1.00 263.61 ? 218  THR A OG1 1 
ATOM   1689  C  CG2 . THR A  1  218  ? -3.211  -40.905  -90.037  1.00 235.27 ? 218  THR A CG2 1 
ATOM   1690  N  N   . HIS A  1  219  ? -7.696  -41.354  -90.475  1.00 282.67 ? 219  HIS A N   1 
ATOM   1691  C  CA  . HIS A  1  219  ? -9.029  -41.190  -91.043  1.00 303.57 ? 219  HIS A CA  1 
ATOM   1692  C  C   . HIS A  1  219  ? -10.067 -40.953  -89.951  1.00 318.18 ? 219  HIS A C   1 
ATOM   1693  O  O   . HIS A  1  219  ? -11.099 -40.326  -90.189  1.00 332.25 ? 219  HIS A O   1 
ATOM   1694  C  CB  . HIS A  1  219  ? -9.411  -42.417  -91.874  1.00 239.80 ? 219  HIS A CB  1 
ATOM   1695  C  CG  . HIS A  1  219  ? -8.569  -42.602  -93.099  1.00 226.68 ? 219  HIS A CG  1 
ATOM   1696  N  ND1 . HIS A  1  219  ? -8.577  -41.711  -94.149  1.00 221.19 ? 219  HIS A ND1 1 
ATOM   1697  C  CD2 . HIS A  1  219  ? -7.694  -43.577  -93.440  1.00 219.27 ? 219  HIS A CD2 1 
ATOM   1698  C  CE1 . HIS A  1  219  ? -7.744  -42.128  -95.085  1.00 210.50 ? 219  HIS A CE1 1 
ATOM   1699  N  NE2 . HIS A  1  219  ? -7.194  -43.258  -94.679  1.00 208.68 ? 219  HIS A NE2 1 
ATOM   1700  N  N   . ILE A  1  220  ? -9.785  -41.460  -88.755  1.00 260.33 ? 220  ILE A N   1 
ATOM   1701  C  CA  . ILE A  1  220  ? -10.693 -41.304  -87.625  1.00 273.91 ? 220  ILE A CA  1 
ATOM   1702  C  C   . ILE A  1  220  ? -11.307 -39.907  -87.599  1.00 272.89 ? 220  ILE A C   1 
ATOM   1703  O  O   . ILE A  1  220  ? -10.616 -38.911  -87.812  1.00 253.38 ? 220  ILE A O   1 
ATOM   1704  C  CB  . ILE A  1  220  ? -9.978  -41.563  -86.286  1.00 190.80 ? 220  ILE A CB  1 
ATOM   1705  C  CG1 . ILE A  1  220  ? -9.464  -43.004  -86.228  1.00 197.80 ? 220  ILE A CG1 1 
ATOM   1706  C  CG2 . ILE A  1  220  ? -10.912 -41.279  -85.119  1.00 203.43 ? 220  ILE A CG2 1 
ATOM   1707  C  CD1 . ILE A  1  220  ? -8.985  -43.425  -84.855  1.00 186.96 ? 220  ILE A CD1 1 
ATOM   1708  N  N   . SER A  1  221  ? -12.609 -39.843  -87.339  1.00 431.03 ? 221  SER A N   1 
ATOM   1709  C  CA  . SER A  1  221  ? -13.318 -38.571  -87.287  1.00 433.72 ? 221  SER A CA  1 
ATOM   1710  C  C   . SER A  1  221  ? -12.918 -37.764  -86.056  1.00 420.73 ? 221  SER A C   1 
ATOM   1711  O  O   . SER A  1  221  ? -12.753 -38.316  -84.968  1.00 418.56 ? 221  SER A O   1 
ATOM   1712  C  CB  . SER A  1  221  ? -14.831 -38.800  -87.297  1.00 388.07 ? 221  SER A CB  1 
ATOM   1713  O  OG  . SER A  1  221  ? -15.279 -39.196  -88.582  1.00 400.15 ? 221  SER A OG  1 
ATOM   1714  N  N   . SER A  1  222  ? -12.765 -36.456  -86.236  1.00 459.18 ? 222  SER A N   1 
ATOM   1715  C  CA  . SER A  1  222  ? -12.386 -35.568  -85.136  1.00 447.03 ? 222  SER A CA  1 
ATOM   1716  C  C   . SER A  1  222  ? -13.292 -35.631  -83.916  1.00 461.97 ? 222  SER A C   1 
ATOM   1717  O  O   . SER A  1  222  ? -12.813 -35.623  -82.784  1.00 451.75 ? 222  SER A O   1 
ATOM   1718  C  CB  . SER A  1  222  ? -12.332 -34.125  -85.640  1.00 370.16 ? 222  SER A CB  1 
ATOM   1719  O  OG  . SER A  1  222  ? -13.618 -33.671  -86.024  1.00 391.75 ? 222  SER A OG  1 
ATOM   1720  N  N   . GLU A  1  223  ? -14.602 -35.685  -84.137  1.00 242.63 ? 223  GLU A N   1 
ATOM   1721  C  CA  . GLU A  1  223  ? -15.529 -35.745  -83.020  1.00 259.70 ? 223  GLU A CA  1 
ATOM   1722  C  C   . GLU A  1  223  ? -15.427 -37.124  -82.418  1.00 264.16 ? 223  GLU A C   1 
ATOM   1723  O  O   . GLU A  1  223  ? -15.951 -37.381  -81.337  1.00 274.08 ? 223  GLU A O   1 
ATOM   1724  C  CB  . GLU A  1  223  ? -16.961 -35.443  -83.465  1.00 20.00  ? 223  GLU A CB  1 
ATOM   1725  C  CG  . GLU A  1  223  ? -17.188 -34.001  -83.892  1.00 20.00  ? 223  GLU A CG  1 
ATOM   1726  C  CD  . GLU A  1  223  ? -18.599 -33.759  -84.395  1.00 20.00  ? 223  GLU A CD  1 
ATOM   1727  O  OE1 . GLU A  1  223  ? -19.340 -34.745  -84.589  1.00 20.00  ? 223  GLU A OE1 1 
ATOM   1728  O  OE2 . GLU A  1  223  ? -18.966 -32.582  -84.597  1.00 20.00  ? 223  GLU A OE2 1 
ATOM   1729  N  N   . ASP A  1  224  ? -14.742 -38.004  -83.140  1.00 262.19 ? 224  ASP A N   1 
ATOM   1730  C  CA  . ASP A  1  224  ? -14.523 -39.378  -82.698  1.00 267.88 ? 224  ASP A CA  1 
ATOM   1731  C  C   . ASP A  1  224  ? -13.248 -39.479  -81.840  1.00 243.97 ? 224  ASP A C   1 
ATOM   1732  O  O   . ASP A  1  224  ? -13.227 -40.220  -80.853  1.00 246.97 ? 224  ASP A O   1 
ATOM   1733  C  CB  . ASP A  1  224  ? -14.426 -40.317  -83.899  1.00 198.90 ? 224  ASP A CB  1 
ATOM   1734  C  CG  . ASP A  1  224  ? -15.761 -40.519  -84.590  1.00 226.06 ? 224  ASP A CG  1 
ATOM   1735  O  OD1 . ASP A  1  224  ? -16.799 -40.172  -83.991  1.00 238.71 ? 224  ASP A OD1 1 
ATOM   1736  O  OD2 . ASP A  1  224  ? -15.868 -41.015  -85.732  1.00 232.96 ? 224  ASP A OD2 1 
ATOM   1737  N  N   . LEU A  1  225  ? -12.212 -38.739  -82.221  1.00 407.23 ? 225  LEU A N   1 
ATOM   1738  C  CA  . LEU A  1  225  ? -10.954 -38.748  -81.484  1.00 383.99 ? 225  LEU A CA  1 
ATOM   1739  C  C   . LEU A  1  225  ? -11.167 -38.361  -80.025  1.00 385.19 ? 225  LEU A C   1 
ATOM   1740  O  O   . LEU A  1  225  ? -10.419 -38.784  -79.144  1.00 374.71 ? 225  LEU A O   1 
ATOM   1741  C  CB  . LEU A  1  225  ? -9.943  -37.801  -82.139  1.00 289.08 ? 225  LEU A CB  1 
ATOM   1742  C  CG  . LEU A  1  225  ? -9.361  -38.254  -83.478  1.00 282.54 ? 225  LEU A CG  1 
ATOM   1743  C  CD1 . LEU A  1  225  ? -8.656  -37.101  -84.174  1.00 266.99 ? 225  LEU A CD1 1 
ATOM   1744  C  CD2 . LEU A  1  225  ? -8.415  -39.429  -83.286  1.00 273.15 ? 225  LEU A CD2 1 
ATOM   1745  N  N   . ALA A  1  226  ? -12.191 -37.552  -79.778  1.00 580.95 ? 226  ALA A N   1 
ATOM   1746  C  CA  . ALA A  1  226  ? -12.507 -37.105  -78.427  1.00 583.08 ? 226  ALA A CA  1 
ATOM   1747  C  C   . ALA A  1  226  ? -13.422 -38.099  -77.717  1.00 604.51 ? 226  ALA A C   1 
ATOM   1748  O  O   . ALA A  1  226  ? -13.336 -38.280  -76.504  1.00 605.48 ? 226  ALA A O   1 
ATOM   1749  C  CB  . ALA A  1  226  ? -13.146 -35.726  -78.458  1.00 518.57 ? 226  ALA A CB  1 
ATOM   1750  N  N   . HIS A  1  227  ? -14.295 -38.743  -78.486  1.00 243.40 ? 227  HIS A N   1 
ATOM   1751  C  CA  . HIS A  1  227  ? -15.227 -39.723  -77.933  1.00 261.90 ? 227  HIS A CA  1 
ATOM   1752  C  C   . HIS A  1  227  ? -14.510 -40.702  -77.010  1.00 254.59 ? 227  HIS A C   1 
ATOM   1753  O  O   . HIS A  1  227  ? -15.123 -41.287  -76.117  1.00 264.02 ? 227  HIS A O   1 
ATOM   1754  C  CB  . HIS A  1  227  ? -15.935 -40.479  -79.056  1.00 201.77 ? 227  HIS A CB  1 
ATOM   1755  C  CG  . HIS A  1  227  ? -17.227 -39.855  -79.483  1.00 219.06 ? 227  HIS A CG  1 
ATOM   1756  N  ND1 . HIS A  1  227  ? -18.163 -39.394  -78.583  1.00 229.97 ? 227  HIS A ND1 1 
ATOM   1757  C  CD2 . HIS A  1  227  ? -17.740 -39.618  -80.713  1.00 228.12 ? 227  HIS A CD2 1 
ATOM   1758  C  CE1 . HIS A  1  227  ? -19.197 -38.900  -79.240  1.00 245.23 ? 227  HIS A CE1 1 
ATOM   1759  N  NE2 . HIS A  1  227  ? -18.964 -39.022  -80.535  1.00 244.43 ? 227  HIS A NE2 1 
ATOM   1760  N  N   . LEU A  1  228  ? -13.208 -40.874  -77.231  1.00 311.24 ? 228  LEU A N   1 
ATOM   1761  C  CA  . LEU A  1  228  ? -12.408 -41.778  -76.416  1.00 302.88 ? 228  LEU A CA  1 
ATOM   1762  C  C   . LEU A  1  228  ? -11.376 -41.012  -75.596  1.00 278.30 ? 228  LEU A C   1 
ATOM   1763  O  O   . LEU A  1  228  ? -11.213 -39.805  -75.757  1.00 267.75 ? 228  LEU A O   1 
ATOM   1764  C  CB  . LEU A  1  228  ? -11.714 -42.820  -77.297  1.00 222.88 ? 228  LEU A CB  1 
ATOM   1765  C  CG  . LEU A  1  228  ? -12.583 -43.500  -78.355  1.00 243.24 ? 228  LEU A CG  1 
ATOM   1766  C  CD1 . LEU A  1  228  ? -11.750 -43.892  -79.565  1.00 233.26 ? 228  LEU A CD1 1 
ATOM   1767  C  CD2 . LEU A  1  228  ? -13.287 -44.716  -77.769  1.00 260.57 ? 228  LEU A CD2 1 
ATOM   1768  N  N   . GLY A  1  229  ? -10.683 -41.725  -74.714  1.00 473.06 ? 229  GLY A N   1 
ATOM   1769  C  CA  . GLY A  1  229  ? -9.670  -41.117  -73.870  1.00 450.09 ? 229  GLY A CA  1 
ATOM   1770  C  C   . GLY A  1  229  ? -8.476  -40.621  -74.662  1.00 426.00 ? 229  GLY A C   1 
ATOM   1771  O  O   . GLY A  1  229  ? -7.331  -40.945  -74.345  1.00 411.14 ? 229  GLY A O   1 
ATOM   1772  N  N   . LEU A  1  230  ? -8.744  -39.832  -75.697  1.00 336.24 ? 230  LEU A N   1 
ATOM   1773  C  CA  . LEU A  1  230  ? -7.687  -39.287  -76.540  1.00 322.00 ? 230  LEU A CA  1 
ATOM   1774  C  C   . LEU A  1  230  ? -7.727  -37.763  -76.559  1.00 319.18 ? 230  LEU A C   1 
ATOM   1775  O  O   . LEU A  1  230  ? -8.688  -37.152  -76.091  1.00 324.95 ? 230  LEU A O   1 
ATOM   1776  C  CB  . LEU A  1  230  ? -7.802  -39.834  -77.964  1.00 250.33 ? 230  LEU A CB  1 
ATOM   1777  C  CG  . LEU A  1  230  ? -7.256  -41.245  -78.194  1.00 251.72 ? 230  LEU A CG  1 
ATOM   1778  C  CD1 . LEU A  1  230  ? -7.319  -41.612  -79.669  1.00 254.51 ? 230  LEU A CD1 1 
ATOM   1779  C  CD2 . LEU A  1  230  ? -5.833  -41.363  -77.669  1.00 240.97 ? 230  LEU A CD2 1 
ATOM   1780  N  N   . ASN A  1  231  ? -6.678  -37.155  -77.103  1.00 230.17 ? 231  ASN A N   1 
ATOM   1781  C  CA  . ASN A  1  231  ? -6.591  -35.702  -77.184  1.00 228.90 ? 231  ASN A CA  1 
ATOM   1782  C  C   . ASN A  1  231  ? -6.224  -35.222  -78.585  1.00 224.84 ? 231  ASN A C   1 
ATOM   1783  O  O   . ASN A  1  231  ? -5.068  -35.306  -78.996  1.00 215.59 ? 231  ASN A O   1 
ATOM   1784  C  CB  . ASN A  1  231  ? -5.582  -35.168  -76.165  1.00 221.82 ? 231  ASN A CB  1 
ATOM   1785  C  CG  . ASN A  1  231  ? -5.990  -33.824  -75.592  1.00 222.82 ? 231  ASN A CG  1 
ATOM   1786  O  OD1 . ASN A  1  231  ? -6.832  -33.747  -74.698  1.00 229.86 ? 231  ASN A OD1 1 
ATOM   1787  N  ND2 . ASN A  1  231  ? -5.391  -32.756  -76.107  1.00 216.01 ? 231  ASN A ND2 1 
ATOM   1788  N  N   . GLU A  1  232  ? -7.217  -34.724  -79.313  1.00 375.91 ? 232  GLU A N   1 
ATOM   1789  C  CA  . GLU A  1  232  ? -7.001  -34.230  -80.668  1.00 374.54 ? 232  GLU A CA  1 
ATOM   1790  C  C   . GLU A  1  232  ? -6.073  -33.019  -80.672  1.00 363.09 ? 232  GLU A C   1 
ATOM   1791  O  O   . GLU A  1  232  ? -6.033  -32.260  -81.639  1.00 359.61 ? 232  GLU A O   1 
ATOM   1792  C  CB  . GLU A  1  232  ? -8.334  -33.873  -81.326  1.00 386.67 ? 232  GLU A CB  1 
ATOM   1793  C  CG  . GLU A  1  232  ? -8.249  -32.719  -82.314  1.00 391.15 ? 232  GLU A CG  1 
ATOM   1794  C  CD  . GLU A  1  232  ? -8.962  -31.477  -81.820  1.00 401.01 ? 232  GLU A CD  1 
ATOM   1795  O  OE1 . GLU A  1  232  ? -10.022 -31.614  -81.174  1.00 412.49 ? 232  GLU A OE1 1 
ATOM   1796  O  OE2 . GLU A  1  232  ? -8.464  -30.360  -82.079  1.00 398.10 ? 232  GLU A OE2 1 
ATOM   1797  N  N   . GLN A  1  233  ? -5.330  -32.846  -79.585  1.00 315.93 ? 233  GLN A N   1 
ATOM   1798  C  CA  . GLN A  1  233  ? -4.402  -31.728  -79.461  1.00 306.79 ? 233  GLN A CA  1 
ATOM   1799  C  C   . GLN A  1  233  ? -3.074  -32.177  -78.861  1.00 296.24 ? 233  GLN A C   1 
ATOM   1800  O  O   . GLN A  1  233  ? -2.013  -31.677  -79.234  1.00 289.01 ? 233  GLN A O   1 
ATOM   1801  C  CB  . GLN A  1  233  ? -5.014  -30.615  -78.608  1.00 240.65 ? 233  GLN A CB  1 
ATOM   1802  C  CG  . GLN A  1  233  ? -5.669  -29.505  -79.415  1.00 250.28 ? 233  GLN A CG  1 
ATOM   1803  C  CD  . GLN A  1  233  ? -6.081  -28.326  -78.555  1.00 253.49 ? 233  GLN A CD  1 
ATOM   1804  O  OE1 . GLN A  1  233  ? -5.854  -28.315  -77.346  1.00 250.70 ? 233  GLN A OE1 1 
ATOM   1805  N  NE2 . GLN A  1  233  ? -6.694  -27.324  -79.177  1.00 259.85 ? 233  GLN A NE2 1 
ATOM   1806  N  N   . TYR A  1  234  ? -3.141  -33.122  -77.929  1.00 337.11 ? 234  TYR A N   1 
ATOM   1807  C  CA  . TYR A  1  234  ? -1.945  -33.639  -77.274  1.00 328.26 ? 234  TYR A CA  1 
ATOM   1808  C  C   . TYR A  1  234  ? -1.685  -35.090  -77.665  1.00 326.09 ? 234  TYR A C   1 
ATOM   1809  O  O   . TYR A  1  234  ? -0.620  -35.422  -78.183  1.00 318.49 ? 234  TYR A O   1 
ATOM   1810  C  CB  . TYR A  1  234  ? -2.071  -33.518  -75.754  1.00 262.04 ? 234  TYR A CB  1 
ATOM   1811  C  CG  . TYR A  1  234  ? -2.074  -32.093  -75.252  1.00 262.05 ? 234  TYR A CG  1 
ATOM   1812  C  CD1 . TYR A  1  234  ? -0.884  -31.407  -75.045  1.00 254.76 ? 234  TYR A CD1 1 
ATOM   1813  C  CD2 . TYR A  1  234  ? -3.265  -31.433  -74.982  1.00 270.34 ? 234  TYR A CD2 1 
ATOM   1814  C  CE1 . TYR A  1  234  ? -0.881  -30.103  -74.585  1.00 256.08 ? 234  TYR A CE1 1 
ATOM   1815  C  CE2 . TYR A  1  234  ? -3.272  -30.130  -74.521  1.00 271.25 ? 234  TYR A CE2 1 
ATOM   1816  C  CZ  . TYR A  1  234  ? -2.078  -29.470  -74.325  1.00 263.93 ? 234  TYR A CZ  1 
ATOM   1817  O  OH  . TYR A  1  234  ? -2.080  -28.173  -73.867  1.00 266.02 ? 234  TYR A OH  1 
ATOM   1818  N  N   . ALA A  1  235  ? -2.667  -35.950  -77.413  1.00 186.24 ? 235  ALA A N   1 
ATOM   1819  C  CA  . ALA A  1  235  ? -2.546  -37.366  -77.738  1.00 185.92 ? 235  ALA A CA  1 
ATOM   1820  C  C   . ALA A  1  235  ? -3.426  -37.739  -78.926  1.00 194.49 ? 235  ALA A C   1 
ATOM   1821  O  O   . ALA A  1  235  ? -4.644  -37.565  -78.886  1.00 202.50 ? 235  ALA A O   1 
ATOM   1822  C  CB  . ALA A  1  235  ? -2.894  -38.219  -76.527  1.00 186.09 ? 235  ALA A CB  1 
ATOM   1823  N  N   . ARG A  1  236  ? -2.803  -38.256  -79.979  1.00 226.94 ? 236  ARG A N   1 
ATOM   1824  C  CA  . ARG A  1  236  ? -3.529  -38.656  -81.179  1.00 235.82 ? 236  ARG A CA  1 
ATOM   1825  C  C   . ARG A  1  236  ? -3.090  -40.038  -81.652  1.00 233.21 ? 236  ARG A C   1 
ATOM   1826  O  O   . ARG A  1  236  ? -1.984  -40.208  -82.162  1.00 226.53 ? 236  ARG A O   1 
ATOM   1827  C  CB  . ARG A  1  236  ? -3.327  -37.629  -82.296  1.00 237.73 ? 236  ARG A CB  1 
ATOM   1828  C  CG  . ARG A  1  236  ? -4.531  -36.738  -82.543  1.00 244.58 ? 236  ARG A CG  1 
ATOM   1829  C  CD  . ARG A  1  236  ? -4.333  -35.870  -83.775  1.00 247.36 ? 236  ARG A CD  1 
ATOM   1830  N  NE  . ARG A  1  236  ? -5.419  -34.911  -83.952  1.00 255.91 ? 236  ARG A NE  1 
ATOM   1831  C  CZ  . ARG A  1  236  ? -5.999  -34.646  -85.118  1.00 262.71 ? 236  ARG A CZ  1 
ATOM   1832  N  NH1 . ARG A  1  236  ? -5.596  -35.268  -86.217  1.00 262.86 ? 236  ARG A NH1 1 
ATOM   1833  N  NH2 . ARG A  1  236  ? -6.982  -33.758  -85.185  1.00 269.20 ? 236  ARG A NH2 1 
ATOM   1834  N  N   . PRO A  1  237  ? -3.966  -41.023  -81.478  1.00 170.15 ? 237  PRO A N   1 
ATOM   1835  C  CA  . PRO A  1  237  ? -3.669  -42.400  -81.888  1.00 170.39 ? 237  PRO A CA  1 
ATOM   1836  C  C   . PRO A  1  237  ? -2.691  -42.444  -83.057  1.00 164.76 ? 237  PRO A C   1 
ATOM   1837  O  O   . PRO A  1  237  ? -1.727  -43.210  -83.025  1.00 158.85 ? 237  PRO A O   1 
ATOM   1838  C  CB  . PRO A  1  237  ? -5.036  -42.931  -82.324  1.00 181.85 ? 237  PRO A CB  1 
ATOM   1839  C  CG  . PRO A  1  237  ? -6.011  -42.144  -81.525  1.00 186.98 ? 237  PRO A CG  1 
ATOM   1840  C  CD  . PRO A  1  237  ? -5.415  -40.772  -81.382  1.00 180.25 ? 237  PRO A CD  1 
ATOM   1841  N  N   . ASP A  1  238  ? -2.943  -41.631  -84.078  1.00 246.63 ? 238  ASP A N   1 
ATOM   1842  C  CA  . ASP A  1  238  ? -2.081  -41.585  -85.253  1.00 242.63 ? 238  ASP A CA  1 
ATOM   1843  C  C   . ASP A  1  238  ? -0.655  -41.201  -84.877  1.00 230.79 ? 238  ASP A C   1 
ATOM   1844  O  O   . ASP A  1  238  ? 0.196   -41.008  -85.747  1.00 226.06 ? 238  ASP A O   1 
ATOM   1845  C  CB  . ASP A  1  238  ? -2.635  -40.604  -86.286  1.00 179.55 ? 238  ASP A CB  1 
ATOM   1846  C  CG  . ASP A  1  238  ? -2.564  -39.163  -85.820  1.00 190.61 ? 238  ASP A CG  1 
ATOM   1847  O  OD1 . ASP A  1  238  ? -2.228  -38.936  -84.639  1.00 196.91 ? 238  ASP A OD1 1 
ATOM   1848  O  OD2 . ASP A  1  238  ? -2.844  -38.259  -86.635  1.00 194.39 ? 238  ASP A OD2 1 
ATOM   1849  N  N   . TRP A  1  239  ? -0.399  -41.089  -83.579  1.00 177.40 ? 239  TRP A N   1 
ATOM   1850  C  CA  . TRP A  1  239  ? 0.925   -40.726  -83.086  1.00 165.39 ? 239  TRP A CA  1 
ATOM   1851  C  C   . TRP A  1  239  ? 1.634   -41.930  -82.473  1.00 162.14 ? 239  TRP A C   1 
ATOM   1852  O  O   . TRP A  1  239  ? 2.855   -41.927  -82.314  1.00 154.89 ? 239  TRP A O   1 
ATOM   1853  C  CB  . TRP A  1  239  ? 0.824   -39.596  -82.058  1.00 163.20 ? 239  TRP A CB  1 
ATOM   1854  C  CG  . TRP A  1  239  ? 0.743   -38.233  -82.673  1.00 161.26 ? 239  TRP A CG  1 
ATOM   1855  C  CD1 . TRP A  1  239  ? 1.548   -37.726  -83.652  1.00 156.42 ? 239  TRP A CD1 1 
ATOM   1856  C  CD2 . TRP A  1  239  ? -0.194  -37.198  -82.350  1.00 165.08 ? 239  TRP A CD2 1 
ATOM   1857  N  NE1 . TRP A  1  239  ? 1.169   -36.441  -83.959  1.00 156.18 ? 239  TRP A NE1 1 
ATOM   1858  C  CE2 . TRP A  1  239  ? 0.101   -36.094  -83.174  1.00 162.26 ? 239  TRP A CE2 1 
ATOM   1859  C  CE3 . TRP A  1  239  ? -1.256  -37.100  -81.445  1.00 171.78 ? 239  TRP A CE3 1 
ATOM   1860  C  CZ2 . TRP A  1  239  ? -0.624  -34.906  -83.118  1.00 166.30 ? 239  TRP A CZ2 1 
ATOM   1861  C  CZ3 . TRP A  1  239  ? -1.975  -35.919  -81.392  1.00 175.23 ? 239  TRP A CZ3 1 
ATOM   1862  C  CH2 . TRP A  1  239  ? -1.657  -34.839  -82.223  1.00 172.66 ? 239  TRP A CH2 1 
ATOM   1863  N  N   . MET A  1  240  ? 0.861   -42.955  -82.131  1.00 185.01 ? 240  MET A N   1 
ATOM   1864  C  CA  . MET A  1  240  ? 1.415   -44.166  -81.536  1.00 183.69 ? 240  MET A CA  1 
ATOM   1865  C  C   . MET A  1  240  ? 2.476   -44.787  -82.436  1.00 180.00 ? 240  MET A C   1 
ATOM   1866  O  O   . MET A  1  240  ? 3.344   -45.527  -81.972  1.00 178.64 ? 240  MET A O   1 
ATOM   1867  C  CB  . MET A  1  240  ? 0.305   -45.179  -81.254  1.00 192.28 ? 240  MET A CB  1 
ATOM   1868  C  CG  . MET A  1  240  ? -0.373  -45.000  -79.906  1.00 195.26 ? 240  MET A CG  1 
ATOM   1869  S  SD  . MET A  1  240  ? -1.740  -46.149  -79.655  1.00 213.11 ? 240  MET A SD  1 
ATOM   1870  C  CE  . MET A  1  240  ? -3.119  -45.169  -80.242  1.00 219.86 ? 240  MET A CE  1 
ATOM   1871  N  N   . ILE A  1  241  ? 2.402   -44.481  -83.728  1.00 163.74 ? 241  ILE A N   1 
ATOM   1872  C  CA  . ILE A  1  241  ? 3.357   -45.010  -84.696  1.00 158.50 ? 241  ILE A CA  1 
ATOM   1873  C  C   . ILE A  1  241  ? 4.477   -44.011  -84.967  1.00 147.47 ? 241  ILE A C   1 
ATOM   1874  O  O   . ILE A  1  241  ? 4.225   -42.837  -85.236  1.00 144.24 ? 241  ILE A O   1 
ATOM   1875  C  CB  . ILE A  1  241  ? 2.669   -45.370  -86.027  1.00 164.56 ? 241  ILE A CB  1 
ATOM   1876  C  CG1 . ILE A  1  241  ? 1.853   -46.654  -85.875  1.00 174.77 ? 241  ILE A CG1 1 
ATOM   1877  C  CG2 . ILE A  1  241  ? 3.700   -45.514  -87.136  1.00 160.28 ? 241  ILE A CG2 1 
ATOM   1878  C  CD1 . ILE A  1  241  ? 0.529   -46.625  -86.606  1.00 184.13 ? 241  ILE A CD1 1 
ATOM   1879  N  N   . ILE A  1  242  ? 5.716   -44.486  -84.892  1.00 241.48 ? 242  ILE A N   1 
ATOM   1880  C  CA  . ILE A  1  242  ? 6.878   -43.637  -85.129  1.00 232.82 ? 242  ILE A CA  1 
ATOM   1881  C  C   . ILE A  1  242  ? 7.161   -43.493  -86.621  1.00 231.05 ? 242  ILE A C   1 
ATOM   1882  O  O   . ILE A  1  242  ? 6.923   -44.417  -87.399  1.00 236.04 ? 242  ILE A O   1 
ATOM   1883  C  CB  . ILE A  1  242  ? 8.133   -44.190  -84.428  1.00 185.40 ? 242  ILE A CB  1 
ATOM   1884  C  CG1 . ILE A  1  242  ? 7.971   -44.118  -82.909  1.00 185.32 ? 242  ILE A CG1 1 
ATOM   1885  C  CG2 . ILE A  1  242  ? 9.372   -43.426  -84.873  1.00 177.78 ? 242  ILE A CG2 1 
ATOM   1886  C  CD1 . ILE A  1  242  ? 9.256   -44.354  -82.146  1.00 180.76 ? 242  ILE A CD1 1 
ATOM   1887  N  N   . THR A  1  243  ? 7.670   -42.329  -87.012  1.00 226.89 ? 243  THR A N   1 
ATOM   1888  C  CA  . THR A  1  243  ? 7.986   -42.063  -88.409  1.00 226.67 ? 243  THR A CA  1 
ATOM   1889  C  C   . THR A  1  243  ? 9.191   -41.136  -88.535  1.00 219.65 ? 243  THR A C   1 
ATOM   1890  O  O   . THR A  1  243  ? 9.981   -41.250  -89.470  1.00 218.52 ? 243  THR A O   1 
ATOM   1891  C  CB  . THR A  1  243  ? 6.790   -41.438  -89.149  1.00 231.50 ? 243  THR A CB  1 
ATOM   1892  O  OG1 . THR A  1  243  ? 5.673   -42.338  -89.104  1.00 241.02 ? 243  THR A OG1 1 
ATOM   1893  C  CG2 . THR A  1  243  ? 7.150   -41.157  -90.601  1.00 230.98 ? 243  THR A CG2 1 
ATOM   1894  N  N   . VAL A  1  244  ? 9.322   -40.219  -87.582  1.00 314.94 ? 244  VAL A N   1 
ATOM   1895  C  CA  . VAL A  1  244  ? 10.432  -39.269  -87.579  1.00 309.11 ? 244  VAL A CA  1 
ATOM   1896  C  C   . VAL A  1  244  ? 11.291  -39.435  -86.331  1.00 303.87 ? 244  VAL A C   1 
ATOM   1897  O  O   . VAL A  1  244  ? 12.001  -38.512  -85.927  1.00 300.68 ? 244  VAL A O   1 
ATOM   1898  C  CB  . VAL A  1  244  ? 9.929   -37.816  -87.657  1.00 265.51 ? 244  VAL A CB  1 
ATOM   1899  C  CG1 . VAL A  1  244  ? 11.106  -36.850  -87.660  1.00 260.80 ? 244  VAL A CG1 1 
ATOM   1900  C  CG2 . VAL A  1  244  ? 9.067   -37.618  -88.893  1.00 269.05 ? 244  VAL A CG2 1 
ATOM   1901  N  N   . LEU A  1  245  ? 11.226  -40.615  -85.725  1.00 151.23 ? 245  LEU A N   1 
ATOM   1902  C  CA  . LEU A  1  245  ? 11.998  -40.903  -84.522  1.00 146.69 ? 245  LEU A CA  1 
ATOM   1903  C  C   . LEU A  1  245  ? 12.962  -39.770  -84.202  1.00 141.37 ? 245  LEU A C   1 
ATOM   1904  O  O   . LEU A  1  245  ? 13.902  -39.508  -84.957  1.00 138.86 ? 245  LEU A O   1 
ATOM   1905  C  CB  . LEU A  1  245  ? 12.762  -42.220  -84.680  1.00 144.66 ? 245  LEU A CB  1 
ATOM   1906  C  CG  . LEU A  1  245  ? 13.095  -42.968  -83.388  1.00 143.53 ? 245  LEU A CG  1 
ATOM   1907  C  CD1 . LEU A  1  245  ? 11.831  -43.484  -82.724  1.00 147.81 ? 245  LEU A CD1 1 
ATOM   1908  C  CD2 . LEU A  1  245  ? 14.066  -44.108  -83.662  1.00 144.45 ? 245  LEU A CD2 1 
ATOM   1909  N  N   . PRO A  1  246  ? 12.733  -39.102  -83.076  1.00 140.84 ? 246  PRO A N   1 
ATOM   1910  C  CA  . PRO A  1  246  ? 13.589  -37.991  -82.649  1.00 135.62 ? 246  PRO A CA  1 
ATOM   1911  C  C   . PRO A  1  246  ? 14.972  -38.474  -82.225  1.00 130.72 ? 246  PRO A C   1 
ATOM   1912  O  O   . PRO A  1  246  ? 15.181  -39.677  -82.055  1.00 131.90 ? 246  PRO A O   1 
ATOM   1913  C  CB  . PRO A  1  246  ? 12.839  -37.421  -81.444  1.00 135.03 ? 246  PRO A CB  1 
ATOM   1914  C  CG  . PRO A  1  246  ? 12.083  -38.577  -80.897  1.00 137.77 ? 246  PRO A CG  1 
ATOM   1915  C  CD  . PRO A  1  246  ? 11.686  -39.407  -82.085  1.00 142.36 ? 246  PRO A CD  1 
ATOM   1916  N  N   . VAL A  1  247  ? 15.902  -37.540  -82.055  1.00 172.34 ? 247  VAL A N   1 
ATOM   1917  C  CA  . VAL A  1  247  ? 17.262  -37.880  -81.651  1.00 167.78 ? 247  VAL A CA  1 
ATOM   1918  C  C   . VAL A  1  247  ? 17.776  -36.921  -80.582  1.00 162.32 ? 247  VAL A C   1 
ATOM   1919  O  O   . VAL A  1  247  ? 18.098  -35.770  -80.869  1.00 162.18 ? 247  VAL A O   1 
ATOM   1920  C  CB  . VAL A  1  247  ? 18.230  -37.863  -82.851  1.00 165.80 ? 247  VAL A CB  1 
ATOM   1921  C  CG1 . VAL A  1  247  ? 19.514  -38.601  -82.508  1.00 163.59 ? 247  VAL A CG1 1 
ATOM   1922  C  CG2 . VAL A  1  247  ? 17.566  -38.474  -84.075  1.00 168.12 ? 247  VAL A CG2 1 
ATOM   1923  N  N   . PRO A  1  248  ? 17.850  -37.404  -79.346  1.00 146.68 ? 248  PRO A N   1 
ATOM   1924  C  CA  . PRO A  1  248  ? 18.327  -36.589  -78.224  1.00 146.24 ? 248  PRO A CA  1 
ATOM   1925  C  C   . PRO A  1  248  ? 19.780  -36.168  -78.412  1.00 142.16 ? 248  PRO A C   1 
ATOM   1926  O  O   . PRO A  1  248  ? 20.555  -36.885  -79.043  1.00 141.46 ? 248  PRO A O   1 
ATOM   1927  C  CB  . PRO A  1  248  ? 18.202  -37.537  -77.032  1.00 144.16 ? 248  PRO A CB  1 
ATOM   1928  C  CG  . PRO A  1  248  ? 18.345  -38.896  -77.621  1.00 145.94 ? 248  PRO A CG  1 
ATOM   1929  C  CD  . PRO A  1  248  ? 17.703  -38.824  -78.977  1.00 147.35 ? 248  PRO A CD  1 
ATOM   1930  N  N   . PRO A  1  249  ? 20.138  -35.010  -77.867  1.00 198.85 ? 249  PRO A N   1 
ATOM   1931  C  CA  . PRO A  1  249  ? 21.506  -34.494  -77.983  1.00 201.41 ? 249  PRO A CA  1 
ATOM   1932  C  C   . PRO A  1  249  ? 22.473  -35.239  -77.070  1.00 201.86 ? 249  PRO A C   1 
ATOM   1933  O  O   . PRO A  1  249  ? 22.067  -35.745  -76.024  1.00 202.03 ? 249  PRO A O   1 
ATOM   1934  C  CB  . PRO A  1  249  ? 21.367  -33.040  -77.527  1.00 199.69 ? 249  PRO A CB  1 
ATOM   1935  C  CG  . PRO A  1  249  ? 20.207  -33.054  -76.596  1.00 200.47 ? 249  PRO A CG  1 
ATOM   1936  C  CD  . PRO A  1  249  ? 19.255  -34.080  -77.140  1.00 199.79 ? 249  PRO A CD  1 
ATOM   1937  N  N   . PRO A  1  250  ? 23.739  -35.303  -77.466  1.00 186.68 ? 250  PRO A N   1 
ATOM   1938  C  CA  . PRO A  1  250  ? 24.762  -35.990  -76.672  1.00 190.33 ? 250  PRO A CA  1 
ATOM   1939  C  C   . PRO A  1  250  ? 24.611  -35.703  -75.182  1.00 189.88 ? 250  PRO A C   1 
ATOM   1940  O  O   . PRO A  1  250  ? 24.767  -36.605  -74.360  1.00 190.37 ? 250  PRO A O   1 
ATOM   1941  C  CB  . PRO A  1  250  ? 26.068  -35.387  -77.193  1.00 188.96 ? 250  PRO A CB  1 
ATOM   1942  C  CG  . PRO A  1  250  ? 25.685  -34.030  -77.668  1.00 191.36 ? 250  PRO A CG  1 
ATOM   1943  C  CD  . PRO A  1  250  ? 24.295  -34.165  -78.220  1.00 189.79 ? 250  PRO A CD  1 
ATOM   1944  N  N   . SER A  1  251  ? 24.307  -34.452  -74.845  1.00 160.40 ? 251  SER A N   1 
ATOM   1945  C  CA  . SER A  1  251  ? 24.133  -34.057  -73.452  1.00 163.22 ? 251  SER A CA  1 
ATOM   1946  C  C   . SER A  1  251  ? 23.428  -35.147  -72.654  1.00 162.79 ? 251  SER A C   1 
ATOM   1947  O  O   . SER A  1  251  ? 23.687  -35.325  -71.463  1.00 163.11 ? 251  SER A O   1 
ATOM   1948  C  CB  . SER A  1  251  ? 23.348  -32.747  -73.361  1.00 132.67 ? 251  SER A CB  1 
ATOM   1949  O  OG  . SER A  1  251  ? 21.989  -32.942  -73.708  1.00 133.10 ? 251  SER A OG  1 
ATOM   1950  N  N   . VAL A  1  252  ? 22.536  -35.875  -73.318  1.00 176.41 ? 252  VAL A N   1 
ATOM   1951  C  CA  . VAL A  1  252  ? 21.799  -36.956  -72.675  1.00 178.12 ? 252  VAL A CA  1 
ATOM   1952  C  C   . VAL A  1  252  ? 22.585  -38.263  -72.731  1.00 179.30 ? 252  VAL A C   1 
ATOM   1953  O  O   . VAL A  1  252  ? 22.322  -39.190  -71.966  1.00 178.50 ? 252  VAL A O   1 
ATOM   1954  C  CB  . VAL A  1  252  ? 20.421  -37.168  -73.329  1.00 179.96 ? 252  VAL A CB  1 
ATOM   1955  C  CG1 . VAL A  1  252  ? 19.572  -38.104  -72.484  1.00 182.45 ? 252  VAL A CG1 1 
ATOM   1956  C  CG2 . VAL A  1  252  ? 19.720  -35.833  -73.528  1.00 179.83 ? 252  VAL A CG2 1 
ATOM   1957  N  N   . ARG A  1  253  ? 23.551  -38.326  -73.642  1.00 137.71 ? 253  ARG A N   1 
ATOM   1958  C  CA  . ARG A  1  253  ? 24.379  -39.515  -73.800  1.00 143.31 ? 253  ARG A CA  1 
ATOM   1959  C  C   . ARG A  1  253  ? 25.765  -39.303  -73.199  1.00 145.28 ? 253  ARG A C   1 
ATOM   1960  O  O   . ARG A  1  253  ? 26.055  -38.244  -72.642  1.00 143.61 ? 253  ARG A O   1 
ATOM   1961  C  CB  . ARG A  1  253  ? 24.499  -39.894  -75.278  1.00 145.22 ? 253  ARG A CB  1 
ATOM   1962  C  CG  . ARG A  1  253  ? 23.512  -39.178  -76.183  1.00 145.07 ? 253  ARG A CG  1 
ATOM   1963  C  CD  . ARG A  1  253  ? 23.067  -40.071  -77.331  1.00 147.21 ? 253  ARG A CD  1 
ATOM   1964  N  NE  . ARG A  1  253  ? 22.511  -39.301  -78.439  1.00 148.72 ? 253  ARG A NE  1 
ATOM   1965  C  CZ  . ARG A  1  253  ? 23.243  -38.688  -79.364  1.00 149.13 ? 253  ARG A CZ  1 
ATOM   1966  N  NH1 . ARG A  1  253  ? 24.566  -38.754  -79.316  1.00 149.34 ? 253  ARG A NH1 1 
ATOM   1967  N  NH2 . ARG A  1  253  ? 22.651  -38.009  -80.338  1.00 148.82 ? 253  ARG A NH2 1 
ATOM   1968  N  N   . PRO A  1  254  ? 26.618  -40.316  -73.314  1.00 186.32 ? 254  PRO A N   1 
ATOM   1969  C  CA  . PRO A  1  254  ? 27.979  -40.242  -72.776  1.00 218.87 ? 254  PRO A CA  1 
ATOM   1970  C  C   . PRO A  1  254  ? 29.032  -40.463  -73.857  1.00 230.01 ? 254  PRO A C   1 
ATOM   1971  O  O   . PRO A  1  254  ? 28.688  -40.698  -75.015  1.00 215.34 ? 254  PRO A O   1 
ATOM   1972  C  CB  . PRO A  1  254  ? 28.013  -41.391  -71.767  1.00 249.55 ? 254  PRO A CB  1 
ATOM   1973  C  CG  . PRO A  1  254  ? 27.045  -42.381  -72.307  1.00 243.07 ? 254  PRO A CG  1 
ATOM   1974  C  CD  . PRO A  1  254  ? 25.951  -41.583  -72.961  1.00 222.25 ? 254  PRO A CD  1 
ATOM   1975  N  N   . SER A  1  255  ? 30.303  -40.387  -73.475  1.00 190.81 ? 255  SER A N   1 
ATOM   1976  C  CA  . SER A  1  255  ? 31.401  -40.583  -74.414  1.00 187.94 ? 255  SER A CA  1 
ATOM   1977  C  C   . SER A  1  255  ? 32.615  -41.187  -73.717  1.00 175.41 ? 255  SER A C   1 
ATOM   1978  O  O   . SER A  1  255  ? 32.503  -42.194  -73.017  1.00 152.04 ? 255  SER A O   1 
ATOM   1979  C  CB  . SER A  1  255  ? 31.780  -39.260  -75.080  1.00 195.53 ? 255  SER A CB  1 
ATOM   1980  O  OG  . SER A  1  255  ? 32.629  -38.493  -74.243  1.00 203.65 ? 255  SER A OG  1 
ATOM   1981  N  N   . ILE A  1  256  ? 33.774  -40.567  -73.911  1.00 223.87 ? 256  ILE A N   1 
ATOM   1982  C  CA  . ILE A  1  256  ? 35.007  -41.038  -73.291  1.00 259.99 ? 256  ILE A CA  1 
ATOM   1983  C  C   . ILE A  1  256  ? 36.191  -40.903  -74.242  1.00 274.52 ? 256  ILE A C   1 
ATOM   1984  O  O   . ILE A  1  256  ? 36.015  -40.726  -75.447  1.00 267.20 ? 256  ILE A O   1 
ATOM   1985  C  CB  . ILE A  1  256  ? 34.886  -42.507  -72.843  1.00 284.09 ? 256  ILE A CB  1 
ATOM   1986  C  CG1 . ILE A  1  256  ? 35.002  -42.611  -71.320  1.00 239.44 ? 256  ILE A CG1 1 
ATOM   1987  C  CG2 . ILE A  1  256  ? 35.945  -43.360  -73.522  1.00 307.68 ? 256  ILE A CG2 1 
ATOM   1988  C  CD1 . ILE A  1  256  ? 35.393  -41.313  -70.647  1.00 220.96 ? 256  ILE A CD1 1 
ATOM   1989  N  N   . SER A  1  257  ? 37.398  -40.987  -73.692  1.00 254.39 ? 257  SER A N   1 
ATOM   1990  C  CA  . SER A  1  257  ? 38.614  -40.876  -74.489  1.00 267.59 ? 257  SER A CA  1 
ATOM   1991  C  C   . SER A  1  257  ? 39.832  -41.351  -73.705  1.00 285.44 ? 257  SER A C   1 
ATOM   1992  O  O   . SER A  1  257  ? 40.343  -40.639  -72.841  1.00 292.10 ? 257  SER A O   1 
ATOM   1993  C  CB  . SER A  1  257  ? 38.818  -39.433  -74.954  1.00 267.92 ? 257  SER A CB  1 
ATOM   1994  O  OG  . SER A  1  257  ? 37.606  -38.700  -74.895  1.00 274.39 ? 257  SER A OG  1 
ATOM   1995  N  N   . VAL A  1  258  ? 40.292  -42.559  -74.013  1.00 242.03 ? 258  VAL A N   1 
ATOM   1996  C  CA  . VAL A  1  258  ? 41.450  -43.133  -73.338  1.00 264.78 ? 258  VAL A CA  1 
ATOM   1997  C  C   . VAL A  1  258  ? 42.709  -42.317  -73.611  1.00 283.06 ? 258  VAL A C   1 
ATOM   1998  O  O   . VAL A  1  258  ? 43.818  -42.854  -73.622  1.00 307.16 ? 258  VAL A O   1 
ATOM   1999  C  CB  . VAL A  1  258  ? 41.690  -44.592  -73.770  1.00 269.86 ? 258  VAL A CB  1 
ATOM   2000  C  CG1 . VAL A  1  258  ? 42.215  -45.412  -72.601  1.00 290.65 ? 258  VAL A CG1 1 
ATOM   2001  C  CG2 . VAL A  1  258  ? 40.411  -45.198  -74.325  1.00 251.05 ? 258  VAL A CG2 1 
ATOM   2002  N  N   . ASP A  1  259  ? 42.531  -41.019  -73.832  1.00 218.41 ? 259  ASP A N   1 
ATOM   2003  C  CA  . ASP A  1  259  ? 43.653  -40.128  -74.104  1.00 235.91 ? 259  ASP A CA  1 
ATOM   2004  C  C   . ASP A  1  259  ? 44.983  -40.804  -73.791  1.00 266.00 ? 259  ASP A C   1 
ATOM   2005  O  O   . ASP A  1  259  ? 45.275  -41.114  -72.636  1.00 274.87 ? 259  ASP A O   1 
ATOM   2006  C  CB  . ASP A  1  259  ? 43.516  -38.834  -73.299  1.00 229.87 ? 259  ASP A CB  1 
ATOM   2007  C  CG  . ASP A  1  259  ? 42.356  -37.976  -73.766  1.00 205.09 ? 259  ASP A CG  1 
ATOM   2008  O  OD1 . ASP A  1  259  ? 41.735  -38.323  -74.793  1.00 194.59 ? 259  ASP A OD1 1 
ATOM   2009  O  OD2 . ASP A  1  259  ? 42.064  -36.958  -73.107  1.00 197.83 ? 259  ASP A OD2 1 
ATOM   2010  N  N   . GLY A  1  260  ? 45.786  -41.027  -74.826  1.00 344.20 ? 260  GLY A N   1 
ATOM   2011  C  CA  . GLY A  1  260  ? 45.413  -40.650  -76.176  1.00 335.60 ? 260  GLY A CA  1 
ATOM   2012  C  C   . GLY A  1  260  ? 44.864  -41.748  -77.067  1.00 328.00 ? 260  GLY A C   1 
ATOM   2013  O  O   . GLY A  1  260  ? 43.995  -42.526  -76.669  1.00 315.54 ? 260  GLY A O   1 
ATOM   2014  N  N   . THR A  1  261  ? 45.374  -41.799  -78.291  1.00 245.73 ? 261  THR A N   1 
ATOM   2015  C  CA  . THR A  1  261  ? 44.924  -42.775  -79.263  1.00 241.20 ? 261  THR A CA  1 
ATOM   2016  C  C   . THR A  1  261  ? 43.709  -43.504  -78.731  1.00 219.91 ? 261  THR A C   1 
ATOM   2017  O  O   . THR A  1  261  ? 43.834  -44.435  -77.939  1.00 229.19 ? 261  THR A O   1 
ATOM   2018  C  CB  . THR A  1  261  ? 46.010  -43.807  -79.566  1.00 273.89 ? 261  THR A CB  1 
ATOM   2019  O  OG1 . THR A  1  261  ? 46.026  -44.795  -78.531  1.00 282.49 ? 261  THR A OG1 1 
ATOM   2020  C  CG2 . THR A  1  261  ? 47.369  -43.142  -79.631  1.00 303.06 ? 261  THR A CG2 1 
ATOM   2021  N  N   . SER A  1  262  ? 42.529  -43.076  -79.168  1.00 318.70 ? 262  SER A N   1 
ATOM   2022  C  CA  . SER A  1  262  ? 41.282  -43.695  -78.734  1.00 298.86 ? 262  SER A CA  1 
ATOM   2023  C  C   . SER A  1  262  ? 40.264  -42.644  -78.307  1.00 274.32 ? 262  SER A C   1 
ATOM   2024  O  O   . SER A  1  262  ? 40.581  -41.456  -78.229  1.00 273.09 ? 262  SER A O   1 
ATOM   2025  C  CB  . SER A  1  262  ? 41.542  -44.674  -77.584  1.00 190.11 ? 262  SER A CB  1 
ATOM   2026  O  OG  . SER A  1  262  ? 40.638  -45.763  -77.629  1.00 181.70 ? 262  SER A OG  1 
ATOM   2027  N  N   . ARG A  1  263  ? 39.041  -43.090  -78.030  1.00 385.79 ? 263  ARG A N   1 
ATOM   2028  C  CA  . ARG A  1  263  ? 37.976  -42.187  -77.610  1.00 358.87 ? 263  ARG A CA  1 
ATOM   2029  C  C   . ARG A  1  263  ? 36.602  -42.812  -77.844  1.00 355.18 ? 263  ARG A C   1 
ATOM   2030  O  O   . ARG A  1  263  ? 35.694  -42.161  -78.356  1.00 366.64 ? 263  ARG A O   1 
ATOM   2031  C  CB  . ARG A  1  263  ? 38.078  -40.852  -78.353  1.00 329.04 ? 263  ARG A CB  1 
ATOM   2032  C  CG  . ARG A  1  263  ? 36.878  -39.943  -78.162  1.00 289.75 ? 263  ARG A CG  1 
ATOM   2033  C  CD  . ARG A  1  263  ? 35.893  -40.077  -79.313  1.00 271.89 ? 263  ARG A CD  1 
ATOM   2034  N  NE  . ARG A  1  263  ? 34.928  -38.984  -79.338  1.00 257.50 ? 263  ARG A NE  1 
ATOM   2035  C  CZ  . ARG A  1  263  ? 35.086  -37.831  -78.697  1.00 232.94 ? 263  ARG A CZ  1 
ATOM   2036  N  NH1 . ARG A  1  263  ? 34.156  -36.889  -78.778  1.00 212.38 ? 263  ARG A NH1 1 
ATOM   2037  N  NH2 . ARG A  1  263  ? 36.177  -37.619  -77.972  1.00 217.78 ? 263  ARG A NH2 1 
ATOM   2038  N  N   . GLY A  1  264  ? 36.461  -44.078  -77.466  1.00 270.27 ? 264  GLY A N   1 
ATOM   2039  C  CA  . GLY A  1  264  ? 35.209  -44.790  -77.636  1.00 261.09 ? 264  GLY A CA  1 
ATOM   2040  C  C   . GLY A  1  264  ? 34.032  -44.057  -77.020  1.00 246.69 ? 264  GLY A C   1 
ATOM   2041  O  O   . GLY A  1  264  ? 34.208  -43.083  -76.291  1.00 244.15 ? 264  GLY A O   1 
ATOM   2042  N  N   . GLU A  1  265  ? 32.827  -44.531  -77.316  1.00 253.40 ? 265  GLU A N   1 
ATOM   2043  C  CA  . GLU A  1  265  ? 31.612  -43.921  -76.789  1.00 244.60 ? 265  GLU A CA  1 
ATOM   2044  C  C   . GLU A  1  265  ? 30.680  -44.970  -76.194  1.00 212.01 ? 265  GLU A C   1 
ATOM   2045  O  O   . GLU A  1  265  ? 31.082  -46.109  -75.961  1.00 127.52 ? 265  GLU A O   1 
ATOM   2046  C  CB  . GLU A  1  265  ? 30.889  -43.134  -77.885  1.00 242.24 ? 265  GLU A CB  1 
ATOM   2047  C  CG  . GLU A  1  265  ? 31.784  -42.177  -78.657  1.00 223.98 ? 265  GLU A CG  1 
ATOM   2048  C  CD  . GLU A  1  265  ? 31.159  -40.808  -78.832  1.00 197.96 ? 265  GLU A CD  1 
ATOM   2049  O  OE1 . GLU A  1  265  ? 29.996  -40.736  -79.282  1.00 195.47 ? 265  GLU A OE1 1 
ATOM   2050  O  OE2 . GLU A  1  265  ? 31.831  -39.802  -78.520  1.00 178.52 ? 265  GLU A OE2 1 
ATOM   2051  N  N   . ASP A  1  266  ? 29.433  -44.579  -75.952  1.00 345.99 ? 266  ASP A N   1 
ATOM   2052  C  CA  . ASP A  1  266  ? 28.442  -45.484  -75.382  1.00 390.56 ? 266  ASP A CA  1 
ATOM   2053  C  C   . ASP A  1  266  ? 27.271  -45.693  -76.337  1.00 393.73 ? 266  ASP A C   1 
ATOM   2054  O  O   . ASP A  1  266  ? 26.880  -44.779  -77.062  1.00 387.50 ? 266  ASP A O   1 
ATOM   2055  C  CB  . ASP A  1  266  ? 27.939  -44.952  -74.040  1.00 403.97 ? 266  ASP A CB  1 
ATOM   2056  C  CG  . ASP A  1  266  ? 28.942  -44.039  -73.362  1.00 412.02 ? 266  ASP A CG  1 
ATOM   2057  O  OD1 . ASP A  1  266  ? 29.051  -44.093  -72.119  1.00 419.62 ? 266  ASP A OD1 1 
ATOM   2058  O  OD2 . ASP A  1  266  ? 29.619  -43.267  -74.072  1.00 408.29 ? 266  ASP A OD2 1 
ATOM   2059  N  N   . ASP A  1  267  ? 26.717  -46.901  -76.329  1.00 297.29 ? 267  ASP A N   1 
ATOM   2060  C  CA  . ASP A  1  267  ? 27.207  -47.963  -75.459  1.00 305.28 ? 267  ASP A CA  1 
ATOM   2061  C  C   . ASP A  1  267  ? 26.259  -49.157  -75.442  1.00 281.37 ? 267  ASP A C   1 
ATOM   2062  O  O   . ASP A  1  267  ? 26.697  -50.307  -75.448  1.00 321.74 ? 267  ASP A O   1 
ATOM   2063  C  CB  . ASP A  1  267  ? 27.418  -47.437  -74.037  1.00 327.72 ? 267  ASP A CB  1 
ATOM   2064  C  CG  . ASP A  1  267  ? 28.820  -47.696  -73.522  1.00 363.07 ? 267  ASP A CG  1 
ATOM   2065  O  OD1 . ASP A  1  267  ? 29.550  -48.487  -74.155  1.00 392.30 ? 267  ASP A OD1 1 
ATOM   2066  O  OD2 . ASP A  1  267  ? 29.193  -47.108  -72.485  1.00 363.60 ? 267  ASP A OD2 1 
ATOM   2067  N  N   . LEU A  1  268  ? 24.959  -48.881  -75.421  1.00 308.15 ? 268  LEU A N   1 
ATOM   2068  C  CA  . LEU A  1  268  ? 24.457  -47.512  -75.416  1.00 243.92 ? 268  LEU A CA  1 
ATOM   2069  C  C   . LEU A  1  268  ? 24.395  -46.936  -76.828  1.00 350.98 ? 268  LEU A C   1 
ATOM   2070  O  O   . LEU A  1  268  ? 24.720  -47.618  -77.800  1.00 237.51 ? 268  LEU A O   1 
ATOM   2071  C  CB  . LEU A  1  268  ? 25.324  -46.622  -74.521  1.00 245.53 ? 268  LEU A CB  1 
ATOM   2072  C  CG  . LEU A  1  268  ? 24.696  -46.179  -73.198  1.00 242.60 ? 268  LEU A CG  1 
ATOM   2073  C  CD1 . LEU A  1  268  ? 23.274  -45.689  -73.415  1.00 229.01 ? 268  LEU A CD1 1 
ATOM   2074  C  CD2 . LEU A  1  268  ? 24.728  -47.311  -72.183  1.00 243.47 ? 268  LEU A CD2 1 
ATOM   2075  N  N   . THR A  1  269  ? 23.975  -45.681  -76.933  1.00 239.93 ? 269  THR A N   1 
ATOM   2076  C  CA  . THR A  1  269  ? 23.860  -45.014  -78.225  1.00 232.68 ? 269  THR A CA  1 
ATOM   2077  C  C   . THR A  1  269  ? 24.223  -45.955  -79.370  1.00 242.48 ? 269  THR A C   1 
ATOM   2078  O  O   . THR A  1  269  ? 23.354  -46.384  -80.130  1.00 240.05 ? 269  THR A O   1 
ATOM   2079  C  CB  . THR A  1  269  ? 24.752  -43.760  -78.297  1.00 161.73 ? 269  THR A CB  1 
ATOM   2080  O  OG1 . THR A  1  269  ? 25.944  -44.058  -79.036  1.00 166.41 ? 269  THR A OG1 1 
ATOM   2081  C  CG2 . THR A  1  269  ? 25.130  -43.295  -76.898  1.00 156.96 ? 269  THR A CG2 1 
ATOM   2082  N  N   . HIS A  1  270  ? 25.507  -46.270  -79.488  1.00 262.20 ? 270  HIS A N   1 
ATOM   2083  C  CA  . HIS A  1  270  ? 25.985  -47.160  -80.541  1.00 275.89 ? 270  HIS A CA  1 
ATOM   2084  C  C   . HIS A  1  270  ? 24.820  -47.774  -81.310  1.00 282.94 ? 270  HIS A C   1 
ATOM   2085  O  O   . HIS A  1  270  ? 24.674  -47.559  -82.513  1.00 287.67 ? 270  HIS A O   1 
ATOM   2086  C  CB  . HIS A  1  270  ? 26.868  -48.262  -79.953  1.00 223.41 ? 270  HIS A CB  1 
ATOM   2087  C  CG  . HIS A  1  270  ? 28.322  -47.912  -79.911  1.00 223.68 ? 270  HIS A CG  1 
ATOM   2088  N  ND1 . HIS A  1  270  ? 29.188  -48.199  -80.946  1.00 232.16 ? 270  HIS A ND1 1 
ATOM   2089  C  CD2 . HIS A  1  270  ? 29.065  -47.297  -78.960  1.00 218.31 ? 270  HIS A CD2 1 
ATOM   2090  C  CE1 . HIS A  1  270  ? 30.400  -47.777  -80.633  1.00 232.72 ? 270  HIS A CE1 1 
ATOM   2091  N  NE2 . HIS A  1  270  ? 30.353  -47.227  -79.433  1.00 224.53 ? 270  HIS A NE2 1 
ATOM   2092  N  N   . LYS A  1  271  ? 23.991  -48.542  -80.608  1.00 411.52 ? 271  LYS A N   1 
ATOM   2093  C  CA  . LYS A  1  271  ? 22.836  -49.182  -81.223  1.00 419.90 ? 271  LYS A CA  1 
ATOM   2094  C  C   . LYS A  1  271  ? 22.127  -48.229  -82.179  1.00 411.19 ? 271  LYS A C   1 
ATOM   2095  O  O   . LYS A  1  271  ? 21.797  -48.596  -83.307  1.00 418.32 ? 271  LYS A O   1 
ATOM   2096  C  CB  . LYS A  1  271  ? 21.861  -49.675  -80.151  1.00 362.61 ? 271  LYS A CB  1 
ATOM   2097  C  CG  . LYS A  1  271  ? 21.186  -50.994  -80.486  1.00 378.33 ? 271  LYS A CG  1 
ATOM   2098  C  CD  . LYS A  1  271  ? 21.502  -52.056  -79.445  1.00 387.54 ? 271  LYS A CD  1 
ATOM   2099  C  CE  . LYS A  1  271  ? 20.301  -52.335  -78.557  1.00 405.63 ? 271  LYS A CE  1 
ATOM   2100  N  NZ  . LYS A  1  271  ? 19.762  -53.708  -78.766  1.00 417.80 ? 271  LYS A NZ  1 
ATOM   2101  N  N   . LEU A  1  272  ? 21.898  -47.003  -81.720  1.00 281.93 ? 272  LEU A N   1 
ATOM   2102  C  CA  . LEU A  1  272  ? 21.240  -45.990  -82.535  1.00 272.08 ? 272  LEU A CA  1 
ATOM   2103  C  C   . LEU A  1  272  ? 21.831  -45.968  -83.933  1.00 274.65 ? 272  LEU A C   1 
ATOM   2104  O  O   . LEU A  1  272  ? 21.109  -45.896  -84.926  1.00 277.13 ? 272  LEU A O   1 
ATOM   2105  C  CB  . LEU A  1  272  ? 21.366  -44.606  -81.912  1.00 190.74 ? 272  LEU A CB  1 
ATOM   2106  C  CG  . LEU A  1  272  ? 20.440  -44.334  -80.731  1.00 186.66 ? 272  LEU A CG  1 
ATOM   2107  C  CD1 . LEU A  1  272  ? 20.651  -42.936  -80.200  1.00 175.42 ? 272  LEU A CD1 1 
ATOM   2108  C  CD2 . LEU A  1  272  ? 18.981  -44.542  -81.127  1.00 190.92 ? 272  LEU A CD2 1 
ATOM   2109  N  N   . SER A  1  273  ? 23.153  -46.027  -84.007  1.00 275.16 ? 273  SER A N   1 
ATOM   2110  C  CA  . SER A  1  273  ? 23.818  -46.063  -85.293  1.00 280.37 ? 273  SER A CA  1 
ATOM   2111  C  C   . SER A  1  273  ? 23.496  -47.364  -86.027  1.00 294.87 ? 273  SER A C   1 
ATOM   2112  O  O   . SER A  1  273  ? 23.359  -47.372  -87.248  1.00 297.07 ? 273  SER A O   1 
ATOM   2113  C  CB  . SER A  1  273  ? 25.329  -45.883  -85.137  1.00 211.95 ? 273  SER A CB  1 
ATOM   2114  O  OG  . SER A  1  273  ? 25.890  -46.920  -84.356  1.00 222.42 ? 273  SER A OG  1 
ATOM   2115  N  N   . ASP A  1  274  ? 23.362  -48.457  -85.281  1.00 198.28 ? 274  ASP A N   1 
ATOM   2116  C  CA  . ASP A  1  274  ? 23.064  -49.767  -85.868  1.00 216.54 ? 274  ASP A CA  1 
ATOM   2117  C  C   . ASP A  1  274  ? 21.704  -49.789  -86.533  1.00 216.58 ? 274  ASP A C   1 
ATOM   2118  O  O   . ASP A  1  274  ? 21.465  -50.553  -87.467  1.00 229.45 ? 274  ASP A O   1 
ATOM   2119  C  CB  . ASP A  1  274  ? 23.106  -50.866  -84.808  1.00 157.33 ? 274  ASP A CB  1 
ATOM   2120  C  CG  . ASP A  1  274  ? 24.516  -51.277  -84.435  1.00 164.31 ? 274  ASP A CG  1 
ATOM   2121  O  OD1 . ASP A  1  274  ? 25.470  -50.692  -84.995  1.00 159.88 ? 274  ASP A OD1 1 
ATOM   2122  O  OD2 . ASP A  1  274  ? 24.668  -52.186  -83.588  1.00 176.30 ? 274  ASP A OD2 1 
ATOM   2123  N  N   . ILE A  1  275  ? 20.810  -48.950  -86.035  1.00 233.15 ? 275  ILE A N   1 
ATOM   2124  C  CA  . ILE A  1  275  ? 19.455  -48.892  -86.557  1.00 233.39 ? 275  ILE A CA  1 
ATOM   2125  C  C   . ILE A  1  275  ? 19.407  -48.155  -87.894  1.00 227.42 ? 275  ILE A C   1 
ATOM   2126  O  O   . ILE A  1  275  ? 18.703  -48.572  -88.817  1.00 236.16 ? 275  ILE A O   1 
ATOM   2127  C  CB  . ILE A  1  275  ? 18.506  -48.248  -85.540  1.00 163.24 ? 275  ILE A CB  1 
ATOM   2128  C  CG1 . ILE A  1  275  ? 18.318  -49.188  -84.349  1.00 173.50 ? 275  ILE A CG1 1 
ATOM   2129  C  CG2 . ILE A  1  275  ? 17.173  -47.927  -86.183  1.00 164.80 ? 275  ILE A CG2 1 
ATOM   2130  C  CD1 . ILE A  1  275  ? 17.217  -48.776  -83.402  1.00 169.56 ? 275  ILE A CD1 1 
ATOM   2131  N  N   . ILE A  1  276  ? 20.158  -47.067  -88.004  1.00 229.38 ? 276  ILE A N   1 
ATOM   2132  C  CA  . ILE A  1  276  ? 20.231  -46.352  -89.270  1.00 226.19 ? 276  ILE A CA  1 
ATOM   2133  C  C   . ILE A  1  276  ? 20.932  -47.217  -90.315  1.00 239.07 ? 276  ILE A C   1 
ATOM   2134  O  O   . ILE A  1  276  ? 20.632  -47.131  -91.507  1.00 241.89 ? 276  ILE A O   1 
ATOM   2135  C  CB  . ILE A  1  276  ? 20.930  -44.988  -89.125  1.00 141.23 ? 276  ILE A CB  1 
ATOM   2136  C  CG1 . ILE A  1  276  ? 20.196  -44.133  -88.095  1.00 132.48 ? 276  ILE A CG1 1 
ATOM   2137  C  CG2 . ILE A  1  276  ? 20.968  -44.248  -90.454  1.00 138.79 ? 276  ILE A CG2 1 
ATOM   2138  C  CD1 . ILE A  1  276  ? 20.526  -42.668  -88.203  1.00 121.90 ? 276  ILE A CD1 1 
ATOM   2139  N  N   . LYS A  1  277  ? 21.856  -48.063  -89.864  1.00 299.97 ? 277  LYS A N   1 
ATOM   2140  C  CA  . LYS A  1  277  ? 22.514  -49.020  -90.742  1.00 315.09 ? 277  LYS A CA  1 
ATOM   2141  C  C   . LYS A  1  277  ? 21.474  -49.952  -91.347  1.00 328.73 ? 277  LYS A C   1 
ATOM   2142  O  O   . LYS A  1  277  ? 21.558  -50.323  -92.515  1.00 335.43 ? 277  LYS A O   1 
ATOM   2143  C  CB  . LYS A  1  277  ? 23.558  -49.840  -89.982  1.00 248.55 ? 277  LYS A CB  1 
ATOM   2144  C  CG  . LYS A  1  277  ? 24.842  -49.092  -89.642  1.00 240.83 ? 277  LYS A CG  1 
ATOM   2145  C  CD  . LYS A  1  277  ? 25.791  -49.956  -88.822  1.00 253.17 ? 277  LYS A CD  1 
ATOM   2146  C  CE  . LYS A  1  277  ? 27.006  -49.168  -88.352  1.00 247.03 ? 277  LYS A CE  1 
ATOM   2147  N  NZ  . LYS A  1  277  ? 27.837  -49.932  -87.381  1.00 259.24 ? 277  LYS A NZ  1 
ATOM   2148  N  N   . ALA A  1  278  ? 20.486  -50.325  -90.536  1.00 175.70 ? 278  ALA A N   1 
ATOM   2149  C  CA  . ALA A  1  278  ? 19.444  -51.253  -90.973  1.00 193.32 ? 278  ALA A CA  1 
ATOM   2150  C  C   . ALA A  1  278  ? 18.272  -50.545  -91.655  1.00 189.01 ? 278  ALA A C   1 
ATOM   2151  O  O   . ALA A  1  278  ? 17.374  -51.200  -92.187  1.00 203.32 ? 278  ALA A O   1 
ATOM   2152  C  CB  . ALA A  1  278  ? 18.958  -52.104  -89.803  1.00 169.05 ? 278  ALA A CB  1 
ATOM   2153  N  N   . ASN A  1  279  ? 18.280  -49.213  -91.644  1.00 258.38 ? 279  ASN A N   1 
ATOM   2154  C  CA  . ASN A  1  279  ? 17.236  -48.438  -92.312  1.00 256.48 ? 279  ASN A CA  1 
ATOM   2155  C  C   . ASN A  1  279  ? 17.650  -47.943  -93.692  1.00 256.23 ? 279  ASN A C   1 
ATOM   2156  O  O   . ASN A  1  279  ? 16.888  -48.055  -94.652  1.00 264.43 ? 279  ASN A O   1 
ATOM   2157  C  CB  . ASN A  1  279  ? 16.822  -47.238  -91.457  1.00 156.41 ? 279  ASN A CB  1 
ATOM   2158  C  CG  . ASN A  1  279  ? 15.885  -46.295  -92.199  1.00 153.05 ? 279  ASN A CG  1 
ATOM   2159  O  OD1 . ASN A  1  279  ? 15.087  -46.732  -93.022  1.00 164.27 ? 279  ASN A OD1 1 
ATOM   2160  N  ND2 . ASN A  1  279  ? 15.977  -45.012  -91.903  1.00 139.93 ? 279  ASN A ND2 1 
ATOM   2161  N  N   . ALA A  1  280  ? 18.846  -47.377  -93.781  1.00 219.47 ? 280  ALA A N   1 
ATOM   2162  C  CA  . ALA A  1  280  ? 19.371  -46.898  -95.058  1.00 220.80 ? 280  ALA A CA  1 
ATOM   2163  C  C   . ALA A  1  280  ? 19.506  -48.041  -96.064  1.00 238.38 ? 280  ALA A C   1 
ATOM   2164  O  O   . ALA A  1  280  ? 19.337  -47.834  -97.266  1.00 240.73 ? 280  ALA A O   1 
ATOM   2165  C  CB  . ALA A  1  280  ? 20.701  -46.196  -94.849  1.00 149.31 ? 280  ALA A CB  1 
ATOM   2166  N  N   . ASN A  1  281  ? 19.816  -49.238  -95.573  1.00 339.22 ? 281  ASN A N   1 
ATOM   2167  C  CA  . ASN A  1  281  ? 19.915  -50.419  -96.433  1.00 359.54 ? 281  ASN A CA  1 
ATOM   2168  C  C   . ASN A  1  281  ? 18.543  -50.930  -96.865  1.00 374.37 ? 281  ASN A C   1 
ATOM   2169  O  O   . ASN A  1  281  ? 18.439  -51.738  -97.788  1.00 390.40 ? 281  ASN A O   1 
ATOM   2170  C  CB  . ASN A  1  281  ? 20.698  -51.541  -95.734  1.00 268.49 ? 281  ASN A CB  1 
ATOM   2171  C  CG  . ASN A  1  281  ? 22.195  -51.291  -95.727  1.00 262.80 ? 281  ASN A CG  1 
ATOM   2172  O  OD1 . ASN A  1  281  ? 22.659  -50.245  -96.175  1.00 250.75 ? 281  ASN A OD1 1 
ATOM   2173  N  ND2 . ASN A  1  281  ? 22.954  -52.252  -95.218  1.00 274.48 ? 281  ASN A ND2 1 
ATOM   2174  N  N   . VAL A  1  282  ? 17.499  -50.467  -96.187  1.00 141.63 ? 282  VAL A N   1 
ATOM   2175  C  CA  . VAL A  1  282  ? 16.136  -50.854  -96.530  1.00 157.81 ? 282  VAL A CA  1 
ATOM   2176  C  C   . VAL A  1  282  ? 15.451  -49.793  -97.399  1.00 152.24 ? 282  VAL A C   1 
ATOM   2177  O  O   . VAL A  1  282  ? 14.632  -50.123  -98.248  1.00 166.65 ? 282  VAL A O   1 
ATOM   2178  C  CB  . VAL A  1  282  ? 15.281  -51.159  -95.272  1.00 162.06 ? 282  VAL A CB  1 
ATOM   2179  C  CG1 . VAL A  1  282  ? 13.842  -51.477  -95.657  1.00 178.56 ? 282  VAL A CG1 1 
ATOM   2180  C  CG2 . VAL A  1  282  ? 15.884  -52.313  -94.484  1.00 173.44 ? 282  VAL A CG2 1 
ATOM   2181  N  N   . ARG A  1  283  ? 15.807  -48.530  -97.185  1.00 392.52 ? 283  ARG A N   1 
ATOM   2182  C  CA  . ARG A  1  283  ? 15.204  -47.427  -97.927  1.00 388.75 ? 283  ARG A CA  1 
ATOM   2183  C  C   . ARG A  1  283  ? 15.685  -47.361  -99.376  1.00 389.92 ? 283  ARG A C   1 
ATOM   2184  O  O   . ARG A  1  283  ? 14.936  -46.960  -100.266 1.00 392.84 ? 283  ARG A O   1 
ATOM   2185  C  CB  . ARG A  1  283  ? 15.482  -46.097  -97.223  1.00 252.76 ? 283  ARG A CB  1 
ATOM   2186  C  CG  . ARG A  1  283  ? 15.502  -44.895  -98.153  1.00 248.05 ? 283  ARG A CG  1 
ATOM   2187  C  CD  . ARG A  1  283  ? 15.946  -43.638  -97.422  1.00 233.81 ? 283  ARG A CD  1 
ATOM   2188  N  NE  . ARG A  1  283  ? 15.496  -42.425  -98.097  1.00 233.40 ? 283  ARG A NE  1 
ATOM   2189  C  CZ  . ARG A  1  283  ? 14.338  -41.820  -97.853  1.00 239.88 ? 283  ARG A CZ  1 
ATOM   2190  N  NH1 . ARG A  1  283  ? 13.507  -42.314  -96.946  1.00 247.20 ? 283  ARG A NH1 1 
ATOM   2191  N  NH2 . ARG A  1  283  ? 14.011  -40.718  -98.515  1.00 241.36 ? 283  ARG A NH2 1 
ATOM   2192  N  N   . ARG A  1  284  ? 16.934  -47.751  -99.608  1.00 364.89 ? 284  ARG A N   1 
ATOM   2193  C  CA  . ARG A  1  284  ? 17.520  -47.689  -100.946 1.00 367.18 ? 284  ARG A CA  1 
ATOM   2194  C  C   . ARG A  1  284  ? 16.876  -48.703  -101.891 1.00 387.02 ? 284  ARG A C   1 
ATOM   2195  O  O   . ARG A  1  284  ? 16.934  -48.550  -103.110 1.00 390.39 ? 284  ARG A O   1 
ATOM   2196  C  CB  . ARG A  1  284  ? 19.036  -47.905  -100.884 1.00 242.59 ? 284  ARG A CB  1 
ATOM   2197  C  CG  . ARG A  1  284  ? 19.444  -49.287  -100.367 1.00 254.33 ? 284  ARG A CG  1 
ATOM   2198  C  CD  . ARG A  1  284  ? 20.955  -49.492  -100.403 1.00 253.40 ? 284  ARG A CD  1 
ATOM   2199  N  NE  . ARG A  1  284  ? 21.358  -50.768  -99.797  1.00 266.13 ? 284  ARG A NE  1 
ATOM   2200  C  CZ  . ARG A  1  284  ? 21.673  -51.863  -100.484 1.00 283.68 ? 284  ARG A CZ  1 
ATOM   2201  N  NH1 . ARG A  1  284  ? 21.641  -51.850  -101.810 1.00 288.82 ? 284  ARG A NH1 1 
ATOM   2202  N  NH2 . ARG A  1  284  ? 22.027  -52.966  -99.841  1.00 297.36 ? 284  ARG A NH2 1 
ATOM   2203  N  N   . CYS A  1  285  ? 16.260  -49.737  -101.316 1.00 262.20 ? 285  CYS A N   1 
ATOM   2204  C  CA  . CYS A  1  285  ? 15.633  -50.808  -102.090 1.00 285.21 ? 285  CYS A CA  1 
ATOM   2205  C  C   . CYS A  1  285  ? 14.213  -50.443  -102.501 1.00 293.68 ? 285  CYS A C   1 
ATOM   2206  O  O   . CYS A  1  285  ? 13.473  -51.283  -103.005 1.00 315.37 ? 285  CYS A O   1 
ATOM   2207  C  CB  . CYS A  1  285  ? 15.584  -52.105  -101.271 1.00 196.99 ? 285  CYS A CB  1 
ATOM   2208  S  SG  . CYS A  1  285  ? 17.068  -52.481  -100.309 1.00 191.10 ? 285  CYS A SG  1 
ATOM   2209  N  N   . GLU A  1  286  ? 13.836  -49.191  -102.276 1.00 388.87 ? 286  GLU A N   1 
ATOM   2210  C  CA  . GLU A  1  286  ? 12.480  -48.740  -102.568 1.00 399.04 ? 286  GLU A CA  1 
ATOM   2211  C  C   . GLU A  1  286  ? 12.160  -48.942  -104.042 1.00 412.32 ? 286  GLU A C   1 
ATOM   2212  O  O   . GLU A  1  286  ? 11.035  -49.278  -104.400 1.00 429.16 ? 286  GLU A O   1 
ATOM   2213  C  CB  . GLU A  1  286  ? 12.293  -47.270  -102.186 1.00 246.57 ? 286  GLU A CB  1 
ATOM   2214  C  CG  . GLU A  1  286  ? 10.875  -46.754  -102.376 1.00 255.74 ? 286  GLU A CG  1 
ATOM   2215  C  CD  . GLU A  1  286  ? 9.879   -47.394  -101.421 1.00 269.79 ? 286  GLU A CD  1 
ATOM   2216  O  OE1 . GLU A  1  286  ? 10.312  -48.039  -100.445 1.00 268.08 ? 286  GLU A OE1 1 
ATOM   2217  O  OE2 . GLU A  1  286  ? 8.663   -47.245  -101.645 1.00 284.04 ? 286  GLU A OE2 1 
ATOM   2218  N  N   . GLN A  1  287  ? 13.165  -48.750  -104.896 1.00 355.02 ? 287  GLN A N   1 
ATOM   2219  C  CA  . GLN A  1  287  ? 12.992  -48.926  -106.330 1.00 364.28 ? 287  GLN A CA  1 
ATOM   2220  C  C   . GLN A  1  287  ? 12.846  -50.405  -106.680 1.00 387.37 ? 287  GLN A C   1 
ATOM   2221  O  O   . GLN A  1  287  ? 12.752  -50.776  -107.851 1.00 398.20 ? 287  GLN A O   1 
ATOM   2222  C  CB  . GLN A  1  287  ? 14.169  -48.314  -107.093 1.00 20.00  ? 287  GLN A CB  1 
ATOM   2223  C  CG  . GLN A  1  287  ? 14.250  -46.800  -107.001 1.00 20.00  ? 287  GLN A CG  1 
ATOM   2224  C  CD  . GLN A  1  287  ? 15.466  -46.237  -107.707 1.00 20.00  ? 287  GLN A CD  1 
ATOM   2225  O  OE1 . GLN A  1  287  ? 16.472  -46.927  -107.870 1.00 20.00  ? 287  GLN A OE1 1 
ATOM   2226  N  NE2 . GLN A  1  287  ? 15.377  -44.979  -108.128 1.00 20.00  ? 287  GLN A NE2 1 
ATOM   2227  N  N   . GLU A  1  288  ? 12.824  -51.246  -105.651 1.00 465.32 ? 288  GLU A N   1 
ATOM   2228  C  CA  . GLU A  1  288  ? 12.705  -52.687  -105.845 1.00 488.17 ? 288  GLU A CA  1 
ATOM   2229  C  C   . GLU A  1  288  ? 11.668  -53.292  -104.911 1.00 503.00 ? 288  GLU A C   1 
ATOM   2230  O  O   . GLU A  1  288  ? 11.566  -52.910  -103.741 1.00 496.39 ? 288  GLU A O   1 
ATOM   2231  C  CB  . GLU A  1  288  ? 14.057  -53.355  -105.625 1.00 350.83 ? 288  GLU A CB  1 
ATOM   2232  C  CG  . GLU A  1  288  ? 15.170  -52.752  -106.457 1.00 334.66 ? 288  GLU A CG  1 
ATOM   2233  C  CD  . GLU A  1  288  ? 16.520  -53.307  -106.085 1.00 333.35 ? 288  GLU A CD  1 
ATOM   2234  O  OE1 . GLU A  1  288  ? 16.578  -54.143  -105.160 1.00 342.89 ? 288  GLU A OE1 1 
ATOM   2235  O  OE2 . GLU A  1  288  ? 17.520  -52.911  -106.717 1.00 324.42 ? 288  GLU A OE2 1 
ATOM   2236  N  N   . GLY A  1  289  ? 10.896  -54.245  -105.428 1.00 544.93 ? 289  GLY A N   1 
ATOM   2237  C  CA  . GLY A  1  289  ? 11.065  -54.700  -106.793 1.00 553.00 ? 289  GLY A CA  1 
ATOM   2238  C  C   . GLY A  1  289  ? 11.669  -56.090  -106.831 1.00 567.66 ? 289  GLY A C   1 
ATOM   2239  O  O   . GLY A  1  289  ? 11.164  -56.982  -107.506 1.00 582.97 ? 289  GLY A O   1 
ATOM   2240  N  N   . ALA A  1  290  ? 12.756  -56.260  -106.085 1.00 278.38 ? 290  ALA A N   1 
ATOM   2241  C  CA  . ALA A  1  290  ? 13.443  -57.538  -105.997 1.00 302.34 ? 290  ALA A CA  1 
ATOM   2242  C  C   . ALA A  1  290  ? 14.470  -57.476  -104.879 1.00 288.89 ? 290  ALA A C   1 
ATOM   2243  O  O   . ALA A  1  290  ? 15.193  -56.492  -104.752 1.00 261.03 ? 290  ALA A O   1 
ATOM   2244  C  CB  . ALA A  1  290  ? 14.112  -57.876  -107.320 1.00 153.48 ? 290  ALA A CB  1 
ATOM   2245  N  N   . PRO A  1  291  ? 14.537  -58.528  -104.051 1.00 273.26 ? 291  PRO A N   1 
ATOM   2246  C  CA  . PRO A  1  291  ? 13.644  -59.691  -104.133 1.00 311.79 ? 291  PRO A CA  1 
ATOM   2247  C  C   . PRO A  1  291  ? 12.249  -59.394  -103.590 1.00 317.27 ? 291  PRO A C   1 
ATOM   2248  O  O   . PRO A  1  291  ? 11.365  -60.237  -103.720 1.00 349.67 ? 291  PRO A O   1 
ATOM   2249  C  CB  . PRO A  1  291  ? 14.338  -60.728  -103.238 1.00 195.18 ? 291  PRO A CB  1 
ATOM   2250  C  CG  . PRO A  1  291  ? 15.744  -60.227  -103.057 1.00 170.41 ? 291  PRO A CG  1 
ATOM   2251  C  CD  . PRO A  1  291  ? 15.625  -58.746  -103.093 1.00 138.73 ? 291  PRO A CD  1 
ATOM   2252  N  N   . ALA A  1  292  ? 12.060  -58.226  -102.987 1.00 307.96 ? 292  ALA A N   1 
ATOM   2253  C  CA  . ALA A  1  292  ? 10.765  -57.843  -102.421 1.00 312.25 ? 292  ALA A CA  1 
ATOM   2254  C  C   . ALA A  1  292  ? 10.351  -58.684  -101.204 1.00 333.38 ? 292  ALA A C   1 
ATOM   2255  O  O   . ALA A  1  292  ? 10.320  -58.181  -100.083 1.00 318.50 ? 292  ALA A O   1 
ATOM   2256  C  CB  . ALA A  1  292  ? 9.678   -57.858  -103.496 1.00 236.32 ? 292  ALA A CB  1 
ATOM   2257  N  N   . HIS A  1  293  ? 10.023  -59.955  -101.422 1.00 317.56 ? 293  HIS A N   1 
ATOM   2258  C  CA  . HIS A  1  293  ? 9.585   -60.813  -100.325 1.00 341.36 ? 293  HIS A CA  1 
ATOM   2259  C  C   . HIS A  1  293  ? 10.693  -61.036  -99.303  1.00 328.71 ? 293  HIS A C   1 
ATOM   2260  O  O   . HIS A  1  293  ? 10.425  -61.288  -98.129  1.00 334.69 ? 293  HIS A O   1 
ATOM   2261  C  CB  . HIS A  1  293  ? 9.078   -62.165  -100.850 1.00 231.02 ? 293  HIS A CB  1 
ATOM   2262  C  CG  . HIS A  1  293  ? 7.766   -62.089  -101.559 1.00 248.54 ? 293  HIS A CG  1 
ATOM   2263  N  ND1 . HIS A  1  293  ? 6.565   -62.378  -100.950 1.00 270.03 ? 293  HIS A ND1 1 
ATOM   2264  C  CD2 . HIS A  1  293  ? 7.458   -61.773  -102.846 1.00 249.72 ? 293  HIS A CD2 1 
ATOM   2265  C  CE1 . HIS A  1  293  ? 5.574   -62.232  -101.815 1.00 284.22 ? 293  HIS A CE1 1 
ATOM   2266  N  NE2 . HIS A  1  293  ? 6.099   -61.865  -102.977 1.00 271.71 ? 293  HIS A NE2 1 
ATOM   2267  N  N   . ILE A  1  294  ? 11.939  -60.939  -99.753  1.00 308.92 ? 294  ILE A N   1 
ATOM   2268  C  CA  . ILE A  1  294  ? 13.083  -61.071  -98.863  1.00 295.75 ? 294  ILE A CA  1 
ATOM   2269  C  C   . ILE A  1  294  ? 13.380  -59.741  -98.156  1.00 253.07 ? 294  ILE A C   1 
ATOM   2270  O  O   . ILE A  1  294  ? 13.980  -59.727  -97.085  1.00 244.06 ? 294  ILE A O   1 
ATOM   2271  C  CB  . ILE A  1  294  ? 14.342  -61.578  -99.606  1.00 183.91 ? 294  ILE A CB  1 
ATOM   2272  C  CG1 . ILE A  1  294  ? 14.072  -62.918  -100.293 1.00 220.75 ? 294  ILE A CG1 1 
ATOM   2273  C  CG2 . ILE A  1  294  ? 15.516  -61.720  -98.654  1.00 175.01 ? 294  ILE A CG2 1 
ATOM   2274  C  CD1 . ILE A  1  294  ? 15.318  -63.549  -100.887 1.00 231.98 ? 294  ILE A CD1 1 
ATOM   2275  N  N   . VAL A  1  295  ? 12.947  -58.633  -98.752  1.00 408.76 ? 295  VAL A N   1 
ATOM   2276  C  CA  . VAL A  1  295  ? 13.188  -57.304  -98.187  1.00 369.98 ? 295  VAL A CA  1 
ATOM   2277  C  C   . VAL A  1  295  ? 12.491  -57.106  -96.832  1.00 367.40 ? 295  VAL A C   1 
ATOM   2278  O  O   . VAL A  1  295  ? 12.943  -56.316  -96.003  1.00 342.52 ? 295  VAL A O   1 
ATOM   2279  C  CB  . VAL A  1  295  ? 12.781  -56.162  -99.169  1.00 205.47 ? 295  VAL A CB  1 
ATOM   2280  C  CG1 . VAL A  1  295  ? 13.093  -54.792  -98.580  1.00 170.86 ? 295  VAL A CG1 1 
ATOM   2281  C  CG2 . VAL A  1  295  ? 13.484  -56.326  -100.505 1.00 205.97 ? 295  VAL A CG2 1 
ATOM   2282  N  N   . SER A  1  296  ? 11.401  -57.838  -96.607  1.00 568.34 ? 296  SER A N   1 
ATOM   2283  C  CA  . SER A  1  296  ? 10.633  -57.726  -95.363  1.00 571.92 ? 296  SER A CA  1 
ATOM   2284  C  C   . SER A  1  296  ? 11.366  -58.364  -94.188  1.00 574.45 ? 296  SER A C   1 
ATOM   2285  O  O   . SER A  1  296  ? 11.160  -57.992  -93.031  1.00 571.39 ? 296  SER A O   1 
ATOM   2286  C  CB  . SER A  1  296  ? 9.265   -58.385  -95.524  1.00 487.92 ? 296  SER A CB  1 
ATOM   2287  O  OG  . SER A  1  296  ? 9.401   -59.787  -95.688  1.00 520.00 ? 296  SER A OG  1 
ATOM   2288  N  N   . GLU A  1  297  ? 12.213  -59.339  -94.502  1.00 335.59 ? 297  GLU A N   1 
ATOM   2289  C  CA  . GLU A  1  297  ? 12.997  -60.043  -93.502  1.00 341.31 ? 297  GLU A CA  1 
ATOM   2290  C  C   . GLU A  1  297  ? 13.974  -59.089  -92.804  1.00 302.87 ? 297  GLU A C   1 
ATOM   2291  O  O   . GLU A  1  297  ? 14.228  -59.221  -91.604  1.00 301.94 ? 297  GLU A O   1 
ATOM   2292  C  CB  . GLU A  1  297  ? 13.735  -61.223  -94.158  1.00 236.64 ? 297  GLU A CB  1 
ATOM   2293  C  CG  . GLU A  1  297  ? 12.814  -62.158  -94.957  1.00 273.00 ? 297  GLU A CG  1 
ATOM   2294  C  CD  . GLU A  1  297  ? 13.556  -63.086  -95.923  1.00 290.37 ? 297  GLU A CD  1 
ATOM   2295  O  OE1 . GLU A  1  297  ? 14.800  -63.148  -95.868  1.00 280.78 ? 297  GLU A OE1 1 
ATOM   2296  O  OE2 . GLU A  1  297  ? 12.880  -63.761  -96.735  1.00 315.45 ? 297  GLU A OE2 1 
ATOM   2297  N  N   . TYR A  1  298  ? 14.499  -58.128  -93.561  1.00 410.90 ? 298  TYR A N   1 
ATOM   2298  C  CA  . TYR A  1  298  ? 15.384  -57.101  -93.005  1.00 373.75 ? 298  TYR A CA  1 
ATOM   2299  C  C   . TYR A  1  298  ? 14.583  -55.971  -92.351  1.00 350.01 ? 298  TYR A C   1 
ATOM   2300  O  O   . TYR A  1  298  ? 15.088  -55.267  -91.473  1.00 328.77 ? 298  TYR A O   1 
ATOM   2301  C  CB  . TYR A  1  298  ? 16.317  -56.526  -94.089  1.00 235.84 ? 298  TYR A CB  1 
ATOM   2302  C  CG  . TYR A  1  298  ? 17.389  -57.472  -94.604  1.00 252.05 ? 298  TYR A CG  1 
ATOM   2303  C  CD1 . TYR A  1  298  ? 18.590  -57.636  -93.926  1.00 247.90 ? 298  TYR A CD1 1 
ATOM   2304  C  CD2 . TYR A  1  298  ? 17.205  -58.190  -95.783  1.00 273.09 ? 298  TYR A CD2 1 
ATOM   2305  C  CE1 . TYR A  1  298  ? 19.575  -58.497  -94.398  1.00 265.08 ? 298  TYR A CE1 1 
ATOM   2306  C  CE2 . TYR A  1  298  ? 18.188  -59.049  -96.263  1.00 289.88 ? 298  TYR A CE2 1 
ATOM   2307  C  CZ  . TYR A  1  298  ? 19.370  -59.199  -95.564  1.00 286.09 ? 298  TYR A CZ  1 
ATOM   2308  O  OH  . TYR A  1  298  ? 20.344  -60.051  -96.036  1.00 305.40 ? 298  TYR A OH  1 
ATOM   2309  N  N   . GLU A  1  299  ? 13.341  -55.801  -92.786  1.00 433.17 ? 299  GLU A N   1 
ATOM   2310  C  CA  . GLU A  1  299  ? 12.447  -54.805  -92.194  1.00 415.95 ? 299  GLU A CA  1 
ATOM   2311  C  C   . GLU A  1  299  ? 12.082  -55.204  -90.771  1.00 421.64 ? 299  GLU A C   1 
ATOM   2312  O  O   . GLU A  1  299  ? 11.854  -54.346  -89.918  1.00 404.40 ? 299  GLU A O   1 
ATOM   2313  C  CB  . GLU A  1  299  ? 11.175  -54.643  -93.025  1.00 317.47 ? 299  GLU A CB  1 
ATOM   2314  C  CG  . GLU A  1  299  ? 11.354  -53.869  -94.322  1.00 303.33 ? 299  GLU A CG  1 
ATOM   2315  C  CD  . GLU A  1  299  ? 10.081  -53.813  -95.157  1.00 319.01 ? 299  GLU A CD  1 
ATOM   2316  O  OE1 . GLU A  1  299  ? 9.005   -54.194  -94.637  1.00 339.32 ? 299  GLU A OE1 1 
ATOM   2317  O  OE2 . GLU A  1  299  ? 10.153  -53.392  -96.332  1.00 312.50 ? 299  GLU A OE2 1 
ATOM   2318  N  N   . GLN A  1  300  ? 12.022  -56.506  -90.520  1.00 543.14 ? 300  GLN A N   1 
ATOM   2319  C  CA  . GLN A  1  300  ? 11.700  -57.009  -89.198  1.00 549.79 ? 300  GLN A CA  1 
ATOM   2320  C  C   . GLN A  1  300  ? 12.789  -56.638  -88.196  1.00 535.31 ? 300  GLN A C   1 
ATOM   2321  O  O   . GLN A  1  300  ? 12.554  -56.627  -86.989  1.00 536.13 ? 300  GLN A O   1 
ATOM   2322  C  CB  . GLN A  1  300  ? 11.483  -58.528  -89.225  1.00 513.49 ? 300  GLN A CB  1 
ATOM   2323  C  CG  . GLN A  1  300  ? 10.262  -58.956  -90.028  1.00 536.75 ? 300  GLN A CG  1 
ATOM   2324  C  CD  . GLN A  1  300  ? 10.037  -60.454  -90.000  1.00 557.78 ? 300  GLN A CD  1 
ATOM   2325  O  OE1 . GLN A  1  300  ? 10.846  -61.204  -89.455  1.00 559.80 ? 300  GLN A OE1 1 
ATOM   2326  N  NE2 . GLN A  1  300  ? 8.931   -60.897  -90.583  1.00 566.05 ? 300  GLN A NE2 1 
ATOM   2327  N  N   . LEU A  1  301  ? 13.983  -56.328  -88.700  1.00 391.39 ? 301  LEU A N   1 
ATOM   2328  C  CA  . LEU A  1  301  ? 15.094  -55.954  -87.832  1.00 367.33 ? 301  LEU A CA  1 
ATOM   2329  C  C   . LEU A  1  301  ? 14.942  -54.553  -87.217  1.00 335.04 ? 301  LEU A C   1 
ATOM   2330  O  O   . LEU A  1  301  ? 15.343  -54.335  -86.075  1.00 326.08 ? 301  LEU A O   1 
ATOM   2331  C  CB  . LEU A  1  301  ? 16.442  -56.103  -88.552  1.00 276.97 ? 301  LEU A CB  1 
ATOM   2332  C  CG  . LEU A  1  301  ? 16.902  -57.529  -88.881  1.00 307.63 ? 301  LEU A CG  1 
ATOM   2333  C  CD1 . LEU A  1  301  ? 18.186  -57.504  -89.699  1.00 301.85 ? 301  LEU A CD1 1 
ATOM   2334  C  CD2 . LEU A  1  301  ? 17.076  -58.380  -87.626  1.00 324.83 ? 301  LEU A CD2 1 
ATOM   2335  N  N   . LEU A  1  302  ? 14.361  -53.610  -87.964  1.00 266.20 ? 302  LEU A N   1 
ATOM   2336  C  CA  . LEU A  1  302  ? 14.061  -52.284  -87.404  1.00 238.15 ? 302  LEU A CA  1 
ATOM   2337  C  C   . LEU A  1  302  ? 12.971  -52.403  -86.346  1.00 245.14 ? 302  LEU A C   1 
ATOM   2338  O  O   . LEU A  1  302  ? 12.853  -51.575  -85.449  1.00 230.17 ? 302  LEU A O   1 
ATOM   2339  C  CB  . LEU A  1  302  ? 13.609  -51.287  -88.477  1.00 155.29 ? 302  LEU A CB  1 
ATOM   2340  C  CG  . LEU A  1  302  ? 14.637  -50.586  -89.374  1.00 140.15 ? 302  LEU A CG  1 
ATOM   2341  C  CD1 . LEU A  1  302  ? 13.995  -49.461  -90.181  1.00 131.68 ? 302  LEU A CD1 1 
ATOM   2342  C  CD2 . LEU A  1  302  ? 15.785  -50.041  -88.560  1.00 123.43 ? 302  LEU A CD2 1 
ATOM   2343  N  N   . GLN A  1  303  ? 12.156  -53.447  -86.473  1.00 316.48 ? 303  GLN A N   1 
ATOM   2344  C  CA  . GLN A  1  303  ? 11.085  -53.695  -85.525  1.00 328.51 ? 303  GLN A CA  1 
ATOM   2345  C  C   . GLN A  1  303  ? 11.674  -54.115  -84.184  1.00 326.71 ? 303  GLN A C   1 
ATOM   2346  O  O   . GLN A  1  303  ? 11.046  -53.939  -83.142  1.00 328.67 ? 303  GLN A O   1 
ATOM   2347  C  CB  . GLN A  1  303  ? 10.140  -54.772  -86.057  1.00 297.54 ? 303  GLN A CB  1 
ATOM   2348  C  CG  . GLN A  1  303  ? 9.612   -54.511  -87.466  1.00 300.28 ? 303  GLN A CG  1 
ATOM   2349  C  CD  . GLN A  1  303  ? 8.764   -55.654  -88.015  1.00 335.36 ? 303  GLN A CD  1 
ATOM   2350  O  OE1 . GLN A  1  303  ? 8.500   -56.637  -87.326  1.00 359.75 ? 303  GLN A OE1 1 
ATOM   2351  N  NE2 . GLN A  1  303  ? 8.339   -55.526  -89.268  1.00 338.73 ? 303  GLN A NE2 1 
ATOM   2352  N  N   . PHE A  1  304  ? 12.889  -54.661  -84.215  1.00 291.10 ? 304  PHE A N   1 
ATOM   2353  C  CA  . PHE A  1  304  ? 13.552  -55.159  -83.011  1.00 291.98 ? 304  PHE A CA  1 
ATOM   2354  C  C   . PHE A  1  304  ? 14.516  -54.135  -82.409  1.00 260.90 ? 304  PHE A C   1 
ATOM   2355  O  O   . PHE A  1  304  ? 14.525  -53.915  -81.199  1.00 254.43 ? 304  PHE A O   1 
ATOM   2356  C  CB  . PHE A  1  304  ? 14.294  -56.476  -83.293  1.00 253.55 ? 304  PHE A CB  1 
ATOM   2357  C  CG  . PHE A  1  304  ? 13.383  -57.668  -83.503  1.00 290.71 ? 304  PHE A CG  1 
ATOM   2358  C  CD1 . PHE A  1  304  ? 12.680  -58.220  -82.438  1.00 310.59 ? 304  PHE A CD1 1 
ATOM   2359  C  CD2 . PHE A  1  304  ? 13.249  -58.248  -84.756  1.00 308.15 ? 304  PHE A CD2 1 
ATOM   2360  C  CE1 . PHE A  1  304  ? 11.849  -59.319  -82.629  1.00 348.66 ? 304  PHE A CE1 1 
ATOM   2361  C  CE2 . PHE A  1  304  ? 12.422  -59.342  -84.948  1.00 345.61 ? 304  PHE A CE2 1 
ATOM   2362  C  CZ  . PHE A  1  304  ? 11.724  -59.880  -83.886  1.00 366.72 ? 304  PHE A CZ  1 
ATOM   2363  N  N   . HIS A  1  305  ? 15.335  -53.509  -83.251  1.00 269.70 ? 305  HIS A N   1 
ATOM   2364  C  CA  . HIS A  1  305  ? 16.330  -52.547  -82.784  1.00 243.91 ? 305  HIS A CA  1 
ATOM   2365  C  C   . HIS A  1  305  ? 15.718  -51.313  -82.086  1.00 224.96 ? 305  HIS A C   1 
ATOM   2366  O  O   . HIS A  1  305  ? 16.083  -50.994  -80.951  1.00 216.48 ? 305  HIS A O   1 
ATOM   2367  C  CB  . HIS A  1  305  ? 17.255  -52.127  -83.936  1.00 176.55 ? 305  HIS A CB  1 
ATOM   2368  C  CG  . HIS A  1  305  ? 18.293  -53.151  -84.299  1.00 190.49 ? 305  HIS A CG  1 
ATOM   2369  N  ND1 . HIS A  1  305  ? 19.549  -53.183  -83.728  1.00 186.50 ? 305  HIS A ND1 1 
ATOM   2370  C  CD2 . HIS A  1  305  ? 18.266  -54.163  -85.199  1.00 210.71 ? 305  HIS A CD2 1 
ATOM   2371  C  CE1 . HIS A  1  305  ? 20.240  -54.183  -84.243  1.00 203.66 ? 305  HIS A CE1 1 
ATOM   2372  N  NE2 . HIS A  1  305  ? 19.490  -54.793  -85.141  1.00 218.73 ? 305  HIS A NE2 1 
ATOM   2373  N  N   . VAL A  1  306  ? 14.808  -50.625  -82.773  1.00 114.73 ? 306  VAL A N   1 
ATOM   2374  C  CA  . VAL A  1  306  ? 14.030  -49.511  -82.197  1.00 109.36 ? 306  VAL A CA  1 
ATOM   2375  C  C   . VAL A  1  306  ? 13.204  -49.941  -80.959  1.00 118.52 ? 306  VAL A C   1 
ATOM   2376  O  O   . VAL A  1  306  ? 12.571  -49.136  -80.280  1.00 112.81 ? 306  VAL A O   1 
ATOM   2377  C  CB  . VAL A  1  306  ? 13.131  -48.830  -83.287  1.00 108.06 ? 306  VAL A CB  1 
ATOM   2378  C  CG1 . VAL A  1  306  ? 11.904  -48.122  -82.682  1.00 107.77 ? 306  VAL A CG1 1 
ATOM   2379  C  CG2 . VAL A  1  306  ? 13.961  -47.885  -84.116  1.00 100.95 ? 306  VAL A CG2 1 
ATOM   2380  N  N   . ALA A  1  307  ? 13.219  -51.226  -80.660  1.00 147.83 ? 307  ALA A N   1 
ATOM   2381  C  CA  . ALA A  1  307  ? 12.527  -51.676  -79.480  1.00 159.22 ? 307  ALA A CA  1 
ATOM   2382  C  C   . ALA A  1  307  ? 13.545  -51.891  -78.377  1.00 152.32 ? 307  ALA A C   1 
ATOM   2383  O  O   . ALA A  1  307  ? 13.375  -51.411  -77.262  1.00 144.95 ? 307  ALA A O   1 
ATOM   2384  C  CB  . ALA A  1  307  ? 11.759  -52.938  -79.770  1.00 139.39 ? 307  ALA A CB  1 
ATOM   2385  N  N   . THR A  1  308  ? 14.620  -52.605  -78.707  1.00 274.59 ? 308  THR A N   1 
ATOM   2386  C  CA  . THR A  1  308  ? 15.688  -52.855  -77.748  1.00 269.76 ? 308  THR A CA  1 
ATOM   2387  C  C   . THR A  1  308  ? 16.200  -51.533  -77.209  1.00 243.47 ? 308  THR A C   1 
ATOM   2388  O  O   . THR A  1  308  ? 16.700  -51.459  -76.089  1.00 239.27 ? 308  THR A O   1 
ATOM   2389  C  CB  . THR A  1  308  ? 16.865  -53.610  -78.378  1.00 229.19 ? 308  THR A CB  1 
ATOM   2390  O  OG1 . THR A  1  308  ? 17.418  -52.835  -79.446  1.00 213.83 ? 308  THR A OG1 1 
ATOM   2391  C  CG2 . THR A  1  308  ? 16.422  -54.966  -78.907  1.00 258.92 ? 308  THR A CG2 1 
ATOM   2392  N  N   . TYR A  1  309  ? 16.072  -50.487  -78.021  1.00 324.03 ? 309  TYR A N   1 
ATOM   2393  C  CA  . TYR A  1  309  ? 16.484  -49.152  -77.616  1.00 299.76 ? 309  TYR A CA  1 
ATOM   2394  C  C   . TYR A  1  309  ? 15.571  -48.608  -76.529  1.00 295.77 ? 309  TYR A C   1 
ATOM   2395  O  O   . TYR A  1  309  ? 15.946  -47.702  -75.787  1.00 281.80 ? 309  TYR A O   1 
ATOM   2396  C  CB  . TYR A  1  309  ? 16.478  -48.204  -78.808  1.00 244.29 ? 309  TYR A CB  1 
ATOM   2397  C  CG  . TYR A  1  309  ? 17.019  -46.828  -78.485  1.00 225.38 ? 309  TYR A CG  1 
ATOM   2398  C  CD1 . TYR A  1  309  ? 18.353  -46.649  -78.171  1.00 218.93 ? 309  TYR A CD1 1 
ATOM   2399  C  CD2 . TYR A  1  309  ? 16.194  -45.708  -78.502  1.00 216.46 ? 309  TYR A CD2 1 
ATOM   2400  C  CE1 . TYR A  1  309  ? 18.860  -45.394  -77.870  1.00 204.61 ? 309  TYR A CE1 1 
ATOM   2401  C  CE2 . TYR A  1  309  ? 16.694  -44.442  -78.210  1.00 201.87 ? 309  TYR A CE2 1 
ATOM   2402  C  CZ  . TYR A  1  309  ? 18.029  -44.296  -77.894  1.00 196.32 ? 309  TYR A CZ  1 
ATOM   2403  O  OH  . TYR A  1  309  ? 18.541  -43.054  -77.597  1.00 185.02 ? 309  TYR A OH  1 
ATOM   2404  N  N   . MET A  1  310  ? 14.370  -49.168  -76.438  1.00 210.11 ? 310  MET A N   1 
ATOM   2405  C  CA  . MET A  1  310  ? 13.399  -48.741  -75.435  1.00 211.45 ? 310  MET A CA  1 
ATOM   2406  C  C   . MET A  1  310  ? 13.302  -49.747  -74.295  1.00 227.25 ? 310  MET A C   1 
ATOM   2407  O  O   . MET A  1  310  ? 13.649  -49.443  -73.154  1.00 219.33 ? 310  MET A O   1 
ATOM   2408  C  CB  . MET A  1  310  ? 12.024  -48.537  -76.072  1.00 171.65 ? 310  MET A CB  1 
ATOM   2409  C  CG  . MET A  1  310  ? 12.069  -47.989  -77.487  1.00 165.62 ? 310  MET A CG  1 
ATOM   2410  S  SD  . MET A  1  310  ? 12.586  -46.258  -77.547  1.00 140.02 ? 310  MET A SD  1 
ATOM   2411  C  CE  . MET A  1  310  ? 11.184  -45.464  -76.763  1.00 141.79 ? 310  MET A CE  1 
ATOM   2412  N  N   . ASP A  1  311  ? 12.836  -50.949  -74.612  1.00 274.55 ? 311  ASP A N   1 
ATOM   2413  C  CA  . ASP A  1  311  ? 12.698  -52.006  -73.617  1.00 295.40 ? 311  ASP A CA  1 
ATOM   2414  C  C   . ASP A  1  311  ? 13.557  -53.216  -73.968  1.00 312.59 ? 311  ASP A C   1 
ATOM   2415  O  O   . ASP A  1  311  ? 13.101  -54.135  -74.649  1.00 329.18 ? 311  ASP A O   1 
ATOM   2416  C  CB  . ASP A  1  311  ? 11.232  -52.425  -73.479  1.00 261.70 ? 311  ASP A CB  1 
ATOM   2417  C  CG  . ASP A  1  311  ? 10.414  -51.427  -72.684  1.00 251.63 ? 311  ASP A CG  1 
ATOM   2418  O  OD1 . ASP A  1  311  ? 10.944  -50.344  -72.361  1.00 227.21 ? 311  ASP A OD1 1 
ATOM   2419  O  OD2 . ASP A  1  311  ? 9.240   -51.727  -72.379  1.00 270.16 ? 311  ASP A OD2 1 
ATOM   2420  N  N   . ASN A  1  312  ? 14.801  -53.207  -73.504  1.00 265.95 ? 312  ASN A N   1 
ATOM   2421  C  CA  . ASN A  1  312  ? 15.727  -54.302  -73.771  1.00 285.35 ? 312  ASN A CA  1 
ATOM   2422  C  C   . ASN A  1  312  ? 15.038  -55.663  -73.731  1.00 320.23 ? 312  ASN A C   1 
ATOM   2423  O  O   . ASN A  1  312  ? 15.164  -56.460  -74.659  1.00 339.00 ? 312  ASN A O   1 
ATOM   2424  C  CB  . ASN A  1  312  ? 16.891  -54.272  -72.780  1.00 212.80 ? 312  ASN A CB  1 
ATOM   2425  C  CG  . ASN A  1  312  ? 17.939  -53.238  -73.142  1.00 189.96 ? 312  ASN A CG  1 
ATOM   2426  O  OD1 . ASN A  1  312  ? 18.710  -53.423  -74.082  1.00 190.44 ? 312  ASN A OD1 1 
ATOM   2427  N  ND2 . ASN A  1  312  ? 17.970  -52.141  -72.395  1.00 171.65 ? 312  ASN A ND2 1 
ATOM   2428  N  N   . GLU A  1  313  ? 14.309  -55.917  -72.651  1.00 236.02 ? 313  GLU A N   1 
ATOM   2429  C  CA  . GLU A  1  313  ? 13.599  -57.182  -72.488  1.00 273.78 ? 313  GLU A CA  1 
ATOM   2430  C  C   . GLU A  1  313  ? 12.099  -56.958  -72.325  1.00 288.19 ? 313  GLU A C   1 
ATOM   2431  O  O   . GLU A  1  313  ? 11.592  -56.883  -71.206  1.00 287.76 ? 313  GLU A O   1 
ATOM   2432  C  CB  . GLU A  1  313  ? 14.148  -57.954  -71.286  1.00 198.86 ? 313  GLU A CB  1 
ATOM   2433  C  CG  . GLU A  1  313  ? 13.480  -59.299  -71.053  1.00 222.77 ? 313  GLU A CG  1 
ATOM   2434  C  CD  . GLU A  1  313  ? 13.932  -60.352  -72.045  1.00 234.98 ? 313  GLU A CD  1 
ATOM   2435  O  OE1 . GLU A  1  313  ? 14.872  -60.078  -72.820  1.00 222.67 ? 313  GLU A OE1 1 
ATOM   2436  O  OE2 . GLU A  1  313  ? 13.347  -61.457  -72.048  1.00 258.41 ? 313  GLU A OE2 1 
ATOM   2437  N  N   . ILE A  1  314  ? 11.396  -56.851  -73.447  1.00 268.76 ? 314  ILE A N   1 
ATOM   2438  C  CA  . ILE A  1  314  ? 9.954   -56.635  -73.430  1.00 278.82 ? 314  ILE A CA  1 
ATOM   2439  C  C   . ILE A  1  314  ? 9.202   -57.949  -73.237  1.00 308.68 ? 314  ILE A C   1 
ATOM   2440  O  O   . ILE A  1  314  ? 8.036   -58.069  -73.613  1.00 323.47 ? 314  ILE A O   1 
ATOM   2441  C  CB  . ILE A  1  314  ? 9.467   -55.963  -74.728  1.00 272.66 ? 314  ILE A CB  1 
ATOM   2442  C  CG1 . ILE A  1  314  ? 9.839   -54.479  -74.730  1.00 245.97 ? 314  ILE A CG1 1 
ATOM   2443  C  CG2 . ILE A  1  314  ? 7.966   -56.143  -74.891  1.00 291.59 ? 314  ILE A CG2 1 
ATOM   2444  C  CD1 . ILE A  1  314  ? 10.094  -53.916  -76.111  1.00 235.36 ? 314  ILE A CD1 1 
ATOM   2445  N  N   . ALA A  1  315  ? 9.878   -58.930  -72.647  1.00 458.07 ? 315  ALA A N   1 
ATOM   2446  C  CA  . ALA A  1  315  ? 9.275   -60.235  -72.404  1.00 488.48 ? 315  ALA A CA  1 
ATOM   2447  C  C   . ALA A  1  315  ? 8.899   -60.923  -73.712  1.00 505.58 ? 315  ALA A C   1 
ATOM   2448  O  O   . ALA A  1  315  ? 7.731   -61.231  -73.949  1.00 526.37 ? 315  ALA A O   1 
ATOM   2449  C  CB  . ALA A  1  315  ? 8.056   -60.097  -71.504  1.00 499.60 ? 315  ALA A CB  1 
ATOM   2450  N  N   . GLY A  1  316  ? 9.896   -61.160  -74.558  1.00 192.79 ? 316  GLY A N   1 
ATOM   2451  C  CA  . GLY A  1  316  ? 9.673   -61.809  -75.836  1.00 207.59 ? 316  GLY A CA  1 
ATOM   2452  C  C   . GLY A  1  316  ? 10.809  -62.735  -76.224  1.00 215.87 ? 316  GLY A C   1 
ATOM   2453  O  O   . GLY A  1  316  ? 10.637  -63.630  -77.050  1.00 237.63 ? 316  GLY A O   1 
ATOM   2454  N  N   . GLN A  1  317  ? 11.975  -62.516  -75.625  1.00 307.30 ? 317  GLN A N   1 
ATOM   2455  C  CA  . GLN A  1  317  ? 13.148  -63.333  -75.912  1.00 316.46 ? 317  GLN A CA  1 
ATOM   2456  C  C   . GLN A  1  317  ? 13.929  -62.779  -77.100  1.00 285.79 ? 317  GLN A C   1 
ATOM   2457  O  O   . GLN A  1  317  ? 14.210  -63.497  -78.059  1.00 299.68 ? 317  GLN A O   1 
ATOM   2458  C  CB  . GLN A  1  317  ? 12.739  -64.782  -76.182  1.00 266.83 ? 317  GLN A CB  1 
ATOM   2459  C  CG  . GLN A  1  317  ? 12.571  -65.624  -74.927  1.00 301.93 ? 317  GLN A CG  1 
ATOM   2460  C  CD  . GLN A  1  317  ? 12.133  -67.043  -75.231  1.00 347.75 ? 317  GLN A CD  1 
ATOM   2461  O  OE1 . GLN A  1  317  ? 12.279  -67.522  -76.355  1.00 355.91 ? 317  GLN A OE1 1 
ATOM   2462  N  NE2 . GLN A  1  317  ? 11.594  -67.724  -74.227  1.00 375.40 ? 317  GLN A NE2 1 
ATOM   2463  N  N   . PRO A  1  318  ? 14.275  -61.498  -77.027  1.00 352.61 ? 318  PRO A N   1 
ATOM   2464  C  CA  . PRO A  1  318  ? 15.026  -60.842  -78.102  1.00 322.44 ? 318  PRO A CA  1 
ATOM   2465  C  C   . PRO A  1  318  ? 16.533  -60.971  -77.902  1.00 310.32 ? 318  PRO A C   1 
ATOM   2466  O  O   . PRO A  1  318  ? 17.249  -61.334  -78.836  1.00 306.34 ? 318  PRO A O   1 
ATOM   2467  C  CB  . PRO A  1  318  ? 14.602  -59.378  -77.974  1.00 195.31 ? 318  PRO A CB  1 
ATOM   2468  C  CG  . PRO A  1  318  ? 14.256  -59.217  -76.537  1.00 210.91 ? 318  PRO A CG  1 
ATOM   2469  C  CD  . PRO A  1  318  ? 13.655  -60.527  -76.110  1.00 244.48 ? 318  PRO A CD  1 
ATOM   2470  N  N   . GLN A  1  319  ? 17.002  -60.675  -76.695  1.00 298.05 ? 319  GLN A N   1 
ATOM   2471  C  CA  . GLN A  1  319  ? 18.424  -60.760  -76.384  1.00 289.08 ? 319  GLN A CA  1 
ATOM   2472  C  C   . GLN A  1  319  ? 19.038  -59.373  -76.235  1.00 249.82 ? 319  GLN A C   1 
ATOM   2473  O  O   . GLN A  1  319  ? 19.533  -59.013  -75.167  1.00 236.03 ? 319  GLN A O   1 
ATOM   2474  C  CB  . GLN A  1  319  ? 19.163  -61.550  -77.465  1.00 223.93 ? 319  GLN A CB  1 
ATOM   2475  C  CG  . GLN A  1  319  ? 18.548  -62.905  -77.773  1.00 264.83 ? 319  GLN A CG  1 
ATOM   2476  C  CD  . GLN A  1  319  ? 19.099  -63.519  -79.045  1.00 286.30 ? 319  GLN A CD  1 
ATOM   2477  O  OE1 . GLN A  1  319  ? 20.035  -62.994  -79.647  1.00 270.29 ? 319  GLN A OE1 1 
ATOM   2478  N  NE2 . GLN A  1  319  ? 18.517  -64.638  -79.463  1.00 325.46 ? 319  GLN A NE2 1 
ATOM   2479  N  N   . ALA A  1  320  ? 19.004  -58.597  -77.315  1.00 264.19 ? 320  ALA A N   1 
ATOM   2480  C  CA  . ALA A  1  320  ? 19.558  -57.248  -77.307  1.00 231.17 ? 320  ALA A CA  1 
ATOM   2481  C  C   . ALA A  1  320  ? 21.009  -57.251  -76.839  1.00 227.38 ? 320  ALA A C   1 
ATOM   2482  O  O   . ALA A  1  320  ? 21.415  -56.405  -76.043  1.00 206.76 ? 320  ALA A O   1 
ATOM   2483  C  CB  . ALA A  1  320  ? 18.716  -56.336  -76.428  1.00 127.49 ? 320  ALA A CB  1 
ATOM   2484  N  N   . LEU A  1  321  ? 21.785  -58.206  -77.339  1.00 329.31 ? 321  LEU A N   1 
ATOM   2485  C  CA  . LEU A  1  321  ? 23.191  -58.321  -76.973  1.00 330.63 ? 321  LEU A CA  1 
ATOM   2486  C  C   . LEU A  1  321  ? 24.059  -57.387  -77.811  1.00 310.19 ? 321  LEU A C   1 
ATOM   2487  O  O   . LEU A  1  321  ? 24.035  -57.440  -79.041  1.00 307.38 ? 321  LEU A O   1 
ATOM   2488  C  CB  . LEU A  1  321  ? 23.669  -59.766  -77.132  1.00 280.74 ? 321  LEU A CB  1 
ATOM   2489  C  CG  . LEU A  1  321  ? 22.676  -60.857  -76.731  1.00 311.55 ? 321  LEU A CG  1 
ATOM   2490  C  CD1 . LEU A  1  321  ? 22.979  -62.156  -77.462  1.00 350.57 ? 321  LEU A CD1 1 
ATOM   2491  C  CD2 . LEU A  1  321  ? 22.689  -61.069  -75.225  1.00 312.48 ? 321  LEU A CD2 1 
ATOM   2492  N  N   . GLN A  1  322  ? 24.821  -56.533  -77.138  1.00 511.31 ? 322  GLN A N   1 
ATOM   2493  C  CA  . GLN A  1  322  ? 25.698  -55.587  -77.818  1.00 496.56 ? 322  GLN A CA  1 
ATOM   2494  C  C   . GLN A  1  322  ? 27.159  -56.005  -77.696  1.00 507.39 ? 322  GLN A C   1 
ATOM   2495  O  O   . GLN A  1  322  ? 27.916  -55.943  -78.664  1.00 505.44 ? 322  GLN A O   1 
ATOM   2496  C  CB  . GLN A  1  322  ? 25.506  -54.178  -77.255  1.00 383.66 ? 322  GLN A CB  1 
ATOM   2497  C  CG  . GLN A  1  322  ? 25.392  -53.096  -78.317  1.00 365.54 ? 322  GLN A CG  1 
ATOM   2498  C  CD  . GLN A  1  322  ? 24.140  -52.255  -78.159  1.00 346.40 ? 322  GLN A CD  1 
ATOM   2499  O  OE1 . GLN A  1  322  ? 23.267  -52.567  -77.348  1.00 346.80 ? 322  GLN A OE1 1 
ATOM   2500  N  NE2 . GLN A  1  322  ? 24.045  -51.183  -78.937  1.00 332.15 ? 322  GLN A NE2 1 
ATOM   2501  N  N   . LYS A  1  323  ? 27.549  -56.433  -76.499  1.00 341.90 ? 323  LYS A N   1 
ATOM   2502  C  CA  . LYS A  1  323  ? 28.919  -56.864  -76.248  1.00 357.01 ? 323  LYS A CA  1 
ATOM   2503  C  C   . LYS A  1  323  ? 28.958  -58.022  -75.257  1.00 374.78 ? 323  LYS A C   1 
ATOM   2504  O  O   . LYS A  1  323  ? 28.681  -57.846  -74.071  1.00 369.26 ? 323  LYS A O   1 
ATOM   2505  C  CB  . LYS A  1  323  ? 29.761  -55.698  -75.727  1.00 250.22 ? 323  LYS A CB  1 
ATOM   2506  C  CG  . LYS A  1  323  ? 29.235  -54.328  -76.122  1.00 226.22 ? 323  LYS A CG  1 
ATOM   2507  C  CD  . LYS A  1  323  ? 30.321  -53.269  -76.022  1.00 214.45 ? 323  LYS A CD  1 
ATOM   2508  C  CE  . LYS A  1  323  ? 29.839  -51.931  -76.557  1.00 199.37 ? 323  LYS A CE  1 
ATOM   2509  N  NZ  . LYS A  1  323  ? 30.861  -50.862  -76.384  1.00 191.62 ? 323  LYS A NZ  1 
ATOM   2510  N  N   . SER A  1  324  ? 29.302  -59.207  -75.751  1.00 174.94 ? 324  SER A N   1 
ATOM   2511  C  CA  . SER A  1  324  ? 29.374  -60.395  -74.911  1.00 193.36 ? 324  SER A CA  1 
ATOM   2512  C  C   . SER A  1  324  ? 27.986  -60.851  -74.477  1.00 198.50 ? 324  SER A C   1 
ATOM   2513  O  O   . SER A  1  324  ? 27.790  -61.295  -73.348  1.00 205.84 ? 324  SER A O   1 
ATOM   2514  C  CB  . SER A  1  324  ? 30.247  -60.131  -73.683  1.00 191.54 ? 324  SER A CB  1 
ATOM   2515  O  OG  . SER A  1  324  ? 30.620  -61.341  -73.053  1.00 211.89 ? 324  SER A OG  1 
ATOM   2516  N  N   . GLY A  1  325  ? 27.021  -60.737  -75.384  1.00 219.85 ? 325  GLY A N   1 
ATOM   2517  C  CA  . GLY A  1  325  ? 25.654  -61.133  -75.102  1.00 229.73 ? 325  GLY A CA  1 
ATOM   2518  C  C   . GLY A  1  325  ? 25.141  -60.548  -73.799  1.00 209.03 ? 325  GLY A C   1 
ATOM   2519  O  O   . GLY A  1  325  ? 24.820  -61.279  -72.863  1.00 224.95 ? 325  GLY A O   1 
ATOM   2520  N  N   . ARG A  1  326  ? 25.060  -59.223  -73.745  1.00 309.15 ? 326  ARG A N   1 
ATOM   2521  C  CA  . ARG A  1  326  ? 24.578  -58.534  -72.554  1.00 287.99 ? 326  ARG A CA  1 
ATOM   2522  C  C   . ARG A  1  326  ? 23.604  -57.420  -72.914  1.00 261.44 ? 326  ARG A C   1 
ATOM   2523  O  O   . ARG A  1  326  ? 23.917  -56.550  -73.727  1.00 246.54 ? 326  ARG A O   1 
ATOM   2524  C  CB  . ARG A  1  326  ? 25.754  -57.968  -71.753  1.00 194.77 ? 326  ARG A CB  1 
ATOM   2525  C  CG  . ARG A  1  326  ? 27.005  -58.830  -71.794  1.00 215.12 ? 326  ARG A CG  1 
ATOM   2526  C  CD  . ARG A  1  326  ? 27.458  -59.213  -70.394  1.00 213.94 ? 326  ARG A CD  1 
ATOM   2527  N  NE  . ARG A  1  326  ? 28.045  -60.550  -70.355  1.00 242.41 ? 326  ARG A NE  1 
ATOM   2528  C  CZ  . ARG A  1  326  ? 29.316  -60.800  -70.065  1.00 244.72 ? 326  ARG A CZ  1 
ATOM   2529  N  NH1 . ARG A  1  326  ? 30.144  -59.801  -69.784  1.00 221.19 ? 326  ARG A NH1 1 
ATOM   2530  N  NH2 . ARG A  1  326  ? 29.765  -62.047  -70.054  1.00 273.70 ? 326  ARG A NH2 1 
ATOM   2531  N  N   . PRO A  1  327  ? 22.421  -57.450  -72.304  1.00 219.50 ? 327  PRO A N   1 
ATOM   2532  C  CA  . PRO A  1  327  ? 21.397  -56.435  -72.561  1.00 198.43 ? 327  PRO A CA  1 
ATOM   2533  C  C   . PRO A  1  327  ? 22.004  -55.120  -73.028  1.00 168.94 ? 327  PRO A C   1 
ATOM   2534  O  O   . PRO A  1  327  ? 23.084  -54.741  -72.571  1.00 163.43 ? 327  PRO A O   1 
ATOM   2535  C  CB  . PRO A  1  327  ? 20.742  -56.255  -71.192  1.00 125.13 ? 327  PRO A CB  1 
ATOM   2536  C  CG  . PRO A  1  327  ? 20.934  -57.565  -70.513  1.00 150.31 ? 327  PRO A CG  1 
ATOM   2537  C  CD  . PRO A  1  327  ? 22.266  -58.075  -70.978  1.00 158.43 ? 327  PRO A CD  1 
ATOM   2538  N  N   . LEU A  1  328  ? 21.312  -54.431  -73.929  1.00 362.05 ? 328  LEU A N   1 
ATOM   2539  C  CA  . LEU A  1  328  ? 21.792  -53.157  -74.453  1.00 335.69 ? 328  LEU A CA  1 
ATOM   2540  C  C   . LEU A  1  328  ? 21.196  -51.984  -73.682  1.00 316.73 ? 328  LEU A C   1 
ATOM   2541  O  O   . LEU A  1  328  ? 20.079  -51.548  -73.960  1.00 313.89 ? 328  LEU A O   1 
ATOM   2542  C  CB  . LEU A  1  328  ? 21.460  -53.031  -75.942  1.00 272.66 ? 328  LEU A CB  1 
ATOM   2543  C  CG  . LEU A  1  328  ? 21.444  -51.613  -76.514  1.00 253.94 ? 328  LEU A CG  1 
ATOM   2544  C  CD1 . LEU A  1  328  ? 20.110  -50.936  -76.244  1.00 245.32 ? 328  LEU A CD1 1 
ATOM   2545  C  CD2 . LEU A  1  328  ? 22.592  -50.791  -75.946  1.00 244.66 ? 328  LEU A CD2 1 
ATOM   2546  N  N   . LYS A  1  329  ? 21.950  -51.478  -72.713  1.00 270.55 ? 329  LYS A N   1 
ATOM   2547  C  CA  . LYS A  1  329  ? 21.496  -50.354  -71.897  1.00 253.61 ? 329  LYS A CA  1 
ATOM   2548  C  C   . LYS A  1  329  ? 20.435  -49.540  -72.627  1.00 241.67 ? 329  LYS A C   1 
ATOM   2549  O  O   . LYS A  1  329  ? 20.755  -48.691  -73.460  1.00 230.20 ? 329  LYS A O   1 
ATOM   2550  C  CB  . LYS A  1  329  ? 22.679  -49.461  -71.517  1.00 180.30 ? 329  LYS A CB  1 
ATOM   2551  C  CG  . LYS A  1  329  ? 22.929  -49.368  -70.021  1.00 183.23 ? 329  LYS A CG  1 
ATOM   2552  C  CD  . LYS A  1  329  ? 24.412  -49.235  -69.716  1.00 179.67 ? 329  LYS A CD  1 
ATOM   2553  C  CE  . LYS A  1  329  ? 24.860  -50.249  -68.676  1.00 193.36 ? 329  LYS A CE  1 
ATOM   2554  N  NZ  . LYS A  1  329  ? 25.987  -49.737  -67.848  1.00 187.89 ? 329  LYS A NZ  1 
ATOM   2555  N  N   . SER A  1  330  ? 19.171  -49.798  -72.304  1.00 204.50 ? 330  SER A N   1 
ATOM   2556  C  CA  . SER A  1  330  ? 18.060  -49.091  -72.928  1.00 175.90 ? 330  SER A CA  1 
ATOM   2557  C  C   . SER A  1  330  ? 17.748  -47.796  -72.186  1.00 128.76 ? 330  SER A C   1 
ATOM   2558  O  O   . SER A  1  330  ? 18.426  -47.443  -71.220  1.00 118.70 ? 330  SER A O   1 
ATOM   2559  C  CB  . SER A  1  330  ? 16.815  -49.980  -72.979  1.00 211.34 ? 330  SER A CB  1 
ATOM   2560  O  OG  . SER A  1  330  ? 15.906  -49.645  -71.949  1.00 213.45 ? 330  SER A OG  1 
ATOM   2561  N  N   . ILE A  1  331  ? 16.718  -47.092  -72.641  1.00 114.92 ? 331  ILE A N   1 
ATOM   2562  C  CA  . ILE A  1  331  ? 16.311  -45.836  -72.021  1.00 107.15 ? 331  ILE A CA  1 
ATOM   2563  C  C   . ILE A  1  331  ? 15.441  -46.083  -70.793  1.00 115.89 ? 331  ILE A C   1 
ATOM   2564  O  O   . ILE A  1  331  ? 15.476  -45.316  -69.832  1.00 117.02 ? 331  ILE A O   1 
ATOM   2565  C  CB  . ILE A  1  331  ? 15.544  -44.941  -73.013  1.00 119.29 ? 331  ILE A CB  1 
ATOM   2566  C  CG1 . ILE A  1  331  ? 14.343  -45.692  -73.591  1.00 111.07 ? 331  ILE A CG1 1 
ATOM   2567  C  CG2 . ILE A  1  331  ? 16.465  -44.463  -74.124  1.00 101.58 ? 331  ILE A CG2 1 
ATOM   2568  C  CD1 . ILE A  1  331  ? 13.032  -45.368  -72.909  1.00 114.89 ? 331  ILE A CD1 1 
ATOM   2569  N  N   . ARG A  1  332  ? 14.660  -47.158  -70.832  1.00 87.00  ? 332  ARG A N   1 
ATOM   2570  C  CA  . ARG A  1  332  ? 13.782  -47.508  -69.725  1.00 128.05 ? 332  ARG A CA  1 
ATOM   2571  C  C   . ARG A  1  332  ? 14.576  -48.025  -68.532  1.00 121.93 ? 332  ARG A C   1 
ATOM   2572  O  O   . ARG A  1  332  ? 14.079  -48.047  -67.403  1.00 146.28 ? 332  ARG A O   1 
ATOM   2573  C  CB  . ARG A  1  332  ? 12.753  -48.552  -70.165  1.00 98.70  ? 332  ARG A CB  1 
ATOM   2574  C  CG  . ARG A  1  332  ? 11.736  -48.914  -69.093  1.00 139.20 ? 332  ARG A CG  1 
ATOM   2575  C  CD  . ARG A  1  332  ? 10.497  -49.555  -69.699  1.00 191.58 ? 332  ARG A CD  1 
ATOM   2576  N  NE  . ARG A  1  332  ? 10.550  -51.013  -69.636  1.00 122.09 ? 332  ARG A NE  1 
ATOM   2577  C  CZ  . ARG A  1  332  ? 10.762  -51.703  -68.522  1.00 145.83 ? 332  ARG A CZ  1 
ATOM   2578  N  NH1 . ARG A  1  332  ? 10.943  -51.069  -67.370  1.00 139.36 ? 332  ARG A NH1 1 
ATOM   2579  N  NH2 . ARG A  1  332  ? 10.792  -53.028  -68.555  1.00 164.98 ? 332  ARG A NH2 1 
ATOM   2580  N  N   . ALA A  1  333  ? 15.812  -48.443  -68.788  1.00 175.90 ? 333  ALA A N   1 
ATOM   2581  C  CA  . ALA A  1  333  ? 16.676  -48.963  -67.736  1.00 186.73 ? 333  ALA A CA  1 
ATOM   2582  C  C   . ALA A  1  333  ? 17.136  -47.845  -66.801  1.00 184.94 ? 333  ALA A C   1 
ATOM   2583  O  O   . ALA A  1  333  ? 17.111  -47.999  -65.579  1.00 192.35 ? 333  ALA A O   1 
ATOM   2584  C  CB  . ALA A  1  333  ? 17.876  -49.681  -68.341  1.00 177.09 ? 333  ALA A CB  1 
ATOM   2585  N  N   . ARG A  1  334  ? 17.560  -46.729  -67.382  1.00 143.46 ? 334  ARG A N   1 
ATOM   2586  C  CA  . ARG A  1  334  ? 18.025  -45.588  -66.603  1.00 132.24 ? 334  ARG A CA  1 
ATOM   2587  C  C   . ARG A  1  334  ? 16.907  -45.015  -65.741  1.00 126.86 ? 334  ARG A C   1 
ATOM   2588  O  O   . ARG A  1  334  ? 17.081  -44.799  -64.542  1.00 127.34 ? 334  ARG A O   1 
ATOM   2589  C  CB  . ARG A  1  334  ? 18.588  -44.507  -67.526  1.00 155.44 ? 334  ARG A CB  1 
ATOM   2590  C  CG  . ARG A  1  334  ? 19.690  -44.990  -68.453  1.00 140.39 ? 334  ARG A CG  1 
ATOM   2591  C  CD  . ARG A  1  334  ? 19.937  -44.001  -69.581  1.00 136.49 ? 334  ARG A CD  1 
ATOM   2592  N  NE  . ARG A  1  334  ? 21.299  -44.092  -70.099  1.00 142.69 ? 334  ARG A NE  1 
ATOM   2593  C  CZ  . ARG A  1  334  ? 21.849  -43.196  -70.912  1.00 130.40 ? 334  ARG A CZ  1 
ATOM   2594  N  NH1 . ARG A  1  334  ? 21.153  -42.138  -71.306  1.00 106.51 ? 334  ARG A NH1 1 
ATOM   2595  N  NH2 . ARG A  1  334  ? 23.096  -43.360  -71.336  1.00 142.25 ? 334  ARG A NH2 1 
ATOM   2596  N  N   . LEU A  1  335  ? 15.755  -44.771  -66.360  1.00 139.24 ? 335  LEU A N   1 
ATOM   2597  C  CA  . LEU A  1  335  ? 14.606  -44.224  -65.651  1.00 132.42 ? 335  LEU A CA  1 
ATOM   2598  C  C   . LEU A  1  335  ? 14.382  -44.943  -64.325  1.00 106.55 ? 335  LEU A C   1 
ATOM   2599  O  O   . LEU A  1  335  ? 14.806  -44.470  -63.270  1.00 124.17 ? 335  LEU A O   1 
ATOM   2600  C  CB  . LEU A  1  335  ? 13.347  -44.316  -66.516  1.00 129.41 ? 335  LEU A CB  1 
ATOM   2601  C  CG  . LEU A  1  335  ? 13.562  -44.234  -68.029  1.00 132.65 ? 335  LEU A CG  1 
ATOM   2602  C  CD1 . LEU A  1  335  ? 12.441  -43.440  -68.689  1.00 145.30 ? 335  LEU A CD1 1 
ATOM   2603  C  CD2 . LEU A  1  335  ? 14.915  -43.626  -68.352  1.00 108.94 ? 335  LEU A CD2 1 
ATOM   2604  N  N   . LYS A  1  336  ? 13.713  -46.090  -64.383  1.00 138.55 ? 336  LYS A N   1 
ATOM   2605  C  CA  . LYS A  1  336  ? 13.432  -46.879  -63.189  1.00 170.51 ? 336  LYS A CA  1 
ATOM   2606  C  C   . LYS A  1  336  ? 14.469  -47.978  -63.002  1.00 254.58 ? 336  LYS A C   1 
ATOM   2607  O  O   . LYS A  1  336  ? 14.222  -49.140  -63.329  1.00 304.20 ? 336  LYS A O   1 
ATOM   2608  C  CB  . LYS A  1  336  ? 12.028  -47.480  -63.263  1.00 133.73 ? 336  LYS A CB  1 
ATOM   2609  C  CG  . LYS A  1  336  ? 11.969  -48.958  -62.907  1.00 154.87 ? 336  LYS A CG  1 
ATOM   2610  C  CD  . LYS A  1  336  ? 10.790  -49.642  -63.582  1.00 200.37 ? 336  LYS A CD  1 
ATOM   2611  C  CE  . LYS A  1  336  ? 10.601  -51.057  -63.061  1.00 219.26 ? 336  LYS A CE  1 
ATOM   2612  N  NZ  . LYS A  1  336  ? 9.302   -51.640  -63.496  1.00 218.74 ? 336  LYS A NZ  1 
ATOM   2613  N  N   . GLY A  1  337  ? 15.630  -47.607  -62.472  1.00 155.98 ? 337  GLY A N   1 
ATOM   2614  C  CA  . GLY A  1  337  ? 16.702  -48.556  -62.240  1.00 160.27 ? 337  GLY A CA  1 
ATOM   2615  C  C   . GLY A  1  337  ? 16.240  -49.775  -61.462  1.00 174.62 ? 337  GLY A C   1 
ATOM   2616  O  O   . GLY A  1  337  ? 15.677  -50.710  -62.031  1.00 187.44 ? 337  GLY A O   1 
ATOM   2617  N  N   . LYS A  1  338  ? 16.475  -49.759  -60.156  1.00 346.62 ? 338  LYS A N   1 
ATOM   2618  C  CA  . LYS A  1  338  ? 17.145  -48.637  -59.510  1.00 324.71 ? 338  LYS A CA  1 
ATOM   2619  C  C   . LYS A  1  338  ? 18.553  -48.445  -60.057  1.00 315.41 ? 338  LYS A C   1 
ATOM   2620  O  O   . LYS A  1  338  ? 18.801  -48.636  -61.247  1.00 330.04 ? 338  LYS A O   1 
ATOM   2621  C  CB  . LYS A  1  338  ? 17.191  -48.839  -57.994  1.00 307.25 ? 338  LYS A CB  1 
ATOM   2622  C  CG  . LYS A  1  338  ? 17.807  -47.677  -57.231  1.00 263.55 ? 338  LYS A CG  1 
ATOM   2623  C  CD  . LYS A  1  338  ? 18.947  -48.142  -56.339  1.00 238.18 ? 338  LYS A CD  1 
ATOM   2624  C  CE  . LYS A  1  338  ? 19.794  -46.972  -55.868  1.00 215.91 ? 338  LYS A CE  1 
ATOM   2625  N  NZ  . LYS A  1  338  ? 19.928  -46.945  -54.384  1.00 200.36 ? 338  LYS A NZ  1 
ATOM   2626  N  N   . GLU A  1  339  ? 19.479  -48.067  -59.179  1.00 282.70 ? 339  GLU A N   1 
ATOM   2627  C  CA  . GLU A  1  339  ? 20.867  -47.846  -59.569  1.00 246.59 ? 339  GLU A CA  1 
ATOM   2628  C  C   . GLU A  1  339  ? 20.975  -46.735  -60.611  1.00 200.92 ? 339  GLU A C   1 
ATOM   2629  O  O   . GLU A  1  339  ? 21.897  -46.725  -61.424  1.00 204.88 ? 339  GLU A O   1 
ATOM   2630  C  CB  . GLU A  1  339  ? 21.477  -49.141  -60.115  1.00 287.66 ? 339  GLU A CB  1 
ATOM   2631  C  CG  . GLU A  1  339  ? 21.639  -50.234  -59.072  1.00 312.27 ? 339  GLU A CG  1 
ATOM   2632  C  CD  . GLU A  1  339  ? 22.181  -51.522  -59.662  1.00 330.09 ? 339  GLU A CD  1 
ATOM   2633  O  OE1 . GLU A  1  339  ? 22.252  -51.628  -60.904  1.00 326.12 ? 339  GLU A OE1 1 
ATOM   2634  O  OE2 . GLU A  1  339  ? 22.535  -52.431  -58.880  1.00 341.88 ? 339  GLU A OE2 1 
ATOM   2635  N  N   . GLY A  1  340  ? 20.028  -45.807  -60.579  1.00 218.71 ? 340  GLY A N   1 
ATOM   2636  C  CA  . GLY A  1  340  ? 20.015  -44.696  -61.513  1.00 216.70 ? 340  GLY A CA  1 
ATOM   2637  C  C   . GLY A  1  340  ? 19.200  -43.525  -61.011  1.00 206.10 ? 340  GLY A C   1 
ATOM   2638  O  O   . GLY A  1  340  ? 19.171  -43.243  -59.812  1.00 205.90 ? 340  GLY A O   1 
ATOM   2639  N  N   . ARG A  1  341  ? 18.540  -42.832  -61.930  1.00 192.64 ? 341  ARG A N   1 
ATOM   2640  C  CA  . ARG A  1  341  ? 17.720  -41.678  -61.580  1.00 170.56 ? 341  ARG A CA  1 
ATOM   2641  C  C   . ARG A  1  341  ? 16.634  -42.054  -60.573  1.00 162.33 ? 341  ARG A C   1 
ATOM   2642  O  O   . ARG A  1  341  ? 16.919  -42.676  -59.550  1.00 189.29 ? 341  ARG A O   1 
ATOM   2643  C  CB  . ARG A  1  341  ? 17.083  -41.070  -62.834  1.00 150.34 ? 341  ARG A CB  1 
ATOM   2644  C  CG  . ARG A  1  341  ? 17.755  -41.484  -64.132  1.00 156.56 ? 341  ARG A CG  1 
ATOM   2645  C  CD  . ARG A  1  341  ? 17.635  -40.393  -65.187  1.00 135.43 ? 341  ARG A CD  1 
ATOM   2646  N  NE  . ARG A  1  341  ? 18.890  -40.185  -65.903  1.00 148.69 ? 341  ARG A NE  1 
ATOM   2647  C  CZ  . ARG A  1  341  ? 19.012  -39.434  -66.991  1.00 156.51 ? 341  ARG A CZ  1 
ATOM   2648  N  NH1 . ARG A  1  341  ? 17.952  -38.815  -67.496  1.00 153.03 ? 341  ARG A NH1 1 
ATOM   2649  N  NH2 . ARG A  1  341  ? 20.194  -39.300  -67.579  1.00 169.35 ? 341  ARG A NH2 1 
ATOM   2650  N  N   . LEU A  1  342  ? 15.397  -41.673  -60.873  1.00 150.73 ? 342  LEU A N   1 
ATOM   2651  C  CA  . LEU A  1  342  ? 14.272  -41.967  -59.995  1.00 180.86 ? 342  LEU A CA  1 
ATOM   2652  C  C   . LEU A  1  342  ? 14.663  -41.820  -58.527  1.00 176.77 ? 342  LEU A C   1 
ATOM   2653  O  O   . LEU A  1  342  ? 14.454  -40.768  -57.922  1.00 154.60 ? 342  LEU A O   1 
ATOM   2654  C  CB  . LEU A  1  342  ? 13.745  -43.379  -60.259  1.00 207.80 ? 342  LEU A CB  1 
ATOM   2655  C  CG  . LEU A  1  342  ? 12.383  -43.717  -59.646  1.00 227.14 ? 342  LEU A CG  1 
ATOM   2656  C  CD1 . LEU A  1  342  ? 12.443  -43.647  -58.128  1.00 190.79 ? 342  LEU A CD1 1 
ATOM   2657  C  CD2 . LEU A  1  342  ? 11.305  -42.792  -60.188  1.00 250.45 ? 342  LEU A CD2 1 
ATOM   2658  N  N   . ARG A  1  343  ? 15.231  -42.880  -57.960  1.00 216.00 ? 343  ARG A N   1 
ATOM   2659  C  CA  . ARG A  1  343  ? 15.650  -42.870  -56.565  1.00 241.75 ? 343  ARG A CA  1 
ATOM   2660  C  C   . ARG A  1  343  ? 17.169  -42.807  -56.447  1.00 232.02 ? 343  ARG A C   1 
ATOM   2661  O  O   . ARG A  1  343  ? 17.794  -43.700  -55.876  1.00 263.62 ? 343  ARG A O   1 
ATOM   2662  C  CB  . ARG A  1  343  ? 15.118  -44.105  -55.837  1.00 293.00 ? 343  ARG A CB  1 
ATOM   2663  C  CG  . ARG A  1  343  ? 14.063  -43.800  -54.786  1.00 342.22 ? 343  ARG A CG  1 
ATOM   2664  C  CD  . ARG A  1  343  ? 13.881  -44.967  -53.830  1.00 367.00 ? 343  ARG A CD  1 
ATOM   2665  N  NE  . ARG A  1  343  ? 12.544  -45.549  -53.923  1.00 359.50 ? 343  ARG A NE  1 
ATOM   2666  C  CZ  . ARG A  1  343  ? 12.255  -46.810  -53.618  1.00 351.57 ? 343  ARG A CZ  1 
ATOM   2667  N  NH1 . ARG A  1  343  ? 13.210  -47.629  -53.198  1.00 351.18 ? 343  ARG A NH1 1 
ATOM   2668  N  NH2 . ARG A  1  343  ? 11.011  -47.253  -53.733  1.00 339.92 ? 343  ARG A NH2 1 
ATOM   2669  N  N   . GLY A  1  344  ? 17.758  -41.745  -56.988  1.00 112.70 ? 344  GLY A N   1 
ATOM   2670  C  CA  . GLY A  1  344  ? 19.198  -41.566  -56.944  1.00 108.96 ? 344  GLY A CA  1 
ATOM   2671  C  C   . GLY A  1  344  ? 19.645  -40.295  -57.639  1.00 128.71 ? 344  GLY A C   1 
ATOM   2672  O  O   . GLY A  1  344  ? 20.735  -39.785  -57.380  1.00 147.97 ? 344  GLY A O   1 
ATOM   2673  N  N   . ASN A  1  345  ? 18.802  -39.787  -58.530  1.00 156.02 ? 345  ASN A N   1 
ATOM   2674  C  CA  . ASN A  1  345  ? 19.114  -38.567  -59.269  1.00 136.65 ? 345  ASN A CA  1 
ATOM   2675  C  C   . ASN A  1  345  ? 17.975  -37.557  -59.223  1.00 129.70 ? 345  ASN A C   1 
ATOM   2676  O  O   . ASN A  1  345  ? 18.080  -36.460  -59.768  1.00 160.25 ? 345  ASN A O   1 
ATOM   2677  C  CB  . ASN A  1  345  ? 19.464  -38.897  -60.722  1.00 132.94 ? 345  ASN A CB  1 
ATOM   2678  C  CG  . ASN A  1  345  ? 20.853  -39.484  -60.869  1.00 131.19 ? 345  ASN A CG  1 
ATOM   2679  O  OD1 . ASN A  1  345  ? 21.520  -39.786  -59.878  1.00 145.11 ? 345  ASN A OD1 1 
ATOM   2680  N  ND2 . ASN A  1  345  ? 21.299  -39.645  -62.109  1.00 111.41 ? 345  ASN A ND2 1 
ATOM   2681  N  N   . LEU A  1  346  ? 16.882  -37.933  -58.561  1.00 97.44  ? 346  LEU A N   1 
ATOM   2682  C  CA  . LEU A  1  346  ? 15.721  -37.058  -58.439  1.00 98.18  ? 346  LEU A CA  1 
ATOM   2683  C  C   . LEU A  1  346  ? 15.219  -37.008  -57.001  1.00 130.61 ? 346  LEU A C   1 
ATOM   2684  O  O   . LEU A  1  346  ? 14.762  -35.970  -56.529  1.00 131.82 ? 346  LEU A O   1 
ATOM   2685  C  CB  . LEU A  1  346  ? 14.601  -37.522  -59.373  1.00 99.57  ? 346  LEU A CB  1 
ATOM   2686  C  CG  . LEU A  1  346  ? 14.826  -37.288  -60.867  1.00 104.57 ? 346  LEU A CG  1 
ATOM   2687  C  CD1 . LEU A  1  346  ? 13.544  -37.543  -61.650  1.00 114.26 ? 346  LEU A CD1 1 
ATOM   2688  C  CD2 . LEU A  1  346  ? 15.341  -35.879  -61.120  1.00 124.53 ? 346  LEU A CD2 1 
ATOM   2689  N  N   . MET A  1  347  ? 15.320  -37.965  -56.237  1.00 133.12 ? 347  MET A N   1 
ATOM   2690  C  CA  . MET A  1  347  ? 14.877  -38.046  -54.850  1.00 122.42 ? 347  MET A CA  1 
ATOM   2691  C  C   . MET A  1  347  ? 16.024  -37.757  -53.888  1.00 123.69 ? 347  MET A C   1 
ATOM   2692  O  O   . MET A  1  347  ? 16.014  -36.747  -53.181  1.00 116.86 ? 347  MET A O   1 
ATOM   2693  C  CB  . MET A  1  347  ? 14.281  -39.424  -54.557  1.00 116.02 ? 347  MET A CB  1 
ATOM   2694  C  CG  . MET A  1  347  ? 13.129  -39.810  -55.472  1.00 121.51 ? 347  MET A CG  1 
ATOM   2695  S  SD  . MET A  1  347  ? 11.931  -38.479  -55.680  1.00 238.24 ? 347  MET A SD  1 
ATOM   2696  C  CE  . MET A  1  347  ? 10.735  -39.267  -56.753  1.00 135.79 ? 347  MET A CE  1 
ATOM   2697  N  N   . GLY A  1  348  ? 17.011  -38.646  -53.865  1.00 140.60 ? 348  GLY A N   1 
ATOM   2698  C  CA  . GLY A  1  348  ? 18.161  -38.487  -52.994  1.00 123.27 ? 348  GLY A CA  1 
ATOM   2699  C  C   . GLY A  1  348  ? 19.424  -38.148  -53.759  1.00 121.27 ? 348  GLY A C   1 
ATOM   2700  O  O   . GLY A  1  348  ? 20.133  -39.038  -54.231  1.00 121.50 ? 348  GLY A O   1 
ATOM   2701  N  N   . LYS A  1  349  ? 19.705  -36.856  -53.884  1.00 106.34 ? 349  LYS A N   1 
ATOM   2702  C  CA  . LYS A  1  349  ? 20.889  -36.395  -54.596  1.00 105.68 ? 349  LYS A CA  1 
ATOM   2703  C  C   . LYS A  1  349  ? 22.016  -36.046  -53.631  1.00 109.69 ? 349  LYS A C   1 
ATOM   2704  O  O   . LYS A  1  349  ? 21.794  -35.400  -52.609  1.00 112.03 ? 349  LYS A O   1 
ATOM   2705  C  CB  . LYS A  1  349  ? 20.554  -35.180  -55.469  1.00 90.16  ? 349  LYS A CB  1 
ATOM   2706  C  CG  . LYS A  1  349  ? 19.619  -35.490  -56.627  1.00 113.34 ? 349  LYS A CG  1 
ATOM   2707  C  CD  . LYS A  1  349  ? 19.306  -34.241  -57.433  1.00 92.77  ? 349  LYS A CD  1 
ATOM   2708  C  CE  . LYS A  1  349  ? 18.390  -34.554  -58.605  1.00 127.06 ? 349  LYS A CE  1 
ATOM   2709  N  NZ  . LYS A  1  349  ? 18.056  -33.333  -59.393  1.00 98.17  ? 349  LYS A NZ  1 
ATOM   2710  N  N   . ARG A  1  350  ? 23.228  -36.480  -53.961  1.00 109.45 ? 350  ARG A N   1 
ATOM   2711  C  CA  . ARG A  1  350  ? 24.392  -36.214  -53.123  1.00 115.79 ? 350  ARG A CA  1 
ATOM   2712  C  C   . ARG A  1  350  ? 24.362  -34.792  -52.573  1.00 117.93 ? 350  ARG A C   1 
ATOM   2713  O  O   . ARG A  1  350  ? 23.775  -34.537  -51.524  1.00 150.82 ? 350  ARG A O   1 
ATOM   2714  C  CB  . ARG A  1  350  ? 25.682  -36.445  -53.910  1.00 159.29 ? 350  ARG A CB  1 
ATOM   2715  C  CG  . ARG A  1  350  ? 25.919  -37.894  -54.306  1.00 160.46 ? 350  ARG A CG  1 
ATOM   2716  C  CD  . ARG A  1  350  ? 26.687  -38.644  -53.229  1.00 151.23 ? 350  ARG A CD  1 
ATOM   2717  N  NE  . ARG A  1  350  ? 26.589  -40.092  -53.391  1.00 168.64 ? 350  ARG A NE  1 
ATOM   2718  C  CZ  . ARG A  1  350  ? 26.721  -40.965  -52.398  1.00 176.62 ? 350  ARG A CZ  1 
ATOM   2719  N  NH1 . ARG A  1  350  ? 26.954  -40.541  -51.164  1.00 180.93 ? 350  ARG A NH1 1 
ATOM   2720  N  NH2 . ARG A  1  350  ? 26.616  -42.265  -52.642  1.00 161.19 ? 350  ARG A NH2 1 
ATOM   2721  N  N   . VAL A  1  351  ? 24.999  -33.872  -53.290  1.00 104.29 ? 351  VAL A N   1 
ATOM   2722  C  CA  . VAL A  1  351  ? 25.045  -32.475  -52.875  1.00 109.52 ? 351  VAL A CA  1 
ATOM   2723  C  C   . VAL A  1  351  ? 26.480  -32.011  -52.645  1.00 111.20 ? 351  VAL A C   1 
ATOM   2724  O  O   . VAL A  1  351  ? 27.423  -32.791  -52.772  1.00 108.05 ? 351  VAL A O   1 
ATOM   2725  C  CB  . VAL A  1  351  ? 24.228  -32.242  -51.593  1.00 103.36 ? 351  VAL A CB  1 
ATOM   2726  C  CG1 . VAL A  1  351  ? 24.741  -31.015  -50.854  1.00 108.15 ? 351  VAL A CG1 1 
ATOM   2727  C  CG2 . VAL A  1  351  ? 22.751  -32.096  -51.926  1.00 134.72 ? 351  VAL A CG2 1 
ATOM   2728  N  N   . ASP A  1  352  ? 26.634  -30.736  -52.305  1.00 105.47 ? 352  ASP A N   1 
ATOM   2729  C  CA  . ASP A  1  352  ? 27.953  -30.163  -52.057  1.00 140.63 ? 352  ASP A CA  1 
ATOM   2730  C  C   . ASP A  1  352  ? 27.991  -29.429  -50.721  1.00 142.68 ? 352  ASP A C   1 
ATOM   2731  O  O   . ASP A  1  352  ? 27.240  -29.754  -49.803  1.00 137.49 ? 352  ASP A O   1 
ATOM   2732  C  CB  . ASP A  1  352  ? 28.349  -29.218  -53.189  1.00 149.18 ? 352  ASP A CB  1 
ATOM   2733  C  CG  . ASP A  1  352  ? 28.316  -29.888  -54.547  1.00 126.73 ? 352  ASP A CG  1 
ATOM   2734  O  OD1 . ASP A  1  352  ? 28.556  -31.112  -54.614  1.00 107.40 ? 352  ASP A OD1 1 
ATOM   2735  O  OD2 . ASP A  1  352  ? 28.050  -29.188  -55.550  1.00 147.60 ? 352  ASP A OD2 1 
ATOM   2736  N  N   . PHE A  1  353  ? 28.872  -28.438  -50.622  1.00 104.99 ? 353  PHE A N   1 
ATOM   2737  C  CA  . PHE A  1  353  ? 29.011  -27.656  -49.399  1.00 102.37 ? 353  PHE A CA  1 
ATOM   2738  C  C   . PHE A  1  353  ? 28.616  -28.471  -48.172  1.00 96.84  ? 353  PHE A C   1 
ATOM   2739  O  O   . PHE A  1  353  ? 27.760  -28.056  -47.388  1.00 96.15  ? 353  PHE A O   1 
ATOM   2740  C  CB  . PHE A  1  353  ? 28.166  -26.385  -49.482  1.00 105.21 ? 353  PHE A CB  1 
ATOM   2741  C  CG  . PHE A  1  353  ? 28.675  -25.377  -50.470  1.00 116.68 ? 353  PHE A CG  1 
ATOM   2742  C  CD1 . PHE A  1  353  ? 28.012  -25.162  -51.668  1.00 149.94 ? 353  PHE A CD1 1 
ATOM   2743  C  CD2 . PHE A  1  353  ? 29.820  -24.643  -50.202  1.00 154.49 ? 353  PHE A CD2 1 
ATOM   2744  C  CE1 . PHE A  1  353  ? 28.481  -24.238  -52.580  1.00 117.85 ? 353  PHE A CE1 1 
ATOM   2745  C  CE2 . PHE A  1  353  ? 30.294  -23.718  -51.114  1.00 113.68 ? 353  PHE A CE2 1 
ATOM   2746  C  CZ  . PHE A  1  353  ? 29.623  -23.514  -52.303  1.00 127.55 ? 353  PHE A CZ  1 
ATOM   2747  N  N   . SER A  1  354  ? 29.245  -29.633  -48.011  1.00 92.05  ? 354  SER A N   1 
ATOM   2748  C  CA  . SER A  1  354  ? 28.960  -30.500  -46.884  1.00 96.80  ? 354  SER A CA  1 
ATOM   2749  C  C   . SER A  1  354  ? 30.216  -31.266  -46.506  1.00 98.74  ? 354  SER A C   1 
ATOM   2750  O  O   . SER A  1  354  ? 31.276  -31.097  -47.127  1.00 91.44  ? 354  SER A O   1 
ATOM   2751  C  CB  . SER A  1  354  ? 27.856  -31.489  -47.225  1.00 88.50  ? 354  SER A CB  1 
ATOM   2752  O  OG  . SER A  1  354  ? 28.371  -32.527  -48.054  1.00 88.22  ? 354  SER A OG  1 
ATOM   2753  N  N   . ALA A  1  355  ? 30.100  -32.092  -45.472  1.00 84.47  ? 355  ALA A N   1 
ATOM   2754  C  CA  . ALA A  1  355  ? 31.249  -32.805  -44.946  1.00 81.81  ? 355  ALA A CA  1 
ATOM   2755  C  C   . ALA A  1  355  ? 30.814  -33.680  -43.797  1.00 82.93  ? 355  ALA A C   1 
ATOM   2756  O  O   . ALA A  1  355  ? 29.712  -33.538  -43.301  1.00 82.21  ? 355  ALA A O   1 
ATOM   2757  C  CB  . ALA A  1  355  ? 32.307  -31.823  -44.482  1.00 84.50  ? 355  ALA A CB  1 
ATOM   2758  N  N   . ARG A  1  356  ? 31.688  -34.574  -43.363  1.00 82.71  ? 356  ARG A N   1 
ATOM   2759  C  CA  . ARG A  1  356  ? 31.356  -35.447  -42.258  1.00 80.72  ? 356  ARG A CA  1 
ATOM   2760  C  C   . ARG A  1  356  ? 32.626  -36.019  -41.668  1.00 82.10  ? 356  ARG A C   1 
ATOM   2761  O  O   . ARG A  1  356  ? 33.659  -36.037  -42.317  1.00 83.98  ? 356  ARG A O   1 
ATOM   2762  C  CB  . ARG A  1  356  ? 30.445  -36.572  -42.725  1.00 84.01  ? 356  ARG A CB  1 
ATOM   2763  C  CG  . ARG A  1  356  ? 31.134  -37.563  -43.651  1.00 81.46  ? 356  ARG A CG  1 
ATOM   2764  C  CD  . ARG A  1  356  ? 30.188  -38.660  -44.144  1.00 80.85  ? 356  ARG A CD  1 
ATOM   2765  N  NE  . ARG A  1  356  ? 29.655  -39.492  -43.067  1.00 83.32  ? 356  ARG A NE  1 
ATOM   2766  C  CZ  . ARG A  1  356  ? 29.050  -40.661  -43.249  1.00 83.24  ? 356  ARG A CZ  1 
ATOM   2767  N  NH1 . ARG A  1  356  ? 28.898  -41.159  -44.476  1.00 83.65  ? 356  ARG A NH1 1 
ATOM   2768  N  NH2 . ARG A  1  356  ? 28.589  -41.340  -42.212  1.00 82.17  ? 356  ARG A NH2 1 
ATOM   2769  N  N   . THR A  1  357  ? 32.548  -36.482  -40.432  1.00 80.16  ? 357  THR A N   1 
ATOM   2770  C  CA  . THR A  1  357  ? 33.685  -37.100  -39.812  1.00 82.57  ? 357  THR A CA  1 
ATOM   2771  C  C   . THR A  1  357  ? 33.259  -37.772  -38.547  1.00 80.49  ? 357  THR A C   1 
ATOM   2772  O  O   . THR A  1  357  ? 32.095  -37.827  -38.244  1.00 80.14  ? 357  THR A O   1 
ATOM   2773  C  CB  . THR A  1  357  ? 34.746  -36.082  -39.539  1.00 79.18  ? 357  THR A CB  1 
ATOM   2774  O  OG1 . THR A  1  357  ? 36.024  -36.671  -39.759  1.00 82.36  ? 357  THR A OG1 1 
ATOM   2775  C  CG2 . THR A  1  357  ? 34.665  -35.548  -38.145  1.00 78.63  ? 357  THR A CG2 1 
ATOM   2776  N  N   . VAL A  1  358  ? 34.202  -38.328  -37.817  1.00 78.01  ? 358  VAL A N   1 
ATOM   2777  C  CA  . VAL A  1  358  ? 33.883  -39.050  -36.593  1.00 80.83  ? 358  VAL A CA  1 
ATOM   2778  C  C   . VAL A  1  358  ? 33.451  -38.095  -35.506  1.00 80.30  ? 358  VAL A C   1 
ATOM   2779  O  O   . VAL A  1  358  ? 33.978  -37.010  -35.428  1.00 76.77  ? 358  VAL A O   1 
ATOM   2780  C  CB  . VAL A  1  358  ? 35.126  -39.760  -36.083  1.00 77.03  ? 358  VAL A CB  1 
ATOM   2781  C  CG1 . VAL A  1  358  ? 34.813  -40.512  -34.821  1.00 77.66  ? 358  VAL A CG1 1 
ATOM   2782  C  CG2 . VAL A  1  358  ? 35.650  -40.693  -37.143  1.00 80.09  ? 358  VAL A CG2 1 
ATOM   2783  N  N   . ILE A  1  359  ? 32.507  -38.455  -34.650  1.00 79.30  ? 359  ILE A N   1 
ATOM   2784  C  CA  . ILE A  1  359  ? 32.141  -37.522  -33.603  1.00 78.87  ? 359  ILE A CA  1 
ATOM   2785  C  C   . ILE A  1  359  ? 32.893  -37.801  -32.339  1.00 78.44  ? 359  ILE A C   1 
ATOM   2786  O  O   . ILE A  1  359  ? 33.400  -38.883  -32.166  1.00 76.92  ? 359  ILE A O   1 
ATOM   2787  C  CB  . ILE A  1  359  ? 30.675  -37.592  -33.232  1.00 78.75  ? 359  ILE A CB  1 
ATOM   2788  C  CG1 . ILE A  1  359  ? 30.203  -39.023  -33.266  1.00 75.74  ? 359  ILE A CG1 1 
ATOM   2789  C  CG2 . ILE A  1  359  ? 29.836  -36.784  -34.166  1.00 78.15  ? 359  ILE A CG2 1 
ATOM   2790  C  CD1 . ILE A  1  359  ? 30.975  -39.952  -32.373  1.00 77.21  ? 359  ILE A CD1 1 
ATOM   2791  N  N   . THR A  1  360  ? 32.938  -36.827  -31.444  1.00 78.72  ? 360  THR A N   1 
ATOM   2792  C  CA  . THR A  1  360  ? 33.596  -36.962  -30.157  1.00 78.83  ? 360  THR A CA  1 
ATOM   2793  C  C   . THR A  1  360  ? 32.754  -36.200  -29.157  1.00 79.48  ? 360  THR A C   1 
ATOM   2794  O  O   . THR A  1  360  ? 31.950  -35.361  -29.534  1.00 77.54  ? 360  THR A O   1 
ATOM   2795  C  CB  . THR A  1  360  ? 34.998  -36.315  -30.175  1.00 76.03  ? 360  THR A CB  1 
ATOM   2796  O  OG1 . THR A  1  360  ? 35.861  -37.016  -31.075  1.00 77.78  ? 360  THR A OG1 1 
ATOM   2797  C  CG2 . THR A  1  360  ? 35.629  -36.306  -28.788  1.00 75.13  ? 360  THR A CG2 1 
ATOM   2798  N  N   . GLY A  1  361  ? 32.930  -36.487  -27.876  1.00 80.31  ? 361  GLY A N   1 
ATOM   2799  C  CA  . GLY A  1  361  ? 32.234  -35.743  -26.844  1.00 118.30 ? 361  GLY A CA  1 
ATOM   2800  C  C   . GLY A  1  361  ? 32.982  -34.481  -26.468  1.00 138.21 ? 361  GLY A C   1 
ATOM   2801  O  O   . GLY A  1  361  ? 34.196  -34.397  -26.654  1.00 86.21  ? 361  GLY A O   1 
ATOM   2802  N  N   . ASP A  1  362  ? 32.233  -33.495  -25.977  1.00 75.61  ? 362  ASP A N   1 
ATOM   2803  C  CA  . ASP A  1  362  ? 32.798  -32.327  -25.301  1.00 79.47  ? 362  ASP A CA  1 
ATOM   2804  C  C   . ASP A  1  362  ? 31.806  -31.708  -24.291  1.00 74.75  ? 362  ASP A C   1 
ATOM   2805  O  O   . ASP A  1  362  ? 30.666  -31.423  -24.643  1.00 74.62  ? 362  ASP A O   1 
ATOM   2806  C  CB  . ASP A  1  362  ? 33.252  -31.284  -26.315  1.00 77.37  ? 362  ASP A CB  1 
ATOM   2807  C  CG  . ASP A  1  362  ? 33.378  -29.905  -25.699  1.00 82.24  ? 362  ASP A CG  1 
ATOM   2808  O  OD1 . ASP A  1  362  ? 32.797  -28.946  -26.263  1.00 94.48  ? 362  ASP A OD1 1 
ATOM   2809  O  OD2 . ASP A  1  362  ? 34.042  -29.789  -24.644  1.00 86.17  ? 362  ASP A OD2 1 
ATOM   2810  N  N   . PRO A  1  363  ? 32.239  -31.517  -23.026  1.00 94.06  ? 363  PRO A N   1 
ATOM   2811  C  CA  . PRO A  1  363  ? 31.330  -31.092  -21.957  1.00 84.82  ? 363  PRO A CA  1 
ATOM   2812  C  C   . PRO A  1  363  ? 31.279  -29.586  -21.837  1.00 93.68  ? 363  PRO A C   1 
ATOM   2813  O  O   . PRO A  1  363  ? 30.356  -29.042  -21.241  1.00 92.12  ? 363  PRO A O   1 
ATOM   2814  C  CB  . PRO A  1  363  ? 31.998  -31.628  -20.691  1.00 90.62  ? 363  PRO A CB  1 
ATOM   2815  C  CG  . PRO A  1  363  ? 33.304  -32.260  -21.131  1.00 82.64  ? 363  PRO A CG  1 
ATOM   2816  C  CD  . PRO A  1  363  ? 33.588  -31.740  -22.500  1.00 90.48  ? 363  PRO A CD  1 
ATOM   2817  N  N   . ASN A  1  364  ? 32.051  -28.985  -22.713  1.00 88.60  ? 364  ASN A N   1 
ATOM   2818  C  CA  . ASN A  1  364  ? 32.337  -27.585  -22.494  1.00 95.78  ? 364  ASN A CA  1 
ATOM   2819  C  C   . ASN A  1  364  ? 31.740  -26.640  -23.503  1.00 98.59  ? 364  ASN A C   1 
ATOM   2820  O  O   . ASN A  1  364  ? 32.025  -25.436  -23.475  1.00 104.31 ? 364  ASN A O   1 
ATOM   2821  C  CB  . ASN A  1  364  ? 33.834  -27.360  -22.394  1.00 102.76 ? 364  ASN A CB  1 
ATOM   2822  C  CG  . ASN A  1  364  ? 34.378  -27.801  -21.069  1.00 103.03 ? 364  ASN A CG  1 
ATOM   2823  O  OD1 . ASN A  1  364  ? 33.777  -27.518  -20.033  1.00 102.50 ? 364  ASN A OD1 1 
ATOM   2824  N  ND2 . ASN A  1  364  ? 35.514  -28.492  -21.080  1.00 104.22 ? 364  ASN A ND2 1 
ATOM   2825  N  N   . LEU A  1  365  ? 30.906  -27.191  -24.387  1.00 75.64  ? 365  LEU A N   1 
ATOM   2826  C  CA  . LEU A  1  365  ? 30.225  -26.405  -25.415  1.00 75.77  ? 365  LEU A CA  1 
ATOM   2827  C  C   . LEU A  1  365  ? 28.809  -26.143  -24.978  1.00 76.50  ? 365  LEU A C   1 
ATOM   2828  O  O   . LEU A  1  365  ? 28.216  -26.946  -24.269  1.00 75.38  ? 365  LEU A O   1 
ATOM   2829  C  CB  . LEU A  1  365  ? 30.170  -27.142  -26.752  1.00 78.27  ? 365  LEU A CB  1 
ATOM   2830  C  CG  . LEU A  1  365  ? 31.491  -27.436  -27.442  1.00 77.10  ? 365  LEU A CG  1 
ATOM   2831  C  CD1 . LEU A  1  365  ? 31.208  -27.743  -28.905  1.00 77.15  ? 365  LEU A CD1 1 
ATOM   2832  C  CD2 . LEU A  1  365  ? 32.426  -26.239  -27.294  1.00 78.50  ? 365  LEU A CD2 1 
ATOM   2833  N  N   . SER A  1  366  ? 28.255  -25.021  -25.398  1.00 88.69  ? 366  SER A N   1 
ATOM   2834  C  CA  . SER A  1  366  ? 26.891  -24.744  -25.028  1.00 88.56  ? 366  SER A CA  1 
ATOM   2835  C  C   . SER A  1  366  ? 26.121  -25.820  -25.776  1.00 81.86  ? 366  SER A C   1 
ATOM   2836  O  O   . SER A  1  366  ? 26.689  -26.510  -26.622  1.00 80.82  ? 366  SER A O   1 
ATOM   2837  C  CB  . SER A  1  366  ? 26.445  -23.334  -25.414  1.00 84.83  ? 366  SER A CB  1 
ATOM   2838  O  OG  . SER A  1  366  ? 26.538  -23.136  -26.816  1.00 85.88  ? 366  SER A OG  1 
ATOM   2839  N  N   . LEU A  1  367  ? 24.847  -25.983  -25.462  1.00 75.72  ? 367  LEU A N   1 
ATOM   2840  C  CA  . LEU A  1  367  ? 24.054  -26.998  -26.144  1.00 77.72  ? 367  LEU A CA  1 
ATOM   2841  C  C   . LEU A  1  367  ? 24.046  -26.768  -27.654  1.00 78.22  ? 367  LEU A C   1 
ATOM   2842  O  O   . LEU A  1  367  ? 24.452  -27.636  -28.439  1.00 77.97  ? 367  LEU A O   1 
ATOM   2843  C  CB  . LEU A  1  367  ? 22.620  -26.964  -25.607  1.00 77.33  ? 367  LEU A CB  1 
ATOM   2844  C  CG  . LEU A  1  367  ? 21.562  -27.959  -26.095  1.00 75.19  ? 367  LEU A CG  1 
ATOM   2845  C  CD1 . LEU A  1  367  ? 21.961  -29.365  -25.707  1.00 77.24  ? 367  LEU A CD1 1 
ATOM   2846  C  CD2 . LEU A  1  367  ? 20.216  -27.611  -25.466  1.00 77.52  ? 367  LEU A CD2 1 
ATOM   2847  N  N   . ASP A  1  368  ? 23.582  -25.591  -28.060  1.00 111.67 ? 368  ASP A N   1 
ATOM   2848  C  CA  . ASP A  1  368  ? 23.517  -25.239  -29.473  1.00 113.22 ? 368  ASP A CA  1 
ATOM   2849  C  C   . ASP A  1  368  ? 24.898  -24.897  -30.021  1.00 113.60 ? 368  ASP A C   1 
ATOM   2850  O  O   . ASP A  1  368  ? 25.052  -23.959  -30.802  1.00 115.78 ? 368  ASP A O   1 
ATOM   2851  C  CB  . ASP A  1  368  ? 22.560  -24.065  -29.689  1.00 119.05 ? 368  ASP A CB  1 
ATOM   2852  C  CG  . ASP A  1  368  ? 23.032  -22.795  -29.008  1.00 125.98 ? 368  ASP A CG  1 
ATOM   2853  O  OD1 . ASP A  1  368  ? 22.354  -21.756  -29.148  1.00 129.92 ? 368  ASP A OD1 1 
ATOM   2854  O  OD2 . ASP A  1  368  ? 24.083  -22.836  -28.333  1.00 129.16 ? 368  ASP A OD2 1 
ATOM   2855  N  N   . GLU A  1  369  ? 25.899  -25.665  -29.606  1.00 121.45 ? 369  GLU A N   1 
ATOM   2856  C  CA  . GLU A  1  369  ? 27.269  -25.445  -30.055  1.00 122.33 ? 369  GLU A CA  1 
ATOM   2857  C  C   . GLU A  1  369  ? 27.830  -26.686  -30.742  1.00 118.09 ? 369  GLU A C   1 
ATOM   2858  O  O   . GLU A  1  369  ? 27.494  -27.813  -30.379  1.00 114.83 ? 369  GLU A O   1 
ATOM   2859  C  CB  . GLU A  1  369  ? 28.163  -25.048  -28.878  1.00 135.44 ? 369  GLU A CB  1 
ATOM   2860  C  CG  . GLU A  1  369  ? 28.133  -23.565  -28.548  1.00 139.57 ? 369  GLU A CG  1 
ATOM   2861  C  CD  . GLU A  1  369  ? 29.436  -23.074  -27.949  1.00 143.29 ? 369  GLU A CD  1 
ATOM   2862  O  OE1 . GLU A  1  369  ? 30.341  -23.906  -27.730  1.00 142.38 ? 369  GLU A OE1 1 
ATOM   2863  O  OE2 . GLU A  1  369  ? 29.555  -21.857  -27.697  1.00 147.58 ? 369  GLU A OE2 1 
ATOM   2864  N  N   . LEU A  1  370  ? 28.685  -26.470  -31.736  1.00 77.30  ? 370  LEU A N   1 
ATOM   2865  C  CA  . LEU A  1  370  ? 29.292  -27.570  -32.476  1.00 77.05  ? 370  LEU A CA  1 
ATOM   2866  C  C   . LEU A  1  370  ? 30.733  -27.248  -32.860  1.00 77.41  ? 370  LEU A C   1 
ATOM   2867  O  O   . LEU A  1  370  ? 30.991  -26.298  -33.597  1.00 78.85  ? 370  LEU A O   1 
ATOM   2868  C  CB  . LEU A  1  370  ? 28.474  -27.889  -33.728  1.00 79.73  ? 370  LEU A CB  1 
ATOM   2869  C  CG  . LEU A  1  370  ? 28.903  -29.126  -34.522  1.00 77.36  ? 370  LEU A CG  1 
ATOM   2870  C  CD1 . LEU A  1  370  ? 28.910  -30.359  -33.632  1.00 78.66  ? 370  LEU A CD1 1 
ATOM   2871  C  CD2 . LEU A  1  370  ? 27.998  -29.333  -35.726  1.00 79.57  ? 370  LEU A CD2 1 
ATOM   2872  N  N   . GLY A  1  371  ? 31.667  -28.046  -32.353  1.00 92.75  ? 371  GLY A N   1 
ATOM   2873  C  CA  . GLY A  1  371  ? 33.076  -27.849  -32.640  1.00 97.96  ? 371  GLY A CA  1 
ATOM   2874  C  C   . GLY A  1  371  ? 33.434  -28.218  -34.066  1.00 98.74  ? 371  GLY A C   1 
ATOM   2875  O  O   . GLY A  1  371  ? 33.367  -29.385  -34.451  1.00 97.23  ? 371  GLY A O   1 
ATOM   2876  N  N   . VAL A  1  372  ? 33.817  -27.217  -34.852  1.00 107.73 ? 372  VAL A N   1 
ATOM   2877  C  CA  . VAL A  1  372  ? 34.191  -27.435  -36.244  1.00 107.39 ? 372  VAL A CA  1 
ATOM   2878  C  C   . VAL A  1  372  ? 35.698  -27.299  -36.437  1.00 138.41 ? 372  VAL A C   1 
ATOM   2879  O  O   . VAL A  1  372  ? 36.263  -26.222  -36.242  1.00 143.13 ? 372  VAL A O   1 
ATOM   2880  C  CB  . VAL A  1  372  ? 33.471  -26.451  -37.184  1.00 108.85 ? 372  VAL A CB  1 
ATOM   2881  C  CG1 . VAL A  1  372  ? 33.963  -26.626  -38.613  1.00 110.36 ? 372  VAL A CG1 1 
ATOM   2882  C  CG2 . VAL A  1  372  ? 31.965  -26.647  -37.103  1.00 126.32 ? 372  VAL A CG2 1 
ATOM   2883  N  N   . PRO A  1  373  ? 36.343  -28.395  -36.821  1.00 81.34  ? 373  PRO A N   1 
ATOM   2884  C  CA  . PRO A  1  373  ? 37.793  -28.399  -37.040  1.00 83.40  ? 373  PRO A CA  1 
ATOM   2885  C  C   . PRO A  1  373  ? 38.206  -27.405  -38.120  1.00 84.36  ? 373  PRO A C   1 
ATOM   2886  O  O   . PRO A  1  373  ? 37.532  -27.290  -39.144  1.00 83.94  ? 373  PRO A O   1 
ATOM   2887  C  CB  . PRO A  1  373  ? 38.065  -29.829  -37.512  1.00 82.06  ? 373  PRO A CB  1 
ATOM   2888  C  CG  . PRO A  1  373  ? 36.795  -30.255  -38.155  1.00 80.72  ? 373  PRO A CG  1 
ATOM   2889  C  CD  . PRO A  1  373  ? 35.695  -29.599  -37.369  1.00 79.64  ? 373  PRO A CD  1 
ATOM   2890  N  N   . ARG A  1  374  ? 39.305  -26.694  -37.888  1.00 81.97  ? 374  ARG A N   1 
ATOM   2891  C  CA  . ARG A  1  374  ? 39.800  -25.714  -38.846  1.00 82.99  ? 374  ARG A CA  1 
ATOM   2892  C  C   . ARG A  1  374  ? 39.961  -26.330  -40.232  1.00 83.41  ? 374  ARG A C   1 
ATOM   2893  O  O   . ARG A  1  374  ? 39.606  -25.718  -41.239  1.00 92.97  ? 374  ARG A O   1 
ATOM   2894  C  CB  . ARG A  1  374  ? 41.133  -25.128  -38.374  1.00 92.13  ? 374  ARG A CB  1 
ATOM   2895  C  CG  . ARG A  1  374  ? 41.016  -24.217  -37.163  1.00 84.26  ? 374  ARG A CG  1 
ATOM   2896  C  CD  . ARG A  1  374  ? 41.238  -24.985  -35.871  1.00 83.29  ? 374  ARG A CD  1 
ATOM   2897  N  NE  . ARG A  1  374  ? 42.633  -24.946  -35.443  1.00 88.21  ? 374  ARG A NE  1 
ATOM   2898  C  CZ  . ARG A  1  374  ? 43.653  -25.379  -36.178  1.00 93.44  ? 374  ARG A CZ  1 
ATOM   2899  N  NH1 . ARG A  1  374  ? 43.435  -25.888  -37.382  1.00 91.56  ? 374  ARG A NH1 1 
ATOM   2900  N  NH2 . ARG A  1  374  ? 44.890  -25.304  -35.708  1.00 99.04  ? 374  ARG A NH2 1 
ATOM   2901  N  N   . SER A  1  375  ? 40.496  -27.545  -40.274  1.00 93.95  ? 375  SER A N   1 
ATOM   2902  C  CA  . SER A  1  375  ? 40.702  -28.248  -41.534  1.00 95.65  ? 375  SER A CA  1 
ATOM   2903  C  C   . SER A  1  375  ? 39.495  -28.098  -42.454  1.00 89.98  ? 375  SER A C   1 
ATOM   2904  O  O   . SER A  1  375  ? 39.643  -27.913  -43.663  1.00 92.30  ? 375  SER A O   1 
ATOM   2905  C  CB  . SER A  1  375  ? 40.988  -29.730  -41.282  1.00 93.07  ? 375  SER A CB  1 
ATOM   2906  O  OG  . SER A  1  375  ? 40.325  -30.547  -42.230  1.00 89.35  ? 375  SER A OG  1 
ATOM   2907  N  N   . ILE A  1  376  ? 38.302  -28.176  -41.875  1.00 95.49  ? 376  ILE A N   1 
ATOM   2908  C  CA  . ILE A  1  376  ? 37.068  -28.049  -42.642  1.00 88.93  ? 376  ILE A CA  1 
ATOM   2909  C  C   . ILE A  1  376  ? 36.686  -26.586  -42.837  1.00 93.12  ? 376  ILE A C   1 
ATOM   2910  O  O   . ILE A  1  376  ? 36.394  -26.154  -43.952  1.00 96.07  ? 376  ILE A O   1 
ATOM   2911  C  CB  . ILE A  1  376  ? 35.901  -28.787  -41.959  1.00 84.85  ? 376  ILE A CB  1 
ATOM   2912  C  CG1 . ILE A  1  376  ? 36.168  -30.294  -41.931  1.00 82.26  ? 376  ILE A CG1 1 
ATOM   2913  C  CG2 . ILE A  1  376  ? 34.591  -28.487  -42.671  1.00 85.48  ? 376  ILE A CG2 1 
ATOM   2914  C  CD1 . ILE A  1  376  ? 34.978  -31.115  -41.485  1.00 84.98  ? 376  ILE A CD1 1 
ATOM   2915  N  N   . ALA A  1  377  ? 36.693  -25.828  -41.746  1.00 87.24  ? 377  ALA A N   1 
ATOM   2916  C  CA  . ALA A  1  377  ? 36.347  -24.415  -41.794  1.00 90.09  ? 377  ALA A CA  1 
ATOM   2917  C  C   . ALA A  1  377  ? 37.140  -23.754  -42.911  1.00 96.54  ? 377  ALA A C   1 
ATOM   2918  O  O   . ALA A  1  377  ? 36.663  -22.806  -43.523  1.00 98.44  ? 377  ALA A O   1 
ATOM   2919  C  CB  . ALA A  1  377  ? 36.665  -23.742  -40.479  1.00 94.83  ? 377  ALA A CB  1 
ATOM   2920  N  N   . LYS A  1  378  ? 38.343  -24.258  -43.168  1.00 91.57  ? 378  LYS A N   1 
ATOM   2921  C  CA  . LYS A  1  378  ? 39.196  -23.708  -44.214  1.00 86.44  ? 378  LYS A CA  1 
ATOM   2922  C  C   . LYS A  1  378  ? 38.785  -24.224  -45.589  1.00 86.87  ? 378  LYS A C   1 
ATOM   2923  O  O   . LYS A  1  378  ? 39.538  -24.108  -46.556  1.00 87.88  ? 378  LYS A O   1 
ATOM   2924  C  CB  . LYS A  1  378  ? 40.663  -24.046  -43.943  1.00 89.12  ? 378  LYS A CB  1 
ATOM   2925  C  CG  . LYS A  1  378  ? 41.314  -23.177  -42.878  1.00 94.66  ? 378  LYS A CG  1 
ATOM   2926  C  CD  . LYS A  1  378  ? 42.823  -23.128  -43.052  1.00 96.04  ? 378  LYS A CD  1 
ATOM   2927  C  CE  . LYS A  1  378  ? 43.416  -24.526  -43.127  1.00 95.34  ? 378  LYS A CE  1 
ATOM   2928  N  NZ  . LYS A  1  378  ? 44.833  -24.504  -43.582  1.00 106.09 ? 378  LYS A NZ  1 
ATOM   2929  N  N   . THR A  1  379  ? 37.587  -24.794  -45.668  1.00 88.30  ? 379  THR A N   1 
ATOM   2930  C  CA  . THR A  1  379  ? 37.075  -25.328  -46.925  1.00 87.61  ? 379  THR A CA  1 
ATOM   2931  C  C   . THR A  1  379  ? 35.558  -25.478  -46.882  1.00 87.25  ? 379  THR A C   1 
ATOM   2932  O  O   . THR A  1  379  ? 35.037  -26.589  -46.782  1.00 87.82  ? 379  THR A O   1 
ATOM   2933  C  CB  . THR A  1  379  ? 37.707  -26.693  -47.257  1.00 88.09  ? 379  THR A CB  1 
ATOM   2934  O  OG1 . THR A  1  379  ? 39.135  -26.570  -47.276  1.00 91.45  ? 379  THR A OG1 1 
ATOM   2935  C  CG2 . THR A  1  379  ? 37.228  -27.186  -48.614  1.00 88.05  ? 379  THR A CG2 1 
ATOM   2936  N  N   . LEU A  1  380  ? 34.855  -24.353  -46.960  1.00 100.73 ? 380  LEU A N   1 
ATOM   2937  C  CA  . LEU A  1  380  ? 33.397  -24.358  -46.930  1.00 92.49  ? 380  LEU A CA  1 
ATOM   2938  C  C   . LEU A  1  380  ? 32.828  -23.112  -47.601  1.00 95.86  ? 380  LEU A C   1 
ATOM   2939  O  O   . LEU A  1  380  ? 33.236  -22.746  -48.704  1.00 97.41  ? 380  LEU A O   1 
ATOM   2940  C  CB  . LEU A  1  380  ? 32.891  -24.457  -45.490  1.00 110.97 ? 380  LEU A CB  1 
ATOM   2941  C  CG  . LEU A  1  380  ? 32.926  -25.849  -44.854  1.00 105.45 ? 380  LEU A CG  1 
ATOM   2942  C  CD1 . LEU A  1  380  ? 31.754  -26.035  -43.903  1.00 85.40  ? 380  LEU A CD1 1 
ATOM   2943  C  CD2 . LEU A  1  380  ? 32.930  -26.929  -45.926  1.00 100.79 ? 380  LEU A CD2 1 
ATOM   2944  N  N   . THR A  1  381  ? 31.884  -22.463  -46.928  1.00 120.88 ? 381  THR A N   1 
ATOM   2945  C  CA  . THR A  1  381  ? 31.256  -21.259  -47.457  1.00 129.29 ? 381  THR A CA  1 
ATOM   2946  C  C   . THR A  1  381  ? 30.113  -21.603  -48.406  1.00 114.51 ? 381  THR A C   1 
ATOM   2947  O  O   . THR A  1  381  ? 30.167  -22.604  -49.121  1.00 108.92 ? 381  THR A O   1 
ATOM   2948  C  CB  . THR A  1  381  ? 32.274  -20.370  -48.197  1.00 137.63 ? 381  THR A CB  1 
ATOM   2949  O  OG1 . THR A  1  381  ? 31.670  -19.110  -48.516  1.00 123.92 ? 381  THR A OG1 1 
ATOM   2950  C  CG2 . THR A  1  381  ? 32.737  -21.044  -49.479  1.00 116.44 ? 381  THR A CG2 1 
ATOM   2951  N  N   . TYR A  1  382  ? 29.078  -20.769  -48.407  1.00 188.00 ? 382  TYR A N   1 
ATOM   2952  C  CA  . TYR A  1  382  ? 29.042  -19.591  -47.549  1.00 191.58 ? 382  TYR A CA  1 
ATOM   2953  C  C   . TYR A  1  382  ? 29.520  -18.350  -48.295  1.00 216.44 ? 382  TYR A C   1 
ATOM   2954  O  O   . TYR A  1  382  ? 30.560  -17.779  -47.968  1.00 223.56 ? 382  TYR A O   1 
ATOM   2955  C  CB  . TYR A  1  382  ? 29.894  -19.813  -46.298  1.00 203.31 ? 382  TYR A CB  1 
ATOM   2956  C  CG  . TYR A  1  382  ? 29.394  -19.073  -45.078  1.00 162.57 ? 382  TYR A CG  1 
ATOM   2957  C  CD1 . TYR A  1  382  ? 28.389  -19.607  -44.282  1.00 161.25 ? 382  TYR A CD1 1 
ATOM   2958  C  CD2 . TYR A  1  382  ? 29.926  -17.841  -44.721  1.00 238.66 ? 382  TYR A CD2 1 
ATOM   2959  C  CE1 . TYR A  1  382  ? 27.928  -18.934  -43.165  1.00 205.91 ? 382  TYR A CE1 1 
ATOM   2960  C  CE2 . TYR A  1  382  ? 29.472  -17.161  -43.607  1.00 290.52 ? 382  TYR A CE2 1 
ATOM   2961  C  CZ  . TYR A  1  382  ? 28.473  -17.712  -42.833  1.00 278.62 ? 382  TYR A CZ  1 
ATOM   2962  O  OH  . TYR A  1  382  ? 28.019  -17.038  -41.723  1.00 310.32 ? 382  TYR A OH  1 
ATOM   2963  N  N   . PRO A  1  383  ? 28.753  -17.938  -49.299  1.00 116.84 ? 383  PRO A N   1 
ATOM   2964  C  CA  . PRO A  1  383  ? 29.098  -16.758  -50.099  1.00 162.87 ? 383  PRO A CA  1 
ATOM   2965  C  C   . PRO A  1  383  ? 29.097  -15.484  -49.261  1.00 142.31 ? 383  PRO A C   1 
ATOM   2966  O  O   . PRO A  1  383  ? 30.101  -15.164  -48.624  1.00 169.88 ? 383  PRO A O   1 
ATOM   2967  C  CB  . PRO A  1  383  ? 27.977  -16.704  -51.138  1.00 158.69 ? 383  PRO A CB  1 
ATOM   2968  C  CG  . PRO A  1  383  ? 27.542  -18.119  -51.285  1.00 144.13 ? 383  PRO A CG  1 
ATOM   2969  C  CD  . PRO A  1  383  ? 27.684  -18.737  -49.923  1.00 139.77 ? 383  PRO A CD  1 
ATOM   2970  N  N   . GLU A  1  384  ? 27.977  -14.769  -49.264  1.00 129.88 ? 384  GLU A N   1 
ATOM   2971  C  CA  . GLU A  1  384  ? 27.856  -13.532  -48.502  1.00 101.82 ? 384  GLU A CA  1 
ATOM   2972  C  C   . GLU A  1  384  ? 28.170  -12.318  -49.370  1.00 104.53 ? 384  GLU A C   1 
ATOM   2973  O  O   . GLU A  1  384  ? 29.329  -12.055  -49.691  1.00 157.74 ? 384  GLU A O   1 
ATOM   2974  C  CB  . GLU A  1  384  ? 28.780  -13.560  -47.283  1.00 125.62 ? 384  GLU A CB  1 
ATOM   2975  C  CG  . GLU A  1  384  ? 28.834  -12.249  -46.515  1.00 155.86 ? 384  GLU A CG  1 
ATOM   2976  C  CD  . GLU A  1  384  ? 28.721  -12.449  -45.016  1.00 117.21 ? 384  GLU A CD  1 
ATOM   2977  O  OE1 . GLU A  1  384  ? 27.797  -11.869  -44.406  1.00 127.68 ? 384  GLU A OE1 1 
ATOM   2978  O  OE2 . GLU A  1  384  ? 29.555  -13.183  -44.447  1.00 148.44 ? 384  GLU A OE2 1 
ATOM   2979  N  N   . THR A  1  385  ? 27.130  -11.580  -49.747  1.00 93.40  ? 385  THR A N   1 
ATOM   2980  C  CA  . THR A  1  385  ? 27.293  -10.394  -50.578  1.00 95.38  ? 385  THR A CA  1 
ATOM   2981  C  C   . THR A  1  385  ? 27.984  -9.273   -49.812  1.00 95.40  ? 385  THR A C   1 
ATOM   2982  O  O   . THR A  1  385  ? 27.976  -9.251   -48.581  1.00 95.24  ? 385  THR A O   1 
ATOM   2983  C  CB  . THR A  1  385  ? 25.938  -9.885   -51.105  1.00 95.83  ? 385  THR A CB  1 
ATOM   2984  O  OG1 . THR A  1  385  ? 24.999  -10.966  -51.140  1.00 96.60  ? 385  THR A OG1 1 
ATOM   2985  C  CG2 . THR A  1  385  ? 26.094  -9.309   -52.505  1.00 98.64  ? 385  THR A CG2 1 
ATOM   2986  N  N   . VAL A  1  386  ? 28.581  -8.340   -50.548  1.00 102.60 ? 386  VAL A N   1 
ATOM   2987  C  CA  . VAL A  1  386  ? 29.282  -7.205   -49.936  1.00 107.64 ? 386  VAL A CA  1 
ATOM   2988  C  C   . VAL A  1  386  ? 28.349  -6.114   -49.451  1.00 110.83 ? 386  VAL A C   1 
ATOM   2989  O  O   . VAL A  1  386  ? 27.815  -5.321   -50.227  1.00 112.08 ? 386  VAL A O   1 
ATOM   2990  C  CB  . VAL A  1  386  ? 30.266  -6.502   -50.877  1.00 109.94 ? 386  VAL A CB  1 
ATOM   2991  C  CG1 . VAL A  1  386  ? 30.696  -5.212   -50.261  1.00 117.42 ? 386  VAL A CG1 1 
ATOM   2992  C  CG2 . VAL A  1  386  ? 31.493  -7.317   -51.110  1.00 110.01 ? 386  VAL A CG2 1 
ATOM   2993  N  N   . THR A  1  387  ? 28.169  -6.048   -48.148  1.00 127.55 ? 387  THR A N   1 
ATOM   2994  C  CA  . THR A  1  387  ? 27.346  -5.003   -47.604  1.00 174.02 ? 387  THR A CA  1 
ATOM   2995  C  C   . THR A  1  387  ? 28.275  -3.828   -47.495  1.00 162.29 ? 387  THR A C   1 
ATOM   2996  O  O   . THR A  1  387  ? 29.486  -4.020   -47.513  1.00 161.94 ? 387  THR A O   1 
ATOM   2997  C  CB  . THR A  1  387  ? 26.797  -5.392   -46.223  1.00 208.66 ? 387  THR A CB  1 
ATOM   2998  O  OG1 . THR A  1  387  ? 27.790  -5.137   -45.221  1.00 197.84 ? 387  THR A OG1 1 
ATOM   2999  C  CG2 . THR A  1  387  ? 26.417  -6.870   -46.198  1.00 218.11 ? 387  THR A CG2 1 
ATOM   3000  N  N   . PRO A  1  388  ? 27.713  -2.618   -47.431  1.00 101.20 ? 388  PRO A N   1 
ATOM   3001  C  CA  . PRO A  1  388  ? 28.363  -1.339   -47.151  1.00 113.36 ? 388  PRO A CA  1 
ATOM   3002  C  C   . PRO A  1  388  ? 28.807  -1.310   -45.706  1.00 114.15 ? 388  PRO A C   1 
ATOM   3003  O  O   . PRO A  1  388  ? 29.433  -0.344   -45.276  1.00 132.82 ? 388  PRO A O   1 
ATOM   3004  C  CB  . PRO A  1  388  ? 27.231  -0.329   -47.320  1.00 123.13 ? 388  PRO A CB  1 
ATOM   3005  C  CG  . PRO A  1  388  ? 26.224  -1.002   -48.159  1.00 137.27 ? 388  PRO A CG  1 
ATOM   3006  C  CD  . PRO A  1  388  ? 26.297  -2.441   -47.788  1.00 116.67 ? 388  PRO A CD  1 
ATOM   3007  N  N   . TYR A  1  389  ? 28.450  -2.350   -44.959  1.00 152.81 ? 389  TYR A N   1 
ATOM   3008  C  CA  . TYR A  1  389  ? 28.786  -2.455   -43.542  1.00 144.45 ? 389  TYR A CA  1 
ATOM   3009  C  C   . TYR A  1  389  ? 30.001  -3.357   -43.388  1.00 136.96 ? 389  TYR A C   1 
ATOM   3010  O  O   . TYR A  1  389  ? 30.605  -3.427   -42.318  1.00 145.86 ? 389  TYR A O   1 
ATOM   3011  C  CB  . TYR A  1  389  ? 27.613  -3.062   -42.771  1.00 115.07 ? 389  TYR A CB  1 
ATOM   3012  C  CG  . TYR A  1  389  ? 26.272  -2.485   -43.161  1.00 114.12 ? 389  TYR A CG  1 
ATOM   3013  C  CD1 . TYR A  1  389  ? 25.219  -3.302   -43.555  1.00 122.95 ? 389  TYR A CD1 1 
ATOM   3014  C  CD2 . TYR A  1  389  ? 26.061  -1.111   -43.146  1.00 162.23 ? 389  TYR A CD2 1 
ATOM   3015  C  CE1 . TYR A  1  389  ? 23.986  -2.753   -43.915  1.00 119.37 ? 389  TYR A CE1 1 
ATOM   3016  C  CE2 . TYR A  1  389  ? 24.846  -0.558   -43.500  1.00 162.08 ? 389  TYR A CE2 1 
ATOM   3017  C  CZ  . TYR A  1  389  ? 23.810  -1.374   -43.882  1.00 145.11 ? 389  TYR A CZ  1 
ATOM   3018  O  OH  . TYR A  1  389  ? 22.618  -0.780   -44.230  1.00 144.80 ? 389  TYR A OH  1 
ATOM   3019  N  N   . ASN A  1  390  ? 30.351  -4.039   -44.471  1.00 99.72  ? 390  ASN A N   1 
ATOM   3020  C  CA  . ASN A  1  390  ? 31.351  -5.086   -44.438  1.00 94.76  ? 390  ASN A CA  1 
ATOM   3021  C  C   . ASN A  1  390  ? 32.651  -4.639   -45.062  1.00 110.28 ? 390  ASN A C   1 
ATOM   3022  O  O   . ASN A  1  390  ? 33.716  -4.961   -44.550  1.00 112.31 ? 390  ASN A O   1 
ATOM   3023  C  CB  . ASN A  1  390  ? 30.820  -6.307   -45.194  1.00 128.98 ? 390  ASN A CB  1 
ATOM   3024  C  CG  . ASN A  1  390  ? 29.669  -6.984   -44.462  1.00 110.76 ? 390  ASN A CG  1 
ATOM   3025  O  OD1 . ASN A  1  390  ? 29.153  -6.458   -43.477  1.00 97.47  ? 390  ASN A OD1 1 
ATOM   3026  N  ND2 . ASN A  1  390  ? 29.269  -8.158   -44.934  1.00 94.25  ? 390  ASN A ND2 1 
ATOM   3027  N  N   . ILE A  1  391  ? 32.538  -3.886   -46.152  1.00 96.98  ? 391  ILE A N   1 
ATOM   3028  C  CA  . ILE A  1  391  ? 33.660  -3.604   -47.040  1.00 98.45  ? 391  ILE A CA  1 
ATOM   3029  C  C   . ILE A  1  391  ? 34.994  -3.687   -46.313  1.00 100.11 ? 391  ILE A C   1 
ATOM   3030  O  O   . ILE A  1  391  ? 35.884  -4.421   -46.734  1.00 99.93  ? 391  ILE A O   1 
ATOM   3031  C  CB  . ILE A  1  391  ? 33.512  -2.256   -47.781  1.00 102.56 ? 391  ILE A CB  1 
ATOM   3032  C  CG1 . ILE A  1  391  ? 32.583  -2.399   -48.985  1.00 101.23 ? 391  ILE A CG1 1 
ATOM   3033  C  CG2 . ILE A  1  391  ? 34.853  -1.752   -48.262  1.00 105.88 ? 391  ILE A CG2 1 
ATOM   3034  C  CD1 . ILE A  1  391  ? 31.129  -2.196   -48.672  1.00 99.60  ? 391  ILE A CD1 1 
ATOM   3035  N  N   . TYR A  1  392  ? 35.127  -2.964   -45.207  1.00 102.55 ? 392  TYR A N   1 
ATOM   3036  C  CA  . TYR A  1  392  ? 36.409  -2.903   -44.517  1.00 108.56 ? 392  TYR A CA  1 
ATOM   3037  C  C   . TYR A  1  392  ? 36.674  -4.228   -43.808  1.00 106.41 ? 392  TYR A C   1 
ATOM   3038  O  O   . TYR A  1  392  ? 37.696  -4.876   -44.053  1.00 110.21 ? 392  TYR A O   1 
ATOM   3039  C  CB  . TYR A  1  392  ? 36.466  -1.693   -43.565  1.00 124.16 ? 392  TYR A CB  1 
ATOM   3040  C  CG  . TYR A  1  392  ? 36.230  -0.392   -44.297  1.00 120.27 ? 392  TYR A CG  1 
ATOM   3041  C  CD1 . TYR A  1  392  ? 35.114  0.384    -44.043  1.00 143.43 ? 392  TYR A CD1 1 
ATOM   3042  C  CD2 . TYR A  1  392  ? 37.092  0.015    -45.298  1.00 159.53 ? 392  TYR A CD2 1 
ATOM   3043  C  CE1 . TYR A  1  392  ? 34.887  1.564    -44.758  1.00 126.34 ? 392  TYR A CE1 1 
ATOM   3044  C  CE2 . TYR A  1  392  ? 36.875  1.179    -46.011  1.00 154.97 ? 392  TYR A CE2 1 
ATOM   3045  C  CZ  . TYR A  1  392  ? 35.775  1.955    -45.743  1.00 152.83 ? 392  TYR A CZ  1 
ATOM   3046  O  OH  . TYR A  1  392  ? 35.570  3.120    -46.460  1.00 201.55 ? 392  TYR A OH  1 
ATOM   3047  N  N   . GLN A  1  393  ? 35.737  -4.639   -42.959  1.00 174.41 ? 393  GLN A N   1 
ATOM   3048  C  CA  . GLN A  1  393  ? 35.847  -5.899   -42.243  1.00 166.71 ? 393  GLN A CA  1 
ATOM   3049  C  C   . GLN A  1  393  ? 36.053  -7.034   -43.241  1.00 195.20 ? 393  GLN A C   1 
ATOM   3050  O  O   . GLN A  1  393  ? 36.980  -7.813   -43.109  1.00 168.78 ? 393  GLN A O   1 
ATOM   3051  C  CB  . GLN A  1  393  ? 34.593  -6.140   -41.404  1.00 156.85 ? 393  GLN A CB  1 
ATOM   3052  C  CG  . GLN A  1  393  ? 34.662  -7.378   -40.530  1.00 182.32 ? 393  GLN A CG  1 
ATOM   3053  C  CD  . GLN A  1  393  ? 33.459  -7.510   -39.620  1.00 171.29 ? 393  GLN A CD  1 
ATOM   3054  O  OE1 . GLN A  1  393  ? 33.140  -8.603   -39.145  1.00 143.11 ? 393  GLN A OE1 1 
ATOM   3055  N  NE2 . GLN A  1  393  ? 32.782  -6.397   -39.376  1.00 157.52 ? 393  GLN A NE2 1 
ATOM   3056  N  N   . LEU A  1  394  ? 35.197  -7.093   -44.252  1.00 94.66  ? 394  LEU A N   1 
ATOM   3057  C  CA  . LEU A  1  394  ? 35.198  -8.210   -45.181  1.00 96.88  ? 394  LEU A CA  1 
ATOM   3058  C  C   . LEU A  1  394  ? 36.470  -8.284   -45.982  1.00 95.12  ? 394  LEU A C   1 
ATOM   3059  O  O   . LEU A  1  394  ? 36.869  -9.342   -46.425  1.00 97.45  ? 394  LEU A O   1 
ATOM   3060  C  CB  . LEU A  1  394  ? 34.014  -8.109   -46.123  1.00 94.16  ? 394  LEU A CB  1 
ATOM   3061  C  CG  . LEU A  1  394  ? 33.565  -9.420   -46.744  1.00 93.89  ? 394  LEU A CG  1 
ATOM   3062  C  CD1 . LEU A  1  394  ? 32.161  -9.270   -47.231  1.00 95.72  ? 394  LEU A CD1 1 
ATOM   3063  C  CD2 . LEU A  1  394  ? 34.468  -9.852   -47.868  1.00 95.29  ? 394  LEU A CD2 1 
ATOM   3064  N  N   . GLN A  1  395  ? 37.097  -7.136   -46.209  1.00 95.34  ? 395  GLN A N   1 
ATOM   3065  C  CA  . GLN A  1  395  ? 38.300  -7.080   -47.032  1.00 112.23 ? 395  GLN A CA  1 
ATOM   3066  C  C   . GLN A  1  395  ? 39.470  -7.764   -46.337  1.00 108.72 ? 395  GLN A C   1 
ATOM   3067  O  O   . GLN A  1  395  ? 40.209  -8.540   -46.944  1.00 115.89 ? 395  GLN A O   1 
ATOM   3068  C  CB  . GLN A  1  395  ? 38.660  -5.629   -47.363  1.00 97.94  ? 395  GLN A CB  1 
ATOM   3069  C  CG  . GLN A  1  395  ? 39.769  -5.482   -48.392  1.00 145.20 ? 395  GLN A CG  1 
ATOM   3070  C  CD  . GLN A  1  395  ? 39.769  -4.120   -49.056  1.00 126.94 ? 395  GLN A CD  1 
ATOM   3071  O  OE1 . GLN A  1  395  ? 39.256  -3.147   -48.505  1.00 143.15 ? 395  GLN A OE1 1 
ATOM   3072  N  NE2 . GLN A  1  395  ? 40.347  -4.044   -50.249  1.00 145.21 ? 395  GLN A NE2 1 
ATOM   3073  N  N   . GLU A  1  396  ? 39.626  -7.462   -45.054  1.00 103.67 ? 396  GLU A N   1 
ATOM   3074  C  CA  . GLU A  1  396  ? 40.685  -8.028   -44.233  1.00 137.14 ? 396  GLU A CA  1 
ATOM   3075  C  C   . GLU A  1  396  ? 40.782  -9.512   -44.475  1.00 141.50 ? 396  GLU A C   1 
ATOM   3076  O  O   . GLU A  1  396  ? 41.880  -10.052  -44.571  1.00 177.26 ? 396  GLU A O   1 
ATOM   3077  C  CB  . GLU A  1  396  ? 40.416  -7.799   -42.751  1.00 172.35 ? 396  GLU A CB  1 
ATOM   3078  C  CG  . GLU A  1  396  ? 41.236  -8.736   -41.868  1.00 219.60 ? 396  GLU A CG  1 
ATOM   3079  C  CD  . GLU A  1  396  ? 40.525  -9.122   -40.585  1.00 227.39 ? 396  GLU A CD  1 
ATOM   3080  O  OE1 . GLU A  1  396  ? 41.044  -9.990   -39.847  1.00 204.91 ? 396  GLU A OE1 1 
ATOM   3081  O  OE2 . GLU A  1  396  ? 39.448  -8.553   -40.313  1.00 241.35 ? 396  GLU A OE2 1 
ATOM   3082  N  N   . LEU A  1  397  ? 39.629  -10.172  -44.565  1.00 98.59  ? 397  LEU A N   1 
ATOM   3083  C  CA  . LEU A  1  397  ? 39.603  -11.608  -44.804  1.00 96.48  ? 397  LEU A CA  1 
ATOM   3084  C  C   . LEU A  1  397  ? 40.411  -11.942  -46.066  1.00 109.68 ? 397  LEU A C   1 
ATOM   3085  O  O   . LEU A  1  397  ? 41.374  -12.715  -46.008  1.00 118.66 ? 397  LEU A O   1 
ATOM   3086  C  CB  . LEU A  1  397  ? 38.164  -12.131  -44.886  1.00 93.90  ? 397  LEU A CB  1 
ATOM   3087  C  CG  . LEU A  1  397  ? 37.321  -11.910  -43.616  1.00 93.89  ? 397  LEU A CG  1 
ATOM   3088  C  CD1 . LEU A  1  397  ? 35.867  -12.290  -43.777  1.00 90.21  ? 397  LEU A CD1 1 
ATOM   3089  C  CD2 . LEU A  1  397  ? 37.906  -12.657  -42.458  1.00 92.50  ? 397  LEU A CD2 1 
ATOM   3090  N  N   . VAL A  1  398  ? 40.047  -11.350  -47.196  1.00 94.80  ? 398  VAL A N   1 
ATOM   3091  C  CA  . VAL A  1  398  ? 40.753  -11.677  -48.414  1.00 98.40  ? 398  VAL A CA  1 
ATOM   3092  C  C   . VAL A  1  398  ? 42.250  -11.462  -48.259  1.00 98.39  ? 398  VAL A C   1 
ATOM   3093  O  O   . VAL A  1  398  ? 43.042  -12.348  -48.539  1.00 98.50  ? 398  VAL A O   1 
ATOM   3094  C  CB  . VAL A  1  398  ? 40.261  -10.847  -49.559  1.00 96.93  ? 398  VAL A CB  1 
ATOM   3095  C  CG1 . VAL A  1  398  ? 40.305  -11.655  -50.818  1.00 99.85  ? 398  VAL A CG1 1 
ATOM   3096  C  CG2 . VAL A  1  398  ? 38.863  -10.384  -49.284  1.00 96.33  ? 398  VAL A CG2 1 
ATOM   3097  N  N   . ARG A  1  399  ? 42.632  -10.285  -47.788  1.00 173.88 ? 399  ARG A N   1 
ATOM   3098  C  CA  . ARG A  1  399  ? 44.042  -9.916   -47.697  1.00 169.01 ? 399  ARG A CA  1 
ATOM   3099  C  C   . ARG A  1  399  ? 44.774  -10.915  -46.808  1.00 181.70 ? 399  ARG A C   1 
ATOM   3100  O  O   . ARG A  1  399  ? 46.001  -11.006  -46.828  1.00 248.11 ? 399  ARG A O   1 
ATOM   3101  C  CB  . ARG A  1  399  ? 44.205  -8.480   -47.170  1.00 232.48 ? 399  ARG A CB  1 
ATOM   3102  C  CG  . ARG A  1  399  ? 45.565  -7.825   -47.455  1.00 304.34 ? 399  ARG A CG  1 
ATOM   3103  C  CD  . ARG A  1  399  ? 45.737  -7.454   -48.930  1.00 328.23 ? 399  ARG A CD  1 
ATOM   3104  N  NE  . ARG A  1  399  ? 47.003  -6.772   -49.194  1.00 379.56 ? 399  ARG A NE  1 
ATOM   3105  C  CZ  . ARG A  1  399  ? 48.158  -7.392   -49.407  1.00 426.78 ? 399  ARG A CZ  1 
ATOM   3106  N  NH1 . ARG A  1  399  ? 48.217  -8.717   -49.393  1.00 403.13 ? 399  ARG A NH1 1 
ATOM   3107  N  NH2 . ARG A  1  399  ? 49.259  -6.691   -49.637  1.00 495.80 ? 399  ARG A NH2 1 
ATOM   3108  N  N   . ASN A  1  400  ? 44.007  -11.670  -46.028  1.00 195.09 ? 400  ASN A N   1 
ATOM   3109  C  CA  . ASN A  1  400  ? 44.574  -12.669  -45.130  1.00 174.89 ? 400  ASN A CA  1 
ATOM   3110  C  C   . ASN A  1  400  ? 45.021  -13.923  -45.874  1.00 173.45 ? 400  ASN A C   1 
ATOM   3111  O  O   . ASN A  1  400  ? 46.170  -14.349  -45.759  1.00 219.87 ? 400  ASN A O   1 
ATOM   3112  C  CB  . ASN A  1  400  ? 43.571  -13.038  -44.036  1.00 189.79 ? 400  ASN A CB  1 
ATOM   3113  C  CG  . ASN A  1  400  ? 43.370  -11.922  -43.028  1.00 166.43 ? 400  ASN A CG  1 
ATOM   3114  O  OD1 . ASN A  1  400  ? 44.231  -11.059  -42.865  1.00 219.71 ? 400  ASN A OD1 1 
ATOM   3115  N  ND2 . ASN A  1  400  ? 42.229  -11.938  -42.347  1.00 178.26 ? 400  ASN A ND2 1 
ATOM   3116  N  N   . GLY A  1  401  ? 44.105  -14.509  -46.641  1.00 154.80 ? 401  GLY A N   1 
ATOM   3117  C  CA  . GLY A  1  401  ? 44.402  -15.708  -47.400  1.00 150.16 ? 401  GLY A CA  1 
ATOM   3118  C  C   . GLY A  1  401  ? 43.430  -16.835  -47.113  1.00 131.96 ? 401  GLY A C   1 
ATOM   3119  O  O   . GLY A  1  401  ? 42.775  -16.852  -46.072  1.00 124.41 ? 401  GLY A O   1 
ATOM   3120  N  N   . PRO A  1  402  ? 43.337  -17.782  -48.042  1.00 112.34 ? 402  PRO A N   1 
ATOM   3121  C  CA  . PRO A  1  402  ? 42.438  -18.929  -47.886  1.00 102.43 ? 402  PRO A CA  1 
ATOM   3122  C  C   . PRO A  1  402  ? 43.063  -20.030  -47.037  1.00 101.51 ? 402  PRO A C   1 
ATOM   3123  O  O   . PRO A  1  402  ? 42.425  -21.051  -46.782  1.00 96.82  ? 402  PRO A O   1 
ATOM   3124  C  CB  . PRO A  1  402  ? 42.248  -19.417  -49.325  1.00 104.50 ? 402  PRO A CB  1 
ATOM   3125  C  CG  . PRO A  1  402  ? 43.499  -19.010  -50.020  1.00 108.86 ? 402  PRO A CG  1 
ATOM   3126  C  CD  . PRO A  1  402  ? 43.910  -17.707  -49.397  1.00 112.76 ? 402  PRO A CD  1 
ATOM   3127  N  N   . ASP A  1  403  ? 44.302  -19.818  -46.604  1.00 264.16 ? 403  ASP A N   1 
ATOM   3128  C  CA  . ASP A  1  403  ? 45.004  -20.795  -45.780  1.00 265.55 ? 403  ASP A CA  1 
ATOM   3129  C  C   . ASP A  1  403  ? 45.070  -20.340  -44.326  1.00 271.67 ? 403  ASP A C   1 
ATOM   3130  O  O   . ASP A  1  403  ? 45.727  -20.970  -43.497  1.00 278.91 ? 403  ASP A O   1 
ATOM   3131  C  CB  . ASP A  1  403  ? 46.415  -21.037  -46.320  1.00 148.07 ? 403  ASP A CB  1 
ATOM   3132  C  CG  . ASP A  1  403  ? 46.429  -21.972  -47.513  1.00 140.43 ? 403  ASP A CG  1 
ATOM   3133  O  OD1 . ASP A  1  403  ? 45.381  -22.588  -47.801  1.00 125.22 ? 403  ASP A OD1 1 
ATOM   3134  O  OD2 . ASP A  1  403  ? 47.488  -22.090  -48.165  1.00 149.39 ? 403  ASP A OD2 1 
ATOM   3135  N  N   . GLU A  1  404  ? 44.384  -19.242  -44.023  1.00 100.80 ? 404  GLU A N   1 
ATOM   3136  C  CA  . GLU A  1  404  ? 44.363  -18.700  -42.670  1.00 105.25 ? 404  GLU A CA  1 
ATOM   3137  C  C   . GLU A  1  404  ? 42.935  -18.561  -42.153  1.00 94.12  ? 404  GLU A C   1 
ATOM   3138  O  O   . GLU A  1  404  ? 42.282  -17.542  -42.375  1.00 94.02  ? 404  GLU A O   1 
ATOM   3139  C  CB  . GLU A  1  404  ? 45.074  -17.345  -42.625  1.00 91.66  ? 404  GLU A CB  1 
ATOM   3140  C  CG  . GLU A  1  404  ? 46.117  -17.228  -41.526  1.00 102.30 ? 404  GLU A CG  1 
ATOM   3141  C  CD  . GLU A  1  404  ? 46.780  -15.864  -41.496  1.00 119.36 ? 404  GLU A CD  1 
ATOM   3142  O  OE1 . GLU A  1  404  ? 46.060  -14.850  -41.611  1.00 117.84 ? 404  GLU A OE1 1 
ATOM   3143  O  OE2 . GLU A  1  404  ? 48.020  -15.806  -41.358  1.00 135.26 ? 404  GLU A OE2 1 
ATOM   3144  N  N   . HIS A  1  405  ? 42.458  -19.592  -41.465  1.00 193.82 ? 405  HIS A N   1 
ATOM   3145  C  CA  . HIS A  1  405  ? 41.106  -19.587  -40.917  1.00 179.54 ? 405  HIS A CA  1 
ATOM   3146  C  C   . HIS A  1  405  ? 40.375  -18.295  -41.264  1.00 178.50 ? 405  HIS A C   1 
ATOM   3147  O  O   . HIS A  1  405  ? 39.562  -18.260  -42.188  1.00 171.73 ? 405  HIS A O   1 
ATOM   3148  C  CB  . HIS A  1  405  ? 41.142  -19.779  -39.399  1.00 173.10 ? 405  HIS A CB  1 
ATOM   3149  C  CG  . HIS A  1  405  ? 39.788  -19.889  -38.771  1.00 159.39 ? 405  HIS A CG  1 
ATOM   3150  N  ND1 . HIS A  1  405  ? 38.809  -20.729  -39.255  1.00 148.69 ? 405  HIS A ND1 1 
ATOM   3151  C  CD2 . HIS A  1  405  ? 39.248  -19.261  -37.699  1.00 155.87 ? 405  HIS A CD2 1 
ATOM   3152  C  CE1 . HIS A  1  405  ? 37.725  -20.616  -38.507  1.00 139.74 ? 405  HIS A CE1 1 
ATOM   3153  N  NE2 . HIS A  1  405  ? 37.966  -19.733  -37.557  1.00 143.80 ? 405  HIS A NE2 1 
ATOM   3154  N  N   . PRO A  1  406  ? 40.668  -17.235  -40.517  1.00 123.01 ? 406  PRO A N   1 
ATOM   3155  C  CA  . PRO A  1  406  ? 40.035  -15.932  -40.747  1.00 121.98 ? 406  PRO A CA  1 
ATOM   3156  C  C   . PRO A  1  406  ? 40.318  -15.403  -42.148  1.00 128.12 ? 406  PRO A C   1 
ATOM   3157  O  O   . PRO A  1  406  ? 40.639  -14.226  -42.309  1.00 135.26 ? 406  PRO A O   1 
ATOM   3158  C  CB  . PRO A  1  406  ? 40.702  -15.036  -39.701  1.00 88.61  ? 406  PRO A CB  1 
ATOM   3159  C  CG  . PRO A  1  406  ? 41.079  -15.965  -38.604  1.00 89.58  ? 406  PRO A CG  1 
ATOM   3160  C  CD  . PRO A  1  406  ? 41.451  -17.259  -39.270  1.00 88.29  ? 406  PRO A CD  1 
ATOM   3161  N  N   . GLY A  1  407  ? 40.196  -16.271  -43.150  1.00 113.65 ? 407  GLY A N   1 
ATOM   3162  C  CA  . GLY A  1  407  ? 40.438  -15.883  -44.527  1.00 119.13 ? 407  GLY A CA  1 
ATOM   3163  C  C   . GLY A  1  407  ? 39.298  -16.273  -45.448  1.00 107.21 ? 407  GLY A C   1 
ATOM   3164  O  O   . GLY A  1  407  ? 38.207  -16.613  -44.990  1.00 95.76  ? 407  GLY A O   1 
ATOM   3165  N  N   . ALA A  1  408  ? 39.553  -16.224  -46.751  1.00 92.74  ? 408  ALA A N   1 
ATOM   3166  C  CA  . ALA A  1  408  ? 38.543  -16.573  -47.744  1.00 91.52  ? 408  ALA A CA  1 
ATOM   3167  C  C   . ALA A  1  408  ? 39.120  -17.201  -49.018  1.00 94.23  ? 408  ALA A C   1 
ATOM   3168  O  O   . ALA A  1  408  ? 40.331  -17.332  -49.179  1.00 94.84  ? 408  ALA A O   1 
ATOM   3169  C  CB  . ALA A  1  408  ? 37.745  -15.353  -48.097  1.00 94.39  ? 408  ALA A CB  1 
ATOM   3170  N  N   . LYS A  1  409  ? 38.226  -17.598  -49.915  1.00 123.18 ? 409  LYS A N   1 
ATOM   3171  C  CA  . LYS A  1  409  ? 38.585  -18.193  -51.199  1.00 123.35 ? 409  LYS A CA  1 
ATOM   3172  C  C   . LYS A  1  409  ? 37.651  -17.497  -52.160  1.00 121.06 ? 409  LYS A C   1 
ATOM   3173  O  O   . LYS A  1  409  ? 36.614  -17.004  -51.741  1.00 116.12 ? 409  LYS A O   1 
ATOM   3174  C  CB  . LYS A  1  409  ? 38.258  -19.677  -51.194  1.00 127.03 ? 409  LYS A CB  1 
ATOM   3175  C  CG  . LYS A  1  409  ? 38.808  -20.421  -49.987  1.00 126.23 ? 409  LYS A CG  1 
ATOM   3176  C  CD  . LYS A  1  409  ? 38.148  -21.793  -49.795  1.00 113.28 ? 409  LYS A CD  1 
ATOM   3177  C  CE  . LYS A  1  409  ? 38.308  -22.716  -51.006  1.00 110.61 ? 409  LYS A CE  1 
ATOM   3178  N  NZ  . LYS A  1  409  ? 37.527  -23.983  -50.847  1.00 98.20  ? 409  LYS A NZ  1 
ATOM   3179  N  N   . TYR A  1  410  ? 37.999  -17.418  -53.433  1.00 148.96 ? 410  TYR A N   1 
ATOM   3180  C  CA  . TYR A  1  410  ? 37.095  -16.793  -54.404  1.00 146.84 ? 410  TYR A CA  1 
ATOM   3181  C  C   . TYR A  1  410  ? 36.481  -15.409  -54.146  1.00 151.21 ? 410  TYR A C   1 
ATOM   3182  O  O   . TYR A  1  410  ? 36.003  -15.102  -53.054  1.00 148.94 ? 410  TYR A O   1 
ATOM   3183  C  CB  . TYR A  1  410  ? 35.951  -17.752  -54.684  1.00 158.75 ? 410  TYR A CB  1 
ATOM   3184  C  CG  . TYR A  1  410  ? 36.411  -19.067  -55.224  1.00 154.51 ? 410  TYR A CG  1 
ATOM   3185  C  CD1 . TYR A  1  410  ? 36.088  -20.248  -54.589  1.00 144.92 ? 410  TYR A CD1 1 
ATOM   3186  C  CD2 . TYR A  1  410  ? 37.183  -19.127  -56.376  1.00 160.79 ? 410  TYR A CD2 1 
ATOM   3187  C  CE1 . TYR A  1  410  ? 36.524  -21.471  -55.082  1.00 141.65 ? 410  TYR A CE1 1 
ATOM   3188  C  CE2 . TYR A  1  410  ? 37.627  -20.339  -56.884  1.00 157.58 ? 410  TYR A CE2 1 
ATOM   3189  C  CZ  . TYR A  1  410  ? 37.293  -21.512  -56.230  1.00 148.01 ? 410  TYR A CZ  1 
ATOM   3190  O  OH  . TYR A  1  410  ? 37.739  -22.723  -56.713  1.00 145.40 ? 410  TYR A OH  1 
ATOM   3191  N  N   . ILE A  1  411  ? 36.483  -14.577  -55.182  1.00 98.15  ? 411  ILE A N   1 
ATOM   3192  C  CA  . ILE A  1  411  ? 35.852  -13.257  -55.125  1.00 98.64  ? 411  ILE A CA  1 
ATOM   3193  C  C   . ILE A  1  411  ? 35.014  -13.108  -56.395  1.00 99.70  ? 411  ILE A C   1 
ATOM   3194  O  O   . ILE A  1  411  ? 35.531  -13.140  -57.509  1.00 101.45 ? 411  ILE A O   1 
ATOM   3195  C  CB  . ILE A  1  411  ? 36.900  -12.133  -55.014  1.00 101.26 ? 411  ILE A CB  1 
ATOM   3196  C  CG1 . ILE A  1  411  ? 37.604  -12.194  -53.658  1.00 99.03  ? 411  ILE A CG1 1 
ATOM   3197  C  CG2 . ILE A  1  411  ? 36.245  -10.775  -55.219  1.00 104.25 ? 411  ILE A CG2 1 
ATOM   3198  C  CD1 . ILE A  1  411  ? 38.820  -11.299  -53.559  1.00 104.64 ? 411  ILE A CD1 1 
ATOM   3199  N  N   . ILE A  1  412  ? 33.712  -12.946  -56.208  1.00 110.64 ? 412  ILE A N   1 
ATOM   3200  C  CA  . ILE A  1  412  ? 32.767  -12.840  -57.306  1.00 109.69 ? 412  ILE A CA  1 
ATOM   3201  C  C   . ILE A  1  412  ? 32.422  -11.406  -57.695  1.00 115.94 ? 412  ILE A C   1 
ATOM   3202  O  O   . ILE A  1  412  ? 32.144  -10.573  -56.831  1.00 119.91 ? 412  ILE A O   1 
ATOM   3203  C  CB  . ILE A  1  412  ? 31.512  -13.595  -56.925  1.00 120.11 ? 412  ILE A CB  1 
ATOM   3204  C  CG1 . ILE A  1  412  ? 31.920  -14.969  -56.387  1.00 112.31 ? 412  ILE A CG1 1 
ATOM   3205  C  CG2 . ILE A  1  412  ? 30.613  -13.746  -58.124  1.00 116.00 ? 412  ILE A CG2 1 
ATOM   3206  C  CD1 . ILE A  1  412  ? 30.779  -15.852  -55.937  1.00 100.70 ? 412  ILE A CD1 1 
ATOM   3207  N  N   . ARG A  1  413  ? 32.423  -11.128  -58.997  1.00 148.73 ? 413  ARG A N   1 
ATOM   3208  C  CA  . ARG A  1  413  ? 32.153  -9.785   -59.505  1.00 158.06 ? 413  ARG A CA  1 
ATOM   3209  C  C   . ARG A  1  413  ? 30.898  -9.631   -60.362  1.00 153.83 ? 413  ARG A C   1 
ATOM   3210  O  O   . ARG A  1  413  ? 30.286  -10.613  -60.787  1.00 143.93 ? 413  ARG A O   1 
ATOM   3211  C  CB  . ARG A  1  413  ? 33.341  -9.304   -60.323  1.00 212.69 ? 413  ARG A CB  1 
ATOM   3212  C  CG  . ARG A  1  413  ? 34.648  -9.335   -59.588  1.00 219.82 ? 413  ARG A CG  1 
ATOM   3213  C  CD  . ARG A  1  413  ? 35.772  -9.646   -60.553  1.00 225.96 ? 413  ARG A CD  1 
ATOM   3214  N  NE  . ARG A  1  413  ? 35.860  -8.661   -61.622  1.00 235.62 ? 413  ARG A NE  1 
ATOM   3215  C  CZ  . ARG A  1  413  ? 36.561  -8.834   -62.735  1.00 240.51 ? 413  ARG A CZ  1 
ATOM   3216  N  NH1 . ARG A  1  413  ? 37.235  -9.963   -62.928  1.00 236.75 ? 413  ARG A NH1 1 
ATOM   3217  N  NH2 . ARG A  1  413  ? 36.589  -7.880   -63.654  1.00 249.59 ? 413  ARG A NH2 1 
ATOM   3218  N  N   . ASP A  1  414  ? 30.551  -8.368   -60.621  1.00 183.66 ? 414  ASP A N   1 
ATOM   3219  C  CA  . ASP A  1  414  ? 29.392  -7.967   -61.424  1.00 182.70 ? 414  ASP A CA  1 
ATOM   3220  C  C   . ASP A  1  414  ? 29.118  -8.875   -62.626  1.00 175.63 ? 414  ASP A C   1 
ATOM   3221  O  O   . ASP A  1  414  ? 28.019  -9.409   -62.775  1.00 167.61 ? 414  ASP A O   1 
ATOM   3222  C  CB  . ASP A  1  414  ? 29.593  -6.527   -61.939  1.00 176.11 ? 414  ASP A CB  1 
ATOM   3223  C  CG  . ASP A  1  414  ? 29.417  -5.473   -60.855  1.00 183.21 ? 414  ASP A CG  1 
ATOM   3224  O  OD1 . ASP A  1  414  ? 30.092  -4.420   -60.936  1.00 195.47 ? 414  ASP A OD1 1 
ATOM   3225  O  OD2 . ASP A  1  414  ? 28.595  -5.678   -59.933  1.00 177.22 ? 414  ASP A OD2 1 
ATOM   3226  N  N   . THR A  1  415  ? 30.127  -9.027   -63.478  1.00 428.25 ? 415  THR A N   1 
ATOM   3227  C  CA  . THR A  1  415  ? 30.014  -9.843   -64.680  1.00 422.76 ? 415  THR A CA  1 
ATOM   3228  C  C   . THR A  1  415  ? 29.768  -11.322  -64.412  1.00 410.25 ? 415  THR A C   1 
ATOM   3229  O  O   . THR A  1  415  ? 29.276  -12.047  -65.283  1.00 403.98 ? 415  THR A O   1 
ATOM   3230  C  CB  . THR A  1  415  ? 31.283  -9.685   -65.537  1.00 150.80 ? 415  THR A CB  1 
ATOM   3231  O  OG1 . THR A  1  415  ? 32.425  -10.118  -64.787  1.00 152.50 ? 415  THR A OG1 1 
ATOM   3232  C  CG2 . THR A  1  415  ? 31.573  -8.214   -65.797  1.00 164.26 ? 415  THR A CG2 1 
ATOM   3233  N  N   . GLY A  1  416  ? 30.112  -11.759  -63.207  1.00 167.26 ? 416  GLY A N   1 
ATOM   3234  C  CA  . GLY A  1  416  ? 29.916  -13.152  -62.851  1.00 156.11 ? 416  GLY A CA  1 
ATOM   3235  C  C   . GLY A  1  416  ? 31.196  -13.944  -62.972  1.00 156.46 ? 416  GLY A C   1 
ATOM   3236  O  O   . GLY A  1  416  ? 31.174  -15.143  -63.237  1.00 148.58 ? 416  GLY A O   1 
ATOM   3237  N  N   . GLU A  1  417  ? 32.333  -13.279  -62.754  1.00 388.68 ? 417  GLU A N   1 
ATOM   3238  C  CA  . GLU A  1  417  ? 33.646  -13.918  -62.909  1.00 391.73 ? 417  GLU A CA  1 
ATOM   3239  C  C   . GLU A  1  417  ? 34.356  -14.212  -61.589  1.00 392.59 ? 417  GLU A C   1 
ATOM   3240  O  O   . GLU A  1  417  ? 34.408  -13.372  -60.706  1.00 397.86 ? 417  GLU A O   1 
ATOM   3241  C  CB  . GLU A  1  417  ? 34.560  -13.086  -63.813  1.00 194.27 ? 417  GLU A CB  1 
ATOM   3242  C  CG  . GLU A  1  417  ? 35.306  -13.907  -64.873  1.00 194.53 ? 417  GLU A CG  1 
ATOM   3243  C  CD  . GLU A  1  417  ? 35.513  -13.157  -66.191  1.00 202.73 ? 417  GLU A CD  1 
ATOM   3244  O  OE1 . GLU A  1  417  ? 36.258  -12.156  -66.204  1.00 215.25 ? 417  GLU A OE1 1 
ATOM   3245  O  OE2 . GLU A  1  417  ? 34.937  -13.574  -67.217  1.00 197.15 ? 417  GLU A OE2 1 
ATOM   3246  N  N   . ARG A  1  418  ? 34.848  -15.439  -61.463  1.00 172.22 ? 418  ARG A N   1 
ATOM   3247  C  CA  . ARG A  1  418  ? 35.402  -15.923  -60.206  1.00 171.35 ? 418  ARG A CA  1 
ATOM   3248  C  C   . ARG A  1  418  ? 36.900  -15.687  -60.095  1.00 183.31 ? 418  ARG A C   1 
ATOM   3249  O  O   . ARG A  1  418  ? 37.697  -16.306  -60.801  1.00 185.98 ? 418  ARG A O   1 
ATOM   3250  C  CB  . ARG A  1  418  ? 35.097  -17.413  -60.031  1.00 202.32 ? 418  ARG A CB  1 
ATOM   3251  C  CG  . ARG A  1  418  ? 33.621  -17.728  -59.858  1.00 191.17 ? 418  ARG A CG  1 
ATOM   3252  C  CD  . ARG A  1  418  ? 32.902  -17.757  -61.197  1.00 188.36 ? 418  ARG A CD  1 
ATOM   3253  N  NE  . ARG A  1  418  ? 31.498  -18.130  -61.057  1.00 178.84 ? 418  ARG A NE  1 
ATOM   3254  C  CZ  . ARG A  1  418  ? 30.646  -18.226  -62.072  1.00 175.48 ? 418  ARG A CZ  1 
ATOM   3255  N  NH1 . ARG A  1  418  ? 31.054  -17.981  -63.309  1.00 180.07 ? 418  ARG A NH1 1 
ATOM   3256  N  NH2 . ARG A  1  418  ? 29.384  -18.572  -61.851  1.00 168.14 ? 418  ARG A NH2 1 
ATOM   3257  N  N   . ILE A  1  419  ? 37.283  -14.783  -59.199  1.00 103.83 ? 419  ILE A N   1 
ATOM   3258  C  CA  . ILE A  1  419  ? 38.689  -14.459  -58.989  1.00 113.96 ? 419  ILE A CA  1 
ATOM   3259  C  C   . ILE A  1  419  ? 39.314  -15.369  -57.939  1.00 109.94 ? 419  ILE A C   1 
ATOM   3260  O  O   . ILE A  1  419  ? 39.548  -14.955  -56.803  1.00 107.27 ? 419  ILE A O   1 
ATOM   3261  C  CB  . ILE A  1  419  ? 38.871  -12.992  -58.557  1.00 198.55 ? 419  ILE A CB  1 
ATOM   3262  C  CG1 . ILE A  1  419  ? 38.549  -12.049  -59.718  1.00 204.20 ? 419  ILE A CG1 1 
ATOM   3263  C  CG2 . ILE A  1  419  ? 40.285  -12.757  -58.049  1.00 212.08 ? 419  ILE A CG2 1 
ATOM   3264  C  CD1 . ILE A  1  419  ? 38.582  -10.584  -59.342  1.00 215.82 ? 419  ILE A CD1 1 
ATOM   3265  N  N   . ASP A  1  420  ? 39.581  -16.612  -58.327  1.00 148.23 ? 420  ASP A N   1 
ATOM   3266  C  CA  . ASP A  1  420  ? 40.179  -17.586  -57.419  1.00 144.97 ? 420  ASP A CA  1 
ATOM   3267  C  C   . ASP A  1  420  ? 41.313  -16.965  -56.611  1.00 157.96 ? 420  ASP A C   1 
ATOM   3268  O  O   . ASP A  1  420  ? 42.294  -16.476  -57.172  1.00 170.42 ? 420  ASP A O   1 
ATOM   3269  C  CB  . ASP A  1  420  ? 40.691  -18.799  -58.197  1.00 170.02 ? 420  ASP A CB  1 
ATOM   3270  C  CG  . ASP A  1  420  ? 41.005  -19.978  -57.298  1.00 165.49 ? 420  ASP A CG  1 
ATOM   3271  O  OD1 . ASP A  1  420  ? 41.560  -19.759  -56.201  1.00 172.86 ? 420  ASP A OD1 1 
ATOM   3272  O  OD2 . ASP A  1  420  ? 40.697  -21.124  -57.687  1.00 155.20 ? 420  ASP A OD2 1 
ATOM   3273  N  N   . LEU A  1  421  ? 41.173  -16.989  -55.289  1.00 98.71  ? 421  LEU A N   1 
ATOM   3274  C  CA  . LEU A  1  421  ? 42.185  -16.430  -54.401  1.00 105.01 ? 421  LEU A CA  1 
ATOM   3275  C  C   . LEU A  1  421  ? 43.450  -17.281  -54.404  1.00 107.60 ? 421  LEU A C   1 
ATOM   3276  O  O   . LEU A  1  421  ? 44.535  -16.800  -54.077  1.00 114.95 ? 421  LEU A O   1 
ATOM   3277  C  CB  . LEU A  1  421  ? 41.639  -16.306  -52.977  1.00 114.60 ? 421  LEU A CB  1 
ATOM   3278  C  CG  . LEU A  1  421  ? 40.658  -15.158  -52.724  1.00 118.72 ? 421  LEU A CG  1 
ATOM   3279  C  CD1 . LEU A  1  421  ? 41.277  -14.112  -51.812  1.00 120.17 ? 421  LEU A CD1 1 
ATOM   3280  C  CD2 . LEU A  1  421  ? 40.210  -14.535  -54.037  1.00 133.95 ? 421  LEU A CD2 1 
ATOM   3281  N  N   . ARG A  1  422  ? 43.302  -18.548  -54.776  1.00 189.66 ? 422  ARG A N   1 
ATOM   3282  C  CA  . ARG A  1  422  ? 44.432  -19.468  -54.824  1.00 192.20 ? 422  ARG A CA  1 
ATOM   3283  C  C   . ARG A  1  422  ? 45.525  -18.952  -55.755  1.00 210.80 ? 422  ARG A C   1 
ATOM   3284  O  O   . ARG A  1  422  ? 45.666  -17.746  -55.953  1.00 221.60 ? 422  ARG A O   1 
ATOM   3285  C  CB  . ARG A  1  422  ? 43.974  -20.857  -55.273  1.00 180.90 ? 422  ARG A CB  1 
ATOM   3286  C  CG  . ARG A  1  422  ? 43.916  -21.884  -54.152  1.00 172.37 ? 422  ARG A CG  1 
ATOM   3287  C  CD  . ARG A  1  422  ? 42.551  -22.550  -54.084  1.00 157.66 ? 422  ARG A CD  1 
ATOM   3288  N  NE  . ARG A  1  422  ? 42.578  -23.907  -54.625  1.00 147.01 ? 422  ARG A NE  1 
ATOM   3289  C  CZ  . ARG A  1  422  ? 42.465  -25.006  -53.888  1.00 141.18 ? 422  ARG A CZ  1 
ATOM   3290  N  NH1 . ARG A  1  422  ? 42.316  -24.915  -52.573  1.00 145.02 ? 422  ARG A NH1 1 
ATOM   3291  N  NH2 . ARG A  1  422  ? 42.499  -26.200  -54.465  1.00 132.17 ? 422  ARG A NH2 1 
ATOM   3292  N  N   . TYR A  1  423  ? 46.295  -19.874  -56.323  1.00 246.28 ? 423  TYR A N   1 
ATOM   3293  C  CA  . TYR A  1  423  ? 47.375  -19.514  -57.234  1.00 264.86 ? 423  TYR A CA  1 
ATOM   3294  C  C   . TYR A  1  423  ? 46.992  -18.318  -58.099  1.00 273.04 ? 423  TYR A C   1 
ATOM   3295  O  O   . TYR A  1  423  ? 47.769  -17.375  -58.249  1.00 282.57 ? 423  TYR A O   1 
ATOM   3296  C  CB  . TYR A  1  423  ? 47.747  -20.705  -58.120  1.00 265.94 ? 423  TYR A CB  1 
ATOM   3297  C  CG  . TYR A  1  423  ? 47.899  -22.006  -57.367  1.00 255.12 ? 423  TYR A CG  1 
ATOM   3298  C  CD1 . TYR A  1  423  ? 49.128  -22.392  -56.846  1.00 262.29 ? 423  TYR A CD1 1 
ATOM   3299  C  CD2 . TYR A  1  423  ? 46.814  -22.851  -57.176  1.00 238.43 ? 423  TYR A CD2 1 
ATOM   3300  C  CE1 . TYR A  1  423  ? 49.271  -23.580  -56.155  1.00 252.83 ? 423  TYR A CE1 1 
ATOM   3301  C  CE2 . TYR A  1  423  ? 46.947  -24.042  -56.487  1.00 229.24 ? 423  TYR A CE2 1 
ATOM   3302  C  CZ  . TYR A  1  423  ? 48.179  -24.402  -55.979  1.00 236.33 ? 423  TYR A CZ  1 
ATOM   3303  O  OH  . TYR A  1  423  ? 48.316  -25.586  -55.293  1.00 227.53 ? 423  TYR A OH  1 
ATOM   3304  N  N   . HIS A  1  424  ? 45.790  -18.363  -58.663  1.00 207.06 ? 424  HIS A N   1 
ATOM   3305  C  CA  . HIS A  1  424  ? 45.302  -17.282  -59.511  1.00 214.31 ? 424  HIS A CA  1 
ATOM   3306  C  C   . HIS A  1  424  ? 45.621  -15.919  -58.908  1.00 219.32 ? 424  HIS A C   1 
ATOM   3307  O  O   . HIS A  1  424  ? 46.677  -15.344  -59.176  1.00 236.03 ? 424  HIS A O   1 
ATOM   3308  C  CB  . HIS A  1  424  ? 43.794  -17.417  -59.736  1.00 200.54 ? 424  HIS A CB  1 
ATOM   3309  C  CG  . HIS A  1  424  ? 43.433  -18.055  -61.041  1.00 200.76 ? 424  HIS A CG  1 
ATOM   3310  N  ND1 . HIS A  1  424  ? 42.519  -17.501  -61.913  1.00 214.79 ? 424  HIS A ND1 1 
ATOM   3311  C  CD2 . HIS A  1  424  ? 43.861  -19.199  -61.624  1.00 189.48 ? 424  HIS A CD2 1 
ATOM   3312  C  CE1 . HIS A  1  424  ? 42.401  -18.276  -62.975  1.00 211.92 ? 424  HIS A CE1 1 
ATOM   3313  N  NE2 . HIS A  1  424  ? 43.205  -19.314  -62.825  1.00 196.49 ? 424  HIS A NE2 1 
ATOM   3314  N  N   . LYS A  1  425  ? 44.704  -15.408  -58.094  1.00 394.87 ? 425  LYS A N   1 
ATOM   3315  C  CA  . LYS A  1  425  ? 44.887  -14.112  -57.452  1.00 398.47 ? 425  LYS A CA  1 
ATOM   3316  C  C   . LYS A  1  425  ? 46.157  -14.088  -56.609  1.00 411.99 ? 425  LYS A C   1 
ATOM   3317  O  O   . LYS A  1  425  ? 47.263  -13.976  -57.139  1.00 426.62 ? 425  LYS A O   1 
ATOM   3318  C  CB  . LYS A  1  425  ? 43.674  -13.768  -56.584  1.00 381.64 ? 425  LYS A CB  1 
ATOM   3319  C  CG  . LYS A  1  425  ? 43.394  -12.279  -56.470  1.00 372.17 ? 425  LYS A CG  1 
ATOM   3320  C  CD  . LYS A  1  425  ? 41.909  -11.984  -56.608  1.00 376.68 ? 425  LYS A CD  1 
ATOM   3321  C  CE  . LYS A  1  425  ? 41.634  -10.490  -56.549  1.00 377.36 ? 425  LYS A CE  1 
ATOM   3322  N  NZ  . LYS A  1  425  ? 40.471  -10.173  -55.675  1.00 377.86 ? 425  LYS A NZ  1 
ATOM   3323  N  N   . ARG A  1  426  ? 45.991  -14.195  -55.295  1.00 180.08 ? 426  ARG A N   1 
ATOM   3324  C  CA  . ARG A  1  426  ? 47.124  -14.185  -54.377  1.00 192.27 ? 426  ARG A CA  1 
ATOM   3325  C  C   . ARG A  1  426  ? 47.831  -12.834  -54.386  1.00 210.58 ? 426  ARG A C   1 
ATOM   3326  O  O   . ARG A  1  426  ? 48.989  -12.726  -53.985  1.00 224.98 ? 426  ARG A O   1 
ATOM   3327  C  CB  . ARG A  1  426  ? 48.111  -15.298  -54.732  1.00 198.22 ? 426  ARG A CB  1 
ATOM   3328  C  CG  . ARG A  1  426  ? 48.894  -15.837  -53.545  1.00 207.13 ? 426  ARG A CG  1 
ATOM   3329  C  CD  . ARG A  1  426  ? 47.984  -16.090  -52.353  1.00 192.23 ? 426  ARG A CD  1 
ATOM   3330  N  NE  . ARG A  1  426  ? 48.552  -15.572  -51.113  1.00 201.11 ? 426  ARG A NE  1 
ATOM   3331  C  CZ  . ARG A  1  426  ? 48.671  -16.280  -49.993  1.00 195.36 ? 426  ARG A CZ  1 
ATOM   3332  N  NH1 . ARG A  1  426  ? 48.262  -17.540  -49.957  1.00 180.94 ? 426  ARG A NH1 1 
ATOM   3333  N  NH2 . ARG A  1  426  ? 49.201  -15.726  -48.911  1.00 204.46 ? 426  ARG A NH2 1 
ATOM   3334  N  N   . ALA A  1  427  ? 47.126  -11.807  -54.849  1.00 172.59 ? 427  ALA A N   1 
ATOM   3335  C  CA  . ALA A  1  427  ? 47.683  -10.461  -54.912  1.00 189.93 ? 427  ALA A CA  1 
ATOM   3336  C  C   . ALA A  1  427  ? 46.647  -9.457   -55.401  1.00 184.69 ? 427  ALA A C   1 
ATOM   3337  O  O   . ALA A  1  427  ? 45.474  -9.531   -55.033  1.00 167.74 ? 427  ALA A O   1 
ATOM   3338  C  CB  . ALA A  1  427  ? 48.911  -10.438  -55.810  1.00 206.03 ? 427  ALA A CB  1 
ATOM   3339  N  N   . GLY A  1  428  ? 47.086  -8.515   -56.231  1.00 333.61 ? 428  GLY A N   1 
ATOM   3340  C  CA  . GLY A  1  428  ? 46.201  -7.498   -56.768  1.00 331.32 ? 428  GLY A CA  1 
ATOM   3341  C  C   . GLY A  1  428  ? 45.281  -6.913   -55.714  1.00 324.86 ? 428  GLY A C   1 
ATOM   3342  O  O   . GLY A  1  428  ? 44.187  -7.423   -55.480  1.00 307.81 ? 428  GLY A O   1 
ATOM   3343  N  N   . ASP A  1  429  ? 45.730  -5.838   -55.076  1.00 232.79 ? 429  ASP A N   1 
ATOM   3344  C  CA  . ASP A  1  429  ? 44.944  -5.178   -54.039  1.00 224.15 ? 429  ASP A CA  1 
ATOM   3345  C  C   . ASP A  1  429  ? 43.451  -5.279   -54.331  1.00 207.72 ? 429  ASP A C   1 
ATOM   3346  O  O   . ASP A  1  429  ? 42.635  -5.383   -53.415  1.00 212.30 ? 429  ASP A O   1 
ATOM   3347  C  CB  . ASP A  1  429  ? 45.355  -3.711   -53.909  1.00 250.58 ? 429  ASP A CB  1 
ATOM   3348  C  CG  . ASP A  1  429  ? 46.728  -3.542   -53.288  1.00 267.34 ? 429  ASP A CG  1 
ATOM   3349  O  OD1 . ASP A  1  429  ? 47.240  -4.520   -52.703  1.00 283.17 ? 429  ASP A OD1 1 
ATOM   3350  O  OD2 . ASP A  1  429  ? 47.296  -2.434   -53.384  1.00 264.74 ? 429  ASP A OD2 1 
ATOM   3351  N  N   . ILE A  1  430  ? 43.100  -5.251   -55.612  1.00 325.26 ? 430  ILE A N   1 
ATOM   3352  C  CA  . ILE A  1  430  ? 41.705  -5.337   -56.026  1.00 284.17 ? 430  ILE A CA  1 
ATOM   3353  C  C   . ILE A  1  430  ? 40.773  -4.874   -54.911  1.00 230.45 ? 430  ILE A C   1 
ATOM   3354  O  O   . ILE A  1  430  ? 39.832  -5.577   -54.543  1.00 185.72 ? 430  ILE A O   1 
ATOM   3355  C  CB  . ILE A  1  430  ? 41.325  -6.772   -56.437  1.00 157.31 ? 430  ILE A CB  1 
ATOM   3356  C  CG1 . ILE A  1  430  ? 41.077  -7.632   -55.196  1.00 142.25 ? 430  ILE A CG1 1 
ATOM   3357  C  CG2 . ILE A  1  430  ? 42.414  -7.383   -57.305  1.00 173.05 ? 430  ILE A CG2 1 
ATOM   3358  C  CD1 . ILE A  1  430  ? 42.205  -7.593   -54.188  1.00 146.98 ? 430  ILE A CD1 1 
ATOM   3359  N  N   . PRO A  1  431  ? 41.042  -3.686   -54.379  1.00 315.05 ? 431  PRO A N   1 
ATOM   3360  C  CA  . PRO A  1  431  ? 40.226  -3.125   -53.298  1.00 286.22 ? 431  PRO A CA  1 
ATOM   3361  C  C   . PRO A  1  431  ? 39.050  -4.031   -52.945  1.00 230.71 ? 431  PRO A C   1 
ATOM   3362  O  O   . PRO A  1  431  ? 39.204  -4.959   -52.151  1.00 261.42 ? 431  PRO A O   1 
ATOM   3363  C  CB  . PRO A  1  431  ? 39.718  -1.812   -53.895  1.00 314.77 ? 431  PRO A CB  1 
ATOM   3364  C  CG  . PRO A  1  431  ? 40.773  -1.418   -54.866  1.00 292.87 ? 431  PRO A CG  1 
ATOM   3365  C  CD  . PRO A  1  431  ? 41.307  -2.700   -55.441  1.00 276.85 ? 431  PRO A CD  1 
ATOM   3366  N  N   . LEU A  1  432  ? 37.890  -3.759   -53.533  1.00 126.17 ? 432  LEU A N   1 
ATOM   3367  C  CA  . LEU A  1  432  ? 36.696  -4.554   -53.276  1.00 123.21 ? 432  LEU A CA  1 
ATOM   3368  C  C   . LEU A  1  432  ? 35.432  -3.785   -53.643  1.00 123.52 ? 432  LEU A C   1 
ATOM   3369  O  O   . LEU A  1  432  ? 35.085  -2.797   -52.996  1.00 124.35 ? 432  LEU A O   1 
ATOM   3370  C  CB  . LEU A  1  432  ? 36.642  -4.981   -51.808  1.00 121.19 ? 432  LEU A CB  1 
ATOM   3371  C  CG  . LEU A  1  432  ? 37.110  -6.405   -51.498  1.00 119.09 ? 432  LEU A CG  1 
ATOM   3372  C  CD1 . LEU A  1  432  ? 37.637  -6.501   -50.074  1.00 118.41 ? 432  LEU A CD1 1 
ATOM   3373  C  CD2 . LEU A  1  432  ? 35.983  -7.401   -51.725  1.00 116.46 ? 432  LEU A CD2 1 
ATOM   3374  N  N   . ARG A  1  433  ? 34.749  -4.243   -54.686  1.00 276.00 ? 433  ARG A N   1 
ATOM   3375  C  CA  . ARG A  1  433  ? 33.522  -3.600   -55.142  1.00 276.44 ? 433  ARG A CA  1 
ATOM   3376  C  C   . ARG A  1  433  ? 32.610  -3.259   -53.969  1.00 275.26 ? 433  ARG A C   1 
ATOM   3377  O  O   . ARG A  1  433  ? 32.923  -3.563   -52.818  1.00 273.98 ? 433  ARG A O   1 
ATOM   3378  C  CB  . ARG A  1  433  ? 32.784  -4.498   -56.138  1.00 275.23 ? 433  ARG A CB  1 
ATOM   3379  C  CG  . ARG A  1  433  ? 31.895  -3.743   -57.113  1.00 276.79 ? 433  ARG A CG  1 
ATOM   3380  C  CD  . ARG A  1  433  ? 30.755  -4.617   -57.609  1.00 275.04 ? 433  ARG A CD  1 
ATOM   3381  N  NE  . ARG A  1  433  ? 29.934  -3.932   -58.605  1.00 276.72 ? 433  ARG A NE  1 
ATOM   3382  C  CZ  . ARG A  1  433  ? 28.673  -3.562   -58.407  1.00 276.56 ? 433  ARG A CZ  1 
ATOM   3383  N  NH1 . ARG A  1  433  ? 28.082  -3.811   -57.245  1.00 274.76 ? 433  ARG A NH1 1 
ATOM   3384  N  NH2 . ARG A  1  433  ? 28.003  -2.942   -59.369  1.00 278.33 ? 433  ARG A NH2 1 
ATOM   3385  N  N   . TYR A  1  434  ? 31.482  -2.624   -54.268  1.00 120.06 ? 434  TYR A N   1 
ATOM   3386  C  CA  . TYR A  1  434  ? 30.524  -2.238   -53.240  1.00 120.08 ? 434  TYR A CA  1 
ATOM   3387  C  C   . TYR A  1  434  ? 29.135  -2.789   -53.547  1.00 118.07 ? 434  TYR A C   1 
ATOM   3388  O  O   . TYR A  1  434  ? 28.125  -2.185   -53.189  1.00 116.56 ? 434  TYR A O   1 
ATOM   3389  C  CB  . TYR A  1  434  ? 30.467  -0.715   -53.105  1.00 128.34 ? 434  TYR A CB  1 
ATOM   3390  C  CG  . TYR A  1  434  ? 30.155  -0.235   -51.705  1.00 129.21 ? 434  TYR A CG  1 
ATOM   3391  C  CD1 . TYR A  1  434  ? 30.968  0.695    -51.072  1.00 132.15 ? 434  TYR A CD1 1 
ATOM   3392  C  CD2 . TYR A  1  434  ? 29.047  -0.712   -51.017  1.00 129.29 ? 434  TYR A CD2 1 
ATOM   3393  C  CE1 . TYR A  1  434  ? 30.687  1.138    -49.793  1.00 134.38 ? 434  TYR A CE1 1 
ATOM   3394  C  CE2 . TYR A  1  434  ? 28.757  -0.275   -49.738  1.00 145.93 ? 434  TYR A CE2 1 
ATOM   3395  C  CZ  . TYR A  1  434  ? 29.580  0.649    -49.131  1.00 130.45 ? 434  TYR A CZ  1 
ATOM   3396  O  OH  . TYR A  1  434  ? 29.296  1.086    -47.858  1.00 126.21 ? 434  TYR A OH  1 
ATOM   3397  N  N   . GLY A  1  435  ? 29.093  -3.940   -54.210  1.00 121.55 ? 435  GLY A N   1 
ATOM   3398  C  CA  . GLY A  1  435  ? 27.834  -4.568   -54.566  1.00 112.48 ? 435  GLY A CA  1 
ATOM   3399  C  C   . GLY A  1  435  ? 28.009  -5.999   -55.038  1.00 106.80 ? 435  GLY A C   1 
ATOM   3400  O  O   . GLY A  1  435  ? 27.030  -6.708   -55.272  1.00 105.34 ? 435  GLY A O   1 
ATOM   3401  N  N   . TRP A  1  436  ? 29.260  -6.424   -55.177  1.00 284.84 ? 436  TRP A N   1 
ATOM   3402  C  CA  . TRP A  1  436  ? 29.564  -7.778   -55.623  1.00 272.74 ? 436  TRP A CA  1 
ATOM   3403  C  C   . TRP A  1  436  ? 29.464  -8.776   -54.472  1.00 275.05 ? 436  TRP A C   1 
ATOM   3404  O  O   . TRP A  1  436  ? 28.946  -8.452   -53.403  1.00 265.95 ? 436  TRP A O   1 
ATOM   3405  C  CB  . TRP A  1  436  ? 30.957  -7.838   -56.253  1.00 271.84 ? 436  TRP A CB  1 
ATOM   3406  C  CG  . TRP A  1  436  ? 32.055  -7.416   -55.327  1.00 276.07 ? 436  TRP A CG  1 
ATOM   3407  C  CD1 . TRP A  1  436  ? 31.963  -7.228   -53.979  1.00 281.79 ? 436  TRP A CD1 1 
ATOM   3408  C  CD2 . TRP A  1  436  ? 33.413  -7.128   -55.680  1.00 285.66 ? 436  TRP A CD2 1 
ATOM   3409  N  NE1 . TRP A  1  436  ? 33.180  -6.840   -53.470  1.00 287.88 ? 436  TRP A NE1 1 
ATOM   3410  C  CE2 . TRP A  1  436  ? 34.086  -6.772   -54.495  1.00 287.47 ? 436  TRP A CE2 1 
ATOM   3411  C  CE3 . TRP A  1  436  ? 34.125  -7.136   -56.884  1.00 284.35 ? 436  TRP A CE3 1 
ATOM   3412  C  CZ2 . TRP A  1  436  ? 35.436  -6.428   -54.477  1.00 295.56 ? 436  TRP A CZ2 1 
ATOM   3413  C  CZ3 . TRP A  1  436  ? 35.465  -6.794   -56.864  1.00 284.88 ? 436  TRP A CZ3 1 
ATOM   3414  C  CH2 . TRP A  1  436  ? 36.106  -6.444   -55.670  1.00 294.22 ? 436  TRP A CH2 1 
ATOM   3415  N  N   . ARG A  1  437  ? 29.962  -9.987   -54.699  1.00 202.53 ? 437  ARG A N   1 
ATOM   3416  C  CA  . ARG A  1  437  ? 29.919  -11.032  -53.684  1.00 154.37 ? 437  ARG A CA  1 
ATOM   3417  C  C   . ARG A  1  437  ? 31.307  -11.602  -53.411  1.00 155.34 ? 437  ARG A C   1 
ATOM   3418  O  O   . ARG A  1  437  ? 32.171  -11.607  -54.287  1.00 161.20 ? 437  ARG A O   1 
ATOM   3419  C  CB  . ARG A  1  437  ? 28.967  -12.153  -54.110  1.00 144.96 ? 437  ARG A CB  1 
ATOM   3420  C  CG  . ARG A  1  437  ? 27.496  -11.776  -54.045  1.00 147.12 ? 437  ARG A CG  1 
ATOM   3421  C  CD  . ARG A  1  437  ? 26.624  -12.839  -54.689  1.00 116.04 ? 437  ARG A CD  1 
ATOM   3422  N  NE  . ARG A  1  437  ? 25.225  -12.718  -54.289  1.00 151.76 ? 437  ARG A NE  1 
ATOM   3423  C  CZ  . ARG A  1  437  ? 24.386  -13.743  -54.182  1.00 139.80 ? 437  ARG A CZ  1 
ATOM   3424  N  NH1 . ARG A  1  437  ? 24.802  -14.973  -54.448  1.00 164.57 ? 437  ARG A NH1 1 
ATOM   3425  N  NH2 . ARG A  1  437  ? 23.129  -13.538  -53.811  1.00 129.09 ? 437  ARG A NH2 1 
ATOM   3426  N  N   . VAL A  1  438  ? 31.512  -12.081  -52.188  1.00 114.63 ? 438  VAL A N   1 
ATOM   3427  C  CA  . VAL A  1  438  ? 32.789  -12.665  -51.795  1.00 120.79 ? 438  VAL A CA  1 
ATOM   3428  C  C   . VAL A  1  438  ? 32.576  -13.876  -50.894  1.00 109.51 ? 438  VAL A C   1 
ATOM   3429  O  O   . VAL A  1  438  ? 31.837  -13.808  -49.912  1.00 105.63 ? 438  VAL A O   1 
ATOM   3430  C  CB  . VAL A  1  438  ? 33.677  -11.641  -51.065  1.00 110.75 ? 438  VAL A CB  1 
ATOM   3431  C  CG1 . VAL A  1  438  ? 34.760  -12.350  -50.267  1.00 148.90 ? 438  VAL A CG1 1 
ATOM   3432  C  CG2 . VAL A  1  438  ? 34.289  -10.665  -52.058  1.00 169.02 ? 438  VAL A CG2 1 
ATOM   3433  N  N   . GLU A  1  439  ? 33.228  -14.984  -51.233  1.00 115.03 ? 439  GLU A N   1 
ATOM   3434  C  CA  . GLU A  1  439  ? 33.091  -16.232  -50.450  1.00 98.66  ? 439  GLU A CA  1 
ATOM   3435  C  C   . GLU A  1  439  ? 34.131  -16.370  -49.324  1.00 104.41 ? 439  GLU A C   1 
ATOM   3436  O  O   . GLU A  1  439  ? 35.338  -16.402  -49.564  1.00 118.95 ? 439  GLU A O   1 
ATOM   3437  C  CB  . GLU A  1  439  ? 33.173  -17.458  -51.374  1.00 93.57  ? 439  GLU A CB  1 
ATOM   3438  C  CG  . GLU A  1  439  ? 31.889  -17.798  -52.137  1.00 93.22  ? 439  GLU A CG  1 
ATOM   3439  C  CD  . GLU A  1  439  ? 32.070  -18.929  -53.151  1.00 95.59  ? 439  GLU A CD  1 
ATOM   3440  O  OE1 . GLU A  1  439  ? 33.197  -19.446  -53.285  1.00 111.70 ? 439  GLU A OE1 1 
ATOM   3441  O  OE2 . GLU A  1  439  ? 31.082  -19.293  -53.825  1.00 114.84 ? 439  GLU A OE2 1 
ATOM   3442  N  N   . ARG A  1  440  ? 33.666  -16.490  -48.094  1.00 90.56  ? 440  ARG A N   1 
ATOM   3443  C  CA  . ARG A  1  440  ? 34.578  -16.500  -46.957  1.00 90.74  ? 440  ARG A CA  1 
ATOM   3444  C  C   . ARG A  1  440  ? 34.683  -17.894  -46.338  1.00 89.28  ? 440  ARG A C   1 
ATOM   3445  O  O   . ARG A  1  440  ? 33.983  -18.800  -46.746  1.00 90.49  ? 440  ARG A O   1 
ATOM   3446  C  CB  . ARG A  1  440  ? 34.058  -15.531  -45.908  1.00 91.22  ? 440  ARG A CB  1 
ATOM   3447  C  CG  . ARG A  1  440  ? 32.763  -15.964  -45.275  1.00 88.93  ? 440  ARG A CG  1 
ATOM   3448  C  CD  . ARG A  1  440  ? 32.318  -14.973  -44.260  1.00 88.66  ? 440  ARG A CD  1 
ATOM   3449  N  NE  . ARG A  1  440  ? 31.672  -15.583  -43.106  1.00 87.84  ? 440  ARG A NE  1 
ATOM   3450  C  CZ  . ARG A  1  440  ? 31.334  -14.901  -42.011  1.00 87.53  ? 440  ARG A CZ  1 
ATOM   3451  N  NH1 . ARG A  1  440  ? 31.594  -13.595  -41.945  1.00 88.95  ? 440  ARG A NH1 1 
ATOM   3452  N  NH2 . ARG A  1  440  ? 30.747  -15.510  -40.983  1.00 86.40  ? 440  ARG A NH2 1 
ATOM   3453  N  N   . HIS A  1  441  ? 35.545  -18.083  -45.349  1.00 88.53  ? 441  HIS A N   1 
ATOM   3454  C  CA  . HIS A  1  441  ? 35.479  -19.314  -44.592  1.00 88.04  ? 441  HIS A CA  1 
ATOM   3455  C  C   . HIS A  1  441  ? 34.392  -19.167  -43.548  1.00 86.84  ? 441  HIS A C   1 
ATOM   3456  O  O   . HIS A  1  441  ? 33.796  -18.109  -43.431  1.00 86.58  ? 441  HIS A O   1 
ATOM   3457  C  CB  . HIS A  1  441  ? 36.777  -19.571  -43.880  1.00 87.72  ? 441  HIS A CB  1 
ATOM   3458  C  CG  . HIS A  1  441  ? 37.899  -19.941  -44.782  1.00 90.10  ? 441  HIS A CG  1 
ATOM   3459  N  ND1 . HIS A  1  441  ? 38.789  -19.012  -45.276  1.00 88.78  ? 441  HIS A ND1 1 
ATOM   3460  C  CD2 . HIS A  1  441  ? 38.333  -21.146  -45.243  1.00 89.03  ? 441  HIS A CD2 1 
ATOM   3461  C  CE1 . HIS A  1  441  ? 39.703  -19.618  -46.009  1.00 91.70  ? 441  HIS A CE1 1 
ATOM   3462  N  NE2 . HIS A  1  441  ? 39.444  -20.914  -46.010  1.00 89.67  ? 441  HIS A NE2 1 
ATOM   3463  N  N   . ILE A  1  442  ? 34.139  -20.226  -42.788  1.00 86.20  ? 442  ILE A N   1 
ATOM   3464  C  CA  . ILE A  1  442  ? 33.160  -20.207  -41.694  1.00 86.80  ? 442  ILE A CA  1 
ATOM   3465  C  C   . ILE A  1  442  ? 33.880  -19.928  -40.371  1.00 85.22  ? 442  ILE A C   1 
ATOM   3466  O  O   . ILE A  1  442  ? 35.057  -20.254  -40.240  1.00 87.01  ? 442  ILE A O   1 
ATOM   3467  C  CB  . ILE A  1  442  ? 32.442  -21.535  -41.621  1.00 84.29  ? 442  ILE A CB  1 
ATOM   3468  C  CG1 . ILE A  1  442  ? 33.452  -22.639  -41.866  1.00 86.31  ? 442  ILE A CG1 1 
ATOM   3469  C  CG2 . ILE A  1  442  ? 31.369  -21.629  -42.675  1.00 86.29  ? 442  ILE A CG2 1 
ATOM   3470  C  CD1 . ILE A  1  442  ? 32.817  -23.946  -42.182  1.00 84.07  ? 442  ILE A CD1 1 
ATOM   3471  N  N   . ARG A  1  443  ? 33.183  -19.353  -39.396  1.00 106.67 ? 443  ARG A N   1 
ATOM   3472  C  CA  . ARG A  1  443  ? 33.877  -18.777  -38.233  1.00 84.90  ? 443  ARG A CA  1 
ATOM   3473  C  C   . ARG A  1  443  ? 33.177  -18.840  -36.861  1.00 82.60  ? 443  ARG A C   1 
ATOM   3474  O  O   . ARG A  1  443  ? 33.717  -19.323  -35.855  1.00 94.27  ? 443  ARG A O   1 
ATOM   3475  C  CB  . ARG A  1  443  ? 34.281  -17.327  -38.538  1.00 106.78 ? 443  ARG A CB  1 
ATOM   3476  C  CG  . ARG A  1  443  ? 33.136  -16.363  -38.922  1.00 111.25 ? 443  ARG A CG  1 
ATOM   3477  C  CD  . ARG A  1  443  ? 33.679  -14.955  -39.147  1.00 104.09 ? 443  ARG A CD  1 
ATOM   3478  N  NE  . ARG A  1  443  ? 32.635  -13.944  -39.298  1.00 123.42 ? 443  ARG A NE  1 
ATOM   3479  C  CZ  . ARG A  1  443  ? 32.867  -12.635  -39.220  1.00 158.02 ? 443  ARG A CZ  1 
ATOM   3480  N  NH1 . ARG A  1  443  ? 34.098  -12.186  -38.977  1.00 183.05 ? 443  ARG A NH1 1 
ATOM   3481  N  NH2 . ARG A  1  443  ? 31.869  -11.773  -39.372  1.00 145.34 ? 443  ARG A NH2 1 
ATOM   3482  N  N   . ASP A  1  444  ? 31.981  -18.305  -36.788  1.00 147.14 ? 444  ASP A N   1 
ATOM   3483  C  CA  . ASP A  1  444  ? 31.296  -18.303  -35.519  1.00 134.79 ? 444  ASP A CA  1 
ATOM   3484  C  C   . ASP A  1  444  ? 29.829  -18.288  -35.805  1.00 141.94 ? 444  ASP A C   1 
ATOM   3485  O  O   . ASP A  1  444  ? 29.334  -17.399  -36.489  1.00 201.80 ? 444  ASP A O   1 
ATOM   3486  C  CB  . ASP A  1  444  ? 31.675  -17.080  -34.693  1.00 204.04 ? 444  ASP A CB  1 
ATOM   3487  C  CG  . ASP A  1  444  ? 30.787  -16.912  -33.473  1.00 234.41 ? 444  ASP A CG  1 
ATOM   3488  O  OD1 . ASP A  1  444  ? 30.297  -17.938  -32.950  1.00 234.45 ? 444  ASP A OD1 1 
ATOM   3489  O  OD2 . ASP A  1  444  ? 30.570  -15.762  -33.035  1.00 243.30 ? 444  ASP A OD2 1 
ATOM   3490  N  N   . GLY A  1  445  ? 29.151  -19.288  -35.276  1.00 108.51 ? 445  GLY A N   1 
ATOM   3491  C  CA  . GLY A  1  445  ? 27.738  -19.498  -35.503  1.00 112.92 ? 445  GLY A CA  1 
ATOM   3492  C  C   . GLY A  1  445  ? 27.045  -18.218  -35.864  1.00 112.39 ? 445  GLY A C   1 
ATOM   3493  O  O   . GLY A  1  445  ? 26.659  -17.450  -34.980  1.00 139.00 ? 445  GLY A O   1 
ATOM   3494  N  N   . ASP A  1  446  ? 26.869  -17.976  -37.158  1.00 85.66  ? 446  ASP A N   1 
ATOM   3495  C  CA  . ASP A  1  446  ? 27.179  -18.924  -38.256  1.00 83.46  ? 446  ASP A CA  1 
ATOM   3496  C  C   . ASP A  1  446  ? 26.546  -20.313  -38.156  1.00 82.00  ? 446  ASP A C   1 
ATOM   3497  O  O   . ASP A  1  446  ? 27.224  -21.307  -38.011  1.00 81.22  ? 446  ASP A O   1 
ATOM   3498  C  CB  . ASP A  1  446  ? 28.677  -19.012  -38.555  1.00 83.56  ? 446  ASP A CB  1 
ATOM   3499  C  CG  . ASP A  1  446  ? 28.942  -19.047  -40.023  1.00 84.20  ? 446  ASP A CG  1 
ATOM   3500  O  OD1 . ASP A  1  446  ? 27.973  -19.344  -40.764  1.00 84.83  ? 446  ASP A OD1 1 
ATOM   3501  O  OD2 . ASP A  1  446  ? 30.077  -18.754  -40.439  1.00 86.43  ? 446  ASP A OD2 1 
ATOM   3502  N  N   . VAL A  1  447  ? 25.229  -20.360  -38.245  1.00 82.34  ? 447  VAL A N   1 
ATOM   3503  C  CA  . VAL A  1  447  ? 24.518  -21.589  -38.021  1.00 81.72  ? 447  VAL A CA  1 
ATOM   3504  C  C   . VAL A  1  447  ? 24.801  -22.530  -39.156  1.00 91.27  ? 447  VAL A C   1 
ATOM   3505  O  O   . VAL A  1  447  ? 25.202  -22.086  -40.219  1.00 83.49  ? 447  VAL A O   1 
ATOM   3506  C  CB  . VAL A  1  447  ? 23.023  -21.326  -37.938  1.00 82.27  ? 447  VAL A CB  1 
ATOM   3507  C  CG1 . VAL A  1  447  ? 22.683  -20.706  -36.589  1.00 96.60  ? 447  VAL A CG1 1 
ATOM   3508  C  CG2 . VAL A  1  447  ? 22.596  -20.412  -39.047  1.00 88.50  ? 447  VAL A CG2 1 
ATOM   3509  N  N   . VAL A  1  448  ? 24.592  -23.825  -38.892  1.00 81.57  ? 448  VAL A N   1 
ATOM   3510  C  CA  . VAL A  1  448  ? 24.776  -24.911  -39.849  1.00 81.78  ? 448  VAL A CA  1 
ATOM   3511  C  C   . VAL A  1  448  ? 24.031  -26.104  -39.314  1.00 80.12  ? 448  VAL A C   1 
ATOM   3512  O  O   . VAL A  1  448  ? 23.924  -26.256  -38.106  1.00 79.67  ? 448  VAL A O   1 
ATOM   3513  C  CB  . VAL A  1  448  ? 26.228  -25.336  -39.917  1.00 82.64  ? 448  VAL A CB  1 
ATOM   3514  C  CG1 . VAL A  1  448  ? 26.681  -25.745  -38.562  1.00 80.89  ? 448  VAL A CG1 1 
ATOM   3515  C  CG2 . VAL A  1  448  ? 26.375  -26.473  -40.874  1.00 80.88  ? 448  VAL A CG2 1 
ATOM   3516  N  N   . ILE A  1  449  ? 23.532  -26.956  -40.206  1.00 80.57  ? 449  ILE A N   1 
ATOM   3517  C  CA  . ILE A  1  449  ? 22.727  -28.104  -39.798  1.00 81.80  ? 449  ILE A CA  1 
ATOM   3518  C  C   . ILE A  1  449  ? 23.449  -29.438  -39.868  1.00 81.48  ? 449  ILE A C   1 
ATOM   3519  O  O   . ILE A  1  449  ? 24.181  -29.727  -40.808  1.00 81.45  ? 449  ILE A O   1 
ATOM   3520  C  CB  . ILE A  1  449  ? 21.493  -28.254  -40.640  1.00 80.70  ? 449  ILE A CB  1 
ATOM   3521  C  CG1 . ILE A  1  449  ? 21.889  -28.391  -42.091  1.00 81.15  ? 449  ILE A CG1 1 
ATOM   3522  C  CG2 . ILE A  1  449  ? 20.586  -27.075  -40.472  1.00 82.04  ? 449  ILE A CG2 1 
ATOM   3523  C  CD1 . ILE A  1  449  ? 20.743  -28.241  -42.991  1.00 82.34  ? 449  ILE A CD1 1 
ATOM   3524  N  N   . PHE A  1  450  ? 23.163  -30.269  -38.876  1.00 82.07  ? 450  PHE A N   1 
ATOM   3525  C  CA  . PHE A  1  450  ? 23.934  -31.449  -38.561  1.00 81.50  ? 450  PHE A CA  1 
ATOM   3526  C  C   . PHE A  1  450  ? 22.927  -32.574  -38.482  1.00 80.83  ? 450  PHE A C   1 
ATOM   3527  O  O   . PHE A  1  450  ? 21.935  -32.435  -37.769  1.00 79.80  ? 450  PHE A O   1 
ATOM   3528  C  CB  . PHE A  1  450  ? 24.487  -31.221  -37.174  1.00 80.33  ? 450  PHE A CB  1 
ATOM   3529  C  CG  . PHE A  1  450  ? 25.732  -31.948  -36.898  1.00 77.69  ? 450  PHE A CG  1 
ATOM   3530  C  CD1 . PHE A  1  450  ? 26.827  -31.796  -37.718  1.00 81.08  ? 450  PHE A CD1 1 
ATOM   3531  C  CD2 . PHE A  1  450  ? 25.828  -32.770  -35.802  1.00 77.06  ? 450  PHE A CD2 1 
ATOM   3532  C  CE1 . PHE A  1  450  ? 28.014  -32.475  -37.463  1.00 80.32  ? 450  PHE A CE1 1 
ATOM   3533  C  CE2 . PHE A  1  450  ? 27.003  -33.471  -35.537  1.00 77.26  ? 450  PHE A CE2 1 
ATOM   3534  C  CZ  . PHE A  1  450  ? 28.104  -33.321  -36.372  1.00 78.48  ? 450  PHE A CZ  1 
ATOM   3535  N  N   . ASN A  1  451  ? 23.153  -33.668  -39.208  1.00 80.25  ? 451  ASN A N   1 
ATOM   3536  C  CA  . ASN A  1  451  ? 22.253  -34.832  -39.149  1.00 78.78  ? 451  ASN A CA  1 
ATOM   3537  C  C   . ASN A  1  451  ? 22.979  -36.157  -38.913  1.00 77.90  ? 451  ASN A C   1 
ATOM   3538  O  O   . ASN A  1  451  ? 24.214  -36.228  -38.983  1.00 78.05  ? 451  ASN A O   1 
ATOM   3539  C  CB  . ASN A  1  451  ? 21.423  -34.960  -40.425  1.00 79.61  ? 451  ASN A CB  1 
ATOM   3540  C  CG  . ASN A  1  451  ? 22.260  -35.397  -41.615  1.00 79.58  ? 451  ASN A CG  1 
ATOM   3541  O  OD1 . ASN A  1  451  ? 23.466  -35.160  -41.638  1.00 79.43  ? 451  ASN A OD1 1 
ATOM   3542  N  ND2 . ASN A  1  451  ? 21.633  -36.041  -42.605  1.00 79.91  ? 451  ASN A ND2 1 
ATOM   3543  N  N   . ARG A  1  452  ? 22.200  -37.214  -38.651  1.00 172.77 ? 452  ARG A N   1 
ATOM   3544  C  CA  . ARG A  1  452  ? 22.743  -38.569  -38.522  1.00 169.31 ? 452  ARG A CA  1 
ATOM   3545  C  C   . ARG A  1  452  ? 21.901  -39.549  -39.320  1.00 128.31 ? 452  ARG A C   1 
ATOM   3546  O  O   . ARG A  1  452  ? 20.734  -39.765  -38.995  1.00 129.70 ? 452  ARG A O   1 
ATOM   3547  C  CB  . ARG A  1  452  ? 22.781  -39.014  -37.057  1.00 165.10 ? 452  ARG A CB  1 
ATOM   3548  C  CG  . ARG A  1  452  ? 23.871  -40.048  -36.754  1.00 164.17 ? 452  ARG A CG  1 
ATOM   3549  C  CD  . ARG A  1  452  ? 23.463  -41.470  -37.140  1.00 139.06 ? 452  ARG A CD  1 
ATOM   3550  N  NE  . ARG A  1  452  ? 24.600  -42.280  -37.590  1.00 169.79 ? 452  ARG A NE  1 
ATOM   3551  C  CZ  . ARG A  1  452  ? 25.243  -43.168  -36.832  1.00 136.36 ? 452  ARG A CZ  1 
ATOM   3552  N  NH1 . ARG A  1  452  ? 24.863  -43.376  -35.573  1.00 151.75 ? 452  ARG A NH1 1 
ATOM   3553  N  NH2 . ARG A  1  452  ? 26.266  -43.852  -37.345  1.00 120.28 ? 452  ARG A NH2 1 
ATOM   3554  N  N   . GLN A  1  453  ? 22.481  -40.122  -40.371  1.00 152.00 ? 453  GLN A N   1 
ATOM   3555  C  CA  . GLN A  1  453  ? 21.833  -41.206  -41.085  1.00 129.33 ? 453  GLN A CA  1 
ATOM   3556  C  C   . GLN A  1  453  ? 21.898  -42.409  -40.156  1.00 128.65 ? 453  GLN A C   1 
ATOM   3557  O  O   . GLN A  1  453  ? 22.992  -42.769  -39.720  1.00 169.87 ? 453  GLN A O   1 
ATOM   3558  C  CB  . GLN A  1  453  ? 22.569  -41.506  -42.399  1.00 130.96 ? 453  GLN A CB  1 
ATOM   3559  C  CG  . GLN A  1  453  ? 22.796  -40.281  -43.301  1.00 164.33 ? 453  GLN A CG  1 
ATOM   3560  C  CD  . GLN A  1  453  ? 23.157  -40.630  -44.743  1.00 179.44 ? 453  GLN A CD  1 
ATOM   3561  O  OE1 . GLN A  1  453  ? 23.443  -41.781  -45.063  1.00 221.76 ? 453  GLN A OE1 1 
ATOM   3562  N  NE2 . GLN A  1  453  ? 23.145  -39.628  -45.620  1.00 137.95 ? 453  GLN A NE2 1 
ATOM   3563  N  N   . PRO A  1  454  ? 20.747  -43.048  -39.849  1.00 80.27  ? 454  PRO A N   1 
ATOM   3564  C  CA  . PRO A  1  454  ? 19.373  -42.880  -40.336  1.00 88.02  ? 454  PRO A CA  1 
ATOM   3565  C  C   . PRO A  1  454  ? 18.591  -41.861  -39.532  1.00 100.86 ? 454  PRO A C   1 
ATOM   3566  O  O   . PRO A  1  454  ? 18.540  -41.949  -38.311  1.00 129.21 ? 454  PRO A O   1 
ATOM   3567  C  CB  . PRO A  1  454  ? 18.746  -44.260  -40.094  1.00 121.03 ? 454  PRO A CB  1 
ATOM   3568  C  CG  . PRO A  1  454  ? 19.843  -45.126  -39.524  1.00 79.45  ? 454  PRO A CG  1 
ATOM   3569  C  CD  . PRO A  1  454  ? 20.814  -44.183  -38.923  1.00 84.09  ? 454  PRO A CD  1 
ATOM   3570  N  N   . SER A  1  455  ? 17.956  -40.923  -40.226  1.00 103.48 ? 455  SER A N   1 
ATOM   3571  C  CA  . SER A  1  455  ? 17.297  -39.801  -39.582  1.00 91.21  ? 455  SER A CA  1 
ATOM   3572  C  C   . SER A  1  455  ? 15.794  -39.969  -39.526  1.00 103.41 ? 455  SER A C   1 
ATOM   3573  O  O   . SER A  1  455  ? 15.068  -39.431  -40.357  1.00 126.66 ? 455  SER A O   1 
ATOM   3574  C  CB  . SER A  1  455  ? 17.630  -38.535  -40.343  1.00 115.08 ? 455  SER A CB  1 
ATOM   3575  O  OG  . SER A  1  455  ? 17.329  -38.687  -41.715  1.00 153.94 ? 455  SER A OG  1 
ATOM   3576  N  N   . LEU A  1  456  ? 15.331  -40.708  -38.525  1.00 83.41  ? 456  LEU A N   1 
ATOM   3577  C  CA  . LEU A  1  456  ? 13.904  -40.959  -38.360  1.00 103.58 ? 456  LEU A CA  1 
ATOM   3578  C  C   . LEU A  1  456  ? 13.151  -39.788  -37.725  1.00 121.49 ? 456  LEU A C   1 
ATOM   3579  O  O   . LEU A  1  456  ? 12.193  -39.276  -38.308  1.00 114.92 ? 456  LEU A O   1 
ATOM   3580  C  CB  . LEU A  1  456  ? 13.682  -42.214  -37.531  1.00 80.11  ? 456  LEU A CB  1 
ATOM   3581  C  CG  . LEU A  1  456  ? 14.618  -43.359  -37.865  1.00 77.83  ? 456  LEU A CG  1 
ATOM   3582  C  CD1 . LEU A  1  456  ? 14.193  -44.615  -37.107  1.00 115.89 ? 456  LEU A CD1 1 
ATOM   3583  C  CD2 . LEU A  1  456  ? 14.605  -43.570  -39.356  1.00 78.43  ? 456  LEU A CD2 1 
ATOM   3584  N  N   . HIS A  1  457  ? 13.574  -39.373  -36.525  1.00 147.03 ? 457  HIS A N   1 
ATOM   3585  C  CA  . HIS A  1  457  ? 12.882  -38.327  -35.764  1.00 124.53 ? 457  HIS A CA  1 
ATOM   3586  C  C   . HIS A  1  457  ? 12.945  -36.998  -36.519  1.00 120.05 ? 457  HIS A C   1 
ATOM   3587  O  O   . HIS A  1  457  ? 13.889  -36.756  -37.274  1.00 173.93 ? 457  HIS A O   1 
ATOM   3588  C  CB  . HIS A  1  457  ? 13.507  -38.112  -34.363  1.00 182.98 ? 457  HIS A CB  1 
ATOM   3589  C  CG  . HIS A  1  457  ? 13.538  -39.333  -33.478  1.00 161.13 ? 457  HIS A CG  1 
ATOM   3590  N  ND1 . HIS A  1  457  ? 14.403  -40.385  -33.682  1.00 195.01 ? 457  HIS A ND1 1 
ATOM   3591  C  CD2 . HIS A  1  457  ? 12.861  -39.625  -32.340  1.00 152.20 ? 457  HIS A CD2 1 
ATOM   3592  C  CE1 . HIS A  1  457  ? 14.228  -41.297  -32.738  1.00 174.60 ? 457  HIS A CE1 1 
ATOM   3593  N  NE2 . HIS A  1  457  ? 13.295  -40.861  -31.910  1.00 130.15 ? 457  HIS A NE2 1 
ATOM   3594  N  N   . LYS A  1  458  ? 11.961  -36.134  -36.309  1.00 99.08  ? 458  LYS A N   1 
ATOM   3595  C  CA  . LYS A  1  458  ? 12.048  -34.765  -36.814  1.00 78.97  ? 458  LYS A CA  1 
ATOM   3596  C  C   . LYS A  1  458  ? 13.421  -34.155  -36.546  1.00 92.73  ? 458  LYS A C   1 
ATOM   3597  O  O   . LYS A  1  458  ? 13.933  -33.404  -37.342  1.00 91.86  ? 458  LYS A O   1 
ATOM   3598  C  CB  . LYS A  1  458  ? 10.971  -33.890  -36.164  1.00 83.63  ? 458  LYS A CB  1 
ATOM   3599  C  CG  . LYS A  1  458  ? 11.197  -32.375  -36.266  1.00 80.65  ? 458  LYS A CG  1 
ATOM   3600  C  CD  . LYS A  1  458  ? 10.248  -31.652  -35.318  1.00 120.83 ? 458  LYS A CD  1 
ATOM   3601  C  CE  . LYS A  1  458  ? 9.724   -30.338  -35.858  1.00 83.90  ? 458  LYS A CE  1 
ATOM   3602  N  NZ  . LYS A  1  458  ? 9.094   -29.510  -34.784  1.00 134.59 ? 458  LYS A NZ  1 
ATOM   3603  N  N   . MET A  1  459  ? 14.017  -34.496  -35.415  1.00 131.35 ? 459  MET A N   1 
ATOM   3604  C  CA  . MET A  1  459  ? 15.237  -33.839  -34.995  1.00 129.06 ? 459  MET A CA  1 
ATOM   3605  C  C   . MET A  1  459  ? 16.486  -34.685  -35.191  1.00 119.03 ? 459  MET A C   1 
ATOM   3606  O  O   . MET A  1  459  ? 17.354  -34.699  -34.325  1.00 107.46 ? 459  MET A O   1 
ATOM   3607  C  CB  . MET A  1  459  ? 15.138  -33.444  -33.530  1.00 103.96 ? 459  MET A CB  1 
ATOM   3608  C  CG  . MET A  1  459  ? 15.006  -34.619  -32.586  1.00 114.16 ? 459  MET A CG  1 
ATOM   3609  S  SD  . MET A  1  459  ? 13.317  -35.242  -32.519  1.00 119.99 ? 459  MET A SD  1 
ATOM   3610  C  CE  . MET A  1  459  ? 12.429  -33.679  -32.510  1.00 101.77 ? 459  MET A CE  1 
ATOM   3611  N  N   . SER A  1  460  ? 16.593  -35.394  -36.304  1.00 172.80 ? 460  SER A N   1 
ATOM   3612  C  CA  . SER A  1  460  ? 17.894  -35.956  -36.620  1.00 160.03 ? 460  SER A CA  1 
ATOM   3613  C  C   . SER A  1  460  ? 18.709  -34.953  -37.444  1.00 159.53 ? 460  SER A C   1 
ATOM   3614  O  O   . SER A  1  460  ? 19.899  -35.162  -37.674  1.00 113.23 ? 460  SER A O   1 
ATOM   3615  C  CB  . SER A  1  460  ? 17.782  -37.302  -37.329  1.00 134.03 ? 460  SER A CB  1 
ATOM   3616  O  OG  . SER A  1  460  ? 17.902  -38.389  -36.411  1.00 129.07 ? 460  SER A OG  1 
ATOM   3617  N  N   . MET A  1  461  ? 18.055  -33.874  -37.878  1.00 78.99  ? 461  MET A N   1 
ATOM   3618  C  CA  . MET A  1  461  ? 18.696  -32.725  -38.506  1.00 80.40  ? 461  MET A CA  1 
ATOM   3619  C  C   . MET A  1  461  ? 18.275  -31.545  -37.693  1.00 78.36  ? 461  MET A C   1 
ATOM   3620  O  O   . MET A  1  461  ? 17.143  -31.098  -37.806  1.00 78.75  ? 461  MET A O   1 
ATOM   3621  C  CB  . MET A  1  461  ? 18.121  -32.476  -39.891  1.00 81.01  ? 461  MET A CB  1 
ATOM   3622  C  CG  . MET A  1  461  ? 18.744  -33.243  -41.020  1.00 79.57  ? 461  MET A CG  1 
ATOM   3623  S  SD  . MET A  1  461  ? 18.250  -32.563  -42.581  1.00 81.53  ? 461  MET A SD  1 
ATOM   3624  C  CE  . MET A  1  461  ? 16.501  -32.901  -42.639  1.00 85.18  ? 461  MET A CE  1 
ATOM   3625  N  N   . MET A  1  462  ? 19.151  -31.033  -36.855  1.00 78.70  ? 462  MET A N   1 
ATOM   3626  C  CA  . MET A  1  462  ? 18.827  -29.802  -36.180  1.00 79.85  ? 462  MET A CA  1 
ATOM   3627  C  C   . MET A  1  462  ? 19.997  -28.879  -36.370  1.00 80.09  ? 462  MET A C   1 
ATOM   3628  O  O   . MET A  1  462  ? 21.042  -29.320  -36.822  1.00 78.27  ? 462  MET A O   1 
ATOM   3629  C  CB  . MET A  1  462  ? 18.523  -30.053  -34.717  1.00 79.07  ? 462  MET A CB  1 
ATOM   3630  C  CG  . MET A  1  462  ? 19.466  -31.015  -34.030  1.00 77.39  ? 462  MET A CG  1 
ATOM   3631  S  SD  . MET A  1  462  ? 18.668  -31.786  -32.605  1.00 77.18  ? 462  MET A SD  1 
ATOM   3632  C  CE  . MET A  1  462  ? 17.668  -30.476  -31.949  1.00 77.38  ? 462  MET A CE  1 
ATOM   3633  N  N   . GLY A  1  463  ? 19.827  -27.609  -36.038  1.00 79.44  ? 463  GLY A N   1 
ATOM   3634  C  CA  . GLY A  1  463  ? 20.826  -26.627  -36.386  1.00 79.86  ? 463  GLY A CA  1 
ATOM   3635  C  C   . GLY A  1  463  ? 21.594  -26.062  -35.218  1.00 79.41  ? 463  GLY A C   1 
ATOM   3636  O  O   . GLY A  1  463  ? 20.992  -25.535  -34.297  1.00 79.74  ? 463  GLY A O   1 
ATOM   3637  N  N   . HIS A  1  464  ? 22.923  -26.147  -35.300  1.00 83.18  ? 464  HIS A N   1 
ATOM   3638  C  CA  . HIS A  1  464  ? 23.856  -25.702  -34.262  1.00 83.83  ? 464  HIS A CA  1 
ATOM   3639  C  C   . HIS A  1  464  ? 24.547  -24.381  -34.611  1.00 84.60  ? 464  HIS A C   1 
ATOM   3640  O  O   . HIS A  1  464  ? 24.185  -23.720  -35.561  1.00 86.50  ? 464  HIS A O   1 
ATOM   3641  C  CB  . HIS A  1  464  ? 24.936  -26.767  -34.066  1.00 82.66  ? 464  HIS A CB  1 
ATOM   3642  C  CG  . HIS A  1  464  ? 24.414  -28.099  -33.632  1.00 82.38  ? 464  HIS A CG  1 
ATOM   3643  N  ND1 . HIS A  1  464  ? 23.802  -28.978  -34.492  1.00 82.16  ? 464  HIS A ND1 1 
ATOM   3644  C  CD2 . HIS A  1  464  ? 24.420  -28.700  -32.418  1.00 80.13  ? 464  HIS A CD2 1 
ATOM   3645  C  CE1 . HIS A  1  464  ? 23.449  -30.071  -33.830  1.00 79.58  ? 464  HIS A CE1 1 
ATOM   3646  N  NE2 . HIS A  1  464  ? 23.814  -29.920  -32.565  1.00 80.92  ? 464  HIS A NE2 1 
ATOM   3647  N  N   . ARG A  1  465  ? 25.557  -23.992  -33.842  1.00 81.18  ? 465  ARG A N   1 
ATOM   3648  C  CA  . ARG A  1  465  ? 26.385  -22.860  -34.238  1.00 83.10  ? 465  ARG A CA  1 
ATOM   3649  C  C   . ARG A  1  465  ? 27.844  -23.273  -34.238  1.00 84.48  ? 465  ARG A C   1 
ATOM   3650  O  O   . ARG A  1  465  ? 28.398  -23.541  -33.201  1.00 84.82  ? 465  ARG A O   1 
ATOM   3651  C  CB  . ARG A  1  465  ? 26.179  -21.692  -33.284  1.00 86.67  ? 465  ARG A CB  1 
ATOM   3652  C  CG  . ARG A  1  465  ? 24.756  -21.093  -33.303  1.00 80.76  ? 465  ARG A CG  1 
ATOM   3653  C  CD  . ARG A  1  465  ? 24.477  -20.159  -32.099  1.00 80.65  ? 465  ARG A CD  1 
ATOM   3654  N  NE  . ARG A  1  465  ? 25.494  -19.110  -31.977  1.00 120.01 ? 465  ARG A NE  1 
ATOM   3655  C  CZ  . ARG A  1  465  ? 26.407  -19.037  -31.002  1.00 85.63  ? 465  ARG A CZ  1 
ATOM   3656  N  NH1 . ARG A  1  465  ? 26.436  -19.945  -30.025  1.00 84.70  ? 465  ARG A NH1 1 
ATOM   3657  N  NH2 . ARG A  1  465  ? 27.292  -18.044  -30.988  1.00 134.51 ? 465  ARG A NH2 1 
ATOM   3658  N  N   . ILE A  1  466  ? 28.459  -23.327  -35.406  1.00 81.24  ? 466  ILE A N   1 
ATOM   3659  C  CA  . ILE A  1  466  ? 29.828  -23.805  -35.552  1.00 81.28  ? 466  ILE A CA  1 
ATOM   3660  C  C   . ILE A  1  466  ? 30.801  -23.208  -34.568  1.00 80.11  ? 466  ILE A C   1 
ATOM   3661  O  O   . ILE A  1  466  ? 30.456  -22.851  -33.449  1.00 80.32  ? 466  ILE A O   1 
ATOM   3662  C  CB  . ILE A  1  466  ? 30.371  -23.486  -36.940  1.00 83.01  ? 466  ILE A CB  1 
ATOM   3663  C  CG1 . ILE A  1  466  ? 30.079  -22.011  -37.275  1.00 83.52  ? 466  ILE A CG1 1 
ATOM   3664  C  CG2 . ILE A  1  466  ? 29.737  -24.421  -37.955  1.00 81.62  ? 466  ILE A CG2 1 
ATOM   3665  C  CD1 . ILE A  1  466  ? 31.224  -21.213  -37.933  1.00 82.15  ? 466  ILE A CD1 1 
ATOM   3666  N  N   . ARG A  1  467  ? 32.048  -23.114  -35.004  1.00 150.87 ? 467  ARG A N   1 
ATOM   3667  C  CA  . ARG A  1  467  ? 33.098  -22.577  -34.169  1.00 115.67 ? 467  ARG A CA  1 
ATOM   3668  C  C   . ARG A  1  467  ? 33.495  -23.633  -33.150  1.00 149.78 ? 467  ARG A C   1 
ATOM   3669  O  O   . ARG A  1  467  ? 32.794  -23.825  -32.165  1.00 91.13  ? 467  ARG A O   1 
ATOM   3670  C  CB  . ARG A  1  467  ? 32.640  -21.267  -33.496  1.00 146.02 ? 467  ARG A CB  1 
ATOM   3671  C  CG  . ARG A  1  467  ? 33.684  -20.580  -32.630  1.00 163.83 ? 467  ARG A CG  1 
ATOM   3672  C  CD  . ARG A  1  467  ? 33.590  -21.076  -31.204  1.00 145.37 ? 467  ARG A CD  1 
ATOM   3673  N  NE  . ARG A  1  467  ? 34.671  -20.568  -30.375  1.00 158.15 ? 467  ARG A NE  1 
ATOM   3674  C  CZ  . ARG A  1  467  ? 34.960  -21.067  -29.183  1.00 129.59 ? 467  ARG A CZ  1 
ATOM   3675  N  NH1 . ARG A  1  467  ? 34.246  -22.081  -28.718  1.00 167.88 ? 467  ARG A NH1 1 
ATOM   3676  N  NH2 . ARG A  1  467  ? 35.953  -20.566  -28.461  1.00 163.50 ? 467  ARG A NH2 1 
ATOM   3677  N  N   . VAL A  1  468  ? 34.625  -24.311  -33.367  1.00 81.54  ? 468  VAL A N   1 
ATOM   3678  C  CA  . VAL A  1  468  ? 35.550  -24.039  -34.470  1.00 80.19  ? 468  VAL A CA  1 
ATOM   3679  C  C   . VAL A  1  468  ? 36.846  -24.731  -34.157  1.00 80.09  ? 468  VAL A C   1 
ATOM   3680  O  O   . VAL A  1  468  ? 37.791  -24.635  -34.933  1.00 80.85  ? 468  VAL A O   1 
ATOM   3681  C  CB  . VAL A  1  468  ? 35.921  -22.560  -34.640  1.00 81.15  ? 468  VAL A CB  1 
ATOM   3682  C  CG1 . VAL A  1  468  ? 36.779  -22.059  -33.433  1.00 81.61  ? 468  VAL A CG1 1 
ATOM   3683  C  CG2 . VAL A  1  468  ? 36.639  -22.365  -35.955  1.00 83.15  ? 468  VAL A CG2 1 
ATOM   3684  N  N   . MET A  1  469  ? 36.871  -25.407  -33.014  1.00 112.95 ? 469  MET A N   1 
ATOM   3685  C  CA  . MET A  1  469  ? 38.053  -26.072  -32.442  1.00 125.20 ? 469  MET A CA  1 
ATOM   3686  C  C   . MET A  1  469  ? 39.096  -26.772  -33.395  1.00 119.11 ? 469  MET A C   1 
ATOM   3687  O  O   . MET A  1  469  ? 38.914  -26.767  -34.598  1.00 124.29 ? 469  MET A O   1 
ATOM   3688  C  CB  . MET A  1  469  ? 37.539  -26.987  -31.322  1.00 106.05 ? 469  MET A CB  1 
ATOM   3689  C  CG  . MET A  1  469  ? 36.917  -26.206  -30.143  1.00 106.74 ? 469  MET A CG  1 
ATOM   3690  S  SD  . MET A  1  469  ? 37.954  -24.825  -29.498  1.00 92.42  ? 469  MET A SD  1 
ATOM   3691  C  CE  . MET A  1  469  ? 37.152  -24.255  -27.977  1.00 113.97 ? 469  MET A CE  1 
ATOM   3692  N  N   . PRO A  1  470  ? 40.205  -27.321  -32.857  1.00 80.95  ? 470  PRO A N   1 
ATOM   3693  C  CA  . PRO A  1  470  ? 41.112  -28.130  -33.671  1.00 81.24  ? 470  PRO A CA  1 
ATOM   3694  C  C   . PRO A  1  470  ? 40.990  -29.613  -33.414  1.00 79.84  ? 470  PRO A C   1 
ATOM   3695  O  O   . PRO A  1  470  ? 40.178  -30.003  -32.591  1.00 80.84  ? 470  PRO A O   1 
ATOM   3696  C  CB  . PRO A  1  470  ? 42.479  -27.689  -33.195  1.00 81.85  ? 470  PRO A CB  1 
ATOM   3697  C  CG  . PRO A  1  470  ? 42.261  -26.552  -32.282  1.00 81.69  ? 470  PRO A CG  1 
ATOM   3698  C  CD  . PRO A  1  470  ? 40.913  -26.766  -31.710  1.00 80.12  ? 470  PRO A CD  1 
ATOM   3699  N  N   . TYR A  1  471  ? 41.808  -30.420  -34.091  1.00 91.96  ? 471  TYR A N   1 
ATOM   3700  C  CA  . TYR A  1  471  ? 41.656  -31.884  -34.088  1.00 81.76  ? 471  TYR A CA  1 
ATOM   3701  C  C   . TYR A  1  471  ? 40.486  -32.261  -34.971  1.00 90.08  ? 471  TYR A C   1 
ATOM   3702  O  O   . TYR A  1  471  ? 39.479  -31.577  -34.991  1.00 80.48  ? 471  TYR A O   1 
ATOM   3703  C  CB  . TYR A  1  471  ? 41.389  -32.410  -32.687  1.00 85.16  ? 471  TYR A CB  1 
ATOM   3704  C  CG  . TYR A  1  471  ? 42.450  -32.130  -31.658  1.00 96.23  ? 471  TYR A CG  1 
ATOM   3705  C  CD1 . TYR A  1  471  ? 42.343  -31.054  -30.795  1.00 86.45  ? 471  TYR A CD1 1 
ATOM   3706  C  CD2 . TYR A  1  471  ? 43.542  -32.962  -31.520  1.00 95.91  ? 471  TYR A CD2 1 
ATOM   3707  C  CE1 . TYR A  1  471  ? 43.295  -30.812  -29.826  1.00 87.09  ? 471  TYR A CE1 1 
ATOM   3708  C  CE2 . TYR A  1  471  ? 44.513  -32.720  -30.557  1.00 85.18  ? 471  TYR A CE2 1 
ATOM   3709  C  CZ  . TYR A  1  471  ? 44.377  -31.641  -29.714  1.00 84.85  ? 471  TYR A CZ  1 
ATOM   3710  O  OH  . TYR A  1  471  ? 45.331  -31.391  -28.755  1.00 84.40  ? 471  TYR A OH  1 
ATOM   3711  N  N   . SER A  1  472  ? 40.572  -33.378  -35.657  1.00 79.47  ? 472  SER A N   1 
ATOM   3712  C  CA  . SER A  1  472  ? 39.683  -33.587  -36.778  1.00 83.14  ? 472  SER A CA  1 
ATOM   3713  C  C   . SER A  1  472  ? 38.372  -34.284  -36.579  1.00 81.48  ? 472  SER A C   1 
ATOM   3714  O  O   . SER A  1  472  ? 37.944  -35.015  -37.444  1.00 79.33  ? 472  SER A O   1 
ATOM   3715  C  CB  . SER A  1  472  ? 40.438  -34.305  -37.860  1.00 82.37  ? 472  SER A CB  1 
ATOM   3716  O  OG  . SER A  1  472  ? 41.691  -34.702  -37.335  1.00 82.78  ? 472  SER A OG  1 
ATOM   3717  N  N   . THR A  1  473  ? 37.690  -34.014  -35.494  1.00 78.61  ? 473  THR A N   1 
ATOM   3718  C  CA  . THR A  1  473  ? 36.384  -34.610  -35.335  1.00 79.03  ? 473  THR A CA  1 
ATOM   3719  C  C   . THR A  1  473  ? 35.405  -33.526  -35.018  1.00 77.47  ? 473  THR A C   1 
ATOM   3720  O  O   . THR A  1  473  ? 35.797  -32.433  -34.671  1.00 79.66  ? 473  THR A O   1 
ATOM   3721  C  CB  . THR A  1  473  ? 36.340  -35.499  -34.149  1.00 78.43  ? 473  THR A CB  1 
ATOM   3722  O  OG1 . THR A  1  473  ? 35.929  -34.716  -33.027  1.00 80.09  ? 473  THR A OG1 1 
ATOM   3723  C  CG2 . THR A  1  473  ? 37.708  -36.079  -33.860  1.00 80.70  ? 473  THR A CG2 1 
ATOM   3724  N  N   . PHE A  1  474  ? 34.129  -33.862  -35.085  1.00 79.39  ? 474  PHE A N   1 
ATOM   3725  C  CA  . PHE A  1  474  ? 33.072  -32.971  -34.655  1.00 78.17  ? 474  PHE A CA  1 
ATOM   3726  C  C   . PHE A  1  474  ? 32.803  -33.017  -33.148  1.00 77.36  ? 474  PHE A C   1 
ATOM   3727  O  O   . PHE A  1  474  ? 32.161  -33.942  -32.685  1.00 78.44  ? 474  PHE A O   1 
ATOM   3728  C  CB  . PHE A  1  474  ? 31.795  -33.382  -35.335  1.00 78.76  ? 474  PHE A CB  1 
ATOM   3729  C  CG  . PHE A  1  474  ? 31.751  -33.027  -36.723  1.00 80.07  ? 474  PHE A CG  1 
ATOM   3730  C  CD1 . PHE A  1  474  ? 31.650  -31.734  -37.095  1.00 78.61  ? 474  PHE A CD1 1 
ATOM   3731  C  CD2 . PHE A  1  474  ? 31.793  -33.984  -37.667  1.00 79.97  ? 474  PHE A CD2 1 
ATOM   3732  C  CE1 . PHE A  1  474  ? 31.603  -31.386  -38.401  1.00 81.49  ? 474  PHE A CE1 1 
ATOM   3733  C  CE2 . PHE A  1  474  ? 31.738  -33.659  -38.987  1.00 80.71  ? 474  PHE A CE2 1 
ATOM   3734  C  CZ  . PHE A  1  474  ? 31.649  -32.341  -39.358  1.00 81.72  ? 474  PHE A CZ  1 
ATOM   3735  N  N   . ARG A  1  475  ? 33.232  -32.038  -32.367  1.00 77.58  ? 475  ARG A N   1 
ATOM   3736  C  CA  . ARG A  1  475  ? 32.831  -32.074  -30.977  1.00 78.20  ? 475  ARG A CA  1 
ATOM   3737  C  C   . ARG A  1  475  ? 31.366  -31.677  -30.919  1.00 76.35  ? 475  ARG A C   1 
ATOM   3738  O  O   . ARG A  1  475  ? 30.975  -30.696  -31.522  1.00 76.45  ? 475  ARG A O   1 
ATOM   3739  C  CB  . ARG A  1  475  ? 33.704  -31.153  -30.144  1.00 76.18  ? 475  ARG A CB  1 
ATOM   3740  C  CG  . ARG A  1  475  ? 34.944  -31.803  -29.473  1.00 76.19  ? 475  ARG A CG  1 
ATOM   3741  C  CD  . ARG A  1  475  ? 35.798  -32.738  -30.336  1.00 76.67  ? 475  ARG A CD  1 
ATOM   3742  N  NE  . ARG A  1  475  ? 36.300  -32.168  -31.580  1.00 78.27  ? 475  ARG A NE  1 
ATOM   3743  C  CZ  . ARG A  1  475  ? 37.130  -31.148  -31.650  1.00 77.90  ? 475  ARG A CZ  1 
ATOM   3744  N  NH1 . ARG A  1  475  ? 37.541  -30.545  -30.547  1.00 77.33  ? 475  ARG A NH1 1 
ATOM   3745  N  NH2 . ARG A  1  475  ? 37.550  -30.735  -32.826  1.00 79.44  ? 475  ARG A NH2 1 
ATOM   3746  N  N   . LEU A  1  476  ? 30.552  -32.477  -30.252  1.00 75.74  ? 476  LEU A N   1 
ATOM   3747  C  CA  . LEU A  1  476  ? 29.178  -32.081  -29.954  1.00 77.93  ? 476  LEU A CA  1 
ATOM   3748  C  C   . LEU A  1  476  ? 28.759  -32.378  -28.499  1.00 77.20  ? 476  LEU A C   1 
ATOM   3749  O  O   . LEU A  1  476  ? 29.507  -32.995  -27.740  1.00 77.08  ? 476  LEU A O   1 
ATOM   3750  C  CB  . LEU A  1  476  ? 28.172  -32.580  -30.992  1.00 76.53  ? 476  LEU A CB  1 
ATOM   3751  C  CG  . LEU A  1  476  ? 27.896  -34.058  -31.195  1.00 76.43  ? 476  LEU A CG  1 
ATOM   3752  C  CD1 . LEU A  1  476  ? 27.631  -34.703  -29.877  1.00 75.64  ? 476  LEU A CD1 1 
ATOM   3753  C  CD2 . LEU A  1  476  ? 26.700  -34.243  -32.089  1.00 76.22  ? 476  LEU A CD2 1 
ATOM   3754  N  N   . ASN A  1  477  ? 27.574  -31.900  -28.111  1.00 75.29  ? 477  ASN A N   1 
ATOM   3755  C  CA  . ASN A  1  477  ? 27.189  -31.827  -26.697  1.00 76.66  ? 477  ASN A CA  1 
ATOM   3756  C  C   . ASN A  1  477  ? 26.467  -33.050  -26.187  1.00 76.11  ? 477  ASN A C   1 
ATOM   3757  O  O   . ASN A  1  477  ? 25.417  -33.379  -26.701  1.00 75.29  ? 477  ASN A O   1 
ATOM   3758  C  CB  . ASN A  1  477  ? 26.260  -30.656  -26.479  1.00 77.40  ? 477  ASN A CB  1 
ATOM   3759  C  CG  . ASN A  1  477  ? 25.996  -30.409  -25.027  1.00 75.97  ? 477  ASN A CG  1 
ATOM   3760  O  OD1 . ASN A  1  477  ? 25.093  -29.672  -24.654  1.00 77.11  ? 477  ASN A OD1 1 
ATOM   3761  N  ND2 . ASN A  1  477  ? 26.804  -30.995  -24.197  1.00 75.26  ? 477  ASN A ND2 1 
ATOM   3762  N  N   . LEU A  1  478  ? 26.992  -33.702  -25.152  1.00 73.79  ? 478  LEU A N   1 
ATOM   3763  C  CA  . LEU A  1  478  ? 26.453  -34.995  -24.713  1.00 75.69  ? 478  LEU A CA  1 
ATOM   3764  C  C   . LEU A  1  478  ? 24.962  -35.032  -24.531  1.00 73.93  ? 478  LEU A C   1 
ATOM   3765  O  O   . LEU A  1  478  ? 24.362  -36.047  -24.801  1.00 73.54  ? 478  LEU A O   1 
ATOM   3766  C  CB  . LEU A  1  478  ? 27.062  -35.436  -23.411  1.00 74.48  ? 478  LEU A CB  1 
ATOM   3767  C  CG  . LEU A  1  478  ? 28.540  -35.258  -23.519  1.00 75.76  ? 478  LEU A CG  1 
ATOM   3768  C  CD1 . LEU A  1  478  ? 29.095  -34.801  -22.138  1.00 73.48  ? 478  LEU A CD1 1 
ATOM   3769  C  CD2 . LEU A  1  478  ? 29.196  -36.519  -24.120  1.00 73.44  ? 478  LEU A CD2 1 
ATOM   3770  N  N   . SER A  1  479  ? 24.347  -33.966  -24.049  1.00 73.44  ? 479  SER A N   1 
ATOM   3771  C  CA  . SER A  1  479  ? 22.929  -34.065  -23.753  1.00 74.02  ? 479  SER A CA  1 
ATOM   3772  C  C   . SER A  1  479  ? 22.120  -34.103  -25.053  1.00 73.55  ? 479  SER A C   1 
ATOM   3773  O  O   . SER A  1  479  ? 20.895  -34.268  -25.051  1.00 74.62  ? 479  SER A O   1 
ATOM   3774  C  CB  . SER A  1  479  ? 22.455  -32.938  -22.842  1.00 74.50  ? 479  SER A CB  1 
ATOM   3775  O  OG  . SER A  1  479  ? 21.554  -32.100  -23.547  1.00 73.80  ? 479  SER A OG  1 
ATOM   3776  N  N   . VAL A  1  480  ? 22.834  -34.000  -26.165  1.00 73.64  ? 480  VAL A N   1 
ATOM   3777  C  CA  . VAL A  1  480  ? 22.235  -33.985  -27.490  1.00 74.09  ? 480  VAL A CA  1 
ATOM   3778  C  C   . VAL A  1  480  ? 22.434  -35.327  -28.174  1.00 75.49  ? 480  VAL A C   1 
ATOM   3779  O  O   . VAL A  1  480  ? 22.136  -35.492  -29.354  1.00 75.79  ? 480  VAL A O   1 
ATOM   3780  C  CB  . VAL A  1  480  ? 22.914  -32.936  -28.356  1.00 74.84  ? 480  VAL A CB  1 
ATOM   3781  C  CG1 . VAL A  1  480  ? 22.276  -32.887  -29.720  1.00 76.00  ? 480  VAL A CG1 1 
ATOM   3782  C  CG2 . VAL A  1  480  ? 22.833  -31.608  -27.689  1.00 74.40  ? 480  VAL A CG2 1 
ATOM   3783  N  N   . THR A  1  481  ? 22.948  -36.294  -27.432  1.00 74.55  ? 481  THR A N   1 
ATOM   3784  C  CA  . THR A  1  481  ? 23.250  -37.559  -28.041  1.00 74.07  ? 481  THR A CA  1 
ATOM   3785  C  C   . THR A  1  481  ? 22.015  -38.435  -28.197  1.00 73.57  ? 481  THR A C   1 
ATOM   3786  O  O   . THR A  1  481  ? 21.905  -39.157  -29.183  1.00 74.89  ? 481  THR A O   1 
ATOM   3787  C  CB  . THR A  1  481  ? 24.329  -38.264  -27.286  1.00 73.65  ? 481  THR A CB  1 
ATOM   3788  O  OG1 . THR A  1  481  ? 25.490  -37.423  -27.271  1.00 74.09  ? 481  THR A OG1 1 
ATOM   3789  C  CG2 . THR A  1  481  ? 24.659  -39.562  -27.972  1.00 74.58  ? 481  THR A CG2 1 
ATOM   3790  N  N   . SER A  1  482  ? 21.087  -38.354  -27.248  1.00 148.79 ? 482  SER A N   1 
ATOM   3791  C  CA  . SER A  1  482  ? 19.828  -39.108  -27.306  1.00 155.12 ? 482  SER A CA  1 
ATOM   3792  C  C   . SER A  1  482  ? 19.010  -38.932  -28.604  1.00 160.84 ? 482  SER A C   1 
ATOM   3793  O  O   . SER A  1  482  ? 18.480  -39.912  -29.140  1.00 122.27 ? 482  SER A O   1 
ATOM   3794  C  CB  . SER A  1  482  ? 18.961  -38.825  -26.069  1.00 155.89 ? 482  SER A CB  1 
ATOM   3795  O  OG  . SER A  1  482  ? 19.388  -39.604  -24.965  1.00 154.37 ? 482  SER A OG  1 
ATOM   3796  N  N   . PRO A  1  483  ? 18.920  -37.699  -29.090  1.00 87.09  ? 483  PRO A N   1 
ATOM   3797  C  CA  . PRO A  1  483  ? 18.174  -37.407  -30.318  1.00 83.25  ? 483  PRO A CA  1 
ATOM   3798  C  C   . PRO A  1  483  ? 18.825  -38.046  -31.539  1.00 77.37  ? 483  PRO A C   1 
ATOM   3799  O  O   . PRO A  1  483  ? 18.147  -38.306  -32.534  1.00 77.69  ? 483  PRO A O   1 
ATOM   3800  C  CB  . PRO A  1  483  ? 18.254  -35.882  -30.417  1.00 88.00  ? 483  PRO A CB  1 
ATOM   3801  C  CG  . PRO A  1  483  ? 18.392  -35.428  -29.007  1.00 84.38  ? 483  PRO A CG  1 
ATOM   3802  C  CD  . PRO A  1  483  ? 19.210  -36.480  -28.314  1.00 74.48  ? 483  PRO A CD  1 
ATOM   3803  N  N   . TYR A  1  484  ? 20.128  -38.294  -31.460  1.00 76.53  ? 484  TYR A N   1 
ATOM   3804  C  CA  . TYR A  1  484  ? 20.861  -38.904  -32.562  1.00 77.45  ? 484  TYR A CA  1 
ATOM   3805  C  C   . TYR A  1  484  ? 21.109  -40.386  -32.306  1.00 76.46  ? 484  TYR A C   1 
ATOM   3806  O  O   . TYR A  1  484  ? 21.989  -40.993  -32.917  1.00 76.82  ? 484  TYR A O   1 
ATOM   3807  C  CB  . TYR A  1  484  ? 22.190  -38.180  -32.789  1.00 76.94  ? 484  TYR A CB  1 
ATOM   3808  C  CG  . TYR A  1  484  ? 22.038  -36.717  -33.139  1.00 77.06  ? 484  TYR A CG  1 
ATOM   3809  C  CD1 . TYR A  1  484  ? 22.308  -35.727  -32.203  1.00 78.45  ? 484  TYR A CD1 1 
ATOM   3810  C  CD2 . TYR A  1  484  ? 21.624  -36.324  -34.405  1.00 78.74  ? 484  TYR A CD2 1 
ATOM   3811  C  CE1 . TYR A  1  484  ? 22.172  -34.389  -32.519  1.00 78.44  ? 484  TYR A CE1 1 
ATOM   3812  C  CE2 . TYR A  1  484  ? 21.484  -34.988  -34.730  1.00 80.02  ? 484  TYR A CE2 1 
ATOM   3813  C  CZ  . TYR A  1  484  ? 21.759  -34.025  -33.782  1.00 79.34  ? 484  TYR A CZ  1 
ATOM   3814  O  OH  . TYR A  1  484  ? 21.621  -32.692  -34.100  1.00 80.73  ? 484  TYR A OH  1 
ATOM   3815  N  N   . ASN A  1  485  ? 20.328  -40.963  -31.399  1.00 167.08 ? 485  ASN A N   1 
ATOM   3816  C  CA  . ASN A  1  485  ? 20.462  -42.375  -31.058  1.00 160.48 ? 485  ASN A CA  1 
ATOM   3817  C  C   . ASN A  1  485  ? 21.741  -42.985  -31.623  1.00 123.96 ? 485  ASN A C   1 
ATOM   3818  O  O   . ASN A  1  485  ? 21.693  -43.882  -32.465  1.00 156.84 ? 485  ASN A O   1 
ATOM   3819  C  CB  . ASN A  1  485  ? 19.244  -43.162  -31.547  1.00 168.94 ? 485  ASN A CB  1 
ATOM   3820  C  CG  . ASN A  1  485  ? 19.075  -43.098  -33.052  1.00 174.66 ? 485  ASN A CG  1 
ATOM   3821  O  OD1 . ASN A  1  485  ? 20.048  -42.950  -33.792  1.00 190.40 ? 485  ASN A OD1 1 
ATOM   3822  N  ND2 . ASN A  1  485  ? 17.835  -43.211  -33.514  1.00 208.93 ? 485  ASN A ND2 1 
ATOM   3823  N  N   . ALA A  1  486  ? 22.883  -42.491  -31.154  1.00 101.80 ? 486  ALA A N   1 
ATOM   3824  C  CA  . ALA A  1  486  ? 24.176  -42.986  -31.612  1.00 104.09 ? 486  ALA A CA  1 
ATOM   3825  C  C   . ALA A  1  486  ? 25.298  -42.535  -30.685  1.00 106.78 ? 486  ALA A C   1 
ATOM   3826  O  O   . ALA A  1  486  ? 25.464  -41.341  -30.430  1.00 89.74  ? 486  ALA A O   1 
ATOM   3827  C  CB  . ALA A  1  486  ? 24.446  -42.528  -33.038  1.00 95.29  ? 486  ALA A CB  1 
ATOM   3828  N  N   . ASP A  1  487  ? 26.067  -43.495  -30.181  1.00 140.83 ? 487  ASP A N   1 
ATOM   3829  C  CA  . ASP A  1  487  ? 27.174  -43.198  -29.282  1.00 127.90 ? 487  ASP A CA  1 
ATOM   3830  C  C   . ASP A  1  487  ? 28.411  -42.754  -30.057  1.00 104.55 ? 487  ASP A C   1 
ATOM   3831  O  O   . ASP A  1  487  ? 28.316  -42.343  -31.214  1.00 109.37 ? 487  ASP A O   1 
ATOM   3832  C  CB  . ASP A  1  487  ? 27.506  -44.416  -28.418  1.00 108.15 ? 487  ASP A CB  1 
ATOM   3833  C  CG  . ASP A  1  487  ? 26.279  -45.010  -27.754  1.00 129.62 ? 487  ASP A CG  1 
ATOM   3834  O  OD1 . ASP A  1  487  ? 25.169  -44.480  -27.969  1.00 123.39 ? 487  ASP A OD1 1 
ATOM   3835  O  OD2 . ASP A  1  487  ? 26.424  -46.009  -27.018  1.00 139.03 ? 487  ASP A OD2 1 
ATOM   3836  N  N   . PHE A  1  488  ? 29.569  -42.838  -29.412  1.00 76.14  ? 488  PHE A N   1 
ATOM   3837  C  CA  . PHE A  1  488  ? 30.826  -42.445  -30.038  1.00 84.40  ? 488  PHE A CA  1 
ATOM   3838  C  C   . PHE A  1  488  ? 31.626  -43.665  -30.481  1.00 113.56 ? 488  PHE A C   1 
ATOM   3839  O  O   . PHE A  1  488  ? 32.856  -43.670  -30.418  1.00 95.00  ? 488  PHE A O   1 
ATOM   3840  C  CB  . PHE A  1  488  ? 31.659  -41.590  -29.081  1.00 87.80  ? 488  PHE A CB  1 
ATOM   3841  C  CG  . PHE A  1  488  ? 30.954  -40.351  -28.608  1.00 96.62  ? 488  PHE A CG  1 
ATOM   3842  C  CD1 . PHE A  1  488  ? 30.412  -40.288  -27.336  1.00 88.20  ? 488  PHE A CD1 1 
ATOM   3843  C  CD2 . PHE A  1  488  ? 30.833  -39.247  -29.435  1.00 93.61  ? 488  PHE A CD2 1 
ATOM   3844  C  CE1 . PHE A  1  488  ? 29.764  -39.149  -26.896  1.00 78.72  ? 488  PHE A CE1 1 
ATOM   3845  C  CE2 . PHE A  1  488  ? 30.185  -38.106  -29.003  1.00 89.16  ? 488  PHE A CE2 1 
ATOM   3846  C  CZ  . PHE A  1  488  ? 29.649  -38.057  -27.731  1.00 83.00  ? 488  PHE A CZ  1 
ATOM   3847  N  N   . ASP A  1  489  ? 30.921  -44.698  -30.929  1.00 122.82 ? 489  ASP A N   1 
ATOM   3848  C  CA  . ASP A  1  489  ? 31.568  -45.931  -31.385  1.00 139.38 ? 489  ASP A CA  1 
ATOM   3849  C  C   . ASP A  1  489  ? 32.402  -45.699  -32.639  1.00 173.42 ? 489  ASP A C   1 
ATOM   3850  O  O   . ASP A  1  489  ? 32.671  -46.626  -33.403  1.00 139.85 ? 489  ASP A O   1 
ATOM   3851  C  CB  . ASP A  1  489  ? 30.505  -47.019  -31.647  1.00 137.51 ? 489  ASP A CB  1 
ATOM   3852  C  CG  . ASP A  1  489  ? 29.947  -47.619  -30.359  1.00 123.50 ? 489  ASP A CG  1 
ATOM   3853  O  OD1 . ASP A  1  489  ? 30.191  -47.039  -29.288  1.00 158.51 ? 489  ASP A OD1 1 
ATOM   3854  O  OD2 . ASP A  1  489  ? 29.275  -48.675  -30.413  1.00 129.52 ? 489  ASP A OD2 1 
ATOM   3855  N  N   . GLY A  1  490  ? 32.812  -44.452  -32.837  1.00 79.91  ? 490  GLY A N   1 
ATOM   3856  C  CA  . GLY A  1  490  ? 33.500  -44.060  -34.049  1.00 78.94  ? 490  GLY A CA  1 
ATOM   3857  C  C   . GLY A  1  490  ? 32.511  -43.743  -35.149  1.00 80.48  ? 490  GLY A C   1 
ATOM   3858  O  O   . GLY A  1  490  ? 32.784  -43.980  -36.329  1.00 76.32  ? 490  GLY A O   1 
ATOM   3859  N  N   . ASP A  1  491  ? 31.361  -43.207  -34.751  1.00 86.27  ? 491  ASP A N   1 
ATOM   3860  C  CA  . ASP A  1  491  ? 30.298  -42.871  -35.690  1.00 94.88  ? 491  ASP A CA  1 
ATOM   3861  C  C   . ASP A  1  491  ? 30.654  -41.645  -36.537  1.00 107.52 ? 491  ASP A C   1 
ATOM   3862  O  O   . ASP A  1  491  ? 31.461  -40.808  -36.147  1.00 94.78  ? 491  ASP A O   1 
ATOM   3863  C  CB  . ASP A  1  491  ? 28.978  -42.612  -34.939  1.00 77.88  ? 491  ASP A CB  1 
ATOM   3864  C  CG  . ASP A  1  491  ? 28.454  -43.857  -34.205  1.00 123.89 ? 491  ASP A CG  1 
ATOM   3865  O  OD1 . ASP A  1  491  ? 29.126  -44.907  -34.275  1.00 87.26  ? 491  ASP A OD1 1 
ATOM   3866  O  OD2 . ASP A  1  491  ? 27.372  -43.788  -33.558  1.00 82.66  ? 491  ASP A OD2 1 
ATOM   3867  N  N   . GLU A  1  492  ? 30.051  -41.541  -37.709  1.00 95.67  ? 492  GLU A N   1 
ATOM   3868  C  CA  . GLU A  1  492  ? 30.212  -40.335  -38.518  1.00 93.04  ? 492  GLU A CA  1 
ATOM   3869  C  C   . GLU A  1  492  ? 28.897  -39.525  -38.486  1.00 86.63  ? 492  GLU A C   1 
ATOM   3870  O  O   . GLU A  1  492  ? 27.820  -40.099  -38.283  1.00 80.86  ? 492  GLU A O   1 
ATOM   3871  C  CB  . GLU A  1  492  ? 30.624  -40.695  -39.961  1.00 80.47  ? 492  GLU A CB  1 
ATOM   3872  C  CG  . GLU A  1  492  ? 31.853  -41.628  -40.090  1.00 86.27  ? 492  GLU A CG  1 
ATOM   3873  C  CD  . GLU A  1  492  ? 32.251  -41.940  -41.543  1.00 121.68 ? 492  GLU A CD  1 
ATOM   3874  O  OE1 . GLU A  1  492  ? 31.473  -41.655  -42.477  1.00 130.83 ? 492  GLU A OE1 1 
ATOM   3875  O  OE2 . GLU A  1  492  ? 33.356  -42.486  -41.749  1.00 145.79 ? 492  GLU A OE2 1 
ATOM   3876  N  N   . MET A  1  493  ? 28.966  -38.207  -38.650  1.00 78.54  ? 493  MET A N   1 
ATOM   3877  C  CA  . MET A  1  493  ? 27.745  -37.413  -38.794  1.00 77.52  ? 493  MET A CA  1 
ATOM   3878  C  C   . MET A  1  493  ? 27.975  -36.346  -39.833  1.00 78.22  ? 493  MET A C   1 
ATOM   3879  O  O   . MET A  1  493  ? 29.033  -35.723  -39.865  1.00 78.43  ? 493  MET A O   1 
ATOM   3880  C  CB  . MET A  1  493  ? 27.353  -36.745  -37.490  1.00 77.22  ? 493  MET A CB  1 
ATOM   3881  C  CG  . MET A  1  493  ? 26.939  -37.686  -36.413  1.00 76.24  ? 493  MET A CG  1 
ATOM   3882  S  SD  . MET A  1  493  ? 26.237  -36.803  -35.027  1.00 75.73  ? 493  MET A SD  1 
ATOM   3883  C  CE  . MET A  1  493  ? 24.709  -36.243  -35.715  1.00 76.88  ? 493  MET A CE  1 
ATOM   3884  N  N   . ASN A  1  494  ? 26.978  -36.137  -40.678  1.00 78.48  ? 494  ASN A N   1 
ATOM   3885  C  CA  . ASN A  1  494  ? 27.125  -35.201  -41.781  1.00 80.40  ? 494  ASN A CA  1 
ATOM   3886  C  C   . ASN A  1  494  ? 26.804  -33.738  -41.412  1.00 84.80  ? 494  ASN A C   1 
ATOM   3887  O  O   . ASN A  1  494  ? 25.951  -33.464  -40.546  1.00 79.21  ? 494  ASN A O   1 
ATOM   3888  C  CB  . ASN A  1  494  ? 26.292  -35.678  -42.965  1.00 85.47  ? 494  ASN A CB  1 
ATOM   3889  C  CG  . ASN A  1  494  ? 26.581  -37.109  -43.315  1.00 83.16  ? 494  ASN A CG  1 
ATOM   3890  O  OD1 . ASN A  1  494  ? 27.614  -37.656  -42.931  1.00 85.54  ? 494  ASN A OD1 1 
ATOM   3891  N  ND2 . ASN A  1  494  ? 25.663  -37.740  -44.045  1.00 84.06  ? 494  ASN A ND2 1 
ATOM   3892  N  N   . MET A  1  495  ? 27.504  -32.800  -42.049  1.00 87.23  ? 495  MET A N   1 
ATOM   3893  C  CA  . MET A  1  495  ? 27.219  -31.383  -41.861  1.00 80.00  ? 495  MET A CA  1 
ATOM   3894  C  C   . MET A  1  495  ? 26.834  -30.741  -43.181  1.00 84.64  ? 495  MET A C   1 
ATOM   3895  O  O   . MET A  1  495  ? 27.550  -30.873  -44.166  1.00 90.23  ? 495  MET A O   1 
ATOM   3896  C  CB  . MET A  1  495  ? 28.434  -30.685  -41.294  1.00 85.61  ? 495  MET A CB  1 
ATOM   3897  C  CG  . MET A  1  495  ? 28.085  -29.548  -40.386  1.00 85.99  ? 495  MET A CG  1 
ATOM   3898  S  SD  . MET A  1  495  ? 29.430  -28.395  -40.230  1.00 101.58 ? 495  MET A SD  1 
ATOM   3899  C  CE  . MET A  1  495  ? 30.777  -29.394  -40.815  1.00 82.15  ? 495  MET A CE  1 
ATOM   3900  N  N   . HIS A  1  496  ? 25.694  -30.065  -43.206  1.00 82.34  ? 496  HIS A N   1 
ATOM   3901  C  CA  . HIS A  1  496  ? 25.279  -29.323  -44.386  1.00 82.89  ? 496  HIS A CA  1 
ATOM   3902  C  C   . HIS A  1  496  ? 25.246  -27.833  -44.038  1.00 83.27  ? 496  HIS A C   1 
ATOM   3903  O  O   . HIS A  1  496  ? 24.453  -27.429  -43.181  1.00 82.90  ? 496  HIS A O   1 
ATOM   3904  C  CB  . HIS A  1  496  ? 23.903  -29.789  -44.848  1.00 82.93  ? 496  HIS A CB  1 
ATOM   3905  C  CG  . HIS A  1  496  ? 23.857  -31.236  -45.249  1.00 82.49  ? 496  HIS A CG  1 
ATOM   3906  N  ND1 . HIS A  1  496  ? 23.467  -32.229  -44.387  1.00 81.70  ? 496  HIS A ND1 1 
ATOM   3907  C  CD2 . HIS A  1  496  ? 24.134  -31.846  -46.425  1.00 84.42  ? 496  HIS A CD2 1 
ATOM   3908  C  CE1 . HIS A  1  496  ? 23.510  -33.395  -45.009  1.00 82.76  ? 496  HIS A CE1 1 
ATOM   3909  N  NE2 . HIS A  1  496  ? 23.911  -33.187  -46.251  1.00 83.18  ? 496  HIS A NE2 1 
ATOM   3910  N  N   . VAL A  1  497  ? 26.129  -27.044  -44.679  1.00 83.33  ? 497  VAL A N   1 
ATOM   3911  C  CA  . VAL A  1  497  ? 26.273  -25.581  -44.498  1.00 85.66  ? 497  VAL A CA  1 
ATOM   3912  C  C   . VAL A  1  497  ? 25.248  -24.866  -45.380  1.00 84.17  ? 497  VAL A C   1 
ATOM   3913  O  O   . VAL A  1  497  ? 25.089  -25.247  -46.530  1.00 86.86  ? 497  VAL A O   1 
ATOM   3914  C  CB  . VAL A  1  497  ? 27.674  -25.119  -44.954  1.00 83.79  ? 497  VAL A CB  1 
ATOM   3915  C  CG1 . VAL A  1  497  ? 27.845  -23.650  -44.705  1.00 86.19  ? 497  VAL A CG1 1 
ATOM   3916  C  CG2 . VAL A  1  497  ? 28.784  -25.916  -44.265  1.00 85.55  ? 497  VAL A CG2 1 
ATOM   3917  N  N   . PRO A  1  498  ? 24.540  -23.831  -44.864  1.00 84.02  ? 498  PRO A N   1 
ATOM   3918  C  CA  . PRO A  1  498  ? 23.580  -23.213  -45.775  1.00 86.53  ? 498  PRO A CA  1 
ATOM   3919  C  C   . PRO A  1  498  ? 24.362  -22.246  -46.611  1.00 87.97  ? 498  PRO A C   1 
ATOM   3920  O  O   . PRO A  1  498  ? 25.493  -21.981  -46.236  1.00 86.70  ? 498  PRO A O   1 
ATOM   3921  C  CB  . PRO A  1  498  ? 22.666  -22.420  -44.848  1.00 85.53  ? 498  PRO A CB  1 
ATOM   3922  C  CG  . PRO A  1  498  ? 23.111  -22.751  -43.458  1.00 84.23  ? 498  PRO A CG  1 
ATOM   3923  C  CD  . PRO A  1  498  ? 24.510  -23.188  -43.549  1.00 84.92  ? 498  PRO A CD  1 
ATOM   3924  N  N   . GLN A  1  499  ? 23.820  -21.730  -47.705  1.00 88.34  ? 499  GLN A N   1 
ATOM   3925  C  CA  . GLN A  1  499  ? 24.455  -20.616  -48.376  1.00 90.90  ? 499  GLN A CA  1 
ATOM   3926  C  C   . GLN A  1  499  ? 23.598  -19.392  -48.205  1.00 89.68  ? 499  GLN A C   1 
ATOM   3927  O  O   . GLN A  1  499  ? 23.804  -18.602  -47.280  1.00 88.35  ? 499  GLN A O   1 
ATOM   3928  C  CB  . GLN A  1  499  ? 24.620  -20.881  -49.848  1.00 90.47  ? 499  GLN A CB  1 
ATOM   3929  C  CG  . GLN A  1  499  ? 25.296  -22.180  -50.154  1.00 92.34  ? 499  GLN A CG  1 
ATOM   3930  C  CD  . GLN A  1  499  ? 26.702  -22.252  -49.618  1.00 91.99  ? 499  GLN A CD  1 
ATOM   3931  O  OE1 . GLN A  1  499  ? 27.656  -22.108  -50.363  1.00 89.63  ? 499  GLN A OE1 1 
ATOM   3932  N  NE2 . GLN A  1  499  ? 26.839  -22.485  -48.329  1.00 89.37  ? 499  GLN A NE2 1 
ATOM   3933  N  N   . SER A  1  500  ? 22.619  -19.231  -49.087  1.00 156.82 ? 500  SER A N   1 
ATOM   3934  C  CA  . SER A  1  500  ? 21.795  -18.010  -49.068  1.00 168.11 ? 500  SER A CA  1 
ATOM   3935  C  C   . SER A  1  500  ? 21.366  -17.516  -47.666  1.00 167.42 ? 500  SER A C   1 
ATOM   3936  O  O   . SER A  1  500  ? 21.149  -18.293  -46.740  1.00 162.19 ? 500  SER A O   1 
ATOM   3937  C  CB  . SER A  1  500  ? 20.601  -18.093  -50.041  1.00 125.84 ? 500  SER A CB  1 
ATOM   3938  O  OG  . SER A  1  500  ? 19.645  -19.067  -49.655  1.00 115.90 ? 500  SER A OG  1 
ATOM   3939  N  N   . GLU A  1  501  ? 21.292  -16.198  -47.522  1.00 125.53 ? 501  GLU A N   1 
ATOM   3940  C  CA  . GLU A  1  501  ? 20.983  -15.621  -46.231  1.00 146.26 ? 501  GLU A CA  1 
ATOM   3941  C  C   . GLU A  1  501  ? 19.504  -15.781  -45.906  1.00 129.53 ? 501  GLU A C   1 
ATOM   3942  O  O   . GLU A  1  501  ? 19.040  -15.278  -44.901  1.00 134.01 ? 501  GLU A O   1 
ATOM   3943  C  CB  . GLU A  1  501  ? 21.423  -14.149  -46.155  1.00 149.75 ? 501  GLU A CB  1 
ATOM   3944  C  CG  . GLU A  1  501  ? 22.926  -13.954  -46.336  1.00 123.15 ? 501  GLU A CG  1 
ATOM   3945  C  CD  . GLU A  1  501  ? 23.741  -14.330  -45.107  1.00 132.18 ? 501  GLU A CD  1 
ATOM   3946  O  OE1 . GLU A  1  501  ? 23.584  -13.617  -44.089  1.00 129.69 ? 501  GLU A OE1 1 
ATOM   3947  O  OE2 . GLU A  1  501  ? 24.544  -15.312  -45.177  1.00 96.29  ? 501  GLU A OE2 1 
ATOM   3948  N  N   . GLU A  1  502  ? 18.769  -16.498  -46.746  1.00 99.43  ? 502  GLU A N   1 
ATOM   3949  C  CA  . GLU A  1  502  ? 17.342  -16.683  -46.497  1.00 100.74 ? 502  GLU A CA  1 
ATOM   3950  C  C   . GLU A  1  502  ? 17.003  -18.039  -45.881  1.00 88.47  ? 502  GLU A C   1 
ATOM   3951  O  O   . GLU A  1  502  ? 15.950  -18.179  -45.251  1.00 89.56  ? 502  GLU A O   1 
ATOM   3952  C  CB  . GLU A  1  502  ? 16.488  -16.400  -47.741  1.00 141.92 ? 502  GLU A CB  1 
ATOM   3953  C  CG  . GLU A  1  502  ? 16.784  -17.261  -48.945  1.00 152.65 ? 502  GLU A CG  1 
ATOM   3954  C  CD  . GLU A  1  502  ? 15.839  -16.998  -50.103  1.00 107.06 ? 502  GLU A CD  1 
ATOM   3955  O  OE1 . GLU A  1  502  ? 15.932  -17.754  -51.096  1.00 128.04 ? 502  GLU A OE1 1 
ATOM   3956  O  OE2 . GLU A  1  502  ? 15.009  -16.060  -50.024  1.00 145.27 ? 502  GLU A OE2 1 
ATOM   3957  N  N   . THR A  1  503  ? 17.893  -19.026  -46.065  1.00 94.16  ? 503  THR A N   1 
ATOM   3958  C  CA  . THR A  1  503  ? 17.790  -20.327  -45.378  1.00 93.25  ? 503  THR A CA  1 
ATOM   3959  C  C   . THR A  1  503  ? 18.471  -20.241  -44.027  1.00 91.30  ? 503  THR A C   1 
ATOM   3960  O  O   . THR A  1  503  ? 18.054  -20.879  -43.058  1.00 96.65  ? 503  THR A O   1 
ATOM   3961  C  CB  . THR A  1  503  ? 18.520  -21.477  -46.120  1.00 98.44  ? 503  THR A CB  1 
ATOM   3962  O  OG1 . THR A  1  503  ? 19.898  -21.514  -45.711  1.00 95.61  ? 503  THR A OG1 1 
ATOM   3963  C  CG2 . THR A  1  503  ? 18.437  -21.316  -47.622  1.00 102.92 ? 503  THR A CG2 1 
ATOM   3964  N  N   . ARG A  1  504  ? 19.536  -19.447  -43.977  1.00 87.42  ? 504  ARG A N   1 
ATOM   3965  C  CA  . ARG A  1  504  ? 20.305  -19.281  -42.764  1.00 86.57  ? 504  ARG A CA  1 
ATOM   3966  C  C   . ARG A  1  504  ? 19.355  -18.865  -41.697  1.00 86.50  ? 504  ARG A C   1 
ATOM   3967  O  O   . ARG A  1  504  ? 19.610  -19.006  -40.519  1.00 85.92  ? 504  ARG A O   1 
ATOM   3968  C  CB  . ARG A  1  504  ? 21.363  -18.212  -42.961  1.00 86.50  ? 504  ARG A CB  1 
ATOM   3969  C  CG  . ARG A  1  504  ? 22.444  -18.253  -41.924  1.00 85.05  ? 504  ARG A CG  1 
ATOM   3970  C  CD  . ARG A  1  504  ? 23.731  -17.662  -42.451  1.00 91.39  ? 504  ARG A CD  1 
ATOM   3971  N  NE  . ARG A  1  504  ? 24.509  -17.089  -41.361  1.00 88.43  ? 504  ARG A NE  1 
ATOM   3972  C  CZ  . ARG A  1  504  ? 24.221  -15.927  -40.788  1.00 96.26  ? 504  ARG A CZ  1 
ATOM   3973  N  NH1 . ARG A  1  504  ? 23.182  -15.211  -41.209  1.00 98.04  ? 504  ARG A NH1 1 
ATOM   3974  N  NH2 . ARG A  1  504  ? 24.981  -15.487  -39.795  1.00 93.61  ? 504  ARG A NH2 1 
ATOM   3975  N  N   . ALA A  1  505  ? 18.229  -18.387  -42.158  1.00 87.85  ? 505  ALA A N   1 
ATOM   3976  C  CA  . ALA A  1  505  ? 17.242  -17.833  -41.295  1.00 86.56  ? 505  ALA A CA  1 
ATOM   3977  C  C   . ALA A  1  505  ? 16.290  -18.927  -40.916  1.00 87.15  ? 505  ALA A C   1 
ATOM   3978  O  O   . ALA A  1  505  ? 15.879  -19.036  -39.766  1.00 84.41  ? 505  ALA A O   1 
ATOM   3979  C  CB  . ALA A  1  505  ? 16.519  -16.740  -42.018  1.00 87.26  ? 505  ALA A CB  1 
ATOM   3980  N  N   . GLU A  1  506  ? 15.925  -19.744  -41.876  1.00 125.39 ? 506  GLU A N   1 
ATOM   3981  C  CA  . GLU A  1  506  ? 15.049  -20.813  -41.509  1.00 114.40 ? 506  GLU A CA  1 
ATOM   3982  C  C   . GLU A  1  506  ? 15.720  -21.611  -40.394  1.00 106.34 ? 506  GLU A C   1 
ATOM   3983  O  O   . GLU A  1  506  ? 15.297  -21.510  -39.245  1.00 108.87 ? 506  GLU A O   1 
ATOM   3984  C  CB  . GLU A  1  506  ? 14.655  -21.621  -42.737  1.00 119.26 ? 506  GLU A CB  1 
ATOM   3985  C  CG  . GLU A  1  506  ? 13.911  -20.738  -43.741  1.00 110.05 ? 506  GLU A CG  1 
ATOM   3986  C  CD  . GLU A  1  506  ? 13.339  -21.475  -44.938  1.00 127.00 ? 506  GLU A CD  1 
ATOM   3987  O  OE1 . GLU A  1  506  ? 13.703  -22.638  -45.173  1.00 126.48 ? 506  GLU A OE1 1 
ATOM   3988  O  OE2 . GLU A  1  506  ? 12.520  -20.868  -45.658  1.00 133.61 ? 506  GLU A OE2 1 
ATOM   3989  N  N   . ILE A  1  507  ? 16.801  -22.333  -40.699  1.00 83.99  ? 507  ILE A N   1 
ATOM   3990  C  CA  . ILE A  1  507  ? 17.462  -23.144  -39.670  1.00 82.07  ? 507  ILE A CA  1 
ATOM   3991  C  C   . ILE A  1  507  ? 18.047  -22.333  -38.505  1.00 82.12  ? 507  ILE A C   1 
ATOM   3992  O  O   . ILE A  1  507  ? 18.980  -22.773  -37.846  1.00 81.16  ? 507  ILE A O   1 
ATOM   3993  C  CB  . ILE A  1  507  ? 18.541  -24.117  -40.221  1.00 82.11  ? 507  ILE A CB  1 
ATOM   3994  C  CG1 . ILE A  1  507  ? 19.886  -23.444  -40.275  1.00 83.59  ? 507  ILE A CG1 1 
ATOM   3995  C  CG2 . ILE A  1  507  ? 18.221  -24.611  -41.592  1.00 83.96  ? 507  ILE A CG2 1 
ATOM   3996  C  CD1 . ILE A  1  507  ? 19.941  -22.457  -41.394  1.00 83.59  ? 507  ILE A CD1 1 
ATOM   3997  N  N   . GLN A  1  508  ? 17.503  -21.150  -38.247  1.00 83.57  ? 508  GLN A N   1 
ATOM   3998  C  CA  . GLN A  1  508  ? 17.870  -20.440  -37.036  1.00 82.83  ? 508  GLN A CA  1 
ATOM   3999  C  C   . GLN A  1  508  ? 16.640  -20.173  -36.201  1.00 83.32  ? 508  GLN A C   1 
ATOM   4000  O  O   . GLN A  1  508  ? 16.714  -20.193  -34.971  1.00 82.01  ? 508  GLN A O   1 
ATOM   4001  C  CB  . GLN A  1  508  ? 18.608  -19.118  -37.309  1.00 83.57  ? 508  GLN A CB  1 
ATOM   4002  C  CG  . GLN A  1  508  ? 18.520  -18.150  -36.108  1.00 82.77  ? 508  GLN A CG  1 
ATOM   4003  C  CD  . GLN A  1  508  ? 19.732  -17.242  -35.974  1.00 83.74  ? 508  GLN A CD  1 
ATOM   4004  O  OE1 . GLN A  1  508  ? 20.143  -16.598  -36.924  1.00 83.99  ? 508  GLN A OE1 1 
ATOM   4005  N  NE2 . GLN A  1  508  ? 20.299  -17.185  -34.779  1.00 83.09  ? 508  GLN A NE2 1 
ATOM   4006  N  N   . GLU A  1  509  ? 15.508  -19.946  -36.862  1.00 101.49 ? 509  GLU A N   1 
ATOM   4007  C  CA  . GLU A  1  509  ? 14.321  -19.447  -36.175  1.00 83.83  ? 509  GLU A CA  1 
ATOM   4008  C  C   . GLU A  1  509  ? 13.324  -20.549  -35.909  1.00 85.46  ? 509  GLU A C   1 
ATOM   4009  O  O   . GLU A  1  509  ? 12.468  -20.414  -35.040  1.00 106.92 ? 509  GLU A O   1 
ATOM   4010  C  CB  . GLU A  1  509  ? 13.653  -18.336  -36.979  1.00 91.20  ? 509  GLU A CB  1 
ATOM   4011  C  CG  . GLU A  1  509  ? 14.404  -17.025  -36.948  1.00 124.45 ? 509  GLU A CG  1 
ATOM   4012  C  CD  . GLU A  1  509  ? 14.418  -16.401  -35.579  1.00 125.22 ? 509  GLU A CD  1 
ATOM   4013  O  OE1 . GLU A  1  509  ? 13.330  -16.272  -34.972  1.00 127.89 ? 509  GLU A OE1 1 
ATOM   4014  O  OE2 . GLU A  1  509  ? 15.522  -16.026  -35.123  1.00 93.43  ? 509  GLU A OE2 1 
ATOM   4015  N  N   . ILE A  1  510  ? 13.433  -21.642  -36.657  1.00 82.64  ? 510  ILE A N   1 
ATOM   4016  C  CA  . ILE A  1  510  ? 12.530  -22.775  -36.497  1.00 88.88  ? 510  ILE A CA  1 
ATOM   4017  C  C   . ILE A  1  510  ? 13.275  -24.009  -36.000  1.00 86.43  ? 510  ILE A C   1 
ATOM   4018  O  O   . ILE A  1  510  ? 12.914  -24.595  -34.980  1.00 86.87  ? 510  ILE A O   1 
ATOM   4019  C  CB  . ILE A  1  510  ? 11.813  -23.115  -37.816  1.00 83.37  ? 510  ILE A CB  1 
ATOM   4020  C  CG1 . ILE A  1  510  ? 12.833  -23.387  -38.923  1.00 87.34  ? 510  ILE A CG1 1 
ATOM   4021  C  CG2 . ILE A  1  510  ? 10.871  -21.990  -38.217  1.00 86.15  ? 510  ILE A CG2 1 
ATOM   4022  C  CD1 . ILE A  1  510  ? 12.221  -23.509  -40.301  1.00 89.40  ? 510  ILE A CD1 1 
ATOM   4023  N  N   . THR A  1  511  ? 14.317  -24.398  -36.729  1.00 81.25  ? 511  THR A N   1 
ATOM   4024  C  CA  . THR A  1  511  ? 15.114  -25.563  -36.364  1.00 80.31  ? 511  THR A CA  1 
ATOM   4025  C  C   . THR A  1  511  ? 16.357  -25.157  -35.578  1.00 79.62  ? 511  THR A C   1 
ATOM   4026  O  O   . THR A  1  511  ? 17.276  -24.546  -36.123  1.00 81.68  ? 511  THR A O   1 
ATOM   4027  C  CB  . THR A  1  511  ? 15.544  -26.364  -37.606  1.00 82.33  ? 511  THR A CB  1 
ATOM   4028  O  OG1 . THR A  1  511  ? 16.722  -27.122  -37.306  1.00 80.60  ? 511  THR A OG1 1 
ATOM   4029  C  CG2 . THR A  1  511  ? 15.832  -25.429  -38.771  1.00 81.65  ? 511  THR A CG2 1 
ATOM   4030  N  N   . MET A  1  512  ? 16.377  -25.501  -34.294  1.00 80.16  ? 512  MET A N   1 
ATOM   4031  C  CA  . MET A  1  512  ? 17.505  -25.174  -33.431  1.00 79.84  ? 512  MET A CA  1 
ATOM   4032  C  C   . MET A  1  512  ? 17.531  -26.066  -32.195  1.00 78.19  ? 512  MET A C   1 
ATOM   4033  O  O   . MET A  1  512  ? 16.564  -26.119  -31.435  1.00 79.41  ? 512  MET A O   1 
ATOM   4034  C  CB  . MET A  1  512  ? 17.453  -23.702  -33.016  1.00 79.05  ? 512  MET A CB  1 
ATOM   4035  C  CG  . MET A  1  512  ? 18.215  -22.768  -33.944  1.00 81.02  ? 512  MET A CG  1 
ATOM   4036  S  SD  . MET A  1  512  ? 19.988  -23.087  -33.950  1.00 80.27  ? 512  MET A SD  1 
ATOM   4037  C  CE  . MET A  1  512  ? 20.572  -21.783  -32.870  1.00 80.95  ? 512  MET A CE  1 
ATOM   4038  N  N   . VAL A  1  513  ? 18.644  -26.767  -32.000  1.00 101.08 ? 513  VAL A N   1 
ATOM   4039  C  CA  . VAL A  1  513  ? 18.798  -27.659  -30.857  1.00 90.42  ? 513  VAL A CA  1 
ATOM   4040  C  C   . VAL A  1  513  ? 17.980  -27.174  -29.665  1.00 95.42  ? 513  VAL A C   1 
ATOM   4041  O  O   . VAL A  1  513  ? 17.483  -27.975  -28.873  1.00 88.64  ? 513  VAL A O   1 
ATOM   4042  C  CB  . VAL A  1  513  ? 20.273  -27.788  -30.437  1.00 87.97  ? 513  VAL A CB  1 
ATOM   4043  C  CG1 . VAL A  1  513  ? 20.879  -29.059  -31.012  1.00 82.21  ? 513  VAL A CG1 1 
ATOM   4044  C  CG2 . VAL A  1  513  ? 21.061  -26.565  -30.882  1.00 92.91  ? 513  VAL A CG2 1 
ATOM   4045  N  N   . PRO A  1  514  ? 17.844  -25.857  -29.542  1.00 81.22  ? 514  PRO A N   1 
ATOM   4046  C  CA  . PRO A  1  514  ? 17.084  -25.260  -28.440  1.00 79.93  ? 514  PRO A CA  1 
ATOM   4047  C  C   . PRO A  1  514  ? 15.579  -25.392  -28.654  1.00 78.60  ? 514  PRO A C   1 
ATOM   4048  O  O   . PRO A  1  514  ? 14.882  -25.945  -27.803  1.00 78.55  ? 514  PRO A O   1 
ATOM   4049  C  CB  . PRO A  1  514  ? 17.495  -23.788  -28.495  1.00 79.29  ? 514  PRO A CB  1 
ATOM   4050  C  CG  . PRO A  1  514  ? 18.860  -23.807  -29.085  1.00 83.35  ? 514  PRO A CG  1 
ATOM   4051  C  CD  . PRO A  1  514  ? 18.864  -24.937  -30.076  1.00 82.21  ? 514  PRO A CD  1 
ATOM   4052  N  N   . LYS A  1  515  ? 15.090  -24.885  -29.781  1.00 86.07  ? 515  LYS A N   1 
ATOM   4053  C  CA  . LYS A  1  515  ? 13.668  -24.949  -30.096  1.00 94.86  ? 515  LYS A CA  1 
ATOM   4054  C  C   . LYS A  1  515  ? 13.269  -26.343  -30.570  1.00 89.38  ? 515  LYS A C   1 
ATOM   4055  O  O   . LYS A  1  515  ? 12.207  -26.528  -31.163  1.00 92.78  ? 515  LYS A O   1 
ATOM   4056  C  CB  . LYS A  1  515  ? 13.307  -23.910  -31.159  1.00 105.01 ? 515  LYS A CB  1 
ATOM   4057  C  CG  . LYS A  1  515  ? 13.905  -22.534  -30.910  1.00 114.99 ? 515  LYS A CG  1 
ATOM   4058  C  CD  . LYS A  1  515  ? 13.546  -21.566  -32.025  1.00 95.93  ? 515  LYS A CD  1 
ATOM   4059  C  CE  . LYS A  1  515  ? 13.849  -20.130  -31.629  1.00 95.80  ? 515  LYS A CE  1 
ATOM   4060  N  NZ  . LYS A  1  515  ? 13.012  -19.157  -32.383  1.00 122.63 ? 515  LYS A NZ  1 
ATOM   4061  N  N   . GLN A  1  516  ? 14.129  -27.321  -30.303  1.00 77.95  ? 516  GLN A N   1 
ATOM   4062  C  CA  . GLN A  1  516  ? 13.869  -28.699  -30.702  1.00 79.67  ? 516  GLN A CA  1 
ATOM   4063  C  C   . GLN A  1  516  ? 14.100  -29.661  -29.541  1.00 77.80  ? 516  GLN A C   1 
ATOM   4064  O  O   . GLN A  1  516  ? 14.261  -30.865  -29.742  1.00 78.67  ? 516  GLN A O   1 
ATOM   4065  C  CB  . GLN A  1  516  ? 14.749  -29.089  -31.891  1.00 78.87  ? 516  GLN A CB  1 
ATOM   4066  C  CG  . GLN A  1  516  ? 14.451  -28.315  -33.164  1.00 79.14  ? 516  GLN A CG  1 
ATOM   4067  C  CD  . GLN A  1  516  ? 13.158  -28.752  -33.823  1.00 79.50  ? 516  GLN A CD  1 
ATOM   4068  O  OE1 . GLN A  1  516  ? 12.313  -29.391  -33.196  1.00 79.11  ? 516  GLN A OE1 1 
ATOM   4069  N  NE2 . GLN A  1  516  ? 12.997  -28.409  -35.095  1.00 81.34  ? 516  GLN A NE2 1 
ATOM   4070  N  N   . ILE A  1  517  ? 14.116  -29.122  -28.326  1.00 77.72  ? 517  ILE A N   1 
ATOM   4071  C  CA  . ILE A  1  517  ? 14.329  -29.930  -27.131  1.00 76.48  ? 517  ILE A CA  1 
ATOM   4072  C  C   . ILE A  1  517  ? 13.028  -30.574  -26.661  1.00 76.59  ? 517  ILE A C   1 
ATOM   4073  O  O   . ILE A  1  517  ? 12.986  -31.214  -25.611  1.00 75.95  ? 517  ILE A O   1 
ATOM   4074  C  CB  . ILE A  1  517  ? 14.921  -29.094  -25.982  1.00 76.32  ? 517  ILE A CB  1 
ATOM   4075  C  CG1 . ILE A  1  517  ? 14.059  -27.855  -25.724  1.00 76.59  ? 517  ILE A CG1 1 
ATOM   4076  C  CG2 . ILE A  1  517  ? 16.354  -28.695  -26.298  1.00 76.11  ? 517  ILE A CG2 1 
ATOM   4077  C  CD1 . ILE A  1  517  ? 14.456  -27.084  -24.485  1.00 76.30  ? 517  ILE A CD1 1 
ATOM   4078  N  N   . VAL A  1  518  ? 11.970  -30.400  -27.446  1.00 77.09  ? 518  VAL A N   1 
ATOM   4079  C  CA  . VAL A  1  518  ? 10.672  -30.962  -27.112  1.00 78.08  ? 518  VAL A CA  1 
ATOM   4080  C  C   . VAL A  1  518  ? 9.860   -31.282  -28.365  1.00 77.93  ? 518  VAL A C   1 
ATOM   4081  O  O   . VAL A  1  518  ? 9.168   -30.432  -28.910  1.00 78.32  ? 518  VAL A O   1 
ATOM   4082  C  CB  . VAL A  1  518  ? 9.872   -30.075  -26.163  1.00 79.69  ? 518  VAL A CB  1 
ATOM   4083  C  CG1 . VAL A  1  518  ? 8.452   -30.498  -26.162  1.00 81.25  ? 518  VAL A CG1 1 
ATOM   4084  C  CG2 . VAL A  1  518  ? 10.376  -30.210  -24.799  1.00 81.61  ? 518  VAL A CG2 1 
ATOM   4085  N  N   . SER A  1  519  ? 9.970   -32.529  -28.820  1.00 78.11  ? 519  SER A N   1 
ATOM   4086  C  CA  . SER A  1  519  ? 9.248   -32.997  -30.000  1.00 79.39  ? 519  SER A CA  1 
ATOM   4087  C  C   . SER A  1  519  ? 7.801   -33.233  -29.641  1.00 86.33  ? 519  SER A C   1 
ATOM   4088  O  O   . SER A  1  519  ? 7.496   -33.600  -28.509  1.00 101.74 ? 519  SER A O   1 
ATOM   4089  C  CB  . SER A  1  519  ? 9.856   -34.295  -30.562  1.00 79.15  ? 519  SER A CB  1 
ATOM   4090  O  OG  . SER A  1  519  ? 9.210   -35.456  -30.072  1.00 77.37  ? 519  SER A OG  1 
ATOM   4091  N  N   . PRO A  1  520  ? 6.909   -33.024  -30.610  1.00 79.37  ? 520  PRO A N   1 
ATOM   4092  C  CA  . PRO A  1  520  ? 5.477   -33.041  -30.385  1.00 80.91  ? 520  PRO A CA  1 
ATOM   4093  C  C   . PRO A  1  520  ? 5.012   -34.462  -30.612  1.00 79.89  ? 520  PRO A C   1 
ATOM   4094  O  O   . PRO A  1  520  ? 3.847   -34.803  -30.414  1.00 81.62  ? 520  PRO A O   1 
ATOM   4095  C  CB  . PRO A  1  520  ? 4.944   -32.147  -31.508  1.00 81.49  ? 520  PRO A CB  1 
ATOM   4096  C  CG  . PRO A  1  520  ? 6.164   -31.719  -32.328  1.00 81.95  ? 520  PRO A CG  1 
ATOM   4097  C  CD  . PRO A  1  520  ? 7.190   -32.742  -32.024  1.00 80.59  ? 520  PRO A CD  1 
ATOM   4098  N  N   . GLN A  1  521  ? 5.945   -35.309  -31.029  1.00 83.14  ? 521  GLN A N   1 
ATOM   4099  C  CA  . GLN A  1  521  ? 5.686   -36.733  -31.046  1.00 82.20  ? 521  GLN A CA  1 
ATOM   4100  C  C   . GLN A  1  521  ? 4.923   -37.106  -29.773  1.00 81.94  ? 521  GLN A C   1 
ATOM   4101  O  O   . GLN A  1  521  ? 3.905   -37.784  -29.837  1.00 82.40  ? 521  GLN A O   1 
ATOM   4102  C  CB  . GLN A  1  521  ? 7.003   -37.503  -31.099  1.00 80.66  ? 521  GLN A CB  1 
ATOM   4103  C  CG  . GLN A  1  521  ? 6.831   -38.997  -31.264  1.00 78.81  ? 521  GLN A CG  1 
ATOM   4104  C  CD  . GLN A  1  521  ? 8.139   -39.707  -31.482  1.00 78.30  ? 521  GLN A CD  1 
ATOM   4105  O  OE1 . GLN A  1  521  ? 9.187   -39.076  -31.602  1.00 77.58  ? 521  GLN A OE1 1 
ATOM   4106  N  NE2 . GLN A  1  521  ? 8.091   -41.032  -31.500  1.00 85.38  ? 521  GLN A NE2 1 
ATOM   4107  N  N   . SER A  1  522  ? 5.411   -36.614  -28.633  1.00 80.17  ? 522  SER A N   1 
ATOM   4108  C  CA  . SER A  1  522  ? 4.928   -36.998  -27.316  1.00 78.73  ? 522  SER A CA  1 
ATOM   4109  C  C   . SER A  1  522  ? 4.648   -35.831  -26.385  1.00 80.40  ? 522  SER A C   1 
ATOM   4110  O  O   . SER A  1  522  ? 4.408   -36.035  -25.214  1.00 79.95  ? 522  SER A O   1 
ATOM   4111  C  CB  . SER A  1  522  ? 5.980   -37.874  -26.681  1.00 77.88  ? 522  SER A CB  1 
ATOM   4112  O  OG  . SER A  1  522  ? 6.469   -38.815  -27.638  1.00 78.33  ? 522  SER A OG  1 
ATOM   4113  N  N   . ASN A  1  523  ? 4.682   -34.613  -26.909  1.00 80.18  ? 523  ASN A N   1 
ATOM   4114  C  CA  . ASN A  1  523  ? 4.714   -33.420  -26.079  1.00 80.09  ? 523  ASN A CA  1 
ATOM   4115  C  C   . ASN A  1  523  ? 5.468   -33.738  -24.822  1.00 78.90  ? 523  ASN A C   1 
ATOM   4116  O  O   . ASN A  1  523  ? 4.962   -33.535  -23.732  1.00 79.59  ? 523  ASN A O   1 
ATOM   4117  C  CB  . ASN A  1  523  ? 3.314   -32.983  -25.717  1.00 79.66  ? 523  ASN A CB  1 
ATOM   4118  C  CG  . ASN A  1  523  ? 2.540   -34.084  -25.118  1.00 80.23  ? 523  ASN A CG  1 
ATOM   4119  O  OD1 . ASN A  1  523  ? 1.598   -34.588  -25.713  1.00 81.11  ? 523  ASN A OD1 1 
ATOM   4120  N  ND2 . ASN A  1  523  ? 2.965   -34.519  -23.952  1.00 79.60  ? 523  ASN A ND2 1 
ATOM   4121  N  N   . LYS A  1  524  ? 6.655   -34.310  -24.999  1.00 98.20  ? 524  LYS A N   1 
ATOM   4122  C  CA  . LYS A  1  524  ? 7.599   -34.516  -23.916  1.00 87.48  ? 524  LYS A CA  1 
ATOM   4123  C  C   . LYS A  1  524  ? 8.970   -34.229  -24.479  1.00 77.66  ? 524  LYS A C   1 
ATOM   4124  O  O   . LYS A  1  524  ? 9.171   -34.406  -25.664  1.00 83.32  ? 524  LYS A O   1 
ATOM   4125  C  CB  . LYS A  1  524  ? 7.511   -35.962  -23.367  1.00 85.16  ? 524  LYS A CB  1 
ATOM   4126  C  CG  . LYS A  1  524  ? 6.115   -36.367  -22.756  1.00 89.59  ? 524  LYS A CG  1 
ATOM   4127  C  CD  . LYS A  1  524  ? 5.698   -35.455  -21.574  1.00 95.57  ? 524  LYS A CD  1 
ATOM   4128  C  CE  . LYS A  1  524  ? 4.245   -35.553  -21.158  1.00 99.01  ? 524  LYS A CE  1 
ATOM   4129  N  NZ  . LYS A  1  524  ? 4.143   -36.474  -20.034  1.00 89.79  ? 524  LYS A NZ  1 
ATOM   4130  N  N   . PRO A  1  525  ? 9.899   -33.751  -23.639  1.00 76.08  ? 525  PRO A N   1 
ATOM   4131  C  CA  . PRO A  1  525  ? 11.285  -33.491  -24.008  1.00 79.56  ? 525  PRO A CA  1 
ATOM   4132  C  C   . PRO A  1  525  ? 11.980  -34.692  -24.631  1.00 77.27  ? 525  PRO A C   1 
ATOM   4133  O  O   . PRO A  1  525  ? 11.601  -35.826  -24.400  1.00 76.49  ? 525  PRO A O   1 
ATOM   4134  C  CB  . PRO A  1  525  ? 11.936  -33.165  -22.658  1.00 78.14  ? 525  PRO A CB  1 
ATOM   4135  C  CG  . PRO A  1  525  ? 10.877  -32.609  -21.869  1.00 79.57  ? 525  PRO A CG  1 
ATOM   4136  C  CD  . PRO A  1  525  ? 9.650   -33.362  -22.251  1.00 79.88  ? 525  PRO A CD  1 
ATOM   4137  N  N   . VAL A  1  526  ? 13.016  -34.431  -25.411  1.00 76.80  ? 526  VAL A N   1 
ATOM   4138  C  CA  . VAL A  1  526  ? 13.753  -35.475  -26.066  1.00 76.80  ? 526  VAL A CA  1 
ATOM   4139  C  C   . VAL A  1  526  ? 15.215  -35.409  -25.706  1.00 76.00  ? 526  VAL A C   1 
ATOM   4140  O  O   . VAL A  1  526  ? 15.995  -36.261  -26.119  1.00 75.49  ? 526  VAL A O   1 
ATOM   4141  C  CB  . VAL A  1  526  ? 13.647  -35.355  -27.551  1.00 77.50  ? 526  VAL A CB  1 
ATOM   4142  C  CG1 . VAL A  1  526  ? 14.344  -36.524  -28.201  1.00 77.57  ? 526  VAL A CG1 1 
ATOM   4143  C  CG2 . VAL A  1  526  ? 12.214  -35.325  -27.929  1.00 76.56  ? 526  VAL A CG2 1 
ATOM   4144  N  N   . MET A  1  527  ? 15.602  -34.404  -24.934  1.00 76.03  ? 527  MET A N   1 
ATOM   4145  C  CA  . MET A  1  527  ? 16.962  -34.371  -24.429  1.00 75.67  ? 527  MET A CA  1 
ATOM   4146  C  C   . MET A  1  527  ? 16.924  -34.096  -22.961  1.00 74.83  ? 527  MET A C   1 
ATOM   4147  O  O   . MET A  1  527  ? 16.009  -33.442  -22.457  1.00 76.75  ? 527  MET A O   1 
ATOM   4148  C  CB  . MET A  1  527  ? 17.753  -33.274  -25.096  1.00 76.37  ? 527  MET A CB  1 
ATOM   4149  C  CG  . MET A  1  527  ? 17.408  -33.086  -26.526  1.00 78.16  ? 527  MET A CG  1 
ATOM   4150  S  SD  . MET A  1  527  ? 18.377  -31.759  -27.242  1.00 78.15  ? 527  MET A SD  1 
ATOM   4151  C  CE  . MET A  1  527  ? 17.633  -31.694  -28.890  1.00 79.95  ? 527  MET A CE  1 
ATOM   4152  N  N   . GLY A  1  528  ? 17.934  -34.592  -22.269  1.00 107.15 ? 528  GLY A N   1 
ATOM   4153  C  CA  . GLY A  1  528  ? 17.978  -34.413  -20.840  1.00 74.87  ? 528  GLY A CA  1 
ATOM   4154  C  C   . GLY A  1  528  ? 19.346  -34.767  -20.333  1.00 98.60  ? 528  GLY A C   1 
ATOM   4155  O  O   . GLY A  1  528  ? 20.180  -35.302  -21.055  1.00 73.18  ? 528  GLY A O   1 
ATOM   4156  N  N   . ILE A  1  529  ? 19.578  -34.462  -19.074  1.00 73.53  ? 529  ILE A N   1 
ATOM   4157  C  CA  . ILE A  1  529  ? 20.842  -34.749  -18.473  1.00 73.14  ? 529  ILE A CA  1 
ATOM   4158  C  C   . ILE A  1  529  ? 21.014  -36.242  -18.535  1.00 73.61  ? 529  ILE A C   1 
ATOM   4159  O  O   . ILE A  1  529  ? 20.186  -36.966  -18.009  1.00 73.38  ? 529  ILE A O   1 
ATOM   4160  C  CB  . ILE A  1  529  ? 20.807  -34.334  -17.025  1.00 73.56  ? 529  ILE A CB  1 
ATOM   4161  C  CG1 . ILE A  1  529  ? 21.038  -32.822  -16.909  1.00 76.36  ? 529  ILE A CG1 1 
ATOM   4162  C  CG2 . ILE A  1  529  ? 21.833  -35.111  -16.252  1.00 75.12  ? 529  ILE A CG2 1 
ATOM   4163  C  CD1 . ILE A  1  529  ? 19.884  -31.971  -17.392  1.00 73.73  ? 529  ILE A CD1 1 
ATOM   4164  N  N   . VAL A  1  530  ? 22.067  -36.722  -19.186  1.00 73.64  ? 530  VAL A N   1 
ATOM   4165  C  CA  . VAL A  1  530  ? 22.328  -38.161  -19.167  1.00 73.37  ? 530  VAL A CA  1 
ATOM   4166  C  C   . VAL A  1  530  ? 23.803  -38.477  -19.154  1.00 73.66  ? 530  VAL A C   1 
ATOM   4167  O  O   . VAL A  1  530  ? 24.612  -37.646  -19.541  1.00 72.83  ? 530  VAL A O   1 
ATOM   4168  C  CB  . VAL A  1  530  ? 21.625  -38.935  -20.321  1.00 74.45  ? 530  VAL A CB  1 
ATOM   4169  C  CG1 . VAL A  1  530  ? 21.482  -40.436  -19.977  1.00 74.23  ? 530  VAL A CG1 1 
ATOM   4170  C  CG2 . VAL A  1  530  ? 20.246  -38.336  -20.597  1.00 74.98  ? 530  VAL A CG2 1 
ATOM   4171  N  N   . GLN A  1  531  ? 24.113  -39.693  -18.689  1.00 89.24  ? 531  GLN A N   1 
ATOM   4172  C  CA  . GLN A  1  531  ? 25.474  -40.213  -18.480  1.00 88.30  ? 531  GLN A CA  1 
ATOM   4173  C  C   . GLN A  1  531  ? 26.158  -39.605  -17.253  1.00 90.18  ? 531  GLN A C   1 
ATOM   4174  O  O   . GLN A  1  531  ? 25.500  -39.351  -16.238  1.00 96.69  ? 531  GLN A O   1 
ATOM   4175  C  CB  . GLN A  1  531  ? 26.327  -40.043  -19.716  1.00 84.78  ? 531  GLN A CB  1 
ATOM   4176  C  CG  . GLN A  1  531  ? 25.785  -40.771  -20.894  1.00 83.47  ? 531  GLN A CG  1 
ATOM   4177  C  CD  . GLN A  1  531  ? 26.214  -42.189  -20.919  1.00 74.19  ? 531  GLN A CD  1 
ATOM   4178  O  OE1 . GLN A  1  531  ? 27.378  -42.494  -20.658  1.00 78.04  ? 531  GLN A OE1 1 
ATOM   4179  N  NE2 . GLN A  1  531  ? 25.286  -43.088  -21.251  1.00 84.88  ? 531  GLN A NE2 1 
ATOM   4180  N  N   . ASP A  1  532  ? 27.461  -39.357  -17.345  1.00 95.64  ? 532  ASP A N   1 
ATOM   4181  C  CA  . ASP A  1  532  ? 28.206  -38.954  -16.167  1.00 98.67  ? 532  ASP A CA  1 
ATOM   4182  C  C   . ASP A  1  532  ? 27.661  -37.709  -15.436  1.00 107.59 ? 532  ASP A C   1 
ATOM   4183  O  O   . ASP A  1  532  ? 27.639  -37.671  -14.209  1.00 102.69 ? 532  ASP A O   1 
ATOM   4184  C  CB  . ASP A  1  532  ? 29.696  -38.822  -16.484  1.00 102.83 ? 532  ASP A CB  1 
ATOM   4185  C  CG  . ASP A  1  532  ? 30.013  -37.599  -17.296  1.00 107.51 ? 532  ASP A CG  1 
ATOM   4186  O  OD1 . ASP A  1  532  ? 31.206  -37.236  -17.347  1.00 102.50 ? 532  ASP A OD1 1 
ATOM   4187  O  OD2 . ASP A  1  532  ? 29.087  -36.999  -17.868  1.00 87.74  ? 532  ASP A OD2 1 
ATOM   4188  N  N   . THR A  1  533  ? 27.212  -36.691  -16.164  1.00 74.86  ? 533  THR A N   1 
ATOM   4189  C  CA  . THR A  1  533  ? 26.693  -35.490  -15.499  1.00 74.48  ? 533  THR A CA  1 
ATOM   4190  C  C   . THR A  1  533  ? 25.458  -35.893  -14.678  1.00 73.68  ? 533  THR A C   1 
ATOM   4191  O  O   . THR A  1  533  ? 25.192  -35.297  -13.640  1.00 73.79  ? 533  THR A O   1 
ATOM   4192  C  CB  . THR A  1  533  ? 26.366  -34.314  -16.492  1.00 74.75  ? 533  THR A CB  1 
ATOM   4193  O  OG1 . THR A  1  533  ? 24.967  -34.303  -16.784  1.00 74.59  ? 533  THR A OG1 1 
ATOM   4194  C  CG2 . THR A  1  533  ? 27.161  -34.415  -17.808  1.00 74.91  ? 533  THR A CG2 1 
ATOM   4195  N  N   . LEU A  1  534  ? 24.749  -36.933  -15.119  1.00 79.73  ? 534  LEU A N   1 
ATOM   4196  C  CA  . LEU A  1  534  ? 23.581  -37.443  -14.402  1.00 76.21  ? 534  LEU A CA  1 
ATOM   4197  C  C   . LEU A  1  534  ? 23.978  -38.267  -13.176  1.00 81.92  ? 534  LEU A C   1 
ATOM   4198  O  O   . LEU A  1  534  ? 23.522  -37.985  -12.078  1.00 107.49 ? 534  LEU A O   1 
ATOM   4199  C  CB  . LEU A  1  534  ? 22.728  -38.287  -15.323  1.00 74.23  ? 534  LEU A CB  1 
ATOM   4200  C  CG  . LEU A  1  534  ? 21.256  -38.387  -14.957  1.00 75.59  ? 534  LEU A CG  1 
ATOM   4201  C  CD1 . LEU A  1  534  ? 20.640  -39.608  -15.646  1.00 74.11  ? 534  LEU A CD1 1 
ATOM   4202  C  CD2 . LEU A  1  534  ? 20.989  -38.429  -13.453  1.00 83.49  ? 534  LEU A CD2 1 
ATOM   4203  N  N   . ALA A  1  535  ? 24.802  -39.285  -13.363  1.00 73.25  ? 535  ALA A N   1 
ATOM   4204  C  CA  . ALA A  1  535  ? 25.309  -40.056  -12.243  1.00 73.54  ? 535  ALA A CA  1 
ATOM   4205  C  C   . ALA A  1  535  ? 25.811  -39.093  -11.179  1.00 74.12  ? 535  ALA A C   1 
ATOM   4206  O  O   . ALA A  1  535  ? 25.655  -39.320  -9.973   1.00 73.61  ? 535  ALA A O   1 
ATOM   4207  C  CB  . ALA A  1  535  ? 26.420  -40.943  -12.706  1.00 73.59  ? 535  ALA A CB  1 
ATOM   4208  N  N   . GLY A  1  536  ? 26.414  -38.009  -11.648  1.00 73.29  ? 536  GLY A N   1 
ATOM   4209  C  CA  . GLY A  1  536  ? 26.996  -36.986  -10.797  1.00 73.87  ? 536  GLY A CA  1 
ATOM   4210  C  C   . GLY A  1  536  ? 25.958  -36.232  -9.990   1.00 74.55  ? 536  GLY A C   1 
ATOM   4211  O  O   . GLY A  1  536  ? 26.140  -36.008  -8.795   1.00 74.35  ? 536  GLY A O   1 
ATOM   4212  N  N   . VAL A  1  537  ? 24.861  -35.844  -10.629  1.00 75.17  ? 537  VAL A N   1 
ATOM   4213  C  CA  . VAL A  1  537  ? 23.833  -35.109  -9.926   1.00 76.59  ? 537  VAL A CA  1 
ATOM   4214  C  C   . VAL A  1  537  ? 23.406  -35.785  -8.639   1.00 75.61  ? 537  VAL A C   1 
ATOM   4215  O  O   . VAL A  1  537  ? 23.578  -35.216  -7.565   1.00 79.13  ? 537  VAL A O   1 
ATOM   4216  C  CB  . VAL A  1  537  ? 22.653  -34.850  -10.790  1.00 76.37  ? 537  VAL A CB  1 
ATOM   4217  C  CG1 . VAL A  1  537  ? 21.433  -34.733  -9.935   1.00 77.63  ? 537  VAL A CG1 1 
ATOM   4218  C  CG2 . VAL A  1  537  ? 22.895  -33.564  -11.567  1.00 80.19  ? 537  VAL A CG2 1 
ATOM   4219  N  N   . ARG A  1  538  ? 22.854  -36.988  -8.727   1.00 87.67  ? 538  ARG A N   1 
ATOM   4220  C  CA  . ARG A  1  538  ? 22.597  -37.762  -7.523   1.00 84.08  ? 538  ARG A CA  1 
ATOM   4221  C  C   . ARG A  1  538  ? 23.758  -37.581  -6.539   1.00 99.48  ? 538  ARG A C   1 
ATOM   4222  O  O   . ARG A  1  538  ? 23.597  -36.935  -5.499   1.00 100.30 ? 538  ARG A O   1 
ATOM   4223  C  CB  . ARG A  1  538  ? 22.427  -39.240  -7.885   1.00 78.09  ? 538  ARG A CB  1 
ATOM   4224  C  CG  . ARG A  1  538  ? 21.865  -40.106  -6.761   1.00 82.27  ? 538  ARG A CG  1 
ATOM   4225  C  CD  . ARG A  1  538  ? 22.458  -41.509  -6.771   1.00 75.85  ? 538  ARG A CD  1 
ATOM   4226  N  NE  . ARG A  1  538  ? 22.224  -42.177  -5.502   1.00 86.51  ? 538  ARG A NE  1 
ATOM   4227  C  CZ  . ARG A  1  538  ? 23.183  -42.524  -4.651   1.00 89.10  ? 538  ARG A CZ  1 
ATOM   4228  N  NH1 . ARG A  1  538  ? 24.452  -42.269  -4.940   1.00 74.87  ? 538  ARG A NH1 1 
ATOM   4229  N  NH2 . ARG A  1  538  ? 22.872  -43.135  -3.522   1.00 87.62  ? 538  ARG A NH2 1 
ATOM   4230  N  N   . LYS A  1  539  ? 24.926  -38.131  -6.881   1.00 106.77 ? 539  LYS A N   1 
ATOM   4231  C  CA  . LYS A  1  539  ? 26.055  -38.112  -5.968   1.00 76.88  ? 539  LYS A CA  1 
ATOM   4232  C  C   . LYS A  1  539  ? 26.589  -36.684  -5.750   1.00 84.26  ? 539  LYS A C   1 
ATOM   4233  O  O   . LYS A  1  539  ? 27.762  -36.393  -6.012   1.00 109.05 ? 539  LYS A O   1 
ATOM   4234  C  CB  . LYS A  1  539  ? 27.137  -39.108  -6.430   1.00 75.93  ? 539  LYS A CB  1 
ATOM   4235  C  CG  . LYS A  1  539  ? 27.737  -39.878  -5.246   1.00 77.40  ? 539  LYS A CG  1 
ATOM   4236  C  CD  . LYS A  1  539  ? 28.972  -40.704  -5.581   1.00 77.33  ? 539  LYS A CD  1 
ATOM   4237  C  CE  . LYS A  1  539  ? 29.643  -41.218  -4.288   1.00 78.96  ? 539  LYS A CE  1 
ATOM   4238  N  NZ  . LYS A  1  539  ? 31.103  -41.469  -4.472   1.00 117.00 ? 539  LYS A NZ  1 
ATOM   4239  N  N   . PHE A  1  540  ? 25.715  -35.818  -5.242   1.00 83.20  ? 540  PHE A N   1 
ATOM   4240  C  CA  . PHE A  1  540  ? 26.019  -34.396  -5.136   1.00 78.96  ? 540  PHE A CA  1 
ATOM   4241  C  C   . PHE A  1  540  ? 24.779  -33.599  -4.791   1.00 78.32  ? 540  PHE A C   1 
ATOM   4242  O  O   . PHE A  1  540  ? 24.867  -32.459  -4.355   1.00 78.79  ? 540  PHE A O   1 
ATOM   4243  C  CB  . PHE A  1  540  ? 26.558  -33.846  -6.452   1.00 77.79  ? 540  PHE A CB  1 
ATOM   4244  C  CG  . PHE A  1  540  ? 26.619  -32.322  -6.504   1.00 82.34  ? 540  PHE A CG  1 
ATOM   4245  C  CD1 . PHE A  1  540  ? 25.560  -31.573  -7.013   1.00 82.10  ? 540  PHE A CD1 1 
ATOM   4246  C  CD2 . PHE A  1  540  ? 27.739  -31.652  -6.046   1.00 82.24  ? 540  PHE A CD2 1 
ATOM   4247  C  CE1 . PHE A  1  540  ? 25.635  -30.192  -7.069   1.00 82.33  ? 540  PHE A CE1 1 
ATOM   4248  C  CE2 . PHE A  1  540  ? 27.806  -30.286  -6.111   1.00 78.20  ? 540  PHE A CE2 1 
ATOM   4249  C  CZ  . PHE A  1  540  ? 26.755  -29.558  -6.621   1.00 78.50  ? 540  PHE A CZ  1 
ATOM   4250  N  N   . SER A  1  541  ? 23.621  -34.173  -5.039   1.00 75.56  ? 541  SER A N   1 
ATOM   4251  C  CA  . SER A  1  541  ? 22.411  -33.515  -4.632   1.00 76.29  ? 541  SER A CA  1 
ATOM   4252  C  C   . SER A  1  541  ? 22.034  -34.096  -3.287   1.00 76.93  ? 541  SER A C   1 
ATOM   4253  O  O   . SER A  1  541  ? 20.996  -33.766  -2.715   1.00 77.26  ? 541  SER A O   1 
ATOM   4254  C  CB  . SER A  1  541  ? 21.313  -33.743  -5.652   1.00 76.27  ? 541  SER A CB  1 
ATOM   4255  O  OG  . SER A  1  541  ? 20.859  -35.093  -5.619   1.00 75.41  ? 541  SER A OG  1 
ATOM   4256  N  N   . LEU A  1  542  ? 22.898  -34.970  -2.780   1.00 90.59  ? 542  LEU A N   1 
ATOM   4257  C  CA  . LEU A  1  542  ? 22.655  -35.605  -1.493   1.00 91.60  ? 542  LEU A CA  1 
ATOM   4258  C  C   . LEU A  1  542  ? 22.839  -34.588  -0.399   1.00 107.59 ? 542  LEU A C   1 
ATOM   4259  O  O   . LEU A  1  542  ? 23.696  -33.719  -0.501   1.00 78.67  ? 542  LEU A O   1 
ATOM   4260  C  CB  . LEU A  1  542  ? 23.640  -36.738  -1.291   1.00 89.39  ? 542  LEU A CB  1 
ATOM   4261  C  CG  . LEU A  1  542  ? 23.434  -37.904  -2.243   1.00 84.63  ? 542  LEU A CG  1 
ATOM   4262  C  CD1 . LEU A  1  542  ? 24.683  -38.739  -2.321   1.00 82.64  ? 542  LEU A CD1 1 
ATOM   4263  C  CD2 . LEU A  1  542  ? 22.261  -38.726  -1.777   1.00 83.88  ? 542  LEU A CD2 1 
ATOM   4264  N  N   . ARG A  1  543  ? 22.046  -34.677  0.650    1.00 85.92  ? 543  ARG A N   1 
ATOM   4265  C  CA  . ARG A  1  543  ? 22.268  -33.773  1.748    1.00 86.46  ? 543  ARG A CA  1 
ATOM   4266  C  C   . ARG A  1  543  ? 23.360  -34.341  2.647    1.00 92.77  ? 543  ARG A C   1 
ATOM   4267  O  O   . ARG A  1  543  ? 23.446  -33.982  3.821    1.00 95.36  ? 543  ARG A O   1 
ATOM   4268  C  CB  . ARG A  1  543  ? 21.002  -33.587  2.559    1.00 84.42  ? 543  ARG A CB  1 
ATOM   4269  C  CG  . ARG A  1  543  ? 20.554  -34.865  3.199    1.00 84.66  ? 543  ARG A CG  1 
ATOM   4270  C  CD  . ARG A  1  543  ? 19.541  -34.624  4.291    1.00 86.23  ? 543  ARG A CD  1 
ATOM   4271  N  NE  . ARG A  1  543  ? 18.926  -35.871  4.711    1.00 95.37  ? 543  ARG A NE  1 
ATOM   4272  C  CZ  . ARG A  1  543  ? 17.634  -36.144  4.587    1.00 87.88  ? 543  ARG A CZ  1 
ATOM   4273  N  NH1 . ARG A  1  543  ? 16.802  -35.245  4.063    1.00 89.54  ? 543  ARG A NH1 1 
ATOM   4274  N  NH2 . ARG A  1  543  ? 17.167  -37.312  5.005    1.00 88.20  ? 543  ARG A NH2 1 
ATOM   4275  N  N   . ASP A  1  544  ? 24.182  -35.238  2.117    1.00 111.57 ? 544  ASP A N   1 
ATOM   4276  C  CA  . ASP A  1  544  ? 25.336  -35.751  2.861    1.00 113.36 ? 544  ASP A CA  1 
ATOM   4277  C  C   . ASP A  1  544  ? 26.563  -34.985  2.381    1.00 131.23 ? 544  ASP A C   1 
ATOM   4278  O  O   . ASP A  1  544  ? 27.625  -35.008  3.013    1.00 128.38 ? 544  ASP A O   1 
ATOM   4279  C  CB  . ASP A  1  544  ? 25.480  -37.263  2.624    1.00 113.57 ? 544  ASP A CB  1 
ATOM   4280  C  CG  . ASP A  1  544  ? 26.842  -37.816  3.036    1.00 107.38 ? 544  ASP A CG  1 
ATOM   4281  O  OD1 . ASP A  1  544  ? 27.268  -37.578  4.189    1.00 95.97  ? 544  ASP A OD1 1 
ATOM   4282  O  OD2 . ASP A  1  544  ? 27.488  -38.504  2.198    1.00 141.31 ? 544  ASP A OD2 1 
ATOM   4283  N  N   . ASN A  1  545  ? 26.399  -34.276  1.266    1.00 81.45  ? 545  ASN A N   1 
ATOM   4284  C  CA  . ASN A  1  545  ? 27.528  -33.621  0.627    1.00 86.74  ? 545  ASN A CA  1 
ATOM   4285  C  C   . ASN A  1  545  ? 27.540  -32.143  0.905    1.00 82.19  ? 545  ASN A C   1 
ATOM   4286  O  O   . ASN A  1  545  ? 26.755  -31.401  0.306    1.00 90.02  ? 545  ASN A O   1 
ATOM   4287  C  CB  . ASN A  1  545  ? 27.479  -33.834  -0.888   1.00 85.62  ? 545  ASN A CB  1 
ATOM   4288  C  CG  . ASN A  1  545  ? 28.650  -33.186  -1.607   1.00 77.32  ? 545  ASN A CG  1 
ATOM   4289  O  OD1 . ASN A  1  545  ? 28.496  -32.651  -2.705   1.00 82.60  ? 545  ASN A OD1 1 
ATOM   4290  N  ND2 . ASN A  1  545  ? 29.829  -33.231  -0.990   1.00 78.87  ? 545  ASN A ND2 1 
ATOM   4291  N  N   . PHE A  1  546  ? 28.433  -31.718  1.795    1.00 84.64  ? 546  PHE A N   1 
ATOM   4292  C  CA  . PHE A  1  546  ? 28.639  -30.292  2.044    1.00 89.95  ? 546  PHE A CA  1 
ATOM   4293  C  C   . PHE A  1  546  ? 29.795  -29.767  1.214    1.00 94.56  ? 546  PHE A C   1 
ATOM   4294  O  O   . PHE A  1  546  ? 30.696  -30.527  0.829    1.00 91.71  ? 546  PHE A O   1 
ATOM   4295  C  CB  . PHE A  1  546  ? 28.959  -30.011  3.507    1.00 93.08  ? 546  PHE A CB  1 
ATOM   4296  C  CG  . PHE A  1  546  ? 27.958  -30.541  4.459    1.00 89.90  ? 546  PHE A CG  1 
ATOM   4297  C  CD1 . PHE A  1  546  ? 28.335  -31.394  5.463    1.00 97.58  ? 546  PHE A CD1 1 
ATOM   4298  C  CD2 . PHE A  1  546  ? 26.643  -30.168  4.366    1.00 87.21  ? 546  PHE A CD2 1 
ATOM   4299  C  CE1 . PHE A  1  546  ? 27.402  -31.879  6.344    1.00 90.49  ? 546  PHE A CE1 1 
ATOM   4300  C  CE2 . PHE A  1  546  ? 25.721  -30.639  5.244    1.00 86.93  ? 546  PHE A CE2 1 
ATOM   4301  C  CZ  . PHE A  1  546  ? 26.095  -31.494  6.229    1.00 87.89  ? 546  PHE A CZ  1 
ATOM   4302  N  N   . LEU A  1  547  ? 29.784  -28.464  0.976    1.00 82.48  ? 547  LEU A N   1 
ATOM   4303  C  CA  . LEU A  1  547  ? 30.847  -27.830  0.235    1.00 81.15  ? 547  LEU A CA  1 
ATOM   4304  C  C   . LEU A  1  547  ? 31.692  -26.923  1.118    1.00 80.69  ? 547  LEU A C   1 
ATOM   4305  O  O   . LEU A  1  547  ? 31.174  -26.072  1.828    1.00 81.03  ? 547  LEU A O   1 
ATOM   4306  C  CB  . LEU A  1  547  ? 30.259  -27.067  -0.937   1.00 80.67  ? 547  LEU A CB  1 
ATOM   4307  C  CG  . LEU A  1  547  ? 29.783  -28.049  -1.990   1.00 78.21  ? 547  LEU A CG  1 
ATOM   4308  C  CD1 . LEU A  1  547  ? 29.570  -27.371  -3.319   1.00 78.04  ? 547  LEU A CD1 1 
ATOM   4309  C  CD2 . LEU A  1  547  ? 30.866  -29.081  -2.100   1.00 78.31  ? 547  LEU A CD2 1 
ATOM   4310  N  N   . THR A  1  548  ? 32.999  -27.152  1.096    1.00 80.55  ? 548  THR A N   1 
ATOM   4311  C  CA  . THR A  1  548  ? 33.923  -26.282  1.809    1.00 81.47  ? 548  THR A CA  1 
ATOM   4312  C  C   . THR A  1  548  ? 33.911  -24.915  1.162    1.00 92.32  ? 548  THR A C   1 
ATOM   4313  O  O   . THR A  1  548  ? 33.893  -24.793  -0.073   1.00 81.04  ? 548  THR A O   1 
ATOM   4314  C  CB  . THR A  1  548  ? 35.382  -26.825  1.799    1.00 90.90  ? 548  THR A CB  1 
ATOM   4315  O  OG1 . THR A  1  548  ? 36.205  -26.061  2.697    1.00 93.84  ? 548  THR A OG1 1 
ATOM   4316  C  CG2 . THR A  1  548  ? 35.994  -26.751  0.398    1.00 81.34  ? 548  THR A CG2 1 
ATOM   4317  N  N   . ARG A  1  549  ? 33.931  -23.884  2.006    1.00 118.62 ? 549  ARG A N   1 
ATOM   4318  C  CA  . ARG A  1  549  ? 33.995  -22.514  1.530    1.00 97.23  ? 549  ARG A CA  1 
ATOM   4319  C  C   . ARG A  1  549  ? 35.070  -22.389  0.450    1.00 118.41 ? 549  ARG A C   1 
ATOM   4320  O  O   . ARG A  1  549  ? 34.957  -21.548  -0.432   1.00 138.68 ? 549  ARG A O   1 
ATOM   4321  C  CB  . ARG A  1  549  ? 34.299  -21.558  2.683    1.00 147.03 ? 549  ARG A CB  1 
ATOM   4322  C  CG  . ARG A  1  549  ? 34.174  -20.093  2.305    1.00 119.28 ? 549  ARG A CG  1 
ATOM   4323  C  CD  . ARG A  1  549  ? 34.435  -19.163  3.479    1.00 136.10 ? 549  ARG A CD  1 
ATOM   4324  N  NE  . ARG A  1  549  ? 35.842  -19.138  3.858    1.00 125.95 ? 549  ARG A NE  1 
ATOM   4325  C  CZ  . ARG A  1  549  ? 36.797  -18.580  3.124    1.00 131.33 ? 549  ARG A CZ  1 
ATOM   4326  N  NH1 . ARG A  1  549  ? 36.505  -18.025  1.955    1.00 138.61 ? 549  ARG A NH1 1 
ATOM   4327  N  NH2 . ARG A  1  549  ? 38.043  -18.590  3.557    1.00 156.48 ? 549  ARG A NH2 1 
ATOM   4328  N  N   . ASN A  1  550  ? 36.104  -23.232  0.531    1.00 112.44 ? 550  ASN A N   1 
ATOM   4329  C  CA  . ASN A  1  550  ? 37.230  -23.178  -0.398   1.00 146.02 ? 550  ASN A CA  1 
ATOM   4330  C  C   . ASN A  1  550  ? 36.795  -23.210  -1.852   1.00 124.43 ? 550  ASN A C   1 
ATOM   4331  O  O   . ASN A  1  550  ? 37.581  -22.886  -2.743   1.00 135.11 ? 550  ASN A O   1 
ATOM   4332  C  CB  . ASN A  1  550  ? 38.216  -24.312  -0.133   1.00 165.96 ? 550  ASN A CB  1 
ATOM   4333  C  CG  . ASN A  1  550  ? 38.838  -24.244  1.251    1.00 116.23 ? 550  ASN A CG  1 
ATOM   4334  O  OD1 . ASN A  1  550  ? 39.231  -25.265  1.815    1.00 138.27 ? 550  ASN A OD1 1 
ATOM   4335  N  ND2 . ASN A  1  550  ? 38.923  -23.043  1.803    1.00 150.37 ? 550  ASN A ND2 1 
ATOM   4336  N  N   . ALA A  1  551  ? 35.544  -23.600  -2.074   1.00 84.18  ? 551  ALA A N   1 
ATOM   4337  C  CA  . ALA A  1  551  ? 34.936  -23.566  -3.389   1.00 81.84  ? 551  ALA A CA  1 
ATOM   4338  C  C   . ALA A  1  551  ? 33.916  -24.653  -3.359   1.00 83.21  ? 551  ALA A C   1 
ATOM   4339  O  O   . ALA A  1  551  ? 34.314  -25.777  -3.148   1.00 79.58  ? 551  ALA A O   1 
ATOM   4340  C  CB  . ALA A  1  551  ? 35.958  -23.884  -4.435   1.00 100.38 ? 551  ALA A CB  1 
ATOM   4341  N  N   . VAL A  1  552  ? 32.622  -24.402  -3.556   1.00 80.14  ? 552  VAL A N   1 
ATOM   4342  C  CA  . VAL A  1  552  ? 31.971  -23.110  -3.839   1.00 81.50  ? 552  VAL A CA  1 
ATOM   4343  C  C   . VAL A  1  552  ? 32.660  -22.149  -4.785   1.00 79.65  ? 552  VAL A C   1 
ATOM   4344  O  O   . VAL A  1  552  ? 32.437  -22.198  -5.997   1.00 79.65  ? 552  VAL A O   1 
ATOM   4345  C  CB  . VAL A  1  552  ? 31.611  -22.349  -2.601   1.00 80.86  ? 552  VAL A CB  1 
ATOM   4346  C  CG1 . VAL A  1  552  ? 30.247  -21.716  -2.804   1.00 81.58  ? 552  VAL A CG1 1 
ATOM   4347  C  CG2 . VAL A  1  552  ? 31.596  -23.278  -1.443   1.00 80.43  ? 552  VAL A CG2 1 
ATOM   4348  N  N   . MET A  1  553  ? 33.458  -21.247  -4.231   1.00 100.13 ? 553  MET A N   1 
ATOM   4349  C  CA  . MET A  1  553  ? 34.130  -20.265  -5.057   1.00 105.88 ? 553  MET A CA  1 
ATOM   4350  C  C   . MET A  1  553  ? 34.503  -20.873  -6.409   1.00 130.77 ? 553  MET A C   1 
ATOM   4351  O  O   . MET A  1  553  ? 33.856  -20.584  -7.429   1.00 95.29  ? 553  MET A O   1 
ATOM   4352  C  CB  . MET A  1  553  ? 35.343  -19.702  -4.330   1.00 124.54 ? 553  MET A CB  1 
ATOM   4353  C  CG  . MET A  1  553  ? 34.959  -19.075  -3.015   1.00 111.36 ? 553  MET A CG  1 
ATOM   4354  S  SD  . MET A  1  553  ? 36.169  -17.921  -2.360   1.00 119.45 ? 553  MET A SD  1 
ATOM   4355  C  CE  . MET A  1  553  ? 37.648  -18.931  -2.377   1.00 304.62 ? 553  MET A CE  1 
ATOM   4356  N  N   . ASN A  1  554  ? 35.498  -21.749  -6.421   1.00 81.17  ? 554  ASN A N   1 
ATOM   4357  C  CA  . ASN A  1  554  ? 35.937  -22.289  -7.677   1.00 138.50 ? 554  ASN A CA  1 
ATOM   4358  C  C   . ASN A  1  554  ? 34.760  -22.625  -8.599   1.00 92.87  ? 554  ASN A C   1 
ATOM   4359  O  O   . ASN A  1  554  ? 34.739  -22.177  -9.748   1.00 103.60 ? 554  ASN A O   1 
ATOM   4360  C  CB  . ASN A  1  554  ? 36.813  -23.488  -7.436   1.00 125.36 ? 554  ASN A CB  1 
ATOM   4361  C  CG  . ASN A  1  554  ? 37.805  -23.681  -8.534   1.00 134.47 ? 554  ASN A CG  1 
ATOM   4362  O  OD1 . ASN A  1  554  ? 37.503  -23.426  -9.698   1.00 89.16  ? 554  ASN A OD1 1 
ATOM   4363  N  ND2 . ASN A  1  554  ? 39.004  -24.124  -8.181   1.00 90.45  ? 554  ASN A ND2 1 
ATOM   4364  N  N   . ILE A  1  555  ? 33.766  -23.355  -8.085   1.00 81.76  ? 555  ILE A N   1 
ATOM   4365  C  CA  . ILE A  1  555  ? 32.681  -23.863  -8.937   1.00 78.00  ? 555  ILE A CA  1 
ATOM   4366  C  C   . ILE A  1  555  ? 31.669  -22.796  -9.326   1.00 77.78  ? 555  ILE A C   1 
ATOM   4367  O  O   . ILE A  1  555  ? 30.805  -23.019  -10.168  1.00 78.44  ? 555  ILE A O   1 
ATOM   4368  C  CB  . ILE A  1  555  ? 31.924  -25.087  -8.321   1.00 77.38  ? 555  ILE A CB  1 
ATOM   4369  C  CG1 . ILE A  1  555  ? 30.764  -24.644  -7.458   1.00 78.76  ? 555  ILE A CG1 1 
ATOM   4370  C  CG2 . ILE A  1  555  ? 32.834  -25.990  -7.546   1.00 77.69  ? 555  ILE A CG2 1 
ATOM   4371  C  CD1 . ILE A  1  555  ? 29.649  -25.632  -7.470   1.00 81.60  ? 555  ILE A CD1 1 
ATOM   4372  N  N   . MET A  1  556  ? 31.783  -21.626  -8.723   1.00 87.46  ? 556  MET A N   1 
ATOM   4373  C  CA  . MET A  1  556  ? 30.862  -20.562  -9.056   1.00 81.13  ? 556  MET A CA  1 
ATOM   4374  C  C   . MET A  1  556  ? 31.156  -19.954  -10.428  1.00 79.10  ? 556  MET A C   1 
ATOM   4375  O  O   . MET A  1  556  ? 30.329  -19.199  -10.936  1.00 83.97  ? 556  MET A O   1 
ATOM   4376  C  CB  . MET A  1  556  ? 30.866  -19.489  -7.970   1.00 90.08  ? 556  MET A CB  1 
ATOM   4377  C  CG  . MET A  1  556  ? 30.157  -19.894  -6.717   1.00 85.65  ? 556  MET A CG  1 
ATOM   4378  S  SD  . MET A  1  556  ? 28.375  -20.011  -6.920   1.00 88.69  ? 556  MET A SD  1 
ATOM   4379  C  CE  . MET A  1  556  ? 27.868  -18.308  -7.028   1.00 87.14  ? 556  MET A CE  1 
ATOM   4380  N  N   . LEU A  1  557  ? 32.292  -20.289  -11.042  1.00 81.35  ? 557  LEU A N   1 
ATOM   4381  C  CA  . LEU A  1  557  ? 32.661  -19.655  -12.314  1.00 82.45  ? 557  LEU A CA  1 
ATOM   4382  C  C   . LEU A  1  557  ? 31.980  -20.295  -13.508  1.00 78.28  ? 557  LEU A C   1 
ATOM   4383  O  O   . LEU A  1  557  ? 32.246  -19.942  -14.659  1.00 78.52  ? 557  LEU A O   1 
ATOM   4384  C  CB  . LEU A  1  557  ? 34.160  -19.657  -12.532  1.00 80.96  ? 557  LEU A CB  1 
ATOM   4385  C  CG  . LEU A  1  557  ? 34.967  -19.282  -11.316  1.00 89.68  ? 557  LEU A CG  1 
ATOM   4386  C  CD1 . LEU A  1  557  ? 36.419  -19.160  -11.710  1.00 97.05  ? 557  LEU A CD1 1 
ATOM   4387  C  CD2 . LEU A  1  557  ? 34.441  -18.000  -10.760  1.00 85.03  ? 557  LEU A CD2 1 
ATOM   4388  N  N   . TRP A  1  558  ? 31.118  -21.253  -13.216  1.00 87.43  ? 558  TRP A N   1 
ATOM   4389  C  CA  . TRP A  1  558  ? 30.157  -21.679  -14.189  1.00 86.14  ? 558  TRP A CA  1 
ATOM   4390  C  C   . TRP A  1  558  ? 28.774  -21.306  -13.734  1.00 83.50  ? 558  TRP A C   1 
ATOM   4391  O  O   . TRP A  1  558  ? 28.463  -21.344  -12.554  1.00 84.64  ? 558  TRP A O   1 
ATOM   4392  C  CB  . TRP A  1  558  ? 30.224  -23.169  -14.385  1.00 102.34 ? 558  TRP A CB  1 
ATOM   4393  C  CG  . TRP A  1  558  ? 31.404  -23.608  -15.210  1.00 78.31  ? 558  TRP A CG  1 
ATOM   4394  C  CD1 . TRP A  1  558  ? 31.472  -23.729  -16.595  1.00 77.37  ? 558  TRP A CD1 1 
ATOM   4395  C  CD2 . TRP A  1  558  ? 32.687  -24.014  -14.717  1.00 85.70  ? 558  TRP A CD2 1 
ATOM   4396  N  NE1 . TRP A  1  558  ? 32.733  -24.180  -16.975  1.00 83.42  ? 558  TRP A NE1 1 
ATOM   4397  C  CE2 . TRP A  1  558  ? 33.489  -24.361  -15.843  1.00 86.95  ? 558  TRP A CE2 1 
ATOM   4398  C  CE3 . TRP A  1  558  ? 33.236  -24.111  -13.438  1.00 82.09  ? 558  TRP A CE3 1 
ATOM   4399  C  CZ2 . TRP A  1  558  ? 34.797  -24.784  -15.707  1.00 84.22  ? 558  TRP A CZ2 1 
ATOM   4400  C  CZ3 . TRP A  1  558  ? 34.507  -24.534  -13.315  1.00 84.91  ? 558  TRP A CZ3 1 
ATOM   4401  C  CH2 . TRP A  1  558  ? 35.278  -24.877  -14.432  1.00 86.25  ? 558  TRP A CH2 1 
ATOM   4402  N  N   . VAL A  1  559  ? 27.944  -20.931  -14.700  1.00 80.44  ? 559  VAL A N   1 
ATOM   4403  C  CA  . VAL A  1  559  ? 26.557  -20.577  -14.424  1.00 81.51  ? 559  VAL A CA  1 
ATOM   4404  C  C   . VAL A  1  559  ? 25.650  -20.319  -15.674  1.00 79.50  ? 559  VAL A C   1 
ATOM   4405  O  O   . VAL A  1  559  ? 24.445  -20.561  -15.627  1.00 103.30 ? 559  VAL A O   1 
ATOM   4406  C  CB  . VAL A  1  559  ? 26.483  -19.479  -13.352  1.00 92.61  ? 559  VAL A CB  1 
ATOM   4407  C  CG1 . VAL A  1  559  ? 26.486  -20.110  -11.964  1.00 85.17  ? 559  VAL A CG1 1 
ATOM   4408  C  CG2 . VAL A  1  559  ? 27.655  -18.551  -13.493  1.00 86.26  ? 559  VAL A CG2 1 
ATOM   4409  N  N   . PRO A  1  560  ? 26.215  -19.843  -16.786  1.00 130.97 ? 560  PRO A N   1 
ATOM   4410  C  CA  . PRO A  1  560  ? 27.514  -19.196  -16.882  1.00 125.82 ? 560  PRO A CA  1 
ATOM   4411  C  C   . PRO A  1  560  ? 27.285  -17.715  -16.633  1.00 160.90 ? 560  PRO A C   1 
ATOM   4412  O  O   . PRO A  1  560  ? 28.243  -16.948  -16.555  1.00 215.17 ? 560  PRO A O   1 
ATOM   4413  C  CB  . PRO A  1  560  ? 27.932  -19.447  -18.344  1.00 158.73 ? 560  PRO A CB  1 
ATOM   4414  C  CG  . PRO A  1  560  ? 26.912  -20.424  -18.910  1.00 140.06 ? 560  PRO A CG  1 
ATOM   4415  C  CD  . PRO A  1  560  ? 25.679  -20.174  -18.118  1.00 120.68 ? 560  PRO A CD  1 
ATOM   4416  N  N   . ASP A  1  561  ? 26.012  -17.333  -16.500  1.00 120.61 ? 561  ASP A N   1 
ATOM   4417  C  CA  . ASP A  1  561  ? 25.622  -15.934  -16.318  1.00 151.92 ? 561  ASP A CA  1 
ATOM   4418  C  C   . ASP A  1  561  ? 25.436  -15.622  -14.835  1.00 140.17 ? 561  ASP A C   1 
ATOM   4419  O  O   . ASP A  1  561  ? 24.335  -15.731  -14.289  1.00 125.02 ? 561  ASP A O   1 
ATOM   4420  C  CB  . ASP A  1  561  ? 24.344  -15.607  -17.092  1.00 122.25 ? 561  ASP A CB  1 
ATOM   4421  C  CG  . ASP A  1  561  ? 24.572  -15.526  -18.589  1.00 180.28 ? 561  ASP A CG  1 
ATOM   4422  O  OD1 . ASP A  1  561  ? 25.706  -15.799  -19.041  1.00 227.13 ? 561  ASP A OD1 1 
ATOM   4423  O  OD2 . ASP A  1  561  ? 23.613  -15.197  -19.321  1.00 180.96 ? 561  ASP A OD2 1 
ATOM   4424  N  N   . TRP A  1  562  ? 26.518  -15.209  -14.189  1.00 80.47  ? 562  TRP A N   1 
ATOM   4425  C  CA  . TRP A  1  562  ? 26.543  -15.165  -12.735  1.00 81.23  ? 562  TRP A CA  1 
ATOM   4426  C  C   . TRP A  1  562  ? 26.086  -13.852  -12.177  1.00 82.26  ? 562  TRP A C   1 
ATOM   4427  O  O   . TRP A  1  562  ? 26.626  -12.809  -12.526  1.00 83.53  ? 562  TRP A O   1 
ATOM   4428  C  CB  . TRP A  1  562  ? 27.952  -15.480  -12.203  1.00 82.10  ? 562  TRP A CB  1 
ATOM   4429  C  CG  . TRP A  1  562  ? 28.031  -15.605  -10.699  1.00 81.66  ? 562  TRP A CG  1 
ATOM   4430  C  CD1 . TRP A  1  562  ? 26.987  -15.773  -9.833   1.00 80.22  ? 562  TRP A CD1 1 
ATOM   4431  C  CD2 . TRP A  1  562  ? 29.219  -15.613  -9.900   1.00 82.42  ? 562  TRP A CD2 1 
ATOM   4432  N  NE1 . TRP A  1  562  ? 27.452  -15.854  -8.544   1.00 80.52  ? 562  TRP A NE1 1 
ATOM   4433  C  CE2 . TRP A  1  562  ? 28.818  -15.764  -8.558   1.00 81.33  ? 562  TRP A CE2 1 
ATOM   4434  C  CE3 . TRP A  1  562  ? 30.576  -15.501  -10.185  1.00 81.47  ? 562  TRP A CE3 1 
ATOM   4435  C  CZ2 . TRP A  1  562  ? 29.726  -15.797  -7.509   1.00 82.11  ? 562  TRP A CZ2 1 
ATOM   4436  C  CZ3 . TRP A  1  562  ? 31.471  -15.537  -9.135   1.00 82.49  ? 562  TRP A CZ3 1 
ATOM   4437  C  CH2 . TRP A  1  562  ? 31.044  -15.680  -7.814   1.00 82.02  ? 562  TRP A CH2 1 
ATOM   4438  N  N   . ASP A  1  563  ? 25.115  -13.921  -11.275  1.00 182.78 ? 563  ASP A N   1 
ATOM   4439  C  CA  . ASP A  1  563  ? 24.688  -12.758  -10.518  1.00 192.83 ? 563  ASP A CA  1 
ATOM   4440  C  C   . ASP A  1  563  ? 25.897  -11.938  -10.071  1.00 156.53 ? 563  ASP A C   1 
ATOM   4441  O  O   . ASP A  1  563  ? 25.857  -10.717  -10.114  1.00 182.00 ? 563  ASP A O   1 
ATOM   4442  C  CB  . ASP A  1  563  ? 23.879  -13.191  -9.293   1.00 146.06 ? 563  ASP A CB  1 
ATOM   4443  C  CG  . ASP A  1  563  ? 22.724  -14.127  -9.642   1.00 157.83 ? 563  ASP A CG  1 
ATOM   4444  O  OD1 . ASP A  1  563  ? 22.639  -14.606  -10.801  1.00 136.60 ? 563  ASP A OD1 1 
ATOM   4445  O  OD2 . ASP A  1  563  ? 21.893  -14.387  -8.744   1.00 164.34 ? 563  ASP A OD2 1 
ATOM   4446  N  N   . GLY A  1  564  ? 26.968  -12.616  -9.681   1.00 113.34 ? 564  GLY A N   1 
ATOM   4447  C  CA  . GLY A  1  564  ? 28.177  -11.972  -9.195   1.00 88.82  ? 564  GLY A CA  1 
ATOM   4448  C  C   . GLY A  1  564  ? 28.217  -12.102  -7.683   1.00 102.64 ? 564  GLY A C   1 
ATOM   4449  O  O   . GLY A  1  564  ? 29.275  -12.064  -7.028   1.00 140.77 ? 564  GLY A O   1 
ATOM   4450  N  N   . ILE A  1  565  ? 27.020  -12.261  -7.131   1.00 123.38 ? 565  ILE A N   1 
ATOM   4451  C  CA  . ILE A  1  565  ? 26.819  -12.395  -5.699   1.00 133.67 ? 565  ILE A CA  1 
ATOM   4452  C  C   . ILE A  1  565  ? 27.027  -13.833  -5.246   1.00 112.37 ? 565  ILE A C   1 
ATOM   4453  O  O   . ILE A  1  565  ? 26.493  -14.765  -5.844   1.00 130.69 ? 565  ILE A O   1 
ATOM   4454  C  CB  . ILE A  1  565  ? 25.413  -11.921  -5.307   1.00 143.07 ? 565  ILE A CB  1 
ATOM   4455  C  CG1 . ILE A  1  565  ? 24.367  -12.458  -6.292   1.00 134.50 ? 565  ILE A CG1 1 
ATOM   4456  C  CG2 . ILE A  1  565  ? 25.378  -10.406  -5.301   1.00 119.32 ? 565  ILE A CG2 1 
ATOM   4457  C  CD1 . ILE A  1  565  ? 22.907  -12.183  -5.913   1.00 129.50 ? 565  ILE A CD1 1 
ATOM   4458  N  N   . LEU A  1  566  ? 27.821  -14.001  -4.197   1.00 83.38  ? 566  LEU A N   1 
ATOM   4459  C  CA  . LEU A  1  566  ? 28.123  -15.317  -3.637   1.00 82.18  ? 566  LEU A CA  1 
ATOM   4460  C  C   . LEU A  1  566  ? 27.043  -15.761  -2.676   1.00 83.87  ? 566  LEU A C   1 
ATOM   4461  O  O   . LEU A  1  566  ? 26.746  -15.072  -1.707   1.00 86.99  ? 566  LEU A O   1 
ATOM   4462  C  CB  . LEU A  1  566  ? 29.438  -15.287  -2.886   1.00 83.92  ? 566  LEU A CB  1 
ATOM   4463  C  CG  . LEU A  1  566  ? 29.857  -16.607  -2.272   1.00 86.85  ? 566  LEU A CG  1 
ATOM   4464  C  CD1 . LEU A  1  566  ? 30.370  -17.503  -3.362   1.00 82.33  ? 566  LEU A CD1 1 
ATOM   4465  C  CD2 . LEU A  1  566  ? 30.921  -16.354  -1.217   1.00 84.53  ? 566  LEU A CD2 1 
ATOM   4466  N  N   . PRO A  1  567  ? 26.480  -16.948  -2.914   1.00 81.77  ? 567  PRO A N   1 
ATOM   4467  C  CA  . PRO A  1  567  ? 25.247  -17.424  -2.273   1.00 82.42  ? 567  PRO A CA  1 
ATOM   4468  C  C   . PRO A  1  567  ? 25.351  -17.428  -0.760   1.00 82.86  ? 567  PRO A C   1 
ATOM   4469  O  O   . PRO A  1  567  ? 26.387  -17.758  -0.236   1.00 82.71  ? 567  PRO A O   1 
ATOM   4470  C  CB  . PRO A  1  567  ? 25.098  -18.848  -2.807   1.00 80.83  ? 567  PRO A CB  1 
ATOM   4471  C  CG  . PRO A  1  567  ? 25.913  -18.883  -4.056   1.00 80.53  ? 567  PRO A CG  1 
ATOM   4472  C  CD  . PRO A  1  567  ? 27.079  -17.979  -3.769   1.00 81.21  ? 567  PRO A CD  1 
ATOM   4473  N  N   . PRO A  1  568  ? 24.289  -17.001  -0.069   1.00 119.21 ? 568  PRO A N   1 
ATOM   4474  C  CA  . PRO A  1  568  ? 24.303  -16.973  1.397    1.00 111.52 ? 568  PRO A CA  1 
ATOM   4475  C  C   . PRO A  1  568  ? 24.431  -18.374  1.996    1.00 149.92 ? 568  PRO A C   1 
ATOM   4476  O  O   . PRO A  1  568  ? 23.509  -19.169  1.856    1.00 93.75  ? 568  PRO A O   1 
ATOM   4477  C  CB  . PRO A  1  568  ? 22.937  -16.358  1.751    1.00 112.82 ? 568  PRO A CB  1 
ATOM   4478  C  CG  . PRO A  1  568  ? 22.534  -15.573  0.544    1.00 124.77 ? 568  PRO A CG  1 
ATOM   4479  C  CD  . PRO A  1  568  ? 23.083  -16.363  -0.630   1.00 131.46 ? 568  PRO A CD  1 
ATOM   4480  N  N   . PRO A  1  569  ? 25.550  -18.653  2.695    1.00 84.13  ? 569  PRO A N   1 
ATOM   4481  C  CA  . PRO A  1  569  ? 25.941  -19.921  3.323    1.00 85.64  ? 569  PRO A CA  1 
ATOM   4482  C  C   . PRO A  1  569  ? 24.868  -20.494  4.211    1.00 84.87  ? 569  PRO A C   1 
ATOM   4483  O  O   . PRO A  1  569  ? 24.223  -19.733  4.914    1.00 86.19  ? 569  PRO A O   1 
ATOM   4484  C  CB  . PRO A  1  569  ? 27.113  -19.537  4.205    1.00 84.87  ? 569  PRO A CB  1 
ATOM   4485  C  CG  . PRO A  1  569  ? 27.678  -18.371  3.591    1.00 87.10  ? 569  PRO A CG  1 
ATOM   4486  C  CD  . PRO A  1  569  ? 26.566  -17.619  2.917    1.00 83.87  ? 569  PRO A CD  1 
ATOM   4487  N  N   . VAL A  1  570  ? 24.721  -21.825  4.195    1.00 82.85  ? 570  VAL A N   1 
ATOM   4488  C  CA  . VAL A  1  570  ? 23.652  -22.554  4.900    1.00 82.89  ? 570  VAL A CA  1 
ATOM   4489  C  C   . VAL A  1  570  ? 24.142  -22.991  6.255    1.00 83.71  ? 570  VAL A C   1 
ATOM   4490  O  O   . VAL A  1  570  ? 23.397  -23.475  7.081    1.00 83.93  ? 570  VAL A O   1 
ATOM   4491  C  CB  . VAL A  1  570  ? 23.205  -23.804  4.101    1.00 82.28  ? 570  VAL A CB  1 
ATOM   4492  C  CG1 . VAL A  1  570  ? 22.378  -24.737  4.943    1.00 82.19  ? 570  VAL A CG1 1 
ATOM   4493  C  CG2 . VAL A  1  570  ? 22.387  -23.400  2.903    1.00 81.72  ? 570  VAL A CG2 1 
ATOM   4494  N  N   . ILE A  1  571  ? 25.422  -22.799  6.474    1.00 91.92  ? 571  ILE A N   1 
ATOM   4495  C  CA  . ILE A  1  571  ? 26.006  -23.254  7.708    1.00 100.56 ? 571  ILE A CA  1 
ATOM   4496  C  C   . ILE A  1  571  ? 27.012  -22.237  8.205    1.00 128.54 ? 571  ILE A C   1 
ATOM   4497  O  O   . ILE A  1  571  ? 28.009  -21.936  7.535    1.00 146.29 ? 571  ILE A O   1 
ATOM   4498  C  CB  . ILE A  1  571  ? 26.673  -24.604  7.509    1.00 90.54  ? 571  ILE A CB  1 
ATOM   4499  C  CG1 . ILE A  1  571  ? 25.643  -25.711  7.675    1.00 105.81 ? 571  ILE A CG1 1 
ATOM   4500  C  CG2 . ILE A  1  571  ? 27.793  -24.774  8.497    1.00 102.46 ? 571  ILE A CG2 1 
ATOM   4501  C  CD1 . ILE A  1  571  ? 26.196  -27.066  7.402    1.00 96.85  ? 571  ILE A CD1 1 
ATOM   4502  N  N   . LEU A  1  572  ? 26.723  -21.695  9.387    1.00 87.40  ? 572  LEU A N   1 
ATOM   4503  C  CA  . LEU A  1  572  ? 27.516  -20.637  9.989    1.00 92.12  ? 572  LEU A CA  1 
ATOM   4504  C  C   . LEU A  1  572  ? 28.217  -21.160  11.242   1.00 92.42  ? 572  LEU A C   1 
ATOM   4505  O  O   . LEU A  1  572  ? 28.964  -20.448  11.900   1.00 93.62  ? 572  LEU A O   1 
ATOM   4506  C  CB  . LEU A  1  572  ? 26.626  -19.426  10.287   1.00 89.88  ? 572  LEU A CB  1 
ATOM   4507  C  CG  . LEU A  1  572  ? 25.937  -18.827  9.040    1.00 87.62  ? 572  LEU A CG  1 
ATOM   4508  C  CD1 . LEU A  1  572  ? 24.579  -19.457  8.837    1.00 86.49  ? 572  LEU A CD1 1 
ATOM   4509  C  CD2 . LEU A  1  572  ? 25.820  -17.294  9.020    1.00 89.65  ? 572  LEU A CD2 1 
ATOM   4510  N  N   . LYS A  1  573  ? 27.990  -22.438  11.535   1.00 177.59 ? 573  LYS A N   1 
ATOM   4511  C  CA  . LYS A  1  573  ? 28.603  -23.114  12.668   1.00 201.89 ? 573  LYS A CA  1 
ATOM   4512  C  C   . LYS A  1  573  ? 30.110  -23.052  12.509   1.00 155.60 ? 573  LYS A C   1 
ATOM   4513  O  O   . LYS A  1  573  ? 30.619  -22.300  11.676   1.00 202.73 ? 573  LYS A O   1 
ATOM   4514  C  CB  . LYS A  1  573  ? 28.167  -24.569  12.683   1.00 135.67 ? 573  LYS A CB  1 
ATOM   4515  C  CG  . LYS A  1  573  ? 26.923  -24.850  11.877   1.00 224.57 ? 573  LYS A CG  1 
ATOM   4516  C  CD  . LYS A  1  573  ? 26.918  -26.279  11.364   1.00 247.54 ? 573  LYS A CD  1 
ATOM   4517  C  CE  . LYS A  1  573  ? 25.654  -26.562  10.567   1.00 214.96 ? 573  LYS A CE  1 
ATOM   4518  N  NZ  . LYS A  1  573  ? 25.604  -27.973  10.078   1.00 177.42 ? 573  LYS A NZ  1 
ATOM   4519  N  N   . PRO A  1  574  ? 30.838  -23.858  13.285   1.00 90.46  ? 574  PRO A N   1 
ATOM   4520  C  CA  . PRO A  1  574  ? 32.304  -23.777  13.324   1.00 92.13  ? 574  PRO A CA  1 
ATOM   4521  C  C   . PRO A  1  574  ? 32.986  -23.577  11.960   1.00 88.38  ? 574  PRO A C   1 
ATOM   4522  O  O   . PRO A  1  574  ? 33.756  -22.627  11.826   1.00 90.18  ? 574  PRO A O   1 
ATOM   4523  C  CB  . PRO A  1  574  ? 32.705  -25.123  13.941   1.00 91.74  ? 574  PRO A CB  1 
ATOM   4524  C  CG  . PRO A  1  574  ? 31.412  -25.965  13.919   1.00 90.56  ? 574  PRO A CG  1 
ATOM   4525  C  CD  . PRO A  1  574  ? 30.364  -24.956  14.140   1.00 89.22  ? 574  PRO A CD  1 
ATOM   4526  N  N   . LYS A  1  575  ? 32.738  -24.447  10.986   1.00 130.23 ? 575  LYS A N   1 
ATOM   4527  C  CA  . LYS A  1  575  ? 33.189  -24.194  9.616    1.00 111.71 ? 575  LYS A CA  1 
ATOM   4528  C  C   . LYS A  1  575  ? 32.011  -23.608  8.853    1.00 129.43 ? 575  LYS A C   1 
ATOM   4529  O  O   . LYS A  1  575  ? 30.865  -23.807  9.238    1.00 103.17 ? 575  LYS A O   1 
ATOM   4530  C  CB  . LYS A  1  575  ? 33.659  -25.490  8.944    1.00 88.37  ? 575  LYS A CB  1 
ATOM   4531  C  CG  . LYS A  1  575  ? 35.057  -25.946  9.344    1.00 96.74  ? 575  LYS A CG  1 
ATOM   4532  C  CD  . LYS A  1  575  ? 35.435  -27.240  8.644    1.00 122.90 ? 575  LYS A CD  1 
ATOM   4533  C  CE  . LYS A  1  575  ? 35.504  -27.065  7.144    1.00 108.26 ? 575  LYS A CE  1 
ATOM   4534  N  NZ  . LYS A  1  575  ? 35.717  -28.366  6.461    1.00 126.36 ? 575  LYS A NZ  1 
ATOM   4535  N  N   . VAL A  1  576  ? 32.279  -22.863  7.788    1.00 123.91 ? 576  VAL A N   1 
ATOM   4536  C  CA  . VAL A  1  576  ? 31.182  -22.372  6.963    1.00 105.81 ? 576  VAL A CA  1 
ATOM   4537  C  C   . VAL A  1  576  ? 30.955  -23.343  5.816    1.00 84.00  ? 576  VAL A C   1 
ATOM   4538  O  O   . VAL A  1  576  ? 31.826  -23.514  4.964    1.00 117.52 ? 576  VAL A O   1 
ATOM   4539  C  CB  . VAL A  1  576  ? 31.472  -20.984  6.396    1.00 143.65 ? 576  VAL A CB  1 
ATOM   4540  C  CG1 . VAL A  1  576  ? 30.225  -20.438  5.731    1.00 101.60 ? 576  VAL A CG1 1 
ATOM   4541  C  CG2 . VAL A  1  576  ? 31.939  -20.049  7.511    1.00 153.29 ? 576  VAL A CG2 1 
ATOM   4542  N  N   . LEU A  1  577  ? 29.783  -23.974  5.797    1.00 86.43  ? 577  LEU A N   1 
ATOM   4543  C  CA  . LEU A  1  577  ? 29.513  -25.037  4.831    1.00 85.93  ? 577  LEU A CA  1 
ATOM   4544  C  C   . LEU A  1  577  ? 28.293  -24.793  3.951    1.00 83.12  ? 577  LEU A C   1 
ATOM   4545  O  O   . LEU A  1  577  ? 27.319  -24.157  4.341    1.00 82.26  ? 577  LEU A O   1 
ATOM   4546  C  CB  . LEU A  1  577  ? 29.371  -26.390  5.520    1.00 82.69  ? 577  LEU A CB  1 
ATOM   4547  C  CG  . LEU A  1  577  ? 30.548  -26.969  6.295    1.00 84.49  ? 577  LEU A CG  1 
ATOM   4548  C  CD1 . LEU A  1  577  ? 30.240  -28.433  6.541    1.00 84.07  ? 577  LEU A CD1 1 
ATOM   4549  C  CD2 . LEU A  1  577  ? 31.856  -26.806  5.551    1.00 83.04  ? 577  LEU A CD2 1 
ATOM   4550  N  N   . TRP A  1  578  ? 28.365  -25.322  2.743    1.00 91.88  ? 578  TRP A N   1 
ATOM   4551  C  CA  . TRP A  1  578  ? 27.296  -25.157  1.786    1.00 85.87  ? 578  TRP A CA  1 
ATOM   4552  C  C   . TRP A  1  578  ? 26.757  -26.520  1.429    1.00 82.63  ? 578  TRP A C   1 
ATOM   4553  O  O   . TRP A  1  578  ? 27.520  -27.457  1.202    1.00 86.38  ? 578  TRP A O   1 
ATOM   4554  C  CB  . TRP A  1  578  ? 27.841  -24.480  0.547    1.00 86.05  ? 578  TRP A CB  1 
ATOM   4555  C  CG  . TRP A  1  578  ? 28.692  -23.323  0.895    1.00 95.45  ? 578  TRP A CG  1 
ATOM   4556  C  CD1 . TRP A  1  578  ? 29.921  -23.336  1.489    1.00 86.86  ? 578  TRP A CD1 1 
ATOM   4557  C  CD2 . TRP A  1  578  ? 28.364  -21.975  0.683    1.00 81.08  ? 578  TRP A CD2 1 
ATOM   4558  N  NE1 . TRP A  1  578  ? 30.384  -22.049  1.653    1.00 123.77 ? 578  TRP A NE1 1 
ATOM   4559  C  CE2 . TRP A  1  578  ? 29.441  -21.192  1.166    1.00 112.06 ? 578  TRP A CE2 1 
ATOM   4560  C  CE3 . TRP A  1  578  ? 27.267  -21.345  0.126    1.00 94.49  ? 578  TRP A CE3 1 
ATOM   4561  C  CZ2 . TRP A  1  578  ? 29.432  -19.813  1.099    1.00 85.11  ? 578  TRP A CZ2 1 
ATOM   4562  C  CZ3 . TRP A  1  578  ? 27.260  -19.987  0.059    1.00 89.82  ? 578  TRP A CZ3 1 
ATOM   4563  C  CH2 . TRP A  1  578  ? 28.336  -19.223  0.537    1.00 124.89 ? 578  TRP A CH2 1 
ATOM   4564  N  N   . THR A  1  579  ? 25.440  -26.638  1.411    1.00 82.39  ? 579  THR A N   1 
ATOM   4565  C  CA  . THR A  1  579  ? 24.829  -27.884  1.009    1.00 84.93  ? 579  THR A CA  1 
ATOM   4566  C  C   . THR A  1  579  ? 24.905  -28.057  -0.502   1.00 84.03  ? 579  THR A C   1 
ATOM   4567  O  O   . THR A  1  579  ? 24.853  -27.094  -1.258   1.00 78.57  ? 579  THR A O   1 
ATOM   4568  C  CB  . THR A  1  579  ? 23.365  -27.975  1.496    1.00 84.69  ? 579  THR A CB  1 
ATOM   4569  O  OG1 . THR A  1  579  ? 22.672  -29.014  0.790    1.00 83.57  ? 579  THR A OG1 1 
ATOM   4570  C  CG2 . THR A  1  579  ? 22.638  -26.661  1.268    1.00 79.78  ? 579  THR A CG2 1 
ATOM   4571  N  N   . GLY A  1  580  ? 25.007  -29.309  -0.928   1.00 122.47 ? 580  GLY A N   1 
ATOM   4572  C  CA  . GLY A  1  580  ? 25.059  -29.641  -2.336   1.00 116.83 ? 580  GLY A CA  1 
ATOM   4573  C  C   . GLY A  1  580  ? 23.818  -29.257  -3.111   1.00 139.94 ? 580  GLY A C   1 
ATOM   4574  O  O   . GLY A  1  580  ? 23.871  -29.079  -4.326   1.00 99.07  ? 580  GLY A O   1 
ATOM   4575  N  N   . LYS A  1  581  ? 22.692  -29.149  -2.424   1.00 77.36  ? 581  LYS A N   1 
ATOM   4576  C  CA  . LYS A  1  581  ? 21.493  -28.710  -3.087   1.00 77.41  ? 581  LYS A CA  1 
ATOM   4577  C  C   . LYS A  1  581  ? 21.600  -27.237  -3.308   1.00 77.89  ? 581  LYS A C   1 
ATOM   4578  O  O   . LYS A  1  581  ? 21.413  -26.785  -4.414   1.00 77.45  ? 581  LYS A O   1 
ATOM   4579  C  CB  . LYS A  1  581  ? 20.285  -29.008  -2.246   1.00 77.57  ? 581  LYS A CB  1 
ATOM   4580  C  CG  . LYS A  1  581  ? 20.312  -30.382  -1.735   1.00 80.29  ? 581  LYS A CG  1 
ATOM   4581  C  CD  . LYS A  1  581  ? 18.937  -30.940  -1.567   1.00 80.89  ? 581  LYS A CD  1 
ATOM   4582  C  CE  . LYS A  1  581  ? 19.030  -32.371  -1.156   1.00 78.44  ? 581  LYS A CE  1 
ATOM   4583  N  NZ  . LYS A  1  581  ? 17.743  -32.797  -0.619   1.00 80.92  ? 581  LYS A NZ  1 
ATOM   4584  N  N   . GLN A  1  582  ? 21.889  -26.484  -2.253   1.00 87.83  ? 582  GLN A N   1 
ATOM   4585  C  CA  . GLN A  1  582  ? 22.093  -25.048  -2.404   1.00 99.55  ? 582  GLN A CA  1 
ATOM   4586  C  C   . GLN A  1  582  ? 22.678  -24.745  -3.780   1.00 98.52  ? 582  GLN A C   1 
ATOM   4587  O  O   . GLN A  1  582  ? 21.929  -24.477  -4.723   1.00 94.87  ? 582  GLN A O   1 
ATOM   4588  C  CB  . GLN A  1  582  ? 23.027  -24.499  -1.314   1.00 104.64 ? 582  GLN A CB  1 
ATOM   4589  C  CG  . GLN A  1  582  ? 22.728  -23.050  -0.891   1.00 79.96  ? 582  GLN A CG  1 
ATOM   4590  C  CD  . GLN A  1  582  ? 23.781  -22.457  0.037    1.00 116.51 ? 582  GLN A CD  1 
ATOM   4591  O  OE1 . GLN A  1  582  ? 23.686  -21.291  0.409    1.00 110.65 ? 582  GLN A OE1 1 
ATOM   4592  N  NE2 . GLN A  1  582  ? 24.790  -23.245  0.405    1.00 81.61  ? 582  GLN A NE2 1 
ATOM   4593  N  N   . ILE A  1  583  ? 24.007  -24.808  -3.905   1.00 78.92  ? 583  ILE A N   1 
ATOM   4594  C  CA  . ILE A  1  583  ? 24.686  -24.299  -5.116   1.00 78.21  ? 583  ILE A CA  1 
ATOM   4595  C  C   . ILE A  1  583  ? 24.212  -24.948  -6.394   1.00 77.75  ? 583  ILE A C   1 
ATOM   4596  O  O   . ILE A  1  583  ? 24.491  -24.452  -7.465   1.00 78.42  ? 583  ILE A O   1 
ATOM   4597  C  CB  . ILE A  1  583  ? 26.217  -24.447  -5.093   1.00 78.26  ? 583  ILE A CB  1 
ATOM   4598  C  CG1 . ILE A  1  583  ? 26.584  -25.861  -5.442   1.00 77.32  ? 583  ILE A CG1 1 
ATOM   4599  C  CG2 . ILE A  1  583  ? 26.805  -24.067  -3.751   1.00 80.00  ? 583  ILE A CG2 1 
ATOM   4600  C  CD1 . ILE A  1  583  ? 25.974  -26.837  -4.481   1.00 77.34  ? 583  ILE A CD1 1 
ATOM   4601  N  N   . LEU A  1  584  ? 23.499  -26.061  -6.291   1.00 77.06  ? 584  LEU A N   1 
ATOM   4602  C  CA  . LEU A  1  584  ? 22.934  -26.659  -7.489   1.00 76.94  ? 584  LEU A CA  1 
ATOM   4603  C  C   . LEU A  1  584  ? 21.717  -25.868  -7.923   1.00 77.22  ? 584  LEU A C   1 
ATOM   4604  O  O   . LEU A  1  584  ? 21.607  -25.486  -9.070   1.00 78.01  ? 584  LEU A O   1 
ATOM   4605  C  CB  . LEU A  1  584  ? 22.598  -28.128  -7.293   1.00 77.44  ? 584  LEU A CB  1 
ATOM   4606  C  CG  . LEU A  1  584  ? 22.530  -28.872  -8.610   1.00 76.11  ? 584  LEU A CG  1 
ATOM   4607  C  CD1 . LEU A  1  584  ? 22.192  -30.323  -8.407   1.00 75.72  ? 584  LEU A CD1 1 
ATOM   4608  C  CD2 . LEU A  1  584  ? 21.508  -28.283  -9.484   1.00 76.34  ? 584  LEU A CD2 1 
ATOM   4609  N  N   . SER A  1  585  ? 20.806  -25.611  -6.994   1.00 117.54 ? 585  SER A N   1 
ATOM   4610  C  CA  . SER A  1  585  ? 19.575  -24.891  -7.302   1.00 80.88  ? 585  SER A CA  1 
ATOM   4611  C  C   . SER A  1  585  ? 19.895  -23.513  -7.885   1.00 84.10  ? 585  SER A C   1 
ATOM   4612  O  O   . SER A  1  585  ? 18.983  -22.761  -8.274   1.00 128.04 ? 585  SER A O   1 
ATOM   4613  C  CB  . SER A  1  585  ? 18.695  -24.769  -6.042   1.00 93.23  ? 585  SER A CB  1 
ATOM   4614  O  OG  . SER A  1  585  ? 19.451  -24.355  -4.916   1.00 111.12 ? 585  SER A OG  1 
ATOM   4615  N  N   . LEU A  1  586  ? 21.187  -23.186  -7.932   1.00 77.37  ? 586  LEU A N   1 
ATOM   4616  C  CA  . LEU A  1  586  ? 21.634  -21.924  -8.488   1.00 77.71  ? 586  LEU A CA  1 
ATOM   4617  C  C   . LEU A  1  586  ? 21.474  -21.936  -9.986   1.00 78.26  ? 586  LEU A C   1 
ATOM   4618  O  O   . LEU A  1  586  ? 21.036  -20.952  -10.565  1.00 78.85  ? 586  LEU A O   1 
ATOM   4619  C  CB  . LEU A  1  586  ? 23.083  -21.659  -8.133   1.00 81.47  ? 586  LEU A CB  1 
ATOM   4620  C  CG  . LEU A  1  586  ? 23.305  -21.163  -6.708   1.00 79.09  ? 586  LEU A CG  1 
ATOM   4621  C  CD1 . LEU A  1  586  ? 24.690  -20.519  -6.579   1.00 80.89  ? 586  LEU A CD1 1 
ATOM   4622  C  CD2 . LEU A  1  586  ? 22.204  -20.181  -6.323   1.00 81.45  ? 586  LEU A CD2 1 
ATOM   4623  N  N   . ILE A  1  587  ? 21.810  -23.036  -10.626  1.00 79.52  ? 587  ILE A N   1 
ATOM   4624  C  CA  . ILE A  1  587  ? 21.714  -23.030  -12.057  1.00 80.09  ? 587  ILE A CA  1 
ATOM   4625  C  C   . ILE A  1  587  ? 20.321  -23.318  -12.561  1.00 79.81  ? 587  ILE A C   1 
ATOM   4626  O  O   . ILE A  1  587  ? 20.164  -23.527  -13.748  1.00 79.94  ? 587  ILE A O   1 
ATOM   4627  C  CB  . ILE A  1  587  ? 22.712  -23.961  -12.698  1.00 77.63  ? 587  ILE A CB  1 
ATOM   4628  C  CG1 . ILE A  1  587  ? 22.648  -25.321  -12.044  1.00 76.53  ? 587  ILE A CG1 1 
ATOM   4629  C  CG2 . ILE A  1  587  ? 24.089  -23.407  -12.520  1.00 79.33  ? 587  ILE A CG2 1 
ATOM   4630  C  CD1 . ILE A  1  587  ? 21.388  -26.053  -12.309  1.00 76.68  ? 587  ILE A CD1 1 
ATOM   4631  N  N   . ILE A  1  588  ? 19.313  -23.323  -11.686  1.00 77.61  ? 588  ILE A N   1 
ATOM   4632  C  CA  . ILE A  1  588  ? 17.915  -23.375  -12.146  1.00 105.89 ? 588  ILE A CA  1 
ATOM   4633  C  C   . ILE A  1  588  ? 17.252  -22.013  -12.093  1.00 129.24 ? 588  ILE A C   1 
ATOM   4634  O  O   . ILE A  1  588  ? 17.437  -21.269  -11.124  1.00 142.01 ? 588  ILE A O   1 
ATOM   4635  C  CB  . ILE A  1  588  ? 17.033  -24.348  -11.343  1.00 88.03  ? 588  ILE A CB  1 
ATOM   4636  C  CG1 . ILE A  1  588  ? 16.369  -23.643  -10.173  1.00 85.15  ? 588  ILE A CG1 1 
ATOM   4637  C  CG2 . ILE A  1  588  ? 17.813  -25.565  -10.869  1.00 78.56  ? 588  ILE A CG2 1 
ATOM   4638  C  CD1 . ILE A  1  588  ? 15.293  -24.478  -9.539   1.00 85.50  ? 588  ILE A CD1 1 
ATOM   4639  N  N   . PRO A  1  589  ? 16.462  -21.690  -13.130  1.00 84.76  ? 589  PRO A N   1 
ATOM   4640  C  CA  . PRO A  1  589  ? 15.791  -20.413  -13.315  1.00 78.96  ? 589  PRO A CA  1 
ATOM   4641  C  C   . PRO A  1  589  ? 15.087  -20.001  -12.051  1.00 88.51  ? 589  PRO A C   1 
ATOM   4642  O  O   . PRO A  1  589  ? 15.001  -20.809  -11.136  1.00 93.18  ? 589  PRO A O   1 
ATOM   4643  C  CB  . PRO A  1  589  ? 14.755  -20.725  -14.386  1.00 83.85  ? 589  PRO A CB  1 
ATOM   4644  C  CG  . PRO A  1  589  ? 15.377  -21.779  -15.186  1.00 80.33  ? 589  PRO A CG  1 
ATOM   4645  C  CD  . PRO A  1  589  ? 16.066  -22.641  -14.174  1.00 80.47  ? 589  PRO A CD  1 
ATOM   4646  N  N   . LYS A  1  590  ? 14.595  -18.769  -12.003  1.00 119.52 ? 590  LYS A N   1 
ATOM   4647  C  CA  . LYS A  1  590  ? 13.970  -18.254  -10.800  1.00 106.54 ? 590  LYS A CA  1 
ATOM   4648  C  C   . LYS A  1  590  ? 12.482  -18.222  -11.008  1.00 142.07 ? 590  LYS A C   1 
ATOM   4649  O  O   . LYS A  1  590  ? 11.983  -17.536  -11.900  1.00 126.22 ? 590  LYS A O   1 
ATOM   4650  C  CB  . LYS A  1  590  ? 14.520  -16.869  -10.472  1.00 154.10 ? 590  LYS A CB  1 
ATOM   4651  C  CG  . LYS A  1  590  ? 15.999  -16.774  -10.765  1.00 98.18  ? 590  LYS A CG  1 
ATOM   4652  C  CD  . LYS A  1  590  ? 16.684  -15.591  -10.111  1.00 102.48 ? 590  LYS A CD  1 
ATOM   4653  C  CE  . LYS A  1  590  ? 18.191  -15.760  -10.253  1.00 104.76 ? 590  LYS A CE  1 
ATOM   4654  N  NZ  . LYS A  1  590  ? 18.956  -14.558  -9.858   1.00 120.18 ? 590  LYS A NZ  1 
ATOM   4655  N  N   . GLY A  1  591  ? 11.786  -19.007  -10.201  1.00 81.75  ? 591  GLY A N   1 
ATOM   4656  C  CA  . GLY A  1  591  ? 10.340  -19.033  -10.218  1.00 86.82  ? 591  GLY A CA  1 
ATOM   4657  C  C   . GLY A  1  591  ? 9.741   -20.172  -11.003  1.00 85.57  ? 591  GLY A C   1 
ATOM   4658  O  O   . GLY A  1  591  ? 8.773   -19.978  -11.728  1.00 115.88 ? 591  GLY A O   1 
ATOM   4659  N  N   . ILE A  1  592  ? 10.325  -21.357  -10.864  1.00 79.72  ? 592  ILE A N   1 
ATOM   4660  C  CA  . ILE A  1  592  ? 9.703   -22.561  -11.398  1.00 82.01  ? 592  ILE A CA  1 
ATOM   4661  C  C   . ILE A  1  592  ? 9.342   -23.474  -10.244  1.00 79.67  ? 592  ILE A C   1 
ATOM   4662  O  O   . ILE A  1  592  ? 10.212  -23.777  -9.453   1.00 79.62  ? 592  ILE A O   1 
ATOM   4663  C  CB  . ILE A  1  592  ? 10.676  -23.365  -12.232  1.00 81.38  ? 592  ILE A CB  1 
ATOM   4664  C  CG1 . ILE A  1  592  ? 12.012  -23.440  -11.530  1.00 78.19  ? 592  ILE A CG1 1 
ATOM   4665  C  CG2 . ILE A  1  592  ? 10.898  -22.729  -13.543  1.00 81.03  ? 592  ILE A CG2 1 
ATOM   4666  C  CD1 . ILE A  1  592  ? 12.796  -22.215  -11.682  1.00 81.78  ? 592  ILE A CD1 1 
ATOM   4667  N  N   . ASN A  1  593  ? 8.094   -23.939  -10.143  1.00 88.61  ? 593  ASN A N   1 
ATOM   4668  C  CA  . ASN A  1  593  ? 7.729   -24.809  -9.017   1.00 81.85  ? 593  ASN A CA  1 
ATOM   4669  C  C   . ASN A  1  593  ? 7.523   -26.280  -9.410   1.00 117.54 ? 593  ASN A C   1 
ATOM   4670  O  O   . ASN A  1  593  ? 7.140   -26.578  -10.548  1.00 79.42  ? 593  ASN A O   1 
ATOM   4671  C  CB  . ASN A  1  593  ? 6.516   -24.257  -8.268   1.00 101.62 ? 593  ASN A CB  1 
ATOM   4672  C  CG  . ASN A  1  593  ? 6.840   -22.988  -7.500   1.00 113.50 ? 593  ASN A CG  1 
ATOM   4673  O  OD1 . ASN A  1  593  ? 6.079   -22.559  -6.642   1.00 153.67 ? 593  ASN A OD1 1 
ATOM   4674  N  ND2 . ASN A  1  593  ? 7.974   -22.383  -7.807   1.00 107.71 ? 593  ASN A ND2 1 
ATOM   4675  N  N   . LEU A  1  594  ? 7.806   -27.196  -8.476   1.00 80.23  ? 594  LEU A N   1 
ATOM   4676  C  CA  . LEU A  1  594  ? 7.550   -28.644  -8.680   1.00 80.73  ? 594  LEU A CA  1 
ATOM   4677  C  C   . LEU A  1  594  ? 7.178   -29.437  -7.413   1.00 80.26  ? 594  LEU A C   1 
ATOM   4678  O  O   . LEU A  1  594  ? 7.832   -29.316  -6.364   1.00 79.51  ? 594  LEU A O   1 
ATOM   4679  C  CB  . LEU A  1  594  ? 8.750   -29.323  -9.329   1.00 78.27  ? 594  LEU A CB  1 
ATOM   4680  C  CG  . LEU A  1  594  ? 8.821   -29.151  -10.820  1.00 78.08  ? 594  LEU A CG  1 
ATOM   4681  C  CD1 . LEU A  1  594  ? 9.784   -30.183  -11.371  1.00 77.52  ? 594  LEU A CD1 1 
ATOM   4682  C  CD2 . LEU A  1  594  ? 7.413   -29.275  -11.393  1.00 79.09  ? 594  LEU A CD2 1 
ATOM   4683  N  N   . ILE A  1  595  ? 6.158   -30.283  -7.519   1.00 133.91 ? 595  ILE A N   1 
ATOM   4684  C  CA  . ILE A  1  595  ? 5.725   -31.073  -6.383   1.00 80.14  ? 595  ILE A CA  1 
ATOM   4685  C  C   . ILE A  1  595  ? 5.722   -32.499  -6.871   1.00 134.61 ? 595  ILE A C   1 
ATOM   4686  O  O   . ILE A  1  595  ? 4.697   -33.008  -7.313   1.00 108.94 ? 595  ILE A O   1 
ATOM   4687  C  CB  . ILE A  1  595  ? 4.317   -30.667  -5.906   1.00 131.61 ? 595  ILE A CB  1 
ATOM   4688  C  CG1 . ILE A  1  595  ? 3.415   -30.358  -7.115   1.00 99.10  ? 595  ILE A CG1 1 
ATOM   4689  C  CG2 . ILE A  1  595  ? 4.417   -29.475  -4.976   1.00 93.95  ? 595  ILE A CG2 1 
ATOM   4690  C  CD1 . ILE A  1  595  ? 1.972   -30.000  -6.763   1.00 103.25 ? 595  ILE A CD1 1 
ATOM   4691  N  N   . ARG A  1  596  ? 6.882   -33.141  -6.819   1.00 189.41 ? 596  ARG A N   1 
ATOM   4692  C  CA  . ARG A  1  596  ? 7.021   -34.451  -7.432   1.00 184.07 ? 596  ARG A CA  1 
ATOM   4693  C  C   . ARG A  1  596  ? 6.237   -35.528  -6.701   1.00 189.91 ? 596  ARG A C   1 
ATOM   4694  O  O   . ARG A  1  596  ? 5.540   -36.325  -7.335   1.00 188.65 ? 596  ARG A O   1 
ATOM   4695  C  CB  . ARG A  1  596  ? 8.478   -34.867  -7.556   1.00 174.52 ? 596  ARG A CB  1 
ATOM   4696  C  CG  . ARG A  1  596  ? 8.607   -36.225  -8.162   1.00 167.95 ? 596  ARG A CG  1 
ATOM   4697  C  CD  . ARG A  1  596  ? 9.908   -36.404  -8.896   1.00 158.16 ? 596  ARG A CD  1 
ATOM   4698  N  NE  . ARG A  1  596  ? 9.878   -37.638  -9.665   1.00 152.24 ? 596  ARG A NE  1 
ATOM   4699  C  CZ  . ARG A  1  596  ? 9.217   -37.790  -10.811  1.00 152.91 ? 596  ARG A CZ  1 
ATOM   4700  N  NH1 . ARG A  1  596  ? 8.529   -36.775  -11.323  1.00 157.05 ? 596  ARG A NH1 1 
ATOM   4701  N  NH2 . ARG A  1  596  ? 9.238   -38.959  -11.446  1.00 150.59 ? 596  ARG A NH2 1 
ATOM   4702  N  N   . ASP A  1  597  ? 6.341   -35.548  -5.377   1.00 170.77 ? 597  ASP A N   1 
ATOM   4703  C  CA  . ASP A  1  597  ? 5.579   -36.499  -4.571   1.00 179.77 ? 597  ASP A CA  1 
ATOM   4704  C  C   . ASP A  1  597  ? 5.688   -37.906  -5.114   1.00 174.86 ? 597  ASP A C   1 
ATOM   4705  O  O   . ASP A  1  597  ? 4.840   -38.344  -5.886   1.00 173.15 ? 597  ASP A O   1 
ATOM   4706  C  CB  . ASP A  1  597  ? 4.102   -36.103  -4.505   1.00 136.99 ? 597  ASP A CB  1 
ATOM   4707  C  CG  . ASP A  1  597  ? 3.842   -34.998  -3.497   1.00 148.98 ? 597  ASP A CG  1 
ATOM   4708  O  OD1 . ASP A  1  597  ? 4.802   -34.283  -3.153   1.00 147.63 ? 597  ASP A OD1 1 
ATOM   4709  O  OD2 . ASP A  1  597  ? 2.685   -34.840  -3.049   1.00 159.17 ? 597  ASP A OD2 1 
ATOM   4710  N  N   . ASP A  1  598  ? 6.729   -38.612  -4.700   1.00 165.46 ? 598  ASP A N   1 
ATOM   4711  C  CA  . ASP A  1  598  ? 6.952   -39.971  -5.163   1.00 162.57 ? 598  ASP A CA  1 
ATOM   4712  C  C   . ASP A  1  598  ? 6.105   -40.921  -4.331   1.00 172.74 ? 598  ASP A C   1 
ATOM   4713  O  O   . ASP A  1  598  ? 5.123   -40.507  -3.729   1.00 182.77 ? 598  ASP A O   1 
ATOM   4714  C  CB  . ASP A  1  598  ? 8.440   -40.348  -5.114   1.00 155.61 ? 598  ASP A CB  1 
ATOM   4715  C  CG  . ASP A  1  598  ? 9.245   -39.719  -6.260   1.00 147.75 ? 598  ASP A CG  1 
ATOM   4716  O  OD1 . ASP A  1  598  ? 8.648   -39.033  -7.116   1.00 148.66 ? 598  ASP A OD1 1 
ATOM   4717  O  OD2 . ASP A  1  598  ? 10.483  -39.906  -6.314   1.00 139.94 ? 598  ASP A OD2 1 
ATOM   4718  N  N   . ASP A  1  599  ? 6.475   -42.198  -4.319   1.00 283.21 ? 599  ASP A N   1 
ATOM   4719  C  CA  . ASP A  1  599  ? 5.699   -43.212  -3.619   1.00 293.76 ? 599  ASP A CA  1 
ATOM   4720  C  C   . ASP A  1  599  ? 5.498   -42.855  -2.164   1.00 304.41 ? 599  ASP A C   1 
ATOM   4721  O  O   . ASP A  1  599  ? 4.740   -41.951  -1.815   1.00 311.81 ? 599  ASP A O   1 
ATOM   4722  C  CB  . ASP A  1  599  ? 6.408   -44.561  -3.685   1.00 222.78 ? 599  ASP A CB  1 
ATOM   4723  C  CG  . ASP A  1  599  ? 6.330   -45.190  -5.059   1.00 214.30 ? 599  ASP A CG  1 
ATOM   4724  O  OD1 . ASP A  1  599  ? 5.580   -44.675  -5.914   1.00 211.35 ? 599  ASP A OD1 1 
ATOM   4725  O  OD2 . ASP A  1  599  ? 7.016   -46.207  -5.285   1.00 210.42 ? 599  ASP A OD2 1 
ATOM   4726  N  N   . LYS A  1  600  ? 6.182   -43.598  -1.315   1.00 273.43 ? 600  LYS A N   1 
ATOM   4727  C  CA  . LYS A  1  600  ? 6.121   -43.366  0.106    1.00 281.12 ? 600  LYS A CA  1 
ATOM   4728  C  C   . LYS A  1  600  ? 6.681   -41.996  0.395    1.00 276.40 ? 600  LYS A C   1 
ATOM   4729  O  O   . LYS A  1  600  ? 7.841   -41.720  0.108    1.00 265.81 ? 600  LYS A O   1 
ATOM   4730  C  CB  . LYS A  1  600  ? 6.953   -44.412  0.827    1.00 212.70 ? 600  LYS A CB  1 
ATOM   4731  C  CG  . LYS A  1  600  ? 6.826   -45.813  0.242    1.00 213.40 ? 600  LYS A CG  1 
ATOM   4732  C  CD  . LYS A  1  600  ? 7.754   -46.779  0.977    1.00 210.72 ? 600  LYS A CD  1 
ATOM   4733  C  CE  . LYS A  1  600  ? 7.427   -48.241  0.689    1.00 215.61 ? 600  LYS A CE  1 
ATOM   4734  N  NZ  . LYS A  1  600  ? 8.158   -49.169  1.610    1.00 216.57 ? 600  LYS A NZ  1 
ATOM   4735  N  N   . GLN A  1  601  ? 5.853   -41.132  0.966    1.00 202.01 ? 601  GLN A N   1 
ATOM   4736  C  CA  . GLN A  1  601  ? 6.304   -39.803  1.338    1.00 199.14 ? 601  GLN A CA  1 
ATOM   4737  C  C   . GLN A  1  601  ? 5.403   -39.225  2.405    1.00 212.50 ? 601  GLN A C   1 
ATOM   4738  O  O   . GLN A  1  601  ? 4.185   -39.311  2.292    1.00 223.99 ? 601  GLN A O   1 
ATOM   4739  C  CB  . GLN A  1  601  ? 6.311   -38.892  0.129    1.00 132.69 ? 601  GLN A CB  1 
ATOM   4740  C  CG  . GLN A  1  601  ? 6.390   -37.434  0.475    1.00 135.62 ? 601  GLN A CG  1 
ATOM   4741  C  CD  . GLN A  1  601  ? 6.277   -36.559  -0.749   1.00 132.05 ? 601  GLN A CD  1 
ATOM   4742  O  OE1 . GLN A  1  601  ? 6.727   -36.938  -1.836   1.00 122.44 ? 601  GLN A OE1 1 
ATOM   4743  N  NE2 . GLN A  1  601  ? 5.668   -35.376  -0.583   1.00 140.19 ? 601  GLN A NE2 1 
ATOM   4744  N  N   . SER A  1  602  ? 6.001   -38.619  3.424    1.00 176.82 ? 602  SER A N   1 
ATOM   4745  C  CA  . SER A  1  602  ? 5.245   -38.206  4.608    1.00 120.17 ? 602  SER A CA  1 
ATOM   4746  C  C   . SER A  1  602  ? 5.400   -36.741  4.972    1.00 123.35 ? 602  SER A C   1 
ATOM   4747  O  O   . SER A  1  602  ? 6.263   -36.043  4.457    1.00 114.08 ? 602  SER A O   1 
ATOM   4748  C  CB  . SER A  1  602  ? 5.690   -39.029  5.806    1.00 122.63 ? 602  SER A CB  1 
ATOM   4749  O  OG  . SER A  1  602  ? 7.022   -38.694  6.152    1.00 113.41 ? 602  SER A OG  1 
ATOM   4750  N  N   . LEU A  1  603  ? 4.565   -36.281  5.894    1.00 379.97 ? 603  LEU A N   1 
ATOM   4751  C  CA  . LEU A  1  603  ? 4.727   -34.934  6.408    1.00 283.40 ? 603  LEU A CA  1 
ATOM   4752  C  C   . LEU A  1  603  ? 6.199   -34.717  6.693    1.00 254.73 ? 603  LEU A C   1 
ATOM   4753  O  O   . LEU A  1  603  ? 6.695   -33.604  6.587    1.00 230.60 ? 603  LEU A O   1 
ATOM   4754  C  CB  . LEU A  1  603  ? 3.886   -34.707  7.670    1.00 242.29 ? 603  LEU A CB  1 
ATOM   4755  C  CG  . LEU A  1  603  ? 3.874   -35.724  8.828    1.00 242.25 ? 603  LEU A CG  1 
ATOM   4756  C  CD1 . LEU A  1  603  ? 5.104   -35.597  9.734    1.00 237.04 ? 603  LEU A CD1 1 
ATOM   4757  C  CD2 . LEU A  1  603  ? 2.598   -35.573  9.659    1.00 259.67 ? 603  LEU A CD2 1 
ATOM   4758  N  N   . SER A  1  604  ? 6.893   -35.799  7.036    1.00 112.72 ? 604  SER A N   1 
ATOM   4759  C  CA  . SER A  1  604  ? 8.313   -35.739  7.362    1.00 89.70  ? 604  SER A CA  1 
ATOM   4760  C  C   . SER A  1  604  ? 9.125   -35.476  6.109    1.00 101.03 ? 604  SER A C   1 
ATOM   4761  O  O   . SER A  1  604  ? 8.700   -34.722  5.232    1.00 106.22 ? 604  SER A O   1 
ATOM   4762  C  CB  . SER A  1  604  ? 8.785   -37.036  8.028    1.00 92.65  ? 604  SER A CB  1 
ATOM   4763  O  OG  . SER A  1  604  ? 10.193  -37.054  8.196    1.00 86.34  ? 604  SER A OG  1 
ATOM   4764  N  N   . ASN A  1  605  ? 10.291  -36.122  6.042    1.00 136.06 ? 605  ASN A N   1 
ATOM   4765  C  CA  . ASN A  1  605  ? 11.262  -35.956  4.962    1.00 174.14 ? 605  ASN A CA  1 
ATOM   4766  C  C   . ASN A  1  605  ? 11.013  -36.933  3.813    1.00 159.25 ? 605  ASN A C   1 
ATOM   4767  O  O   . ASN A  1  605  ? 11.063  -36.548  2.629    1.00 176.50 ? 605  ASN A O   1 
ATOM   4768  C  CB  . ASN A  1  605  ? 12.687  -36.151  5.510    1.00 136.63 ? 605  ASN A CB  1 
ATOM   4769  C  CG  . ASN A  1  605  ? 13.006  -35.225  6.680    1.00 180.71 ? 605  ASN A CG  1 
ATOM   4770  O  OD1 . ASN A  1  605  ? 14.116  -34.685  6.755    1.00 203.16 ? 605  ASN A OD1 1 
ATOM   4771  N  ND2 . ASN A  1  605  ? 12.054  -35.040  7.593    1.00 181.75 ? 605  ASN A ND2 1 
ATOM   4772  N  N   . PRO A  1  606  ? 10.787  -38.209  4.168    1.00 88.17  ? 606  PRO A N   1 
ATOM   4773  C  CA  . PRO A  1  606  ? 11.107  -38.717  5.511    1.00 109.25 ? 606  PRO A CA  1 
ATOM   4774  C  C   . PRO A  1  606  ? 12.602  -38.981  5.497    1.00 101.78 ? 606  PRO A C   1 
ATOM   4775  O  O   . PRO A  1  606  ? 13.303  -38.936  6.501    1.00 103.36 ? 606  PRO A O   1 
ATOM   4776  C  CB  . PRO A  1  606  ? 10.347  -40.048  5.575    1.00 122.48 ? 606  PRO A CB  1 
ATOM   4777  C  CG  . PRO A  1  606  ? 9.294   -39.968  4.485    1.00 103.09 ? 606  PRO A CG  1 
ATOM   4778  C  CD  . PRO A  1  606  ? 9.933   -39.137  3.407    1.00 107.03 ? 606  PRO A CD  1 
ATOM   4779  N  N   . THR A  1  607  ? 13.087  -39.205  4.284    1.00 80.88  ? 607  THR A N   1 
ATOM   4780  C  CA  . THR A  1  607  ? 14.455  -39.573  4.048    1.00 80.87  ? 607  THR A CA  1 
ATOM   4781  C  C   . THR A  1  607  ? 14.784  -39.231  2.607    1.00 80.38  ? 607  THR A C   1 
ATOM   4782  O  O   . THR A  1  607  ? 14.867  -40.124  1.757    1.00 79.16  ? 607  THR A O   1 
ATOM   4783  C  CB  . THR A  1  607  ? 14.619  -41.050  4.187    1.00 80.44  ? 607  THR A CB  1 
ATOM   4784  O  OG1 . THR A  1  607  ? 15.901  -41.411  3.665    1.00 79.71  ? 607  THR A OG1 1 
ATOM   4785  C  CG2 . THR A  1  607  ? 13.492  -41.782  3.405    1.00 81.14  ? 607  THR A CG2 1 
ATOM   4786  N  N   . ASP A  1  608  ? 14.974  -37.937  2.348    1.00 93.12  ? 608  ASP A N   1 
ATOM   4787  C  CA  . ASP A  1  608  ? 15.270  -37.449  1.011    1.00 90.52  ? 608  ASP A CA  1 
ATOM   4788  C  C   . ASP A  1  608  ? 14.435  -38.202  0.012    1.00 96.02  ? 608  ASP A C   1 
ATOM   4789  O  O   . ASP A  1  608  ? 14.993  -38.789  -0.909   1.00 89.73  ? 608  ASP A O   1 
ATOM   4790  C  CB  . ASP A  1  608  ? 16.754  -37.634  0.683    1.00 84.31  ? 608  ASP A CB  1 
ATOM   4791  C  CG  . ASP A  1  608  ? 17.514  -36.331  0.659    1.00 79.39  ? 608  ASP A CG  1 
ATOM   4792  O  OD1 . ASP A  1  608  ? 18.759  -36.368  0.529    1.00 79.92  ? 608  ASP A OD1 1 
ATOM   4793  O  OD2 . ASP A  1  608  ? 16.860  -35.268  0.751    1.00 79.77  ? 608  ASP A OD2 1 
ATOM   4794  N  N   . SER A  1  609  ? 13.117  -38.211  0.196    1.00 88.21  ? 609  SER A N   1 
ATOM   4795  C  CA  . SER A  1  609  ? 12.260  -38.990  -0.687   1.00 87.73  ? 609  SER A CA  1 
ATOM   4796  C  C   . SER A  1  609  ? 11.252  -38.112  -1.393   1.00 91.04  ? 609  SER A C   1 
ATOM   4797  O  O   . SER A  1  609  ? 10.304  -37.621  -0.777   1.00 97.96  ? 609  SER A O   1 
ATOM   4798  C  CB  . SER A  1  609  ? 11.526  -40.083  0.104    1.00 132.12 ? 609  SER A CB  1 
ATOM   4799  O  OG  . SER A  1  609  ? 12.393  -41.086  0.610    1.00 131.13 ? 609  SER A OG  1 
ATOM   4800  N  N   . GLY A  1  610  ? 11.440  -37.934  -2.688   1.00 80.26  ? 610  GLY A N   1 
ATOM   4801  C  CA  . GLY A  1  610  ? 10.569  -37.050  -3.425   1.00 78.21  ? 610  GLY A CA  1 
ATOM   4802  C  C   . GLY A  1  610  ? 11.408  -35.926  -3.960   1.00 80.37  ? 610  GLY A C   1 
ATOM   4803  O  O   . GLY A  1  610  ? 12.629  -36.086  -4.049   1.00 77.33  ? 610  GLY A O   1 
ATOM   4804  N  N   . MET A  1  611  ? 10.775  -34.804  -4.309   1.00 79.71  ? 611  MET A N   1 
ATOM   4805  C  CA  . MET A  1  611  ? 11.498  -33.639  -4.848   1.00 78.65  ? 611  MET A CA  1 
ATOM   4806  C  C   . MET A  1  611  ? 10.524  -32.477  -4.991   1.00 84.63  ? 611  MET A C   1 
ATOM   4807  O  O   . MET A  1  611  ? 9.331   -32.715  -5.226   1.00 83.24  ? 611  MET A O   1 
ATOM   4808  C  CB  . MET A  1  611  ? 12.139  -33.985  -6.200   1.00 77.72  ? 611  MET A CB  1 
ATOM   4809  C  CG  . MET A  1  611  ? 13.467  -33.337  -6.476   1.00 88.09  ? 611  MET A CG  1 
ATOM   4810  S  SD  . MET A  1  611  ? 13.233  -31.645  -6.949   1.00 83.88  ? 611  MET A SD  1 
ATOM   4811  C  CE  . MET A  1  611  ? 11.876  -31.809  -8.100   1.00 93.17  ? 611  MET A CE  1 
ATOM   4812  N  N   . LEU A  1  612  ? 11.016  -31.244  -4.848   1.00 78.51  ? 612  LEU A N   1 
ATOM   4813  C  CA  . LEU A  1  612  ? 10.155  -30.063  -4.731   1.00 79.71  ? 612  LEU A CA  1 
ATOM   4814  C  C   . LEU A  1  612  ? 10.979  -28.784  -4.760   1.00 79.64  ? 612  LEU A C   1 
ATOM   4815  O  O   . LEU A  1  612  ? 11.835  -28.562  -3.899   1.00 79.41  ? 612  LEU A O   1 
ATOM   4816  C  CB  . LEU A  1  612  ? 9.387   -30.105  -3.417   1.00 81.46  ? 612  LEU A CB  1 
ATOM   4817  C  CG  . LEU A  1  612  ? 8.855   -28.798  -2.848   1.00 81.16  ? 612  LEU A CG  1 
ATOM   4818  C  CD1 . LEU A  1  612  ? 7.762   -28.278  -3.707   1.00 80.66  ? 612  LEU A CD1 1 
ATOM   4819  C  CD2 . LEU A  1  612  ? 8.344   -29.057  -1.464   1.00 81.10  ? 612  LEU A CD2 1 
ATOM   4820  N  N   . ILE A  1  613  ? 10.732  -27.931  -5.756   1.00 79.31  ? 613  ILE A N   1 
ATOM   4821  C  CA  . ILE A  1  613  ? 11.481  -26.683  -5.900   1.00 79.29  ? 613  ILE A CA  1 
ATOM   4822  C  C   . ILE A  1  613  ? 10.551  -25.463  -5.758   1.00 81.24  ? 613  ILE A C   1 
ATOM   4823  O  O   . ILE A  1  613  ? 9.337   -25.541  -6.032   1.00 82.64  ? 613  ILE A O   1 
ATOM   4824  C  CB  . ILE A  1  613  ? 12.192  -26.598  -7.261   1.00 78.60  ? 613  ILE A CB  1 
ATOM   4825  C  CG1 . ILE A  1  613  ? 11.189  -26.772  -8.381   1.00 78.39  ? 613  ILE A CG1 1 
ATOM   4826  C  CG2 . ILE A  1  613  ? 13.228  -27.671  -7.434   1.00 77.45  ? 613  ILE A CG2 1 
ATOM   4827  C  CD1 . ILE A  1  613  ? 11.758  -26.338  -9.697   1.00 78.10  ? 613  ILE A CD1 1 
ATOM   4828  N  N   . GLU A  1  614  ? 11.126  -24.333  -5.345   1.00 139.72 ? 614  GLU A N   1 
ATOM   4829  C  CA  . GLU A  1  614  ? 10.374  -23.081  -5.201   1.00 100.55 ? 614  GLU A CA  1 
ATOM   4830  C  C   . GLU A  1  614  ? 10.932  -21.975  -6.073   1.00 97.03  ? 614  GLU A C   1 
ATOM   4831  O  O   . GLU A  1  614  ? 11.136  -22.152  -7.261   1.00 87.00  ? 614  GLU A O   1 
ATOM   4832  C  CB  . GLU A  1  614  ? 10.381  -22.608  -3.756   1.00 110.34 ? 614  GLU A CB  1 
ATOM   4833  C  CG  . GLU A  1  614  ? 9.744   -23.583  -2.777   1.00 142.85 ? 614  GLU A CG  1 
ATOM   4834  C  CD  . GLU A  1  614  ? 8.255   -23.723  -2.982   1.00 108.50 ? 614  GLU A CD  1 
ATOM   4835  O  OE1 . GLU A  1  614  ? 7.725   -23.092  -3.926   1.00 131.37 ? 614  GLU A OE1 1 
ATOM   4836  O  OE2 . GLU A  1  614  ? 7.613   -24.468  -2.200   1.00 158.46 ? 614  GLU A OE2 1 
ATOM   4837  N  N   . ASN A  1  615  ? 11.170  -20.816  -5.493   1.00 112.04 ? 615  ASN A N   1 
ATOM   4838  C  CA  . ASN A  1  615  ? 11.662  -19.742  -6.316   1.00 126.95 ? 615  ASN A CA  1 
ATOM   4839  C  C   . ASN A  1  615  ? 13.017  -20.124  -6.888   1.00 130.65 ? 615  ASN A C   1 
ATOM   4840  O  O   . ASN A  1  615  ? 14.036  -19.541  -6.532   1.00 116.74 ? 615  ASN A O   1 
ATOM   4841  C  CB  . ASN A  1  615  ? 11.732  -18.430  -5.540   1.00 126.98 ? 615  ASN A CB  1 
ATOM   4842  C  CG  . ASN A  1  615  ? 11.760  -17.203  -6.459   1.00 172.45 ? 615  ASN A CG  1 
ATOM   4843  O  OD1 . ASN A  1  615  ? 11.327  -17.255  -7.613   1.00 117.86 ? 615  ASN A OD1 1 
ATOM   4844  N  ND2 . ASN A  1  615  ? 12.268  -16.091  -5.935   1.00 240.45 ? 615  ASN A ND2 1 
ATOM   4845  N  N   . GLY A  1  616  ? 13.017  -21.118  -7.771   1.00 125.30 ? 616  GLY A N   1 
ATOM   4846  C  CA  . GLY A  1  616  ? 14.235  -21.556  -8.419   1.00 135.55 ? 616  GLY A CA  1 
ATOM   4847  C  C   . GLY A  1  616  ? 15.266  -22.028  -7.429   1.00 125.86 ? 616  GLY A C   1 
ATOM   4848  O  O   . GLY A  1  616  ? 16.455  -21.767  -7.602   1.00 130.57 ? 616  GLY A O   1 
ATOM   4849  N  N   . GLU A  1  617  ? 14.789  -22.720  -6.393   1.00 109.64 ? 617  GLU A N   1 
ATOM   4850  C  CA  . GLU A  1  617  ? 15.658  -23.306  -5.362   1.00 118.62 ? 617  GLU A CA  1 
ATOM   4851  C  C   . GLU A  1  617  ? 15.041  -24.601  -4.831   1.00 100.83 ? 617  GLU A C   1 
ATOM   4852  O  O   . GLU A  1  617  ? 13.853  -24.634  -4.515   1.00 102.48 ? 617  GLU A O   1 
ATOM   4853  C  CB  . GLU A  1  617  ? 15.861  -22.330  -4.197   1.00 124.34 ? 617  GLU A CB  1 
ATOM   4854  C  CG  . GLU A  1  617  ? 16.831  -21.175  -4.435   1.00 151.67 ? 617  GLU A CG  1 
ATOM   4855  C  CD  . GLU A  1  617  ? 17.077  -20.354  -3.167   1.00 101.42 ? 617  GLU A CD  1 
ATOM   4856  O  OE1 . GLU A  1  617  ? 16.681  -20.812  -2.071   1.00 114.56 ? 617  GLU A OE1 1 
ATOM   4857  O  OE2 . GLU A  1  617  ? 17.665  -19.254  -3.268   1.00 162.17 ? 617  GLU A OE2 1 
ATOM   4858  N  N   . ILE A  1  618  ? 15.828  -25.675  -4.753   1.00 132.73 ? 618  ILE A N   1 
ATOM   4859  C  CA  . ILE A  1  618  ? 15.267  -26.943  -4.294   1.00 126.33 ? 618  ILE A CA  1 
ATOM   4860  C  C   . ILE A  1  618  ? 15.373  -26.964  -2.801   1.00 92.62  ? 618  ILE A C   1 
ATOM   4861  O  O   . ILE A  1  618  ? 16.134  -26.196  -2.208   1.00 143.49 ? 618  ILE A O   1 
ATOM   4862  C  CB  . ILE A  1  618  ? 15.994  -28.188  -4.833   1.00 129.41 ? 618  ILE A CB  1 
ATOM   4863  C  CG1 . ILE A  1  618  ? 17.172  -28.545  -3.938   1.00 99.35  ? 618  ILE A CG1 1 
ATOM   4864  C  CG2 . ILE A  1  618  ? 16.483  -27.959  -6.251   1.00 115.30 ? 618  ILE A CG2 1 
ATOM   4865  C  CD1 . ILE A  1  618  ? 18.201  -27.443  -3.888   1.00 135.19 ? 618  ILE A CD1 1 
ATOM   4866  N  N   . ILE A  1  619  ? 14.611  -27.853  -2.190   1.00 78.90  ? 619  ILE A N   1 
ATOM   4867  C  CA  . ILE A  1  619  ? 14.535  -27.863  -0.744   1.00 80.51  ? 619  ILE A CA  1 
ATOM   4868  C  C   . ILE A  1  619  ? 14.159  -29.216  -0.185   1.00 79.58  ? 619  ILE A C   1 
ATOM   4869  O  O   . ILE A  1  619  ? 13.917  -29.344  1.016    1.00 80.22  ? 619  ILE A O   1 
ATOM   4870  C  CB  . ILE A  1  619  ? 13.465  -26.902  -0.275   1.00 80.97  ? 619  ILE A CB  1 
ATOM   4871  C  CG1 . ILE A  1  619  ? 12.197  -27.101  -1.085   1.00 80.98  ? 619  ILE A CG1 1 
ATOM   4872  C  CG2 . ILE A  1  619  ? 13.924  -25.494  -0.461   1.00 80.36  ? 619  ILE A CG2 1 
ATOM   4873  C  CD1 . ILE A  1  619  ? 11.054  -26.385  -0.491   1.00 81.59  ? 619  ILE A CD1 1 
ATOM   4874  N  N   . TYR A  1  620  ? 14.153  -30.242  -1.031   1.00 122.56 ? 620  TYR A N   1 
ATOM   4875  C  CA  . TYR A  1  620  ? 13.357  -31.418  -0.732   1.00 81.43  ? 620  TYR A CA  1 
ATOM   4876  C  C   . TYR A  1  620  ? 13.801  -32.550  -1.630   1.00 113.29 ? 620  TYR A C   1 
ATOM   4877  O  O   . TYR A  1  620  ? 13.745  -32.431  -2.849   1.00 112.94 ? 620  TYR A O   1 
ATOM   4878  C  CB  . TYR A  1  620  ? 11.906  -31.048  -1.011   1.00 104.21 ? 620  TYR A CB  1 
ATOM   4879  C  CG  . TYR A  1  620  ? 10.882  -32.044  -0.576   1.00 85.37  ? 620  TYR A CG  1 
ATOM   4880  C  CD1 . TYR A  1  620  ? 10.194  -32.792  -1.499   1.00 90.97  ? 620  TYR A CD1 1 
ATOM   4881  C  CD2 . TYR A  1  620  ? 10.576  -32.204  0.749    1.00 86.92  ? 620  TYR A CD2 1 
ATOM   4882  C  CE1 . TYR A  1  620  ? 9.247   -33.687  -1.114   1.00 140.20 ? 620  TYR A CE1 1 
ATOM   4883  C  CE2 . TYR A  1  620  ? 9.626   -33.096  1.152    1.00 132.57 ? 620  TYR A CE2 1 
ATOM   4884  C  CZ  . TYR A  1  620  ? 8.967   -33.839  0.220    1.00 111.38 ? 620  TYR A CZ  1 
ATOM   4885  O  OH  . TYR A  1  620  ? 8.021   -34.736  0.628    1.00 94.46  ? 620  TYR A OH  1 
ATOM   4886  N  N   . GLY A  1  621  ? 14.279  -33.637  -1.047   1.00 120.95 ? 621  GLY A N   1 
ATOM   4887  C  CA  . GLY A  1  621  ? 14.651  -34.790  -1.848   1.00 84.67  ? 621  GLY A CA  1 
ATOM   4888  C  C   . GLY A  1  621  ? 15.926  -34.639  -2.655   1.00 115.16 ? 621  GLY A C   1 
ATOM   4889  O  O   . GLY A  1  621  ? 16.799  -33.856  -2.301   1.00 80.24  ? 621  GLY A O   1 
ATOM   4890  N  N   . VAL A  1  622  ? 16.009  -35.367  -3.767   1.00 76.94  ? 622  VAL A N   1 
ATOM   4891  C  CA  . VAL A  1  622  ? 17.278  -35.566  -4.450   1.00 76.85  ? 622  VAL A CA  1 
ATOM   4892  C  C   . VAL A  1  622  ? 17.176  -35.666  -5.950   1.00 76.82  ? 622  VAL A C   1 
ATOM   4893  O  O   . VAL A  1  622  ? 16.384  -36.426  -6.464   1.00 76.21  ? 622  VAL A O   1 
ATOM   4894  C  CB  . VAL A  1  622  ? 17.859  -36.889  -4.046   1.00 76.28  ? 622  VAL A CB  1 
ATOM   4895  C  CG1 . VAL A  1  622  ? 18.974  -37.261  -5.000   1.00 76.57  ? 622  VAL A CG1 1 
ATOM   4896  C  CG2 . VAL A  1  622  ? 18.332  -36.849  -2.604   1.00 77.62  ? 622  VAL A CG2 1 
ATOM   4897  N  N   . VAL A  1  623  ? 18.041  -34.966  -6.660   1.00 76.33  ? 623  VAL A N   1 
ATOM   4898  C  CA  . VAL A  1  623  ? 17.929  -34.933  -8.108   1.00 75.95  ? 623  VAL A CA  1 
ATOM   4899  C  C   . VAL A  1  623  ? 18.496  -36.190  -8.774   1.00 74.88  ? 623  VAL A C   1 
ATOM   4900  O  O   . VAL A  1  623  ? 19.628  -36.587  -8.495   1.00 74.53  ? 623  VAL A O   1 
ATOM   4901  C  CB  . VAL A  1  623  ? 18.595  -33.653  -8.670   1.00 75.41  ? 623  VAL A CB  1 
ATOM   4902  C  CG1 . VAL A  1  623  ? 18.370  -33.544  -10.137  1.00 74.44  ? 623  VAL A CG1 1 
ATOM   4903  C  CG2 . VAL A  1  623  ? 18.036  -32.402  -7.976   1.00 76.54  ? 623  VAL A CG2 1 
ATOM   4904  N  N   . ASP A  1  624  ? 17.699  -36.800  -9.651   1.00 112.48 ? 624  ASP A N   1 
ATOM   4905  C  CA  . ASP A  1  624  ? 18.110  -37.951  -10.459  1.00 113.24 ? 624  ASP A CA  1 
ATOM   4906  C  C   . ASP A  1  624  ? 17.407  -37.932  -11.815  1.00 109.46 ? 624  ASP A C   1 
ATOM   4907  O  O   . ASP A  1  624  ? 16.856  -36.918  -12.206  1.00 145.33 ? 624  ASP A O   1 
ATOM   4908  C  CB  . ASP A  1  624  ? 17.800  -39.263  -9.739   1.00 107.35 ? 624  ASP A CB  1 
ATOM   4909  C  CG  . ASP A  1  624  ? 16.389  -39.311  -9.182   1.00 97.48  ? 624  ASP A CG  1 
ATOM   4910  O  OD1 . ASP A  1  624  ? 15.707  -38.263  -9.180   1.00 96.73  ? 624  ASP A OD1 1 
ATOM   4911  O  OD2 . ASP A  1  624  ? 15.963  -40.402  -8.740   1.00 119.00 ? 624  ASP A OD2 1 
ATOM   4912  N  N   . LYS A  1  625  ? 17.412  -39.040  -12.546  1.00 74.20  ? 625  LYS A N   1 
ATOM   4913  C  CA  . LYS A  1  625  ? 16.717  -39.061  -13.832  1.00 74.87  ? 625  LYS A CA  1 
ATOM   4914  C  C   . LYS A  1  625  ? 15.245  -38.695  -13.706  1.00 74.47  ? 625  LYS A C   1 
ATOM   4915  O  O   . LYS A  1  625  ? 14.617  -38.217  -14.644  1.00 76.67  ? 625  LYS A O   1 
ATOM   4916  C  CB  . LYS A  1  625  ? 16.817  -40.424  -14.504  1.00 74.68  ? 625  LYS A CB  1 
ATOM   4917  C  CG  . LYS A  1  625  ? 15.930  -40.528  -15.747  1.00 74.92  ? 625  LYS A CG  1 
ATOM   4918  C  CD  . LYS A  1  625  ? 15.641  -41.969  -16.174  1.00 77.31  ? 625  LYS A CD  1 
ATOM   4919  C  CE  . LYS A  1  625  ? 16.879  -42.639  -16.781  1.00 73.88  ? 625  LYS A CE  1 
ATOM   4920  N  NZ  . LYS A  1  625  ? 17.434  -41.971  -18.023  1.00 73.29  ? 625  LYS A NZ  1 
ATOM   4921  N  N   . LYS A  1  626  ? 14.693  -38.935  -12.532  1.00 109.36 ? 626  LYS A N   1 
ATOM   4922  C  CA  . LYS A  1  626  ? 13.281  -38.722  -12.321  1.00 122.54 ? 626  LYS A CA  1 
ATOM   4923  C  C   . LYS A  1  626  ? 12.893  -37.316  -12.731  1.00 115.94 ? 626  LYS A C   1 
ATOM   4924  O  O   . LYS A  1  626  ? 11.749  -37.082  -13.095  1.00 123.56 ? 626  LYS A O   1 
ATOM   4925  C  CB  . LYS A  1  626  ? 12.936  -38.988  -10.854  1.00 120.49 ? 626  LYS A CB  1 
ATOM   4926  C  CG  . LYS A  1  626  ? 13.237  -40.423  -10.421  1.00 113.30 ? 626  LYS A CG  1 
ATOM   4927  C  CD  . LYS A  1  626  ? 12.807  -40.715  -8.990   1.00 101.29 ? 626  LYS A CD  1 
ATOM   4928  C  CE  . LYS A  1  626  ? 13.146  -42.149  -8.595   1.00 128.60 ? 626  LYS A CE  1 
ATOM   4929  N  NZ  . LYS A  1  626  ? 12.627  -43.156  -9.568   1.00 139.21 ? 626  LYS A NZ  1 
ATOM   4930  N  N   . THR A  1  627  ? 13.862  -36.399  -12.701  1.00 76.01  ? 627  THR A N   1 
ATOM   4931  C  CA  . THR A  1  627  ? 13.571  -34.963  -12.774  1.00 76.63  ? 627  THR A CA  1 
ATOM   4932  C  C   . THR A  1  627  ? 14.449  -34.175  -13.765  1.00 76.69  ? 627  THR A C   1 
ATOM   4933  O  O   . THR A  1  627  ? 14.024  -33.170  -14.306  1.00 76.93  ? 627  THR A O   1 
ATOM   4934  C  CB  . THR A  1  627  ? 13.570  -34.334  -11.359  1.00 75.21  ? 627  THR A CB  1 
ATOM   4935  O  OG1 . THR A  1  627  ? 14.841  -34.542  -10.743  1.00 74.93  ? 627  THR A OG1 1 
ATOM   4936  C  CG2 . THR A  1  627  ? 12.495  -34.977  -10.484  1.00 75.85  ? 627  THR A CG2 1 
ATOM   4937  N  N   . VAL A  1  628  ? 15.649  -34.638  -14.034  1.00 75.97  ? 628  VAL A N   1 
ATOM   4938  C  CA  . VAL A  1  628  ? 16.440  -33.964  -15.028  1.00 75.85  ? 628  VAL A CA  1 
ATOM   4939  C  C   . VAL A  1  628  ? 16.637  -34.846  -16.258  1.00 74.65  ? 628  VAL A C   1 
ATOM   4940  O  O   . VAL A  1  628  ? 17.711  -34.833  -16.880  1.00 74.76  ? 628  VAL A O   1 
ATOM   4941  C  CB  . VAL A  1  628  ? 17.743  -33.526  -14.445  1.00 75.71  ? 628  VAL A CB  1 
ATOM   4942  C  CG1 . VAL A  1  628  ? 17.463  -32.748  -13.189  1.00 77.20  ? 628  VAL A CG1 1 
ATOM   4943  C  CG2 . VAL A  1  628  ? 18.587  -34.720  -14.153  1.00 75.31  ? 628  VAL A CG2 1 
ATOM   4944  N  N   . GLY A  1  629  ? 15.584  -35.595  -16.606  1.00 74.97  ? 629  GLY A N   1 
ATOM   4945  C  CA  . GLY A  1  629  ? 15.581  -36.454  -17.788  1.00 73.87  ? 629  GLY A CA  1 
ATOM   4946  C  C   . GLY A  1  629  ? 14.240  -36.255  -18.438  1.00 74.64  ? 629  GLY A C   1 
ATOM   4947  O  O   . GLY A  1  629  ? 13.375  -35.659  -17.815  1.00 74.52  ? 629  GLY A O   1 
ATOM   4948  N  N   . ALA A  1  630  ? 14.053  -36.744  -19.654  1.00 74.35  ? 630  ALA A N   1 
ATOM   4949  C  CA  . ALA A  1  630  ? 12.844  -36.447  -20.419  1.00 74.88  ? 630  ALA A CA  1 
ATOM   4950  C  C   . ALA A  1  630  ? 11.500  -36.800  -19.780  1.00 75.72  ? 630  ALA A C   1 
ATOM   4951  O  O   . ALA A  1  630  ? 10.564  -37.189  -20.480  1.00 76.48  ? 630  ALA A O   1 
ATOM   4952  C  CB  . ALA A  1  630  ? 12.941  -37.076  -21.791  1.00 74.90  ? 630  ALA A CB  1 
ATOM   4953  N  N   . SER A  1  631  ? 11.386  -36.617  -18.470  1.00 78.47  ? 631  SER A N   1 
ATOM   4954  C  CA  . SER A  1  631  ? 10.181  -37.033  -17.739  1.00 108.81 ? 631  SER A CA  1 
ATOM   4955  C  C   . SER A  1  631  ? 8.928   -36.273  -18.174  1.00 82.36  ? 631  SER A C   1 
ATOM   4956  O  O   . SER A  1  631  ? 9.038   -35.227  -18.782  1.00 82.42  ? 631  SER A O   1 
ATOM   4957  C  CB  . SER A  1  631  ? 10.401  -36.886  -16.219  1.00 105.20 ? 631  SER A CB  1 
ATOM   4958  O  OG  . SER A  1  631  ? 9.304   -37.371  -15.436  1.00 79.76  ? 631  SER A OG  1 
ATOM   4959  N  N   . GLN A  1  632  ? 7.746   -36.810  -17.870  1.00 137.18 ? 632  GLN A N   1 
ATOM   4960  C  CA  . GLN A  1  632  ? 6.474   -36.136  -18.145  1.00 103.60 ? 632  GLN A CA  1 
ATOM   4961  C  C   . GLN A  1  632  ? 6.557   -34.696  -17.660  1.00 104.90 ? 632  GLN A C   1 
ATOM   4962  O  O   . GLN A  1  632  ? 7.030   -33.820  -18.360  1.00 177.15 ? 632  GLN A O   1 
ATOM   4963  C  CB  . GLN A  1  632  ? 5.304   -36.827  -17.413  1.00 114.24 ? 632  GLN A CB  1 
ATOM   4964  C  CG  . GLN A  1  632  ? 5.185   -38.349  -17.578  1.00 151.24 ? 632  GLN A CG  1 
ATOM   4965  C  CD  . GLN A  1  632  ? 4.082   -38.963  -16.711  1.00 139.89 ? 632  GLN A CD  1 
ATOM   4966  O  OE1 . GLN A  1  632  ? 3.501   -38.293  -15.857  1.00 143.00 ? 632  GLN A OE1 1 
ATOM   4967  N  NE2 . GLN A  1  632  ? 3.793   -40.242  -16.935  1.00 97.77  ? 632  GLN A NE2 1 
ATOM   4968  N  N   . GLY A  1  633  ? 6.089   -34.464  -16.439  1.00 78.32  ? 633  GLY A N   1 
ATOM   4969  C  CA  . GLY A  1  633  ? 6.211   -33.165  -15.795  1.00 78.85  ? 633  GLY A CA  1 
ATOM   4970  C  C   . GLY A  1  633  ? 7.642   -32.907  -15.405  1.00 78.63  ? 633  GLY A C   1 
ATOM   4971  O  O   . GLY A  1  633  ? 7.915   -32.409  -14.324  1.00 80.31  ? 633  GLY A O   1 
ATOM   4972  N  N   . GLY A  1  634  ? 8.547   -33.250  -16.312  1.00 77.50  ? 634  GLY A N   1 
ATOM   4973  C  CA  . GLY A  1  634  ? 9.976   -33.182  -16.066  1.00 75.97  ? 634  GLY A CA  1 
ATOM   4974  C  C   . GLY A  1  634  ? 10.553  -31.793  -15.867  1.00 78.04  ? 634  GLY A C   1 
ATOM   4975  O  O   . GLY A  1  634  ? 10.074  -30.844  -16.458  1.00 106.26 ? 634  GLY A O   1 
ATOM   4976  N  N   . LEU A  1  635  ? 11.588  -31.663  -15.045  1.00 76.70  ? 635  LEU A N   1 
ATOM   4977  C  CA  . LEU A  1  635  ? 12.099  -30.347  -14.764  1.00 76.49  ? 635  LEU A CA  1 
ATOM   4978  C  C   . LEU A  1  635  ? 12.559  -29.790  -16.075  1.00 77.00  ? 635  LEU A C   1 
ATOM   4979  O  O   . LEU A  1  635  ? 12.437  -28.598  -16.312  1.00 78.18  ? 635  LEU A O   1 
ATOM   4980  C  CB  . LEU A  1  635  ? 13.267  -30.385  -13.789  1.00 76.44  ? 635  LEU A CB  1 
ATOM   4981  C  CG  . LEU A  1  635  ? 13.695  -29.039  -13.197  1.00 77.33  ? 635  LEU A CG  1 
ATOM   4982  C  CD1 . LEU A  1  635  ? 14.584  -29.191  -12.000  1.00 77.53  ? 635  LEU A CD1 1 
ATOM   4983  C  CD2 . LEU A  1  635  ? 14.395  -28.166  -14.212  1.00 77.51  ? 635  LEU A CD2 1 
ATOM   4984  N  N   . VAL A  1  636  ? 13.086  -30.641  -16.944  1.00 75.65  ? 636  VAL A N   1 
ATOM   4985  C  CA  . VAL A  1  636  ? 13.552  -30.150  -18.215  1.00 76.75  ? 636  VAL A CA  1 
ATOM   4986  C  C   . VAL A  1  636  ? 12.402  -29.618  -19.000  1.00 77.83  ? 636  VAL A C   1 
ATOM   4987  O  O   . VAL A  1  636  ? 12.523  -28.629  -19.685  1.00 77.46  ? 636  VAL A O   1 
ATOM   4988  C  CB  . VAL A  1  636  ? 14.118  -31.240  -19.034  1.00 75.01  ? 636  VAL A CB  1 
ATOM   4989  C  CG1 . VAL A  1  636  ? 14.332  -30.753  -20.453  1.00 76.50  ? 636  VAL A CG1 1 
ATOM   4990  C  CG2 . VAL A  1  636  ? 15.392  -31.709  -18.393  1.00 75.53  ? 636  VAL A CG2 1 
ATOM   4991  N  N   . HIS A  1  637  ? 11.283  -30.319  -18.906  1.00 78.62  ? 637  HIS A N   1 
ATOM   4992  C  CA  . HIS A  1  637  ? 10.052  -29.964  -19.601  1.00 79.36  ? 637  HIS A CA  1 
ATOM   4993  C  C   . HIS A  1  637  ? 9.541   -28.649  -19.092  1.00 78.01  ? 637  HIS A C   1 
ATOM   4994  O  O   . HIS A  1  637  ? 9.014   -27.866  -19.853  1.00 78.30  ? 637  HIS A O   1 
ATOM   4995  C  CB  . HIS A  1  637  ? 8.988   -31.032  -19.342  1.00 79.94  ? 637  HIS A CB  1 
ATOM   4996  C  CG  . HIS A  1  637  ? 7.856   -31.036  -20.318  1.00 80.06  ? 637  HIS A CG  1 
ATOM   4997  N  ND1 . HIS A  1  637  ? 7.987   -31.518  -21.602  1.00 77.83  ? 637  HIS A ND1 1 
ATOM   4998  C  CD2 . HIS A  1  637  ? 6.569   -30.662  -20.186  1.00 79.49  ? 637  HIS A CD2 1 
ATOM   4999  C  CE1 . HIS A  1  637  ? 6.830   -31.415  -22.228  1.00 80.96  ? 637  HIS A CE1 1 
ATOM   5000  N  NE2 . HIS A  1  637  ? 5.952   -30.897  -21.389  1.00 78.08  ? 637  HIS A NE2 1 
ATOM   5001  N  N   . THR A  1  638  ? 9.719   -28.412  -17.799  1.00 77.28  ? 638  THR A N   1 
ATOM   5002  C  CA  . THR A  1  638  ? 9.003   -27.347  -17.113  1.00 78.59  ? 638  THR A CA  1 
ATOM   5003  C  C   . THR A  1  638  ? 9.580   -25.955  -17.334  1.00 77.79  ? 638  THR A C   1 
ATOM   5004  O  O   . THR A  1  638  ? 8.905   -24.956  -17.086  1.00 78.59  ? 638  THR A O   1 
ATOM   5005  C  CB  . THR A  1  638  ? 8.900   -27.597  -15.601  1.00 78.02  ? 638  THR A CB  1 
ATOM   5006  O  OG1 . THR A  1  638  ? 8.486   -28.940  -15.346  1.00 79.94  ? 638  THR A OG1 1 
ATOM   5007  C  CG2 . THR A  1  638  ? 7.899   -26.648  -14.975  1.00 78.69  ? 638  THR A CG2 1 
ATOM   5008  N  N   . ILE A  1  639  ? 10.819  -25.866  -17.784  1.00 78.42  ? 639  ILE A N   1 
ATOM   5009  C  CA  . ILE A  1  639  ? 11.347  -24.565  -18.137  1.00 77.53  ? 639  ILE A CA  1 
ATOM   5010  C  C   . ILE A  1  639  ? 11.566  -24.477  -19.639  1.00 83.99  ? 639  ILE A C   1 
ATOM   5011  O  O   . ILE A  1  639  ? 12.690  -24.356  -20.120  1.00 80.98  ? 639  ILE A O   1 
ATOM   5012  C  CB  . ILE A  1  639  ? 12.614  -24.210  -17.347  1.00 80.64  ? 639  ILE A CB  1 
ATOM   5013  C  CG1 . ILE A  1  639  ? 13.747  -25.153  -17.652  1.00 76.97  ? 639  ILE A CG1 1 
ATOM   5014  C  CG2 . ILE A  1  639  ? 12.365  -24.302  -15.890  1.00 81.63  ? 639  ILE A CG2 1 
ATOM   5015  C  CD1 . ILE A  1  639  ? 14.680  -25.323  -16.533  1.00 77.39  ? 639  ILE A CD1 1 
ATOM   5016  N  N   . TRP A  1  640  ? 10.495  -24.519  -20.400  1.00 79.16  ? 640  TRP A N   1 
ATOM   5017  C  CA  . TRP A  1  640  ? 10.730  -24.608  -21.802  1.00 80.07  ? 640  TRP A CA  1 
ATOM   5018  C  C   . TRP A  1  640  ? 9.968   -23.711  -22.810  1.00 78.61  ? 640  TRP A C   1 
ATOM   5019  O  O   . TRP A  1  640  ? 10.626  -23.150  -23.699  1.00 79.09  ? 640  TRP A O   1 
ATOM   5020  C  CB  . TRP A  1  640  ? 10.766  -26.071  -22.226  1.00 78.68  ? 640  TRP A CB  1 
ATOM   5021  C  CG  . TRP A  1  640  ? 11.108  -26.240  -23.681  1.00 77.58  ? 640  TRP A CG  1 
ATOM   5022  C  CD1 . TRP A  1  640  ? 12.342  -26.386  -24.235  1.00 77.60  ? 640  TRP A CD1 1 
ATOM   5023  C  CD2 . TRP A  1  640  ? 10.186  -26.231  -24.761  1.00 80.36  ? 640  TRP A CD2 1 
ATOM   5024  N  NE1 . TRP A  1  640  ? 12.236  -26.490  -25.598  1.00 77.49  ? 640  TRP A NE1 1 
ATOM   5025  C  CE2 . TRP A  1  640  ? 10.918  -26.392  -25.937  1.00 79.18  ? 640  TRP A CE2 1 
ATOM   5026  C  CE3 . TRP A  1  640  ? 8.798   -26.106  -24.836  1.00 80.06  ? 640  TRP A CE3 1 
ATOM   5027  C  CZ2 . TRP A  1  640  ? 10.322  -26.436  -27.159  1.00 81.15  ? 640  TRP A CZ2 1 
ATOM   5028  C  CZ3 . TRP A  1  640  ? 8.204   -26.152  -26.055  1.00 81.90  ? 640  TRP A CZ3 1 
ATOM   5029  C  CH2 . TRP A  1  640  ? 8.960   -26.315  -27.204  1.00 81.65  ? 640  TRP A CH2 1 
ATOM   5030  N  N   . LYS A  1  641  ? 8.646   -23.516  -22.732  1.00 83.35  ? 641  LYS A N   1 
ATOM   5031  C  CA  . LYS A  1  641  ? 7.746   -23.864  -21.638  1.00 83.50  ? 641  LYS A CA  1 
ATOM   5032  C  C   . LYS A  1  641  ? 8.160   -23.210  -20.333  1.00 80.94  ? 641  LYS A C   1 
ATOM   5033  O  O   . LYS A  1  641  ? 8.472   -23.900  -19.379  1.00 81.21  ? 641  LYS A O   1 
ATOM   5034  C  CB  . LYS A  1  641  ? 7.565   -25.374  -21.506  1.00 81.17  ? 641  LYS A CB  1 
ATOM   5035  C  CG  . LYS A  1  641  ? 6.137   -25.819  -21.195  1.00 88.57  ? 641  LYS A CG  1 
ATOM   5036  C  CD  . LYS A  1  641  ? 5.214   -25.709  -22.405  1.00 86.93  ? 641  LYS A CD  1 
ATOM   5037  C  CE  . LYS A  1  641  ? 3.913   -26.478  -22.203  1.00 89.84  ? 641  LYS A CE  1 
ATOM   5038  N  NZ  . LYS A  1  641  ? 2.711   -25.693  -22.623  1.00 90.16  ? 641  LYS A NZ  1 
ATOM   5039  N  N   . GLU A  1  642  ? 8.197   -21.872  -20.310  1.00 126.47 ? 642  GLU A N   1 
ATOM   5040  C  CA  . GLU A  1  642  ? 8.440   -21.099  -19.092  1.00 132.66 ? 642  GLU A CA  1 
ATOM   5041  C  C   . GLU A  1  642  ? 9.886   -21.213  -18.643  1.00 82.87  ? 642  GLU A C   1 
ATOM   5042  O  O   . GLU A  1  642  ? 10.192  -22.068  -17.840  1.00 84.40  ? 642  GLU A O   1 
ATOM   5043  C  CB  . GLU A  1  642  ? 7.524   -21.649  -18.003  1.00 129.54 ? 642  GLU A CB  1 
ATOM   5044  C  CG  . GLU A  1  642  ? 7.062   -20.694  -16.952  1.00 100.45 ? 642  GLU A CG  1 
ATOM   5045  C  CD  . GLU A  1  642  ? 5.898   -21.270  -16.167  1.00 109.42 ? 642  GLU A CD  1 
ATOM   5046  O  OE1 . GLU A  1  642  ? 5.422   -22.350  -16.575  1.00 101.39 ? 642  GLU A OE1 1 
ATOM   5047  O  OE2 . GLU A  1  642  ? 5.460   -20.660  -15.160  1.00 116.55 ? 642  GLU A OE2 1 
ATOM   5048  N  N   . LYS A  1  643  ? 10.752  -20.350  -19.163  1.00 135.04 ? 643  LYS A N   1 
ATOM   5049  C  CA  . LYS A  1  643  ? 10.337  -19.335  -20.125  1.00 137.45 ? 643  LYS A CA  1 
ATOM   5050  C  C   . LYS A  1  643  ? 11.058  -19.513  -21.458  1.00 113.08 ? 643  LYS A C   1 
ATOM   5051  O  O   . LYS A  1  643  ? 11.991  -18.775  -21.774  1.00 121.25 ? 643  LYS A O   1 
ATOM   5052  C  CB  . LYS A  1  643  ? 10.596  -17.933  -19.572  1.00 163.05 ? 643  LYS A CB  1 
ATOM   5053  C  CG  . LYS A  1  643  ? 10.855  -17.895  -18.074  1.00 152.33 ? 643  LYS A CG  1 
ATOM   5054  C  CD  . LYS A  1  643  ? 10.575  -16.516  -17.500  1.00 173.26 ? 643  LYS A CD  1 
ATOM   5055  C  CE  . LYS A  1  643  ? 10.645  -16.526  -15.982  1.00 161.53 ? 643  LYS A CE  1 
ATOM   5056  N  NZ  . LYS A  1  643  ? 10.606  -15.149  -15.415  1.00 189.15 ? 643  LYS A NZ  1 
ATOM   5057  N  N   . GLY A  1  644  ? 10.619  -20.496  -22.236  1.00 88.18  ? 644  GLY A N   1 
ATOM   5058  C  CA  . GLY A  1  644  ? 11.217  -20.772  -23.530  1.00 87.18  ? 644  GLY A CA  1 
ATOM   5059  C  C   . GLY A  1  644  ? 12.683  -21.142  -23.423  1.00 85.43  ? 644  GLY A C   1 
ATOM   5060  O  O   . GLY A  1  644  ? 13.295  -20.999  -22.364  1.00 123.72 ? 644  GLY A O   1 
ATOM   5061  N  N   . PRO A  1  645  ? 13.249  -21.624  -24.526  1.00 82.26  ? 645  PRO A N   1 
ATOM   5062  C  CA  . PRO A  1  645  ? 14.660  -22.020  -24.557  1.00 80.77  ? 645  PRO A CA  1 
ATOM   5063  C  C   . PRO A  1  645  ? 15.581  -20.866  -24.176  1.00 80.67  ? 645  PRO A C   1 
ATOM   5064  O  O   . PRO A  1  645  ? 15.734  -19.919  -24.949  1.00 84.04  ? 645  PRO A O   1 
ATOM   5065  C  CB  . PRO A  1  645  ? 14.877  -22.404  -26.022  1.00 80.32  ? 645  PRO A CB  1 
ATOM   5066  C  CG  . PRO A  1  645  ? 13.537  -22.847  -26.490  1.00 81.27  ? 645  PRO A CG  1 
ATOM   5067  C  CD  . PRO A  1  645  ? 12.543  -21.984  -25.767  1.00 80.31  ? 645  PRO A CD  1 
ATOM   5068  N  N   . GLU A  1  646  ? 16.188  -20.950  -22.996  1.00 138.83 ? 646  GLU A N   1 
ATOM   5069  C  CA  . GLU A  1  646  ? 17.091  -19.911  -22.523  1.00 165.40 ? 646  GLU A CA  1 
ATOM   5070  C  C   . GLU A  1  646  ? 16.344  -18.859  -21.709  1.00 178.16 ? 646  GLU A C   1 
ATOM   5071  O  O   . GLU A  1  646  ? 15.350  -18.295  -22.168  1.00 168.85 ? 646  GLU A O   1 
ATOM   5072  C  CB  . GLU A  1  646  ? 17.813  -19.250  -23.700  1.00 196.08 ? 646  GLU A CB  1 
ATOM   5073  C  CG  . GLU A  1  646  ? 17.034  -18.118  -24.348  1.00 164.71 ? 646  GLU A CG  1 
ATOM   5074  C  CD  . GLU A  1  646  ? 17.741  -17.545  -25.561  1.00 188.34 ? 646  GLU A CD  1 
ATOM   5075  O  OE1 . GLU A  1  646  ? 18.883  -17.967  -25.839  1.00 180.14 ? 646  GLU A OE1 1 
ATOM   5076  O  OE2 . GLU A  1  646  ? 17.153  -16.673  -26.237  1.00 211.41 ? 646  GLU A OE2 1 
ATOM   5077  N  N   . ILE A  1  647  ? 16.829  -18.597  -20.500  1.00 223.10 ? 647  ILE A N   1 
ATOM   5078  C  CA  . ILE A  1  647  ? 18.010  -19.280  -19.986  1.00 255.08 ? 647  ILE A CA  1 
ATOM   5079  C  C   . ILE A  1  647  ? 17.887  -20.792  -20.146  1.00 252.88 ? 647  ILE A C   1 
ATOM   5080  O  O   . ILE A  1  647  ? 18.802  -21.539  -19.801  1.00 261.27 ? 647  ILE A O   1 
ATOM   5081  C  CB  . ILE A  1  647  ? 18.249  -18.951  -18.501  1.00 347.18 ? 647  ILE A CB  1 
ATOM   5082  C  CG1 . ILE A  1  647  ? 16.978  -19.198  -17.687  1.00 305.50 ? 647  ILE A CG1 1 
ATOM   5083  C  CG2 . ILE A  1  647  ? 18.718  -17.512  -18.344  1.00 375.44 ? 647  ILE A CG2 1 
ATOM   5084  C  CD1 . ILE A  1  647  ? 17.130  -18.901  -16.211  1.00 274.99 ? 647  ILE A CD1 1 
ATOM   5085  N  N   . CYS A  1  648  ? 16.750  -21.235  -20.674  1.00 97.88  ? 648  CYS A N   1 
ATOM   5086  C  CA  . CYS A  1  648  ? 16.505  -22.657  -20.882  1.00 95.73  ? 648  CYS A CA  1 
ATOM   5087  C  C   . CYS A  1  648  ? 17.735  -23.350  -21.459  1.00 96.91  ? 648  CYS A C   1 
ATOM   5088  O  O   . CYS A  1  648  ? 18.270  -24.285  -20.863  1.00 95.66  ? 648  CYS A O   1 
ATOM   5089  C  CB  . CYS A  1  648  ? 15.304  -22.864  -21.808  1.00 96.51  ? 648  CYS A CB  1 
ATOM   5090  S  SG  . CYS A  1  648  ? 14.744  -24.578  -21.932  1.00 94.16  ? 648  CYS A SG  1 
ATOM   5091  N  N   . LYS A  1  649  ? 18.181  -22.883  -22.621  1.00 92.72  ? 649  LYS A N   1 
ATOM   5092  C  CA  . LYS A  1  649  ? 19.350  -23.455  -23.279  1.00 84.75  ? 649  LYS A CA  1 
ATOM   5093  C  C   . LYS A  1  649  ? 20.562  -23.443  -22.355  1.00 102.70 ? 649  LYS A C   1 
ATOM   5094  O  O   . LYS A  1  649  ? 21.495  -24.227  -22.529  1.00 96.84  ? 649  LYS A O   1 
ATOM   5095  C  CB  . LYS A  1  649  ? 19.664  -22.694  -24.569  1.00 115.84 ? 649  LYS A CB  1 
ATOM   5096  C  CG  . LYS A  1  649  ? 21.125  -22.756  -24.985  1.00 113.86 ? 649  LYS A CG  1 
ATOM   5097  C  CD  . LYS A  1  649  ? 21.510  -21.551  -25.828  1.00 113.06 ? 649  LYS A CD  1 
ATOM   5098  C  CE  . LYS A  1  649  ? 22.801  -21.801  -26.591  1.00 108.32 ? 649  LYS A CE  1 
ATOM   5099  N  NZ  . LYS A  1  649  ? 23.391  -20.537  -27.111  1.00 108.34 ? 649  LYS A NZ  1 
ATOM   5100  N  N   . GLY A  1  650  ? 20.542  -22.550  -21.371  1.00 106.12 ? 650  GLY A N   1 
ATOM   5101  C  CA  . GLY A  1  650  ? 21.634  -22.436  -20.421  1.00 105.73 ? 650  GLY A CA  1 
ATOM   5102  C  C   . GLY A  1  650  ? 21.578  -23.500  -19.344  1.00 105.03 ? 650  GLY A C   1 
ATOM   5103  O  O   . GLY A  1  650  ? 22.603  -23.877  -18.775  1.00 104.33 ? 650  GLY A O   1 
ATOM   5104  N  N   . PHE A  1  651  ? 20.374  -23.987  -19.062  1.00 77.06  ? 651  PHE A N   1 
ATOM   5105  C  CA  . PHE A  1  651  ? 20.182  -25.016  -18.046  1.00 76.29  ? 651  PHE A CA  1 
ATOM   5106  C  C   . PHE A  1  651  ? 21.141  -26.182  -18.256  1.00 76.32  ? 651  PHE A C   1 
ATOM   5107  O  O   . PHE A  1  651  ? 21.833  -26.603  -17.328  1.00 75.60  ? 651  PHE A O   1 
ATOM   5108  C  CB  . PHE A  1  651  ? 18.736  -25.516  -18.057  1.00 75.56  ? 651  PHE A CB  1 
ATOM   5109  C  CG  . PHE A  1  651  ? 18.411  -26.455  -16.931  1.00 75.26  ? 651  PHE A CG  1 
ATOM   5110  C  CD1 . PHE A  1  651  ? 17.991  -27.749  -17.189  1.00 76.60  ? 651  PHE A CD1 1 
ATOM   5111  C  CD2 . PHE A  1  651  ? 18.526  -26.045  -15.613  1.00 75.93  ? 651  PHE A CD2 1 
ATOM   5112  C  CE1 . PHE A  1  651  ? 17.691  -28.615  -16.155  1.00 75.31  ? 651  PHE A CE1 1 
ATOM   5113  C  CE2 . PHE A  1  651  ? 18.229  -26.906  -14.576  1.00 76.33  ? 651  PHE A CE2 1 
ATOM   5114  C  CZ  . PHE A  1  651  ? 17.810  -28.193  -14.846  1.00 75.15  ? 651  PHE A CZ  1 
ATOM   5115  N  N   . PHE A  1  652  ? 21.178  -26.700  -19.479  1.00 76.30  ? 652  PHE A N   1 
ATOM   5116  C  CA  . PHE A  1  652  ? 22.054  -27.817  -19.812  1.00 76.15  ? 652  PHE A CA  1 
ATOM   5117  C  C   . PHE A  1  652  ? 23.522  -27.423  -19.686  1.00 76.24  ? 652  PHE A C   1 
ATOM   5118  O  O   . PHE A  1  652  ? 24.377  -28.258  -19.393  1.00 74.50  ? 652  PHE A O   1 
ATOM   5119  C  CB  . PHE A  1  652  ? 21.765  -28.321  -21.228  1.00 74.48  ? 652  PHE A CB  1 
ATOM   5120  C  CG  . PHE A  1  652  ? 20.397  -28.918  -21.390  1.00 74.56  ? 652  PHE A CG  1 
ATOM   5121  C  CD1 . PHE A  1  652  ? 19.288  -28.107  -21.567  1.00 75.00  ? 652  PHE A CD1 1 
ATOM   5122  C  CD2 . PHE A  1  652  ? 20.219  -30.292  -21.365  1.00 74.38  ? 652  PHE A CD2 1 
ATOM   5123  C  CE1 . PHE A  1  652  ? 18.028  -28.655  -21.717  1.00 74.86  ? 652  PHE A CE1 1 
ATOM   5124  C  CE2 . PHE A  1  652  ? 18.960  -30.844  -21.514  1.00 75.10  ? 652  PHE A CE2 1 
ATOM   5125  C  CZ  . PHE A  1  652  ? 17.865  -30.025  -21.691  1.00 75.91  ? 652  PHE A CZ  1 
ATOM   5126  N  N   . ASN A  1  653  ? 23.807  -26.144  -19.909  1.00 74.89  ? 653  ASN A N   1 
ATOM   5127  C  CA  . ASN A  1  653  ? 25.171  -25.635  -19.819  1.00 78.11  ? 653  ASN A CA  1 
ATOM   5128  C  C   . ASN A  1  653  ? 25.629  -25.473  -18.374  1.00 78.93  ? 653  ASN A C   1 
ATOM   5129  O  O   . ASN A  1  653  ? 26.804  -25.663  -18.060  1.00 78.53  ? 653  ASN A O   1 
ATOM   5130  C  CB  . ASN A  1  653  ? 25.298  -24.307  -20.564  1.00 75.85  ? 653  ASN A CB  1 
ATOM   5131  C  CG  . ASN A  1  653  ? 24.946  -24.427  -22.034  1.00 79.37  ? 653  ASN A CG  1 
ATOM   5132  O  OD1 . ASN A  1  653  ? 25.418  -25.331  -22.725  1.00 79.94  ? 653  ASN A OD1 1 
ATOM   5133  N  ND2 . ASN A  1  653  ? 24.115  -23.511  -22.521  1.00 76.20  ? 653  ASN A ND2 1 
ATOM   5134  N  N   . GLY A  1  654  ? 24.694  -25.119  -17.499  1.00 77.56  ? 654  GLY A N   1 
ATOM   5135  C  CA  . GLY A  1  654  ? 24.999  -24.931  -16.092  1.00 75.83  ? 654  GLY A CA  1 
ATOM   5136  C  C   . GLY A  1  654  ? 25.247  -26.243  -15.373  1.00 77.23  ? 654  GLY A C   1 
ATOM   5137  O  O   . GLY A  1  654  ? 26.371  -26.534  -14.963  1.00 77.00  ? 654  GLY A O   1 
ATOM   5138  N  N   . ILE A  1  655  ? 24.194  -27.038  -15.222  1.00 75.43  ? 655  ILE A N   1 
ATOM   5139  C  CA  . ILE A  1  655  ? 24.298  -28.329  -14.551  1.00 75.88  ? 655  ILE A CA  1 
ATOM   5140  C  C   . ILE A  1  655  ? 25.350  -29.210  -15.216  1.00 74.43  ? 655  ILE A C   1 
ATOM   5141  O  O   . ILE A  1  655  ? 26.198  -29.797  -14.541  1.00 75.22  ? 655  ILE A O   1 
ATOM   5142  C  CB  . ILE A  1  655  ? 22.949  -29.072  -14.544  1.00 74.43  ? 655  ILE A CB  1 
ATOM   5143  C  CG1 . ILE A  1  655  ? 21.790  -28.075  -14.596  1.00 74.59  ? 655  ILE A CG1 1 
ATOM   5144  C  CG2 . ILE A  1  655  ? 22.839  -29.963  -13.317  1.00 75.62  ? 655  ILE A CG2 1 
ATOM   5145  C  CD1 . ILE A  1  655  ? 20.464  -28.657  -14.155  1.00 75.06  ? 655  ILE A CD1 1 
ATOM   5146  N  N   . GLN A  1  656  ? 25.290  -29.299  -16.541  1.00 91.49  ? 656  GLN A N   1 
ATOM   5147  C  CA  . GLN A  1  656  ? 26.239  -30.107  -17.297  1.00 88.61  ? 656  GLN A CA  1 
ATOM   5148  C  C   . GLN A  1  656  ? 27.633  -29.490  -17.267  1.00 97.24  ? 656  GLN A C   1 
ATOM   5149  O  O   . GLN A  1  656  ? 28.544  -29.955  -17.953  1.00 131.88 ? 656  GLN A O   1 
ATOM   5150  C  CB  . GLN A  1  656  ? 25.768  -30.271  -18.744  1.00 87.47  ? 656  GLN A CB  1 
ATOM   5151  C  CG  . GLN A  1  656  ? 26.502  -31.354  -19.517  1.00 82.06  ? 656  GLN A CG  1 
ATOM   5152  C  CD  . GLN A  1  656  ? 26.343  -31.208  -21.017  1.00 119.03 ? 656  GLN A CD  1 
ATOM   5153  O  OE1 . GLN A  1  656  ? 27.305  -31.350  -21.772  1.00 79.06  ? 656  GLN A OE1 1 
ATOM   5154  N  NE2 . GLN A  1  656  ? 25.123  -30.923  -21.459  1.00 86.77  ? 656  GLN A NE2 1 
ATOM   5155  N  N   . ARG A  1  657  ? 27.793  -28.441  -16.467  1.00 74.79  ? 657  ARG A N   1 
ATOM   5156  C  CA  . ARG A  1  657  ? 29.080  -27.755  -16.344  1.00 83.20  ? 657  ARG A CA  1 
ATOM   5157  C  C   . ARG A  1  657  ? 29.481  -27.651  -14.900  1.00 86.72  ? 657  ARG A C   1 
ATOM   5158  O  O   . ARG A  1  657  ? 30.627  -27.864  -14.551  1.00 103.00 ? 657  ARG A O   1 
ATOM   5159  C  CB  . ARG A  1  657  ? 29.027  -26.354  -16.953  1.00 93.65  ? 657  ARG A CB  1 
ATOM   5160  C  CG  . ARG A  1  657  ? 29.279  -26.306  -18.460  1.00 83.03  ? 657  ARG A CG  1 
ATOM   5161  C  CD  . ARG A  1  657  ? 29.447  -24.871  -18.945  1.00 86.74  ? 657  ARG A CD  1 
ATOM   5162  N  NE  . ARG A  1  657  ? 29.343  -24.758  -20.393  1.00 109.39 ? 657  ARG A NE  1 
ATOM   5163  C  CZ  . ARG A  1  657  ? 29.574  -23.628  -21.038  1.00 82.97  ? 657  ARG A CZ  1 
ATOM   5164  N  NH1 . ARG A  1  657  ? 29.921  -22.550  -20.345  1.00 107.12 ? 657  ARG A NH1 1 
ATOM   5165  N  NH2 . ARG A  1  657  ? 29.463  -23.567  -22.356  1.00 104.48 ? 657  ARG A NH2 1 
ATOM   5166  N  N   . VAL A  1  658  ? 28.516  -27.300  -14.063  1.00 75.96  ? 658  VAL A N   1 
ATOM   5167  C  CA  . VAL A  1  658  ? 28.745  -27.251  -12.635  1.00 77.86  ? 658  VAL A CA  1 
ATOM   5168  C  C   . VAL A  1  658  ? 29.098  -28.634  -12.142  1.00 76.21  ? 658  VAL A C   1 
ATOM   5169  O  O   . VAL A  1  658  ? 30.163  -28.856  -11.585  1.00 76.03  ? 658  VAL A O   1 
ATOM   5170  C  CB  . VAL A  1  658  ? 27.490  -26.839  -11.908  1.00 75.65  ? 658  VAL A CB  1 
ATOM   5171  C  CG1 . VAL A  1  658  ? 27.771  -26.764  -10.428  1.00 76.48  ? 658  VAL A CG1 1 
ATOM   5172  C  CG2 . VAL A  1  658  ? 27.004  -25.528  -12.434  1.00 76.89  ? 658  VAL A CG2 1 
ATOM   5173  N  N   . VAL A  1  659  ? 28.192  -29.569  -12.372  1.00 74.68  ? 659  VAL A N   1 
ATOM   5174  C  CA  . VAL A  1  659  ? 28.347  -30.922  -11.883  1.00 76.42  ? 659  VAL A CA  1 
ATOM   5175  C  C   . VAL A  1  659  ? 29.572  -31.603  -12.455  1.00 75.17  ? 659  VAL A C   1 
ATOM   5176  O  O   . VAL A  1  659  ? 30.387  -32.108  -11.697  1.00 76.58  ? 659  VAL A O   1 
ATOM   5177  C  CB  . VAL A  1  659  ? 27.123  -31.758  -12.169  1.00 78.94  ? 659  VAL A CB  1 
ATOM   5178  C  CG1 . VAL A  1  659  ? 27.348  -33.163  -11.729  1.00 76.28  ? 659  VAL A CG1 1 
ATOM   5179  C  CG2 . VAL A  1  659  ? 25.956  -31.204  -11.439  1.00 76.00  ? 659  VAL A CG2 1 
ATOM   5180  N  N   . ASN A  1  660  ? 29.711  -31.637  -13.776  1.00 76.81  ? 660  ASN A N   1 
ATOM   5181  C  CA  . ASN A  1  660  ? 30.937  -32.183  -14.328  1.00 77.37  ? 660  ASN A CA  1 
ATOM   5182  C  C   . ASN A  1  660  ? 32.095  -31.635  -13.525  1.00 84.99  ? 660  ASN A C   1 
ATOM   5183  O  O   . ASN A  1  660  ? 33.025  -32.366  -13.245  1.00 86.28  ? 660  ASN A O   1 
ATOM   5184  C  CB  . ASN A  1  660  ? 31.121  -31.851  -15.805  1.00 77.83  ? 660  ASN A CB  1 
ATOM   5185  C  CG  . ASN A  1  660  ? 30.123  -32.557  -16.687  1.00 109.30 ? 660  ASN A CG  1 
ATOM   5186  O  OD1 . ASN A  1  660  ? 29.072  -32.979  -16.224  1.00 77.53  ? 660  ASN A OD1 1 
ATOM   5187  N  ND2 . ASN A  1  660  ? 30.443  -32.688  -17.966  1.00 106.03 ? 660  ASN A ND2 1 
ATOM   5188  N  N   . TYR A  1  661  ? 32.039  -30.363  -13.124  1.00 77.60  ? 661  TYR A N   1 
ATOM   5189  C  CA  . TYR A  1  661  ? 33.161  -29.762  -12.421  1.00 77.58  ? 661  TYR A CA  1 
ATOM   5190  C  C   . TYR A  1  661  ? 33.237  -30.297  -11.029  1.00 77.80  ? 661  TYR A C   1 
ATOM   5191  O  O   . TYR A  1  661  ? 34.317  -30.528  -10.506  1.00 79.10  ? 661  TYR A O   1 
ATOM   5192  C  CB  . TYR A  1  661  ? 33.095  -28.249  -12.334  1.00 79.15  ? 661  TYR A CB  1 
ATOM   5193  C  CG  . TYR A  1  661  ? 34.303  -27.717  -11.602  1.00 80.87  ? 661  TYR A CG  1 
ATOM   5194  C  CD1 . TYR A  1  661  ? 35.413  -27.290  -12.292  1.00 77.78  ? 661  TYR A CD1 1 
ATOM   5195  C  CD2 . TYR A  1  661  ? 34.359  -27.681  -10.218  1.00 79.08  ? 661  TYR A CD2 1 
ATOM   5196  C  CE1 . TYR A  1  661  ? 36.542  -26.811  -11.639  1.00 81.24  ? 661  TYR A CE1 1 
ATOM   5197  C  CE2 . TYR A  1  661  ? 35.497  -27.205  -9.546   1.00 80.29  ? 661  TYR A CE2 1 
ATOM   5198  C  CZ  . TYR A  1  661  ? 36.583  -26.777  -10.272  1.00 78.55  ? 661  TYR A CZ  1 
ATOM   5199  O  OH  . TYR A  1  661  ? 37.728  -26.315  -9.661   1.00 79.08  ? 661  TYR A OH  1 
ATOM   5200  N  N   . TRP A  1  662  ? 32.095  -30.479  -10.398  1.00 88.04  ? 662  TRP A N   1 
ATOM   5201  C  CA  . TRP A  1  662  ? 32.100  -31.125  -9.096   1.00 87.07  ? 662  TRP A CA  1 
ATOM   5202  C  C   . TRP A  1  662  ? 32.710  -32.499  -9.211   1.00 77.54  ? 662  TRP A C   1 
ATOM   5203  O  O   . TRP A  1  662  ? 33.677  -32.816  -8.534   1.00 81.72  ? 662  TRP A O   1 
ATOM   5204  C  CB  . TRP A  1  662  ? 30.680  -31.247  -8.583   1.00 80.52  ? 662  TRP A CB  1 
ATOM   5205  C  CG  . TRP A  1  662  ? 30.534  -32.142  -7.450   1.00 78.34  ? 662  TRP A CG  1 
ATOM   5206  C  CD1 . TRP A  1  662  ? 29.790  -33.291  -7.401   1.00 75.40  ? 662  TRP A CD1 1 
ATOM   5207  C  CD2 . TRP A  1  662  ? 31.142  -32.002  -6.177   1.00 84.85  ? 662  TRP A CD2 1 
ATOM   5208  N  NE1 . TRP A  1  662  ? 29.895  -33.869  -6.167   1.00 84.44  ? 662  TRP A NE1 1 
ATOM   5209  C  CE2 . TRP A  1  662  ? 30.718  -33.098  -5.391   1.00 79.12  ? 662  TRP A CE2 1 
ATOM   5210  C  CE3 . TRP A  1  662  ? 32.015  -31.060  -5.622   1.00 96.50  ? 662  TRP A CE3 1 
ATOM   5211  C  CZ2 . TRP A  1  662  ? 31.137  -33.280  -4.072   1.00 78.85  ? 662  TRP A CZ2 1 
ATOM   5212  C  CZ3 . TRP A  1  662  ? 32.436  -31.241  -4.307   1.00 95.12  ? 662  TRP A CZ3 1 
ATOM   5213  C  CH2 . TRP A  1  662  ? 31.993  -32.346  -3.544   1.00 91.98  ? 662  TRP A CH2 1 
ATOM   5214  N  N   . LEU A  1  663  ? 32.147  -33.300  -10.099  1.00 75.35  ? 663  LEU A N   1 
ATOM   5215  C  CA  . LEU A  1  663  ? 32.550  -34.685  -10.247  1.00 79.15  ? 663  LEU A CA  1 
ATOM   5216  C  C   . LEU A  1  663  ? 34.033  -34.820  -10.523  1.00 77.22  ? 663  LEU A C   1 
ATOM   5217  O  O   . LEU A  1  663  ? 34.654  -35.734  -10.035  1.00 77.50  ? 663  LEU A O   1 
ATOM   5218  C  CB  . LEU A  1  663  ? 31.745  -35.334  -11.354  1.00 75.40  ? 663  LEU A CB  1 
ATOM   5219  C  CG  . LEU A  1  663  ? 31.229  -36.725  -11.078  1.00 77.35  ? 663  LEU A CG  1 
ATOM   5220  C  CD1 . LEU A  1  663  ? 30.336  -37.231  -12.211  1.00 76.20  ? 663  LEU A CD1 1 
ATOM   5221  C  CD2 . LEU A  1  663  ? 32.407  -37.620  -10.898  1.00 74.13  ? 663  LEU A CD2 1 
ATOM   5222  N  N   . LEU A  1  664  ? 34.603  -33.913  -11.304  1.00 75.34  ? 664  LEU A N   1 
ATOM   5223  C  CA  . LEU A  1  664  ? 36.028  -33.951  -11.568  1.00 78.14  ? 664  LEU A CA  1 
ATOM   5224  C  C   . LEU A  1  664  ? 36.799  -34.175  -10.274  1.00 76.20  ? 664  LEU A C   1 
ATOM   5225  O  O   . LEU A  1  664  ? 37.711  -34.970  -10.223  1.00 76.24  ? 664  LEU A O   1 
ATOM   5226  C  CB  . LEU A  1  664  ? 36.497  -32.675  -12.248  1.00 76.13  ? 664  LEU A CB  1 
ATOM   5227  C  CG  . LEU A  1  664  ? 37.949  -32.764  -12.682  1.00 76.44  ? 664  LEU A CG  1 
ATOM   5228  C  CD1 . LEU A  1  664  ? 37.955  -33.628  -13.871  1.00 75.71  ? 664  LEU A CD1 1 
ATOM   5229  C  CD2 . LEU A  1  664  ? 38.565  -31.411  -12.985  1.00 76.89  ? 664  LEU A CD2 1 
ATOM   5230  N  N   . HIS A  1  665  ? 36.421  -33.496  -9.206   1.00 94.56  ? 665  HIS A N   1 
ATOM   5231  C  CA  . HIS A  1  665  ? 37.213  -33.579  -7.984   1.00 99.83  ? 665  HIS A CA  1 
ATOM   5232  C  C   . HIS A  1  665  ? 36.535  -34.440  -6.928   1.00 98.72  ? 665  HIS A C   1 
ATOM   5233  O  O   . HIS A  1  665  ? 36.984  -34.516  -5.787   1.00 80.57  ? 665  HIS A O   1 
ATOM   5234  C  CB  . HIS A  1  665  ? 37.452  -32.186  -7.424   1.00 77.31  ? 665  HIS A CB  1 
ATOM   5235  C  CG  . HIS A  1  665  ? 38.230  -31.292  -8.338   1.00 120.08 ? 665  HIS A CG  1 
ATOM   5236  N  ND1 . HIS A  1  665  ? 37.758  -30.895  -9.561   1.00 112.04 ? 665  HIS A ND1 1 
ATOM   5237  C  CD2 . HIS A  1  665  ? 39.451  -30.734  -8.186   1.00 125.42 ? 665  HIS A CD2 1 
ATOM   5238  C  CE1 . HIS A  1  665  ? 38.668  -30.116  -10.142  1.00 80.34  ? 665  HIS A CE1 1 
ATOM   5239  N  NE2 . HIS A  1  665  ? 39.690  -30.002  -9.331   1.00 99.22  ? 665  HIS A NE2 1 
ATOM   5240  N  N   . ASN A  1  666  ? 35.431  -35.064  -7.312   1.00 77.02  ? 666  ASN A N   1 
ATOM   5241  C  CA  . ASN A  1  666  ? 34.721  -35.977  -6.420   1.00 76.02  ? 666  ASN A CA  1 
ATOM   5242  C  C   . ASN A  1  666  ? 35.131  -37.409  -6.748   1.00 76.48  ? 666  ASN A C   1 
ATOM   5243  O  O   . ASN A  1  666  ? 35.125  -38.281  -5.886   1.00 77.54  ? 666  ASN A O   1 
ATOM   5244  C  CB  . ASN A  1  666  ? 33.213  -35.818  -6.605   1.00 76.25  ? 666  ASN A CB  1 
ATOM   5245  C  CG  . ASN A  1  666  ? 32.409  -36.426  -5.483   1.00 76.04  ? 666  ASN A CG  1 
ATOM   5246  O  OD1 . ASN A  1  666  ? 32.963  -36.949  -4.534   1.00 77.09  ? 666  ASN A OD1 1 
ATOM   5247  N  ND2 . ASN A  1  666  ? 31.083  -36.347  -5.584   1.00 76.73  ? 666  ASN A ND2 1 
ATOM   5248  N  N   . GLY A  1  667  ? 35.492  -37.635  -8.010   1.00 77.12  ? 667  GLY A N   1 
ATOM   5249  C  CA  . GLY A  1  667  ? 35.915  -38.938  -8.477   1.00 76.11  ? 667  GLY A CA  1 
ATOM   5250  C  C   . GLY A  1  667  ? 34.753  -39.879  -8.408   1.00 74.97  ? 667  GLY A C   1 
ATOM   5251  O  O   . GLY A  1  667  ? 33.951  -39.838  -7.480   1.00 75.52  ? 667  GLY A O   1 
ATOM   5252  N  N   . PHE A  1  668  ? 34.666  -40.726  -9.420   1.00 134.48 ? 668  PHE A N   1 
ATOM   5253  C  CA  . PHE A  1  668  ? 33.691  -41.809  -9.418   1.00 129.82 ? 668  PHE A CA  1 
ATOM   5254  C  C   . PHE A  1  668  ? 34.036  -42.884  -10.417  1.00 86.51  ? 668  PHE A C   1 
ATOM   5255  O  O   . PHE A  1  668  ? 34.540  -42.585  -11.503  1.00 85.45  ? 668  PHE A O   1 
ATOM   5256  C  CB  . PHE A  1  668  ? 32.323  -41.296  -9.749   1.00 124.83 ? 668  PHE A CB  1 
ATOM   5257  C  CG  . PHE A  1  668  ? 31.295  -42.372  -9.849   1.00 75.96  ? 668  PHE A CG  1 
ATOM   5258  C  CD1 . PHE A  1  668  ? 30.705  -42.882  -8.707   1.00 74.89  ? 668  PHE A CD1 1 
ATOM   5259  C  CD2 . PHE A  1  668  ? 30.897  -42.861  -11.077  1.00 109.37 ? 668  PHE A CD2 1 
ATOM   5260  C  CE1 . PHE A  1  668  ? 29.740  -43.860  -8.791   1.00 100.54 ? 668  PHE A CE1 1 
ATOM   5261  C  CE2 . PHE A  1  668  ? 29.925  -43.837  -11.158  1.00 102.89 ? 668  PHE A CE2 1 
ATOM   5262  C  CZ  . PHE A  1  668  ? 29.352  -44.335  -10.014  1.00 108.08 ? 668  PHE A CZ  1 
ATOM   5263  N  N   . SER A  1  669  ? 33.724  -44.130  -10.065  1.00 74.09  ? 669  SER A N   1 
ATOM   5264  C  CA  . SER A  1  669  ? 34.258  -45.272  -10.798  1.00 75.22  ? 669  SER A CA  1 
ATOM   5265  C  C   . SER A  1  669  ? 33.712  -46.568  -10.240  1.00 74.50  ? 669  SER A C   1 
ATOM   5266  O  O   . SER A  1  669  ? 33.051  -46.560  -9.207   1.00 78.49  ? 669  SER A O   1 
ATOM   5267  C  CB  . SER A  1  669  ? 35.792  -45.268  -10.726  1.00 77.49  ? 669  SER A CB  1 
ATOM   5268  O  OG  . SER A  1  669  ? 36.358  -46.567  -10.731  1.00 79.20  ? 669  SER A OG  1 
ATOM   5269  N  N   . ILE A  1  670  ? 33.972  -47.673  -10.944  1.00 74.95  ? 670  ILE A N   1 
ATOM   5270  C  CA  . ILE A  1  670  ? 33.553  -48.996  -10.490  1.00 76.31  ? 670  ILE A CA  1 
ATOM   5271  C  C   . ILE A  1  670  ? 34.525  -50.111  -10.837  1.00 77.30  ? 670  ILE A C   1 
ATOM   5272  O  O   . ILE A  1  670  ? 35.102  -50.135  -11.909  1.00 74.99  ? 670  ILE A O   1 
ATOM   5273  C  CB  . ILE A  1  670  ? 32.235  -49.382  -11.076  1.00 74.65  ? 670  ILE A CB  1 
ATOM   5274  C  CG1 . ILE A  1  670  ? 32.430  -49.714  -12.528  1.00 74.26  ? 670  ILE A CG1 1 
ATOM   5275  C  CG2 . ILE A  1  670  ? 31.269  -48.246  -10.945  1.00 76.18  ? 670  ILE A CG2 1 
ATOM   5276  C  CD1 . ILE A  1  670  ? 31.382  -50.599  -13.024  1.00 76.38  ? 670  ILE A CD1 1 
ATOM   5277  N  N   . GLY A  1  671  ? 34.685  -51.051  -9.914   1.00 96.28  ? 671  GLY A N   1 
ATOM   5278  C  CA  . GLY A  1  671  ? 35.546  -52.203  -10.116  1.00 108.42 ? 671  GLY A CA  1 
ATOM   5279  C  C   . GLY A  1  671  ? 34.764  -53.478  -9.863   1.00 97.72  ? 671  GLY A C   1 
ATOM   5280  O  O   . GLY A  1  671  ? 33.534  -53.445  -9.776   1.00 104.20 ? 671  GLY A O   1 
ATOM   5281  N  N   . ILE A  1  672  ? 35.465  -54.603  -9.733   1.00 75.79  ? 672  ILE A N   1 
ATOM   5282  C  CA  . ILE A  1  672  ? 34.793  -55.878  -9.557   1.00 75.37  ? 672  ILE A CA  1 
ATOM   5283  C  C   . ILE A  1  672  ? 34.075  -55.911  -8.232   1.00 75.85  ? 672  ILE A C   1 
ATOM   5284  O  O   . ILE A  1  672  ? 32.918  -56.270  -8.179   1.00 77.17  ? 672  ILE A O   1 
ATOM   5285  C  CB  . ILE A  1  672  ? 35.766  -57.032  -9.585   1.00 77.96  ? 672  ILE A CB  1 
ATOM   5286  C  CG1 . ILE A  1  672  ? 36.691  -56.907  -10.773  1.00 77.12  ? 672  ILE A CG1 1 
ATOM   5287  C  CG2 . ILE A  1  672  ? 35.027  -58.334  -9.689   1.00 77.12  ? 672  ILE A CG2 1 
ATOM   5288  C  CD1 . ILE A  1  672  ? 37.340  -58.192  -11.099  1.00 77.79  ? 672  ILE A CD1 1 
ATOM   5289  N  N   . GLY A  1  673  ? 34.778  -55.559  -7.164   1.00 77.48  ? 673  GLY A N   1 
ATOM   5290  C  CA  . GLY A  1  673  ? 34.185  -55.534  -5.843   1.00 76.54  ? 673  GLY A CA  1 
ATOM   5291  C  C   . GLY A  1  673  ? 32.733  -55.103  -5.876   1.00 88.18  ? 673  GLY A C   1 
ATOM   5292  O  O   . GLY A  1  673  ? 31.930  -55.575  -5.086   1.00 85.02  ? 673  GLY A O   1 
ATOM   5293  N  N   . ASP A  1  674  ? 32.402  -54.203  -6.798   1.00 111.71 ? 674  ASP A N   1 
ATOM   5294  C  CA  . ASP A  1  674  ? 31.050  -53.685  -6.922   1.00 105.56 ? 674  ASP A CA  1 
ATOM   5295  C  C   . ASP A  1  674  ? 30.145  -54.748  -7.526   1.00 120.85 ? 674  ASP A C   1 
ATOM   5296  O  O   . ASP A  1  674  ? 28.940  -54.524  -7.685   1.00 97.31  ? 674  ASP A O   1 
ATOM   5297  C  CB  . ASP A  1  674  ? 31.039  -52.427  -7.791   1.00 105.82 ? 674  ASP A CB  1 
ATOM   5298  C  CG  . ASP A  1  674  ? 31.876  -51.308  -7.212   1.00 104.38 ? 674  ASP A CG  1 
ATOM   5299  O  OD1 . ASP A  1  674  ? 32.203  -51.362  -6.005   1.00 113.28 ? 674  ASP A OD1 1 
ATOM   5300  O  OD2 . ASP A  1  674  ? 32.201  -50.376  -7.972   1.00 123.74 ? 674  ASP A OD2 1 
ATOM   5301  N  N   . THR A  1  675  ? 30.721  -55.902  -7.854   1.00 75.14  ? 675  THR A N   1 
ATOM   5302  C  CA  . THR A  1  675  ? 29.980  -56.943  -8.543   1.00 77.02  ? 675  THR A CA  1 
ATOM   5303  C  C   . THR A  1  675  ? 29.876  -58.219  -7.730   1.00 77.14  ? 675  THR A C   1 
ATOM   5304  O  O   . THR A  1  675  ? 29.106  -59.123  -8.073   1.00 76.39  ? 675  THR A O   1 
ATOM   5305  C  CB  . THR A  1  675  ? 30.600  -57.233  -9.918   1.00 74.80  ? 675  THR A CB  1 
ATOM   5306  O  OG1 . THR A  1  675  ? 29.635  -57.857  -10.761  1.00 76.70  ? 675  THR A OG1 1 
ATOM   5307  C  CG2 . THR A  1  675  ? 31.801  -58.116  -9.820   1.00 75.37  ? 675  THR A CG2 1 
ATOM   5308  N  N   . ILE A  1  676  ? 30.623  -58.261  -6.626   1.00 77.93  ? 676  ILE A N   1 
ATOM   5309  C  CA  . ILE A  1  676  ? 30.744  -59.477  -5.824   1.00 79.20  ? 676  ILE A CA  1 
ATOM   5310  C  C   . ILE A  1  676  ? 29.920  -59.417  -4.540   1.00 78.95  ? 676  ILE A C   1 
ATOM   5311  O  O   . ILE A  1  676  ? 30.291  -58.765  -3.574   1.00 79.55  ? 676  ILE A O   1 
ATOM   5312  C  CB  . ILE A  1  676  ? 32.244  -59.858  -5.577   1.00 76.95  ? 676  ILE A CB  1 
ATOM   5313  C  CG1 . ILE A  1  676  ? 32.930  -59.009  -4.491   1.00 77.51  ? 676  ILE A CG1 1 
ATOM   5314  C  CG2 . ILE A  1  676  ? 33.032  -59.717  -6.883   1.00 77.66  ? 676  ILE A CG2 1 
ATOM   5315  C  CD1 . ILE A  1  676  ? 34.450  -59.414  -4.194   1.00 77.84  ? 676  ILE A CD1 1 
ATOM   5316  N  N   . ALA A  1  677  ? 28.792  -60.110  -4.551   1.00 77.96  ? 677  ALA A N   1 
ATOM   5317  C  CA  . ALA A  1  677  ? 27.819  -60.010  -3.480   1.00 79.32  ? 677  ALA A CA  1 
ATOM   5318  C  C   . ALA A  1  677  ? 28.361  -60.535  -2.165   1.00 77.96  ? 677  ALA A C   1 
ATOM   5319  O  O   . ALA A  1  677  ? 29.240  -61.391  -2.170   1.00 84.14  ? 677  ALA A O   1 
ATOM   5320  C  CB  . ALA A  1  677  ? 26.554  -60.756  -3.864   1.00 80.72  ? 677  ALA A CB  1 
ATOM   5321  N  N   . ASP A  1  678  ? 27.825  -60.050  -1.045   1.00 155.17 ? 678  ASP A N   1 
ATOM   5322  C  CA  . ASP A  1  678  ? 28.320  -60.457  0.277    1.00 155.26 ? 678  ASP A CA  1 
ATOM   5323  C  C   . ASP A  1  678  ? 28.463  -61.981  0.406    1.00 159.26 ? 678  ASP A C   1 
ATOM   5324  O  O   . ASP A  1  678  ? 27.620  -62.725  -0.065   1.00 141.36 ? 678  ASP A O   1 
ATOM   5325  C  CB  . ASP A  1  678  ? 27.440  -59.883  1.399    1.00 121.40 ? 678  ASP A CB  1 
ATOM   5326  C  CG  . ASP A  1  678  ? 28.047  -60.079  2.787    1.00 152.05 ? 678  ASP A CG  1 
ATOM   5327  O  OD1 . ASP A  1  678  ? 27.370  -59.772  3.791    1.00 120.19 ? 678  ASP A OD1 1 
ATOM   5328  O  OD2 . ASP A  1  678  ? 29.209  -60.537  2.875    1.00 192.09 ? 678  ASP A OD2 1 
ATOM   5329  N  N   . ALA A  1  679  ? 29.537  -62.439  1.038    1.00 100.13 ? 679  ALA A N   1 
ATOM   5330  C  CA  . ALA A  1  679  ? 29.792  -63.871  1.175    1.00 100.25 ? 679  ALA A CA  1 
ATOM   5331  C  C   . ALA A  1  679  ? 28.676  -64.594  1.951    1.00 107.84 ? 679  ALA A C   1 
ATOM   5332  O  O   . ALA A  1  679  ? 28.150  -65.610  1.501    1.00 97.41  ? 679  ALA A O   1 
ATOM   5333  C  CB  . ALA A  1  679  ? 31.148  -64.119  1.826    1.00 134.59 ? 679  ALA A CB  1 
ATOM   5334  N  N   . ASP A  1  680  ? 28.324  -64.070  3.122    1.00 157.30 ? 680  ASP A N   1 
ATOM   5335  C  CA  . ASP A  1  680  ? 27.227  -64.647  3.901    1.00 162.60 ? 680  ASP A CA  1 
ATOM   5336  C  C   . ASP A  1  680  ? 25.942  -64.660  3.066    1.00 155.55 ? 680  ASP A C   1 
ATOM   5337  O  O   . ASP A  1  680  ? 25.317  -65.699  2.888    1.00 157.17 ? 680  ASP A O   1 
ATOM   5338  C  CB  . ASP A  1  680  ? 27.011  -63.842  5.194    1.00 117.24 ? 680  ASP A CB  1 
ATOM   5339  C  CG  . ASP A  1  680  ? 26.475  -64.699  6.348    1.00 113.28 ? 680  ASP A CG  1 
ATOM   5340  O  OD1 . ASP A  1  680  ? 26.285  -65.921  6.153    1.00 117.13 ? 680  ASP A OD1 1 
ATOM   5341  O  OD2 . ASP A  1  680  ? 26.245  -64.148  7.452    1.00 126.91 ? 680  ASP A OD2 1 
ATOM   5342  N  N   . THR A  1  681  ? 25.582  -63.490  2.537    1.00 122.08 ? 681  THR A N   1 
ATOM   5343  C  CA  . THR A  1  681  ? 24.318  -63.245  1.824    1.00 118.10 ? 681  THR A CA  1 
ATOM   5344  C  C   . THR A  1  681  ? 24.297  -63.890  0.439    1.00 146.56 ? 681  THR A C   1 
ATOM   5345  O  O   . THR A  1  681  ? 23.332  -63.755  -0.319   1.00 171.48 ? 681  THR A O   1 
ATOM   5346  C  CB  . THR A  1  681  ? 24.079  -61.719  1.653    1.00 159.51 ? 681  THR A CB  1 
ATOM   5347  O  OG1 . THR A  1  681  ? 24.970  -61.190  0.657    1.00 112.06 ? 681  THR A OG1 1 
ATOM   5348  C  CG2 . THR A  1  681  ? 24.305  -60.970  2.981    1.00 162.13 ? 681  THR A CG2 1 
ATOM   5349  N  N   . MET A  1  682  ? 25.384  -64.572  0.113    1.00 105.24 ? 682  MET A N   1 
ATOM   5350  C  CA  . MET A  1  682  ? 25.509  -65.227  -1.173   1.00 95.33  ? 682  MET A CA  1 
ATOM   5351  C  C   . MET A  1  682  ? 25.208  -66.698  -0.943   1.00 156.97 ? 682  MET A C   1 
ATOM   5352  O  O   . MET A  1  682  ? 24.804  -67.408  -1.865   1.00 131.98 ? 682  MET A O   1 
ATOM   5353  C  CB  . MET A  1  682  ? 26.918  -65.018  -1.728   1.00 134.05 ? 682  MET A CB  1 
ATOM   5354  C  CG  . MET A  1  682  ? 26.970  -64.556  -3.184   1.00 156.07 ? 682  MET A CG  1 
ATOM   5355  S  SD  . MET A  1  682  ? 26.530  -65.856  -4.366   1.00 101.26 ? 682  MET A SD  1 
ATOM   5356  C  CE  . MET A  1  682  ? 27.391  -65.285  -5.828   1.00 102.93 ? 682  MET A CE  1 
ATOM   5357  N  N   . LYS A  1  683  ? 25.389  -67.148  0.299    1.00 144.48 ? 683  LYS A N   1 
ATOM   5358  C  CA  . LYS A  1  683  ? 24.982  -68.497  0.688    1.00 157.93 ? 683  LYS A CA  1 
ATOM   5359  C  C   . LYS A  1  683  ? 23.478  -68.644  0.487    1.00 126.25 ? 683  LYS A C   1 
ATOM   5360  O  O   . LYS A  1  683  ? 23.002  -69.674  0.030    1.00 141.78 ? 683  LYS A O   1 
ATOM   5361  C  CB  . LYS A  1  683  ? 25.330  -68.790  2.154    1.00 171.16 ? 683  LYS A CB  1 
ATOM   5362  C  CG  . LYS A  1  683  ? 26.791  -69.152  2.450    1.00 172.00 ? 683  LYS A CG  1 
ATOM   5363  C  CD  . LYS A  1  683  ? 26.984  -69.422  3.945    1.00 163.20 ? 683  LYS A CD  1 
ATOM   5364  C  CE  . LYS A  1  683  ? 28.449  -69.617  4.316    1.00 168.67 ? 683  LYS A CE  1 
ATOM   5365  N  NZ  . LYS A  1  683  ? 28.657  -69.534  5.794    1.00 177.72 ? 683  LYS A NZ  1 
ATOM   5366  N  N   . GLU A  1  684  ? 22.747  -67.589  0.837    1.00 125.45 ? 684  GLU A N   1 
ATOM   5367  C  CA  . GLU A  1  684  ? 21.285  -67.570  0.805    1.00 110.24 ? 684  GLU A CA  1 
ATOM   5368  C  C   . GLU A  1  684  ? 20.749  -67.412  -0.619   1.00 127.96 ? 684  GLU A C   1 
ATOM   5369  O  O   . GLU A  1  684  ? 19.541  -67.486  -0.859   1.00 170.18 ? 684  GLU A O   1 
ATOM   5370  C  CB  . GLU A  1  684  ? 20.759  -66.426  1.691    1.00 157.80 ? 684  GLU A CB  1 
ATOM   5371  C  CG  . GLU A  1  684  ? 19.230  -66.301  1.786    1.00 174.96 ? 684  GLU A CG  1 
ATOM   5372  C  CD  . GLU A  1  684  ? 18.766  -64.982  2.405    1.00 168.78 ? 684  GLU A CD  1 
ATOM   5373  O  OE1 . GLU A  1  684  ? 17.571  -64.634  2.267    1.00 130.01 ? 684  GLU A OE1 1 
ATOM   5374  O  OE2 . GLU A  1  684  ? 19.600  -64.282  3.022    1.00 190.70 ? 684  GLU A OE2 1 
ATOM   5375  N  N   . VAL A  1  685  ? 21.655  -67.172  -1.557   1.00 115.63 ? 685  VAL A N   1 
ATOM   5376  C  CA  . VAL A  1  685  ? 21.292  -67.004  -2.962   1.00 118.02 ? 685  VAL A CA  1 
ATOM   5377  C  C   . VAL A  1  685  ? 21.204  -68.366  -3.562   1.00 169.15 ? 685  VAL A C   1 
ATOM   5378  O  O   . VAL A  1  685  ? 20.206  -68.754  -4.154   1.00 172.90 ? 685  VAL A O   1 
ATOM   5379  C  CB  . VAL A  1  685  ? 22.424  -66.344  -3.753   1.00 133.95 ? 685  VAL A CB  1 
ATOM   5380  C  CG1 . VAL A  1  685  ? 22.088  -66.333  -5.248   1.00 155.33 ? 685  VAL A CG1 1 
ATOM   5381  C  CG2 . VAL A  1  685  ? 22.727  -64.953  -3.220   1.00 93.61  ? 685  VAL A CG2 1 
ATOM   5382  N  N   . THR A  1  686  ? 22.317  -69.065  -3.391   1.00 82.45  ? 686  THR A N   1 
ATOM   5383  C  CA  . THR A  1  686  ? 22.531  -70.411  -3.884   1.00 81.65  ? 686  THR A CA  1 
ATOM   5384  C  C   . THR A  1  686  ? 21.532  -71.358  -3.202   1.00 88.01  ? 686  THR A C   1 
ATOM   5385  O  O   . THR A  1  686  ? 21.237  -72.426  -3.704   1.00 89.90  ? 686  THR A O   1 
ATOM   5386  C  CB  . THR A  1  686  ? 24.026  -70.804  -3.638   1.00 81.71  ? 686  THR A CB  1 
ATOM   5387  O  OG1 . THR A  1  686  ? 24.482  -71.720  -4.637   1.00 83.90  ? 686  THR A OG1 1 
ATOM   5388  C  CG2 . THR A  1  686  ? 24.242  -71.356  -2.238   1.00 87.03  ? 686  THR A CG2 1 
ATOM   5389  N  N   . ARG A  1  687  ? 20.987  -70.926  -2.071   1.00 101.77 ? 687  ARG A N   1 
ATOM   5390  C  CA  . ARG A  1  687  ? 19.974  -71.716  -1.375   1.00 144.45 ? 687  ARG A CA  1 
ATOM   5391  C  C   . ARG A  1  687  ? 18.629  -71.621  -2.071   1.00 105.83 ? 687  ARG A C   1 
ATOM   5392  O  O   . ARG A  1  687  ? 17.952  -72.614  -2.223   1.00 176.46 ? 687  ARG A O   1 
ATOM   5393  C  CB  . ARG A  1  687  ? 19.839  -71.305  0.101    1.00 104.52 ? 687  ARG A CB  1 
ATOM   5394  C  CG  . ARG A  1  687  ? 18.727  -72.051  0.864    1.00 171.36 ? 687  ARG A CG  1 
ATOM   5395  C  CD  . ARG A  1  687  ? 18.641  -71.645  2.339    1.00 125.01 ? 687  ARG A CD  1 
ATOM   5396  N  NE  . ARG A  1  687  ? 19.804  -72.085  3.114    1.00 158.49 ? 687  ARG A NE  1 
ATOM   5397  C  CZ  . ARG A  1  687  ? 20.784  -71.284  3.515    1.00 166.05 ? 687  ARG A CZ  1 
ATOM   5398  N  NH1 . ARG A  1  687  ? 20.745  -69.989  3.227    1.00 154.60 ? 687  ARG A NH1 1 
ATOM   5399  N  NH2 . ARG A  1  687  ? 21.799  -71.778  4.208    1.00 166.48 ? 687  ARG A NH2 1 
ATOM   5400  N  N   . THR A  1  688  ? 18.243  -70.424  -2.502   1.00 160.11 ? 688  THR A N   1 
ATOM   5401  C  CA  . THR A  1  688  ? 16.913  -70.231  -3.086   1.00 120.08 ? 688  THR A CA  1 
ATOM   5402  C  C   . THR A  1  688  ? 16.867  -70.599  -4.565   1.00 114.51 ? 688  THR A C   1 
ATOM   5403  O  O   . THR A  1  688  ? 15.823  -70.513  -5.219   1.00 133.69 ? 688  THR A O   1 
ATOM   5404  C  CB  . THR A  1  688  ? 16.420  -68.794  -2.922   1.00 118.23 ? 688  THR A CB  1 
ATOM   5405  O  OG1 . THR A  1  688  ? 15.064  -68.700  -3.384   1.00 156.42 ? 688  THR A OG1 1 
ATOM   5406  C  CG2 . THR A  1  688  ? 17.306  -67.846  -3.710   1.00 103.43 ? 688  THR A CG2 1 
ATOM   5407  N  N   . VAL A  1  689  ? 18.018  -71.011  -5.080   1.00 154.87 ? 689  VAL A N   1 
ATOM   5408  C  CA  . VAL A  1  689  ? 18.123  -71.449  -6.451   1.00 114.71 ? 689  VAL A CA  1 
ATOM   5409  C  C   . VAL A  1  689  ? 18.016  -72.953  -6.478   1.00 147.57 ? 689  VAL A C   1 
ATOM   5410  O  O   . VAL A  1  689  ? 17.221  -73.522  -7.216   1.00 192.06 ? 689  VAL A O   1 
ATOM   5411  C  CB  . VAL A  1  689  ? 19.484  -71.090  -7.020   1.00 139.31 ? 689  VAL A CB  1 
ATOM   5412  C  CG1 . VAL A  1  689  ? 19.688  -71.780  -8.353   1.00 118.34 ? 689  VAL A CG1 1 
ATOM   5413  C  CG2 . VAL A  1  689  ? 19.625  -69.581  -7.136   1.00 156.13 ? 689  VAL A CG2 1 
ATOM   5414  N  N   . LYS A  1  690  ? 18.841  -73.602  -5.670   1.00 186.43 ? 690  LYS A N   1 
ATOM   5415  C  CA  . LYS A  1  690  ? 18.810  -75.047  -5.568   1.00 211.99 ? 690  LYS A CA  1 
ATOM   5416  C  C   . LYS A  1  690  ? 17.520  -75.472  -4.868   1.00 204.58 ? 690  LYS A C   1 
ATOM   5417  O  O   . LYS A  1  690  ? 17.147  -76.636  -4.891   1.00 231.87 ? 690  LYS A O   1 
ATOM   5418  C  CB  . LYS A  1  690  ? 20.041  -75.554  -4.811   1.00 236.40 ? 690  LYS A CB  1 
ATOM   5419  C  CG  . LYS A  1  690  ? 21.397  -75.264  -5.502   1.00 219.18 ? 690  LYS A CG  1 
ATOM   5420  C  CD  . LYS A  1  690  ? 22.580  -75.672  -4.605   1.00 219.69 ? 690  LYS A CD  1 
ATOM   5421  C  CE  . LYS A  1  690  ? 23.927  -75.600  -5.328   1.00 212.29 ? 690  LYS A CE  1 
ATOM   5422  N  NZ  . LYS A  1  690  ? 25.071  -75.979  -4.431   1.00 202.41 ? 690  LYS A NZ  1 
ATOM   5423  N  N   . GLU A  1  691  ? 16.843  -74.513  -4.250   1.00 137.34 ? 691  GLU A N   1 
ATOM   5424  C  CA  . GLU A  1  691  ? 15.586  -74.777  -3.556   1.00 179.33 ? 691  GLU A CA  1 
ATOM   5425  C  C   . GLU A  1  691  ? 14.427  -74.606  -4.519   1.00 132.20 ? 691  GLU A C   1 
ATOM   5426  O  O   . GLU A  1  691  ? 13.260  -74.649  -4.117   1.00 138.21 ? 691  GLU A O   1 
ATOM   5427  C  CB  . GLU A  1  691  ? 15.406  -73.831  -2.349   1.00 157.68 ? 691  GLU A CB  1 
ATOM   5428  C  CG  . GLU A  1  691  ? 14.066  -73.964  -1.593   1.00 196.47 ? 691  GLU A CG  1 
ATOM   5429  C  CD  . GLU A  1  691  ? 13.805  -72.825  -0.600   1.00 194.23 ? 691  GLU A CD  1 
ATOM   5430  O  OE1 . GLU A  1  691  ? 12.647  -72.689  -0.137   1.00 210.34 ? 691  GLU A OE1 1 
ATOM   5431  O  OE2 . GLU A  1  691  ? 14.750  -72.068  -0.279   1.00 156.59 ? 691  GLU A OE2 1 
ATOM   5432  N  N   . ALA A  1  692  ? 14.758  -74.396  -5.793   1.00 83.77  ? 692  ALA A N   1 
ATOM   5433  C  CA  . ALA A  1  692  ? 13.764  -74.285  -6.861   1.00 82.80  ? 692  ALA A CA  1 
ATOM   5434  C  C   . ALA A  1  692  ? 13.997  -75.415  -7.857   1.00 83.26  ? 692  ALA A C   1 
ATOM   5435  O  O   . ALA A  1  692  ? 13.267  -75.564  -8.826   1.00 83.43  ? 692  ALA A O   1 
ATOM   5436  C  CB  . ALA A  1  692  ? 13.836  -72.944  -7.548   1.00 82.38  ? 692  ALA A CB  1 
ATOM   5437  N  N   . ARG A  1  693  ? 15.034  -76.201  -7.601   1.00 106.00 ? 693  ARG A N   1 
ATOM   5438  C  CA  . ARG A  1  693  ? 15.169  -77.492  -8.240   1.00 130.24 ? 693  ARG A CA  1 
ATOM   5439  C  C   . ARG A  1  693  ? 14.012  -78.345  -7.761   1.00 167.32 ? 693  ARG A C   1 
ATOM   5440  O  O   . ARG A  1  693  ? 13.239  -78.825  -8.574   1.00 168.92 ? 693  ARG A O   1 
ATOM   5441  C  CB  . ARG A  1  693  ? 16.482  -78.141  -7.838   1.00 150.56 ? 693  ARG A CB  1 
ATOM   5442  C  CG  . ARG A  1  693  ? 17.690  -77.384  -8.306   1.00 117.09 ? 693  ARG A CG  1 
ATOM   5443  C  CD  . ARG A  1  693  ? 17.746  -77.407  -9.812   1.00 114.53 ? 693  ARG A CD  1 
ATOM   5444  N  NE  . ARG A  1  693  ? 18.983  -76.819  -10.303  1.00 91.93  ? 693  ARG A NE  1 
ATOM   5445  C  CZ  . ARG A  1  693  ? 20.113  -77.499  -10.476  1.00 103.93 ? 693  ARG A CZ  1 
ATOM   5446  N  NH1 . ARG A  1  693  ? 20.158  -78.798  -10.189  1.00 160.91 ? 693  ARG A NH1 1 
ATOM   5447  N  NH2 . ARG A  1  693  ? 21.199  -76.885  -10.933  1.00 90.03  ? 693  ARG A NH2 1 
ATOM   5448  N  N   . ARG A  1  694  ? 13.892  -78.500  -6.440   1.00 122.64 ? 694  ARG A N   1 
ATOM   5449  C  CA  . ARG A  1  694  ? 12.814  -79.277  -5.815   1.00 122.62 ? 694  ARG A CA  1 
ATOM   5450  C  C   . ARG A  1  694  ? 11.456  -78.896  -6.362   1.00 143.32 ? 694  ARG A C   1 
ATOM   5451  O  O   . ARG A  1  694  ? 10.538  -79.709  -6.366   1.00 204.63 ? 694  ARG A O   1 
ATOM   5452  C  CB  . ARG A  1  694  ? 12.806  -79.113  -4.286   1.00 139.61 ? 694  ARG A CB  1 
ATOM   5453  C  CG  . ARG A  1  694  ? 11.543  -79.614  -3.580   1.00 161.68 ? 694  ARG A CG  1 
ATOM   5454  C  CD  . ARG A  1  694  ? 11.604  -79.365  -2.078   1.00 147.23 ? 694  ARG A CD  1 
ATOM   5455  N  NE  . ARG A  1  694  ? 12.929  -79.646  -1.526   1.00 179.09 ? 694  ARG A NE  1 
ATOM   5456  C  CZ  . ARG A  1  694  ? 13.306  -80.828  -1.048   1.00 213.50 ? 694  ARG A CZ  1 
ATOM   5457  N  NH1 . ARG A  1  694  ? 12.451  -81.842  -1.045   1.00 257.24 ? 694  ARG A NH1 1 
ATOM   5458  N  NH2 . ARG A  1  694  ? 14.535  -80.991  -0.572   1.00 190.42 ? 694  ARG A NH2 1 
ATOM   5459  N  N   . GLN A  1  695  ? 11.332  -77.655  -6.818   1.00 187.98 ? 695  GLN A N   1 
ATOM   5460  C  CA  . GLN A  1  695  ? 10.081  -77.180  -7.392   1.00 187.94 ? 695  GLN A CA  1 
ATOM   5461  C  C   . GLN A  1  695  ? 9.906   -77.660  -8.836   1.00 164.85 ? 695  GLN A C   1 
ATOM   5462  O  O   . GLN A  1  695  ? 8.796   -77.628  -9.375   1.00 213.24 ? 695  GLN A O   1 
ATOM   5463  C  CB  . GLN A  1  695  ? 9.962   -75.654  -7.280   1.00 170.86 ? 695  GLN A CB  1 
ATOM   5464  C  CG  . GLN A  1  695  ? 9.705   -75.147  -5.859   1.00 184.84 ? 695  GLN A CG  1 
ATOM   5465  C  CD  . GLN A  1  695  ? 10.059  -73.673  -5.671   1.00 181.32 ? 695  GLN A CD  1 
ATOM   5466  O  OE1 . GLN A  1  695  ? 10.371  -72.967  -6.635   1.00 178.93 ? 695  GLN A OE1 1 
ATOM   5467  N  NE2 . GLN A  1  695  ? 10.020  -73.202  -4.424   1.00 173.22 ? 695  GLN A NE2 1 
ATOM   5468  N  N   . VAL A  1  696  ? 10.992  -78.117  -9.454   1.00 85.29  ? 696  VAL A N   1 
ATOM   5469  C  CA  . VAL A  1  696  ? 10.900  -78.739  -10.781  1.00 85.12  ? 696  VAL A CA  1 
ATOM   5470  C  C   . VAL A  1  696  ? 10.788  -80.246  -10.639  1.00 86.64  ? 696  VAL A C   1 
ATOM   5471  O  O   . VAL A  1  696  ? 10.024  -80.891  -11.349  1.00 91.18  ? 696  VAL A O   1 
ATOM   5472  C  CB  . VAL A  1  696  ? 12.117  -78.447  -11.664  1.00 84.09  ? 696  VAL A CB  1 
ATOM   5473  C  CG1 . VAL A  1  696  ? 11.965  -79.126  -12.983  1.00 85.06  ? 696  VAL A CG1 1 
ATOM   5474  C  CG2 . VAL A  1  696  ? 12.269  -76.977  -11.891  1.00 86.37  ? 696  VAL A CG2 1 
ATOM   5475  N  N   . ALA A  1  697  ? 11.577  -80.801  -9.723   1.00 174.02 ? 697  ALA A N   1 
ATOM   5476  C  CA  . ALA A  1  697  ? 11.465  -82.209  -9.391   1.00 200.18 ? 697  ALA A CA  1 
ATOM   5477  C  C   . ALA A  1  697  ? 9.991   -82.546  -9.229   1.00 207.36 ? 697  ALA A C   1 
ATOM   5478  O  O   . ALA A  1  697  ? 9.508   -83.520  -9.800   1.00 216.94 ? 697  ALA A O   1 
ATOM   5479  C  CB  . ALA A  1  697  ? 12.227  -82.513  -8.107   1.00 203.73 ? 697  ALA A CB  1 
ATOM   5480  N  N   . GLU A  1  698  ? 9.275   -81.723  -8.473   1.00 158.09 ? 698  GLU A N   1 
ATOM   5481  C  CA  . GLU A  1  698  ? 7.846   -81.930  -8.262   1.00 190.49 ? 698  GLU A CA  1 
ATOM   5482  C  C   . GLU A  1  698  ? 7.042   -81.521  -9.490   1.00 150.19 ? 698  GLU A C   1 
ATOM   5483  O  O   . GLU A  1  698  ? 5.846   -81.258  -9.394   1.00 186.14 ? 698  GLU A O   1 
ATOM   5484  C  CB  . GLU A  1  698  ? 7.340   -81.196  -7.012   1.00 225.03 ? 698  GLU A CB  1 
ATOM   5485  C  CG  . GLU A  1  698  ? 7.096   -79.697  -7.191   1.00 214.05 ? 698  GLU A CG  1 
ATOM   5486  C  CD  . GLU A  1  698  ? 6.393   -79.058  -5.993   1.00 200.73 ? 698  GLU A CD  1 
ATOM   5487  O  OE1 . GLU A  1  698  ? 5.957   -79.805  -5.088   1.00 186.91 ? 698  GLU A OE1 1 
ATOM   5488  O  OE2 . GLU A  1  698  ? 6.274   -77.808  -5.954   1.00 186.87 ? 698  GLU A OE2 1 
ATOM   5489  N  N   . CYS A  1  699  ? 7.699   -81.460  -10.640  1.00 205.75 ? 699  CYS A N   1 
ATOM   5490  C  CA  . CYS A  1  699  ? 7.012   -81.176  -11.896  1.00 152.92 ? 699  CYS A CA  1 
ATOM   5491  C  C   . CYS A  1  699  ? 7.484   -82.105  -13.011  1.00 178.96 ? 699  CYS A C   1 
ATOM   5492  O  O   . CYS A  1  699  ? 6.680   -82.565  -13.820  1.00 167.17 ? 699  CYS A O   1 
ATOM   5493  C  CB  . CYS A  1  699  ? 7.167   -79.712  -12.312  1.00 139.34 ? 699  CYS A CB  1 
ATOM   5494  S  SG  . CYS A  1  699  ? 5.938   -78.590  -11.579  1.00 131.73 ? 699  CYS A SG  1 
ATOM   5495  N  N   . ILE A  1  700  ? 8.783   -82.382  -13.055  1.00 152.87 ? 700  ILE A N   1 
ATOM   5496  C  CA  . ILE A  1  700  ? 9.304   -83.298  -14.061  1.00 150.74 ? 700  ILE A CA  1 
ATOM   5497  C  C   . ILE A  1  700  ? 8.733   -84.700  -13.871  1.00 148.05 ? 700  ILE A C   1 
ATOM   5498  O  O   . ILE A  1  700  ? 8.532   -85.427  -14.842  1.00 177.34 ? 700  ILE A O   1 
ATOM   5499  C  CB  . ILE A  1  700  ? 10.849  -83.374  -14.064  1.00 109.96 ? 700  ILE A CB  1 
ATOM   5500  C  CG1 . ILE A  1  700  ? 11.405  -83.513  -12.643  1.00 139.56 ? 700  ILE A CG1 1 
ATOM   5501  C  CG2 . ILE A  1  700  ? 11.427  -82.159  -14.728  1.00 93.44  ? 700  ILE A CG2 1 
ATOM   5502  C  CD1 . ILE A  1  700  ? 12.915  -83.704  -12.601  1.00 126.50 ? 700  ILE A CD1 1 
ATOM   5503  N  N   . GLN A  1  701  ? 8.477   -85.079  -12.620  1.00 127.04 ? 701  GLN A N   1 
ATOM   5504  C  CA  . GLN A  1  701  ? 8.016   -86.435  -12.320  1.00 151.66 ? 701  GLN A CA  1 
ATOM   5505  C  C   . GLN A  1  701  ? 6.530   -86.481  -12.015  1.00 172.47 ? 701  GLN A C   1 
ATOM   5506  O  O   . GLN A  1  701  ? 5.898   -87.519  -12.190  1.00 252.54 ? 701  GLN A O   1 
ATOM   5507  C  CB  . GLN A  1  701  ? 8.814   -87.054  -11.166  1.00 141.44 ? 701  GLN A CB  1 
ATOM   5508  C  CG  . GLN A  1  701  ? 8.595   -88.547  -11.002  1.00 188.09 ? 701  GLN A CG  1 
ATOM   5509  C  CD  . GLN A  1  701  ? 9.633   -89.200  -10.112  1.00 194.18 ? 701  GLN A CD  1 
ATOM   5510  O  OE1 . GLN A  1  701  ? 10.677  -88.615  -9.820   1.00 181.67 ? 701  GLN A OE1 1 
ATOM   5511  N  NE2 . GLN A  1  701  ? 9.351   -90.423  -9.683   1.00 217.65 ? 701  GLN A NE2 1 
ATOM   5512  N  N   . ASP A  1  702  ? 5.973   -85.361  -11.567  1.00 117.91 ? 702  ASP A N   1 
ATOM   5513  C  CA  . ASP A  1  702  ? 4.554   -85.325  -11.227  1.00 137.61 ? 702  ASP A CA  1 
ATOM   5514  C  C   . ASP A  1  702  ? 3.669   -85.157  -12.453  1.00 124.14 ? 702  ASP A C   1 
ATOM   5515  O  O   . ASP A  1  702  ? 2.461   -85.371  -12.387  1.00 168.74 ? 702  ASP A O   1 
ATOM   5516  C  CB  . ASP A  1  702  ? 4.243   -84.230  -10.201  1.00 119.72 ? 702  ASP A CB  1 
ATOM   5517  C  CG  . ASP A  1  702  ? 2.803   -84.269  -9.726   1.00 141.01 ? 702  ASP A CG  1 
ATOM   5518  O  OD1 . ASP A  1  702  ? 2.256   -85.384  -9.559   1.00 194.70 ? 702  ASP A OD1 1 
ATOM   5519  O  OD2 . ASP A  1  702  ? 2.217   -83.181  -9.528   1.00 92.51  ? 702  ASP A OD2 1 
ATOM   5520  N  N   . ALA A  1  703  ? 4.267   -84.773  -13.571  1.00 92.03  ? 703  ALA A N   1 
ATOM   5521  C  CA  . ALA A  1  703  ? 3.519   -84.675  -14.809  1.00 92.30  ? 703  ALA A CA  1 
ATOM   5522  C  C   . ALA A  1  703  ? 3.901   -85.840  -15.727  1.00 93.27  ? 703  ALA A C   1 
ATOM   5523  O  O   . ALA A  1  703  ? 3.750   -85.779  -16.959  1.00 93.53  ? 703  ALA A O   1 
ATOM   5524  C  CB  . ALA A  1  703  ? 3.756   -83.341  -15.480  1.00 90.38  ? 703  ALA A CB  1 
ATOM   5525  N  N   . GLN A  1  704  ? 4.394   -86.908  -15.107  1.00 94.12  ? 704  GLN A N   1 
ATOM   5526  C  CA  . GLN A  1  704  ? 4.539   -88.201  -15.773  1.00 93.33  ? 704  GLN A CA  1 
ATOM   5527  C  C   . GLN A  1  704  ? 3.470   -89.166  -15.217  1.00 144.04 ? 704  GLN A C   1 
ATOM   5528  O  O   . GLN A  1  704  ? 3.342   -90.292  -15.668  1.00 130.97 ? 704  GLN A O   1 
ATOM   5529  C  CB  . GLN A  1  704  ? 5.957   -88.762  -15.578  1.00 127.72 ? 704  GLN A CB  1 
ATOM   5530  C  CG  . GLN A  1  704  ? 7.056   -88.023  -16.351  1.00 93.25  ? 704  GLN A CG  1 
ATOM   5531  C  CD  . GLN A  1  704  ? 8.468   -88.485  -15.993  1.00 91.92  ? 704  GLN A CD  1 
ATOM   5532  O  OE1 . GLN A  1  704  ? 8.705   -89.024  -14.912  1.00 92.40  ? 704  GLN A OE1 1 
ATOM   5533  N  NE2 . GLN A  1  704  ? 9.411   -88.256  -16.904  1.00 95.24  ? 704  GLN A NE2 1 
ATOM   5534  N  N   . HIS A  1  705  ? 2.708   -88.689  -14.235  1.00 96.09  ? 705  HIS A N   1 
ATOM   5535  C  CA  . HIS A  1  705  ? 1.589   -89.423  -13.660  1.00 115.49 ? 705  HIS A CA  1 
ATOM   5536  C  C   . HIS A  1  705  ? 0.270   -88.727  -14.022  1.00 98.79  ? 705  HIS A C   1 
ATOM   5537  O  O   . HIS A  1  705  ? -0.709  -88.799  -13.279  1.00 111.71 ? 705  HIS A O   1 
ATOM   5538  C  CB  . HIS A  1  705  ? 1.737   -89.505  -12.138  1.00 148.69 ? 705  HIS A CB  1 
ATOM   5539  C  CG  . HIS A  1  705  ? 2.996   -90.177  -11.685  1.00 162.31 ? 705  HIS A CG  1 
ATOM   5540  N  ND1 . HIS A  1  705  ? 3.032   -91.491  -11.280  1.00 199.41 ? 705  HIS A ND1 1 
ATOM   5541  C  CD2 . HIS A  1  705  ? 4.266   -89.717  -11.578  1.00 142.60 ? 705  HIS A CD2 1 
ATOM   5542  C  CE1 . HIS A  1  705  ? 4.269   -91.816  -10.943  1.00 190.52 ? 705  HIS A CE1 1 
ATOM   5543  N  NE2 . HIS A  1  705  ? 5.036   -90.756  -11.116  1.00 143.96 ? 705  HIS A NE2 1 
ATOM   5544  N  N   . ASN A  1  706  ? 0.262   -88.045  -15.163  1.00 158.84 ? 706  ASN A N   1 
ATOM   5545  C  CA  . ASN A  1  706  ? -0.890  -87.277  -15.645  1.00 122.21 ? 706  ASN A CA  1 
ATOM   5546  C  C   . ASN A  1  706  ? -1.631  -86.411  -14.607  1.00 171.92 ? 706  ASN A C   1 
ATOM   5547  O  O   . ASN A  1  706  ? -2.855  -86.279  -14.652  1.00 157.40 ? 706  ASN A O   1 
ATOM   5548  C  CB  . ASN A  1  706  ? -1.876  -88.175  -16.393  1.00 135.94 ? 706  ASN A CB  1 
ATOM   5549  C  CG  . ASN A  1  706  ? -2.859  -87.384  -17.234  1.00 180.06 ? 706  ASN A CG  1 
ATOM   5550  O  OD1 . ASN A  1  706  ? -2.593  -86.242  -17.618  1.00 156.70 ? 706  ASN A OD1 1 
ATOM   5551  N  ND2 . ASN A  1  706  ? -4.013  -87.983  -17.511  1.00 229.62 ? 706  ASN A ND2 1 
ATOM   5552  N  N   . ARG A  1  707  ? -0.887  -85.815  -13.692  1.00 217.50 ? 707  ARG A N   1 
ATOM   5553  C  CA  . ARG A  1  707  ? -1.516  -84.980  -12.684  1.00 200.78 ? 707  ARG A CA  1 
ATOM   5554  C  C   . ARG A  1  707  ? -1.055  -83.533  -12.764  1.00 168.86 ? 707  ARG A C   1 
ATOM   5555  O  O   . ARG A  1  707  ? -0.516  -82.989  -11.811  1.00 185.08 ? 707  ARG A O   1 
ATOM   5556  C  CB  . ARG A  1  707  ? -1.275  -85.549  -11.288  1.00 201.25 ? 707  ARG A CB  1 
ATOM   5557  C  CG  . ARG A  1  707  ? -2.559  -85.891  -10.551  1.00 224.41 ? 707  ARG A CG  1 
ATOM   5558  C  CD  . ARG A  1  707  ? -2.576  -87.338  -10.094  1.00 271.44 ? 707  ARG A CD  1 
ATOM   5559  N  NE  . ARG A  1  707  ? -3.932  -87.858  -9.991   1.00 312.79 ? 707  ARG A NE  1 
ATOM   5560  C  CZ  . ARG A  1  707  ? -4.223  -89.124  -9.718   1.00 329.36 ? 707  ARG A CZ  1 
ATOM   5561  N  NH1 . ARG A  1  707  ? -3.253  -90.003  -9.520   1.00 358.20 ? 707  ARG A NH1 1 
ATOM   5562  N  NH2 . ARG A  1  707  ? -5.488  -89.514  -9.643   1.00 302.93 ? 707  ARG A NH2 1 
ATOM   5563  N  N   . LEU A  1  708  ? -1.286  -82.919  -13.911  1.00 184.83 ? 708  LEU A N   1 
ATOM   5564  C  CA  . LEU A  1  708  ? -0.888  -81.540  -14.167  1.00 196.98 ? 708  LEU A CA  1 
ATOM   5565  C  C   . LEU A  1  708  ? -1.783  -80.559  -13.417  1.00 236.22 ? 708  LEU A C   1 
ATOM   5566  O  O   . LEU A  1  708  ? -1.542  -80.258  -12.248  1.00 266.41 ? 708  LEU A O   1 
ATOM   5567  C  CB  . LEU A  1  708  ? -0.919  -81.242  -15.667  1.00 150.75 ? 708  LEU A CB  1 
ATOM   5568  C  CG  . LEU A  1  708  ? 0.233   -80.403  -16.218  1.00 123.39 ? 708  LEU A CG  1 
ATOM   5569  C  CD1 . LEU A  1  708  ? 1.443   -80.485  -15.300  1.00 110.66 ? 708  LEU A CD1 1 
ATOM   5570  C  CD2 . LEU A  1  708  ? 0.597   -80.843  -17.627  1.00 162.63 ? 708  LEU A CD2 1 
ATOM   5571  N  N   . LYS A  1  709  ? -2.813  -80.066  -14.096  1.00 257.81 ? 709  LYS A N   1 
ATOM   5572  C  CA  . LYS A  1  709  ? -3.070  -80.446  -15.480  1.00 234.87 ? 709  LYS A CA  1 
ATOM   5573  C  C   . LYS A  1  709  ? -2.712  -79.311  -16.436  1.00 174.85 ? 709  LYS A C   1 
ATOM   5574  O  O   . LYS A  1  709  ? -1.714  -78.616  -16.245  1.00 166.49 ? 709  LYS A O   1 
ATOM   5575  C  CB  . LYS A  1  709  ? -4.534  -80.844  -15.663  1.00 255.36 ? 709  LYS A CB  1 
ATOM   5576  C  CG  . LYS A  1  709  ? -4.974  -82.009  -14.791  1.00 249.41 ? 709  LYS A CG  1 
ATOM   5577  C  CD  . LYS A  1  709  ? -6.477  -82.218  -14.866  1.00 218.10 ? 709  LYS A CD  1 
ATOM   5578  C  CE  . LYS A  1  709  ? -6.915  -83.392  -14.005  1.00 196.33 ? 709  LYS A CE  1 
ATOM   5579  N  NZ  . LYS A  1  709  ? -8.384  -83.620  -14.082  1.00 189.99 ? 709  LYS A NZ  1 
ATOM   5580  N  N   . PRO A  1  710  ? -3.533  -79.130  -17.466  1.00 245.92 ? 710  PRO A N   1 
ATOM   5581  C  CA  . PRO A  1  710  ? -3.304  -78.078  -18.460  1.00 222.90 ? 710  PRO A CA  1 
ATOM   5582  C  C   . PRO A  1  710  ? -4.471  -77.096  -18.526  1.00 202.69 ? 710  PRO A C   1 
ATOM   5583  O  O   . PRO A  1  710  ? -5.302  -77.069  -17.618  1.00 197.19 ? 710  PRO A O   1 
ATOM   5584  C  CB  . PRO A  1  710  ? -3.200  -78.857  -19.771  1.00 264.86 ? 710  PRO A CB  1 
ATOM   5585  C  CG  . PRO A  1  710  ? -4.026  -80.073  -19.546  1.00 310.07 ? 710  PRO A CG  1 
ATOM   5586  C  CD  . PRO A  1  710  ? -3.852  -80.426  -18.095  1.00 291.66 ? 710  PRO A CD  1 
ATOM   5587  N  N   . GLU A  1  711  ? -4.523  -76.304  -19.589  1.00 255.87 ? 711  GLU A N   1 
ATOM   5588  C  CA  . GLU A  1  711  ? -5.591  -75.325  -19.763  1.00 286.58 ? 711  GLU A CA  1 
ATOM   5589  C  C   . GLU A  1  711  ? -5.255  -74.012  -19.065  1.00 293.79 ? 711  GLU A C   1 
ATOM   5590  O  O   . GLU A  1  711  ? -4.739  -74.005  -17.946  1.00 320.97 ? 711  GLU A O   1 
ATOM   5591  C  CB  . GLU A  1  711  ? -6.916  -75.878  -19.234  1.00 302.93 ? 711  GLU A CB  1 
ATOM   5592  C  CG  . GLU A  1  711  ? -7.556  -76.921  -20.134  1.00 301.73 ? 711  GLU A CG  1 
ATOM   5593  C  CD  . GLU A  1  711  ? -8.993  -76.584  -20.481  1.00 285.51 ? 711  GLU A CD  1 
ATOM   5594  O  OE1 . GLU A  1  711  ? -9.628  -75.822  -19.724  1.00 266.26 ? 711  GLU A OE1 1 
ATOM   5595  O  OE2 . GLU A  1  711  ? -9.486  -77.087  -21.515  1.00 283.65 ? 711  GLU A OE2 1 
ATOM   5596  N  N   . PRO A  1  712  ? -5.548  -72.901  -19.730  1.00 293.56 ? 712  PRO A N   1 
ATOM   5597  C  CA  . PRO A  1  712  ? -6.162  -72.939  -21.063  1.00 258.28 ? 712  PRO A CA  1 
ATOM   5598  C  C   . PRO A  1  712  ? -5.130  -72.716  -22.165  1.00 228.82 ? 712  PRO A C   1 
ATOM   5599  O  O   . PRO A  1  712  ? -3.963  -73.073  -22.005  1.00 229.67 ? 712  PRO A O   1 
ATOM   5600  C  CB  . PRO A  1  712  ? -7.149  -71.775  -21.022  1.00 229.42 ? 712  PRO A CB  1 
ATOM   5601  C  CG  . PRO A  1  712  ? -6.558  -70.821  -20.047  1.00 231.51 ? 712  PRO A CG  1 
ATOM   5602  C  CD  . PRO A  1  712  ? -5.886  -71.667  -19.002  1.00 260.69 ? 712  PRO A CD  1 
ATOM   5603  N  N   . GLY A  1  713  ? -5.565  -72.129  -23.276  1.00 148.50 ? 713  GLY A N   1 
ATOM   5604  C  CA  . GLY A  1  713  ? -4.679  -71.862  -24.394  1.00 158.17 ? 713  GLY A CA  1 
ATOM   5605  C  C   . GLY A  1  713  ? -4.018  -73.120  -24.924  1.00 214.20 ? 713  GLY A C   1 
ATOM   5606  O  O   . GLY A  1  713  ? -3.651  -73.196  -26.096  1.00 227.17 ? 713  GLY A O   1 
ATOM   5607  N  N   . MET A  1  714  ? -3.869  -74.115  -24.054  1.00 191.06 ? 714  MET A N   1 
ATOM   5608  C  CA  . MET A  1  714  ? -3.249  -75.376  -24.429  1.00 235.92 ? 714  MET A CA  1 
ATOM   5609  C  C   . MET A  1  714  ? -1.809  -75.171  -24.885  1.00 229.05 ? 714  MET A C   1 
ATOM   5610  O  O   . MET A  1  714  ? -1.360  -74.039  -25.066  1.00 234.78 ? 714  MET A O   1 
ATOM   5611  C  CB  . MET A  1  714  ? -4.057  -76.061  -25.538  1.00 288.87 ? 714  MET A CB  1 
ATOM   5612  C  CG  . MET A  1  714  ? -5.464  -75.514  -25.708  1.00 304.59 ? 714  MET A CG  1 
ATOM   5613  S  SD  . MET A  1  714  ? -6.631  -76.224  -24.529  1.00 245.21 ? 714  MET A SD  1 
ATOM   5614  C  CE  . MET A  1  714  ? -6.789  -77.890  -25.169  1.00 217.98 ? 714  MET A CE  1 
ATOM   5615  N  N   . THR A  1  715  ? -1.086  -76.272  -25.069  1.00 125.52 ? 715  THR A N   1 
ATOM   5616  C  CA  . THR A  1  715  ? -1.645  -77.601  -24.847  1.00 115.14 ? 715  THR A CA  1 
ATOM   5617  C  C   . THR A  1  715  ? -1.273  -78.134  -23.467  1.00 97.24  ? 715  THR A C   1 
ATOM   5618  O  O   . THR A  1  715  ? -1.181  -77.374  -22.502  1.00 126.13 ? 715  THR A O   1 
ATOM   5619  C  CB  . THR A  1  715  ? -1.169  -78.600  -25.918  1.00 118.09 ? 715  THR A CB  1 
ATOM   5620  O  OG1 . THR A  1  715  ? 0.188   -78.975  -25.655  1.00 160.17 ? 715  THR A OG1 1 
ATOM   5621  C  CG2 . THR A  1  715  ? -1.260  -77.979  -27.304  1.00 115.80 ? 715  THR A CG2 1 
ATOM   5622  N  N   . LEU A  1  716  ? -1.063  -79.443  -23.379  1.00 91.03  ? 716  LEU A N   1 
ATOM   5623  C  CA  . LEU A  1  716  ? -0.698  -80.080  -22.113  1.00 91.24  ? 716  LEU A CA  1 
ATOM   5624  C  C   . LEU A  1  716  ? 0.825   -80.084  -21.961  1.00 95.37  ? 716  LEU A C   1 
ATOM   5625  O  O   . LEU A  1  716  ? 1.347   -79.839  -20.874  1.00 92.20  ? 716  LEU A O   1 
ATOM   5626  C  CB  . LEU A  1  716  ? -1.277  -81.500  -22.031  1.00 106.19 ? 716  LEU A CB  1 
ATOM   5627  C  CG  . LEU A  1  716  ? -1.330  -82.228  -20.678  1.00 119.92 ? 716  LEU A CG  1 
ATOM   5628  C  CD1 . LEU A  1  716  ? -2.329  -83.374  -20.703  1.00 128.26 ? 716  LEU A CD1 1 
ATOM   5629  C  CD2 . LEU A  1  716  ? 0.036   -82.747  -20.255  1.00 124.54 ? 716  LEU A CD2 1 
ATOM   5630  N  N   . ARG A  1  717  ? 1.537   -80.339  -23.055  1.00 143.48 ? 717  ARG A N   1 
ATOM   5631  C  CA  . ARG A  1  717  ? 2.994   -80.294  -23.019  1.00 173.07 ? 717  ARG A CA  1 
ATOM   5632  C  C   . ARG A  1  717  ? 3.439   -78.854  -22.832  1.00 134.90 ? 717  ARG A C   1 
ATOM   5633  O  O   . ARG A  1  717  ? 4.409   -78.580  -22.120  1.00 109.86 ? 717  ARG A O   1 
ATOM   5634  C  CB  . ARG A  1  717  ? 3.605   -80.863  -24.300  1.00 195.86 ? 717  ARG A CB  1 
ATOM   5635  C  CG  . ARG A  1  717  ? 5.060   -81.307  -24.149  1.00 182.23 ? 717  ARG A CG  1 
ATOM   5636  C  CD  . ARG A  1  717  ? 5.996   -80.139  -23.932  1.00 160.83 ? 717  ARG A CD  1 
ATOM   5637  N  NE  . ARG A  1  717  ? 7.336   -80.568  -23.545  1.00 161.65 ? 717  ARG A NE  1 
ATOM   5638  C  CZ  . ARG A  1  717  ? 8.319   -80.795  -24.403  1.00 166.63 ? 717  ARG A CZ  1 
ATOM   5639  N  NH1 . ARG A  1  717  ? 8.112   -80.635  -25.706  1.00 175.70 ? 717  ARG A NH1 1 
ATOM   5640  N  NH2 . ARG A  1  717  ? 9.508   -81.177  -23.966  1.00 171.37 ? 717  ARG A NH2 1 
ATOM   5641  N  N   . GLU A  1  718  ? 2.716   -77.937  -23.465  1.00 140.97 ? 718  GLU A N   1 
ATOM   5642  C  CA  . GLU A  1  718  ? 3.015   -76.515  -23.356  1.00 146.44 ? 718  GLU A CA  1 
ATOM   5643  C  C   . GLU A  1  718  ? 2.662   -75.920  -21.979  1.00 102.54 ? 718  GLU A C   1 
ATOM   5644  O  O   . GLU A  1  718  ? 3.461   -75.184  -21.390  1.00 113.04 ? 718  GLU A O   1 
ATOM   5645  C  CB  . GLU A  1  718  ? 2.345   -75.742  -24.500  1.00 95.87  ? 718  GLU A CB  1 
ATOM   5646  C  CG  . GLU A  1  718  ? 2.679   -76.305  -25.867  1.00 117.29 ? 718  GLU A CG  1 
ATOM   5647  C  CD  . GLU A  1  718  ? 2.415   -75.324  -26.991  1.00 111.11 ? 718  GLU A CD  1 
ATOM   5648  O  OE1 . GLU A  1  718  ? 2.686   -75.663  -28.158  1.00 131.72 ? 718  GLU A OE1 1 
ATOM   5649  O  OE2 . GLU A  1  718  ? 1.942   -74.208  -26.708  1.00 145.24 ? 718  GLU A OE2 1 
ATOM   5650  N  N   . SER A  1  719  ? 1.489   -76.261  -21.453  1.00 111.99 ? 719  SER A N   1 
ATOM   5651  C  CA  . SER A  1  719  ? 1.097   -75.799  -20.134  1.00 106.64 ? 719  SER A CA  1 
ATOM   5652  C  C   . SER A  1  719  ? 1.997   -76.388  -19.049  1.00 113.53 ? 719  SER A C   1 
ATOM   5653  O  O   . SER A  1  719  ? 1.910   -75.990  -17.898  1.00 110.63 ? 719  SER A O   1 
ATOM   5654  C  CB  . SER A  1  719  ? -0.370  -76.114  -19.845  1.00 97.89  ? 719  SER A CB  1 
ATOM   5655  O  OG  . SER A  1  719  ? -0.609  -77.506  -19.831  1.00 109.34 ? 719  SER A OG  1 
ATOM   5656  N  N   . PHE A  1  720  ? 2.859   -77.327  -19.424  1.00 88.21  ? 720  PHE A N   1 
ATOM   5657  C  CA  . PHE A  1  720  ? 3.952   -77.760  -18.549  1.00 87.91  ? 720  PHE A CA  1 
ATOM   5658  C  C   . PHE A  1  720  ? 5.142   -76.821  -18.711  1.00 85.55  ? 720  PHE A C   1 
ATOM   5659  O  O   . PHE A  1  720  ? 5.631   -76.234  -17.737  1.00 90.52  ? 720  PHE A O   1 
ATOM   5660  C  CB  . PHE A  1  720  ? 4.399   -79.197  -18.852  1.00 87.81  ? 720  PHE A CB  1 
ATOM   5661  C  CG  . PHE A  1  720  ? 5.793   -79.533  -18.339  1.00 88.70  ? 720  PHE A CG  1 
ATOM   5662  C  CD1 . PHE A  1  720  ? 5.985   -79.940  -17.029  1.00 93.06  ? 720  PHE A CD1 1 
ATOM   5663  C  CD2 . PHE A  1  720  ? 6.902   -79.450  -19.175  1.00 87.29  ? 720  PHE A CD2 1 
ATOM   5664  C  CE1 . PHE A  1  720  ? 7.249   -80.262  -16.568  1.00 91.66  ? 720  PHE A CE1 1 
ATOM   5665  C  CE2 . PHE A  1  720  ? 8.169   -79.772  -18.719  1.00 87.47  ? 720  PHE A CE2 1 
ATOM   5666  C  CZ  . PHE A  1  720  ? 8.342   -80.180  -17.419  1.00 91.57  ? 720  PHE A CZ  1 
ATOM   5667  N  N   . GLU A  1  721  ? 5.602   -76.677  -19.949  1.00 165.37 ? 721  GLU A N   1 
ATOM   5668  C  CA  . GLU A  1  721  ? 6.667   -75.739  -20.247  1.00 103.25 ? 721  GLU A CA  1 
ATOM   5669  C  C   . GLU A  1  721  ? 6.378   -74.431  -19.517  1.00 148.52 ? 721  GLU A C   1 
ATOM   5670  O  O   . GLU A  1  721  ? 7.269   -73.801  -18.954  1.00 108.35 ? 721  GLU A O   1 
ATOM   5671  C  CB  . GLU A  1  721  ? 6.742   -75.496  -21.750  1.00 95.32  ? 721  GLU A CB  1 
ATOM   5672  C  CG  . GLU A  1  721  ? 8.083   -75.000  -22.235  1.00 103.76 ? 721  GLU A CG  1 
ATOM   5673  C  CD  . GLU A  1  721  ? 9.178   -76.031  -22.075  1.00 112.76 ? 721  GLU A CD  1 
ATOM   5674  O  OE1 . GLU A  1  721  ? 8.888   -77.170  -21.637  1.00 121.17 ? 721  GLU A OE1 1 
ATOM   5675  O  OE2 . GLU A  1  721  ? 10.339  -75.702  -22.389  1.00 98.56  ? 721  GLU A OE2 1 
ATOM   5676  N  N   . ALA A  1  722  ? 5.111   -74.033  -19.514  1.00 110.01 ? 722  ALA A N   1 
ATOM   5677  C  CA  . ALA A  1  722  ? 4.701   -72.803  -18.849  1.00 97.77  ? 722  ALA A CA  1 
ATOM   5678  C  C   . ALA A  1  722  ? 5.004   -72.808  -17.355  1.00 100.91 ? 722  ALA A C   1 
ATOM   5679  O  O   . ALA A  1  722  ? 5.753   -71.970  -16.865  1.00 128.92 ? 722  ALA A O   1 
ATOM   5680  C  CB  . ALA A  1  722  ? 3.223   -72.546  -19.086  1.00 100.53 ? 722  ALA A CB  1 
ATOM   5681  N  N   . LYS A  1  723  ? 4.423   -73.761  -16.634  1.00 116.40 ? 723  LYS A N   1 
ATOM   5682  C  CA  . LYS A  1  723  ? 4.593   -73.817  -15.185  1.00 136.01 ? 723  LYS A CA  1 
ATOM   5683  C  C   . LYS A  1  723  ? 6.052   -73.954  -14.739  1.00 133.76 ? 723  LYS A C   1 
ATOM   5684  O  O   . LYS A  1  723  ? 6.329   -74.002  -13.534  1.00 116.91 ? 723  LYS A O   1 
ATOM   5685  C  CB  . LYS A  1  723  ? 3.707   -74.903  -14.570  1.00 177.55 ? 723  LYS A CB  1 
ATOM   5686  C  CG  . LYS A  1  723  ? 2.230   -74.649  -14.806  1.00 207.88 ? 723  LYS A CG  1 
ATOM   5687  C  CD  . LYS A  1  723  ? 1.368   -75.605  -14.028  1.00 239.89 ? 723  LYS A CD  1 
ATOM   5688  C  CE  . LYS A  1  723  ? -0.095  -75.258  -14.217  1.00 207.58 ? 723  LYS A CE  1 
ATOM   5689  N  NZ  . LYS A  1  723  ? -0.975  -76.127  -13.402  1.00 197.61 ? 723  LYS A NZ  1 
ATOM   5690  N  N   . VAL A  1  724  ? 6.979   -73.986  -15.702  1.00 83.77  ? 724  VAL A N   1 
ATOM   5691  C  CA  . VAL A  1  724  ? 8.417   -74.055  -15.389  1.00 83.78  ? 724  VAL A CA  1 
ATOM   5692  C  C   . VAL A  1  724  ? 9.135   -72.712  -15.682  1.00 82.89  ? 724  VAL A C   1 
ATOM   5693  O  O   . VAL A  1  724  ? 9.732   -72.079  -14.784  1.00 82.08  ? 724  VAL A O   1 
ATOM   5694  C  CB  . VAL A  1  724  ? 9.122   -75.269  -16.084  1.00 83.38  ? 724  VAL A CB  1 
ATOM   5695  C  CG1 . VAL A  1  724  ? 10.404  -75.656  -15.343  1.00 84.63  ? 724  VAL A CG1 1 
ATOM   5696  C  CG2 . VAL A  1  724  ? 8.194   -76.447  -16.117  1.00 83.92  ? 724  VAL A CG2 1 
ATOM   5697  N  N   . SER A  1  725  ? 9.064   -72.263  -16.928  1.00 117.26 ? 725  SER A N   1 
ATOM   5698  C  CA  . SER A  1  725  ? 9.631   -70.971  -17.267  1.00 96.24  ? 725  SER A CA  1 
ATOM   5699  C  C   . SER A  1  725  ? 9.069   -69.934  -16.297  1.00 144.19 ? 725  SER A C   1 
ATOM   5700  O  O   . SER A  1  725  ? 9.633   -68.857  -16.128  1.00 112.52 ? 725  SER A O   1 
ATOM   5701  C  CB  . SER A  1  725  ? 9.328   -70.588  -18.721  1.00 146.52 ? 725  SER A CB  1 
ATOM   5702  O  OG  . SER A  1  725  ? 7.949   -70.351  -18.918  1.00 108.20 ? 725  SER A OG  1 
ATOM   5703  N  N   . ARG A  1  726  ? 7.950   -70.264  -15.658  1.00 129.35 ? 726  ARG A N   1 
ATOM   5704  C  CA  . ARG A  1  726  ? 7.356   -69.385  -14.659  1.00 96.94  ? 726  ARG A CA  1 
ATOM   5705  C  C   . ARG A  1  726  ? 8.088   -69.500  -13.331  1.00 108.37 ? 726  ARG A C   1 
ATOM   5706  O  O   . ARG A  1  726  ? 8.375   -68.493  -12.685  1.00 144.79 ? 726  ARG A O   1 
ATOM   5707  C  CB  . ARG A  1  726  ? 5.880   -69.738  -14.475  1.00 118.96 ? 726  ARG A CB  1 
ATOM   5708  C  CG  . ARG A  1  726  ? 5.219   -69.119  -13.246  1.00 134.69 ? 726  ARG A CG  1 
ATOM   5709  C  CD  . ARG A  1  726  ? 3.775   -69.578  -13.119  1.00 160.64 ? 726  ARG A CD  1 
ATOM   5710  N  NE  . ARG A  1  726  ? 3.096   -69.519  -14.411  1.00 139.20 ? 726  ARG A NE  1 
ATOM   5711  C  CZ  . ARG A  1  726  ? 1.824   -69.846  -14.597  1.00 150.99 ? 726  ARG A CZ  1 
ATOM   5712  N  NH1 . ARG A  1  726  ? 1.082   -70.252  -13.575  1.00 177.19 ? 726  ARG A NH1 1 
ATOM   5713  N  NH2 . ARG A  1  726  ? 1.286   -69.763  -15.808  1.00 129.88 ? 726  ARG A NH2 1 
ATOM   5714  N  N   . ILE A  1  727  ? 8.390   -70.731  -12.927  1.00 86.09  ? 727  ILE A N   1 
ATOM   5715  C  CA  . ILE A  1  727  ? 9.093   -70.976  -11.674  1.00 92.10  ? 727  ILE A CA  1 
ATOM   5716  C  C   . ILE A  1  727  ? 10.558  -70.559  -11.782  1.00 83.34  ? 727  ILE A C   1 
ATOM   5717  O  O   . ILE A  1  727  ? 11.129  -70.020  -10.835  1.00 82.44  ? 727  ILE A O   1 
ATOM   5718  C  CB  . ILE A  1  727  ? 9.018   -72.459  -11.264  1.00 103.31 ? 727  ILE A CB  1 
ATOM   5719  C  CG1 . ILE A  1  727  ? 9.856   -73.317  -12.214  1.00 145.25 ? 727  ILE A CG1 1 
ATOM   5720  C  CG2 . ILE A  1  727  ? 7.573   -72.932  -11.242  1.00 109.33 ? 727  ILE A CG2 1 
ATOM   5721  C  CD1 . ILE A  1  727  ? 10.532  -74.489  -11.538  1.00 159.00 ? 727  ILE A CD1 1 
ATOM   5722  N  N   . LEU A  1  728  ? 11.158  -70.818  -12.938  1.00 83.24  ? 728  LEU A N   1 
ATOM   5723  C  CA  . LEU A  1  728  ? 12.552  -70.469  -13.172  1.00 82.29  ? 728  LEU A CA  1 
ATOM   5724  C  C   . LEU A  1  728  ? 12.738  -68.956  -13.221  1.00 79.29  ? 728  LEU A C   1 
ATOM   5725  O  O   . LEU A  1  728  ? 13.700  -68.422  -12.669  1.00 80.97  ? 728  LEU A O   1 
ATOM   5726  C  CB  . LEU A  1  728  ? 13.055  -71.102  -14.473  1.00 81.37  ? 728  LEU A CB  1 
ATOM   5727  C  CG  . LEU A  1  728  ? 13.100  -72.631  -14.510  1.00 81.93  ? 728  LEU A CG  1 
ATOM   5728  C  CD1 . LEU A  1  728  ? 13.852  -73.117  -15.739  1.00 80.76  ? 728  LEU A CD1 1 
ATOM   5729  C  CD2 . LEU A  1  728  ? 13.730  -73.181  -13.239  1.00 82.41  ? 728  LEU A CD2 1 
ATOM   5730  N  N   . ASN A  1  729  ? 11.810  -68.274  -13.881  1.00 129.11 ? 729  ASN A N   1 
ATOM   5731  C  CA  . ASN A  1  729  ? 11.866  -66.822  -13.999  1.00 121.51 ? 729  ASN A CA  1 
ATOM   5732  C  C   . ASN A  1  729  ? 11.646  -66.129  -12.658  1.00 127.73 ? 729  ASN A C   1 
ATOM   5733  O  O   . ASN A  1  729  ? 12.399  -65.230  -12.282  1.00 136.94 ? 729  ASN A O   1 
ATOM   5734  C  CB  . ASN A  1  729  ? 10.839  -66.326  -15.020  1.00 120.17 ? 729  ASN A CB  1 
ATOM   5735  C  CG  . ASN A  1  729  ? 11.366  -66.362  -16.441  1.00 114.12 ? 729  ASN A CG  1 
ATOM   5736  O  OD1 . ASN A  1  729  ? 11.728  -67.422  -16.955  1.00 122.55 ? 729  ASN A OD1 1 
ATOM   5737  N  ND2 . ASN A  1  729  ? 11.413  -65.201  -17.085  1.00 112.51 ? 729  ASN A ND2 1 
ATOM   5738  N  N   . GLN A  1  730  ? 10.613  -66.555  -11.941  1.00 127.76 ? 730  GLN A N   1 
ATOM   5739  C  CA  . GLN A  1  730  ? 10.295  -65.983  -10.639  1.00 172.78 ? 730  GLN A CA  1 
ATOM   5740  C  C   . GLN A  1  730  ? 11.355  -66.347  -9.606   1.00 133.61 ? 730  GLN A C   1 
ATOM   5741  O  O   . GLN A  1  730  ? 11.776  -65.506  -8.813   1.00 135.54 ? 730  GLN A O   1 
ATOM   5742  C  CB  . GLN A  1  730  ? 8.917   -66.453  -10.167  1.00 128.53 ? 730  GLN A CB  1 
ATOM   5743  C  CG  . GLN A  1  730  ? 7.769   -65.566  -10.618  1.00 149.09 ? 730  GLN A CG  1 
ATOM   5744  C  CD  . GLN A  1  730  ? 7.134   -64.807  -9.468   1.00 191.93 ? 730  GLN A CD  1 
ATOM   5745  O  OE1 . GLN A  1  730  ? 7.222   -63.582  -9.394   1.00 218.45 ? 730  GLN A OE1 1 
ATOM   5746  N  NE2 . GLN A  1  730  ? 6.489   -65.538  -8.564   1.00 201.21 ? 730  GLN A NE2 1 
ATOM   5747  N  N   . ALA A  1  731  ? 11.783  -67.604  -9.623   1.00 169.11 ? 731  ALA A N   1 
ATOM   5748  C  CA  . ALA A  1  731  ? 12.797  -68.082  -8.692   1.00 116.98 ? 731  ALA A CA  1 
ATOM   5749  C  C   . ALA A  1  731  ? 14.080  -67.269  -8.816   1.00 105.04 ? 731  ALA A C   1 
ATOM   5750  O  O   . ALA A  1  731  ? 14.808  -67.088  -7.841   1.00 100.19 ? 731  ALA A O   1 
ATOM   5751  C  CB  . ALA A  1  731  ? 13.078  -69.560  -8.924   1.00 167.79 ? 731  ALA A CB  1 
ATOM   5752  N  N   . ARG A  1  732  ? 14.365  -66.784  -10.015  1.00 132.22 ? 732  ARG A N   1 
ATOM   5753  C  CA  . ARG A  1  732  ? 15.550  -65.979  -10.219  1.00 121.47 ? 732  ARG A CA  1 
ATOM   5754  C  C   . ARG A  1  732  ? 15.395  -64.656  -9.499   1.00 115.10 ? 732  ARG A C   1 
ATOM   5755  O  O   . ARG A  1  732  ? 16.282  -64.223  -8.768   1.00 108.96 ? 732  ARG A O   1 
ATOM   5756  C  CB  . ARG A  1  732  ? 15.764  -65.714  -11.701  1.00 117.33 ? 732  ARG A CB  1 
ATOM   5757  C  CG  . ARG A  1  732  ? 15.747  -64.240  -12.060  1.00 108.40 ? 732  ARG A CG  1 
ATOM   5758  C  CD  . ARG A  1  732  ? 16.426  -63.991  -13.391  1.00 103.22 ? 732  ARG A CD  1 
ATOM   5759  N  NE  . ARG A  1  732  ? 15.798  -62.909  -14.141  1.00 99.28  ? 732  ARG A NE  1 
ATOM   5760  C  CZ  . ARG A  1  732  ? 15.564  -62.951  -15.447  1.00 98.95  ? 732  ARG A CZ  1 
ATOM   5761  N  NH1 . ARG A  1  732  ? 15.902  -64.023  -16.148  1.00 102.81 ? 732  ARG A NH1 1 
ATOM   5762  N  NH2 . ARG A  1  732  ? 14.989  -61.925  -16.054  1.00 94.87  ? 732  ARG A NH2 1 
ATOM   5763  N  N   . ASP A  1  733  ? 14.258  -64.007  -9.713   1.00 194.43 ? 733  ASP A N   1 
ATOM   5764  C  CA  . ASP A  1  733  ? 14.021  -62.696  -9.125   1.00 203.83 ? 733  ASP A CA  1 
ATOM   5765  C  C   . ASP A  1  733  ? 14.382  -62.686  -7.645   1.00 189.11 ? 733  ASP A C   1 
ATOM   5766  O  O   . ASP A  1  733  ? 14.987  -61.734  -7.147   1.00 193.29 ? 733  ASP A O   1 
ATOM   5767  C  CB  . ASP A  1  733  ? 12.563  -62.277  -9.313   1.00 223.48 ? 733  ASP A CB  1 
ATOM   5768  C  CG  . ASP A  1  733  ? 11.949  -62.854  -10.575  1.00 221.12 ? 733  ASP A CG  1 
ATOM   5769  O  OD1 . ASP A  1  733  ? 11.503  -64.019  -10.545  1.00 217.14 ? 733  ASP A OD1 1 
ATOM   5770  O  OD2 . ASP A  1  733  ? 11.918  -62.139  -11.601  1.00 212.63 ? 733  ASP A OD2 1 
ATOM   5771  N  N   . ASN A  1  734  ? 14.006  -63.750  -6.942   1.00 156.42 ? 734  ASN A N   1 
ATOM   5772  C  CA  . ASN A  1  734  ? 14.290  -63.865  -5.517   1.00 140.00 ? 734  ASN A CA  1 
ATOM   5773  C  C   . ASN A  1  734  ? 15.784  -63.786  -5.223   1.00 119.65 ? 734  ASN A C   1 
ATOM   5774  O  O   . ASN A  1  734  ? 16.207  -63.101  -4.290   1.00 130.52 ? 734  ASN A O   1 
ATOM   5775  C  CB  . ASN A  1  734  ? 13.714  -65.169  -4.959   1.00 151.84 ? 734  ASN A CB  1 
ATOM   5776  C  CG  . ASN A  1  734  ? 12.264  -65.382  -5.356   1.00 173.34 ? 734  ASN A CG  1 
ATOM   5777  O  OD1 . ASN A  1  734  ? 11.532  -64.425  -5.605   1.00 177.64 ? 734  ASN A OD1 1 
ATOM   5778  N  ND2 . ASN A  1  734  ? 11.847  -66.640  -5.414   1.00 159.03 ? 734  ASN A ND2 1 
ATOM   5779  N  N   . ALA A  1  735  ? 16.577  -64.490  -6.022   1.00 99.67  ? 735  ALA A N   1 
ATOM   5780  C  CA  . ALA A  1  735  ? 18.025  -64.497  -5.848   1.00 87.69  ? 735  ALA A CA  1 
ATOM   5781  C  C   . ALA A  1  735  ? 18.618  -63.121  -6.137   1.00 78.76  ? 735  ALA A C   1 
ATOM   5782  O  O   . ALA A  1  735  ? 19.530  -62.669  -5.444   1.00 78.21  ? 735  ALA A O   1 
ATOM   5783  C  CB  . ALA A  1  735  ? 18.660  -65.546  -6.749   1.00 88.20  ? 735  ALA A CB  1 
ATOM   5784  N  N   . GLY A  1  736  ? 18.093  -62.459  -7.164   1.00 138.86 ? 736  GLY A N   1 
ATOM   5785  C  CA  . GLY A  1  736  ? 18.564  -61.138  -7.542   1.00 101.55 ? 736  GLY A CA  1 
ATOM   5786  C  C   . GLY A  1  736  ? 18.076  -60.060  -6.595   1.00 107.86 ? 736  GLY A C   1 
ATOM   5787  O  O   . GLY A  1  736  ? 18.837  -59.175  -6.205   1.00 104.74 ? 736  GLY A O   1 
ATOM   5788  N  N   . ARG A  1  737  ? 16.802  -60.136  -6.224   1.00 147.54 ? 737  ARG A N   1 
ATOM   5789  C  CA  . ARG A  1  737  ? 16.210  -59.163  -5.314   1.00 148.77 ? 737  ARG A CA  1 
ATOM   5790  C  C   . ARG A  1  737  ? 16.935  -59.154  -3.973   1.00 182.93 ? 737  ARG A C   1 
ATOM   5791  O  O   . ARG A  1  737  ? 17.087  -58.106  -3.346   1.00 133.15 ? 737  ARG A O   1 
ATOM   5792  C  CB  . ARG A  1  737  ? 14.723  -59.460  -5.106   1.00 150.25 ? 737  ARG A CB  1 
ATOM   5793  C  CG  . ARG A  1  737  ? 13.793  -58.533  -5.871   1.00 158.68 ? 737  ARG A CG  1 
ATOM   5794  C  CD  . ARG A  1  737  ? 12.336  -58.829  -5.553   1.00 152.13 ? 737  ARG A CD  1 
ATOM   5795  N  NE  . ARG A  1  737  ? 11.432  -58.249  -6.542   1.00 175.71 ? 737  ARG A NE  1 
ATOM   5796  C  CZ  . ARG A  1  737  ? 10.820  -57.078  -6.400   1.00 188.98 ? 737  ARG A CZ  1 
ATOM   5797  N  NH1 . ARG A  1  737  ? 11.014  -56.356  -5.305   1.00 181.76 ? 737  ARG A NH1 1 
ATOM   5798  N  NH2 . ARG A  1  737  ? 10.014  -56.628  -7.352   1.00 181.05 ? 737  ARG A NH2 1 
ATOM   5799  N  N   . SER A  1  738  ? 17.381  -60.328  -3.538   1.00 82.33  ? 738  SER A N   1 
ATOM   5800  C  CA  . SER A  1  738  ? 18.093  -60.457  -2.273   1.00 95.55  ? 738  SER A CA  1 
ATOM   5801  C  C   . SER A  1  738  ? 19.542  -60.001  -2.407   1.00 79.87  ? 738  SER A C   1 
ATOM   5802  O  O   . SER A  1  738  ? 20.116  -59.443  -1.473   1.00 85.21  ? 738  SER A O   1 
ATOM   5803  C  CB  . SER A  1  738  ? 18.041  -61.903  -1.774   1.00 104.80 ? 738  SER A CB  1 
ATOM   5804  O  OG  . SER A  1  738  ? 18.091  -62.817  -2.855   1.00 110.71 ? 738  SER A OG  1 
ATOM   5805  N  N   . ALA A  1  739  ? 20.126  -60.242  -3.576   1.00 77.49  ? 739  ALA A N   1 
ATOM   5806  C  CA  . ALA A  1  739  ? 21.508  -59.854  -3.836   1.00 77.17  ? 739  ALA A CA  1 
ATOM   5807  C  C   . ALA A  1  739  ? 21.682  -58.343  -3.740   1.00 76.80  ? 739  ALA A C   1 
ATOM   5808  O  O   . ALA A  1  739  ? 22.699  -57.857  -3.245   1.00 77.23  ? 739  ALA A O   1 
ATOM   5809  C  CB  . ALA A  1  739  ? 21.951  -60.355  -5.203   1.00 77.02  ? 739  ALA A CB  1 
ATOM   5810  N  N   . GLU A  1  740  ? 20.684  -57.605  -4.215   1.00 110.39 ? 740  GLU A N   1 
ATOM   5811  C  CA  . GLU A  1  740  ? 20.725  -56.148  -4.180   1.00 127.33 ? 740  GLU A CA  1 
ATOM   5812  C  C   . GLU A  1  740  ? 20.325  -55.619  -2.808   1.00 158.34 ? 740  GLU A C   1 
ATOM   5813  O  O   . GLU A  1  740  ? 20.960  -54.709  -2.274   1.00 123.15 ? 740  GLU A O   1 
ATOM   5814  C  CB  . GLU A  1  740  ? 19.811  -55.561  -5.257   1.00 122.03 ? 740  GLU A CB  1 
ATOM   5815  C  CG  . GLU A  1  740  ? 20.527  -55.190  -6.546   1.00 144.38 ? 740  GLU A CG  1 
ATOM   5816  C  CD  . GLU A  1  740  ? 21.405  -56.310  -7.067   1.00 107.93 ? 740  GLU A CD  1 
ATOM   5817  O  OE1 . GLU A  1  740  ? 21.009  -57.488  -6.939   1.00 161.97 ? 740  GLU A OE1 1 
ATOM   5818  O  OE2 . GLU A  1  740  ? 22.492  -56.013  -7.606   1.00 117.38 ? 740  GLU A OE2 1 
ATOM   5819  N  N   . HIS A  1  741  ? 19.270  -56.195  -2.241   1.00 128.87 ? 741  HIS A N   1 
ATOM   5820  C  CA  . HIS A  1  741  ? 18.784  -55.784  -0.930   1.00 113.31 ? 741  HIS A CA  1 
ATOM   5821  C  C   . HIS A  1  741  ? 19.833  -56.035  0.149    1.00 163.98 ? 741  HIS A C   1 
ATOM   5822  O  O   . HIS A  1  741  ? 19.592  -55.790  1.331    1.00 129.22 ? 741  HIS A O   1 
ATOM   5823  C  CB  . HIS A  1  741  ? 17.488  -56.518  -0.584   1.00 139.53 ? 741  HIS A CB  1 
ATOM   5824  C  CG  . HIS A  1  741  ? 16.732  -55.907  0.555    1.00 173.40 ? 741  HIS A CG  1 
ATOM   5825  N  ND1 . HIS A  1  741  ? 15.920  -54.805  0.403    1.00 157.43 ? 741  HIS A ND1 1 
ATOM   5826  C  CD2 . HIS A  1  741  ? 16.666  -56.245  1.865    1.00 216.49 ? 741  HIS A CD2 1 
ATOM   5827  C  CE1 . HIS A  1  741  ? 15.386  -54.489  1.570    1.00 186.90 ? 741  HIS A CE1 1 
ATOM   5828  N  NE2 . HIS A  1  741  ? 15.823  -55.348  2.473    1.00 222.31 ? 741  HIS A NE2 1 
ATOM   5829  N  N   . SER A  1  742  ? 20.996  -56.525  -0.267   1.00 91.05  ? 742  SER A N   1 
ATOM   5830  C  CA  . SER A  1  742  ? 22.083  -56.811  0.661    1.00 88.86  ? 742  SER A CA  1 
ATOM   5831  C  C   . SER A  1  742  ? 23.366  -56.102  0.242    1.00 87.20  ? 742  SER A C   1 
ATOM   5832  O  O   . SER A  1  742  ? 24.459  -56.465  0.678    1.00 90.87  ? 742  SER A O   1 
ATOM   5833  C  CB  . SER A  1  742  ? 22.324  -58.319  0.759    1.00 100.25 ? 742  SER A CB  1 
ATOM   5834  O  OG  . SER A  1  742  ? 23.303  -58.741  -0.175   1.00 89.27  ? 742  SER A OG  1 
ATOM   5835  N  N   . LEU A  1  743  ? 23.226  -55.087  -0.605   1.00 89.14  ? 743  LEU A N   1 
ATOM   5836  C  CA  . LEU A  1  743  ? 24.373  -54.325  -1.084   1.00 84.90  ? 743  LEU A CA  1 
ATOM   5837  C  C   . LEU A  1  743  ? 24.340  -52.893  -0.562   1.00 82.23  ? 743  LEU A C   1 
ATOM   5838  O  O   . LEU A  1  743  ? 23.416  -52.135  -0.858   1.00 80.33  ? 743  LEU A O   1 
ATOM   5839  C  CB  . LEU A  1  743  ? 24.416  -54.326  -2.614   1.00 78.93  ? 743  LEU A CB  1 
ATOM   5840  C  CG  . LEU A  1  743  ? 24.914  -55.612  -3.277   1.00 81.91  ? 743  LEU A CG  1 
ATOM   5841  C  CD1 . LEU A  1  743  ? 25.130  -55.400  -4.768   1.00 77.93  ? 743  LEU A CD1 1 
ATOM   5842  C  CD2 . LEU A  1  743  ? 26.190  -56.102  -2.610   1.00 87.23  ? 743  LEU A CD2 1 
ATOM   5843  N  N   . LYS A  1  744  ? 25.354  -52.529  0.216    1.00 113.31 ? 744  LYS A N   1 
ATOM   5844  C  CA  . LYS A  1  744  ? 25.444  -51.187  0.781    1.00 121.81 ? 744  LYS A CA  1 
ATOM   5845  C  C   . LYS A  1  744  ? 24.846  -50.186  -0.234   1.00 139.09 ? 744  LYS A C   1 
ATOM   5846  O  O   . LYS A  1  744  ? 25.105  -50.293  -1.427   1.00 121.53 ? 744  LYS A O   1 
ATOM   5847  C  CB  . LYS A  1  744  ? 26.917  -50.869  1.120    1.00 140.21 ? 744  LYS A CB  1 
ATOM   5848  C  CG  . LYS A  1  744  ? 27.119  -50.140  2.453    1.00 119.23 ? 744  LYS A CG  1 
ATOM   5849  C  CD  . LYS A  1  744  ? 26.342  -48.818  2.507    1.00 140.18 ? 744  LYS A CD  1 
ATOM   5850  C  CE  . LYS A  1  744  ? 26.399  -48.174  3.898    1.00 145.94 ? 744  LYS A CE  1 
ATOM   5851  N  NZ  . LYS A  1  744  ? 25.858  -46.779  3.959    1.00 115.49 ? 744  LYS A NZ  1 
ATOM   5852  N  N   . ASP A  1  745  ? 24.024  -49.240  0.215    1.00 135.33 ? 745  ASP A N   1 
ATOM   5853  C  CA  . ASP A  1  745  ? 23.473  -48.222  -0.696   1.00 158.84 ? 745  ASP A CA  1 
ATOM   5854  C  C   . ASP A  1  745  ? 24.577  -47.499  -1.479   1.00 100.70 ? 745  ASP A C   1 
ATOM   5855  O  O   . ASP A  1  745  ? 24.379  -47.087  -2.623   1.00 106.27 ? 745  ASP A O   1 
ATOM   5856  C  CB  . ASP A  1  745  ? 22.657  -47.198  0.095    1.00 113.22 ? 745  ASP A CB  1 
ATOM   5857  C  CG  . ASP A  1  745  ? 21.383  -47.783  0.657    1.00 138.22 ? 745  ASP A CG  1 
ATOM   5858  O  OD1 . ASP A  1  745  ? 20.964  -47.374  1.769    1.00 186.60 ? 745  ASP A OD1 1 
ATOM   5859  O  OD2 . ASP A  1  745  ? 20.802  -48.663  -0.025   1.00 106.86 ? 745  ASP A OD2 1 
ATOM   5860  N  N   . SER A  1  746  ? 25.732  -47.357  -0.848   1.00 93.76  ? 746  SER A N   1 
ATOM   5861  C  CA  . SER A  1  746  ? 26.871  -46.698  -1.455   1.00 113.77 ? 746  SER A CA  1 
ATOM   5862  C  C   . SER A  1  746  ? 27.775  -47.703  -2.166   1.00 104.69 ? 746  SER A C   1 
ATOM   5863  O  O   . SER A  1  746  ? 28.965  -47.814  -1.889   1.00 109.15 ? 746  SER A O   1 
ATOM   5864  C  CB  . SER A  1  746  ? 27.640  -45.929  -0.373   1.00 85.47  ? 746  SER A CB  1 
ATOM   5865  O  OG  . SER A  1  746  ? 27.930  -46.745  0.757    1.00 103.27 ? 746  SER A OG  1 
ATOM   5866  N  N   . ASN A  1  747  ? 27.198  -48.440  -3.089   1.00 105.09 ? 747  ASN A N   1 
ATOM   5867  C  CA  . ASN A  1  747  ? 27.982  -49.391  -3.839   1.00 137.05 ? 747  ASN A CA  1 
ATOM   5868  C  C   . ASN A  1  747  ? 27.926  -49.047  -5.302   1.00 131.27 ? 747  ASN A C   1 
ATOM   5869  O  O   . ASN A  1  747  ? 26.878  -49.200  -5.916   1.00 117.64 ? 747  ASN A O   1 
ATOM   5870  C  CB  . ASN A  1  747  ? 27.444  -50.804  -3.653   1.00 83.63  ? 747  ASN A CB  1 
ATOM   5871  C  CG  . ASN A  1  747  ? 27.774  -51.707  -4.830   1.00 136.66 ? 747  ASN A CG  1 
ATOM   5872  O  OD1 . ASN A  1  747  ? 28.937  -51.847  -5.207   1.00 93.77  ? 747  ASN A OD1 1 
ATOM   5873  N  ND2 . ASN A  1  747  ? 26.756  -52.303  -5.425   1.00 103.11 ? 747  ASN A ND2 1 
ATOM   5874  N  N   . ASN A  1  748  ? 29.042  -48.585  -5.862   1.00 102.53 ? 748  ASN A N   1 
ATOM   5875  C  CA  . ASN A  1  748  ? 29.086  -48.204  -7.269   1.00 123.01 ? 748  ASN A CA  1 
ATOM   5876  C  C   . ASN A  1  748  ? 28.230  -49.180  -8.035   1.00 103.45 ? 748  ASN A C   1 
ATOM   5877  O  O   . ASN A  1  748  ? 27.957  -50.263  -7.527   1.00 104.76 ? 748  ASN A O   1 
ATOM   5878  C  CB  . ASN A  1  748  ? 30.531  -48.181  -7.794   1.00 106.18 ? 748  ASN A CB  1 
ATOM   5879  C  CG  . ASN A  1  748  ? 31.467  -47.232  -6.981   1.00 105.22 ? 748  ASN A CG  1 
ATOM   5880  O  OD1 . ASN A  1  748  ? 31.095  -46.116  -6.619   1.00 114.72 ? 748  ASN A OD1 1 
ATOM   5881  N  ND2 . ASN A  1  748  ? 32.688  -47.692  -6.716   1.00 123.25 ? 748  ASN A ND2 1 
ATOM   5882  N  N   . VAL A  1  749  ? 27.796  -48.809  -9.237   1.00 75.14  ? 749  VAL A N   1 
ATOM   5883  C  CA  . VAL A  1  749  ? 26.890  -49.661  -10.050  1.00 75.60  ? 749  VAL A CA  1 
ATOM   5884  C  C   . VAL A  1  749  ? 25.501  -49.774  -9.481   1.00 74.35  ? 749  VAL A C   1 
ATOM   5885  O  O   . VAL A  1  749  ? 24.551  -49.976  -10.210  1.00 74.37  ? 749  VAL A O   1 
ATOM   5886  C  CB  . VAL A  1  749  ? 27.361  -51.136  -10.255  1.00 76.42  ? 749  VAL A CB  1 
ATOM   5887  C  CG1 . VAL A  1  749  ? 26.195  -52.016  -10.676  1.00 75.33  ? 749  VAL A CG1 1 
ATOM   5888  C  CG2 . VAL A  1  749  ? 28.472  -51.211  -11.263  1.00 76.14  ? 749  VAL A CG2 1 
ATOM   5889  N  N   . LYS A  1  750  ? 25.383  -49.696  -8.169   1.00 74.58  ? 750  LYS A N   1 
ATOM   5890  C  CA  . LYS A  1  750  ? 24.061  -49.708  -7.595   1.00 74.83  ? 750  LYS A CA  1 
ATOM   5891  C  C   . LYS A  1  750  ? 23.602  -48.268  -7.524   1.00 74.49  ? 750  LYS A C   1 
ATOM   5892  O  O   . LYS A  1  750  ? 22.408  -47.982  -7.658   1.00 74.47  ? 750  LYS A O   1 
ATOM   5893  C  CB  . LYS A  1  750  ? 24.014  -50.389  -6.228   1.00 77.19  ? 750  LYS A CB  1 
ATOM   5894  C  CG  . LYS A  1  750  ? 22.592  -50.620  -5.801   1.00 75.39  ? 750  LYS A CG  1 
ATOM   5895  C  CD  . LYS A  1  750  ? 22.530  -51.139  -4.415   1.00 81.07  ? 750  LYS A CD  1 
ATOM   5896  C  CE  . LYS A  1  750  ? 21.098  -51.150  -3.962   1.00 75.91  ? 750  LYS A CE  1 
ATOM   5897  N  NZ  . LYS A  1  750  ? 20.952  -51.108  -2.469   1.00 80.97  ? 750  LYS A NZ  1 
ATOM   5898  N  N   . GLN A  1  751  ? 24.557  -47.356  -7.325   1.00 75.86  ? 751  GLN A N   1 
ATOM   5899  C  CA  . GLN A  1  751  ? 24.228  -45.940  -7.304   1.00 74.55  ? 751  GLN A CA  1 
ATOM   5900  C  C   . GLN A  1  751  ? 24.148  -45.418  -8.738   1.00 82.11  ? 751  GLN A C   1 
ATOM   5901  O  O   . GLN A  1  751  ? 23.348  -44.539  -9.049   1.00 89.47  ? 751  GLN A O   1 
ATOM   5902  C  CB  . GLN A  1  751  ? 25.192  -45.120  -6.429   1.00 125.67 ? 751  GLN A CB  1 
ATOM   5903  C  CG  . GLN A  1  751  ? 26.667  -45.146  -6.821   1.00 113.04 ? 751  GLN A CG  1 
ATOM   5904  C  CD  . GLN A  1  751  ? 27.530  -44.353  -5.826   1.00 82.81  ? 751  GLN A CD  1 
ATOM   5905  O  OE1 . GLN A  1  751  ? 28.725  -44.166  -6.036   1.00 114.91 ? 751  GLN A OE1 1 
ATOM   5906  N  NE2 . GLN A  1  751  ? 26.917  -43.878  -4.742   1.00 134.66 ? 751  GLN A NE2 1 
ATOM   5907  N  N   . MET A  1  752  ? 24.950  -45.986  -9.620   1.00 73.92  ? 752  MET A N   1 
ATOM   5908  C  CA  . MET A  1  752  ? 24.910  -45.617  -11.029  1.00 74.08  ? 752  MET A CA  1 
ATOM   5909  C  C   . MET A  1  752  ? 23.541  -45.899  -11.595  1.00 73.26  ? 752  MET A C   1 
ATOM   5910  O  O   . MET A  1  752  ? 23.100  -45.283  -12.554  1.00 72.98  ? 752  MET A O   1 
ATOM   5911  C  CB  . MET A  1  752  ? 25.920  -46.461  -11.780  1.00 73.49  ? 752  MET A CB  1 
ATOM   5912  C  CG  . MET A  1  752  ? 26.269  -45.999  -13.164  1.00 73.32  ? 752  MET A CG  1 
ATOM   5913  S  SD  . MET A  1  752  ? 27.780  -46.809  -13.645  1.00 72.96  ? 752  MET A SD  1 
ATOM   5914  C  CE  . MET A  1  752  ? 28.781  -46.556  -12.181  1.00 73.73  ? 752  MET A CE  1 
ATOM   5915  N  N   . VAL A  1  753  ? 22.889  -46.872  -10.993  1.00 74.60  ? 753  VAL A N   1 
ATOM   5916  C  CA  . VAL A  1  753  ? 21.567  -47.267  -11.405  1.00 74.90  ? 753  VAL A CA  1 
ATOM   5917  C  C   . VAL A  1  753  ? 20.505  -46.397  -10.758  1.00 82.02  ? 753  VAL A C   1 
ATOM   5918  O  O   . VAL A  1  753  ? 19.583  -45.927  -11.425  1.00 78.53  ? 753  VAL A O   1 
ATOM   5919  C  CB  . VAL A  1  753  ? 21.320  -48.730  -11.045  1.00 77.60  ? 753  VAL A CB  1 
ATOM   5920  C  CG1 . VAL A  1  753  ? 19.837  -49.059  -11.090  1.00 80.72  ? 753  VAL A CG1 1 
ATOM   5921  C  CG2 . VAL A  1  753  ? 22.090  -49.622  -11.985  1.00 79.66  ? 753  VAL A CG2 1 
ATOM   5922  N  N   . ALA A  1  754  ? 20.620  -46.192  -9.455   1.00 101.90 ? 754  ALA A N   1 
ATOM   5923  C  CA  . ALA A  1  754  ? 19.625  -45.403  -8.771   1.00 74.47  ? 754  ALA A CA  1 
ATOM   5924  C  C   . ALA A  1  754  ? 19.510  -44.082  -9.488   1.00 75.04  ? 754  ALA A C   1 
ATOM   5925  O  O   . ALA A  1  754  ? 18.409  -43.588  -9.693   1.00 103.45 ? 754  ALA A O   1 
ATOM   5926  C  CB  . ALA A  1  754  ? 20.002  -45.212  -7.335   1.00 74.04  ? 754  ALA A CB  1 
ATOM   5927  N  N   . ALA A  1  755  ? 20.651  -43.529  -9.895   1.00 74.11  ? 755  ALA A N   1 
ATOM   5928  C  CA  . ALA A  1  755  ? 20.656  -42.277  -10.642  1.00 74.23  ? 755  ALA A CA  1 
ATOM   5929  C  C   . ALA A  1  755  ? 19.760  -42.426  -11.869  1.00 74.42  ? 755  ALA A C   1 
ATOM   5930  O  O   . ALA A  1  755  ? 18.819  -41.652  -12.079  1.00 73.66  ? 755  ALA A O   1 
ATOM   5931  C  CB  . ALA A  1  755  ? 22.078  -41.859  -11.031  1.00 74.09  ? 755  ALA A CB  1 
ATOM   5932  N  N   . GLY A  1  756  ? 20.035  -43.452  -12.660  1.00 73.00  ? 756  GLY A N   1 
ATOM   5933  C  CA  . GLY A  1  756  ? 19.240  -43.742  -13.834  1.00 74.46  ? 756  GLY A CA  1 
ATOM   5934  C  C   . GLY A  1  756  ? 20.200  -43.760  -14.986  1.00 73.26  ? 756  GLY A C   1 
ATOM   5935  O  O   . GLY A  1  756  ? 19.907  -44.240  -16.083  1.00 73.19  ? 756  GLY A O   1 
ATOM   5936  N  N   . SER A  1  757  ? 21.381  -43.248  -14.697  1.00 72.84  ? 757  SER A N   1 
ATOM   5937  C  CA  . SER A  1  757  ? 22.357  -43.000  -15.713  1.00 73.15  ? 757  SER A CA  1 
ATOM   5938  C  C   . SER A  1  757  ? 22.479  -44.135  -16.708  1.00 73.45  ? 757  SER A C   1 
ATOM   5939  O  O   . SER A  1  757  ? 22.490  -43.888  -17.914  1.00 72.62  ? 757  SER A O   1 
ATOM   5940  C  CB  . SER A  1  757  ? 23.690  -42.800  -15.058  1.00 72.50  ? 757  SER A CB  1 
ATOM   5941  O  OG  . SER A  1  757  ? 24.183  -44.050  -14.637  1.00 73.57  ? 757  SER A OG  1 
ATOM   5942  N  N   . LYS A  1  758  ? 22.575  -45.374  -16.226  1.00 110.18 ? 758  LYS A N   1 
ATOM   5943  C  CA  . LYS A  1  758  ? 22.898  -46.508  -17.102  1.00 104.42 ? 758  LYS A CA  1 
ATOM   5944  C  C   . LYS A  1  758  ? 22.639  -47.867  -16.447  1.00 101.82 ? 758  LYS A C   1 
ATOM   5945  O  O   . LYS A  1  758  ? 23.135  -48.165  -15.354  1.00 95.62  ? 758  LYS A O   1 
ATOM   5946  C  CB  . LYS A  1  758  ? 24.371  -46.429  -17.522  1.00 87.61  ? 758  LYS A CB  1 
ATOM   5947  C  CG  . LYS A  1  758  ? 24.782  -47.361  -18.601  1.00 91.32  ? 758  LYS A CG  1 
ATOM   5948  C  CD  . LYS A  1  758  ? 24.284  -46.891  -19.935  1.00 92.89  ? 758  LYS A CD  1 
ATOM   5949  C  CE  . LYS A  1  758  ? 22.915  -47.477  -20.267  1.00 110.63 ? 758  LYS A CE  1 
ATOM   5950  N  NZ  . LYS A  1  758  ? 22.584  -47.377  -21.732  1.00 75.20  ? 758  LYS A NZ  1 
ATOM   5951  N  N   . GLY A  1  759  ? 21.876  -48.708  -17.111  1.00 77.57  ? 759  GLY A N   1 
ATOM   5952  C  CA  . GLY A  1  759  ? 21.722  -50.056  -16.602  1.00 72.90  ? 759  GLY A CA  1 
ATOM   5953  C  C   . GLY A  1  759  ? 20.720  -50.176  -15.490  1.00 72.63  ? 759  GLY A C   1 
ATOM   5954  O  O   . GLY A  1  759  ? 20.267  -49.159  -14.984  1.00 85.59  ? 759  GLY A O   1 
ATOM   5955  N  N   . SER A  1  760  ? 20.398  -51.411  -15.098  1.00 73.78  ? 760  SER A N   1 
ATOM   5956  C  CA  . SER A  1  760  ? 19.202  -51.668  -14.300  1.00 74.11  ? 760  SER A CA  1 
ATOM   5957  C  C   . SER A  1  760  ? 19.253  -52.899  -13.406  1.00 73.74  ? 760  SER A C   1 
ATOM   5958  O  O   . SER A  1  760  ? 20.176  -53.709  -13.493  1.00 74.19  ? 760  SER A O   1 
ATOM   5959  C  CB  . SER A  1  760  ? 18.011  -51.820  -15.236  1.00 74.08  ? 760  SER A CB  1 
ATOM   5960  O  OG  . SER A  1  760  ? 18.300  -52.778  -16.244  1.00 73.98  ? 760  SER A OG  1 
ATOM   5961  N  N   . PHE A  1  761  ? 18.231  -53.033  -12.562  1.00 109.40 ? 761  PHE A N   1 
ATOM   5962  C  CA  . PHE A  1  761  ? 18.133  -54.134  -11.601  1.00 124.47 ? 761  PHE A CA  1 
ATOM   5963  C  C   . PHE A  1  761  ? 18.489  -55.488  -12.211  1.00 107.01 ? 761  PHE A C   1 
ATOM   5964  O  O   . PHE A  1  761  ? 19.203  -56.284  -11.606  1.00 127.49 ? 761  PHE A O   1 
ATOM   5965  C  CB  . PHE A  1  761  ? 16.734  -54.203  -10.975  1.00 117.37 ? 761  PHE A CB  1 
ATOM   5966  C  CG  . PHE A  1  761  ? 16.534  -55.366  -10.015  1.00 154.92 ? 761  PHE A CG  1 
ATOM   5967  C  CD1 . PHE A  1  761  ? 16.999  -55.304  -8.709   1.00 141.85 ? 761  PHE A CD1 1 
ATOM   5968  C  CD2 . PHE A  1  761  ? 15.857  -56.512  -10.420  1.00 157.97 ? 761  PHE A CD2 1 
ATOM   5969  C  CE1 . PHE A  1  761  ? 16.810  -56.357  -7.832   1.00 123.68 ? 761  PHE A CE1 1 
ATOM   5970  C  CE2 . PHE A  1  761  ? 15.663  -57.573  -9.548   1.00 123.80 ? 761  PHE A CE2 1 
ATOM   5971  C  CZ  . PHE A  1  761  ? 16.138  -57.495  -8.248   1.00 108.90 ? 761  PHE A CZ  1 
ATOM   5972  N  N   . ILE A  1  762  ? 17.999  -55.737  -13.417  1.00 75.03  ? 762  ILE A N   1 
ATOM   5973  C  CA  . ILE A  1  762  ? 18.307  -56.992  -14.133  1.00 75.60  ? 762  ILE A CA  1 
ATOM   5974  C  C   . ILE A  1  762  ? 19.754  -57.111  -14.616  1.00 74.63  ? 762  ILE A C   1 
ATOM   5975  O  O   . ILE A  1  762  ? 20.174  -58.165  -15.072  1.00 75.52  ? 762  ILE A O   1 
ATOM   5976  C  CB  . ILE A  1  762  ? 17.348  -57.225  -15.315  1.00 75.58  ? 762  ILE A CB  1 
ATOM   5977  C  CG1 . ILE A  1  762  ? 17.849  -58.351  -16.197  1.00 76.79  ? 762  ILE A CG1 1 
ATOM   5978  C  CG2 . ILE A  1  762  ? 17.190  -55.964  -16.124  1.00 74.00  ? 762  ILE A CG2 1 
ATOM   5979  C  CD1 . ILE A  1  762  ? 17.193  -58.405  -17.564  1.00 76.12  ? 762  ILE A CD1 1 
ATOM   5980  N  N   . ASN A  1  763  ? 20.505  -56.024  -14.518  1.00 76.98  ? 763  ASN A N   1 
ATOM   5981  C  CA  . ASN A  1  763  ? 21.899  -56.035  -14.911  1.00 79.87  ? 763  ASN A CA  1 
ATOM   5982  C  C   . ASN A  1  763  ? 22.757  -56.455  -13.747  1.00 77.36  ? 763  ASN A C   1 
ATOM   5983  O  O   . ASN A  1  763  ? 23.829  -57.025  -13.927  1.00 78.80  ? 763  ASN A O   1 
ATOM   5984  C  CB  . ASN A  1  763  ? 22.330  -54.649  -15.354  1.00 79.04  ? 763  ASN A CB  1 
ATOM   5985  C  CG  . ASN A  1  763  ? 22.037  -54.384  -16.814  1.00 76.30  ? 763  ASN A CG  1 
ATOM   5986  O  OD1 . ASN A  1  763  ? 21.962  -55.306  -17.623  1.00 82.65  ? 763  ASN A OD1 1 
ATOM   5987  N  ND2 . ASN A  1  763  ? 21.889  -53.115  -17.166  1.00 73.39  ? 763  ASN A ND2 1 
ATOM   5988  N  N   . ILE A  1  764  ? 22.290  -56.145  -12.540  1.00 75.42  ? 764  ILE A N   1 
ATOM   5989  C  CA  . ILE A  1  764  ? 23.038  -56.458  -11.326  1.00 74.31  ? 764  ILE A CA  1 
ATOM   5990  C  C   . ILE A  1  764  ? 22.812  -57.901  -10.944  1.00 75.18  ? 764  ILE A C   1 
ATOM   5991  O  O   . ILE A  1  764  ? 23.756  -58.631  -10.625  1.00 76.58  ? 764  ILE A O   1 
ATOM   5992  C  CB  . ILE A  1  764  ? 22.651  -55.565  -10.128  1.00 74.63  ? 764  ILE A CB  1 
ATOM   5993  C  CG1 . ILE A  1  764  ? 21.247  -55.034  -10.290  1.00 75.38  ? 764  ILE A CG1 1 
ATOM   5994  C  CG2 . ILE A  1  764  ? 23.595  -54.396  -9.982   1.00 73.97  ? 764  ILE A CG2 1 
ATOM   5995  C  CD1 . ILE A  1  764  ? 20.979  -53.841  -9.420   1.00 74.41  ? 764  ILE A CD1 1 
ATOM   5996  N  N   . SER A  1  765  ? 21.552  -58.322  -10.998  1.00 106.95 ? 765  SER A N   1 
ATOM   5997  C  CA  . SER A  1  765  ? 21.215  -59.683  -10.605  1.00 132.26 ? 765  SER A CA  1 
ATOM   5998  C  C   . SER A  1  765  ? 21.947  -60.700  -11.488  1.00 94.09  ? 765  SER A C   1 
ATOM   5999  O  O   . SER A  1  765  ? 22.363  -61.761  -11.011  1.00 95.83  ? 765  SER A O   1 
ATOM   6000  C  CB  . SER A  1  765  ? 19.713  -59.902  -10.671  1.00 120.25 ? 765  SER A CB  1 
ATOM   6001  O  OG  . SER A  1  765  ? 19.206  -59.318  -11.840  1.00 96.59  ? 765  SER A OG  1 
ATOM   6002  N  N   . GLN A  1  766  ? 22.124  -60.364  -12.765  1.00 78.84  ? 766  GLN A N   1 
ATOM   6003  C  CA  . GLN A  1  766  ? 22.784  -61.250  -13.725  1.00 128.35 ? 766  GLN A CA  1 
ATOM   6004  C  C   . GLN A  1  766  ? 24.304  -61.217  -13.575  1.00 80.02  ? 766  GLN A C   1 
ATOM   6005  O  O   . GLN A  1  766  ? 25.017  -62.067  -14.100  1.00 94.94  ? 766  GLN A O   1 
ATOM   6006  C  CB  . GLN A  1  766  ? 22.446  -60.839  -15.159  1.00 81.29  ? 766  GLN A CB  1 
ATOM   6007  C  CG  . GLN A  1  766  ? 21.205  -61.438  -15.785  1.00 78.42  ? 766  GLN A CG  1 
ATOM   6008  C  CD  . GLN A  1  766  ? 21.114  -61.116  -17.281  1.00 107.87 ? 766  GLN A CD  1 
ATOM   6009  O  OE1 . GLN A  1  766  ? 22.052  -61.355  -18.036  1.00 117.20 ? 766  GLN A OE1 1 
ATOM   6010  N  NE2 . GLN A  1  766  ? 19.985  -60.567  -17.702  1.00 112.79 ? 766  GLN A NE2 1 
ATOM   6011  N  N   . MET A  1  767  ? 24.825  -60.219  -12.892  1.00 82.50  ? 767  MET A N   1 
ATOM   6012  C  CA  . MET A  1  767  ? 26.252  -60.125  -12.842  1.00 89.58  ? 767  MET A CA  1 
ATOM   6013  C  C   . MET A  1  767  ? 26.752  -60.736  -11.563  1.00 76.70  ? 767  MET A C   1 
ATOM   6014  O  O   . MET A  1  767  ? 27.849  -61.292  -11.539  1.00 87.86  ? 767  MET A O   1 
ATOM   6015  C  CB  . MET A  1  767  ? 26.680  -58.672  -12.938  1.00 88.77  ? 767  MET A CB  1 
ATOM   6016  C  CG  . MET A  1  767  ? 26.417  -58.009  -14.285  1.00 74.04  ? 767  MET A CG  1 
ATOM   6017  S  SD  . MET A  1  767  ? 27.376  -56.481  -14.518  1.00 93.76  ? 767  MET A SD  1 
ATOM   6018  C  CE  . MET A  1  767  ? 26.934  -55.565  -13.061  1.00 80.50  ? 767  MET A CE  1 
ATOM   6019  N  N   . SER A  1  768  ? 25.955  -60.654  -10.504  1.00 76.91  ? 768  SER A N   1 
ATOM   6020  C  CA  . SER A  1  768  ? 26.441  -61.087  -9.207   1.00 75.64  ? 768  SER A CA  1 
ATOM   6021  C  C   . SER A  1  768  ? 25.718  -62.328  -8.681   1.00 76.21  ? 768  SER A C   1 
ATOM   6022  O  O   . SER A  1  768  ? 26.270  -63.066  -7.854   1.00 76.70  ? 768  SER A O   1 
ATOM   6023  C  CB  . SER A  1  768  ? 26.333  -59.955  -8.213   1.00 76.09  ? 768  SER A CB  1 
ATOM   6024  O  OG  . SER A  1  768  ? 25.127  -59.255  -8.409   1.00 75.98  ? 768  SER A OG  1 
ATOM   6025  N  N   . ALA A  1  769  ? 24.497  -62.577  -9.170   1.00 76.13  ? 769  ALA A N   1 
ATOM   6026  C  CA  . ALA A  1  769  ? 23.745  -63.775  -8.763   1.00 76.85  ? 769  ALA A CA  1 
ATOM   6027  C  C   . ALA A  1  769  ? 23.849  -64.906  -9.795   1.00 76.70  ? 769  ALA A C   1 
ATOM   6028  O  O   . ALA A  1  769  ? 24.854  -65.635  -9.843   1.00 77.52  ? 769  ALA A O   1 
ATOM   6029  C  CB  . ALA A  1  769  ? 22.288  -63.439  -8.468   1.00 76.41  ? 769  ALA A CB  1 
ATOM   6030  N  N   . CYS A  1  770  ? 22.812  -65.048  -10.613  1.00 110.84 ? 770  CYS A N   1 
ATOM   6031  C  CA  . CYS A  1  770  ? 22.781  -66.085  -11.637  1.00 84.10  ? 770  CYS A CA  1 
ATOM   6032  C  C   . CYS A  1  770  ? 22.866  -65.482  -13.035  1.00 104.67 ? 770  CYS A C   1 
ATOM   6033  O  O   . CYS A  1  770  ? 23.701  -64.617  -13.300  1.00 113.32 ? 770  CYS A O   1 
ATOM   6034  C  CB  . CYS A  1  770  ? 21.516  -66.934  -11.506  1.00 103.20 ? 770  CYS A CB  1 
ATOM   6035  S  SG  . CYS A  1  770  ? 20.158  -66.117  -10.634  1.00 130.80 ? 770  CYS A SG  1 
ATOM   6036  N  N   . VAL A  1  771  ? 21.995  -65.945  -13.925  1.00 84.91  ? 771  VAL A N   1 
ATOM   6037  C  CA  . VAL A  1  771  ? 21.971  -65.451  -15.297  1.00 76.77  ? 771  VAL A CA  1 
ATOM   6038  C  C   . VAL A  1  771  ? 20.787  -66.023  -16.068  1.00 84.93  ? 771  VAL A C   1 
ATOM   6039  O  O   . VAL A  1  771  ? 19.870  -65.295  -16.450  1.00 83.80  ? 771  VAL A O   1 
ATOM   6040  C  CB  . VAL A  1  771  ? 23.272  -65.794  -16.048  1.00 76.85  ? 771  VAL A CB  1 
ATOM   6041  C  CG1 . VAL A  1  771  ? 23.185  -65.341  -17.498  1.00 79.17  ? 771  VAL A CG1 1 
ATOM   6042  C  CG2 . VAL A  1  771  ? 24.467  -65.157  -15.355  1.00 75.88  ? 771  VAL A CG2 1 
ATOM   6043  N  N   . GLY A  1  772  ? 20.808  -67.332  -16.294  1.00 187.75 ? 772  GLY A N   1 
ATOM   6044  C  CA  . GLY A  1  772  ? 19.740  -68.003  -17.013  1.00 213.94 ? 772  GLY A CA  1 
ATOM   6045  C  C   . GLY A  1  772  ? 18.395  -67.839  -16.332  1.00 194.26 ? 772  GLY A C   1 
ATOM   6046  O  O   . GLY A  1  772  ? 18.290  -67.204  -15.284  1.00 202.10 ? 772  GLY A O   1 
ATOM   6047  N  N   . GLN A  1  773  ? 17.376  -68.472  -16.902  1.00 116.91 ? 773  GLN A N   1 
ATOM   6048  C  CA  . GLN A  1  773  ? 17.565  -69.313  -18.079  1.00 115.05 ? 773  GLN A CA  1 
ATOM   6049  C  C   . GLN A  1  773  ? 17.371  -68.510  -19.356  1.00 111.16 ? 773  GLN A C   1 
ATOM   6050  O  O   . GLN A  1  773  ? 16.565  -67.581  -19.395  1.00 104.09 ? 773  GLN A O   1 
ATOM   6051  C  CB  . GLN A  1  773  ? 16.601  -70.500  -18.053  1.00 128.64 ? 773  GLN A CB  1 
ATOM   6052  C  CG  . GLN A  1  773  ? 15.702  -70.596  -19.273  1.00 130.49 ? 773  GLN A CG  1 
ATOM   6053  C  CD  . GLN A  1  773  ? 14.756  -71.779  -19.208  1.00 160.47 ? 773  GLN A CD  1 
ATOM   6054  O  OE1 . GLN A  1  773  ? 13.973  -71.912  -18.267  1.00 152.69 ? 773  GLN A OE1 1 
ATOM   6055  N  NE2 . GLN A  1  773  ? 14.822  -72.647  -20.211  1.00 122.16 ? 773  GLN A NE2 1 
ATOM   6056  N  N   . GLN A  1  774  ? 18.110  -68.867  -20.402  1.00 136.62 ? 774  GLN A N   1 
ATOM   6057  C  CA  . GLN A  1  774  ? 17.989  -68.152  -21.654  1.00 144.26 ? 774  GLN A CA  1 
ATOM   6058  C  C   . GLN A  1  774  ? 16.975  -68.817  -22.561  1.00 167.23 ? 774  GLN A C   1 
ATOM   6059  O  O   . GLN A  1  774  ? 16.663  -69.995  -22.395  1.00 156.28 ? 774  GLN A O   1 
ATOM   6060  C  CB  . GLN A  1  774  ? 19.341  -67.981  -22.338  1.00 157.28 ? 774  GLN A CB  1 
ATOM   6061  C  CG  . GLN A  1  774  ? 20.243  -67.088  -21.529  1.00 126.41 ? 774  GLN A CG  1 
ATOM   6062  C  CD  . GLN A  1  774  ? 19.626  -65.714  -21.358  1.00 114.08 ? 774  GLN A CD  1 
ATOM   6063  O  OE1 . GLN A  1  774  ? 19.031  -65.174  -22.291  1.00 111.39 ? 774  GLN A OE1 1 
ATOM   6064  N  NE2 . GLN A  1  774  ? 19.772  -65.135  -20.174  1.00 104.16 ? 774  GLN A NE2 1 
ATOM   6065  N  N   . ILE A  1  775  ? 16.451  -68.047  -23.508  1.00 98.70  ? 775  ILE A N   1 
ATOM   6066  C  CA  . ILE A  1  775  ? 15.318  -68.473  -24.311  1.00 108.74 ? 775  ILE A CA  1 
ATOM   6067  C  C   . ILE A  1  775  ? 15.621  -68.539  -25.789  1.00 108.47 ? 775  ILE A C   1 
ATOM   6068  O  O   . ILE A  1  775  ? 16.768  -68.595  -26.208  1.00 104.35 ? 775  ILE A O   1 
ATOM   6069  C  CB  . ILE A  1  775  ? 14.156  -67.495  -24.169  1.00 118.44 ? 775  ILE A CB  1 
ATOM   6070  C  CG1 . ILE A  1  775  ? 14.536  -66.154  -24.793  1.00 89.70  ? 775  ILE A CG1 1 
ATOM   6071  C  CG2 . ILE A  1  775  ? 13.795  -67.320  -22.716  1.00 106.41 ? 775  ILE A CG2 1 
ATOM   6072  C  CD1 . ILE A  1  775  ? 15.682  -66.241  -25.776  1.00 81.29  ? 775  ILE A CD1 1 
ATOM   6073  N  N   . VAL A  1  776  ? 14.552  -68.501  -26.571  1.00 86.73  ? 776  VAL A N   1 
ATOM   6074  C  CA  . VAL A  1  776  ? 14.641  -68.631  -28.006  1.00 89.49  ? 776  VAL A CA  1 
ATOM   6075  C  C   . VAL A  1  776  ? 13.255  -68.935  -28.515  1.00 97.42  ? 776  VAL A C   1 
ATOM   6076  O  O   . VAL A  1  776  ? 12.623  -69.894  -28.082  1.00 105.63 ? 776  VAL A O   1 
ATOM   6077  C  CB  . VAL A  1  776  ? 15.509  -69.809  -28.386  1.00 93.76  ? 776  VAL A CB  1 
ATOM   6078  C  CG1 . VAL A  1  776  ? 15.955  -70.536  -27.136  1.00 95.73  ? 776  VAL A CG1 1 
ATOM   6079  C  CG2 . VAL A  1  776  ? 14.722  -70.743  -29.284  1.00 104.05 ? 776  VAL A CG2 1 
ATOM   6080  N  N   . GLU A  1  777  ? 12.780  -68.115  -29.435  1.00 103.03 ? 777  GLU A N   1 
ATOM   6081  C  CA  . GLU A  1  777  ? 11.467  -68.340  -29.996  1.00 111.08 ? 777  GLU A CA  1 
ATOM   6082  C  C   . GLU A  1  777  ? 10.514  -68.893  -28.951  1.00 115.75 ? 777  GLU A C   1 
ATOM   6083  O  O   . GLU A  1  777  ? 9.852   -69.898  -29.182  1.00 125.87 ? 777  GLU A O   1 
ATOM   6084  C  CB  . GLU A  1  777  ? 11.556  -69.305  -31.175  1.00 119.94 ? 777  GLU A CB  1 
ATOM   6085  C  CG  . GLU A  1  777  ? 12.682  -68.992  -32.144  1.00 115.49 ? 777  GLU A CG  1 
ATOM   6086  C  CD  . GLU A  1  777  ? 12.359  -69.405  -33.565  1.00 115.04 ? 777  GLU A CD  1 
ATOM   6087  O  OE1 . GLU A  1  777  ? 12.229  -68.513  -34.425  1.00 111.46 ? 777  GLU A OE1 1 
ATOM   6088  O  OE2 . GLU A  1  777  ? 12.239  -70.620  -33.820  1.00 123.97 ? 777  GLU A OE2 1 
ATOM   6089  N  N   . GLY A  1  778  ? 10.444  -68.237  -27.802  1.00 136.06 ? 778  GLY A N   1 
ATOM   6090  C  CA  . GLY A  1  778  ? 9.340   -68.460  -26.888  1.00 137.27 ? 778  GLY A CA  1 
ATOM   6091  C  C   . GLY A  1  778  ? 9.305   -69.882  -26.359  1.00 145.44 ? 778  GLY A C   1 
ATOM   6092  O  O   . GLY A  1  778  ? 8.234   -70.423  -26.078  1.00 150.24 ? 778  GLY A O   1 
ATOM   6093  N  N   . LYS A  1  779  ? 10.479  -70.485  -26.223  1.00 84.57  ? 779  LYS A N   1 
ATOM   6094  C  CA  . LYS A  1  779  ? 10.587  -71.852  -25.722  1.00 86.09  ? 779  LYS A CA  1 
ATOM   6095  C  C   . LYS A  1  779  ? 12.020  -72.181  -25.322  1.00 83.55  ? 779  LYS A C   1 
ATOM   6096  O  O   . LYS A  1  779  ? 12.923  -72.197  -26.158  1.00 81.40  ? 779  LYS A O   1 
ATOM   6097  C  CB  . LYS A  1  779  ? 10.095  -72.846  -26.775  1.00 97.37  ? 779  LYS A CB  1 
ATOM   6098  C  CG  . LYS A  1  779  ? 9.680   -74.195  -26.208  1.00 108.74 ? 779  LYS A CG  1 
ATOM   6099  C  CD  . LYS A  1  779  ? 9.764   -75.286  -27.262  1.00 120.85 ? 779  LYS A CD  1 
ATOM   6100  C  CE  . LYS A  1  779  ? 9.846   -76.663  -26.625  1.00 131.47 ? 779  LYS A CE  1 
ATOM   6101  N  NZ  . LYS A  1  779  ? 9.325   -77.724  -27.529  1.00 144.59 ? 779  LYS A NZ  1 
ATOM   6102  N  N   . ARG A  1  780  ? 12.223  -72.447  -24.035  1.00 84.48  ? 780  ARG A N   1 
ATOM   6103  C  CA  . ARG A  1  780  ? 13.546  -72.780  -23.518  1.00 82.42  ? 780  ARG A CA  1 
ATOM   6104  C  C   . ARG A  1  780  ? 14.321  -73.643  -24.505  1.00 87.75  ? 780  ARG A C   1 
ATOM   6105  O  O   . ARG A  1  780  ? 13.743  -74.483  -25.197  1.00 82.55  ? 780  ARG A O   1 
ATOM   6106  C  CB  . ARG A  1  780  ? 13.433  -73.495  -22.170  1.00 87.80  ? 780  ARG A CB  1 
ATOM   6107  C  CG  . ARG A  1  780  ? 12.952  -74.933  -22.270  1.00 86.28  ? 780  ARG A CG  1 
ATOM   6108  C  CD  . ARG A  1  780  ? 12.110  -75.322  -21.067  1.00 90.89  ? 780  ARG A CD  1 
ATOM   6109  N  NE  . ARG A  1  780  ? 12.934  -75.641  -19.904  1.00 89.75  ? 780  ARG A NE  1 
ATOM   6110  C  CZ  . ARG A  1  780  ? 13.127  -76.872  -19.441  1.00 99.24  ? 780  ARG A CZ  1 
ATOM   6111  N  NH1 . ARG A  1  780  ? 12.554  -77.905  -20.041  1.00 109.57 ? 780  ARG A NH1 1 
ATOM   6112  N  NH2 . ARG A  1  780  ? 13.893  -77.070  -18.375  1.00 98.06  ? 780  ARG A NH2 1 
ATOM   6113  N  N   . ILE A  1  781  ? 15.632  -73.434  -24.568  1.00 80.80  ? 781  ILE A N   1 
ATOM   6114  C  CA  . ILE A  1  781  ? 16.489  -74.194  -25.469  1.00 122.31 ? 781  ILE A CA  1 
ATOM   6115  C  C   . ILE A  1  781  ? 15.721  -75.344  -26.116  1.00 82.35  ? 781  ILE A C   1 
ATOM   6116  O  O   . ILE A  1  781  ? 15.217  -76.232  -25.428  1.00 81.88  ? 781  ILE A O   1 
ATOM   6117  C  CB  . ILE A  1  781  ? 17.721  -74.757  -24.741  1.00 122.03 ? 781  ILE A CB  1 
ATOM   6118  C  CG1 . ILE A  1  781  ? 18.765  -75.238  -25.750  1.00 122.89 ? 781  ILE A CG1 1 
ATOM   6119  C  CG2 . ILE A  1  781  ? 17.318  -75.882  -23.802  1.00 82.46  ? 781  ILE A CG2 1 
ATOM   6120  C  CD1 . ILE A  1  781  ? 18.832  -74.399  -27.007  1.00 116.77 ? 781  ILE A CD1 1 
ATOM   6121  N  N   . PRO A  1  782  ? 15.639  -75.322  -27.442  1.00 81.81  ? 782  PRO A N   1 
ATOM   6122  C  CA  . PRO A  1  782  ? 14.929  -76.367  -28.189  1.00 90.48  ? 782  PRO A CA  1 
ATOM   6123  C  C   . PRO A  1  782  ? 15.755  -77.647  -28.296  1.00 92.84  ? 782  PRO A C   1 
ATOM   6124  O  O   . PRO A  1  782  ? 16.982  -77.597  -28.210  1.00 93.24  ? 782  PRO A O   1 
ATOM   6125  C  CB  . PRO A  1  782  ? 14.749  -75.742  -29.572  1.00 87.80  ? 782  PRO A CB  1 
ATOM   6126  C  CG  . PRO A  1  782  ? 14.717  -74.279  -29.312  1.00 83.65  ? 782  PRO A CG  1 
ATOM   6127  C  CD  . PRO A  1  782  ? 15.663  -74.040  -28.168  1.00 81.75  ? 782  PRO A CD  1 
ATOM   6128  N  N   . PHE A  1  783  ? 15.081  -78.774  -28.485  1.00 102.83 ? 783  PHE A N   1 
ATOM   6129  C  CA  . PHE A  1  783  ? 15.763  -80.071  -28.609  1.00 167.85 ? 783  PHE A CA  1 
ATOM   6130  C  C   . PHE A  1  783  ? 16.366  -80.191  -29.981  1.00 147.74 ? 783  PHE A C   1 
ATOM   6131  O  O   . PHE A  1  783  ? 16.712  -79.198  -30.581  1.00 96.92  ? 783  PHE A O   1 
ATOM   6132  C  CB  . PHE A  1  783  ? 14.799  -81.232  -28.402  1.00 154.79 ? 783  PHE A CB  1 
ATOM   6133  C  CG  . PHE A  1  783  ? 14.301  -81.346  -27.012  1.00 160.25 ? 783  PHE A CG  1 
ATOM   6134  C  CD1 . PHE A  1  783  ? 15.060  -81.971  -26.041  1.00 194.64 ? 783  PHE A CD1 1 
ATOM   6135  C  CD2 . PHE A  1  783  ? 13.074  -80.822  -26.675  1.00 168.03 ? 783  PHE A CD2 1 
ATOM   6136  C  CE1 . PHE A  1  783  ? 14.599  -82.064  -24.755  1.00 184.26 ? 783  PHE A CE1 1 
ATOM   6137  C  CE2 . PHE A  1  783  ? 12.606  -80.915  -25.397  1.00 141.79 ? 783  PHE A CE2 1 
ATOM   6138  C  CZ  . PHE A  1  783  ? 13.369  -81.535  -24.431  1.00 144.42 ? 783  PHE A CZ  1 
ATOM   6139  N  N   . GLY A  1  784  ? 16.479  -81.402  -30.505  1.00 125.03 ? 784  GLY A N   1 
ATOM   6140  C  CA  . GLY A  1  784  ? 17.172  -81.582  -31.766  1.00 136.63 ? 784  GLY A CA  1 
ATOM   6141  C  C   . GLY A  1  784  ? 18.602  -81.133  -31.564  1.00 170.75 ? 784  GLY A C   1 
ATOM   6142  O  O   . GLY A  1  784  ? 18.839  -80.046  -31.061  1.00 109.70 ? 784  GLY A O   1 
ATOM   6143  N  N   . PHE A  1  785  ? 19.558  -81.969  -31.913  1.00 89.04  ? 785  PHE A N   1 
ATOM   6144  C  CA  . PHE A  1  785  ? 19.310  -83.267  -32.514  1.00 111.92 ? 785  PHE A CA  1 
ATOM   6145  C  C   . PHE A  1  785  ? 18.643  -84.290  -31.583  1.00 153.19 ? 785  PHE A C   1 
ATOM   6146  O  O   . PHE A  1  785  ? 18.703  -84.182  -30.344  1.00 118.57 ? 785  PHE A O   1 
ATOM   6147  C  CB  . PHE A  1  785  ? 20.624  -83.842  -33.046  1.00 100.88 ? 785  PHE A CB  1 
ATOM   6148  C  CG  . PHE A  1  785  ? 21.803  -83.602  -32.138  1.00 94.66  ? 785  PHE A CG  1 
ATOM   6149  C  CD1 . PHE A  1  785  ? 22.124  -82.330  -31.703  1.00 121.01 ? 785  PHE A CD1 1 
ATOM   6150  C  CD2 . PHE A  1  785  ? 22.600  -84.646  -31.737  1.00 119.88 ? 785  PHE A CD2 1 
ATOM   6151  C  CE1 . PHE A  1  785  ? 23.196  -82.117  -30.885  1.00 88.29  ? 785  PHE A CE1 1 
ATOM   6152  C  CE2 . PHE A  1  785  ? 23.684  -84.415  -30.911  1.00 114.62 ? 785  PHE A CE2 1 
ATOM   6153  C  CZ  . PHE A  1  785  ? 23.974  -83.151  -30.490  1.00 128.39 ? 785  PHE A CZ  1 
ATOM   6154  N  N   . LYS A  1  786  ? 18.003  -85.281  -32.212  1.00 91.09  ? 786  LYS A N   1 
ATOM   6155  C  CA  . LYS A  1  786  ? 17.280  -86.349  -31.518  1.00 102.85 ? 786  LYS A CA  1 
ATOM   6156  C  C   . LYS A  1  786  ? 16.312  -85.858  -30.427  1.00 140.99 ? 786  LYS A C   1 
ATOM   6157  O  O   . LYS A  1  786  ? 15.636  -84.855  -30.588  1.00 104.26 ? 786  LYS A O   1 
ATOM   6158  C  CB  . LYS A  1  786  ? 18.272  -87.381  -30.966  1.00 149.67 ? 786  LYS A CB  1 
ATOM   6159  C  CG  . LYS A  1  786  ? 17.707  -88.799  -30.909  1.00 199.41 ? 786  LYS A CG  1 
ATOM   6160  C  CD  . LYS A  1  786  ? 17.217  -89.264  -32.281  1.00 219.32 ? 786  LYS A CD  1 
ATOM   6161  C  CE  . LYS A  1  786  ? 16.627  -90.677  -32.249  1.00 246.28 ? 786  LYS A CE  1 
ATOM   6162  N  NZ  . LYS A  1  786  ? 16.089  -91.089  -33.578  1.00 244.80 ? 786  LYS A NZ  1 
ATOM   6163  N  N   . TYR A  1  787  ? 16.219  -86.577  -29.326  1.00 89.52  ? 787  TYR A N   1 
ATOM   6164  C  CA  . TYR A  1  787  ? 15.324  -86.163  -28.278  1.00 132.16 ? 787  TYR A CA  1 
ATOM   6165  C  C   . TYR A  1  787  ? 16.178  -85.701  -27.110  1.00 120.33 ? 787  TYR A C   1 
ATOM   6166  O  O   . TYR A  1  787  ? 16.150  -86.298  -26.034  1.00 88.18  ? 787  TYR A O   1 
ATOM   6167  C  CB  . TYR A  1  787  ? 14.415  -87.318  -27.860  1.00 142.71 ? 787  TYR A CB  1 
ATOM   6168  C  CG  . TYR A  1  787  ? 13.331  -87.701  -28.864  1.00 145.87 ? 787  TYR A CG  1 
ATOM   6169  C  CD1 . TYR A  1  787  ? 11.982  -87.530  -28.562  1.00 116.15 ? 787  TYR A CD1 1 
ATOM   6170  C  CD2 . TYR A  1  787  ? 13.655  -88.247  -30.106  1.00 150.17 ? 787  TYR A CD2 1 
ATOM   6171  C  CE1 . TYR A  1  787  ? 10.990  -87.877  -29.471  1.00 128.04 ? 787  TYR A CE1 1 
ATOM   6172  C  CE2 . TYR A  1  787  ? 12.670  -88.602  -31.028  1.00 158.86 ? 787  TYR A CE2 1 
ATOM   6173  C  CZ  . TYR A  1  787  ? 11.339  -88.414  -30.703  1.00 153.49 ? 787  TYR A CZ  1 
ATOM   6174  O  OH  . TYR A  1  787  ? 10.362  -88.761  -31.618  1.00 201.96 ? 787  TYR A OH  1 
ATOM   6175  N  N   . ARG A  1  788  ? 16.929  -84.628  -27.321  1.00 89.15  ? 788  ARG A N   1 
ATOM   6176  C  CA  . ARG A  1  788  ? 17.891  -84.168  -26.329  1.00 87.83  ? 788  ARG A CA  1 
ATOM   6177  C  C   . ARG A  1  788  ? 18.432  -82.803  -26.728  1.00 86.74  ? 788  ARG A C   1 
ATOM   6178  O  O   . ARG A  1  788  ? 18.518  -82.479  -27.911  1.00 87.19  ? 788  ARG A O   1 
ATOM   6179  C  CB  . ARG A  1  788  ? 19.041  -85.165  -26.220  1.00 92.20  ? 788  ARG A CB  1 
ATOM   6180  C  CG  . ARG A  1  788  ? 19.731  -85.391  -27.544  1.00 86.79  ? 788  ARG A CG  1 
ATOM   6181  C  CD  . ARG A  1  788  ? 20.511  -86.690  -27.591  1.00 91.96  ? 788  ARG A CD  1 
ATOM   6182  N  NE  . ARG A  1  788  ? 21.605  -86.714  -26.628  1.00 88.18  ? 788  ARG A NE  1 
ATOM   6183  C  CZ  . ARG A  1  788  ? 22.742  -87.376  -26.829  1.00 90.89  ? 788  ARG A CZ  1 
ATOM   6184  N  NH1 . ARG A  1  788  ? 22.938  -88.035  -27.968  1.00 104.93 ? 788  ARG A NH1 1 
ATOM   6185  N  NH2 . ARG A  1  788  ? 23.689  -87.381  -25.907  1.00 87.75  ? 788  ARG A NH2 1 
ATOM   6186  N  N   . THR A  1  789  ? 18.793  -82.015  -25.732  1.00 86.78  ? 789  THR A N   1 
ATOM   6187  C  CA  . THR A  1  789  ? 19.297  -80.669  -25.954  1.00 89.03  ? 789  THR A CA  1 
ATOM   6188  C  C   . THR A  1  789  ? 20.697  -80.689  -26.552  1.00 87.77  ? 789  THR A C   1 
ATOM   6189  O  O   . THR A  1  789  ? 21.023  -79.889  -27.413  1.00 85.45  ? 789  THR A O   1 
ATOM   6190  C  CB  . THR A  1  789  ? 19.287  -79.868  -24.626  1.00 88.75  ? 789  THR A CB  1 
ATOM   6191  O  OG1 . THR A  1  789  ? 19.526  -78.495  -24.895  1.00 82.39  ? 789  THR A OG1 1 
ATOM   6192  C  CG2 . THR A  1  789  ? 20.330  -80.370  -23.641  1.00 86.74  ? 789  THR A CG2 1 
ATOM   6193  N  N   . LEU A  1  790  ? 21.497  -81.650  -26.101  1.00 86.18  ? 790  LEU A N   1 
ATOM   6194  C  CA  . LEU A  1  790  ? 22.912  -81.749  -26.442  1.00 87.16  ? 790  LEU A CA  1 
ATOM   6195  C  C   . LEU A  1  790  ? 23.455  -83.151  -26.095  1.00 86.67  ? 790  LEU A C   1 
ATOM   6196  O  O   . LEU A  1  790  ? 22.802  -83.904  -25.372  1.00 85.21  ? 790  LEU A O   1 
ATOM   6197  C  CB  . LEU A  1  790  ? 23.692  -80.698  -25.671  1.00 85.42  ? 790  LEU A CB  1 
ATOM   6198  C  CG  . LEU A  1  790  ? 23.699  -79.311  -26.257  1.00 84.04  ? 790  LEU A CG  1 
ATOM   6199  C  CD1 . LEU A  1  790  ? 24.556  -78.446  -25.383  1.00 85.45  ? 790  LEU A CD1 1 
ATOM   6200  C  CD2 . LEU A  1  790  ? 24.232  -79.367  -27.661  1.00 82.52  ? 790  LEU A CD2 1 
ATOM   6201  N  N   . PRO A  1  791  ? 24.647  -83.502  -26.608  1.00 85.10  ? 791  PRO A N   1 
ATOM   6202  C  CA  . PRO A  1  791  ? 25.219  -84.834  -26.383  1.00 87.94  ? 791  PRO A CA  1 
ATOM   6203  C  C   . PRO A  1  791  ? 25.922  -84.987  -25.028  1.00 87.87  ? 791  PRO A C   1 
ATOM   6204  O  O   . PRO A  1  791  ? 26.802  -85.842  -24.913  1.00 90.25  ? 791  PRO A O   1 
ATOM   6205  C  CB  . PRO A  1  791  ? 26.262  -84.963  -27.501  1.00 86.18  ? 791  PRO A CB  1 
ATOM   6206  C  CG  . PRO A  1  791  ? 26.023  -83.805  -28.416  1.00 86.14  ? 791  PRO A CG  1 
ATOM   6207  C  CD  . PRO A  1  791  ? 25.461  -82.727  -27.550  1.00 84.84  ? 791  PRO A CD  1 
ATOM   6208  N  N   . HIS A  1  792  ? 25.557  -84.185  -24.031  1.00 84.24  ? 792  HIS A N   1 
ATOM   6209  C  CA  . HIS A  1  792  ? 26.119  -84.352  -22.703  1.00 84.31  ? 792  HIS A CA  1 
ATOM   6210  C  C   . HIS A  1  792  ? 24.946  -84.574  -21.801  1.00 87.78  ? 792  HIS A C   1 
ATOM   6211  O  O   . HIS A  1  792  ? 25.020  -84.384  -20.602  1.00 84.53  ? 792  HIS A O   1 
ATOM   6212  C  CB  . HIS A  1  792  ? 26.897  -83.111  -22.297  1.00 87.97  ? 792  HIS A CB  1 
ATOM   6213  C  CG  . HIS A  1  792  ? 27.752  -82.551  -23.398  1.00 86.19  ? 792  HIS A CG  1 
ATOM   6214  N  ND1 . HIS A  1  792  ? 27.206  -82.013  -24.549  1.00 86.33  ? 792  HIS A ND1 1 
ATOM   6215  C  CD2 . HIS A  1  792  ? 29.085  -82.457  -23.531  1.00 87.04  ? 792  HIS A CD2 1 
ATOM   6216  C  CE1 . HIS A  1  792  ? 28.184  -81.629  -25.344  1.00 86.30  ? 792  HIS A CE1 1 
ATOM   6217  N  NE2 . HIS A  1  792  ? 29.336  -81.871  -24.749  1.00 86.60  ? 792  HIS A NE2 1 
ATOM   6218  N  N   . PHE A  1  793  ? 23.844  -84.978  -22.403  1.00 87.26  ? 793  PHE A N   1 
ATOM   6219  C  CA  . PHE A  1  793  ? 22.631  -85.214  -21.652  1.00 84.98  ? 793  PHE A CA  1 
ATOM   6220  C  C   . PHE A  1  793  ? 21.860  -86.469  -22.105  1.00 86.25  ? 793  PHE A C   1 
ATOM   6221  O  O   . PHE A  1  793  ? 21.936  -86.870  -23.267  1.00 92.07  ? 793  PHE A O   1 
ATOM   6222  C  CB  . PHE A  1  793  ? 21.737  -83.961  -21.701  1.00 85.39  ? 793  PHE A CB  1 
ATOM   6223  C  CG  . PHE A  1  793  ? 22.381  -82.733  -21.109  1.00 83.77  ? 793  PHE A CG  1 
ATOM   6224  C  CD1 . PHE A  1  793  ? 22.914  -82.750  -19.814  1.00 87.72  ? 793  PHE A CD1 1 
ATOM   6225  C  CD2 . PHE A  1  793  ? 22.466  -81.567  -21.836  1.00 84.38  ? 793  PHE A CD2 1 
ATOM   6226  C  CE1 . PHE A  1  793  ? 23.530  -81.614  -19.253  1.00 84.59  ? 793  PHE A CE1 1 
ATOM   6227  C  CE2 . PHE A  1  793  ? 23.072  -80.430  -21.293  1.00 83.67  ? 793  PHE A CE2 1 
ATOM   6228  C  CZ  . PHE A  1  793  ? 23.608  -80.453  -19.999  1.00 82.75  ? 793  PHE A CZ  1 
ATOM   6229  N  N   . PRO A  1  794  ? 21.118  -87.092  -21.169  1.00 89.58  ? 794  PRO A N   1 
ATOM   6230  C  CA  . PRO A  1  794  ? 20.215  -88.201  -21.450  1.00 87.49  ? 794  PRO A CA  1 
ATOM   6231  C  C   . PRO A  1  794  ? 19.268  -87.798  -22.529  1.00 95.24  ? 794  PRO A C   1 
ATOM   6232  O  O   . PRO A  1  794  ? 19.583  -87.004  -23.411  1.00 95.54  ? 794  PRO A O   1 
ATOM   6233  C  CB  . PRO A  1  794  ? 19.393  -88.326  -20.171  1.00 92.48  ? 794  PRO A CB  1 
ATOM   6234  C  CG  . PRO A  1  794  ? 20.203  -87.718  -19.102  1.00 89.68  ? 794  PRO A CG  1 
ATOM   6235  C  CD  . PRO A  1  794  ? 21.028  -86.654  -19.762  1.00 92.68  ? 794  PRO A CD  1 
ATOM   6236  N  N   . LYS A  1  795  ? 18.074  -88.357  -22.440  1.00 93.15  ? 795  LYS A N   1 
ATOM   6237  C  CA  . LYS A  1  795  ? 17.021  -88.060  -23.387  1.00 93.36  ? 795  LYS A CA  1 
ATOM   6238  C  C   . LYS A  1  795  ? 15.784  -87.734  -22.582  1.00 92.01  ? 795  LYS A C   1 
ATOM   6239  O  O   . LYS A  1  795  ? 15.545  -88.332  -21.530  1.00 102.86 ? 795  LYS A O   1 
ATOM   6240  C  CB  . LYS A  1  795  ? 16.730  -89.287  -24.249  1.00 97.89  ? 795  LYS A CB  1 
ATOM   6241  C  CG  . LYS A  1  795  ? 17.957  -90.088  -24.628  1.00 101.87 ? 795  LYS A CG  1 
ATOM   6242  C  CD  . LYS A  1  795  ? 18.355  -89.841  -26.066  1.00 115.21 ? 795  LYS A CD  1 
ATOM   6243  C  CE  . LYS A  1  795  ? 17.520  -90.648  -27.029  1.00 90.07  ? 795  LYS A CE  1 
ATOM   6244  N  NZ  . LYS A  1  795  ? 18.050  -90.561  -28.405  1.00 90.73  ? 795  LYS A NZ  1 
ATOM   6245  N  N   . ASP A  1  796  ? 14.983  -86.805  -23.084  1.00 91.16  ? 796  ASP A N   1 
ATOM   6246  C  CA  . ASP A  1  796  ? 13.817  -86.342  -22.349  1.00 123.66 ? 796  ASP A CA  1 
ATOM   6247  C  C   . ASP A  1  796  ? 14.263  -85.650  -21.049  1.00 116.86 ? 796  ASP A C   1 
ATOM   6248  O  O   . ASP A  1  796  ? 13.633  -85.813  -20.004  1.00 123.16 ? 796  ASP A O   1 
ATOM   6249  C  CB  . ASP A  1  796  ? 12.838  -87.497  -22.072  1.00 146.00 ? 796  ASP A CB  1 
ATOM   6250  C  CG  . ASP A  1  796  ? 12.323  -88.158  -23.356  1.00 170.07 ? 796  ASP A CG  1 
ATOM   6251  O  OD1 . ASP A  1  796  ? 12.940  -87.970  -24.423  1.00 107.51 ? 796  ASP A OD1 1 
ATOM   6252  O  OD2 . ASP A  1  796  ? 11.299  -88.869  -23.306  1.00 133.50 ? 796  ASP A OD2 1 
ATOM   6253  N  N   . ASP A  1  797  ? 15.346  -84.885  -21.131  1.00 139.87 ? 797  ASP A N   1 
ATOM   6254  C  CA  . ASP A  1  797  ? 15.872  -84.174  -19.971  1.00 173.66 ? 797  ASP A CA  1 
ATOM   6255  C  C   . ASP A  1  797  ? 15.234  -82.795  -19.834  1.00 132.03 ? 797  ASP A C   1 
ATOM   6256  O  O   . ASP A  1  797  ? 15.911  -81.774  -19.957  1.00 94.92  ? 797  ASP A O   1 
ATOM   6257  C  CB  . ASP A  1  797  ? 17.393  -84.043  -20.068  1.00 119.86 ? 797  ASP A CB  1 
ATOM   6258  C  CG  . ASP A  1  797  ? 18.041  -83.777  -18.723  1.00 104.21 ? 797  ASP A CG  1 
ATOM   6259  O  OD1 . ASP A  1  797  ? 17.304  -83.628  -17.726  1.00 135.82 ? 797  ASP A OD1 1 
ATOM   6260  O  OD2 . ASP A  1  797  ? 19.287  -83.714  -18.663  1.00 112.86 ? 797  ASP A OD2 1 
ATOM   6261  N  N   . ASP A  1  798  ? 13.930  -82.774  -19.579  1.00 118.21 ? 798  ASP A N   1 
ATOM   6262  C  CA  . ASP A  1  798  ? 13.200  -81.521  -19.426  1.00 114.56 ? 798  ASP A CA  1 
ATOM   6263  C  C   . ASP A  1  798  ? 13.570  -80.824  -18.121  1.00 106.46 ? 798  ASP A C   1 
ATOM   6264  O  O   . ASP A  1  798  ? 12.699  -80.352  -17.390  1.00 119.39 ? 798  ASP A O   1 
ATOM   6265  C  CB  . ASP A  1  798  ? 11.692  -81.770  -19.481  1.00 188.32 ? 798  ASP A CB  1 
ATOM   6266  C  CG  . ASP A  1  798  ? 11.229  -82.249  -20.843  1.00 143.96 ? 798  ASP A CG  1 
ATOM   6267  O  OD1 . ASP A  1  798  ? 10.007  -82.427  -21.027  1.00 156.63 ? 798  ASP A OD1 1 
ATOM   6268  O  OD2 . ASP A  1  798  ? 12.088  -82.447  -21.728  1.00 151.51 ? 798  ASP A OD2 1 
ATOM   6269  N  N   . SER A  1  799  ? 14.867  -80.762  -17.834  1.00 130.40 ? 799  SER A N   1 
ATOM   6270  C  CA  . SER A  1  799  ? 15.353  -80.125  -16.618  1.00 125.60 ? 799  SER A CA  1 
ATOM   6271  C  C   . SER A  1  799  ? 16.219  -78.911  -16.939  1.00 137.07 ? 799  SER A C   1 
ATOM   6272  O  O   . SER A  1  799  ? 16.882  -78.868  -17.976  1.00 113.88 ? 799  SER A O   1 
ATOM   6273  C  CB  . SER A  1  799  ? 16.142  -81.121  -15.766  1.00 131.06 ? 799  SER A CB  1 
ATOM   6274  O  OG  . SER A  1  799  ? 17.409  -81.392  -16.341  1.00 130.28 ? 799  SER A OG  1 
ATOM   6275  N  N   . PRO A  1  800  ? 16.209  -77.928  -16.045  1.00 84.51  ? 800  PRO A N   1 
ATOM   6276  C  CA  . PRO A  1  800  ? 16.996  -76.706  -16.235  1.00 84.68  ? 800  PRO A CA  1 
ATOM   6277  C  C   . PRO A  1  800  ? 18.495  -76.987  -16.197  1.00 83.07  ? 800  PRO A C   1 
ATOM   6278  O  O   . PRO A  1  800  ? 19.260  -76.344  -16.915  1.00 81.50  ? 800  PRO A O   1 
ATOM   6279  C  CB  . PRO A  1  800  ? 16.593  -75.846  -15.036  1.00 81.34  ? 800  PRO A CB  1 
ATOM   6280  C  CG  . PRO A  1  800  ? 15.215  -76.298  -14.703  1.00 83.91  ? 800  PRO A CG  1 
ATOM   6281  C  CD  . PRO A  1  800  ? 15.185  -77.770  -14.998  1.00 82.94  ? 800  PRO A CD  1 
ATOM   6282  N  N   . GLU A  1  801  ? 18.903  -77.939  -15.364  1.00 162.05 ? 801  GLU A N   1 
ATOM   6283  C  CA  . GLU A  1  801  ? 20.311  -78.298  -15.242  1.00 121.69 ? 801  GLU A CA  1 
ATOM   6284  C  C   . GLU A  1  801  ? 20.929  -78.586  -16.605  1.00 116.50 ? 801  GLU A C   1 
ATOM   6285  O  O   . GLU A  1  801  ? 22.098  -78.960  -16.701  1.00 114.47 ? 801  GLU A O   1 
ATOM   6286  C  CB  . GLU A  1  801  ? 20.476  -79.510  -14.322  1.00 182.70 ? 801  GLU A CB  1 
ATOM   6287  C  CG  . GLU A  1  801  ? 19.259  -79.808  -13.462  1.00 214.49 ? 801  GLU A CG  1 
ATOM   6288  C  CD  . GLU A  1  801  ? 19.299  -81.197  -12.857  1.00 235.56 ? 801  GLU A CD  1 
ATOM   6289  O  OE1 . GLU A  1  801  ? 19.690  -82.146  -13.568  1.00 240.60 ? 801  GLU A OE1 1 
ATOM   6290  O  OE2 . GLU A  1  801  ? 18.939  -81.340  -11.669  1.00 214.16 ? 801  GLU A OE2 1 
ATOM   6291  N  N   . SER A  1  802  ? 20.136  -78.411  -17.657  1.00 86.17  ? 802  SER A N   1 
ATOM   6292  C  CA  . SER A  1  802  ? 20.604  -78.653  -19.017  1.00 81.38  ? 802  SER A CA  1 
ATOM   6293  C  C   . SER A  1  802  ? 20.014  -77.639  -19.991  1.00 83.76  ? 802  SER A C   1 
ATOM   6294  O  O   . SER A  1  802  ? 20.723  -76.776  -20.510  1.00 81.39  ? 802  SER A O   1 
ATOM   6295  C  CB  . SER A  1  802  ? 20.252  -80.075  -19.460  1.00 82.36  ? 802  SER A CB  1 
ATOM   6296  O  OG  . SER A  1  802  ? 19.327  -80.059  -20.533  1.00 82.26  ? 802  SER A OG  1 
ATOM   6297  N  N   . ARG A  1  803  ? 18.712  -77.748  -20.234  1.00 112.39 ? 803  ARG A N   1 
ATOM   6298  C  CA  . ARG A  1  803  ? 18.024  -76.842  -21.146  1.00 101.59 ? 803  ARG A CA  1 
ATOM   6299  C  C   . ARG A  1  803  ? 18.223  -75.387  -20.733  1.00 83.18  ? 803  ARG A C   1 
ATOM   6300  O  O   . ARG A  1  803  ? 17.807  -74.978  -19.649  1.00 81.71  ? 803  ARG A O   1 
ATOM   6301  C  CB  . ARG A  1  803  ? 16.531  -77.172  -21.205  1.00 105.19 ? 803  ARG A CB  1 
ATOM   6302  C  CG  . ARG A  1  803  ? 16.204  -78.425  -22.002  1.00 89.17  ? 803  ARG A CG  1 
ATOM   6303  C  CD  . ARG A  1  803  ? 14.940  -78.239  -22.826  1.00 97.24  ? 803  ARG A CD  1 
ATOM   6304  N  NE  . ARG A  1  803  ? 13.736  -78.536  -22.055  1.00 108.97 ? 803  ARG A NE  1 
ATOM   6305  C  CZ  . ARG A  1  803  ? 12.541  -78.758  -22.593  1.00 94.52  ? 803  ARG A CZ  1 
ATOM   6306  N  NH1 . ARG A  1  803  ? 12.385  -78.717  -23.909  1.00 111.30 ? 803  ARG A NH1 1 
ATOM   6307  N  NH2 . ARG A  1  803  ? 11.500  -79.021  -21.814  1.00 133.30 ? 803  ARG A NH2 1 
ATOM   6308  N  N   . GLY A  1  804  ? 18.861  -74.612  -21.603  1.00 125.49 ? 804  GLY A N   1 
ATOM   6309  C  CA  . GLY A  1  804  ? 19.115  -73.209  -21.331  1.00 103.42 ? 804  GLY A CA  1 
ATOM   6310  C  C   . GLY A  1  804  ? 18.702  -72.806  -19.929  1.00 92.70  ? 804  GLY A C   1 
ATOM   6311  O  O   . GLY A  1  804  ? 17.514  -72.697  -19.629  1.00 141.25 ? 804  GLY A O   1 
ATOM   6312  N  N   . PHE A  1  805  ? 19.691  -72.584  -19.068  1.00 80.82  ? 805  PHE A N   1 
ATOM   6313  C  CA  . PHE A  1  805  ? 19.430  -72.189  -17.689  1.00 80.64  ? 805  PHE A CA  1 
ATOM   6314  C  C   . PHE A  1  805  ? 20.704  -72.238  -16.851  1.00 81.21  ? 805  PHE A C   1 
ATOM   6315  O  O   . PHE A  1  805  ? 21.111  -73.302  -16.385  1.00 82.21  ? 805  PHE A O   1 
ATOM   6316  C  CB  . PHE A  1  805  ? 18.358  -73.087  -17.068  1.00 82.90  ? 805  PHE A CB  1 
ATOM   6317  C  CG  . PHE A  1  805  ? 17.913  -72.645  -15.703  1.00 82.63  ? 805  PHE A CG  1 
ATOM   6318  C  CD1 . PHE A  1  805  ? 16.593  -72.295  -15.470  1.00 83.22  ? 805  PHE A CD1 1 
ATOM   6319  C  CD2 . PHE A  1  805  ? 18.814  -72.580  -14.654  1.00 82.97  ? 805  PHE A CD2 1 
ATOM   6320  C  CE1 . PHE A  1  805  ? 16.181  -71.888  -14.215  1.00 83.46  ? 805  PHE A CE1 1 
ATOM   6321  C  CE2 . PHE A  1  805  ? 18.408  -72.174  -13.397  1.00 82.50  ? 805  PHE A CE2 1 
ATOM   6322  C  CZ  . PHE A  1  805  ? 17.089  -71.828  -13.178  1.00 83.05  ? 805  PHE A CZ  1 
ATOM   6323  N  N   . ILE A  1  806  ? 21.327  -71.080  -16.664  1.00 98.56  ? 806  ILE A N   1 
ATOM   6324  C  CA  . ILE A  1  806  ? 22.555  -70.989  -15.882  1.00 93.08  ? 806  ILE A CA  1 
ATOM   6325  C  C   . ILE A  1  806  ? 22.253  -70.716  -14.412  1.00 113.30 ? 806  ILE A C   1 
ATOM   6326  O  O   . ILE A  1  806  ? 21.228  -70.122  -14.079  1.00 101.24 ? 806  ILE A O   1 
ATOM   6327  C  CB  . ILE A  1  806  ? 23.485  -69.885  -16.419  1.00 88.64  ? 806  ILE A CB  1 
ATOM   6328  C  CG1 . ILE A  1  806  ? 24.010  -70.259  -17.806  1.00 85.61  ? 806  ILE A CG1 1 
ATOM   6329  C  CG2 . ILE A  1  806  ? 24.636  -69.644  -15.455  1.00 96.24  ? 806  ILE A CG2 1 
ATOM   6330  C  CD1 . ILE A  1  806  ? 24.764  -69.141  -18.495  1.00 87.65  ? 806  ILE A CD1 1 
ATOM   6331  N  N   . GLU A  1  807  ? 23.152  -71.154  -13.537  1.00 114.99 ? 807  GLU A N   1 
ATOM   6332  C  CA  . GLU A  1  807  ? 22.984  -70.960  -12.102  1.00 114.86 ? 807  GLU A CA  1 
ATOM   6333  C  C   . GLU A  1  807  ? 23.990  -69.950  -11.561  1.00 107.31 ? 807  GLU A C   1 
ATOM   6334  O  O   . GLU A  1  807  ? 23.808  -69.397  -10.476  1.00 83.39  ? 807  GLU A O   1 
ATOM   6335  C  CB  . GLU A  1  807  ? 23.123  -72.291  -11.361  1.00 112.21 ? 807  GLU A CB  1 
ATOM   6336  C  CG  . GLU A  1  807  ? 21.839  -72.772  -10.703  1.00 149.39 ? 807  GLU A CG  1 
ATOM   6337  C  CD  . GLU A  1  807  ? 22.077  -73.898  -9.718   1.00 108.13 ? 807  GLU A CD  1 
ATOM   6338  O  OE1 . GLU A  1  807  ? 23.248  -74.135  -9.354   1.00 159.88 ? 807  GLU A OE1 1 
ATOM   6339  O  OE2 . GLU A  1  807  ? 21.093  -74.548  -9.306   1.00 134.53 ? 807  GLU A OE2 1 
ATOM   6340  N  N   . ASN A  1  808  ? 25.053  -69.715  -12.323  1.00 96.39  ? 808  ASN A N   1 
ATOM   6341  C  CA  . ASN A  1  808  ? 26.092  -68.773  -11.921  1.00 116.35 ? 808  ASN A CA  1 
ATOM   6342  C  C   . ASN A  1  808  ? 26.058  -67.491  -12.746  1.00 78.12  ? 808  ASN A C   1 
ATOM   6343  O  O   . ASN A  1  808  ? 25.381  -67.420  -13.771  1.00 79.50  ? 808  ASN A O   1 
ATOM   6344  C  CB  . ASN A  1  808  ? 27.472  -69.423  -12.017  1.00 104.86 ? 808  ASN A CB  1 
ATOM   6345  C  CG  . ASN A  1  808  ? 27.553  -70.734  -11.259  1.00 109.70 ? 808  ASN A CG  1 
ATOM   6346  O  OD1 . ASN A  1  808  ? 27.933  -71.764  -11.816  1.00 116.90 ? 808  ASN A OD1 1 
ATOM   6347  N  ND2 . ASN A  1  808  ? 27.196  -70.701  -9.980   1.00 102.12 ? 808  ASN A ND2 1 
ATOM   6348  N  N   . SER A  1  809  ? 26.805  -66.477  -12.297  1.00 78.84  ? 809  SER A N   1 
ATOM   6349  C  CA  . SER A  1  809  ? 26.860  -65.197  -12.992  1.00 75.49  ? 809  SER A CA  1 
ATOM   6350  C  C   . SER A  1  809  ? 28.233  -64.965  -13.613  1.00 77.58  ? 809  SER A C   1 
ATOM   6351  O  O   . SER A  1  809  ? 29.170  -65.728  -13.377  1.00 77.25  ? 809  SER A O   1 
ATOM   6352  C  CB  . SER A  1  809  ? 26.515  -64.053  -12.035  1.00 77.44  ? 809  SER A CB  1 
ATOM   6353  O  OG  . SER A  1  809  ? 27.640  -63.681  -11.259  1.00 76.06  ? 809  SER A OG  1 
ATOM   6354  N  N   . TYR A  1  810  ? 28.347  -63.905  -14.407  1.00 78.13  ? 810  TYR A N   1 
ATOM   6355  C  CA  . TYR A  1  810  ? 29.605  -63.571  -15.064  1.00 78.22  ? 810  TYR A CA  1 
ATOM   6356  C  C   . TYR A  1  810  ? 30.701  -63.287  -14.042  1.00 77.09  ? 810  TYR A C   1 
ATOM   6357  O  O   . TYR A  1  810  ? 31.486  -62.353  -14.202  1.00 74.41  ? 810  TYR A O   1 
ATOM   6358  C  CB  . TYR A  1  810  ? 29.423  -62.366  -15.988  1.00 78.14  ? 810  TYR A CB  1 
ATOM   6359  C  CG  . TYR A  1  810  ? 28.178  -62.432  -16.844  1.00 80.25  ? 810  TYR A CG  1 
ATOM   6360  C  CD1 . TYR A  1  810  ? 26.926  -62.166  -16.305  1.00 78.02  ? 810  TYR A CD1 1 
ATOM   6361  C  CD2 . TYR A  1  810  ? 28.255  -62.761  -18.190  1.00 75.55  ? 810  TYR A CD2 1 
ATOM   6362  C  CE1 . TYR A  1  810  ? 25.786  -62.225  -17.083  1.00 75.93  ? 810  TYR A CE1 1 
ATOM   6363  C  CE2 . TYR A  1  810  ? 27.120  -62.823  -18.977  1.00 80.36  ? 810  TYR A CE2 1 
ATOM   6364  C  CZ  . TYR A  1  810  ? 25.888  -62.555  -18.418  1.00 77.37  ? 810  TYR A CZ  1 
ATOM   6365  O  OH  . TYR A  1  810  ? 24.756  -62.615  -19.197  1.00 73.93  ? 810  TYR A OH  1 
ATOM   6366  N  N   . LEU A  1  811  ? 30.748  -64.099  -12.991  1.00 77.44  ? 811  LEU A N   1 
ATOM   6367  C  CA  . LEU A  1  811  ? 31.747  -63.937  -11.942  1.00 76.05  ? 811  LEU A CA  1 
ATOM   6368  C  C   . LEU A  1  811  ? 32.513  -65.235  -11.703  1.00 77.24  ? 811  LEU A C   1 
ATOM   6369  O  O   . LEU A  1  811  ? 33.734  -65.228  -11.547  1.00 81.03  ? 811  LEU A O   1 
ATOM   6370  C  CB  . LEU A  1  811  ? 31.089  -63.469  -10.643  1.00 74.82  ? 811  LEU A CB  1 
ATOM   6371  C  CG  . LEU A  1  811  ? 31.314  -62.005  -10.258  1.00 76.27  ? 811  LEU A CG  1 
ATOM   6372  C  CD1 . LEU A  1  811  ? 30.508  -61.644  -9.019   1.00 78.35  ? 811  LEU A CD1 1 
ATOM   6373  C  CD2 . LEU A  1  811  ? 32.793  -61.727  -10.040  1.00 73.65  ? 811  LEU A CD2 1 
ATOM   6374  N  N   . ARG A  1  812  ? 31.786  -66.347  -11.678  1.00 105.32 ? 812  ARG A N   1 
ATOM   6375  C  CA  . ARG A  1  812  ? 32.394  -67.654  -11.458  1.00 182.08 ? 812  ARG A CA  1 
ATOM   6376  C  C   . ARG A  1  812  ? 33.039  -68.184  -12.735  1.00 218.51 ? 812  ARG A C   1 
ATOM   6377  O  O   . ARG A  1  812  ? 34.213  -68.551  -12.742  1.00 246.52 ? 812  ARG A O   1 
ATOM   6378  C  CB  . ARG A  1  812  ? 31.354  -68.650  -10.943  1.00 193.56 ? 812  ARG A CB  1 
ATOM   6379  C  CG  . ARG A  1  812  ? 30.567  -68.158  -9.739   1.00 151.30 ? 812  ARG A CG  1 
ATOM   6380  C  CD  . ARG A  1  812  ? 30.164  -69.311  -8.834   1.00 154.96 ? 812  ARG A CD  1 
ATOM   6381  N  NE  . ARG A  1  812  ? 30.158  -68.925  -7.426   1.00 128.62 ? 812  ARG A NE  1 
ATOM   6382  C  CZ  . ARG A  1  812  ? 29.448  -69.539  -6.486   1.00 126.77 ? 812  ARG A CZ  1 
ATOM   6383  N  NH1 . ARG A  1  812  ? 28.681  -70.574  -6.801   1.00 156.05 ? 812  ARG A NH1 1 
ATOM   6384  N  NH2 . ARG A  1  812  ? 29.503  -69.119  -5.229   1.00 101.58 ? 812  ARG A NH2 1 
ATOM   6385  N  N   . GLY A  1  813  ? 32.262  -68.219  -13.813  1.00 104.46 ? 813  GLY A N   1 
ATOM   6386  C  CA  . GLY A  1  813  ? 30.881  -67.779  -13.772  1.00 97.77  ? 813  GLY A CA  1 
ATOM   6387  C  C   . GLY A  1  813  ? 29.951  -68.713  -14.522  1.00 99.78  ? 813  GLY A C   1 
ATOM   6388  O  O   . GLY A  1  813  ? 29.000  -69.247  -13.952  1.00 149.54 ? 813  GLY A O   1 
ATOM   6389  N  N   . LEU A  1  814  ? 30.229  -68.909  -15.807  1.00 83.90  ? 814  LEU A N   1 
ATOM   6390  C  CA  . LEU A  1  814  ? 29.414  -69.785  -16.641  1.00 82.15  ? 814  LEU A CA  1 
ATOM   6391  C  C   . LEU A  1  814  ? 30.126  -71.107  -16.911  1.00 96.82  ? 814  LEU A C   1 
ATOM   6392  O  O   . LEU A  1  814  ? 31.353  -71.159  -16.988  1.00 104.38 ? 814  LEU A O   1 
ATOM   6393  C  CB  . LEU A  1  814  ? 29.068  -69.096  -17.962  1.00 82.00  ? 814  LEU A CB  1 
ATOM   6394  C  CG  . LEU A  1  814  ? 27.676  -68.468  -18.054  1.00 87.43  ? 814  LEU A CG  1 
ATOM   6395  C  CD1 . LEU A  1  814  ? 27.692  -67.043  -17.520  1.00 84.36  ? 814  LEU A CD1 1 
ATOM   6396  C  CD2 . LEU A  1  814  ? 27.164  -68.502  -19.485  1.00 91.79  ? 814  LEU A CD2 1 
ATOM   6397  N  N   . THR A  1  815  ? 29.346  -72.174  -17.052  1.00 83.61  ? 815  THR A N   1 
ATOM   6398  C  CA  . THR A  1  815  ? 29.898  -73.498  -17.312  1.00 90.45  ? 815  THR A CA  1 
ATOM   6399  C  C   . THR A  1  815  ? 29.707  -73.899  -18.771  1.00 85.98  ? 815  THR A C   1 
ATOM   6400  O  O   . THR A  1  815  ? 28.694  -73.569  -19.388  1.00 86.19  ? 815  THR A O   1 
ATOM   6401  C  CB  . THR A  1  815  ? 29.256  -74.566  -16.407  1.00 98.37  ? 815  THR A CB  1 
ATOM   6402  O  OG1 . THR A  1  815  ? 27.920  -74.831  -16.852  1.00 88.40  ? 815  THR A OG1 1 
ATOM   6403  C  CG2 . THR A  1  815  ? 29.220  -74.089  -14.964  1.00 122.20 ? 815  THR A CG2 1 
ATOM   6404  N  N   . PRO A  1  816  ? 30.686  -74.612  -19.316  1.00 90.60  ? 816  PRO A N   1 
ATOM   6405  C  CA  . PRO A  1  816  ? 30.627  -75.062  -20.712  1.00 86.76  ? 816  PRO A CA  1 
ATOM   6406  C  C   . PRO A  1  816  ? 29.212  -75.459  -21.117  1.00 85.93  ? 816  PRO A C   1 
ATOM   6407  O  O   . PRO A  1  816  ? 28.568  -74.745  -21.886  1.00 86.20  ? 816  PRO A O   1 
ATOM   6408  C  CB  . PRO A  1  816  ? 31.539  -76.290  -20.717  1.00 89.50  ? 816  PRO A CB  1 
ATOM   6409  C  CG  . PRO A  1  816  ? 32.512  -76.032  -19.622  1.00 87.53  ? 816  PRO A CG  1 
ATOM   6410  C  CD  . PRO A  1  816  ? 31.749  -75.294  -18.559  1.00 89.06  ? 816  PRO A CD  1 
ATOM   6411  N  N   . GLN A  1  817  ? 28.739  -76.590  -20.602  1.00 118.10 ? 817  GLN A N   1 
ATOM   6412  C  CA  . GLN A  1  817  ? 27.399  -77.072  -20.915  1.00 136.22 ? 817  GLN A CA  1 
ATOM   6413  C  C   . GLN A  1  817  ? 26.380  -75.937  -20.866  1.00 101.78 ? 817  GLN A C   1 
ATOM   6414  O  O   . GLN A  1  817  ? 25.220  -76.114  -21.239  1.00 112.90 ? 817  GLN A O   1 
ATOM   6415  C  CB  . GLN A  1  817  ? 26.991  -78.186  -19.949  1.00 161.50 ? 817  GLN A CB  1 
ATOM   6416  C  CG  . GLN A  1  817  ? 26.709  -79.519  -20.623  1.00 187.73 ? 817  GLN A CG  1 
ATOM   6417  C  CD  . GLN A  1  817  ? 26.481  -80.638  -19.626  1.00 204.55 ? 817  GLN A CD  1 
ATOM   6418  O  OE1 . GLN A  1  817  ? 25.819  -80.451  -18.605  1.00 185.60 ? 817  GLN A OE1 1 
ATOM   6419  N  NE2 . GLN A  1  817  ? 27.029  -81.812  -19.919  1.00 231.15 ? 817  GLN A NE2 1 
ATOM   6420  N  N   . GLU A  1  818  ? 26.822  -74.772  -20.404  1.00 85.75  ? 818  GLU A N   1 
ATOM   6421  C  CA  . GLU A  1  818  ? 25.948  -73.602  -20.305  1.00 87.87  ? 818  GLU A CA  1 
ATOM   6422  C  C   . GLU A  1  818  ? 26.341  -72.547  -21.306  1.00 87.97  ? 818  GLU A C   1 
ATOM   6423  O  O   . GLU A  1  818  ? 25.497  -71.958  -21.939  1.00 84.19  ? 818  GLU A O   1 
ATOM   6424  C  CB  . GLU A  1  818  ? 26.017  -72.969  -18.918  1.00 88.83  ? 818  GLU A CB  1 
ATOM   6425  C  CG  . GLU A  1  818  ? 25.082  -73.607  -17.922  1.00 87.16  ? 818  GLU A CG  1 
ATOM   6426  C  CD  . GLU A  1  818  ? 25.405  -73.235  -16.505  1.00 82.85  ? 818  GLU A CD  1 
ATOM   6427  O  OE1 . GLU A  1  818  ? 26.129  -72.230  -16.312  1.00 82.49  ? 818  GLU A OE1 1 
ATOM   6428  O  OE2 . GLU A  1  818  ? 24.930  -73.957  -15.597  1.00 83.78  ? 818  GLU A OE2 1 
ATOM   6429  N  N   . PHE A  1  819  ? 27.652  -72.330  -21.438  1.00 83.72  ? 819  PHE A N   1 
ATOM   6430  C  CA  . PHE A  1  819  ? 28.247  -71.202  -22.198  1.00 82.30  ? 819  PHE A CA  1 
ATOM   6431  C  C   . PHE A  1  819  ? 27.668  -70.997  -23.585  1.00 83.68  ? 819  PHE A C   1 
ATOM   6432  O  O   . PHE A  1  819  ? 27.451  -69.875  -24.054  1.00 82.29  ? 819  PHE A O   1 
ATOM   6433  C  CB  . PHE A  1  819  ? 29.746  -71.399  -22.348  1.00 83.42  ? 819  PHE A CB  1 
ATOM   6434  C  CG  . PHE A  1  819  ? 30.331  -70.514  -23.376  1.00 82.54  ? 819  PHE A CG  1 
ATOM   6435  C  CD1 . PHE A  1  819  ? 30.160  -69.151  -23.305  1.00 81.91  ? 819  PHE A CD1 1 
ATOM   6436  C  CD2 . PHE A  1  819  ? 31.001  -71.032  -24.437  1.00 83.59  ? 819  PHE A CD2 1 
ATOM   6437  C  CE1 . PHE A  1  819  ? 30.675  -68.327  -24.273  1.00 81.28  ? 819  PHE A CE1 1 
ATOM   6438  C  CE2 . PHE A  1  819  ? 31.517  -70.217  -25.398  1.00 84.01  ? 819  PHE A CE2 1 
ATOM   6439  C  CZ  . PHE A  1  819  ? 31.363  -68.856  -25.310  1.00 81.45  ? 819  PHE A CZ  1 
ATOM   6440  N  N   . PHE A  1  820  ? 27.477  -72.130  -24.234  1.00 87.66  ? 820  PHE A N   1 
ATOM   6441  C  CA  . PHE A  1  820  ? 26.892  -72.253  -25.543  1.00 85.22  ? 820  PHE A CA  1 
ATOM   6442  C  C   . PHE A  1  820  ? 25.413  -71.886  -25.518  1.00 83.78  ? 820  PHE A C   1 
ATOM   6443  O  O   . PHE A  1  820  ? 24.988  -71.002  -26.243  1.00 86.63  ? 820  PHE A O   1 
ATOM   6444  C  CB  . PHE A  1  820  ? 27.087  -73.684  -26.001  1.00 85.23  ? 820  PHE A CB  1 
ATOM   6445  C  CG  . PHE A  1  820  ? 26.611  -73.947  -27.358  1.00 91.91  ? 820  PHE A CG  1 
ATOM   6446  C  CD1 . PHE A  1  820  ? 27.505  -74.041  -28.388  1.00 89.31  ? 820  PHE A CD1 1 
ATOM   6447  C  CD2 . PHE A  1  820  ? 25.270  -74.121  -27.603  1.00 86.10  ? 820  PHE A CD2 1 
ATOM   6448  C  CE1 . PHE A  1  820  ? 27.086  -74.297  -29.629  1.00 88.87  ? 820  PHE A CE1 1 
ATOM   6449  C  CE2 . PHE A  1  820  ? 24.840  -74.380  -28.857  1.00 87.76  ? 820  PHE A CE2 1 
ATOM   6450  C  CZ  . PHE A  1  820  ? 25.762  -74.472  -29.878  1.00 86.76  ? 820  PHE A CZ  1 
ATOM   6451  N  N   . PHE A  1  821  ? 24.624  -72.562  -24.694  1.00 95.43  ? 821  PHE A N   1 
ATOM   6452  C  CA  . PHE A  1  821  ? 23.229  -72.181  -24.585  1.00 91.68  ? 821  PHE A CA  1 
ATOM   6453  C  C   . PHE A  1  821  ? 23.074  -70.660  -24.606  1.00 88.23  ? 821  PHE A C   1 
ATOM   6454  O  O   . PHE A  1  821  ? 22.185  -70.140  -25.272  1.00 85.92  ? 821  PHE A O   1 
ATOM   6455  C  CB  . PHE A  1  821  ? 22.591  -72.752  -23.320  1.00 90.75  ? 821  PHE A CB  1 
ATOM   6456  C  CG  . PHE A  1  821  ? 22.299  -74.213  -23.394  1.00 96.22  ? 821  PHE A CG  1 
ATOM   6457  C  CD1 . PHE A  1  821  ? 23.216  -75.128  -22.944  1.00 85.97  ? 821  PHE A CD1 1 
ATOM   6458  C  CD2 . PHE A  1  821  ? 21.099  -74.663  -23.903  1.00 85.32  ? 821  PHE A CD2 1 
ATOM   6459  C  CE1 . PHE A  1  821  ? 22.957  -76.475  -23.005  1.00 90.19  ? 821  PHE A CE1 1 
ATOM   6460  C  CE2 . PHE A  1  821  ? 20.828  -76.004  -23.971  1.00 88.94  ? 821  PHE A CE2 1 
ATOM   6461  C  CZ  . PHE A  1  821  ? 21.760  -76.920  -23.520  1.00 89.21  ? 821  PHE A CZ  1 
ATOM   6462  N  N   . HIS A  1  822  ? 23.933  -69.974  -23.859  1.00 132.29 ? 822  HIS A N   1 
ATOM   6463  C  CA  . HIS A  1  822  ? 23.870  -68.524  -23.742  1.00 119.30 ? 822  HIS A CA  1 
ATOM   6464  C  C   . HIS A  1  822  ? 24.204  -67.840  -25.061  1.00 96.59  ? 822  HIS A C   1 
ATOM   6465  O  O   . HIS A  1  822  ? 23.518  -66.902  -25.471  1.00 98.47  ? 822  HIS A O   1 
ATOM   6466  C  CB  . HIS A  1  822  ? 24.817  -68.034  -22.644  1.00 125.36 ? 822  HIS A CB  1 
ATOM   6467  C  CG  . HIS A  1  822  ? 24.952  -66.544  -22.582  1.00 111.57 ? 822  HIS A CG  1 
ATOM   6468  N  ND1 . HIS A  1  822  ? 23.867  -65.696  -22.637  1.00 81.61  ? 822  HIS A ND1 1 
ATOM   6469  C  CD2 . HIS A  1  822  ? 26.045  -65.752  -22.469  1.00 77.06  ? 822  HIS A CD2 1 
ATOM   6470  C  CE1 . HIS A  1  822  ? 24.285  -64.445  -22.562  1.00 80.67  ? 822  HIS A CE1 1 
ATOM   6471  N  NE2 . HIS A  1  822  ? 25.602  -64.451  -22.459  1.00 88.23  ? 822  HIS A NE2 1 
ATOM   6472  N  N   . ALA A  1  823  ? 25.256  -68.307  -25.723  1.00 83.85  ? 823  ALA A N   1 
ATOM   6473  C  CA  . ALA A  1  823  ? 25.664  -67.708  -26.981  1.00 86.49  ? 823  ALA A CA  1 
ATOM   6474  C  C   . ALA A  1  823  ? 24.629  -67.859  -28.088  1.00 86.78  ? 823  ALA A C   1 
ATOM   6475  O  O   . ALA A  1  823  ? 24.588  -67.033  -28.998  1.00 82.31  ? 823  ALA A O   1 
ATOM   6476  C  CB  . ALA A  1  823  ? 27.002  -68.257  -27.436  1.00 93.43  ? 823  ALA A CB  1 
ATOM   6477  N  N   . MET A  1  824  ? 23.816  -68.909  -28.031  1.00 84.64  ? 824  MET A N   1 
ATOM   6478  C  CA  . MET A  1  824  ? 22.887  -69.152  -29.128  1.00 87.04  ? 824  MET A CA  1 
ATOM   6479  C  C   . MET A  1  824  ? 21.567  -68.472  -28.855  1.00 83.65  ? 824  MET A C   1 
ATOM   6480  O  O   . MET A  1  824  ? 20.736  -68.359  -29.739  1.00 85.71  ? 824  MET A O   1 
ATOM   6481  C  CB  . MET A  1  824  ? 22.677  -70.644  -29.404  1.00 97.52  ? 824  MET A CB  1 
ATOM   6482  C  CG  . MET A  1  824  ? 21.927  -71.414  -28.335  1.00 103.64 ? 824  MET A CG  1 
ATOM   6483  S  SD  . MET A  1  824  ? 21.357  -72.985  -28.982  1.00 89.08  ? 824  MET A SD  1 
ATOM   6484  C  CE  . MET A  1  824  ? 19.939  -72.408  -29.909  1.00 85.19  ? 824  MET A CE  1 
ATOM   6485  N  N   . ALA A  1  825  ? 21.379  -68.024  -27.622  1.00 97.79  ? 825  ALA A N   1 
ATOM   6486  C  CA  . ALA A  1  825  ? 20.193  -67.241  -27.304  1.00 86.46  ? 825  ALA A CA  1 
ATOM   6487  C  C   . ALA A  1  825  ? 20.580  -65.849  -27.661  1.00 78.87  ? 825  ALA A C   1 
ATOM   6488  O  O   . ALA A  1  825  ? 19.750  -65.031  -28.046  1.00 77.68  ? 825  ALA A O   1 
ATOM   6489  C  CB  . ALA A  1  825  ? 19.850  -67.321  -25.828  1.00 81.27  ? 825  ALA A CB  1 
ATOM   6490  N  N   . GLY A  1  826  ? 21.871  -65.602  -27.525  1.00 91.47  ? 826  GLY A N   1 
ATOM   6491  C  CA  . GLY A  1  826  ? 22.417  -64.297  -27.800  1.00 96.00  ? 826  GLY A CA  1 
ATOM   6492  C  C   . GLY A  1  826  ? 22.332  -64.018  -29.282  1.00 81.96  ? 826  GLY A C   1 
ATOM   6493  O  O   . GLY A  1  826  ? 22.103  -62.907  -29.699  1.00 77.04  ? 826  GLY A O   1 
ATOM   6494  N  N   . ARG A  1  827  ? 22.501  -65.042  -30.101  1.00 82.86  ? 827  ARG A N   1 
ATOM   6495  C  CA  . ARG A  1  827  ? 22.523  -64.807  -31.531  1.00 78.58  ? 827  ARG A CA  1 
ATOM   6496  C  C   . ARG A  1  827  ? 21.116  -64.649  -32.077  1.00 79.68  ? 827  ARG A C   1 
ATOM   6497  O  O   . ARG A  1  827  ? 20.933  -64.637  -33.292  1.00 83.15  ? 827  ARG A O   1 
ATOM   6498  C  CB  . ARG A  1  827  ? 23.255  -65.919  -32.288  1.00 80.84  ? 827  ARG A CB  1 
ATOM   6499  C  CG  . ARG A  1  827  ? 23.610  -65.519  -33.709  1.00 82.79  ? 827  ARG A CG  1 
ATOM   6500  C  CD  . ARG A  1  827  ? 23.563  -66.692  -34.670  1.00 82.23  ? 827  ARG A CD  1 
ATOM   6501  N  NE  . ARG A  1  827  ? 24.881  -67.198  -35.056  1.00 85.39  ? 827  ARG A NE  1 
ATOM   6502  C  CZ  . ARG A  1  827  ? 25.981  -67.119  -34.314  1.00 85.89  ? 827  ARG A CZ  1 
ATOM   6503  N  NH1 . ARG A  1  827  ? 25.963  -66.536  -33.108  1.00 82.19  ? 827  ARG A NH1 1 
ATOM   6504  N  NH2 . ARG A  1  827  ? 27.116  -67.649  -34.780  1.00 88.09  ? 827  ARG A NH2 1 
ATOM   6505  N  N   . GLU A  1  828  ? 20.124  -64.512  -31.202  1.00 88.67  ? 828  GLU A N   1 
ATOM   6506  C  CA  . GLU A  1  828  ? 18.781  -64.301  -31.694  1.00 87.63  ? 828  GLU A CA  1 
ATOM   6507  C  C   . GLU A  1  828  ? 18.488  -62.810  -31.675  1.00 79.60  ? 828  GLU A C   1 
ATOM   6508  O  O   . GLU A  1  828  ? 18.131  -62.238  -32.703  1.00 85.76  ? 828  GLU A O   1 
ATOM   6509  C  CB  . GLU A  1  828  ? 17.730  -65.081  -30.902  1.00 93.01  ? 828  GLU A CB  1 
ATOM   6510  C  CG  . GLU A  1  828  ? 16.355  -65.211  -31.630  1.00 133.04 ? 828  GLU A CG  1 
ATOM   6511  C  CD  . GLU A  1  828  ? 15.188  -65.590  -30.698  1.00 152.05 ? 828  GLU A CD  1 
ATOM   6512  O  OE1 . GLU A  1  828  ? 14.022  -65.179  -30.948  1.00 121.44 ? 828  GLU A OE1 1 
ATOM   6513  O  OE2 . GLU A  1  828  ? 15.433  -66.309  -29.709  1.00 178.95 ? 828  GLU A OE2 1 
ATOM   6514  N  N   . GLY A  1  829  ? 18.638  -62.175  -30.516  1.00 182.17 ? 829  GLY A N   1 
ATOM   6515  C  CA  . GLY A  1  829  ? 18.506  -60.734  -30.414  1.00 176.01 ? 829  GLY A CA  1 
ATOM   6516  C  C   . GLY A  1  829  ? 19.675  -60.072  -31.109  1.00 159.30 ? 829  GLY A C   1 
ATOM   6517  O  O   . GLY A  1  829  ? 19.926  -58.882  -30.917  1.00 184.91 ? 829  GLY A O   1 
ATOM   6518  N  N   . LEU A  1  830  ? 20.379  -60.853  -31.925  1.00 77.66  ? 830  LEU A N   1 
ATOM   6519  C  CA  . LEU A  1  830  ? 21.587  -60.412  -32.594  1.00 81.43  ? 830  LEU A CA  1 
ATOM   6520  C  C   . LEU A  1  830  ? 21.272  -60.394  -34.060  1.00 77.86  ? 830  LEU A C   1 
ATOM   6521  O  O   . LEU A  1  830  ? 22.016  -59.893  -34.871  1.00 77.05  ? 830  LEU A O   1 
ATOM   6522  C  CB  . LEU A  1  830  ? 22.728  -61.392  -32.289  1.00 77.99  ? 830  LEU A CB  1 
ATOM   6523  C  CG  . LEU A  1  830  ? 24.206  -61.103  -32.548  1.00 77.85  ? 830  LEU A CG  1 
ATOM   6524  C  CD1 . LEU A  1  830  ? 24.590  -61.462  -33.982  1.00 79.60  ? 830  LEU A CD1 1 
ATOM   6525  C  CD2 . LEU A  1  830  ? 24.510  -59.647  -32.220  1.00 77.65  ? 830  LEU A CD2 1 
ATOM   6526  N  N   . ILE A  1  831  ? 20.131  -60.954  -34.401  1.00 79.70  ? 831  ILE A N   1 
ATOM   6527  C  CA  . ILE A  1  831  ? 19.643  -60.862  -35.754  1.00 77.70  ? 831  ILE A CA  1 
ATOM   6528  C  C   . ILE A  1  831  ? 18.356  -60.062  -35.701  1.00 79.18  ? 831  ILE A C   1 
ATOM   6529  O  O   . ILE A  1  831  ? 17.999  -59.397  -36.661  1.00 79.75  ? 831  ILE A O   1 
ATOM   6530  C  CB  . ILE A  1  831  ? 19.436  -62.259  -36.454  1.00 87.12  ? 831  ILE A CB  1 
ATOM   6531  C  CG1 . ILE A  1  831  ? 18.424  -63.117  -35.731  1.00 81.43  ? 831  ILE A CG1 1 
ATOM   6532  C  CG2 . ILE A  1  831  ? 20.738  -63.068  -36.567  1.00 82.75  ? 831  ILE A CG2 1 
ATOM   6533  C  CD1 . ILE A  1  831  ? 18.576  -64.553  -36.081  1.00 82.02  ? 831  ILE A CD1 1 
ATOM   6534  N  N   . ASP A  1  832  ? 17.678  -60.117  -34.553  1.00 108.61 ? 832  ASP A N   1 
ATOM   6535  C  CA  . ASP A  1  832  ? 16.465  -59.328  -34.335  1.00 134.68 ? 832  ASP A CA  1 
ATOM   6536  C  C   . ASP A  1  832  ? 16.841  -57.856  -34.202  1.00 112.58 ? 832  ASP A C   1 
ATOM   6537  O  O   . ASP A  1  832  ? 15.995  -56.975  -34.298  1.00 132.80 ? 832  ASP A O   1 
ATOM   6538  C  CB  . ASP A  1  832  ? 15.704  -59.832  -33.103  1.00 159.51 ? 832  ASP A CB  1 
ATOM   6539  C  CG  . ASP A  1  832  ? 15.116  -61.221  -33.309  1.00 223.95 ? 832  ASP A CG  1 
ATOM   6540  O  OD1 . ASP A  1  832  ? 15.296  -61.784  -34.409  1.00 242.91 ? 832  ASP A OD1 1 
ATOM   6541  O  OD2 . ASP A  1  832  ? 14.479  -61.749  -32.377  1.00 238.06 ? 832  ASP A OD2 1 
ATOM   6542  N  N   . THR A  1  833  ? 18.129  -57.620  -34.010  1.00 77.65  ? 833  THR A N   1 
ATOM   6543  C  CA  . THR A  1  833  ? 18.703  -56.289  -34.063  1.00 75.91  ? 833  THR A CA  1 
ATOM   6544  C  C   . THR A  1  833  ? 19.236  -56.004  -35.470  1.00 75.17  ? 833  THR A C   1 
ATOM   6545  O  O   . THR A  1  833  ? 19.516  -54.864  -35.821  1.00 74.36  ? 833  THR A O   1 
ATOM   6546  C  CB  . THR A  1  833  ? 19.875  -56.152  -33.075  1.00 73.39  ? 833  THR A CB  1 
ATOM   6547  O  OG1 . THR A  1  833  ? 19.698  -54.990  -32.244  1.00 75.39  ? 833  THR A OG1 1 
ATOM   6548  C  CG2 . THR A  1  833  ? 21.241  -56.081  -33.817  1.00 74.77  ? 833  THR A CG2 1 
ATOM   6549  N  N   . ALA A  1  834  ? 19.400  -57.049  -36.278  1.00 75.42  ? 834  ALA A N   1 
ATOM   6550  C  CA  . ALA A  1  834  ? 19.817  -56.861  -37.664  1.00 103.90 ? 834  ALA A CA  1 
ATOM   6551  C  C   . ALA A  1  834  ? 18.631  -56.414  -38.528  1.00 96.05  ? 834  ALA A C   1 
ATOM   6552  O  O   . ALA A  1  834  ? 18.808  -55.783  -39.575  1.00 96.33  ? 834  ALA A O   1 
ATOM   6553  C  CB  . ALA A  1  834  ? 20.460  -58.126  -38.210  1.00 124.71 ? 834  ALA A CB  1 
ATOM   6554  N  N   . VAL A  1  835  ? 17.425  -56.748  -38.080  1.00 107.68 ? 835  VAL A N   1 
ATOM   6555  C  CA  . VAL A  1  835  ? 16.213  -56.389  -38.808  1.00 97.76  ? 835  VAL A CA  1 
ATOM   6556  C  C   . VAL A  1  835  ? 15.809  -54.945  -38.529  1.00 102.68 ? 835  VAL A C   1 
ATOM   6557  O  O   . VAL A  1  835  ? 15.843  -54.099  -39.421  1.00 116.82 ? 835  VAL A O   1 
ATOM   6558  C  CB  . VAL A  1  835  ? 15.042  -57.320  -38.444  1.00 131.08 ? 835  VAL A CB  1 
ATOM   6559  C  CG1 . VAL A  1  835  ? 13.765  -56.860  -39.129  1.00 189.10 ? 835  VAL A CG1 1 
ATOM   6560  C  CG2 . VAL A  1  835  ? 15.370  -58.755  -38.823  1.00 160.22 ? 835  VAL A CG2 1 
ATOM   6561  N  N   . LYS A  1  836  ? 15.427  -54.672  -37.285  1.00 169.14 ? 836  LYS A N   1 
ATOM   6562  C  CA  . LYS A  1  836  ? 15.016  -53.330  -36.888  1.00 165.18 ? 836  LYS A CA  1 
ATOM   6563  C  C   . LYS A  1  836  ? 15.929  -52.270  -37.494  1.00 226.89 ? 836  LYS A C   1 
ATOM   6564  O  O   . LYS A  1  836  ? 15.620  -51.079  -37.462  1.00 251.50 ? 836  LYS A O   1 
ATOM   6565  C  CB  . LYS A  1  836  ? 15.003  -53.204  -35.363  1.00 143.39 ? 836  LYS A CB  1 
ATOM   6566  C  CG  . LYS A  1  836  ? 14.255  -51.985  -34.848  1.00 159.37 ? 836  LYS A CG  1 
ATOM   6567  C  CD  . LYS A  1  836  ? 14.949  -51.382  -33.638  1.00 192.90 ? 836  LYS A CD  1 
ATOM   6568  C  CE  . LYS A  1  836  ? 14.560  -49.926  -33.446  1.00 176.51 ? 836  LYS A CE  1 
ATOM   6569  N  NZ  . LYS A  1  836  ? 14.408  -49.575  -32.007  1.00 106.84 ? 836  LYS A NZ  1 
ATOM   6570  N  N   . THR A  1  837  ? 17.055  -52.710  -38.045  1.00 181.14 ? 837  THR A N   1 
ATOM   6571  C  CA  . THR A  1  837  ? 18.015  -51.800  -38.659  1.00 173.77 ? 837  THR A CA  1 
ATOM   6572  C  C   . THR A  1  837  ? 17.582  -51.410  -40.068  1.00 202.72 ? 837  THR A C   1 
ATOM   6573  O  O   . THR A  1  837  ? 17.924  -50.332  -40.557  1.00 210.69 ? 837  THR A O   1 
ATOM   6574  C  CB  . THR A  1  837  ? 19.423  -52.420  -38.718  1.00 156.56 ? 837  THR A CB  1 
ATOM   6575  O  OG1 . THR A  1  837  ? 20.148  -52.082  -37.529  1.00 155.85 ? 837  THR A OG1 1 
ATOM   6576  C  CG2 . THR A  1  837  ? 20.181  -51.906  -39.932  1.00 139.33 ? 837  THR A CG2 1 
ATOM   6577  N  N   . ALA A  1  838  ? 16.828  -52.292  -40.715  1.00 175.10 ? 838  ALA A N   1 
ATOM   6578  C  CA  . ALA A  1  838  ? 16.345  -52.042  -42.068  1.00 175.72 ? 838  ALA A CA  1 
ATOM   6579  C  C   . ALA A  1  838  ? 14.828  -51.892  -42.099  1.00 173.72 ? 838  ALA A C   1 
ATOM   6580  O  O   . ALA A  1  838  ? 14.310  -50.813  -42.380  1.00 164.82 ? 838  ALA A O   1 
ATOM   6581  C  CB  . ALA A  1  838  ? 16.786  -53.162  -43.000  1.00 188.89 ? 838  ALA A CB  1 
ATOM   6582  N  N   . GLU A  1  839  ? 14.123  -52.980  -41.806  1.00 131.64 ? 839  GLU A N   1 
ATOM   6583  C  CA  . GLU A  1  839  ? 12.665  -52.969  -41.798  1.00 130.73 ? 839  GLU A CA  1 
ATOM   6584  C  C   . GLU A  1  839  ? 12.122  -51.661  -41.230  1.00 117.54 ? 839  GLU A C   1 
ATOM   6585  O  O   . GLU A  1  839  ? 11.411  -50.924  -41.911  1.00 112.72 ? 839  GLU A O   1 
ATOM   6586  C  CB  . GLU A  1  839  ? 12.124  -54.154  -40.999  1.00 140.03 ? 839  GLU A CB  1 
ATOM   6587  C  CG  . GLU A  1  839  ? 11.424  -55.206  -41.841  1.00 152.04 ? 839  GLU A CG  1 
ATOM   6588  C  CD  . GLU A  1  839  ? 10.591  -56.159  -41.011  1.00 158.51 ? 839  GLU A CD  1 
ATOM   6589  O  OE1 . GLU A  1  839  ? 10.472  -55.938  -39.787  1.00 152.94 ? 839  GLU A OE1 1 
ATOM   6590  O  OE2 . GLU A  1  839  ? 10.048  -57.129  -41.582  1.00 169.15 ? 839  GLU A OE2 1 
ATOM   6591  N  N   . THR A  1  840  ? 12.472  -51.377  -39.980  1.00 241.63 ? 840  THR A N   1 
ATOM   6592  C  CA  . THR A  1  840  ? 12.027  -50.154  -39.318  1.00 230.16 ? 840  THR A CA  1 
ATOM   6593  C  C   . THR A  1  840  ? 12.057  -48.975  -40.288  1.00 223.18 ? 840  THR A C   1 
ATOM   6594  O  O   . THR A  1  840  ? 11.178  -48.114  -40.250  1.00 216.05 ? 840  THR A O   1 
ATOM   6595  C  CB  . THR A  1  840  ? 12.899  -49.826  -38.095  1.00 225.19 ? 840  THR A CB  1 
ATOM   6596  O  OG1 . THR A  1  840  ? 14.263  -49.666  -38.508  1.00 225.01 ? 840  THR A OG1 1 
ATOM   6597  C  CG2 . THR A  1  840  ? 12.813  -50.938  -37.065  1.00 231.92 ? 840  THR A CG2 1 
ATOM   6598  N  N   . GLY A  1  841  ? 13.069  -48.946  -41.147  1.00 99.75  ? 841  GLY A N   1 
ATOM   6599  C  CA  . GLY A  1  841  ? 13.206  -47.882  -42.123  1.00 92.57  ? 841  GLY A CA  1 
ATOM   6600  C  C   . GLY A  1  841  ? 12.180  -47.993  -43.236  1.00 93.69  ? 841  GLY A C   1 
ATOM   6601  O  O   . GLY A  1  841  ? 11.622  -46.985  -43.675  1.00 85.75  ? 841  GLY A O   1 
ATOM   6602  N  N   . TYR A  1  842  ? 11.934  -49.215  -43.690  1.00 135.47 ? 842  TYR A N   1 
ATOM   6603  C  CA  . TYR A  1  842  ? 10.963  -49.455  -44.751  1.00 137.86 ? 842  TYR A CA  1 
ATOM   6604  C  C   . TYR A  1  842  ? 9.587   -48.928  -44.362  1.00 131.35 ? 842  TYR A C   1 
ATOM   6605  O  O   . TYR A  1  842  ? 8.987   -48.144  -45.099  1.00 124.55 ? 842  TYR A O   1 
ATOM   6606  C  CB  . TYR A  1  842  ? 10.883  -50.948  -45.072  1.00 152.66 ? 842  TYR A CB  1 
ATOM   6607  C  CG  . TYR A  1  842  ? 12.158  -51.523  -45.655  1.00 160.53 ? 842  TYR A CG  1 
ATOM   6608  C  CD1 . TYR A  1  842  ? 12.405  -51.460  -47.019  1.00 162.41 ? 842  TYR A CD1 1 
ATOM   6609  C  CD2 . TYR A  1  842  ? 13.104  -52.125  -44.840  1.00 165.18 ? 842  TYR A CD2 1 
ATOM   6610  C  CE1 . TYR A  1  842  ? 13.568  -51.983  -47.557  1.00 170.06 ? 842  TYR A CE1 1 
ATOM   6611  C  CE2 . TYR A  1  842  ? 14.269  -52.649  -45.369  1.00 172.02 ? 842  TYR A CE2 1 
ATOM   6612  C  CZ  . TYR A  1  842  ? 14.495  -52.573  -46.729  1.00 174.80 ? 842  TYR A CZ  1 
ATOM   6613  O  OH  . TYR A  1  842  ? 15.650  -53.095  -47.259  1.00 182.09 ? 842  TYR A OH  1 
ATOM   6614  N  N   . ILE A  1  843  ? 9.098   -49.362  -43.207  1.00 85.73  ? 843  ILE A N   1 
ATOM   6615  C  CA  . ILE A  1  843  ? 7.796   -48.925  -42.716  1.00 83.02  ? 843  ILE A CA  1 
ATOM   6616  C  C   . ILE A  1  843  ? 7.748   -47.408  -42.562  1.00 73.74  ? 843  ILE A C   1 
ATOM   6617  O  O   . ILE A  1  843  ? 6.699   -46.789  -42.742  1.00 72.98  ? 843  ILE A O   1 
ATOM   6618  C  CB  . ILE A  1  843  ? 7.454   -49.580  -41.365  1.00 84.23  ? 843  ILE A CB  1 
ATOM   6619  C  CG1 . ILE A  1  843  ? 6.126   -49.040  -40.831  1.00 83.12  ? 843  ILE A CG1 1 
ATOM   6620  C  CG2 . ILE A  1  843  ? 8.572   -49.339  -40.358  1.00 85.72  ? 843  ILE A CG2 1 
ATOM   6621  C  CD1 . ILE A  1  843  ? 6.253   -47.744  -40.062  1.00 76.56  ? 843  ILE A CD1 1 
ATOM   6622  N  N   . GLN A  1  844  ? 8.879   -46.807  -42.235  1.00 119.19 ? 844  GLN A N   1 
ATOM   6623  C  CA  . GLN A  1  844  ? 8.899   -45.366  -42.081  1.00 130.70 ? 844  GLN A CA  1 
ATOM   6624  C  C   . GLN A  1  844  ? 8.437   -44.724  -43.371  1.00 126.19 ? 844  GLN A C   1 
ATOM   6625  O  O   . GLN A  1  844  ? 7.449   -43.996  -43.395  1.00 78.87  ? 844  GLN A O   1 
ATOM   6626  C  CB  . GLN A  1  844  ? 10.296  -44.867  -41.717  1.00 144.64 ? 844  GLN A CB  1 
ATOM   6627  C  CG  . GLN A  1  844  ? 10.389  -43.358  -41.595  1.00 117.27 ? 844  GLN A CG  1 
ATOM   6628  C  CD  . GLN A  1  844  ? 9.980   -42.860  -40.227  1.00 73.03  ? 844  GLN A CD  1 
ATOM   6629  O  OE1 . GLN A  1  844  ? 9.471   -41.752  -40.086  1.00 82.01  ? 844  GLN A OE1 1 
ATOM   6630  N  NE2 . GLN A  1  844  ? 10.206  -43.676  -39.206  1.00 89.03  ? 844  GLN A NE2 1 
ATOM   6631  N  N   . ARG A  1  845  ? 9.150   -44.991  -44.453  1.00 95.49  ? 845  ARG A N   1 
ATOM   6632  C  CA  . ARG A  1  845  ? 8.807   -44.375  -45.732  1.00 74.02  ? 845  ARG A CA  1 
ATOM   6633  C  C   . ARG A  1  845  ? 7.373   -44.608  -46.151  1.00 74.68  ? 845  ARG A C   1 
ATOM   6634  O  O   . ARG A  1  845  ? 6.803   -43.797  -46.871  1.00 74.80  ? 845  ARG A O   1 
ATOM   6635  C  CB  . ARG A  1  845  ? 9.740   -44.863  -46.847  1.00 75.06  ? 845  ARG A CB  1 
ATOM   6636  C  CG  . ARG A  1  845  ? 11.140  -44.272  -46.803  1.00 98.55  ? 845  ARG A CG  1 
ATOM   6637  C  CD  . ARG A  1  845  ? 12.050  -44.885  -47.859  1.00 144.17 ? 845  ARG A CD  1 
ATOM   6638  N  NE  . ARG A  1  845  ? 13.454  -44.766  -47.471  1.00 179.64 ? 845  ARG A NE  1 
ATOM   6639  C  CZ  . ARG A  1  845  ? 14.476  -45.277  -48.154  1.00 201.41 ? 845  ARG A CZ  1 
ATOM   6640  N  NH1 . ARG A  1  845  ? 14.258  -45.956  -49.274  1.00 212.64 ? 845  ARG A NH1 1 
ATOM   6641  N  NH2 . ARG A  1  845  ? 15.713  -45.110  -47.708  1.00 195.05 ? 845  ARG A NH2 1 
ATOM   6642  N  N   . ARG A  1  846  ? 6.796   -45.731  -45.769  1.00 74.57  ? 846  ARG A N   1 
ATOM   6643  C  CA  . ARG A  1  846  ? 5.440   -45.960  -46.190  1.00 77.75  ? 846  ARG A CA  1 
ATOM   6644  C  C   . ARG A  1  846  ? 4.657   -44.725  -45.799  1.00 74.13  ? 846  ARG A C   1 
ATOM   6645  O  O   . ARG A  1  846  ? 4.232   -43.951  -46.645  1.00 74.40  ? 846  ARG A O   1 
ATOM   6646  C  CB  . ARG A  1  846  ? 4.860   -47.203  -45.531  1.00 97.32  ? 846  ARG A CB  1 
ATOM   6647  C  CG  . ARG A  1  846  ? 3.466   -47.556  -46.010  1.00 113.81 ? 846  ARG A CG  1 
ATOM   6648  C  CD  . ARG A  1  846  ? 3.496   -48.750  -46.944  1.00 115.70 ? 846  ARG A CD  1 
ATOM   6649  N  NE  . ARG A  1  846  ? 4.013   -49.943  -46.285  1.00 140.95 ? 846  ARG A NE  1 
ATOM   6650  C  CZ  . ARG A  1  846  ? 3.613   -51.178  -46.563  1.00 162.31 ? 846  ARG A CZ  1 
ATOM   6651  N  NH1 . ARG A  1  846  ? 2.688   -51.383  -47.488  1.00 145.22 ? 846  ARG A NH1 1 
ATOM   6652  N  NH2 . ARG A  1  846  ? 4.135   -52.209  -45.917  1.00 182.55 ? 846  ARG A NH2 1 
ATOM   6653  N  N   . LEU A  1  847  ? 4.501   -44.523  -44.499  1.00 90.85  ? 847  LEU A N   1 
ATOM   6654  C  CA  . LEU A  1  847  ? 3.638   -43.424  -44.018  1.00 98.44  ? 847  LEU A CA  1 
ATOM   6655  C  C   . LEU A  1  847  ? 3.907   -42.143  -44.791  1.00 96.38  ? 847  LEU A C   1 
ATOM   6656  O  O   . LEU A  1  847  ? 3.014   -41.602  -45.448  1.00 78.29  ? 847  LEU A O   1 
ATOM   6657  C  CB  . LEU A  1  847  ? 3.807   -43.177  -42.516  1.00 77.03  ? 847  LEU A CB  1 
ATOM   6658  C  CG  . LEU A  1  847  ? 3.118   -44.206  -41.620  1.00 80.70  ? 847  LEU A CG  1 
ATOM   6659  C  CD1 . LEU A  1  847  ? 1.679   -44.434  -42.052  1.00 100.10 ? 847  LEU A CD1 1 
ATOM   6660  C  CD2 . LEU A  1  847  ? 3.898   -45.504  -41.625  1.00 117.73 ? 847  LEU A CD2 1 
ATOM   6661  N  N   . VAL A  1  848  ? 5.148   -41.669  -44.731  1.00 73.73  ? 848  VAL A N   1 
ATOM   6662  C  CA  . VAL A  1  848  ? 5.533   -40.430  -45.397  1.00 73.64  ? 848  VAL A CA  1 
ATOM   6663  C  C   . VAL A  1  848  ? 4.961   -40.367  -46.802  1.00 75.02  ? 848  VAL A C   1 
ATOM   6664  O  O   . VAL A  1  848  ? 4.444   -39.335  -47.219  1.00 74.27  ? 848  VAL A O   1 
ATOM   6665  C  CB  . VAL A  1  848  ? 7.056   -40.301  -45.545  1.00 73.11  ? 848  VAL A CB  1 
ATOM   6666  C  CG1 . VAL A  1  848  ? 7.440   -38.935  -46.087  1.00 73.45  ? 848  VAL A CG1 1 
ATOM   6667  C  CG2 . VAL A  1  848  ? 7.750   -40.585  -44.237  1.00 72.30  ? 848  VAL A CG2 1 
ATOM   6668  N  N   . LYS A  1  849  ? 5.069   -41.466  -47.537  1.00 74.69  ? 849  LYS A N   1 
ATOM   6669  C  CA  . LYS A  1  849  ? 4.727   -41.431  -48.944  1.00 78.38  ? 849  LYS A CA  1 
ATOM   6670  C  C   . LYS A  1  849  ? 3.219   -41.356  -49.120  1.00 75.87  ? 849  LYS A C   1 
ATOM   6671  O  O   . LYS A  1  849  ? 2.723   -41.157  -50.227  1.00 76.42  ? 849  LYS A O   1 
ATOM   6672  C  CB  . LYS A  1  849  ? 5.363   -42.595  -49.707  1.00 83.15  ? 849  LYS A CB  1 
ATOM   6673  C  CG  . LYS A  1  849  ? 6.816   -42.330  -50.131  1.00 129.81 ? 849  LYS A CG  1 
ATOM   6674  C  CD  . LYS A  1  849  ? 7.464   -43.541  -50.788  1.00 162.13 ? 849  LYS A CD  1 
ATOM   6675  C  CE  . LYS A  1  849  ? 8.983   -43.385  -50.841  1.00 187.53 ? 849  LYS A CE  1 
ATOM   6676  N  NZ  . LYS A  1  849  ? 9.697   -44.638  -51.225  1.00 216.47 ? 849  LYS A NZ  1 
ATOM   6677  N  N   . ALA A  1  850  ? 2.483   -41.443  -48.023  1.00 85.64  ? 850  ALA A N   1 
ATOM   6678  C  CA  . ALA A  1  850  ? 1.046   -41.244  -48.108  1.00 88.19  ? 850  ALA A CA  1 
ATOM   6679  C  C   . ALA A  1  850  ? 0.559   -40.027  -47.311  1.00 87.18  ? 850  ALA A C   1 
ATOM   6680  O  O   . ALA A  1  850  ? -0.614  -39.694  -47.386  1.00 83.23  ? 850  ALA A O   1 
ATOM   6681  C  CB  . ALA A  1  850  ? 0.305   -42.488  -47.683  1.00 89.98  ? 850  ALA A CB  1 
ATOM   6682  N  N   . MET A  1  851  ? 1.442   -39.366  -46.570  1.00 101.45 ? 851  MET A N   1 
ATOM   6683  C  CA  . MET A  1  851  ? 1.017   -38.259  -45.713  1.00 97.90  ? 851  MET A CA  1 
ATOM   6684  C  C   . MET A  1  851  ? 1.657   -36.926  -46.113  1.00 109.62 ? 851  MET A C   1 
ATOM   6685  O  O   . MET A  1  851  ? 1.236   -35.884  -45.614  1.00 76.39  ? 851  MET A O   1 
ATOM   6686  C  CB  . MET A  1  851  ? 1.321   -38.553  -44.242  1.00 132.25 ? 851  MET A CB  1 
ATOM   6687  C  CG  . MET A  1  851  ? 0.824   -39.887  -43.750  1.00 140.22 ? 851  MET A CG  1 
ATOM   6688  S  SD  . MET A  1  851  ? -0.584  -39.705  -42.636  1.00 99.52  ? 851  MET A SD  1 
ATOM   6689  C  CE  . MET A  1  851  ? 0.204   -39.432  -41.066  1.00 75.20  ? 851  MET A CE  1 
ATOM   6690  N  N   . GLU A  1  852  ? 2.677   -36.955  -46.979  1.00 95.68  ? 852  GLU A N   1 
ATOM   6691  C  CA  . GLU A  1  852  ? 3.292   -35.722  -47.489  1.00 77.00  ? 852  GLU A CA  1 
ATOM   6692  C  C   . GLU A  1  852  ? 2.150   -34.808  -47.925  1.00 79.74  ? 852  GLU A C   1 
ATOM   6693  O  O   . GLU A  1  852  ? 2.069   -33.629  -47.540  1.00 73.85  ? 852  GLU A O   1 
ATOM   6694  C  CB  . GLU A  1  852  ? 4.201   -36.030  -48.682  1.00 81.60  ? 852  GLU A CB  1 
ATOM   6695  C  CG  . GLU A  1  852  ? 5.419   -36.884  -48.356  1.00 131.83 ? 852  GLU A CG  1 
ATOM   6696  C  CD  . GLU A  1  852  ? 6.335   -37.159  -49.555  1.00 147.45 ? 852  GLU A CD  1 
ATOM   6697  O  OE1 . GLU A  1  852  ? 6.059   -36.658  -50.668  1.00 113.75 ? 852  GLU A OE1 1 
ATOM   6698  O  OE2 . GLU A  1  852  ? 7.346   -37.883  -49.380  1.00 151.09 ? 852  GLU A OE2 1 
ATOM   6699  N  N   . ASP A  1  853  ? 1.246   -35.409  -48.698  1.00 150.36 ? 853  ASP A N   1 
ATOM   6700  C  CA  . ASP A  1  853  ? 0.018   -34.767  -49.145  1.00 150.44 ? 853  ASP A CA  1 
ATOM   6701  C  C   . ASP A  1  853  ? -0.486  -33.718  -48.122  1.00 96.83  ? 853  ASP A C   1 
ATOM   6702  O  O   . ASP A  1  853  ? -0.592  -32.542  -48.451  1.00 76.17  ? 853  ASP A O   1 
ATOM   6703  C  CB  . ASP A  1  853  ? -1.076  -35.825  -49.483  1.00 180.46 ? 853  ASP A CB  1 
ATOM   6704  C  CG  . ASP A  1  853  ? -0.659  -36.815  -50.602  1.00 182.52 ? 853  ASP A CG  1 
ATOM   6705  O  OD1 . ASP A  1  853  ? -1.179  -37.969  -50.634  1.00 86.03  ? 853  ASP A OD1 1 
ATOM   6706  O  OD2 . ASP A  1  853  ? 0.171   -36.439  -51.456  1.00 241.63 ? 853  ASP A OD2 1 
ATOM   6707  N  N   . VAL A  1  854  ? -0.747  -34.135  -46.878  1.00 114.01 ? 854  VAL A N   1 
ATOM   6708  C  CA  . VAL A  1  854  ? -1.450  -33.285  -45.894  1.00 104.45 ? 854  VAL A CA  1 
ATOM   6709  C  C   . VAL A  1  854  ? -0.592  -32.208  -45.272  1.00 91.13  ? 854  VAL A C   1 
ATOM   6710  O  O   . VAL A  1  854  ? 0.640   -32.333  -45.218  1.00 82.93  ? 854  VAL A O   1 
ATOM   6711  C  CB  . VAL A  1  854  ? -2.129  -34.077  -44.727  1.00 80.54  ? 854  VAL A CB  1 
ATOM   6712  C  CG1 . VAL A  1  854  ? -3.387  -34.793  -45.191  1.00 94.66  ? 854  VAL A CG1 1 
ATOM   6713  C  CG2 . VAL A  1  854  ? -1.176  -35.054  -44.121  1.00 79.57  ? 854  VAL A CG2 1 
ATOM   6714  N  N   . MET A  1  855  ? -1.300  -31.180  -44.773  1.00 74.92  ? 855  MET A N   1 
ATOM   6715  C  CA  . MET A  1  855  ? -0.755  -29.914  -44.240  1.00 82.61  ? 855  MET A CA  1 
ATOM   6716  C  C   . MET A  1  855  ? -1.875  -28.989  -43.763  1.00 74.85  ? 855  MET A C   1 
ATOM   6717  O  O   . MET A  1  855  ? -3.002  -29.093  -44.220  1.00 92.79  ? 855  MET A O   1 
ATOM   6718  C  CB  . MET A  1  855  ? 0.029   -29.172  -45.307  1.00 130.93 ? 855  MET A CB  1 
ATOM   6719  C  CG  . MET A  1  855  ? 0.745   -27.958  -44.775  1.00 88.39  ? 855  MET A CG  1 
ATOM   6720  S  SD  . MET A  1  855  ? 1.473   -26.982  -46.097  1.00 96.18  ? 855  MET A SD  1 
ATOM   6721  C  CE  . MET A  1  855  ? 1.992   -28.249  -47.276  1.00 227.63 ? 855  MET A CE  1 
ATOM   6722  N  N   . VAL A  1  856  ? -1.573  -28.066  -42.858  1.00 74.94  ? 856  VAL A N   1 
ATOM   6723  C  CA  . VAL A  1  856  ? -2.624  -27.191  -42.330  1.00 72.69  ? 856  VAL A CA  1 
ATOM   6724  C  C   . VAL A  1  856  ? -2.800  -25.875  -43.106  1.00 73.82  ? 856  VAL A C   1 
ATOM   6725  O  O   . VAL A  1  856  ? -1.918  -24.998  -43.129  1.00 73.15  ? 856  VAL A O   1 
ATOM   6726  C  CB  . VAL A  1  856  ? -2.343  -26.781  -40.904  1.00 75.68  ? 856  VAL A CB  1 
ATOM   6727  C  CG1 . VAL A  1  856  ? -3.633  -26.523  -40.182  1.00 74.38  ? 856  VAL A CG1 1 
ATOM   6728  C  CG2 . VAL A  1  856  ? -1.526  -27.828  -40.208  1.00 74.71  ? 856  VAL A CG2 1 
ATOM   6729  N  N   . ARG A  1  857  ? -3.970  -25.728  -43.709  1.00 79.48  ? 857  ARG A N   1 
ATOM   6730  C  CA  . ARG A  1  857  ? -4.274  -24.546  -44.490  1.00 103.47 ? 857  ARG A CA  1 
ATOM   6731  C  C   . ARG A  1  857  ? -4.661  -23.386  -43.581  1.00 89.48  ? 857  ARG A C   1 
ATOM   6732  O  O   . ARG A  1  857  ? -5.236  -23.591  -42.510  1.00 76.30  ? 857  ARG A O   1 
ATOM   6733  C  CB  . ARG A  1  857  ? -5.376  -24.857  -45.511  1.00 115.51 ? 857  ARG A CB  1 
ATOM   6734  C  CG  . ARG A  1  857  ? -4.927  -25.703  -46.707  1.00 81.64  ? 857  ARG A CG  1 
ATOM   6735  C  CD  . ARG A  1  857  ? -4.982  -24.919  -48.023  1.00 110.61 ? 857  ARG A CD  1 
ATOM   6736  N  NE  . ARG A  1  857  ? -4.188  -25.497  -49.106  1.00 139.49 ? 857  ARG A NE  1 
ATOM   6737  C  CZ  . ARG A  1  857  ? -3.783  -26.763  -49.164  1.00 167.26 ? 857  ARG A CZ  1 
ATOM   6738  N  NH1 . ARG A  1  857  ? -4.113  -27.630  -48.216  1.00 102.93 ? 857  ARG A NH1 1 
ATOM   6739  N  NH2 . ARG A  1  857  ? -3.057  -27.172  -50.199  1.00 194.22 ? 857  ARG A NH2 1 
ATOM   6740  N  N   . TYR A  1  858  ? -4.340  -22.174  -44.043  1.00 74.17  ? 858  TYR A N   1 
ATOM   6741  C  CA  . TYR A  1  858  ? -4.542  -20.916  -43.318  1.00 75.50  ? 858  TYR A CA  1 
ATOM   6742  C  C   . TYR A  1  858  ? -5.955  -20.691  -42.820  1.00 76.00  ? 858  TYR A C   1 
ATOM   6743  O  O   . TYR A  1  858  ? -6.234  -19.671  -42.183  1.00 75.30  ? 858  TYR A O   1 
ATOM   6744  C  CB  . TYR A  1  858  ? -4.160  -19.714  -44.189  1.00 75.20  ? 858  TYR A CB  1 
ATOM   6745  C  CG  . TYR A  1  858  ? -2.714  -19.263  -44.076  1.00 74.92  ? 858  TYR A CG  1 
ATOM   6746  C  CD1 . TYR A  1  858  ? -1.853  -19.407  -45.135  1.00 75.40  ? 858  TYR A CD1 1 
ATOM   6747  C  CD2 . TYR A  1  858  ? -2.220  -18.692  -42.919  1.00 75.38  ? 858  TYR A CD2 1 
ATOM   6748  C  CE1 . TYR A  1  858  ? -0.535  -19.012  -45.047  1.00 75.10  ? 858  TYR A CE1 1 
ATOM   6749  C  CE2 . TYR A  1  858  ? -0.906  -18.305  -42.829  1.00 75.15  ? 858  TYR A CE2 1 
ATOM   6750  C  CZ  . TYR A  1  858  ? -0.078  -18.464  -43.884  1.00 74.00  ? 858  TYR A CZ  1 
ATOM   6751  O  OH  . TYR A  1  858  ? 1.218   -18.068  -43.766  1.00 74.76  ? 858  TYR A OH  1 
ATOM   6752  N  N   . ASP A  1  859  ? -6.848  -21.614  -43.153  1.00 83.17  ? 859  ASP A N   1 
ATOM   6753  C  CA  . ASP A  1  859  ? -8.247  -21.492  -42.773  1.00 84.73  ? 859  ASP A CA  1 
ATOM   6754  C  C   . ASP A  1  859  ? -8.470  -22.088  -41.396  1.00 77.43  ? 859  ASP A C   1 
ATOM   6755  O  O   . ASP A  1  859  ? -9.473  -21.822  -40.744  1.00 74.78  ? 859  ASP A O   1 
ATOM   6756  C  CB  . ASP A  1  859  ? -9.182  -22.117  -43.828  1.00 128.72 ? 859  ASP A CB  1 
ATOM   6757  C  CG  . ASP A  1  859  ? -9.051  -23.627  -43.932  1.00 132.29 ? 859  ASP A CG  1 
ATOM   6758  O  OD1 . ASP A  1  859  ? -9.775  -24.338  -43.211  1.00 89.96  ? 859  ASP A OD1 1 
ATOM   6759  O  OD2 . ASP A  1  859  ? -8.270  -24.112  -44.769  1.00 166.85 ? 859  ASP A OD2 1 
ATOM   6760  N  N   . GLY A  1  860  ? -7.488  -22.848  -40.928  1.00 92.93  ? 860  GLY A N   1 
ATOM   6761  C  CA  . GLY A  1  860  ? -7.670  -23.586  -39.702  1.00 119.00 ? 860  GLY A CA  1 
ATOM   6762  C  C   . GLY A  1  860  ? -8.263  -24.946  -40.002  1.00 113.21 ? 860  GLY A C   1 
ATOM   6763  O  O   . GLY A  1  860  ? -9.283  -25.344  -39.449  1.00 104.74 ? 860  GLY A O   1 
ATOM   6764  N  N   . THR A  1  861  ? -7.614  -25.667  -40.908  1.00 77.63  ? 861  THR A N   1 
ATOM   6765  C  CA  . THR A  1  861  ? -8.088  -26.974  -41.334  1.00 78.40  ? 861  THR A CA  1 
ATOM   6766  C  C   . THR A  1  861  ? -6.972  -27.687  -42.095  1.00 74.31  ? 861  THR A C   1 
ATOM   6767  O  O   . THR A  1  861  ? -6.180  -27.052  -42.788  1.00 74.29  ? 861  THR A O   1 
ATOM   6768  C  CB  . THR A  1  861  ? -9.324  -26.831  -42.223  1.00 80.05  ? 861  THR A CB  1 
ATOM   6769  O  OG1 . THR A  1  861  ? -10.314 -27.796  -41.846  1.00 80.17  ? 861  THR A OG1 1 
ATOM   6770  C  CG2 . THR A  1  861  ? -8.960  -26.962  -43.689  1.00 74.09  ? 861  THR A CG2 1 
ATOM   6771  N  N   . VAL A  1  862  ? -6.879  -29.004  -41.949  1.00 74.05  ? 862  VAL A N   1 
ATOM   6772  C  CA  . VAL A  1  862  ? -5.836  -29.771  -42.632  1.00 76.74  ? 862  VAL A CA  1 
ATOM   6773  C  C   . VAL A  1  862  ? -6.344  -30.423  -43.903  1.00 82.22  ? 862  VAL A C   1 
ATOM   6774  O  O   . VAL A  1  862  ? -7.318  -31.167  -43.872  1.00 80.88  ? 862  VAL A O   1 
ATOM   6775  C  CB  . VAL A  1  862  ? -5.331  -30.888  -41.754  1.00 73.95  ? 862  VAL A CB  1 
ATOM   6776  C  CG1 . VAL A  1  862  ? -4.068  -31.493  -42.362  1.00 74.83  ? 862  VAL A CG1 1 
ATOM   6777  C  CG2 . VAL A  1  862  ? -5.072  -30.358  -40.362  1.00 73.71  ? 862  VAL A CG2 1 
ATOM   6778  N  N   . ARG A  1  863  ? -5.634  -30.212  -45.005  1.00 102.80 ? 863  ARG A N   1 
ATOM   6779  C  CA  . ARG A  1  863  ? -6.133  -30.629  -46.307  1.00 117.10 ? 863  ARG A CA  1 
ATOM   6780  C  C   . ARG A  1  863  ? -5.151  -31.377  -47.195  1.00 110.08 ? 863  ARG A C   1 
ATOM   6781  O  O   . ARG A  1  863  ? -3.937  -31.284  -47.039  1.00 85.99  ? 863  ARG A O   1 
ATOM   6782  C  CB  . ARG A  1  863  ? -6.664  -29.430  -47.076  1.00 111.49 ? 863  ARG A CB  1 
ATOM   6783  C  CG  . ARG A  1  863  ? -8.000  -28.942  -46.609  1.00 87.13  ? 863  ARG A CG  1 
ATOM   6784  C  CD  . ARG A  1  863  ? -8.191  -27.565  -47.157  1.00 88.03  ? 863  ARG A CD  1 
ATOM   6785  N  NE  . ARG A  1  863  ? -9.311  -26.845  -46.569  1.00 87.66  ? 863  ARG A NE  1 
ATOM   6786  C  CZ  . ARG A  1  863  ? -10.289 -26.340  -47.308  1.00 96.03  ? 863  ARG A CZ  1 
ATOM   6787  N  NH1 . ARG A  1  863  ? -10.247 -26.518  -48.627  1.00 98.26  ? 863  ARG A NH1 1 
ATOM   6788  N  NH2 . ARG A  1  863  ? -11.298 -25.671  -46.756  1.00 101.52 ? 863  ARG A NH2 1 
ATOM   6789  N  N   . ASN A  1  864  ? -5.725  -32.119  -48.137  1.00 95.88  ? 864  ASN A N   1 
ATOM   6790  C  CA  . ASN A  1  864  ? -4.972  -32.895  -49.096  1.00 86.02  ? 864  ASN A CA  1 
ATOM   6791  C  C   . ASN A  1  864  ? -4.267  -32.037  -50.116  1.00 85.77  ? 864  ASN A C   1 
ATOM   6792  O  O   . ASN A  1  864  ? -4.474  -30.831  -50.194  1.00 86.84  ? 864  ASN A O   1 
ATOM   6793  C  CB  . ASN A  1  864  ? -5.895  -33.853  -49.837  1.00 84.57  ? 864  ASN A CB  1 
ATOM   6794  C  CG  . ASN A  1  864  ? -5.129  -34.950  -50.559  1.00 131.50 ? 864  ASN A CG  1 
ATOM   6795  O  OD1 . ASN A  1  864  ? -5.665  -35.626  -51.435  1.00 157.49 ? 864  ASN A OD1 1 
ATOM   6796  N  ND2 . ASN A  1  864  ? -3.871  -35.135  -50.176  1.00 128.39 ? 864  ASN A ND2 1 
ATOM   6797  N  N   . ALA A  1  865  ? -3.445  -32.684  -50.920  1.00 76.48  ? 865  ALA A N   1 
ATOM   6798  C  CA  . ALA A  1  865  ? -2.872  -32.039  -52.089  1.00 79.12  ? 865  ALA A CA  1 
ATOM   6799  C  C   . ALA A  1  865  ? -4.005  -31.367  -52.861  1.00 82.32  ? 865  ALA A C   1 
ATOM   6800  O  O   . ALA A  1  865  ? -3.985  -30.163  -53.094  1.00 78.49  ? 865  ALA A O   1 
ATOM   6801  C  CB  . ALA A  1  865  ? -2.154  -33.073  -52.962  1.00 77.80  ? 865  ALA A CB  1 
ATOM   6802  N  N   . MET A  1  866  ? -5.008  -32.159  -53.229  1.00 79.00  ? 866  MET A N   1 
ATOM   6803  C  CA  . MET A  1  866  ? -6.067  -31.689  -54.113  1.00 81.25  ? 866  MET A CA  1 
ATOM   6804  C  C   . MET A  1  866  ? -7.044  -30.756  -53.420  1.00 79.16  ? 866  MET A C   1 
ATOM   6805  O  O   . MET A  1  866  ? -7.917  -30.177  -54.066  1.00 118.65 ? 866  MET A O   1 
ATOM   6806  C  CB  . MET A  1  866  ? -6.818  -32.856  -54.764  1.00 110.46 ? 866  MET A CB  1 
ATOM   6807  C  CG  . MET A  1  866  ? -6.112  -33.396  -56.005  1.00 137.68 ? 866  MET A CG  1 
ATOM   6808  S  SD  . MET A  1  866  ? -5.394  -32.082  -57.036  1.00 239.10 ? 866  MET A SD  1 
ATOM   6809  C  CE  . MET A  1  866  ? -6.836  -31.349  -57.816  1.00 83.50  ? 866  MET A CE  1 
ATOM   6810  N  N   . GLY A  1  867  ? -6.891  -30.586  -52.118  1.00 79.08  ? 867  GLY A N   1 
ATOM   6811  C  CA  . GLY A  1  867  ? -7.809  -29.725  -51.396  1.00 78.99  ? 867  GLY A CA  1 
ATOM   6812  C  C   . GLY A  1  867  ? -8.795  -30.531  -50.587  1.00 78.07  ? 867  GLY A C   1 
ATOM   6813  O  O   . GLY A  1  867  ? -9.414  -30.013  -49.666  1.00 76.84  ? 867  GLY A O   1 
ATOM   6814  N  N   . ASP A  1  868  ? -8.923  -31.809  -50.955  1.00 132.72 ? 868  ASP A N   1 
ATOM   6815  C  CA  . ASP A  1  868  ? -9.743  -32.748  -50.215  1.00 135.27 ? 868  ASP A CA  1 
ATOM   6816  C  C   . ASP A  1  868  ? -9.328  -32.656  -48.773  1.00 103.34 ? 868  ASP A C   1 
ATOM   6817  O  O   . ASP A  1  868  ? -8.187  -32.943  -48.434  1.00 126.07 ? 868  ASP A O   1 
ATOM   6818  C  CB  . ASP A  1  868  ? -9.572  -34.186  -50.739  1.00 167.25 ? 868  ASP A CB  1 
ATOM   6819  C  CG  . ASP A  1  868  ? -10.273 -34.416  -52.073  1.00 192.64 ? 868  ASP A CG  1 
ATOM   6820  O  OD1 . ASP A  1  868  ? -10.764 -33.433  -52.665  1.00 225.15 ? 868  ASP A OD1 1 
ATOM   6821  O  OD2 . ASP A  1  868  ? -10.336 -35.584  -52.527  1.00 161.29 ? 868  ASP A OD2 1 
ATOM   6822  N  N   . ILE A  1  869  ? -10.261 -32.234  -47.926  1.00 92.89  ? 869  ILE A N   1 
ATOM   6823  C  CA  . ILE A  1  869  ? -9.957  -31.960  -46.519  1.00 102.29 ? 869  ILE A CA  1 
ATOM   6824  C  C   . ILE A  1  869  ? -10.114 -33.179  -45.617  1.00 99.41  ? 869  ILE A C   1 
ATOM   6825  O  O   . ILE A  1  869  ? -11.083 -33.948  -45.728  1.00 125.33 ? 869  ILE A O   1 
ATOM   6826  C  CB  . ILE A  1  869  ? -10.794 -30.787  -45.965  1.00 81.25  ? 869  ILE A CB  1 
ATOM   6827  C  CG1 . ILE A  1  869  ? -12.045 -31.273  -45.246  1.00 75.05  ? 869  ILE A CG1 1 
ATOM   6828  C  CG2 . ILE A  1  869  ? -11.149 -29.791  -47.069  1.00 76.54  ? 869  ILE A CG2 1 
ATOM   6829  C  CD1 . ILE A  1  869  ? -12.820 -30.149  -44.630  1.00 74.90  ? 869  ILE A CD1 1 
ATOM   6830  N  N   . ILE A  1  870  ? -9.152  -33.344  -44.720  1.00 73.87  ? 870  ILE A N   1 
ATOM   6831  C  CA  . ILE A  1  870  ? -9.098  -34.539  -43.892  1.00 74.21  ? 870  ILE A CA  1 
ATOM   6832  C  C   . ILE A  1  870  ? -9.410  -34.247  -42.431  1.00 73.05  ? 870  ILE A C   1 
ATOM   6833  O  O   . ILE A  1  870  ? -9.890  -35.116  -41.713  1.00 72.99  ? 870  ILE A O   1 
ATOM   6834  C  CB  . ILE A  1  870  ? -7.735  -35.237  -44.006  1.00 73.32  ? 870  ILE A CB  1 
ATOM   6835  C  CG1 . ILE A  1  870  ? -6.624  -34.304  -43.556  1.00 72.91  ? 870  ILE A CG1 1 
ATOM   6836  C  CG2 . ILE A  1  870  ? -7.448  -35.615  -45.442  1.00 74.29  ? 870  ILE A CG2 1 
ATOM   6837  C  CD1 . ILE A  1  870  ? -6.536  -34.117  -42.063  1.00 73.54  ? 870  ILE A CD1 1 
ATOM   6838  N  N   . GLN A  1  871  ? -9.150  -33.030  -41.975  1.00 88.60  ? 871  GLN A N   1 
ATOM   6839  C  CA  . GLN A  1  871  ? -9.570  -32.650  -40.634  1.00 91.77  ? 871  GLN A CA  1 
ATOM   6840  C  C   . GLN A  1  871  ? -10.144 -31.224  -40.647  1.00 72.35  ? 871  GLN A C   1 
ATOM   6841  O  O   . GLN A  1  871  ? -9.682  -30.380  -41.432  1.00 80.97  ? 871  GLN A O   1 
ATOM   6842  C  CB  . GLN A  1  871  ? -8.391  -32.748  -39.659  1.00 77.82  ? 871  GLN A CB  1 
ATOM   6843  C  CG  . GLN A  1  871  ? -8.136  -34.154  -39.069  1.00 75.96  ? 871  GLN A CG  1 
ATOM   6844  C  CD  . GLN A  1  871  ? -7.122  -34.170  -37.915  1.00 85.56  ? 871  GLN A CD  1 
ATOM   6845  O  OE1 . GLN A  1  871  ? -6.551  -33.158  -37.564  1.00 78.29  ? 871  GLN A OE1 1 
ATOM   6846  N  NE2 . GLN A  1  871  ? -6.905  -35.324  -37.332  1.00 74.84  ? 871  GLN A NE2 1 
ATOM   6847  N  N   . PHE A  1  872  ? -11.136 -30.963  -39.790  1.00 73.99  ? 872  PHE A N   1 
ATOM   6848  C  CA  . PHE A  1  872  ? -11.704 -29.624  -39.620  1.00 73.61  ? 872  PHE A CA  1 
ATOM   6849  C  C   . PHE A  1  872  ? -11.088 -28.812  -38.480  1.00 72.36  ? 872  PHE A C   1 
ATOM   6850  O  O   . PHE A  1  872  ? -11.411 -27.642  -38.341  1.00 72.54  ? 872  PHE A O   1 
ATOM   6851  C  CB  . PHE A  1  872  ? -13.184 -29.709  -39.346  1.00 74.32  ? 872  PHE A CB  1 
ATOM   6852  C  CG  . PHE A  1  872  ? -13.989 -30.214  -40.499  1.00 73.89  ? 872  PHE A CG  1 
ATOM   6853  C  CD1 . PHE A  1  872  ? -14.607 -31.446  -40.426  1.00 74.46  ? 872  PHE A CD1 1 
ATOM   6854  C  CD2 . PHE A  1  872  ? -14.174 -29.455  -41.628  1.00 75.22  ? 872  PHE A CD2 1 
ATOM   6855  C  CE1 . PHE A  1  872  ? -15.383 -31.916  -41.458  1.00 75.98  ? 872  PHE A CE1 1 
ATOM   6856  C  CE2 . PHE A  1  872  ? -14.955 -29.920  -42.664  1.00 76.84  ? 872  PHE A CE2 1 
ATOM   6857  C  CZ  . PHE A  1  872  ? -15.556 -31.149  -42.577  1.00 77.49  ? 872  PHE A CZ  1 
ATOM   6858  N  N   . ALA A  1  873  ? -10.263 -29.453  -37.652  1.00 71.50  ? 873  ALA A N   1 
ATOM   6859  C  CA  . ALA A  1  873  ? -9.456  -28.769  -36.635  1.00 71.01  ? 873  ALA A CA  1 
ATOM   6860  C  C   . ALA A  1  873  ? -8.002  -28.706  -37.079  1.00 70.78  ? 873  ALA A C   1 
ATOM   6861  O  O   . ALA A  1  873  ? -7.719  -28.520  -38.261  1.00 71.71  ? 873  ALA A O   1 
ATOM   6862  C  CB  . ALA A  1  873  ? -9.561  -29.462  -35.302  1.00 71.14  ? 873  ALA A CB  1 
ATOM   6863  N  N   . TYR A  1  874  ? -7.070  -28.839  -36.133  1.00 71.28  ? 874  TYR A N   1 
ATOM   6864  C  CA  . TYR A  1  874  ? -5.634  -28.723  -36.445  1.00 97.82  ? 874  TYR A CA  1 
ATOM   6865  C  C   . TYR A  1  874  ? -5.044  -30.068  -36.017  1.00 107.93 ? 874  TYR A C   1 
ATOM   6866  O  O   . TYR A  1  874  ? -3.843  -30.421  -36.185  1.00 71.43  ? 874  TYR A O   1 
ATOM   6867  C  CB  . TYR A  1  874  ? -5.003  -27.531  -35.682  1.00 159.01 ? 874  TYR A CB  1 
ATOM   6868  C  CG  . TYR A  1  874  ? -5.416  -26.076  -36.091  1.00 188.09 ? 874  TYR A CG  1 
ATOM   6869  C  CD1 . TYR A  1  874  ? -6.236  -25.284  -35.269  1.00 176.18 ? 874  TYR A CD1 1 
ATOM   6870  C  CD2 . TYR A  1  874  ? -4.951  -25.489  -37.274  1.00 207.10 ? 874  TYR A CD2 1 
ATOM   6871  C  CE1 . TYR A  1  874  ? -6.588  -23.956  -35.627  1.00 165.72 ? 874  TYR A CE1 1 
ATOM   6872  C  CE2 . TYR A  1  874  ? -5.301  -24.162  -37.637  1.00 192.67 ? 874  TYR A CE2 1 
ATOM   6873  C  CZ  . TYR A  1  874  ? -6.120  -23.407  -36.810  1.00 160.87 ? 874  TYR A CZ  1 
ATOM   6874  O  OH  . TYR A  1  874  ? -6.468  -22.103  -37.166  1.00 126.10 ? 874  TYR A OH  1 
ATOM   6875  N  N   . GLY A  1  875  ? -5.983  -30.808  -35.463  1.00 71.31  ? 875  GLY A N   1 
ATOM   6876  C  CA  . GLY A  1  875  ? -5.786  -32.138  -34.951  1.00 94.10  ? 875  GLY A CA  1 
ATOM   6877  C  C   . GLY A  1  875  ? -6.941  -32.384  -33.996  1.00 74.12  ? 875  GLY A C   1 
ATOM   6878  O  O   . GLY A  1  875  ? -6.733  -32.858  -32.878  1.00 73.30  ? 875  GLY A O   1 
ATOM   6879  N  N   . GLU A  1  876  ? -8.156  -32.048  -34.419  1.00 123.62 ? 876  GLU A N   1 
ATOM   6880  C  CA  . GLU A  1  876  ? -9.362  -32.206  -33.591  1.00 134.73 ? 876  GLU A CA  1 
ATOM   6881  C  C   . GLU A  1  876  ? -9.338  -31.243  -32.401  1.00 139.83 ? 876  GLU A C   1 
ATOM   6882  O  O   . GLU A  1  876  ? -10.357 -30.618  -32.036  1.00 76.55  ? 876  GLU A O   1 
ATOM   6883  C  CB  . GLU A  1  876  ? -9.514  -33.647  -33.092  1.00 154.14 ? 876  GLU A CB  1 
ATOM   6884  C  CG  . GLU A  1  876  ? -9.826  -34.684  -34.173  1.00 166.95 ? 876  GLU A CG  1 
ATOM   6885  C  CD  . GLU A  1  876  ? -9.887  -36.094  -33.613  1.00 188.36 ? 876  GLU A CD  1 
ATOM   6886  O  OE1 . GLU A  1  876  ? -10.191 -36.247  -32.407  1.00 163.81 ? 876  GLU A OE1 1 
ATOM   6887  O  OE2 . GLU A  1  876  ? -9.627  -37.044  -34.380  1.00 198.15 ? 876  GLU A OE2 1 
ATOM   6888  N  N   . ASP A  1  877  ? -8.148  -31.140  -31.817  1.00 139.21 ? 877  ASP A N   1 
ATOM   6889  C  CA  . ASP A  1  877  ? -7.884  -30.213  -30.729  1.00 120.29 ? 877  ASP A CA  1 
ATOM   6890  C  C   . ASP A  1  877  ? -7.847  -28.831  -31.311  1.00 71.20  ? 877  ASP A C   1 
ATOM   6891  O  O   . ASP A  1  877  ? -8.623  -27.973  -30.923  1.00 71.55  ? 877  ASP A O   1 
ATOM   6892  C  CB  . ASP A  1  877  ? -6.542  -30.500  -30.060  1.00 106.15 ? 877  ASP A CB  1 
ATOM   6893  C  CG  . ASP A  1  877  ? -6.509  -30.036  -28.621  1.00 154.33 ? 877  ASP A CG  1 
ATOM   6894  O  OD1 . ASP A  1  877  ? -7.138  -28.997  -28.314  1.00 206.49 ? 877  ASP A OD1 1 
ATOM   6895  O  OD2 . ASP A  1  877  ? -5.874  -30.722  -27.789  1.00 153.61 ? 877  ASP A OD2 1 
ATOM   6896  N  N   . GLY A  1  878  ? -6.949  -28.637  -32.264  1.00 75.14  ? 878  GLY A N   1 
ATOM   6897  C  CA  . GLY A  1  878  ? -6.701  -27.332  -32.839  1.00 75.43  ? 878  GLY A CA  1 
ATOM   6898  C  C   . GLY A  1  878  ? -5.350  -26.779  -32.415  1.00 77.23  ? 878  GLY A C   1 
ATOM   6899  O  O   . GLY A  1  878  ? -4.959  -25.695  -32.862  1.00 98.27  ? 878  GLY A O   1 
ATOM   6900  N  N   . LEU A  1  879  ? -4.640  -27.540  -31.580  1.00 68.26  ? 879  LEU A N   1 
ATOM   6901  C  CA  . LEU A  1  879  ? -3.377  -27.074  -30.988  1.00 68.59  ? 879  LEU A CA  1 
ATOM   6902  C  C   . LEU A  1  879  ? -2.133  -27.803  -31.470  1.00 69.59  ? 879  LEU A C   1 
ATOM   6903  O  O   . LEU A  1  879  ? -2.238  -28.882  -32.055  1.00 67.78  ? 879  LEU A O   1 
ATOM   6904  C  CB  . LEU A  1  879  ? -3.476  -27.157  -29.487  1.00 68.26  ? 879  LEU A CB  1 
ATOM   6905  C  CG  . LEU A  1  879  ? -4.745  -26.446  -29.092  1.00 67.92  ? 879  LEU A CG  1 
ATOM   6906  C  CD1 . LEU A  1  879  ? -4.922  -26.550  -27.637  1.00 68.09  ? 879  LEU A CD1 1 
ATOM   6907  C  CD2 . LEU A  1  879  ? -4.649  -25.000  -29.495  1.00 68.95  ? 879  LEU A CD2 1 
ATOM   6908  N  N   . ASP A  1  880  ? -0.951  -27.195  -31.263  1.00 70.30  ? 880  ASP A N   1 
ATOM   6909  C  CA  . ASP A  1  880  ? 0.319   -27.819  -31.677  1.00 69.38  ? 880  ASP A CA  1 
ATOM   6910  C  C   . ASP A  1  880  ? 0.813   -28.842  -30.664  1.00 70.15  ? 880  ASP A C   1 
ATOM   6911  O  O   . ASP A  1  880  ? 1.210   -28.488  -29.555  1.00 67.99  ? 880  ASP A O   1 
ATOM   6912  C  CB  . ASP A  1  880  ? 1.434   -26.792  -31.894  1.00 71.90  ? 880  ASP A CB  1 
ATOM   6913  C  CG  . ASP A  1  880  ? 2.706   -27.421  -32.495  1.00 75.64  ? 880  ASP A CG  1 
ATOM   6914  O  OD1 . ASP A  1  880  ? 2.798   -28.672  -32.580  1.00 82.86  ? 880  ASP A OD1 1 
ATOM   6915  O  OD2 . ASP A  1  880  ? 3.619   -26.656  -32.881  1.00 99.08  ? 880  ASP A OD2 1 
ATOM   6916  N  N   . ALA A  1  881  ? 0.810   -30.107  -31.061  1.00 79.18  ? 881  ALA A N   1 
ATOM   6917  C  CA  . ALA A  1  881  ? 1.188   -31.185  -30.162  1.00 81.31  ? 881  ALA A CA  1 
ATOM   6918  C  C   . ALA A  1  881  ? 2.297   -30.749  -29.196  1.00 85.72  ? 881  ALA A C   1 
ATOM   6919  O  O   . ALA A  1  881  ? 2.204   -30.941  -27.979  1.00 88.42  ? 881  ALA A O   1 
ATOM   6920  C  CB  . ALA A  1  881  ? 1.631   -32.370  -30.968  1.00 93.05  ? 881  ALA A CB  1 
ATOM   6921  N  N   . THR A  1  882  ? 3.331   -30.143  -29.773  1.00 67.15  ? 882  THR A N   1 
ATOM   6922  C  CA  . THR A  1  882  ? 4.584   -29.830  -29.101  1.00 65.97  ? 882  THR A CA  1 
ATOM   6923  C  C   . THR A  1  882  ? 4.476   -28.914  -27.895  1.00 67.54  ? 882  THR A C   1 
ATOM   6924  O  O   . THR A  1  882  ? 5.428   -28.780  -27.145  1.00 65.28  ? 882  THR A O   1 
ATOM   6925  C  CB  . THR A  1  882  ? 5.550   -29.180  -30.098  1.00 66.94  ? 882  THR A CB  1 
ATOM   6926  O  OG1 . THR A  1  882  ? 6.889   -29.283  -29.611  1.00 66.09  ? 882  THR A OG1 1 
ATOM   6927  C  CG2 . THR A  1  882  ? 5.224   -27.720  -30.311  1.00 66.87  ? 882  THR A CG2 1 
ATOM   6928  N  N   . LEU A  1  883  ? 3.346   -28.258  -27.721  1.00 85.00  ? 883  LEU A N   1 
ATOM   6929  C  CA  . LEU A  1  883  ? 3.233   -27.341  -26.606  1.00 66.64  ? 883  LEU A CA  1 
ATOM   6930  C  C   . LEU A  1  883  ? 2.172   -27.800  -25.633  1.00 69.76  ? 883  LEU A C   1 
ATOM   6931  O  O   . LEU A  1  883  ? 1.243   -27.055  -25.317  1.00 68.69  ? 883  LEU A O   1 
ATOM   6932  C  CB  . LEU A  1  883  ? 2.889   -25.955  -27.107  1.00 73.72  ? 883  LEU A CB  1 
ATOM   6933  C  CG  . LEU A  1  883  ? 4.100   -25.229  -27.650  1.00 88.22  ? 883  LEU A CG  1 
ATOM   6934  C  CD1 . LEU A  1  883  ? 3.684   -23.997  -28.416  1.00 89.01  ? 883  LEU A CD1 1 
ATOM   6935  C  CD2 . LEU A  1  883  ? 4.991   -24.881  -26.482  1.00 114.29 ? 883  LEU A CD2 1 
ATOM   6936  N  N   . VAL A  1  884  ? 2.282   -29.014  -25.134  1.00 78.05  ? 884  VAL A N   1 
ATOM   6937  C  CA  . VAL A  1  884  ? 1.155   -29.514  -24.379  1.00 88.73  ? 884  VAL A CA  1 
ATOM   6938  C  C   . VAL A  1  884  ? 1.580   -30.354  -23.213  1.00 87.38  ? 884  VAL A C   1 
ATOM   6939  O  O   . VAL A  1  884  ? 2.593   -31.049  -23.284  1.00 79.53  ? 884  VAL A O   1 
ATOM   6940  C  CB  . VAL A  1  884  ? 0.231   -30.309  -25.251  1.00 81.26  ? 884  VAL A CB  1 
ATOM   6941  C  CG1 . VAL A  1  884  ? -0.713  -31.117  -24.389  1.00 80.32  ? 884  VAL A CG1 1 
ATOM   6942  C  CG2 . VAL A  1  884  ? -0.526  -29.365  -26.133  1.00 92.47  ? 884  VAL A CG2 1 
ATOM   6943  N  N   . GLU A  1  885  ? 0.804   -30.274  -22.134  1.00 77.29  ? 885  GLU A N   1 
ATOM   6944  C  CA  . GLU A  1  885  ? 1.142   -31.011  -20.917  1.00 78.69  ? 885  GLU A CA  1 
ATOM   6945  C  C   . GLU A  1  885  ? -0.038  -31.792  -20.357  1.00 78.55  ? 885  GLU A C   1 
ATOM   6946  O  O   . GLU A  1  885  ? -1.071  -31.205  -19.995  1.00 74.98  ? 885  GLU A O   1 
ATOM   6947  C  CB  . GLU A  1  885  ? 1.746   -30.079  -19.865  1.00 74.87  ? 885  GLU A CB  1 
ATOM   6948  C  CG  . GLU A  1  885  ? 2.616   -28.989  -20.469  1.00 73.69  ? 885  GLU A CG  1 
ATOM   6949  C  CD  . GLU A  1  885  ? 3.372   -28.191  -19.422  1.00 72.29  ? 885  GLU A CD  1 
ATOM   6950  O  OE1 . GLU A  1  885  ? 4.509   -27.791  -19.716  1.00 77.85  ? 885  GLU A OE1 1 
ATOM   6951  O  OE2 . GLU A  1  885  ? 2.850   -27.964  -18.308  1.00 72.58  ? 885  GLU A OE2 1 
ATOM   6952  N  N   . TYR A  1  886  ? 0.097   -33.122  -20.323  1.00 122.84 ? 886  TYR A N   1 
ATOM   6953  C  CA  . TYR A  1  886  ? -0.973  -33.934  -19.780  1.00 125.67 ? 886  TYR A CA  1 
ATOM   6954  C  C   . TYR A  1  886  ? -1.385  -33.171  -18.481  1.00 136.03 ? 886  TYR A C   1 
ATOM   6955  O  O   . TYR A  1  886  ? -0.550  -32.532  -17.807  1.00 65.99  ? 886  TYR A O   1 
ATOM   6956  C  CB  . TYR A  1  886  ? -0.559  -35.433  -19.601  1.00 65.30  ? 886  TYR A CB  1 
ATOM   6957  C  CG  . TYR A  1  886  ? 0.015   -35.734  -18.220  1.00 192.64 ? 886  TYR A CG  1 
ATOM   6958  C  CD1 . TYR A  1  886  ? 1.045   -34.944  -17.705  1.00 218.14 ? 886  TYR A CD1 1 
ATOM   6959  C  CD2 . TYR A  1  886  ? -0.481  -36.789  -17.413  1.00 157.37 ? 886  TYR A CD2 1 
ATOM   6960  C  CE1 . TYR A  1  886  ? 1.572   -35.170  -16.454  1.00 193.67 ? 886  TYR A CE1 1 
ATOM   6961  C  CE2 . TYR A  1  886  ? 0.057   -37.039  -16.129  1.00 74.62  ? 886  TYR A CE2 1 
ATOM   6962  C  CZ  . TYR A  1  886  ? 1.091   -36.200  -15.673  1.00 122.82 ? 886  TYR A CZ  1 
ATOM   6963  O  OH  . TYR A  1  886  ? 1.696   -36.330  -14.446  1.00 77.91  ? 886  TYR A OH  1 
ATOM   6964  N  N   . GLN A  1  887  ? -2.682  -33.160  -18.199  1.00 101.11 ? 887  GLN A N   1 
ATOM   6965  C  CA  . GLN A  1  887  ? -3.251  -32.418  -17.079  1.00 72.71  ? 887  GLN A CA  1 
ATOM   6966  C  C   . GLN A  1  887  ? -4.288  -33.300  -16.352  1.00 111.32 ? 887  GLN A C   1 
ATOM   6967  O  O   . GLN A  1  887  ? -4.583  -34.420  -16.791  1.00 139.24 ? 887  GLN A O   1 
ATOM   6968  C  CB  . GLN A  1  887  ? -3.919  -31.165  -17.625  1.00 74.40  ? 887  GLN A CB  1 
ATOM   6969  C  CG  . GLN A  1  887  ? -4.638  -30.349  -16.597  1.00 96.89  ? 887  GLN A CG  1 
ATOM   6970  C  CD  . GLN A  1  887  ? -3.685  -29.515  -15.795  1.00 107.97 ? 887  GLN A CD  1 
ATOM   6971  O  OE1 . GLN A  1  887  ? -2.949  -28.706  -16.352  1.00 67.66  ? 887  GLN A OE1 1 
ATOM   6972  N  NE2 . GLN A  1  887  ? -3.677  -29.707  -14.480  1.00 156.18 ? 887  GLN A NE2 1 
ATOM   6973  N  N   . VAL A  1  888  ? -4.885  -32.800  -15.270  1.00 79.79  ? 888  VAL A N   1 
ATOM   6974  C  CA  . VAL A  1  888  ? -5.820  -33.620  -14.492  1.00 78.60  ? 888  VAL A CA  1 
ATOM   6975  C  C   . VAL A  1  888  ? -7.129  -32.892  -14.162  1.00 78.27  ? 888  VAL A C   1 
ATOM   6976  O  O   . VAL A  1  888  ? -7.101  -31.718  -13.787  1.00 93.88  ? 888  VAL A O   1 
ATOM   6977  C  CB  . VAL A  1  888  ? -5.155  -34.116  -13.200  1.00 87.37  ? 888  VAL A CB  1 
ATOM   6978  C  CG1 . VAL A  1  888  ? -4.685  -32.931  -12.356  1.00 100.54 ? 888  VAL A CG1 1 
ATOM   6979  C  CG2 . VAL A  1  888  ? -6.090  -35.033  -12.437  1.00 76.49  ? 888  VAL A CG2 1 
ATOM   6980  N  N   . PHE A  1  889  ? -8.272  -33.578  -14.310  1.00 76.96  ? 889  PHE A N   1 
ATOM   6981  C  CA  . PHE A  1  889  ? -9.580  -32.999  -13.934  1.00 76.07  ? 889  PHE A CA  1 
ATOM   6982  C  C   . PHE A  1  889  ? -10.012 -33.319  -12.513  1.00 83.26  ? 889  PHE A C   1 
ATOM   6983  O  O   . PHE A  1  889  ? -10.630 -34.352  -12.249  1.00 75.63  ? 889  PHE A O   1 
ATOM   6984  C  CB  . PHE A  1  889  ? -10.670 -33.457  -14.881  1.00 80.29  ? 889  PHE A CB  1 
ATOM   6985  C  CG  . PHE A  1  889  ? -10.466 -32.998  -16.259  1.00 80.70  ? 889  PHE A CG  1 
ATOM   6986  C  CD1 . PHE A  1  889  ? -9.526  -33.599  -17.056  1.00 82.54  ? 889  PHE A CD1 1 
ATOM   6987  C  CD2 . PHE A  1  889  ? -11.177 -31.936  -16.762  1.00 80.69  ? 889  PHE A CD2 1 
ATOM   6988  C  CE1 . PHE A  1  889  ? -9.319  -33.163  -18.358  1.00 80.41  ? 889  PHE A CE1 1 
ATOM   6989  C  CE2 . PHE A  1  889  ? -10.968 -31.489  -18.067  1.00 79.90  ? 889  PHE A CE2 1 
ATOM   6990  C  CZ  . PHE A  1  889  ? -10.051 -32.106  -18.858  1.00 68.13  ? 889  PHE A CZ  1 
ATOM   6991  N  N   . ASP A  1  890  ? -9.725  -32.411  -11.594  1.00 124.20 ? 890  ASP A N   1 
ATOM   6992  C  CA  . ASP A  1  890  ? -10.082 -32.624  -10.207  1.00 132.30 ? 890  ASP A CA  1 
ATOM   6993  C  C   . ASP A  1  890  ? -11.547 -33.008  -10.097  1.00 97.90  ? 890  ASP A C   1 
ATOM   6994  O  O   . ASP A  1  890  ? -11.901 -33.896  -9.327   1.00 107.06 ? 890  ASP A O   1 
ATOM   6995  C  CB  . ASP A  1  890  ? -9.802  -31.357  -9.415   1.00 160.76 ? 890  ASP A CB  1 
ATOM   6996  C  CG  . ASP A  1  890  ? -8.426  -30.797  -9.713   1.00 164.63 ? 890  ASP A CG  1 
ATOM   6997  O  OD1 . ASP A  1  890  ? -7.498  -31.601  -9.948   1.00 201.88 ? 890  ASP A OD1 1 
ATOM   6998  O  OD2 . ASP A  1  890  ? -8.269  -29.561  -9.741   1.00 102.31 ? 890  ASP A OD2 1 
ATOM   6999  N  N   . SER A  1  891  ? -12.366 -32.352  -10.924  1.00 69.61  ? 891  SER A N   1 
ATOM   7000  C  CA  . SER A  1  891  ? -13.831 -32.403  -10.833  1.00 73.93  ? 891  SER A CA  1 
ATOM   7001  C  C   . SER A  1  891  ? -14.481 -33.696  -11.342  1.00 74.56  ? 891  SER A C   1 
ATOM   7002  O  O   . SER A  1  891  ? -15.698 -33.755  -11.508  1.00 73.22  ? 891  SER A O   1 
ATOM   7003  C  CB  . SER A  1  891  ? -14.431 -31.220  -11.598  1.00 78.25  ? 891  SER A CB  1 
ATOM   7004  O  OG  . SER A  1  891  ? -13.994 -31.204  -12.938  1.00 74.48  ? 891  SER A OG  1 
ATOM   7005  N  N   . LEU A  1  892  ? -13.680 -34.730  -11.578  1.00 94.82  ? 892  LEU A N   1 
ATOM   7006  C  CA  . LEU A  1  892  ? -14.205 -35.945  -12.194  1.00 96.47  ? 892  LEU A CA  1 
ATOM   7007  C  C   . LEU A  1  892  ? -14.411 -37.086  -11.220  1.00 77.09  ? 892  LEU A C   1 
ATOM   7008  O  O   . LEU A  1  892  ? -15.543 -37.386  -10.848  1.00 79.84  ? 892  LEU A O   1 
ATOM   7009  C  CB  . LEU A  1  892  ? -13.305 -36.406  -13.332  1.00 105.83 ? 892  LEU A CB  1 
ATOM   7010  C  CG  . LEU A  1  892  ? -13.870 -37.578  -14.126  1.00 85.70  ? 892  LEU A CG  1 
ATOM   7011  C  CD1 . LEU A  1  892  ? -15.164 -37.206  -14.831  1.00 84.78  ? 892  LEU A CD1 1 
ATOM   7012  C  CD2 . LEU A  1  892  ? -12.849 -38.054  -15.122  1.00 103.88 ? 892  LEU A CD2 1 
ATOM   7013  N  N   . ARG A  1  893  ? -13.332 -37.732  -10.814  1.00 106.64 ? 893  ARG A N   1 
ATOM   7014  C  CA  . ARG A  1  893  ? -13.436 -38.912  -9.955   1.00 150.84 ? 893  ARG A CA  1 
ATOM   7015  C  C   . ARG A  1  893  ? -13.866 -38.544  -8.523   1.00 162.30 ? 893  ARG A C   1 
ATOM   7016  O  O   . ARG A  1  893  ? -13.375 -39.130  -7.559   1.00 195.11 ? 893  ARG A O   1 
ATOM   7017  C  CB  . ARG A  1  893  ? -12.107 -39.685  -9.941   1.00 186.35 ? 893  ARG A CB  1 
ATOM   7018  C  CG  . ARG A  1  893  ? -11.568 -40.042  -11.323  1.00 194.75 ? 893  ARG A CG  1 
ATOM   7019  C  CD  . ARG A  1  893  ? -10.195 -40.698  -11.233  1.00 171.87 ? 893  ARG A CD  1 
ATOM   7020  N  NE  . ARG A  1  893  ? -10.201 -41.884  -10.382  1.00 177.36 ? 893  ARG A NE  1 
ATOM   7021  C  CZ  . ARG A  1  893  ? -9.819  -41.891  -9.109   1.00 181.08 ? 893  ARG A CZ  1 
ATOM   7022  N  NH1 . ARG A  1  893  ? -9.390  -40.770  -8.529   1.00 171.29 ? 893  ARG A NH1 1 
ATOM   7023  N  NH2 . ARG A  1  893  ? -9.862  -43.023  -8.417   1.00 172.26 ? 893  ARG A NH2 1 
ATOM   7024  N  N   . LEU A  1  894  ? -14.786 -37.586  -8.397   1.00 90.52  ? 894  LEU A N   1 
ATOM   7025  C  CA  . LEU A  1  894  ? -15.237 -37.100  -7.091   1.00 70.96  ? 894  LEU A CA  1 
ATOM   7026  C  C   . LEU A  1  894  ? -16.660 -37.530  -6.774   1.00 80.95  ? 894  LEU A C   1 
ATOM   7027  O  O   . LEU A  1  894  ? -17.533 -37.553  -7.649   1.00 117.29 ? 894  LEU A O   1 
ATOM   7028  C  CB  . LEU A  1  894  ? -15.148 -35.569  -7.016   1.00 71.10  ? 894  LEU A CB  1 
ATOM   7029  C  CG  . LEU A  1  894  ? -13.758 -34.922  -7.036   1.00 117.85 ? 894  LEU A CG  1 
ATOM   7030  C  CD1 . LEU A  1  894  ? -13.855 -33.411  -6.942   1.00 128.06 ? 894  LEU A CD1 1 
ATOM   7031  C  CD2 . LEU A  1  894  ? -12.892 -35.481  -5.912   1.00 148.17 ? 894  LEU A CD2 1 
ATOM   7032  N  N   . SER A  1  895  ? -16.889 -37.841  -5.505   1.00 105.46 ? 895  SER A N   1 
ATOM   7033  C  CA  . SER A  1  895  ? -18.194 -38.248  -5.038   1.00 102.25 ? 895  SER A CA  1 
ATOM   7034  C  C   . SER A  1  895  ? -19.074 -37.026  -5.006   1.00 91.79  ? 895  SER A C   1 
ATOM   7035  O  O   . SER A  1  895  ? -18.640 -35.947  -4.613   1.00 136.20 ? 895  SER A O   1 
ATOM   7036  C  CB  . SER A  1  895  ? -18.103 -38.866  -3.646   1.00 116.37 ? 895  SER A CB  1 
ATOM   7037  O  OG  . SER A  1  895  ? -19.385 -39.265  -3.192   1.00 133.25 ? 895  SER A OG  1 
ATOM   7038  N  N   . THR A  1  896  ? -20.314 -37.198  -5.434   1.00 71.27  ? 896  THR A N   1 
ATOM   7039  C  CA  . THR A  1  896  ? -21.240 -36.083  -5.522   1.00 72.29  ? 896  THR A CA  1 
ATOM   7040  C  C   . THR A  1  896  ? -21.275 -35.419  -4.180   1.00 72.68  ? 896  THR A C   1 
ATOM   7041  O  O   . THR A  1  896  ? -21.425 -34.203  -4.078   1.00 72.63  ? 896  THR A O   1 
ATOM   7042  C  CB  . THR A  1  896  ? -22.650 -36.565  -5.868   1.00 72.35  ? 896  THR A CB  1 
ATOM   7043  O  OG1 . THR A  1  896  ? -22.918 -37.798  -5.185   1.00 72.62  ? 896  THR A OG1 1 
ATOM   7044  C  CG2 . THR A  1  896  ? -22.790 -36.786  -7.374   1.00 72.61  ? 896  THR A CG2 1 
ATOM   7045  N  N   . LYS A  1  897  ? -21.125 -36.251  -3.156   1.00 138.81 ? 897  LYS A N   1 
ATOM   7046  C  CA  . LYS A  1  897  ? -21.182 -35.817  -1.772   1.00 142.71 ? 897  LYS A CA  1 
ATOM   7047  C  C   . LYS A  1  897  ? -20.062 -34.831  -1.470   1.00 110.89 ? 897  LYS A C   1 
ATOM   7048  O  O   . LYS A  1  897  ? -20.249 -33.876  -0.722   1.00 122.75 ? 897  LYS A O   1 
ATOM   7049  C  CB  . LYS A  1  897  ? -21.126 -37.026  -0.831   1.00 164.48 ? 897  LYS A CB  1 
ATOM   7050  C  CG  . LYS A  1  897  ? -22.225 -38.088  -1.064   1.00 174.87 ? 897  LYS A CG  1 
ATOM   7051  C  CD  . LYS A  1  897  ? -23.633 -37.558  -0.768   1.00 175.22 ? 897  LYS A CD  1 
ATOM   7052  C  CE  . LYS A  1  897  ? -24.714 -38.623  -1.015   1.00 160.08 ? 897  LYS A CE  1 
ATOM   7053  N  NZ  . LYS A  1  897  ? -26.104 -38.055  -1.024   1.00 149.20 ? 897  LYS A NZ  1 
ATOM   7054  N  N   . GLN A  1  898  ? -18.899 -35.048  -2.066   1.00 133.73 ? 898  GLN A N   1 
ATOM   7055  C  CA  . GLN A  1  898  ? -17.784 -34.145  -1.826   1.00 133.78 ? 898  GLN A CA  1 
ATOM   7056  C  C   . GLN A  1  898  ? -17.690 -33.080  -2.905   1.00 103.19 ? 898  GLN A C   1 
ATOM   7057  O  O   . GLN A  1  898  ? -17.074 -32.030  -2.716   1.00 95.62  ? 898  GLN A O   1 
ATOM   7058  C  CB  . GLN A  1  898  ? -16.467 -34.923  -1.717   1.00 131.21 ? 898  GLN A CB  1 
ATOM   7059  C  CG  . GLN A  1  898  ? -16.305 -36.030  -2.735   1.00 135.71 ? 898  GLN A CG  1 
ATOM   7060  C  CD  . GLN A  1  898  ? -15.213 -36.989  -2.345   1.00 148.10 ? 898  GLN A CD  1 
ATOM   7061  O  OE1 . GLN A  1  898  ? -14.540 -36.807  -1.325   1.00 156.56 ? 898  GLN A OE1 1 
ATOM   7062  N  NE2 . GLN A  1  898  ? -15.022 -38.021  -3.156   1.00 91.35  ? 898  GLN A NE2 1 
ATOM   7063  N  N   . PHE A  1  899  ? -18.297 -33.355  -4.050   1.00 76.71  ? 899  PHE A N   1 
ATOM   7064  C  CA  . PHE A  1  899  ? -18.402 -32.367  -5.096   1.00 78.06  ? 899  PHE A CA  1 
ATOM   7065  C  C   . PHE A  1  899  ? -19.039 -31.133  -4.489   1.00 77.21  ? 899  PHE A C   1 
ATOM   7066  O  O   . PHE A  1  899  ? -18.454 -30.058  -4.539   1.00 79.30  ? 899  PHE A O   1 
ATOM   7067  C  CB  . PHE A  1  899  ? -19.290 -32.892  -6.205   1.00 73.84  ? 899  PHE A CB  1 
ATOM   7068  C  CG  . PHE A  1  899  ? -19.272 -32.052  -7.445   1.00 73.65  ? 899  PHE A CG  1 
ATOM   7069  C  CD1 . PHE A  1  899  ? -20.336 -31.247  -7.768   1.00 76.83  ? 899  PHE A CD1 1 
ATOM   7070  C  CD2 . PHE A  1  899  ? -18.194 -32.070  -8.283   1.00 77.33  ? 899  PHE A CD2 1 
ATOM   7071  C  CE1 . PHE A  1  899  ? -20.315 -30.481  -8.917   1.00 78.98  ? 899  PHE A CE1 1 
ATOM   7072  C  CE2 . PHE A  1  899  ? -18.166 -31.304  -9.430   1.00 75.18  ? 899  PHE A CE2 1 
ATOM   7073  C  CZ  . PHE A  1  899  ? -19.225 -30.512  -9.739   1.00 76.87  ? 899  PHE A CZ  1 
ATOM   7074  N  N   . GLU A  1  900  ? -20.239 -31.292  -3.922   1.00 124.06 ? 900  GLU A N   1 
ATOM   7075  C  CA  . GLU A  1  900  ? -20.957 -30.190  -3.287   1.00 128.72 ? 900  GLU A CA  1 
ATOM   7076  C  C   . GLU A  1  900  ? -20.091 -29.476  -2.262   1.00 130.27 ? 900  GLU A C   1 
ATOM   7077  O  O   . GLU A  1  900  ? -20.205 -28.269  -2.098   1.00 181.08 ? 900  GLU A O   1 
ATOM   7078  C  CB  . GLU A  1  900  ? -22.231 -30.688  -2.604   1.00 165.59 ? 900  GLU A CB  1 
ATOM   7079  C  CG  . GLU A  1  900  ? -23.171 -31.477  -3.497   1.00 189.24 ? 900  GLU A CG  1 
ATOM   7080  C  CD  . GLU A  1  900  ? -24.445 -31.880  -2.775   1.00 178.86 ? 900  GLU A CD  1 
ATOM   7081  O  OE1 . GLU A  1  900  ? -24.590 -31.523  -1.589   1.00 169.61 ? 900  GLU A OE1 1 
ATOM   7082  O  OE2 . GLU A  1  900  ? -25.291 -32.550  -3.401   1.00 159.42 ? 900  GLU A OE2 1 
ATOM   7083  N  N   . LYS A  1  901  ? -19.222 -30.219  -1.584   1.00 80.12  ? 901  LYS A N   1 
ATOM   7084  C  CA  . LYS A  1  901  ? -18.319 -29.641  -0.596   1.00 99.56  ? 901  LYS A CA  1 
ATOM   7085  C  C   . LYS A  1  901  ? -17.054 -29.046  -1.217   1.00 116.64 ? 901  LYS A C   1 
ATOM   7086  O  O   . LYS A  1  901  ? -15.959 -29.189  -0.663   1.00 134.66 ? 901  LYS A O   1 
ATOM   7087  C  CB  . LYS A  1  901  ? -17.951 -30.701  0.458    1.00 106.54 ? 901  LYS A CB  1 
ATOM   7088  C  CG  . LYS A  1  901  ? -17.329 -30.137  1.747    1.00 110.20 ? 901  LYS A CG  1 
ATOM   7089  C  CD  . LYS A  1  901  ? -17.048 -31.225  2.780    1.00 112.45 ? 901  LYS A CD  1 
ATOM   7090  C  CE  . LYS A  1  901  ? -16.543 -30.633  4.086    1.00 131.49 ? 901  LYS A CE  1 
ATOM   7091  N  NZ  . LYS A  1  901  ? -16.045 -31.682  5.016    1.00 146.19 ? 901  LYS A NZ  1 
ATOM   7092  N  N   . LYS A  1  902  ? -17.192 -28.368  -2.352   1.00 76.46  ? 902  LYS A N   1 
ATOM   7093  C  CA  . LYS A  1  902  ? -16.034 -27.805  -3.043   1.00 76.08  ? 902  LYS A CA  1 
ATOM   7094  C  C   . LYS A  1  902  ? -16.421 -26.657  -3.950   1.00 92.07  ? 902  LYS A C   1 
ATOM   7095  O  O   . LYS A  1  902  ? -15.628 -25.755  -4.203   1.00 141.18 ? 902  LYS A O   1 
ATOM   7096  C  CB  . LYS A  1  902  ? -15.318 -28.870  -3.869   1.00 77.03  ? 902  LYS A CB  1 
ATOM   7097  C  CG  . LYS A  1  902  ? -13.962 -28.435  -4.395   1.00 75.64  ? 902  LYS A CG  1 
ATOM   7098  C  CD  . LYS A  1  902  ? -13.177 -29.624  -4.901   1.00 105.86 ? 902  LYS A CD  1 
ATOM   7099  C  CE  . LYS A  1  902  ? -11.733 -29.253  -5.173   1.00 102.46 ? 902  LYS A CE  1 
ATOM   7100  N  NZ  . LYS A  1  902  ? -10.874 -30.475  -5.303   1.00 101.26 ? 902  LYS A NZ  1 
ATOM   7101  N  N   . TYR A  1  903  ? -17.654 -26.686  -4.427   1.00 84.05  ? 903  TYR A N   1 
ATOM   7102  C  CA  . TYR A  1  903  ? -18.095 -25.712  -5.401   1.00 73.60  ? 903  TYR A CA  1 
ATOM   7103  C  C   . TYR A  1  903  ? -19.412 -25.052  -4.994   1.00 95.06  ? 903  TYR A C   1 
ATOM   7104  O  O   . TYR A  1  903  ? -19.551 -23.832  -5.069   1.00 129.07 ? 903  TYR A O   1 
ATOM   7105  C  CB  . TYR A  1  903  ? -18.258 -26.393  -6.752   1.00 78.17  ? 903  TYR A CB  1 
ATOM   7106  C  CG  . TYR A  1  903  ? -17.040 -27.151  -7.267   1.00 75.90  ? 903  TYR A CG  1 
ATOM   7107  C  CD1 . TYR A  1  903  ? -16.745 -28.440  -6.832   1.00 80.09  ? 903  TYR A CD1 1 
ATOM   7108  C  CD2 . TYR A  1  903  ? -16.213 -26.607  -8.238   1.00 95.55  ? 903  TYR A CD2 1 
ATOM   7109  C  CE1 . TYR A  1  903  ? -15.645 -29.144  -7.336   1.00 85.38  ? 903  TYR A CE1 1 
ATOM   7110  C  CE2 . TYR A  1  903  ? -15.114 -27.306  -8.736   1.00 100.73 ? 903  TYR A CE2 1 
ATOM   7111  C  CZ  . TYR A  1  903  ? -14.834 -28.569  -8.285   1.00 88.45  ? 903  TYR A CZ  1 
ATOM   7112  O  OH  . TYR A  1  903  ? -13.750 -29.245  -8.792   1.00 76.35  ? 903  TYR A OH  1 
ATOM   7113  N  N   . ARG A  1  904  ? -20.381 -25.860  -4.575   1.00 109.33 ? 904  ARG A N   1 
ATOM   7114  C  CA  . ARG A  1  904  ? -21.696 -25.349  -4.200   1.00 75.01  ? 904  ARG A CA  1 
ATOM   7115  C  C   . ARG A  1  904  ? -21.638 -24.432  -2.985   1.00 104.98 ? 904  ARG A C   1 
ATOM   7116  O  O   . ARG A  1  904  ? -20.836 -24.634  -2.072   1.00 113.47 ? 904  ARG A O   1 
ATOM   7117  C  CB  . ARG A  1  904  ? -22.668 -26.510  -3.930   1.00 107.17 ? 904  ARG A CB  1 
ATOM   7118  C  CG  . ARG A  1  904  ? -24.096 -26.087  -3.568   1.00 104.28 ? 904  ARG A CG  1 
ATOM   7119  C  CD  . ARG A  1  904  ? -24.958 -27.269  -3.094   1.00 75.86  ? 904  ARG A CD  1 
ATOM   7120  N  NE  . ARG A  1  904  ? -26.342 -26.863  -2.879   1.00 89.09  ? 904  ARG A NE  1 
ATOM   7121  C  CZ  . ARG A  1  904  ? -27.335 -27.695  -2.574   1.00 144.05 ? 904  ARG A CZ  1 
ATOM   7122  N  NH1 . ARG A  1  904  ? -27.099 -28.996  -2.458   1.00 171.24 ? 904  ARG A NH1 1 
ATOM   7123  N  NH2 . ARG A  1  904  ? -28.566 -27.229  -2.387   1.00 151.17 ? 904  ARG A NH2 1 
ATOM   7124  N  N   . ILE A  1  905  ? -22.517 -23.435  -2.976   1.00 186.61 ? 905  ILE A N   1 
ATOM   7125  C  CA  . ILE A  1  905  ? -22.594 -22.448  -1.899   1.00 194.97 ? 905  ILE A CA  1 
ATOM   7126  C  C   . ILE A  1  905  ? -24.019 -21.930  -1.717   1.00 179.43 ? 905  ILE A C   1 
ATOM   7127  O  O   . ILE A  1  905  ? -24.794 -21.835  -2.680   1.00 141.85 ? 905  ILE A O   1 
ATOM   7128  C  CB  . ILE A  1  905  ? -21.679 -21.228  -2.141   1.00 118.90 ? 905  ILE A CB  1 
ATOM   7129  C  CG1 . ILE A  1  905  ? -21.963 -20.596  -3.519   1.00 140.89 ? 905  ILE A CG1 1 
ATOM   7130  C  CG2 . ILE A  1  905  ? -20.205 -21.582  -1.925   1.00 92.71  ? 905  ILE A CG2 1 
ATOM   7131  C  CD1 . ILE A  1  905  ? -21.927 -21.551  -4.725   1.00 146.69 ? 905  ILE A CD1 1 
ATOM   7132  N  N   . ASP A  1  906  ? -24.355 -21.580  -0.483   1.00 168.72 ? 906  ASP A N   1 
ATOM   7133  C  CA  . ASP A  1  906  ? -25.713 -21.194  -0.147   1.00 180.92 ? 906  ASP A CA  1 
ATOM   7134  C  C   . ASP A  1  906  ? -25.755 -20.344  1.122    1.00 191.09 ? 906  ASP A C   1 
ATOM   7135  O  O   . ASP A  1  906  ? -24.734 -20.113  1.770    1.00 160.07 ? 906  ASP A O   1 
ATOM   7136  C  CB  . ASP A  1  906  ? -26.557 -22.448  0.040    1.00 186.81 ? 906  ASP A CB  1 
ATOM   7137  C  CG  . ASP A  1  906  ? -28.032 -22.198  -0.179   1.00 188.43 ? 906  ASP A CG  1 
ATOM   7138  O  OD1 . ASP A  1  906  ? -28.372 -21.225  -0.885   1.00 201.77 ? 906  ASP A OD1 1 
ATOM   7139  O  OD2 . ASP A  1  906  ? -28.849 -22.986  0.345    1.00 175.73 ? 906  ASP A OD2 1 
ATOM   7140  N  N   . LEU A  1  907  ? -26.951 -19.897  1.475    1.00 224.91 ? 907  LEU A N   1 
ATOM   7141  C  CA  . LEU A  1  907  ? -27.150 -19.137  2.702    1.00 218.97 ? 907  LEU A CA  1 
ATOM   7142  C  C   . LEU A  1  907  ? -27.725 -20.036  3.788    1.00 218.48 ? 907  LEU A C   1 
ATOM   7143  O  O   . LEU A  1  907  ? -27.915 -19.611  4.926    1.00 224.09 ? 907  LEU A O   1 
ATOM   7144  C  CB  . LEU A  1  907  ? -28.079 -17.949  2.454    1.00 194.90 ? 907  LEU A CB  1 
ATOM   7145  C  CG  . LEU A  1  907  ? -29.581 -18.199  2.277    1.00 153.34 ? 907  LEU A CG  1 
ATOM   7146  C  CD1 . LEU A  1  907  ? -30.309 -16.892  1.979    1.00 121.93 ? 907  LEU A CD1 1 
ATOM   7147  C  CD2 . LEU A  1  907  ? -29.849 -19.201  1.170    1.00 161.26 ? 907  LEU A CD2 1 
ATOM   7148  N  N   . MET A  1  908  ? -28.003 -21.283  3.424    1.00 267.53 ? 908  MET A N   1 
ATOM   7149  C  CA  . MET A  1  908  ? -28.562 -22.246  4.365    1.00 284.42 ? 908  MET A CA  1 
ATOM   7150  C  C   . MET A  1  908  ? -27.541 -22.628  5.431    1.00 294.38 ? 908  MET A C   1 
ATOM   7151  O  O   . MET A  1  908  ? -26.588 -23.357  5.156    1.00 247.80 ? 908  MET A O   1 
ATOM   7152  C  CB  . MET A  1  908  ? -29.060 -23.496  3.640    1.00 291.11 ? 908  MET A CB  1 
ATOM   7153  C  CG  . MET A  1  908  ? -29.679 -24.545  4.560    1.00 299.57 ? 908  MET A CG  1 
ATOM   7154  S  SD  . MET A  1  908  ? -31.119 -23.934  5.456    1.00 529.45 ? 908  MET A SD  1 
ATOM   7155  C  CE  . MET A  1  908  ? -31.318 -25.225  6.683    1.00 175.04 ? 908  MET A CE  1 
ATOM   7156  N  N   . GLU A  1  909  ? -27.756 -22.129  6.645    1.00 446.74 ? 909  GLU A N   1 
ATOM   7157  C  CA  . GLU A  1  909  ? -26.865 -22.377  7.779    1.00 451.14 ? 909  GLU A CA  1 
ATOM   7158  C  C   . GLU A  1  909  ? -25.401 -22.536  7.369    1.00 450.14 ? 909  GLU A C   1 
ATOM   7159  O  O   . GLU A  1  909  ? -24.676 -23.369  7.913    1.00 473.56 ? 909  GLU A O   1 
ATOM   7160  C  CB  . GLU A  1  909  ? -27.344 -23.584  8.600    1.00 437.22 ? 909  GLU A CB  1 
ATOM   7161  C  CG  . GLU A  1  909  ? -27.677 -24.818  7.781    1.00 424.05 ? 909  GLU A CG  1 
ATOM   7162  C  CD  . GLU A  1  909  ? -26.458 -25.667  7.473    1.00 415.78 ? 909  GLU A CD  1 
ATOM   7163  O  OE1 . GLU A  1  909  ? -26.378 -26.204  6.351    1.00 418.02 ? 909  GLU A OE1 1 
ATOM   7164  O  OE2 . GLU A  1  909  ? -25.587 -25.797  8.357    1.00 408.13 ? 909  GLU A OE2 1 
ATOM   7165  N  N   . ASP A  1  910  ? -24.973 -21.719  6.409    1.00 267.27 ? 910  ASP A N   1 
ATOM   7166  C  CA  . ASP A  1  910  ? -23.601 -21.763  5.927    1.00 244.89 ? 910  ASP A CA  1 
ATOM   7167  C  C   . ASP A  1  910  ? -22.896 -20.436  6.152    1.00 248.76 ? 910  ASP A C   1 
ATOM   7168  O  O   . ASP A  1  910  ? -22.461 -20.137  7.266    1.00 279.63 ? 910  ASP A O   1 
ATOM   7169  C  CB  . ASP A  1  910  ? -23.566 -22.103  4.442    1.00 225.31 ? 910  ASP A CB  1 
ATOM   7170  C  CG  . ASP A  1  910  ? -22.155 -22.159  3.899    1.00 204.45 ? 910  ASP A CG  1 
ATOM   7171  O  OD1 . ASP A  1  910  ? -21.232 -22.432  4.695    1.00 152.38 ? 910  ASP A OD1 1 
ATOM   7172  O  OD2 . ASP A  1  910  ? -21.967 -21.935  2.686    1.00 211.85 ? 910  ASP A OD2 1 
ATOM   7173  N  N   . ARG A  1  911  ? -22.783 -19.653  5.085    1.00 185.37 ? 911  ARG A N   1 
ATOM   7174  C  CA  . ARG A  1  911  ? -22.138 -18.351  5.158    1.00 196.11 ? 911  ARG A CA  1 
ATOM   7175  C  C   . ARG A  1  911  ? -20.819 -18.490  5.908    1.00 206.79 ? 911  ARG A C   1 
ATOM   7176  O  O   . ARG A  1  911  ? -20.605 -17.852  6.942    1.00 240.50 ? 911  ARG A O   1 
ATOM   7177  C  CB  . ARG A  1  911  ? -23.063 -17.353  5.858    1.00 207.44 ? 911  ARG A CB  1 
ATOM   7178  C  CG  . ARG A  1  911  ? -22.566 -15.915  5.892    1.00 203.02 ? 911  ARG A CG  1 
ATOM   7179  C  CD  . ARG A  1  911  ? -23.492 -15.056  6.736    1.00 215.76 ? 911  ARG A CD  1 
ATOM   7180  N  NE  . ARG A  1  911  ? -23.005 -13.690  6.880    1.00 239.14 ? 911  ARG A NE  1 
ATOM   7181  C  CZ  . ARG A  1  911  ? -23.550 -12.785  7.682    1.00 246.74 ? 911  ARG A CZ  1 
ATOM   7182  N  NH1 . ARG A  1  911  ? -24.609 -13.103  8.421    1.00 249.90 ? 911  ARG A NH1 1 
ATOM   7183  N  NH2 . ARG A  1  911  ? -23.043 -11.563  7.750    1.00 240.96 ? 911  ARG A NH2 1 
ATOM   7184  N  N   . SER A  1  912  ? -19.944 -19.339  5.393    1.00 165.46 ? 912  SER A N   1 
ATOM   7185  C  CA  . SER A  1  912  ? -18.644 -19.532  6.011    1.00 149.41 ? 912  SER A CA  1 
ATOM   7186  C  C   . SER A  1  912  ? -17.613 -18.687  5.287    1.00 148.83 ? 912  SER A C   1 
ATOM   7187  O  O   . SER A  1  912  ? -16.569 -18.346  5.843    1.00 130.40 ? 912  SER A O   1 
ATOM   7188  C  CB  . SER A  1  912  ? -18.243 -21.011  6.003    1.00 154.83 ? 912  SER A CB  1 
ATOM   7189  O  OG  . SER A  1  912  ? -18.298 -21.549  4.692    1.00 152.58 ? 912  SER A OG  1 
ATOM   7190  N  N   . LEU A  1  913  ? -17.924 -18.337  4.045    1.00 173.07 ? 913  LEU A N   1 
ATOM   7191  C  CA  . LEU A  1  913  ? -17.017 -17.555  3.213    1.00 165.86 ? 913  LEU A CA  1 
ATOM   7192  C  C   . LEU A  1  913  ? -16.840 -16.149  3.744    1.00 176.60 ? 913  LEU A C   1 
ATOM   7193  O  O   . LEU A  1  913  ? -15.792 -15.538  3.550    1.00 142.16 ? 913  LEU A O   1 
ATOM   7194  C  CB  . LEU A  1  913  ? -17.540 -17.462  1.781    1.00 125.92 ? 913  LEU A CB  1 
ATOM   7195  C  CG  . LEU A  1  913  ? -17.471 -18.754  0.979    1.00 137.70 ? 913  LEU A CG  1 
ATOM   7196  C  CD1 . LEU A  1  913  ? -17.748 -18.439  -0.485   1.00 104.15 ? 913  LEU A CD1 1 
ATOM   7197  C  CD2 . LEU A  1  913  ? -16.116 -19.459  1.160    1.00 145.60 ? 913  LEU A CD2 1 
ATOM   7198  N  N   . SER A  1  914  ? -17.869 -15.632  4.398    1.00 153.90 ? 914  SER A N   1 
ATOM   7199  C  CA  . SER A  1  914  ? -17.828 -14.275  4.915    1.00 169.48 ? 914  SER A CA  1 
ATOM   7200  C  C   . SER A  1  914  ? -16.592 -14.088  5.775    1.00 172.90 ? 914  SER A C   1 
ATOM   7201  O  O   . SER A  1  914  ? -16.159 -12.964  6.019    1.00 168.30 ? 914  SER A O   1 
ATOM   7202  C  CB  . SER A  1  914  ? -19.090 -13.977  5.722    1.00 183.46 ? 914  SER A CB  1 
ATOM   7203  O  OG  . SER A  1  914  ? -19.366 -15.024  6.635    1.00 208.60 ? 914  SER A OG  1 
ATOM   7204  N  N   . LEU A  1  915  ? -16.026 -15.198  6.221    1.00 208.23 ? 915  LEU A N   1 
ATOM   7205  C  CA  . LEU A  1  915  ? -14.813 -15.171  7.019    1.00 200.82 ? 915  LEU A CA  1 
ATOM   7206  C  C   . LEU A  1  915  ? -13.617 -14.890  6.134    1.00 194.19 ? 915  LEU A C   1 
ATOM   7207  O  O   . LEU A  1  915  ? -12.530 -14.602  6.621    1.00 183.81 ? 915  LEU A O   1 
ATOM   7208  C  CB  . LEU A  1  915  ? -14.616 -16.500  7.748    1.00 188.33 ? 915  LEU A CB  1 
ATOM   7209  C  CG  . LEU A  1  915  ? -15.604 -16.798  8.875    1.00 180.33 ? 915  LEU A CG  1 
ATOM   7210  C  CD1 . LEU A  1  915  ? -15.290 -18.135  9.528    1.00 190.30 ? 915  LEU A CD1 1 
ATOM   7211  C  CD2 . LEU A  1  915  ? -15.596 -15.678  9.913    1.00 166.24 ? 915  LEU A CD2 1 
ATOM   7212  N  N   . TYR A  1  916  ? -13.823 -14.977  4.823    1.00 174.97 ? 916  TYR A N   1 
ATOM   7213  C  CA  . TYR A  1  916  ? -12.756 -14.730  3.864    1.00 173.64 ? 916  TYR A CA  1 
ATOM   7214  C  C   . TYR A  1  916  ? -13.035 -13.483  3.030    1.00 136.10 ? 916  TYR A C   1 
ATOM   7215  O  O   . TYR A  1  916  ? -12.113 -12.793  2.603    1.00 119.83 ? 916  TYR A O   1 
ATOM   7216  C  CB  . TYR A  1  916  ? -12.572 -15.943  2.946    1.00 180.96 ? 916  TYR A CB  1 
ATOM   7217  C  CG  . TYR A  1  916  ? -12.242 -17.222  3.684    1.00 165.64 ? 916  TYR A CG  1 
ATOM   7218  C  CD1 . TYR A  1  916  ? -11.105 -17.315  4.477    1.00 198.38 ? 916  TYR A CD1 1 
ATOM   7219  C  CD2 . TYR A  1  916  ? -13.064 -18.334  3.585    1.00 107.64 ? 916  TYR A CD2 1 
ATOM   7220  C  CE1 . TYR A  1  916  ? -10.800 -18.481  5.150    1.00 198.84 ? 916  TYR A CE1 1 
ATOM   7221  C  CE2 . TYR A  1  916  ? -12.765 -19.506  4.257    1.00 141.70 ? 916  TYR A CE2 1 
ATOM   7222  C  CZ  . TYR A  1  916  ? -11.632 -19.574  5.037    1.00 172.02 ? 916  TYR A CZ  1 
ATOM   7223  O  OH  . TYR A  1  916  ? -11.330 -20.737  5.709    1.00 147.92 ? 916  TYR A OH  1 
ATOM   7224  N  N   . MET A  1  917  ? -14.315 -13.205  2.804    1.00 141.82 ? 917  MET A N   1 
ATOM   7225  C  CA  . MET A  1  917  ? -14.716 -12.039  2.022    1.00 179.47 ? 917  MET A CA  1 
ATOM   7226  C  C   . MET A  1  917  ? -13.851 -10.826  2.353    1.00 190.87 ? 917  MET A C   1 
ATOM   7227  O  O   . MET A  1  917  ? -13.847 -9.836   1.623    1.00 187.14 ? 917  MET A O   1 
ATOM   7228  C  CB  . MET A  1  917  ? -16.191 -11.716  2.266    1.00 234.58 ? 917  MET A CB  1 
ATOM   7229  C  CG  . MET A  1  917  ? -17.159 -12.609  1.503    1.00 252.51 ? 917  MET A CG  1 
ATOM   7230  S  SD  . MET A  1  917  ? -16.579 -12.993  -0.163   1.00 130.68 ? 917  MET A SD  1 
ATOM   7231  C  CE  . MET A  1  917  ? -16.974 -11.475  -1.020   1.00 362.26 ? 917  MET A CE  1 
ATOM   7232  N  N   . GLU A  1  918  ? -13.121 -10.911  3.460    1.00 217.86 ? 918  GLU A N   1 
ATOM   7233  C  CA  . GLU A  1  918  ? -12.252 -9.823   3.892    1.00 238.21 ? 918  GLU A CA  1 
ATOM   7234  C  C   . GLU A  1  918  ? -11.230 -9.477   2.815    1.00 255.38 ? 918  GLU A C   1 
ATOM   7235  O  O   . GLU A  1  918  ? -10.620 -10.362  2.215    1.00 256.40 ? 918  GLU A O   1 
ATOM   7236  C  CB  . GLU A  1  918  ? -11.540 -10.190  5.195    1.00 272.76 ? 918  GLU A CB  1 
ATOM   7237  C  CG  . GLU A  1  918  ? -12.466 -10.712  6.282    1.00 281.06 ? 918  GLU A CG  1 
ATOM   7238  C  CD  . GLU A  1  918  ? -11.806 -11.762  7.155    1.00 272.55 ? 918  GLU A CD  1 
ATOM   7239  O  OE1 . GLU A  1  918  ? -10.572 -11.930  7.057    1.00 255.96 ? 918  GLU A OE1 1 
ATOM   7240  O  OE2 . GLU A  1  918  ? -12.522 -12.421  7.938    1.00 268.30 ? 918  GLU A OE2 1 
ATOM   7241  N  N   . ASN A  1  919  ? -11.046 -8.183   2.577    1.00 183.02 ? 919  ASN A N   1 
ATOM   7242  C  CA  . ASN A  1  919  ? -11.783 -7.155   3.306    1.00 182.35 ? 919  ASN A CA  1 
ATOM   7243  C  C   . ASN A  1  919  ? -13.005 -6.669   2.538    1.00 162.84 ? 919  ASN A C   1 
ATOM   7244  O  O   . ASN A  1  919  ? -12.919 -6.342   1.353    1.00 161.24 ? 919  ASN A O   1 
ATOM   7245  C  CB  . ASN A  1  919  ? -10.869 -5.978   3.645    1.00 199.37 ? 919  ASN A CB  1 
ATOM   7246  C  CG  . ASN A  1  919  ? -9.536  -6.049   2.922    1.00 186.11 ? 919  ASN A CG  1 
ATOM   7247  O  OD1 . ASN A  1  919  ? -8.482  -5.843   3.523    1.00 192.19 ? 919  ASN A OD1 1 
ATOM   7248  N  ND2 . ASN A  1  919  ? -9.580  -6.343   1.626    1.00 165.64 ? 919  ASN A ND2 1 
ATOM   7249  N  N   . SER A  1  920  ? -14.148 -6.620   3.217    1.00 170.91 ? 920  SER A N   1 
ATOM   7250  C  CA  . SER A  1  920  ? -15.387 -6.172   2.599    1.00 185.98 ? 920  SER A CA  1 
ATOM   7251  C  C   . SER A  1  920  ? -16.324 -7.345   2.327    1.00 165.91 ? 920  SER A C   1 
ATOM   7252  O  O   . SER A  1  920  ? -15.990 -8.254   1.565    1.00 112.17 ? 920  SER A O   1 
ATOM   7253  C  CB  . SER A  1  920  ? -15.102 -5.417   1.301    1.00 178.02 ? 920  SER A CB  1 
ATOM   7254  O  OG  . SER A  1  920  ? -16.237 -4.693   0.867    1.00 153.82 ? 920  SER A OG  1 
ATOM   7255  N  N   . ILE A  1  921  ? -17.496 -7.318   2.953    1.00 169.94 ? 921  ILE A N   1 
ATOM   7256  C  CA  . ILE A  1  921  ? -18.481 -8.382   2.777    1.00 167.19 ? 921  ILE A CA  1 
ATOM   7257  C  C   . ILE A  1  921  ? -19.666 -7.902   1.941    1.00 175.81 ? 921  ILE A C   1 
ATOM   7258  O  O   . ILE A  1  921  ? -20.057 -8.553   0.972    1.00 136.84 ? 921  ILE A O   1 
ATOM   7259  C  CB  . ILE A  1  921  ? -19.000 -8.901   4.131    1.00 174.56 ? 921  ILE A CB  1 
ATOM   7260  C  CG1 . ILE A  1  921  ? -19.258 -7.732   5.086    1.00 172.14 ? 921  ILE A CG1 1 
ATOM   7261  C  CG2 . ILE A  1  921  ? -18.013 -9.884   4.737    1.00 176.12 ? 921  ILE A CG2 1 
ATOM   7262  C  CD1 . ILE A  1  921  ? -19.256 -8.126   6.544    1.00 150.75 ? 921  ILE A CD1 1 
ATOM   7263  N  N   . GLU A  1  922  ? -20.228 -6.760   2.317    1.00 305.18 ? 922  GLU A N   1 
ATOM   7264  C  CA  . GLU A  1  922  ? -21.369 -6.192   1.604    1.00 344.33 ? 922  GLU A CA  1 
ATOM   7265  C  C   . GLU A  1  922  ? -22.354 -5.543   2.569    1.00 382.31 ? 922  GLU A C   1 
ATOM   7266  O  O   . GLU A  1  922  ? -22.454 -4.318   2.630    1.00 394.52 ? 922  GLU A O   1 
ATOM   7267  C  CB  . GLU A  1  922  ? -22.074 -7.270   0.780    1.00 327.73 ? 922  GLU A CB  1 
ATOM   7268  C  CG  . GLU A  1  922  ? -21.779 -7.205   -0.710   1.00 313.50 ? 922  GLU A CG  1 
ATOM   7269  C  CD  . GLU A  1  922  ? -20.303 -7.022   -1.005   1.00 308.17 ? 922  GLU A CD  1 
ATOM   7270  O  OE1 . GLU A  1  922  ? -19.609 -8.038   -1.224   1.00 285.89 ? 922  GLU A OE1 1 
ATOM   7271  O  OE2 . GLU A  1  922  ? -19.835 -5.864   -1.011   1.00 324.81 ? 922  GLU A OE2 1 
ATOM   7272  N  N   . ASN A  1  923  ? -23.077 -6.367   3.318    1.00 373.56 ? 923  ASN A N   1 
ATOM   7273  C  CA  . ASN A  1  923  ? -22.933 -7.814   3.218    1.00 358.12 ? 923  ASN A CA  1 
ATOM   7274  C  C   . ASN A  1  923  ? -24.094 -8.462   2.468    1.00 363.64 ? 923  ASN A C   1 
ATOM   7275  O  O   . ASN A  1  923  ? -25.256 -8.152   2.725    1.00 383.94 ? 923  ASN A O   1 
ATOM   7276  C  CB  . ASN A  1  923  ? -22.796 -8.437   4.608    1.00 326.01 ? 923  ASN A CB  1 
ATOM   7277  C  CG  . ASN A  1  923  ? -24.026 -8.217   5.469    1.00 284.17 ? 923  ASN A CG  1 
ATOM   7278  O  OD1 . ASN A  1  923  ? -24.866 -7.368   5.167    1.00 277.83 ? 923  ASN A OD1 1 
ATOM   7279  N  ND2 . ASN A  1  923  ? -24.133 -8.978   6.553    1.00 255.34 ? 923  ASN A ND2 1 
ATOM   7280  N  N   . ASP A  1  924  ? -23.770 -9.359   1.544    1.00 350.07 ? 924  ASP A N   1 
ATOM   7281  C  CA  . ASP A  1  924  ? -24.788 -10.050  0.757    1.00 309.65 ? 924  ASP A CA  1 
ATOM   7282  C  C   . ASP A  1  924  ? -25.519 -9.094   -0.181   1.00 292.38 ? 924  ASP A C   1 
ATOM   7283  O  O   . ASP A  1  924  ? -26.205 -9.522   -1.116   1.00 273.23 ? 924  ASP A O   1 
ATOM   7284  C  CB  . ASP A  1  924  ? -25.782 -10.784  1.663    1.00 272.81 ? 924  ASP A CB  1 
ATOM   7285  C  CG  . ASP A  1  924  ? -25.099 -11.655  2.715    1.00 204.81 ? 924  ASP A CG  1 
ATOM   7286  O  OD1 . ASP A  1  924  ? -23.855 -11.587  2.838    1.00 205.69 ? 924  ASP A OD1 1 
ATOM   7287  O  OD2 . ASP A  1  924  ? -25.802 -12.406  3.429    1.00 119.41 ? 924  ASP A OD2 1 
ATOM   7288  N  N   . SER A  1  925  ? -25.353 -7.797   0.069    1.00 302.02 ? 925  SER A N   1 
ATOM   7289  C  CA  . SER A  1  925  ? -25.996 -6.754   -0.727   1.00 292.24 ? 925  SER A CA  1 
ATOM   7290  C  C   . SER A  1  925  ? -27.436 -7.131   -1.078   1.00 309.64 ? 925  SER A C   1 
ATOM   7291  O  O   . SER A  1  925  ? -28.196 -7.567   -0.220   1.00 310.46 ? 925  SER A O   1 
ATOM   7292  C  CB  . SER A  1  925  ? -25.186 -6.466   -1.994   1.00 244.52 ? 925  SER A CB  1 
ATOM   7293  O  OG  . SER A  1  925  ? -25.404 -5.143   -2.458   1.00 217.74 ? 925  SER A OG  1 
ATOM   7294  N  N   . SER A  1  926  ? -27.806 -6.963   -2.342   1.00 569.66 ? 926  SER A N   1 
ATOM   7295  C  CA  . SER A  1  926  ? -29.163 -7.267   -2.778   1.00 569.04 ? 926  SER A CA  1 
ATOM   7296  C  C   . SER A  1  926  ? -29.180 -8.275   -3.922   1.00 562.15 ? 926  SER A C   1 
ATOM   7297  O  O   . SER A  1  926  ? -28.576 -8.044   -4.975   1.00 560.49 ? 926  SER A O   1 
ATOM   7298  C  CB  . SER A  1  926  ? -29.886 -5.987   -3.204   1.00 20.00  ? 926  SER A CB  1 
ATOM   7299  O  OG  . SER A  1  926  ? -29.265 -5.404   -4.336   1.00 20.00  ? 926  SER A OG  1 
ATOM   7300  N  N   . VAL A  1  927  ? -29.879 -9.391   -3.718   1.00 182.84 ? 927  VAL A N   1 
ATOM   7301  C  CA  . VAL A  1  927  ? -29.955 -10.479  -4.692   1.00 175.50 ? 927  VAL A CA  1 
ATOM   7302  C  C   . VAL A  1  927  ? -28.670 -10.580  -5.498   1.00 171.76 ? 927  VAL A C   1 
ATOM   7303  O  O   . VAL A  1  927  ? -27.573 -10.492  -4.945   1.00 170.85 ? 927  VAL A O   1 
ATOM   7304  C  CB  . VAL A  1  927  ? -31.161 -10.330  -5.658   1.00 176.58 ? 927  VAL A CB  1 
ATOM   7305  C  CG1 . VAL A  1  927  ? -32.469 -10.589  -4.927   1.00 176.43 ? 927  VAL A CG1 1 
ATOM   7306  C  CG2 . VAL A  1  927  ? -31.180 -8.958   -6.316   1.00 184.32 ? 927  VAL A CG2 1 
ATOM   7307  N  N   . GLN A  1  928  ? -28.824 -10.772  -6.804   1.00 329.50 ? 928  GLN A N   1 
ATOM   7308  C  CA  . GLN A  1  928  ? -27.699 -10.822  -7.727   1.00 326.73 ? 928  GLN A CA  1 
ATOM   7309  C  C   . GLN A  1  928  ? -26.680 -11.879  -7.312   1.00 321.12 ? 928  GLN A C   1 
ATOM   7310  O  O   . GLN A  1  928  ? -26.604 -12.948  -7.909   1.00 316.25 ? 928  GLN A O   1 
ATOM   7311  C  CB  . GLN A  1  928  ? -27.036 -9.449   -7.838   1.00 332.33 ? 928  GLN A CB  1 
ATOM   7312  C  CG  . GLN A  1  928  ? -27.980 -8.360   -8.325   1.00 338.35 ? 928  GLN A CG  1 
ATOM   7313  C  CD  . GLN A  1  928  ? -27.346 -6.988   -8.308   1.00 345.65 ? 928  GLN A CD  1 
ATOM   7314  O  OE1 . GLN A  1  928  ? -26.186 -6.834   -7.932   1.00 346.06 ? 928  GLN A OE1 1 
ATOM   7315  N  NE2 . GLN A  1  928  ? -28.104 -5.977   -8.717   1.00 351.86 ? 928  GLN A NE2 1 
ATOM   7316  N  N   . ASP A  1  929  ? -25.904 -11.575  -6.280   1.00 209.33 ? 929  ASP A N   1 
ATOM   7317  C  CA  . ASP A  1  929  ? -24.865 -12.473  -5.801   1.00 204.60 ? 929  ASP A CA  1 
ATOM   7318  C  C   . ASP A  1  929  ? -25.430 -13.842  -5.475   1.00 199.37 ? 929  ASP A C   1 
ATOM   7319  O  O   . ASP A  1  929  ? -25.003 -14.847  -6.032   1.00 194.22 ? 929  ASP A O   1 
ATOM   7320  C  CB  . ASP A  1  929  ? -24.197 -11.877  -4.572   1.00 208.74 ? 929  ASP A CB  1 
ATOM   7321  C  CG  . ASP A  1  929  ? -23.767 -10.441  -4.797   1.00 214.10 ? 929  ASP A CG  1 
ATOM   7322  O  OD1 . ASP A  1  929  ? -23.716 -10.012  -5.970   1.00 214.24 ? 929  ASP A OD1 1 
ATOM   7323  O  OD2 . ASP A  1  929  ? -23.476 -9.742   -3.806   1.00 218.62 ? 929  ASP A OD2 1 
ATOM   7324  N  N   . LEU A  1  930  ? -26.395 -13.871  -4.570   1.00 223.57 ? 930  LEU A N   1 
ATOM   7325  C  CA  . LEU A  1  930  ? -27.056 -15.114  -4.222   1.00 219.34 ? 930  LEU A CA  1 
ATOM   7326  C  C   . LEU A  1  930  ? -27.417 -15.896  -5.475   1.00 215.15 ? 930  LEU A C   1 
ATOM   7327  O  O   . LEU A  1  930  ? -27.442 -17.125  -5.460   1.00 210.37 ? 930  LEU A O   1 
ATOM   7328  C  CB  . LEU A  1  930  ? -28.318 -14.819  -3.410   1.00 222.88 ? 930  LEU A CB  1 
ATOM   7329  C  CG  . LEU A  1  930  ? -28.080 -14.046  -2.113   1.00 227.70 ? 930  LEU A CG  1 
ATOM   7330  C  CD1 . LEU A  1  930  ? -29.390 -13.840  -1.373   1.00 231.36 ? 930  LEU A CD1 1 
ATOM   7331  C  CD2 . LEU A  1  930  ? -27.081 -14.787  -1.242   1.00 224.49 ? 930  LEU A CD2 1 
ATOM   7332  N  N   . LEU A  1  931  ? -27.676 -15.168  -6.558   1.00 160.84 ? 931  LEU A N   1 
ATOM   7333  C  CA  . LEU A  1  931  ? -28.130 -15.759  -7.812   1.00 158.45 ? 931  LEU A CA  1 
ATOM   7334  C  C   . LEU A  1  931  ? -26.975 -16.223  -8.705   1.00 155.25 ? 931  LEU A C   1 
ATOM   7335  O  O   . LEU A  1  931  ? -27.105 -17.211  -9.415   1.00 151.89 ? 931  LEU A O   1 
ATOM   7336  C  CB  . LEU A  1  931  ? -29.042 -14.785  -8.576   1.00 162.77 ? 931  LEU A CB  1 
ATOM   7337  C  CG  . LEU A  1  931  ? -30.367 -14.369  -7.916   1.00 166.52 ? 931  LEU A CG  1 
ATOM   7338  C  CD1 . LEU A  1  931  ? -31.051 -13.248  -8.699   1.00 171.74 ? 931  LEU A CD1 1 
ATOM   7339  C  CD2 . LEU A  1  931  ? -31.303 -15.553  -7.761   1.00 163.48 ? 931  LEU A CD2 1 
ATOM   7340  N  N   . ASP A  1  932  ? -25.856 -15.502  -8.676   1.00 134.15 ? 932  ASP A N   1 
ATOM   7341  C  CA  . ASP A  1  932  ? -24.695 -15.877  -9.481   1.00 131.45 ? 932  ASP A CA  1 
ATOM   7342  C  C   . ASP A  1  932  ? -24.152 -17.211  -9.045   1.00 126.56 ? 932  ASP A C   1 
ATOM   7343  O  O   . ASP A  1  932  ? -23.611 -17.974  -9.838   1.00 123.54 ? 932  ASP A O   1 
ATOM   7344  C  CB  . ASP A  1  932  ? -23.584 -14.845  -9.339   1.00 134.23 ? 932  ASP A CB  1 
ATOM   7345  C  CG  . ASP A  1  932  ? -23.611 -13.819  -10.429  1.00 138.85 ? 932  ASP A CG  1 
ATOM   7346  O  OD1 . ASP A  1  932  ? -24.486 -13.926  -11.314  1.00 139.36 ? 932  ASP A OD1 1 
ATOM   7347  O  OD2 . ASP A  1  932  ? -22.753 -12.906  -10.404  1.00 142.32 ? 932  ASP A OD2 1 
ATOM   7348  N  N   . GLU A  1  933  ? -24.310 -17.479  -7.758   1.00 110.79 ? 933  GLU A N   1 
ATOM   7349  C  CA  . GLU A  1  933  ? -23.714 -18.631  -7.101   1.00 113.47 ? 933  GLU A CA  1 
ATOM   7350  C  C   . GLU A  1  933  ? -24.342 -19.950  -7.490   1.00 120.83 ? 933  GLU A C   1 
ATOM   7351  O  O   . GLU A  1  933  ? -23.702 -20.995  -7.404   1.00 100.50 ? 933  GLU A O   1 
ATOM   7352  C  CB  . GLU A  1  933  ? -23.821 -18.466  -5.593   1.00 140.90 ? 933  GLU A CB  1 
ATOM   7353  C  CG  . GLU A  1  933  ? -22.945 -17.367  -5.118   1.00 157.74 ? 933  GLU A CG  1 
ATOM   7354  C  CD  . GLU A  1  933  ? -21.608 -17.473  -5.782   1.00 142.18 ? 933  GLU A CD  1 
ATOM   7355  O  OE1 . GLU A  1  933  ? -21.139 -18.613  -5.894   1.00 110.30 ? 933  GLU A OE1 1 
ATOM   7356  O  OE2 . GLU A  1  933  ? -21.036 -16.450  -6.201   1.00 186.94 ? 933  GLU A OE2 1 
ATOM   7357  N  N   . GLU A  1  934  ? -25.603 -19.912  -7.891   1.00 214.40 ? 934  GLU A N   1 
ATOM   7358  C  CA  . GLU A  1  934  ? -26.297 -21.128  -8.263   1.00 196.63 ? 934  GLU A CA  1 
ATOM   7359  C  C   . GLU A  1  934  ? -26.300 -21.270  -9.779   1.00 179.66 ? 934  GLU A C   1 
ATOM   7360  O  O   . GLU A  1  934  ? -26.545 -22.349  -10.308  1.00 158.98 ? 934  GLU A O   1 
ATOM   7361  C  CB  . GLU A  1  934  ? -27.711 -21.124  -7.675   1.00 202.64 ? 934  GLU A CB  1 
ATOM   7362  C  CG  . GLU A  1  934  ? -27.709 -20.957  -6.159   1.00 215.05 ? 934  GLU A CG  1 
ATOM   7363  C  CD  . GLU A  1  934  ? -29.091 -20.757  -5.567   1.00 217.28 ? 934  GLU A CD  1 
ATOM   7364  O  OE1 . GLU A  1  934  ? -30.094 -20.895  -6.302   1.00 194.11 ? 934  GLU A OE1 1 
ATOM   7365  O  OE2 . GLU A  1  934  ? -29.167 -20.460  -4.355   1.00 222.37 ? 934  GLU A OE2 1 
ATOM   7366  N  N   . TYR A  1  935  ? -26.003 -20.177  -10.465  1.00 136.21 ? 935  TYR A N   1 
ATOM   7367  C  CA  . TYR A  1  935  ? -25.907 -20.179  -11.918  1.00 119.81 ? 935  TYR A CA  1 
ATOM   7368  C  C   . TYR A  1  935  ? -24.545 -20.696  -12.356  1.00 94.12  ? 935  TYR A C   1 
ATOM   7369  O  O   . TYR A  1  935  ? -24.444 -21.384  -13.367  1.00 108.19 ? 935  TYR A O   1 
ATOM   7370  C  CB  . TYR A  1  935  ? -26.172 -18.773  -12.471  1.00 151.77 ? 935  TYR A CB  1 
ATOM   7371  C  CG  . TYR A  1  935  ? -26.268 -18.650  -13.986  1.00 163.89 ? 935  TYR A CG  1 
ATOM   7372  C  CD1 . TYR A  1  935  ? -27.466 -18.894  -14.652  1.00 170.62 ? 935  TYR A CD1 1 
ATOM   7373  C  CD2 . TYR A  1  935  ? -25.174 -18.237  -14.745  1.00 159.95 ? 935  TYR A CD2 1 
ATOM   7374  C  CE1 . TYR A  1  935  ? -27.560 -18.763  -16.032  1.00 179.38 ? 935  TYR A CE1 1 
ATOM   7375  C  CE2 . TYR A  1  935  ? -25.256 -18.099  -16.122  1.00 165.85 ? 935  TYR A CE2 1 
ATOM   7376  C  CZ  . TYR A  1  935  ? -26.449 -18.362  -16.761  1.00 185.30 ? 935  TYR A CZ  1 
ATOM   7377  O  OH  . TYR A  1  935  ? -26.522 -18.221  -18.131  1.00 198.12 ? 935  TYR A OH  1 
ATOM   7378  N  N   . THR A  1  936  ? -23.500 -20.366  -11.602  1.00 99.73  ? 936  THR A N   1 
ATOM   7379  C  CA  . THR A  1  936  ? -22.164 -20.897  -11.860  1.00 117.92 ? 936  THR A CA  1 
ATOM   7380  C  C   . THR A  1  936  ? -22.259 -22.430  -11.812  1.00 98.95  ? 936  THR A C   1 
ATOM   7381  O  O   . THR A  1  936  ? -21.847 -23.133  -12.747  1.00 76.26  ? 936  THR A O   1 
ATOM   7382  C  CB  . THR A  1  936  ? -21.090 -20.290  -10.861  1.00 139.64 ? 936  THR A CB  1 
ATOM   7383  O  OG1 . THR A  1  936  ? -19.764 -20.743  -11.169  1.00 107.35 ? 936  THR A OG1 1 
ATOM   7384  C  CG2 . THR A  1  936  ? -21.403 -20.644  -9.419   1.00 145.48 ? 936  THR A CG2 1 
ATOM   7385  N  N   . GLN A  1  937  ? -22.867 -22.942  -10.753  1.00 82.51  ? 937  GLN A N   1 
ATOM   7386  C  CA  . GLN A  1  937  ? -22.913 -24.379  -10.537  1.00 82.30  ? 937  GLN A CA  1 
ATOM   7387  C  C   . GLN A  1  937  ? -23.867 -25.087  -11.510  1.00 83.59  ? 937  GLN A C   1 
ATOM   7388  O  O   . GLN A  1  937  ? -23.748 -26.299  -11.724  1.00 86.48  ? 937  GLN A O   1 
ATOM   7389  C  CB  . GLN A  1  937  ? -23.274 -24.691  -9.087   1.00 81.72  ? 937  GLN A CB  1 
ATOM   7390  C  CG  . GLN A  1  937  ? -23.262 -26.158  -8.737   1.00 81.56  ? 937  GLN A CG  1 
ATOM   7391  C  CD  . GLN A  1  937  ? -23.355 -26.386  -7.256   1.00 88.11  ? 937  GLN A CD  1 
ATOM   7392  O  OE1 . GLN A  1  937  ? -22.987 -27.449  -6.755   1.00 78.72  ? 937  GLN A OE1 1 
ATOM   7393  N  NE2 . GLN A  1  937  ? -23.837 -25.386  -6.536   1.00 152.58 ? 937  GLN A NE2 1 
ATOM   7394  N  N   . LEU A  1  938  ? -24.810 -24.358  -12.111  1.00 120.60 ? 938  LEU A N   1 
ATOM   7395  C  CA  . LEU A  1  938  ? -25.656 -24.978  -13.126  1.00 120.57 ? 938  LEU A CA  1 
ATOM   7396  C  C   . LEU A  1  938  ? -24.783 -25.479  -14.264  1.00 133.67 ? 938  LEU A C   1 
ATOM   7397  O  O   . LEU A  1  938  ? -25.027 -26.561  -14.790  1.00 166.82 ? 938  LEU A O   1 
ATOM   7398  C  CB  . LEU A  1  938  ? -26.718 -24.021  -13.658  1.00 127.04 ? 938  LEU A CB  1 
ATOM   7399  C  CG  . LEU A  1  938  ? -27.904 -23.760  -12.735  1.00 121.90 ? 938  LEU A CG  1 
ATOM   7400  C  CD1 . LEU A  1  938  ? -29.041 -23.099  -13.520  1.00 114.46 ? 938  LEU A CD1 1 
ATOM   7401  C  CD2 . LEU A  1  938  ? -28.361 -25.051  -12.059  1.00 109.98 ? 938  LEU A CD2 1 
ATOM   7402  N  N   . VAL A  1  939  ? -23.759 -24.710  -14.624  1.00 92.85  ? 939  VAL A N   1 
ATOM   7403  C  CA  . VAL A  1  939  ? -22.884 -25.122  -15.715  1.00 104.14 ? 939  VAL A CA  1 
ATOM   7404  C  C   . VAL A  1  939  ? -21.714 -25.970  -15.207  1.00 97.78  ? 939  VAL A C   1 
ATOM   7405  O  O   . VAL A  1  939  ? -21.299 -26.911  -15.881  1.00 134.44 ? 939  VAL A O   1 
ATOM   7406  C  CB  . VAL A  1  939  ? -22.418 -23.936  -16.630  1.00 114.79 ? 939  VAL A CB  1 
ATOM   7407  C  CG1 . VAL A  1  939  ? -21.195 -24.323  -17.449  1.00 93.63  ? 939  VAL A CG1 1 
ATOM   7408  C  CG2 . VAL A  1  939  ? -23.543 -23.480  -17.578  1.00 73.95  ? 939  VAL A CG2 1 
ATOM   7409  N  N   . ALA A  1  940  ? -21.195 -25.674  -14.016  1.00 81.73  ? 940  ALA A N   1 
ATOM   7410  C  CA  . ALA A  1  940  ? -20.108 -26.514  -13.467  1.00 86.15  ? 940  ALA A CA  1 
ATOM   7411  C  C   . ALA A  1  940  ? -20.668 -27.910  -13.229  1.00 81.97  ? 940  ALA A C   1 
ATOM   7412  O  O   . ALA A  1  940  ? -19.916 -28.869  -13.100  1.00 79.48  ? 940  ALA A O   1 
ATOM   7413  C  CB  . ALA A  1  940  ? -19.477 -25.920  -12.163  1.00 77.39  ? 940  ALA A CB  1 
ATOM   7414  N  N   . ASP A  1  941  ? -22.001 -27.997  -13.196  1.00 76.40  ? 941  ASP A N   1 
ATOM   7415  C  CA  . ASP A  1  941  ? -22.730 -29.243  -12.973  1.00 79.34  ? 941  ASP A CA  1 
ATOM   7416  C  C   . ASP A  1  941  ? -23.145 -29.939  -14.269  1.00 77.64  ? 941  ASP A C   1 
ATOM   7417  O  O   . ASP A  1  941  ? -23.199 -31.163  -14.312  1.00 87.92  ? 941  ASP A O   1 
ATOM   7418  C  CB  . ASP A  1  941  ? -23.966 -29.000  -12.116  1.00 116.92 ? 941  ASP A CB  1 
ATOM   7419  C  CG  . ASP A  1  941  ? -24.974 -30.124  -12.222  1.00 187.33 ? 941  ASP A CG  1 
ATOM   7420  O  OD1 . ASP A  1  941  ? -24.580 -31.299  -12.052  1.00 194.26 ? 941  ASP A OD1 1 
ATOM   7421  O  OD2 . ASP A  1  941  ? -26.167 -29.839  -12.475  1.00 232.79 ? 941  ASP A OD2 1 
ATOM   7422  N  N   . ARG A  1  942  ? -23.451 -29.177  -15.316  1.00 113.60 ? 942  ARG A N   1 
ATOM   7423  C  CA  . ARG A  1  942  ? -23.707 -29.771  -16.627  1.00 127.76 ? 942  ARG A CA  1 
ATOM   7424  C  C   . ARG A  1  942  ? -22.409 -30.298  -17.196  1.00 110.07 ? 942  ARG A C   1 
ATOM   7425  O  O   . ARG A  1  942  ? -22.388 -30.892  -18.264  1.00 115.44 ? 942  ARG A O   1 
ATOM   7426  C  CB  . ARG A  1  942  ? -24.294 -28.747  -17.606  1.00 191.36 ? 942  ARG A CB  1 
ATOM   7427  C  CG  . ARG A  1  942  ? -25.764 -28.404  -17.378  1.00 232.14 ? 942  ARG A CG  1 
ATOM   7428  C  CD  . ARG A  1  942  ? -26.297 -27.474  -18.473  1.00 255.07 ? 942  ARG A CD  1 
ATOM   7429  N  NE  . ARG A  1  942  ? -27.651 -27.002  -18.179  1.00 247.74 ? 942  ARG A NE  1 
ATOM   7430  C  CZ  . ARG A  1  942  ? -28.339 -26.158  -18.949  1.00 222.16 ? 942  ARG A CZ  1 
ATOM   7431  N  NH1 . ARG A  1  942  ? -27.802 -25.681  -20.069  1.00 228.19 ? 942  ARG A NH1 1 
ATOM   7432  N  NH2 . ARG A  1  942  ? -29.566 -25.785  -18.594  1.00 185.29 ? 942  ARG A NH2 1 
ATOM   7433  N  N   . GLU A  1  943  ? -21.318 -30.073  -16.471  1.00 84.17  ? 943  GLU A N   1 
ATOM   7434  C  CA  . GLU A  1  943  ? -20.003 -30.531  -16.905  1.00 76.23  ? 943  GLU A CA  1 
ATOM   7435  C  C   . GLU A  1  943  ? -19.590 -31.799  -16.166  1.00 86.82  ? 943  GLU A C   1 
ATOM   7436  O  O   . GLU A  1  943  ? -18.782 -32.584  -16.663  1.00 115.96 ? 943  GLU A O   1 
ATOM   7437  C  CB  . GLU A  1  943  ? -18.957 -29.435  -16.691  1.00 89.08  ? 943  GLU A CB  1 
ATOM   7438  C  CG  . GLU A  1  943  ? -19.303 -28.109  -17.348  1.00 147.69 ? 943  GLU A CG  1 
ATOM   7439  C  CD  . GLU A  1  943  ? -18.119 -27.166  -17.420  1.00 163.91 ? 943  GLU A CD  1 
ATOM   7440  O  OE1 . GLU A  1  943  ? -17.132 -27.393  -16.688  1.00 166.74 ? 943  GLU A OE1 1 
ATOM   7441  O  OE2 . GLU A  1  943  ? -18.173 -26.198  -18.207  1.00 145.50 ? 943  GLU A OE2 1 
ATOM   7442  N  N   . LEU A  1  944  ? -20.151 -31.995  -14.977  1.00 105.29 ? 944  LEU A N   1 
ATOM   7443  C  CA  . LEU A  1  944  ? -19.845 -33.169  -14.168  1.00 102.25 ? 944  LEU A CA  1 
ATOM   7444  C  C   . LEU A  1  944  ? -20.528 -34.414  -14.724  1.00 149.24 ? 944  LEU A C   1 
ATOM   7445  O  O   . LEU A  1  944  ? -20.005 -35.523  -14.610  1.00 217.85 ? 944  LEU A O   1 
ATOM   7446  C  CB  . LEU A  1  944  ? -20.265 -32.942  -12.714  1.00 156.85 ? 944  LEU A CB  1 
ATOM   7447  C  CG  . LEU A  1  944  ? -19.913 -34.055  -11.726  1.00 102.96 ? 944  LEU A CG  1 
ATOM   7448  C  CD1 . LEU A  1  944  ? -21.008 -35.112  -11.694  1.00 118.47 ? 944  LEU A CD1 1 
ATOM   7449  C  CD2 . LEU A  1  944  ? -18.570 -34.680  -12.074  1.00 99.05  ? 944  LEU A CD2 1 
ATOM   7450  N  N   . LEU A  1  945  ? -21.698 -34.223  -15.324  1.00 98.91  ? 945  LEU A N   1 
ATOM   7451  C  CA  . LEU A  1  945  ? -22.453 -35.329  -15.900  1.00 137.35 ? 945  LEU A CA  1 
ATOM   7452  C  C   . LEU A  1  945  ? -21.966 -35.656  -17.307  1.00 167.27 ? 945  LEU A C   1 
ATOM   7453  O  O   . LEU A  1  945  ? -22.114 -36.783  -17.779  1.00 246.99 ? 945  LEU A O   1 
ATOM   7454  C  CB  . LEU A  1  945  ? -23.948 -35.001  -15.924  1.00 143.23 ? 945  LEU A CB  1 
ATOM   7455  C  CG  . LEU A  1  945  ? -24.858 -36.040  -16.581  1.00 147.52 ? 945  LEU A CG  1 
ATOM   7456  C  CD1 . LEU A  1  945  ? -26.288 -35.894  -16.082  1.00 112.81 ? 945  LEU A CD1 1 
ATOM   7457  C  CD2 . LEU A  1  945  ? -24.801 -35.926  -18.095  1.00 166.34 ? 945  LEU A CD2 1 
ATOM   7458  N  N   . CYS A  1  946  ? -21.383 -34.664  -17.972  1.00 83.48  ? 946  CYS A N   1 
ATOM   7459  C  CA  . CYS A  1  946  ? -20.871 -34.845  -19.326  1.00 83.90  ? 946  CYS A CA  1 
ATOM   7460  C  C   . CYS A  1  946  ? -19.616 -34.010  -19.557  1.00 82.60  ? 946  CYS A C   1 
ATOM   7461  O  O   . CYS A  1  946  ? -19.698 -32.826  -19.882  1.00 82.79  ? 946  CYS A O   1 
ATOM   7462  C  CB  . CYS A  1  946  ? -21.942 -34.480  -20.355  1.00 84.38  ? 946  CYS A CB  1 
ATOM   7463  S  SG  . CYS A  1  946  ? -21.333 -33.512  -21.755  1.00 85.23  ? 946  CYS A SG  1 
ATOM   7464  N  N   . LYS A  1  947  ? -18.456 -34.636  -19.385  1.00 77.35  ? 947  LYS A N   1 
ATOM   7465  C  CA  . LYS A  1  947  ? -18.393 -36.041  -18.998  1.00 77.13  ? 947  LYS A CA  1 
ATOM   7466  C  C   . LYS A  1  947  ? -19.027 -36.266  -17.630  1.00 77.79  ? 947  LYS A C   1 
ATOM   7467  O  O   . LYS A  1  947  ? -19.374 -35.313  -16.932  1.00 77.65  ? 947  LYS A O   1 
ATOM   7468  C  CB  . LYS A  1  947  ? -16.943 -36.530  -18.993  1.00 76.87  ? 947  LYS A CB  1 
ATOM   7469  C  CG  . LYS A  1  947  ? -15.913 -35.419  -19.117  1.00 76.29  ? 947  LYS A CG  1 
ATOM   7470  C  CD  . LYS A  1  947  ? -16.033 -34.425  -17.973  1.00 76.78  ? 947  LYS A CD  1 
ATOM   7471  C  CE  . LYS A  1  947  ? -14.733 -33.664  -17.763  1.00 76.22  ? 947  LYS A CE  1 
ATOM   7472  N  NZ  . LYS A  1  947  ? -14.248 -33.770  -16.359  1.00 76.62  ? 947  LYS A NZ  1 
ATOM   7473  N  N   . PHE A  1  948  ? -19.178 -37.532  -17.255  1.00 97.32  ? 948  PHE A N   1 
ATOM   7474  C  CA  . PHE A  1  948  ? -18.759 -38.638  -18.106  1.00 82.07  ? 948  PHE A CA  1 
ATOM   7475  C  C   . PHE A  1  948  ? -19.559 -38.670  -19.404  1.00 132.60 ? 948  PHE A C   1 
ATOM   7476  O  O   . PHE A  1  948  ? -19.371 -37.827  -20.281  1.00 181.49 ? 948  PHE A O   1 
ATOM   7477  C  CB  . PHE A  1  948  ? -18.904 -39.970  -17.365  1.00 167.32 ? 948  PHE A CB  1 
ATOM   7478  C  CG  . PHE A  1  948  ? -19.814 -39.902  -16.171  1.00 195.08 ? 948  PHE A CG  1 
ATOM   7479  C  CD1 . PHE A  1  948  ? -21.171 -40.143  -16.303  1.00 182.12 ? 948  PHE A CD1 1 
ATOM   7480  C  CD2 . PHE A  1  948  ? -19.311 -39.598  -14.917  1.00 182.22 ? 948  PHE A CD2 1 
ATOM   7481  C  CE1 . PHE A  1  948  ? -22.010 -40.083  -15.207  1.00 161.42 ? 948  PHE A CE1 1 
ATOM   7482  C  CE2 . PHE A  1  948  ? -20.146 -39.536  -13.817  1.00 149.53 ? 948  PHE A CE2 1 
ATOM   7483  C  CZ  . PHE A  1  948  ? -21.497 -39.778  -13.963  1.00 142.89 ? 948  PHE A CZ  1 
ATOM   7484  N  N   . ILE A  1  949  ? -20.451 -39.648  -19.519  1.00 125.40 ? 949  ILE A N   1 
ATOM   7485  C  CA  . ILE A  1  949  ? -21.281 -39.792  -20.709  1.00 175.82 ? 949  ILE A CA  1 
ATOM   7486  C  C   . ILE A  1  949  ? -20.441 -39.702  -21.979  1.00 197.87 ? 949  ILE A C   1 
ATOM   7487  O  O   . ILE A  1  949  ? -20.967 -39.787  -23.089  1.00 124.77 ? 949  ILE A O   1 
ATOM   7488  C  CB  . ILE A  1  949  ? -22.387 -38.723  -20.759  1.00 223.17 ? 949  ILE A CB  1 
ATOM   7489  C  CG1 . ILE A  1  949  ? -21.833 -37.406  -21.307  1.00 262.49 ? 949  ILE A CG1 1 
ATOM   7490  C  CG2 . ILE A  1  949  ? -22.992 -38.518  -19.378  1.00 147.16 ? 949  ILE A CG2 1 
ATOM   7491  C  CD1 . ILE A  1  949  ? -22.899 -36.450  -21.794  1.00 264.50 ? 949  ILE A CD1 1 
ATOM   7492  N  N   . PHE A  1  950  ? -19.135 -39.530  -21.808  1.00 205.23 ? 950  PHE A N   1 
ATOM   7493  C  CA  . PHE A  1  950  ? -18.220 -39.428  -22.939  1.00 200.74 ? 950  PHE A CA  1 
ATOM   7494  C  C   . PHE A  1  950  ? -16.902 -40.136  -22.647  1.00 191.41 ? 950  PHE A C   1 
ATOM   7495  O  O   . PHE A  1  950  ? -16.417 -40.926  -23.456  1.00 214.77 ? 950  PHE A O   1 
ATOM   7496  C  CB  . PHE A  1  950  ? -17.964 -37.961  -23.290  1.00 87.39  ? 950  PHE A CB  1 
ATOM   7497  C  CG  . PHE A  1  950  ? -18.901 -37.413  -24.328  1.00 164.21 ? 950  PHE A CG  1 
ATOM   7498  C  CD1 . PHE A  1  950  ? -18.526 -37.357  -25.660  1.00 185.91 ? 950  PHE A CD1 1 
ATOM   7499  C  CD2 . PHE A  1  950  ? -20.158 -36.953  -23.970  1.00 87.47  ? 950  PHE A CD2 1 
ATOM   7500  C  CE1 . PHE A  1  950  ? -19.386 -36.853  -26.616  1.00 110.71 ? 950  PHE A CE1 1 
ATOM   7501  C  CE2 . PHE A  1  950  ? -21.023 -36.448  -24.923  1.00 112.99 ? 950  PHE A CE2 1 
ATOM   7502  C  CZ  . PHE A  1  950  ? -20.636 -36.398  -26.247  1.00 102.41 ? 950  PHE A CZ  1 
ATOM   7503  N  N   . PRO A  1  951  ? -16.326 -39.846  -21.484  1.00 85.93  ? 951  PRO A N   1 
ATOM   7504  C  CA  . PRO A  1  951  ? -15.057 -40.458  -21.080  1.00 85.22  ? 951  PRO A CA  1 
ATOM   7505  C  C   . PRO A  1  951  ? -15.272 -41.652  -20.155  1.00 86.48  ? 951  PRO A C   1 
ATOM   7506  O  O   . PRO A  1  951  ? -16.068 -41.571  -19.220  1.00 86.61  ? 951  PRO A O   1 
ATOM   7507  C  CB  . PRO A  1  951  ? -14.354 -39.329  -20.323  1.00 85.59  ? 951  PRO A CB  1 
ATOM   7508  C  CG  . PRO A  1  951  ? -14.905 -38.084  -20.921  1.00 86.01  ? 951  PRO A CG  1 
ATOM   7509  C  CD  . PRO A  1  951  ? -16.336 -38.390  -21.259  1.00 86.15  ? 951  PRO A CD  1 
ATOM   7510  N  N   . LYS A  1  952  ? -14.567 -42.747  -20.421  1.00 175.11 ? 952  LYS A N   1 
ATOM   7511  C  CA  . LYS A  1  952  ? -14.688 -43.951  -19.609  1.00 146.02 ? 952  LYS A CA  1 
ATOM   7512  C  C   . LYS A  1  952  ? -14.585 -43.626  -18.122  1.00 123.08 ? 952  LYS A C   1 
ATOM   7513  O  O   . LYS A  1  952  ? -15.593 -43.384  -17.459  1.00 147.45 ? 952  LYS A O   1 
ATOM   7514  C  CB  . LYS A  1  952  ? -13.616 -44.971  -19.999  1.00 189.09 ? 952  LYS A CB  1 
ATOM   7515  C  CG  . LYS A  1  952  ? -13.832 -45.605  -21.363  1.00 218.10 ? 952  LYS A CG  1 
ATOM   7516  C  CD  . LYS A  1  952  ? -15.149 -46.361  -21.419  1.00 237.09 ? 952  LYS A CD  1 
ATOM   7517  C  CE  . LYS A  1  952  ? -14.969 -47.817  -21.019  1.00 227.45 ? 952  LYS A CE  1 
ATOM   7518  N  NZ  . LYS A  1  952  ? -16.242 -48.582  -21.121  1.00 203.75 ? 952  LYS A NZ  1 
ATOM   7519  N  N   . GLY A  1  953  ? -13.361 -43.624  -17.606  1.00 105.63 ? 953  GLY A N   1 
ATOM   7520  C  CA  . GLY A  1  953  ? -13.124 -43.330  -16.204  1.00 71.23  ? 953  GLY A CA  1 
ATOM   7521  C  C   . GLY A  1  953  ? -11.861 -42.522  -15.986  1.00 122.33 ? 953  GLY A C   1 
ATOM   7522  O  O   . GLY A  1  953  ? -11.760 -41.759  -15.025  1.00 67.54  ? 953  GLY A O   1 
ATOM   7523  N  N   . ASP A  1  954  ? -10.895 -42.689  -16.882  1.00 172.51 ? 954  ASP A N   1 
ATOM   7524  C  CA  . ASP A  1  954  ? -9.629  -41.970  -16.788  1.00 150.74 ? 954  ASP A CA  1 
ATOM   7525  C  C   . ASP A  1  954  ? -9.854  -40.496  -16.472  1.00 83.36  ? 954  ASP A C   1 
ATOM   7526  O  O   . ASP A  1  954  ? -10.962 -39.981  -16.624  1.00 88.62  ? 954  ASP A O   1 
ATOM   7527  C  CB  . ASP A  1  954  ? -8.833  -42.115  -18.087  1.00 196.31 ? 954  ASP A CB  1 
ATOM   7528  C  CG  . ASP A  1  954  ? -8.386  -43.541  -18.341  1.00 212.52 ? 954  ASP A CG  1 
ATOM   7529  O  OD1 . ASP A  1  954  ? -8.583  -44.395  -17.451  1.00 192.79 ? 954  ASP A OD1 1 
ATOM   7530  O  OD2 . ASP A  1  954  ? -7.835  -43.807  -19.429  1.00 239.24 ? 954  ASP A OD2 1 
ATOM   7531  N  N   . ALA A  1  955  ? -8.797  -39.822  -16.032  1.00 67.03  ? 955  ALA A N   1 
ATOM   7532  C  CA  . ALA A  1  955  ? -8.878  -38.406  -15.693  1.00 67.32  ? 955  ALA A CA  1 
ATOM   7533  C  C   . ALA A  1  955  ? -7.724  -37.625  -16.314  1.00 66.29  ? 955  ALA A C   1 
ATOM   7534  O  O   . ALA A  1  955  ? -7.903  -36.498  -16.777  1.00 66.46  ? 955  ALA A O   1 
ATOM   7535  C  CB  . ALA A  1  955  ? -8.893  -38.222  -14.183  1.00 71.22  ? 955  ALA A CB  1 
ATOM   7536  N  N   . ARG A  1  956  ? -6.542  -38.231  -16.320  1.00 105.57 ? 956  ARG A N   1 
ATOM   7537  C  CA  . ARG A  1  956  ? -5.358  -37.593  -16.884  1.00 105.44 ? 956  ARG A CA  1 
ATOM   7538  C  C   . ARG A  1  956  ? -5.456  -37.491  -18.403  1.00 129.24 ? 956  ARG A C   1 
ATOM   7539  O  O   . ARG A  1  956  ? -5.535  -38.504  -19.099  1.00 165.92 ? 956  ARG A O   1 
ATOM   7540  C  CB  . ARG A  1  956  ? -4.096  -38.363  -16.490  1.00 89.47  ? 956  ARG A CB  1 
ATOM   7541  C  CG  . ARG A  1  956  ? -3.437  -37.862  -15.215  1.00 108.49 ? 956  ARG A CG  1 
ATOM   7542  C  CD  . ARG A  1  956  ? -2.417  -38.862  -14.691  1.00 183.89 ? 956  ARG A CD  1 
ATOM   7543  N  NE  . ARG A  1  956  ? -2.651  -40.205  -15.213  1.00 241.02 ? 956  ARG A NE  1 
ATOM   7544  C  CZ  . ARG A  1  956  ? -1.947  -41.276  -14.862  1.00 229.48 ? 956  ARG A CZ  1 
ATOM   7545  N  NH1 . ARG A  1  956  ? -0.958  -41.164  -13.985  1.00 243.11 ? 956  ARG A NH1 1 
ATOM   7546  N  NH2 . ARG A  1  956  ? -2.230  -42.460  -15.388  1.00 173.89 ? 956  ARG A NH2 1 
ATOM   7547  N  N   . TRP A  1  957  ? -5.452  -36.263  -18.910  1.00 79.75  ? 957  TRP A N   1 
ATOM   7548  C  CA  . TRP A  1  957  ? -5.540  -36.028  -20.334  1.00 66.74  ? 957  TRP A CA  1 
ATOM   7549  C  C   . TRP A  1  957  ? -4.632  -34.856  -20.744  1.00 79.88  ? 957  TRP A C   1 
ATOM   7550  O  O   . TRP A  1  957  ? -4.332  -33.984  -19.927  1.00 77.92  ? 957  TRP A O   1 
ATOM   7551  C  CB  . TRP A  1  957  ? -6.987  -35.782  -20.728  1.00 80.30  ? 957  TRP A CB  1 
ATOM   7552  C  CG  . TRP A  1  957  ? -7.950  -36.996  -20.670  1.00 69.41  ? 957  TRP A CG  1 
ATOM   7553  C  CD1 . TRP A  1  957  ? -9.141  -37.062  -19.979  1.00 66.83  ? 957  TRP A CD1 1 
ATOM   7554  C  CD2 . TRP A  1  957  ? -7.853  -38.230  -21.396  1.00 68.00  ? 957  TRP A CD2 1 
ATOM   7555  N  NE1 . TRP A  1  957  ? -9.762  -38.255  -20.212  1.00 67.41  ? 957  TRP A NE1 1 
ATOM   7556  C  CE2 . TRP A  1  957  ? -8.991  -38.994  -21.078  1.00 79.31  ? 957  TRP A CE2 1 
ATOM   7557  C  CE3 . TRP A  1  957  ? -6.921  -38.759  -22.283  1.00 80.39  ? 957  TRP A CE3 1 
ATOM   7558  C  CZ2 . TRP A  1  957  ? -9.207  -40.265  -21.600  1.00 95.76  ? 957  TRP A CZ2 1 
ATOM   7559  C  CZ3 . TRP A  1  957  ? -7.133  -40.005  -22.803  1.00 76.44  ? 957  TRP A CZ3 1 
ATOM   7560  C  CH2 . TRP A  1  957  ? -8.264  -40.755  -22.463  1.00 98.55  ? 957  TRP A CH2 1 
ATOM   7561  N  N   . PRO A  1  958  ? -4.181  -34.814  -22.010  1.00 65.96  ? 958  PRO A N   1 
ATOM   7562  C  CA  . PRO A  1  958  ? -3.213  -33.754  -22.300  1.00 65.69  ? 958  PRO A CA  1 
ATOM   7563  C  C   . PRO A  1  958  ? -3.877  -32.523  -22.871  1.00 66.37  ? 958  PRO A C   1 
ATOM   7564  O  O   . PRO A  1  958  ? -4.395  -32.547  -24.012  1.00 68.10  ? 958  PRO A O   1 
ATOM   7565  C  CB  . PRO A  1  958  ? -2.316  -34.378  -23.375  1.00 65.84  ? 958  PRO A CB  1 
ATOM   7566  C  CG  . PRO A  1  958  ? -2.865  -35.757  -23.615  1.00 65.86  ? 958  PRO A CG  1 
ATOM   7567  C  CD  . PRO A  1  958  ? -4.278  -35.746  -23.125  1.00 66.24  ? 958  PRO A CD  1 
ATOM   7568  N  N   . LEU A  1  959  ? -3.835  -31.448  -22.090  1.00 109.49 ? 959  LEU A N   1 
ATOM   7569  C  CA  . LEU A  1  959  ? -4.375  -30.152  -22.499  1.00 86.20  ? 959  LEU A CA  1 
ATOM   7570  C  C   . LEU A  1  959  ? -3.289  -29.102  -22.748  1.00 108.27 ? 959  LEU A C   1 
ATOM   7571  O  O   . LEU A  1  959  ? -2.139  -29.278  -22.325  1.00 117.35 ? 959  LEU A O   1 
ATOM   7572  C  CB  . LEU A  1  959  ? -5.321  -29.638  -21.439  1.00 80.08  ? 959  LEU A CB  1 
ATOM   7573  C  CG  . LEU A  1  959  ? -6.746  -29.914  -21.845  1.00 75.47  ? 959  LEU A CG  1 
ATOM   7574  C  CD1 . LEU A  1  959  ? -6.831  -31.318  -22.378  1.00 107.88 ? 959  LEU A CD1 1 
ATOM   7575  C  CD2 . LEU A  1  959  ? -7.672  -29.720  -20.668  1.00 73.28  ? 959  LEU A CD2 1 
ATOM   7576  N  N   . PRO A  1  960  ? -3.646  -27.997  -23.438  1.00 67.65  ? 960  PRO A N   1 
ATOM   7577  C  CA  . PRO A  1  960  ? -2.654  -26.940  -23.674  1.00 66.12  ? 960  PRO A CA  1 
ATOM   7578  C  C   . PRO A  1  960  ? -2.545  -26.046  -22.448  1.00 68.04  ? 960  PRO A C   1 
ATOM   7579  O  O   . PRO A  1  960  ? -3.568  -25.848  -21.793  1.00 68.33  ? 960  PRO A O   1 
ATOM   7580  C  CB  . PRO A  1  960  ? -3.293  -26.109  -24.778  1.00 68.64  ? 960  PRO A CB  1 
ATOM   7581  C  CG  . PRO A  1  960  ? -4.745  -26.531  -24.851  1.00 68.40  ? 960  PRO A CG  1 
ATOM   7582  C  CD  . PRO A  1  960  ? -4.998  -27.613  -23.888  1.00 68.09  ? 960  PRO A CD  1 
ATOM   7583  N  N   . VAL A  1  961  ? -1.362  -25.509  -22.144  1.00 85.74  ? 961  VAL A N   1 
ATOM   7584  C  CA  . VAL A  1  961  ? -1.257  -24.557  -21.027  1.00 81.10  ? 961  VAL A CA  1 
ATOM   7585  C  C   . VAL A  1  961  ? -1.529  -25.186  -19.659  1.00 78.93  ? 961  VAL A C   1 
ATOM   7586  O  O   . VAL A  1  961  ? -2.686  -25.364  -19.255  1.00 79.50  ? 961  VAL A O   1 
ATOM   7587  C  CB  . VAL A  1  961  ? -2.262  -23.389  -21.191  1.00 93.89  ? 961  VAL A CB  1 
ATOM   7588  C  CG1 . VAL A  1  961  ? -2.355  -22.567  -19.922  1.00 93.07  ? 961  VAL A CG1 1 
ATOM   7589  C  CG2 . VAL A  1  961  ? -1.884  -22.525  -22.379  1.00 113.18 ? 961  VAL A CG2 1 
ATOM   7590  N  N   . ASN A  1  962  ? -0.460  -25.523  -18.949  1.00 77.68  ? 962  ASN A N   1 
ATOM   7591  C  CA  . ASN A  1  962  ? -0.617  -26.061  -17.606  1.00 69.00  ? 962  ASN A CA  1 
ATOM   7592  C  C   . ASN A  1  962  ? -1.288  -25.015  -16.709  1.00 68.56  ? 962  ASN A C   1 
ATOM   7593  O  O   . ASN A  1  962  ? -0.666  -24.026  -16.330  1.00 66.01  ? 962  ASN A O   1 
ATOM   7594  C  CB  . ASN A  1  962  ? 0.743   -26.489  -17.016  1.00 74.43  ? 962  ASN A CB  1 
ATOM   7595  C  CG  . ASN A  1  962  ? 0.598   -27.340  -15.751  1.00 65.34  ? 962  ASN A CG  1 
ATOM   7596  O  OD1 . ASN A  1  962  ? -0.438  -27.322  -15.095  1.00 64.88  ? 962  ASN A OD1 1 
ATOM   7597  N  ND2 . ASN A  1  962  ? 1.639   -28.091  -15.417  1.00 72.47  ? 962  ASN A ND2 1 
ATOM   7598  N  N   . VAL A  1  963  ? -2.563  -25.221  -16.391  1.00 66.09  ? 963  VAL A N   1 
ATOM   7599  C  CA  . VAL A  1  963  ? -3.228  -24.326  -15.446  1.00 66.37  ? 963  VAL A CA  1 
ATOM   7600  C  C   . VAL A  1  963  ? -2.809  -24.662  -13.995  1.00 68.32  ? 963  VAL A C   1 
ATOM   7601  O  O   . VAL A  1  963  ? -2.460  -23.764  -13.234  1.00 67.73  ? 963  VAL A O   1 
ATOM   7602  C  CB  . VAL A  1  963  ? -4.768  -24.316  -15.632  1.00 66.84  ? 963  VAL A CB  1 
ATOM   7603  C  CG1 . VAL A  1  963  ? -5.386  -23.080  -15.050  1.00 69.36  ? 963  VAL A CG1 1 
ATOM   7604  C  CG2 . VAL A  1  963  ? -5.116  -24.401  -17.089  1.00 69.03  ? 963  VAL A CG2 1 
ATOM   7605  N  N   . GLN A  1  964  ? -2.823  -25.946  -13.617  1.00 124.45 ? 964  GLN A N   1 
ATOM   7606  C  CA  . GLN A  1  964  ? -2.498  -26.354  -12.247  1.00 104.45 ? 964  GLN A CA  1 
ATOM   7607  C  C   . GLN A  1  964  ? -1.191  -25.725  -11.792  1.00 82.84  ? 964  GLN A C   1 
ATOM   7608  O  O   . GLN A  1  964  ? -0.879  -25.731  -10.607  1.00 98.41  ? 964  GLN A O   1 
ATOM   7609  C  CB  . GLN A  1  964  ? -2.415  -27.884  -12.119  1.00 127.39 ? 964  GLN A CB  1 
ATOM   7610  C  CG  . GLN A  1  964  ? -2.112  -28.420  -10.693  1.00 140.81 ? 964  GLN A CG  1 
ATOM   7611  C  CD  . GLN A  1  964  ? -1.452  -29.817  -10.685  1.00 185.98 ? 964  GLN A CD  1 
ATOM   7612  O  OE1 . GLN A  1  964  ? -1.483  -30.525  -11.689  1.00 206.87 ? 964  GLN A OE1 1 
ATOM   7613  N  NE2 . GLN A  1  964  ? -0.860  -30.201  -9.547   1.00 201.29 ? 964  GLN A NE2 1 
ATOM   7614  N  N   . ARG A  1  965  ? -0.434  -25.178  -12.737  1.00 65.22  ? 965  ARG A N   1 
ATOM   7615  C  CA  . ARG A  1  965  ? 0.850   -24.557  -12.414  1.00 65.42  ? 965  ARG A CA  1 
ATOM   7616  C  C   . ARG A  1  965  ? 0.828   -23.030  -12.452  1.00 76.46  ? 965  ARG A C   1 
ATOM   7617  O  O   . ARG A  1  965  ? 1.485   -22.376  -11.641  1.00 67.29  ? 965  ARG A O   1 
ATOM   7618  C  CB  . ARG A  1  965  ? 1.976   -25.044  -13.323  1.00 76.00  ? 965  ARG A CB  1 
ATOM   7619  C  CG  . ARG A  1  965  ? 3.256   -24.226  -13.131  1.00 86.82  ? 965  ARG A CG  1 
ATOM   7620  C  CD  . ARG A  1  965  ? 4.199   -24.284  -14.324  1.00 82.76  ? 965  ARG A CD  1 
ATOM   7621  N  NE  . ARG A  1  965  ? 4.799   -25.600  -14.461  1.00 76.97  ? 965  ARG A NE  1 
ATOM   7622  C  CZ  . ARG A  1  965  ? 4.776   -26.316  -15.577  1.00 77.87  ? 965  ARG A CZ  1 
ATOM   7623  N  NH1 . ARG A  1  965  ? 4.202   -25.830  -16.680  1.00 75.18  ? 965  ARG A NH1 1 
ATOM   7624  N  NH2 . ARG A  1  965  ? 5.343   -27.517  -15.592  1.00 81.46  ? 965  ARG A NH2 1 
ATOM   7625  N  N   . ILE A  1  966  ? 0.107   -22.448  -13.404  1.00 74.29  ? 966  ILE A N   1 
ATOM   7626  C  CA  . ILE A  1  966  ? 0.050   -20.994  -13.476  1.00 75.13  ? 966  ILE A CA  1 
ATOM   7627  C  C   . ILE A  1  966  ? -0.406  -20.430  -12.128  1.00 91.52  ? 966  ILE A C   1 
ATOM   7628  O  O   . ILE A  1  966  ? -0.161  -19.265  -11.850  1.00 124.62 ? 966  ILE A O   1 
ATOM   7629  C  CB  . ILE A  1  966  ? -0.890  -20.513  -14.568  1.00 112.24 ? 966  ILE A CB  1 
ATOM   7630  C  CG1 . ILE A  1  966  ? -2.234  -21.224  -14.420  1.00 191.31 ? 966  ILE A CG1 1 
ATOM   7631  C  CG2 . ILE A  1  966  ? -0.297  -20.800  -15.929  1.00 75.72  ? 966  ILE A CG2 1 
ATOM   7632  C  CD1 . ILE A  1  966  ? -3.383  -20.505  -15.026  1.00 222.63 ? 966  ILE A CD1 1 
ATOM   7633  N  N   . ILE A  1  967  ? -1.058  -21.249  -11.290  1.00 66.31  ? 967  ILE A N   1 
ATOM   7634  C  CA  . ILE A  1  967  ? -1.470  -20.817  -9.961   1.00 67.08  ? 967  ILE A CA  1 
ATOM   7635  C  C   . ILE A  1  967  ? -0.351  -21.083  -8.932   1.00 66.08  ? 967  ILE A C   1 
ATOM   7636  O  O   . ILE A  1  967  ? -0.263  -20.411  -7.921   1.00 66.56  ? 967  ILE A O   1 
ATOM   7637  C  CB  . ILE A  1  967  ? -2.782  -21.473  -9.541   1.00 67.76  ? 967  ILE A CB  1 
ATOM   7638  C  CG1 . ILE A  1  967  ? -2.601  -22.969  -9.442   1.00 66.79  ? 967  ILE A CG1 1 
ATOM   7639  C  CG2 . ILE A  1  967  ? -3.902  -21.200  -10.538  1.00 68.31  ? 967  ILE A CG2 1 
ATOM   7640  C  CD1 . ILE A  1  967  ? -3.617  -23.629  -8.512   1.00 67.77  ? 967  ILE A CD1 1 
ATOM   7641  N  N   . GLN A  1  968  ? 0.524   -22.044  -9.215   1.00 108.82 ? 968  GLN A N   1 
ATOM   7642  C  CA  . GLN A  1  968  ? 1.744   -22.260  -8.438   1.00 120.59 ? 968  GLN A CA  1 
ATOM   7643  C  C   . GLN A  1  968  ? 2.779   -22.793  -9.426   1.00 230.34 ? 968  GLN A C   1 
ATOM   7644  O  O   . GLN A  1  968  ? 2.676   -23.931  -9.892   1.00 284.46 ? 968  GLN A O   1 
ATOM   7645  C  CB  . GLN A  1  968  ? 1.516   -23.270  -7.314   1.00 99.61  ? 968  GLN A CB  1 
ATOM   7646  C  CG  . GLN A  1  968  ? 0.946   -24.608  -7.809   1.00 135.15 ? 968  GLN A CG  1 
ATOM   7647  C  CD  . GLN A  1  968  ? 1.226   -25.768  -6.863   1.00 165.84 ? 968  GLN A CD  1 
ATOM   7648  O  OE1 . GLN A  1  968  ? 1.929   -25.618  -5.857   1.00 165.22 ? 968  GLN A OE1 1 
ATOM   7649  N  NE2 . GLN A  1  968  ? 0.690   -26.942  -7.196   1.00 182.42 ? 968  GLN A NE2 1 
ATOM   7650  N  N   . ASN A  1  969  ? 3.762   -21.975  -9.775   1.00 198.08 ? 969  ASN A N   1 
ATOM   7651  C  CA  . ASN A  1  969  ? 3.913   -20.658  -9.179   1.00 150.44 ? 969  ASN A CA  1 
ATOM   7652  C  C   . ASN A  1  969  ? 2.927   -19.603  -9.634   1.00 68.86  ? 969  ASN A C   1 
ATOM   7653  O  O   . ASN A  1  969  ? 2.741   -19.374  -10.824  1.00 70.19  ? 969  ASN A O   1 
ATOM   7654  C  CB  . ASN A  1  969  ? 5.347   -20.141  -9.355   1.00 158.88 ? 969  ASN A CB  1 
ATOM   7655  C  CG  . ASN A  1  969  ? 5.757   -19.956  -10.815  1.00 130.08 ? 969  ASN A CG  1 
ATOM   7656  O  OD1 . ASN A  1  969  ? 6.664   -19.179  -11.101  1.00 145.17 ? 969  ASN A OD1 1 
ATOM   7657  N  ND2 . ASN A  1  969  ? 5.116   -20.675  -11.737  1.00 69.25  ? 969  ASN A ND2 1 
ATOM   7658  N  N   . ALA A  1  970  ? 2.256   -19.028  -8.652   1.00 74.89  ? 970  ALA A N   1 
ATOM   7659  C  CA  . ALA A  1  970  ? 1.592   -17.743  -8.762   1.00 79.09  ? 970  ALA A CA  1 
ATOM   7660  C  C   . ALA A  1  970  ? 1.469   -17.344  -7.312   1.00 88.49  ? 970  ALA A C   1 
ATOM   7661  O  O   . ALA A  1  970  ? 1.618   -16.189  -6.954   1.00 88.32  ? 970  ALA A O   1 
ATOM   7662  C  CB  . ALA A  1  970  ? 0.217   -17.862  -9.376   1.00 68.79  ? 970  ALA A CB  1 
ATOM   7663  N  N   . LEU A  1  971  ? 1.216   -18.344  -6.477   1.00 69.02  ? 971  LEU A N   1 
ATOM   7664  C  CA  . LEU A  1  971  ? 1.215   -18.165  -5.041   1.00 74.86  ? 971  LEU A CA  1 
ATOM   7665  C  C   . LEU A  1  971  ? 2.663   -18.136  -4.573   1.00 68.43  ? 971  LEU A C   1 
ATOM   7666  O  O   . LEU A  1  971  ? 2.960   -18.463  -3.420   1.00 73.99  ? 971  LEU A O   1 
ATOM   7667  C  CB  . LEU A  1  971  ? 0.449   -19.295  -4.345   1.00 74.03  ? 971  LEU A CB  1 
ATOM   7668  C  CG  . LEU A  1  971  ? -0.927  -19.685  -4.867   1.00 73.55  ? 971  LEU A CG  1 
ATOM   7669  C  CD1 . LEU A  1  971  ? -1.738  -20.276  -3.750   1.00 72.82  ? 971  LEU A CD1 1 
ATOM   7670  C  CD2 . LEU A  1  971  ? -1.641  -18.502  -5.447   1.00 75.66  ? 971  LEU A CD2 1 
ATOM   7671  N  N   . GLN A  1  972  ? 3.564   -17.778  -5.481   1.00 97.28  ? 972  GLN A N   1 
ATOM   7672  C  CA  . GLN A  1  972  ? 4.940   -17.557  -5.114   1.00 121.51 ? 972  GLN A CA  1 
ATOM   7673  C  C   . GLN A  1  972  ? 5.163   -16.093  -5.374   1.00 137.25 ? 972  GLN A C   1 
ATOM   7674  O  O   . GLN A  1  972  ? 5.787   -15.384  -4.586   1.00 196.71 ? 972  GLN A O   1 
ATOM   7675  C  CB  . GLN A  1  972  ? 5.874   -18.408  -5.968   1.00 132.09 ? 972  GLN A CB  1 
ATOM   7676  C  CG  . GLN A  1  972  ? 7.330   -18.311  -5.553   1.00 160.19 ? 972  GLN A CG  1 
ATOM   7677  C  CD  . GLN A  1  972  ? 7.946   -16.979  -5.927   1.00 171.24 ? 972  GLN A CD  1 
ATOM   7678  O  OE1 . GLN A  1  972  ? 8.658   -16.351  -5.135   1.00 175.20 ? 972  GLN A OE1 1 
ATOM   7679  N  NE2 . GLN A  1  972  ? 7.669   -16.537  -7.138   1.00 166.81 ? 972  GLN A NE2 1 
ATOM   7680  N  N   . ILE A  1  973  ? 4.599   -15.638  -6.482   1.00 96.87  ? 973  ILE A N   1 
ATOM   7681  C  CA  . ILE A  1  973  ? 4.815   -14.280  -6.938   1.00 143.58 ? 973  ILE A CA  1 
ATOM   7682  C  C   . ILE A  1  973  ? 4.209   -13.269  -5.981   1.00 163.96 ? 973  ILE A C   1 
ATOM   7683  O  O   . ILE A  1  973  ? 4.820   -12.258  -5.648   1.00 218.42 ? 973  ILE A O   1 
ATOM   7684  C  CB  . ILE A  1  973  ? 4.228   -14.083  -8.323   1.00 134.24 ? 973  ILE A CB  1 
ATOM   7685  C  CG1 . ILE A  1  973  ? 4.557   -15.295  -9.214   1.00 100.22 ? 973  ILE A CG1 1 
ATOM   7686  C  CG2 . ILE A  1  973  ? 4.748   -12.787  -8.917   1.00 181.19 ? 973  ILE A CG2 1 
ATOM   7687  C  CD1 . ILE A  1  973  ? 6.049   -15.538  -9.363   1.00 126.94 ? 973  ILE A CD1 1 
ATOM   7688  N  N   . PHE A  1  974  ? 2.999   -13.557  -5.530   1.00 84.00  ? 974  PHE A N   1 
ATOM   7689  C  CA  . PHE A  1  974  ? 2.285   -12.643  -4.646   1.00 82.29  ? 974  PHE A CA  1 
ATOM   7690  C  C   . PHE A  1  974  ? 2.201   -13.148  -3.197   1.00 87.85  ? 974  PHE A C   1 
ATOM   7691  O  O   . PHE A  1  974  ? 2.004   -12.368  -2.256   1.00 84.18  ? 974  PHE A O   1 
ATOM   7692  C  CB  . PHE A  1  974  ? 0.901   -12.394  -5.221   1.00 88.93  ? 974  PHE A CB  1 
ATOM   7693  C  CG  . PHE A  1  974  ? 0.937   -11.851  -6.618   1.00 100.74 ? 974  PHE A CG  1 
ATOM   7694  C  CD1 . PHE A  1  974  ? 1.305   -10.542  -6.835   1.00 157.17 ? 974  PHE A CD1 1 
ATOM   7695  C  CD2 . PHE A  1  974  ? 0.615   -12.633  -7.700   1.00 91.53  ? 974  PHE A CD2 1 
ATOM   7696  C  CE1 . PHE A  1  974  ? 1.343   -10.023  -8.112   1.00 163.74 ? 974  PHE A CE1 1 
ATOM   7697  C  CE2 . PHE A  1  974  ? 0.651   -12.104  -8.974   1.00 86.63  ? 974  PHE A CE2 1 
ATOM   7698  C  CZ  . PHE A  1  974  ? 1.019   -10.809  -9.179   1.00 133.51 ? 974  PHE A CZ  1 
ATOM   7699  N  N   . HIS A  1  975  ? 2.349   -14.461  -3.045   1.00 172.83 ? 975  HIS A N   1 
ATOM   7700  C  CA  . HIS A  1  975  ? 2.267   -15.117  -1.747   1.00 172.16 ? 975  HIS A CA  1 
ATOM   7701  C  C   . HIS A  1  975  ? 0.921   -14.936  -1.059   1.00 143.51 ? 975  HIS A C   1 
ATOM   7702  O  O   . HIS A  1  975  ? -0.115  -15.430  -1.509   1.00 86.35  ? 975  HIS A O   1 
ATOM   7703  C  CB  . HIS A  1  975  ? 3.387   -14.632  -0.838   1.00 142.84 ? 975  HIS A CB  1 
ATOM   7704  C  CG  . HIS A  1  975  ? 3.679   -15.569  0.283    1.00 165.92 ? 975  HIS A CG  1 
ATOM   7705  N  ND1 . HIS A  1  975  ? 3.096   -15.450  1.524    1.00 185.07 ? 975  HIS A ND1 1 
ATOM   7706  C  CD2 . HIS A  1  975  ? 4.477   -16.662  0.350    1.00 198.34 ? 975  HIS A CD2 1 
ATOM   7707  C  CE1 . HIS A  1  975  ? 3.538   -16.411  2.314    1.00 216.84 ? 975  HIS A CE1 1 
ATOM   7708  N  NE2 . HIS A  1  975  ? 4.376   -17.164  1.620    1.00 223.31 ? 975  HIS A NE2 1 
ATOM   7709  N  N   . LEU A  1  976  ? 0.934   -14.205  0.042    1.00 214.06 ? 976  LEU A N   1 
ATOM   7710  C  CA  . LEU A  1  976  ? -0.284  -13.986  0.799    1.00 260.47 ? 976  LEU A CA  1 
ATOM   7711  C  C   . LEU A  1  976  ? -0.865  -15.308  1.269    1.00 237.68 ? 976  LEU A C   1 
ATOM   7712  O  O   . LEU A  1  976  ? -1.291  -16.140  0.468    1.00 223.99 ? 976  LEU A O   1 
ATOM   7713  C  CB  . LEU A  1  976  ? -1.318  -13.215  -0.021   1.00 288.12 ? 976  LEU A CB  1 
ATOM   7714  C  CG  . LEU A  1  976  ? -0.967  -11.769  -0.361   1.00 283.11 ? 976  LEU A CG  1 
ATOM   7715  C  CD1 . LEU A  1  976  ? -2.054  -11.190  -1.220   1.00 275.53 ? 976  LEU A CD1 1 
ATOM   7716  C  CD2 . LEU A  1  976  ? -0.775  -10.928  0.895    1.00 273.00 ? 976  LEU A CD2 1 
ATOM   7717  N  N   . GLU A  1  977  ? -0.885  -15.485  2.579    1.00 190.80 ? 977  GLU A N   1 
ATOM   7718  C  CA  . GLU A  1  977  ? -1.366  -16.715  3.157    1.00 149.30 ? 977  GLU A CA  1 
ATOM   7719  C  C   . GLU A  1  977  ? -2.810  -16.587  3.652    1.00 160.29 ? 977  GLU A C   1 
ATOM   7720  O  O   . GLU A  1  977  ? -3.435  -15.536  3.498    1.00 157.70 ? 977  GLU A O   1 
ATOM   7721  C  CB  . GLU A  1  977  ? -0.423  -17.156  4.274    1.00 112.09 ? 977  GLU A CB  1 
ATOM   7722  C  CG  . GLU A  1  977  ? 1.012   -17.398  3.790    1.00 155.09 ? 977  GLU A CG  1 
ATOM   7723  C  CD  . GLU A  1  977  ? 1.122   -18.504  2.737    1.00 177.55 ? 977  GLU A CD  1 
ATOM   7724  O  OE1 . GLU A  1  977  ? 0.198   -19.332  2.646    1.00 149.50 ? 977  GLU A OE1 1 
ATOM   7725  O  OE2 . GLU A  1  977  ? 2.131   -18.553  2.006    1.00 219.90 ? 977  GLU A OE2 1 
ATOM   7726  N  N   . ALA A  1  978  ? -3.335  -17.673  4.206    1.00 183.86 ? 978  ALA A N   1 
ATOM   7727  C  CA  . ALA A  1  978  ? -4.687  -17.696  4.721    1.00 226.36 ? 978  ALA A CA  1 
ATOM   7728  C  C   . ALA A  1  978  ? -4.957  -16.433  5.531    1.00 268.04 ? 978  ALA A C   1 
ATOM   7729  O  O   . ALA A  1  978  ? -6.058  -15.889  5.490    1.00 278.88 ? 978  ALA A O   1 
ATOM   7730  C  CB  . ALA A  1  978  ? -4.908  -18.933  5.571    1.00 239.95 ? 978  ALA A CB  1 
ATOM   7731  N  N   . LYS A  1  979  ? -3.936  -15.970  6.251    1.00 327.83 ? 979  LYS A N   1 
ATOM   7732  C  CA  . LYS A  1  979  ? -4.055  -14.790  7.103    1.00 324.67 ? 979  LYS A CA  1 
ATOM   7733  C  C   . LYS A  1  979  ? -4.595  -13.595  6.327    1.00 322.14 ? 979  LYS A C   1 
ATOM   7734  O  O   . LYS A  1  979  ? -5.360  -12.794  6.866    1.00 340.77 ? 979  LYS A O   1 
ATOM   7735  C  CB  . LYS A  1  979  ? -2.710  -14.446  7.763    1.00 297.32 ? 979  LYS A CB  1 
ATOM   7736  C  CG  . LYS A  1  979  ? -2.778  -13.289  8.768    1.00 267.88 ? 979  LYS A CG  1 
ATOM   7737  C  CD  . LYS A  1  979  ? -1.432  -13.038  9.451    1.00 266.56 ? 979  LYS A CD  1 
ATOM   7738  C  CE  . LYS A  1  979  ? -1.476  -11.779  10.317   1.00 258.58 ? 979  LYS A CE  1 
ATOM   7739  N  NZ  . LYS A  1  979  ? -0.192  -11.523  11.031   1.00 233.22 ? 979  LYS A NZ  1 
ATOM   7740  N  N   . LYS A  1  980  ? -4.199  -13.471  5.063    1.00 211.83 ? 980  LYS A N   1 
ATOM   7741  C  CA  . LYS A  1  980  ? -4.772  -12.440  4.199    1.00 173.23 ? 980  LYS A CA  1 
ATOM   7742  C  C   . LYS A  1  980  ? -5.945  -13.020  3.420    1.00 130.64 ? 980  LYS A C   1 
ATOM   7743  O  O   . LYS A  1  980  ? -5.746  -13.889  2.576    1.00 111.39 ? 980  LYS A O   1 
ATOM   7744  C  CB  . LYS A  1  980  ? -3.721  -11.862  3.240    1.00 174.58 ? 980  LYS A CB  1 
ATOM   7745  C  CG  . LYS A  1  980  ? -2.614  -11.046  3.915    1.00 191.38 ? 980  LYS A CG  1 
ATOM   7746  C  CD  . LYS A  1  980  ? -3.164  -9.860   4.710    1.00 185.93 ? 980  LYS A CD  1 
ATOM   7747  C  CE  . LYS A  1  980  ? -2.051  -9.125   5.454    1.00 147.20 ? 980  LYS A CE  1 
ATOM   7748  N  NZ  . LYS A  1  980  ? -2.580  -8.259   6.545    1.00 147.42 ? 980  LYS A NZ  1 
ATOM   7749  N  N   . PRO A  1  981  ? -7.174  -12.554  3.724    1.00 79.67  ? 981  PRO A N   1 
ATOM   7750  C  CA  . PRO A  1  981  ? -8.386  -12.944  2.997    1.00 76.25  ? 981  PRO A CA  1 
ATOM   7751  C  C   . PRO A  1  981  ? -8.481  -12.140  1.714    1.00 77.26  ? 981  PRO A C   1 
ATOM   7752  O  O   . PRO A  1  981  ? -7.810  -11.112  1.613    1.00 79.82  ? 981  PRO A O   1 
ATOM   7753  C  CB  . PRO A  1  981  ? -9.521  -12.542  3.945    1.00 76.04  ? 981  PRO A CB  1 
ATOM   7754  C  CG  . PRO A  1  981  ? -8.870  -12.171  5.232    1.00 89.28  ? 981  PRO A CG  1 
ATOM   7755  C  CD  . PRO A  1  981  ? -7.506  -11.701  4.871    1.00 79.95  ? 981  PRO A CD  1 
ATOM   7756  N  N   . THR A  1  982  ? -9.337  -12.579  0.792    1.00 106.51 ? 982  THR A N   1 
ATOM   7757  C  CA  . THR A  1  982  ? -9.364  -12.084  -0.592   1.00 130.29 ? 982  THR A CA  1 
ATOM   7758  C  C   . THR A  1  982  ? -9.982  -10.710  -0.858   1.00 127.97 ? 982  THR A C   1 
ATOM   7759  O  O   . THR A  1  982  ? -11.141 -10.455  -0.538   1.00 103.89 ? 982  THR A O   1 
ATOM   7760  C  CB  . THR A  1  982  ? -10.066 -13.090  -1.528   1.00 176.79 ? 982  THR A CB  1 
ATOM   7761  O  OG1 . THR A  1  982  ? -10.313 -12.472  -2.793   1.00 185.09 ? 982  THR A OG1 1 
ATOM   7762  C  CG2 . THR A  1  982  ? -11.380 -13.570  -0.922   1.00 194.43 ? 982  THR A CG2 1 
ATOM   7763  N  N   . ASP A  1  983  ? -9.196  -9.846   -1.488   1.00 160.49 ? 983  ASP A N   1 
ATOM   7764  C  CA  . ASP A  1  983  ? -9.642  -8.509   -1.854   1.00 136.39 ? 983  ASP A CA  1 
ATOM   7765  C  C   . ASP A  1  983  ? -10.459 -8.572   -3.126   1.00 133.96 ? 983  ASP A C   1 
ATOM   7766  O  O   . ASP A  1  983  ? -10.660 -7.563   -3.792   1.00 153.25 ? 983  ASP A O   1 
ATOM   7767  C  CB  . ASP A  1  983  ? -8.445  -7.590   -2.077   1.00 147.59 ? 983  ASP A CB  1 
ATOM   7768  C  CG  . ASP A  1  983  ? -7.487  -7.574   -0.901   1.00 200.40 ? 983  ASP A CG  1 
ATOM   7769  O  OD1 . ASP A  1  983  ? -7.809  -8.198   0.135    1.00 232.62 ? 983  ASP A OD1 1 
ATOM   7770  O  OD2 . ASP A  1  983  ? -6.412  -6.938   -1.005   1.00 189.97 ? 983  ASP A OD2 1 
ATOM   7771  N  N   . LEU A  1  984  ? -10.917 -9.771   -3.457   1.00 127.74 ? 984  LEU A N   1 
ATOM   7772  C  CA  . LEU A  1  984  ? -11.671 -9.994   -4.682   1.00 114.06 ? 984  LEU A CA  1 
ATOM   7773  C  C   . LEU A  1  984  ? -13.149 -9.782   -4.478   1.00 103.56 ? 984  LEU A C   1 
ATOM   7774  O  O   . LEU A  1  984  ? -13.572 -9.105   -3.554   1.00 125.50 ? 984  LEU A O   1 
ATOM   7775  C  CB  . LEU A  1  984  ? -11.484 -11.421  -5.177   1.00 80.19  ? 984  LEU A CB  1 
ATOM   7776  C  CG  . LEU A  1  984  ? -10.211 -11.773  -5.921   1.00 76.85  ? 984  LEU A CG  1 
ATOM   7777  C  CD1 . LEU A  1  984  ? -10.376 -13.156  -6.524   1.00 79.14  ? 984  LEU A CD1 1 
ATOM   7778  C  CD2 . LEU A  1  984  ? -9.955  -10.729  -6.999   1.00 79.38  ? 984  LEU A CD2 1 
ATOM   7779  N  N   . LEU A  1  985  ? -13.923 -10.411  -5.342   1.00 152.87 ? 985  LEU A N   1 
ATOM   7780  C  CA  . LEU A  1  985  ? -15.355 -10.278  -5.304   1.00 130.64 ? 985  LEU A CA  1 
ATOM   7781  C  C   . LEU A  1  985  ? -15.934 -11.350  -6.213   1.00 126.73 ? 985  LEU A C   1 
ATOM   7782  O  O   . LEU A  1  985  ? -15.575 -11.424  -7.397   1.00 137.12 ? 985  LEU A O   1 
ATOM   7783  C  CB  . LEU A  1  985  ? -15.745 -8.890   -5.805   1.00 180.83 ? 985  LEU A CB  1 
ATOM   7784  C  CG  . LEU A  1  985  ? -17.031 -8.244   -5.278   1.00 170.08 ? 985  LEU A CG  1 
ATOM   7785  C  CD1 . LEU A  1  985  ? -18.274 -8.668   -6.065   1.00 135.39 ? 985  LEU A CD1 1 
ATOM   7786  C  CD2 . LEU A  1  985  ? -17.182 -8.529   -3.788   1.00 163.42 ? 985  LEU A CD2 1 
ATOM   7787  N  N   . PRO A  1  986  ? -16.824 -12.191  -5.659   1.00 78.30  ? 986  PRO A N   1 
ATOM   7788  C  CA  . PRO A  1  986  ? -17.469 -13.283  -6.400   1.00 80.27  ? 986  PRO A CA  1 
ATOM   7789  C  C   . PRO A  1  986  ? -18.046 -12.839  -7.746   1.00 78.30  ? 986  PRO A C   1 
ATOM   7790  O  O   . PRO A  1  986  ? -18.231 -13.673  -8.628   1.00 78.37  ? 986  PRO A O   1 
ATOM   7791  C  CB  . PRO A  1  986  ? -18.586 -13.727  -5.457   1.00 77.38  ? 986  PRO A CB  1 
ATOM   7792  C  CG  . PRO A  1  986  ? -18.040 -13.440  -4.099   1.00 77.30  ? 986  PRO A CG  1 
ATOM   7793  C  CD  . PRO A  1  986  ? -17.206 -12.185  -4.234   1.00 78.11  ? 986  PRO A CD  1 
ATOM   7794  N  N   . SER A  1  987  ? -18.323 -11.545  -7.897   1.00 153.51 ? 987  SER A N   1 
ATOM   7795  C  CA  . SER A  1  987  ? -18.899 -11.039  -9.138   1.00 184.34 ? 987  SER A CA  1 
ATOM   7796  C  C   . SER A  1  987  ? -17.803 -10.694  -10.152  1.00 167.20 ? 987  SER A C   1 
ATOM   7797  O  O   . SER A  1  987  ? -18.085 -10.212  -11.248  1.00 163.31 ? 987  SER A O   1 
ATOM   7798  C  CB  . SER A  1  987  ? -19.808 -9.826   -8.879   1.00 226.24 ? 987  SER A CB  1 
ATOM   7799  O  OG  . SER A  1  987  ? -20.645 -9.587   -9.990   1.00 260.48 ? 987  SER A OG  1 
ATOM   7800  N  N   . ASP A  1  988  ? -16.551 -10.964  -9.790   1.00 128.03 ? 988  ASP A N   1 
ATOM   7801  C  CA  . ASP A  1  988  ? -15.424 -10.659  -10.657  1.00 139.26 ? 988  ASP A CA  1 
ATOM   7802  C  C   . ASP A  1  988  ? -14.859 -11.925  -11.279  1.00 126.91 ? 988  ASP A C   1 
ATOM   7803  O  O   . ASP A  1  988  ? -14.713 -12.021  -12.496  1.00 116.98 ? 988  ASP A O   1 
ATOM   7804  C  CB  . ASP A  1  988  ? -14.328 -9.923   -9.888   1.00 163.21 ? 988  ASP A CB  1 
ATOM   7805  C  CG  . ASP A  1  988  ? -14.772 -8.560   -9.407   1.00 194.28 ? 988  ASP A CG  1 
ATOM   7806  O  OD1 . ASP A  1  988  ? -15.800 -8.054   -9.918   1.00 215.72 ? 988  ASP A OD1 1 
ATOM   7807  O  OD2 . ASP A  1  988  ? -14.089 -7.989   -8.526   1.00 176.73 ? 988  ASP A OD2 1 
ATOM   7808  N  N   . ILE A  1  989  ? -14.539 -12.906  -10.436  1.00 127.75 ? 989  ILE A N   1 
ATOM   7809  C  CA  . ILE A  1  989  ? -13.922 -14.125  -10.939  1.00 120.23 ? 989  ILE A CA  1 
ATOM   7810  C  C   . ILE A  1  989  ? -14.805 -14.743  -12.007  1.00 133.37 ? 989  ILE A C   1 
ATOM   7811  O  O   . ILE A  1  989  ? -14.295 -15.338  -12.956  1.00 177.84 ? 989  ILE A O   1 
ATOM   7812  C  CB  . ILE A  1  989  ? -13.640 -15.175  -9.839   1.00 88.15  ? 989  ILE A CB  1 
ATOM   7813  C  CG1 . ILE A  1  989  ? -14.853 -16.093  -9.635   1.00 97.16  ? 989  ILE A CG1 1 
ATOM   7814  C  CG2 . ILE A  1  989  ? -13.213 -14.505  -8.540   1.00 77.80  ? 989  ILE A CG2 1 
ATOM   7815  C  CD1 . ILE A  1  989  ? -16.017 -15.454  -8.928   1.00 116.52 ? 989  ILE A CD1 1 
ATOM   7816  N  N   . ILE A  1  990  ? -16.121 -14.576  -11.875  1.00 85.69  ? 990  ILE A N   1 
ATOM   7817  C  CA  . ILE A  1  990  ? -17.036 -15.160  -12.850  1.00 78.06  ? 990  ILE A CA  1 
ATOM   7818  C  C   . ILE A  1  990  ? -17.028 -14.357  -14.142  1.00 105.10 ? 990  ILE A C   1 
ATOM   7819  O  O   . ILE A  1  990  ? -17.096 -14.920  -15.239  1.00 88.89  ? 990  ILE A O   1 
ATOM   7820  C  CB  . ILE A  1  990  ? -18.459 -15.319  -12.320  1.00 78.11  ? 990  ILE A CB  1 
ATOM   7821  C  CG1 . ILE A  1  990  ? -19.017 -13.977  -11.868  1.00 142.80 ? 990  ILE A CG1 1 
ATOM   7822  C  CG2 . ILE A  1  990  ? -18.492 -16.326  -11.214  1.00 79.48  ? 990  ILE A CG2 1 
ATOM   7823  C  CD1 . ILE A  1  990  ? -20.520 -13.969  -11.799  1.00 181.45 ? 990  ILE A CD1 1 
ATOM   7824  N  N   . ASN A  1  991  ? -16.923 -13.041  -14.026  1.00 134.49 ? 991  ASN A N   1 
ATOM   7825  C  CA  . ASN A  1  991  ? -16.714 -12.240  -15.210  1.00 130.84 ? 991  ASN A CA  1 
ATOM   7826  C  C   . ASN A  1  991  ? -15.315 -12.489  -15.751  1.00 136.80 ? 991  ASN A C   1 
ATOM   7827  O  O   . ASN A  1  991  ? -15.125 -12.575  -16.963  1.00 174.05 ? 991  ASN A O   1 
ATOM   7828  C  CB  . ASN A  1  991  ? -16.942 -10.769  -14.911  1.00 130.39 ? 991  ASN A CB  1 
ATOM   7829  C  CG  . ASN A  1  991  ? -18.381 -10.476  -14.559  1.00 142.63 ? 991  ASN A CG  1 
ATOM   7830  O  OD1 . ASN A  1  991  ? -19.258 -11.330  -14.724  1.00 148.67 ? 991  ASN A OD1 1 
ATOM   7831  N  ND2 . ASN A  1  991  ? -18.635 -9.262   -14.069  1.00 146.97 ? 991  ASN A ND2 1 
ATOM   7832  N  N   . GLY A  1  992  ? -14.336 -12.636  -14.855  1.00 91.58  ? 992  GLY A N   1 
ATOM   7833  C  CA  . GLY A  1  992  ? -12.961 -12.892  -15.246  1.00 114.22 ? 992  GLY A CA  1 
ATOM   7834  C  C   . GLY A  1  992  ? -12.850 -13.916  -16.360  1.00 121.98 ? 992  GLY A C   1 
ATOM   7835  O  O   . GLY A  1  992  ? -12.204 -13.671  -17.385  1.00 140.24 ? 992  GLY A O   1 
ATOM   7836  N  N   . LEU A  1  993  ? -13.492 -15.062  -16.155  1.00 91.04  ? 993  LEU A N   1 
ATOM   7837  C  CA  . LEU A  1  993  ? -13.457 -16.152  -17.114  1.00 85.56  ? 993  LEU A CA  1 
ATOM   7838  C  C   . LEU A  1  993  ? -14.142 -15.758  -18.379  1.00 115.82 ? 993  LEU A C   1 
ATOM   7839  O  O   . LEU A  1  993  ? -13.532 -15.681  -19.440  1.00 122.30 ? 993  LEU A O   1 
ATOM   7840  C  CB  . LEU A  1  993  ? -14.212 -17.356  -16.575  1.00 73.09  ? 993  LEU A CB  1 
ATOM   7841  C  CG  . LEU A  1  993  ? -13.516 -18.078  -15.452  1.00 75.79  ? 993  LEU A CG  1 
ATOM   7842  C  CD1 . LEU A  1  993  ? -14.318 -19.293  -15.064  1.00 113.30 ? 993  LEU A CD1 1 
ATOM   7843  C  CD2 . LEU A  1  993  ? -12.161 -18.465  -15.948  1.00 73.60  ? 993  LEU A CD2 1 
ATOM   7844  N  N   . ASN A  1  994  ? -15.442 -15.539  -18.254  1.00 121.19 ? 994  ASN A N   1 
ATOM   7845  C  CA  . ASN A  1  994  ? -16.295 -15.313  -19.401  1.00 143.59 ? 994  ASN A CA  1 
ATOM   7846  C  C   . ASN A  1  994  ? -15.643 -14.364  -20.386  1.00 128.86 ? 994  ASN A C   1 
ATOM   7847  O  O   . ASN A  1  994  ? -15.871 -14.456  -21.594  1.00 137.84 ? 994  ASN A O   1 
ATOM   7848  C  CB  . ASN A  1  994  ? -17.669 -14.816  -18.945  1.00 149.24 ? 994  ASN A CB  1 
ATOM   7849  C  CG  . ASN A  1  994  ? -18.406 -15.842  -18.091  1.00 129.53 ? 994  ASN A CG  1 
ATOM   7850  O  OD1 . ASN A  1  994  ? -17.789 -16.718  -17.480  1.00 115.05 ? 994  ASN A OD1 1 
ATOM   7851  N  ND2 . ASN A  1  994  ? -19.729 -15.743  -18.061  1.00 127.23 ? 994  ASN A ND2 1 
ATOM   7852  N  N   . GLU A  1  995  ? -14.799 -13.479  -19.865  1.00 129.76 ? 995  GLU A N   1 
ATOM   7853  C  CA  . GLU A  1  995  ? -14.109 -12.517  -20.705  1.00 132.93 ? 995  GLU A CA  1 
ATOM   7854  C  C   . GLU A  1  995  ? -12.787 -13.066  -21.208  1.00 138.56 ? 995  GLU A C   1 
ATOM   7855  O  O   . GLU A  1  995  ? -12.256 -12.600  -22.207  1.00 157.41 ? 995  GLU A O   1 
ATOM   7856  C  CB  . GLU A  1  995  ? -13.919 -11.185  -19.971  1.00 185.81 ? 995  GLU A CB  1 
ATOM   7857  C  CG  . GLU A  1  995  ? -15.197 -10.336  -19.872  1.00 230.93 ? 995  GLU A CG  1 
ATOM   7858  C  CD  . GLU A  1  995  ? -15.064 -9.141   -18.929  1.00 218.51 ? 995  GLU A CD  1 
ATOM   7859  O  OE1 . GLU A  1  995  ? -13.920 -8.707   -18.663  1.00 183.99 ? 995  GLU A OE1 1 
ATOM   7860  O  OE2 . GLU A  1  995  ? -16.117 -8.642   -18.462  1.00 215.27 ? 995  GLU A OE2 1 
ATOM   7861  N  N   . LEU A  1  996  ? -12.260 -14.071  -20.529  1.00 125.91 ? 996  LEU A N   1 
ATOM   7862  C  CA  . LEU A  1  996  ? -10.975 -14.620  -20.932  1.00 143.42 ? 996  LEU A CA  1 
ATOM   7863  C  C   . LEU A  1  996  ? -11.018 -16.090  -21.249  1.00 80.84  ? 996  LEU A C   1 
ATOM   7864  O  O   . LEU A  1  996  ? -10.004 -16.777  -21.151  1.00 72.62  ? 996  LEU A O   1 
ATOM   7865  C  CB  . LEU A  1  996  ? -9.924  -14.357  -19.868  1.00 176.83 ? 996  LEU A CB  1 
ATOM   7866  C  CG  . LEU A  1  996  ? -9.591  -12.874  -19.738  1.00 188.80 ? 996  LEU A CG  1 
ATOM   7867  C  CD1 . LEU A  1  996  ? -8.695  -12.645  -18.542  1.00 179.23 ? 996  LEU A CD1 1 
ATOM   7868  C  CD2 . LEU A  1  996  ? -8.938  -12.338  -21.023  1.00 188.64 ? 996  LEU A CD2 1 
ATOM   7869  N  N   . ILE A  1  997  ? -12.202 -16.574  -21.586  1.00 111.44 ? 997  ILE A N   1 
ATOM   7870  C  CA  . ILE A  1  997  ? -12.320 -17.829  -22.281  1.00 111.32 ? 997  ILE A CA  1 
ATOM   7871  C  C   . ILE A  1  997  ? -12.702 -17.401  -23.673  1.00 119.28 ? 997  ILE A C   1 
ATOM   7872  O  O   . ILE A  1  997  ? -12.274 -17.989  -24.660  1.00 111.69 ? 997  ILE A O   1 
ATOM   7873  C  CB  . ILE A  1  997  ? -13.382 -18.804  -21.676  1.00 103.40 ? 997  ILE A CB  1 
ATOM   7874  C  CG1 . ILE A  1  997  ? -14.816 -18.318  -21.913  1.00 118.87 ? 997  ILE A CG1 1 
ATOM   7875  C  CG2 . ILE A  1  997  ? -13.122 -19.060  -20.203  1.00 106.88 ? 997  ILE A CG2 1 
ATOM   7876  C  CD1 . ILE A  1  997  ? -15.865 -19.340  -21.486  1.00 102.34 ? 997  ILE A CD1 1 
ATOM   7877  N  N   . ALA A  1  998  ? -13.475 -16.331  -23.747  1.00 111.05 ? 998  ALA A N   1 
ATOM   7878  C  CA  . ALA A  1  998  ? -13.877 -15.810  -25.037  1.00 138.50 ? 998  ALA A CA  1 
ATOM   7879  C  C   . ALA A  1  998  ? -12.716 -15.032  -25.639  1.00 109.49 ? 998  ALA A C   1 
ATOM   7880  O  O   . ALA A  1  998  ? -12.830 -14.445  -26.715  1.00 95.44  ? 998  ALA A O   1 
ATOM   7881  C  CB  . ALA A  1  998  ? -15.104 -14.941  -24.904  1.00 159.81 ? 998  ALA A CB  1 
ATOM   7882  N  N   . LYS A  1  999  ? -11.582 -15.034  -24.947  1.00 93.96  ? 999  LYS A N   1 
ATOM   7883  C  CA  . LYS A  1  999  ? -10.386 -14.547  -25.589  1.00 96.53  ? 999  LYS A CA  1 
ATOM   7884  C  C   . LYS A  1  999  ? -9.506  -15.681  -26.149  1.00 119.37 ? 999  LYS A C   1 
ATOM   7885  O  O   . LYS A  1  999  ? -8.492  -15.416  -26.809  1.00 122.90 ? 999  LYS A O   1 
ATOM   7886  C  CB  . LYS A  1  999  ? -9.599  -13.627  -24.664  1.00 89.83  ? 999  LYS A CB  1 
ATOM   7887  C  CG  . LYS A  1  999  ? -8.566  -12.817  -25.429  1.00 146.34 ? 999  LYS A CG  1 
ATOM   7888  C  CD  . LYS A  1  999  ? -8.001  -11.675  -24.618  1.00 167.89 ? 999  LYS A CD  1 
ATOM   7889  C  CE  . LYS A  1  999  ? -7.208  -10.734  -25.520  1.00 174.17 ? 999  LYS A CE  1 
ATOM   7890  N  NZ  . LYS A  1  999  ? -6.365  -9.790   -24.747  1.00 159.21 ? 999  LYS A NZ  1 
ATOM   7891  N  N   . LEU A  1  1000 ? -9.903  -16.938  -25.926  1.00 85.79  ? 1000 LEU A N   1 
ATOM   7892  C  CA  . LEU A  1  1000 ? -9.114  -18.099  -26.367  1.00 71.68  ? 1000 LEU A CA  1 
ATOM   7893  C  C   . LEU A  1  1000 ? -9.470  -18.589  -27.751  1.00 76.10  ? 1000 LEU A C   1 
ATOM   7894  O  O   . LEU A  1  1000 ? -9.472  -19.785  -27.968  1.00 81.84  ? 1000 LEU A O   1 
ATOM   7895  C  CB  . LEU A  1  1000 ? -9.321  -19.277  -25.428  1.00 71.45  ? 1000 LEU A CB  1 
ATOM   7896  C  CG  . LEU A  1  1000 ? -9.480  -18.938  -23.971  1.00 71.67  ? 1000 LEU A CG  1 
ATOM   7897  C  CD1 . LEU A  1  1000 ? -9.455  -20.218  -23.217  1.00 71.53  ? 1000 LEU A CD1 1 
ATOM   7898  C  CD2 . LEU A  1  1000 ? -8.371  -18.033  -23.513  1.00 118.39 ? 1000 LEU A CD2 1 
ATOM   7899  N  N   . THR A  1  1001 ? -9.787  -17.699  -28.680  1.00 75.00  ? 1001 THR A N   1 
ATOM   7900  C  CA  . THR A  1  1001 ? -10.357 -18.152  -29.939  1.00 99.65  ? 1001 THR A CA  1 
ATOM   7901  C  C   . THR A  1  1001 ? -9.313  -18.789  -30.860  1.00 88.36  ? 1001 THR A C   1 
ATOM   7902  O  O   . THR A  1  1001 ? -8.152  -18.376  -30.841  1.00 76.61  ? 1001 THR A O   1 
ATOM   7903  C  CB  . THR A  1  1001 ? -11.049 -17.002  -30.652  1.00 131.81 ? 1001 THR A CB  1 
ATOM   7904  O  OG1 . THR A  1  1001 ? -11.267 -17.355  -32.025  1.00 208.49 ? 1001 THR A OG1 1 
ATOM   7905  C  CG2 . THR A  1  1001 ? -10.199 -15.733  -30.554  1.00 80.87  ? 1001 THR A CG2 1 
ATOM   7906  N  N   . ILE A  1  1002 ? -9.711  -19.809  -31.625  1.00 79.47  ? 1002 ILE A N   1 
ATOM   7907  C  CA  . ILE A  1  1002 ? -8.783  -20.384  -32.609  1.00 74.84  ? 1002 ILE A CA  1 
ATOM   7908  C  C   . ILE A  1  1002 ? -9.370  -20.526  -33.995  1.00 99.32  ? 1002 ILE A C   1 
ATOM   7909  O  O   . ILE A  1  1002 ? -8.650  -20.688  -34.974  1.00 132.52 ? 1002 ILE A O   1 
ATOM   7910  C  CB  . ILE A  1  1002 ? -8.161  -21.740  -32.186  1.00 75.14  ? 1002 ILE A CB  1 
ATOM   7911  C  CG1 . ILE A  1  1002 ? -9.212  -22.811  -31.931  1.00 71.09  ? 1002 ILE A CG1 1 
ATOM   7912  C  CG2 . ILE A  1  1002 ? -7.333  -21.574  -30.954  1.00 72.77  ? 1002 ILE A CG2 1 
ATOM   7913  C  CD1 . ILE A  1  1002 ? -8.666  -23.931  -31.047  1.00 76.31  ? 1002 ILE A CD1 1 
ATOM   7914  N  N   . PHE A  1  1003 ? -10.690 -20.478  -34.074  1.00 86.54  ? 1003 PHE A N   1 
ATOM   7915  C  CA  . PHE A  1  1003 ? -11.338 -20.395  -35.374  1.00 118.73 ? 1003 PHE A CA  1 
ATOM   7916  C  C   . PHE A  1  1003 ? -11.968 -19.013  -35.545  1.00 119.63 ? 1003 PHE A C   1 
ATOM   7917  O  O   . PHE A  1  1003 ? -12.798 -18.581  -34.750  1.00 122.40 ? 1003 PHE A O   1 
ATOM   7918  C  CB  . PHE A  1  1003 ? -12.389 -21.491  -35.543  1.00 147.20 ? 1003 PHE A CB  1 
ATOM   7919  C  CG  . PHE A  1  1003 ? -11.817 -22.845  -35.837  1.00 116.60 ? 1003 PHE A CG  1 
ATOM   7920  C  CD1 . PHE A  1  1003 ? -11.362 -23.646  -34.814  1.00 118.25 ? 1003 PHE A CD1 1 
ATOM   7921  C  CD2 . PHE A  1  1003 ? -11.750 -23.321  -37.135  1.00 88.56  ? 1003 PHE A CD2 1 
ATOM   7922  C  CE1 . PHE A  1  1003 ? -10.845 -24.895  -35.080  1.00 156.07 ? 1003 PHE A CE1 1 
ATOM   7923  C  CE2 . PHE A  1  1003 ? -11.237 -24.557  -37.414  1.00 128.68 ? 1003 PHE A CE2 1 
ATOM   7924  C  CZ  . PHE A  1  1003 ? -10.779 -25.352  -36.387  1.00 170.41 ? 1003 PHE A CZ  1 
ATOM   7925  N  N   . ARG A  1  1004 ? -11.549 -18.316  -36.588  1.00 109.30 ? 1004 ARG A N   1 
ATOM   7926  C  CA  . ARG A  1  1004 ? -12.052 -16.978  -36.807  1.00 131.72 ? 1004 ARG A CA  1 
ATOM   7927  C  C   . ARG A  1  1004 ? -12.886 -16.978  -38.078  1.00 179.25 ? 1004 ARG A C   1 
ATOM   7928  O  O   . ARG A  1  1004 ? -12.549 -17.640  -39.060  1.00 216.45 ? 1004 ARG A O   1 
ATOM   7929  C  CB  . ARG A  1  1004 ? -10.883 -16.000  -36.901  1.00 127.13 ? 1004 ARG A CB  1 
ATOM   7930  C  CG  . ARG A  1  1004 ? -9.690  -16.418  -36.043  1.00 108.69 ? 1004 ARG A CG  1 
ATOM   7931  C  CD  . ARG A  1  1004 ? -8.631  -15.326  -35.914  1.00 77.72  ? 1004 ARG A CD  1 
ATOM   7932  N  NE  . ARG A  1  1004 ? -7.862  -15.462  -34.676  1.00 109.31 ? 1004 ARG A NE  1 
ATOM   7933  C  CZ  . ARG A  1  1004 ? -8.141  -14.812  -33.544  1.00 112.21 ? 1004 ARG A CZ  1 
ATOM   7934  N  NH1 . ARG A  1  1004 ? -9.166  -13.970  -33.489  1.00 79.47  ? 1004 ARG A NH1 1 
ATOM   7935  N  NH2 . ARG A  1  1004 ? -7.399  -14.999  -32.461  1.00 111.21 ? 1004 ARG A NH2 1 
ATOM   7936  N  N   . GLY A  1  1005 ? -14.004 -16.270  -38.039  1.00 166.45 ? 1005 GLY A N   1 
ATOM   7937  C  CA  . GLY A  1  1005 ? -14.431 -15.577  -36.843  1.00 82.45  ? 1005 GLY A CA  1 
ATOM   7938  C  C   . GLY A  1  1005 ? -15.938 -15.653  -36.775  1.00 182.51 ? 1005 GLY A C   1 
ATOM   7939  O  O   . GLY A  1  1005 ? -16.497 -16.749  -36.694  1.00 194.87 ? 1005 GLY A O   1 
ATOM   7940  N  N   . SER A  1  1006 ? -16.600 -14.500  -36.799  1.00 174.32 ? 1006 SER A N   1 
ATOM   7941  C  CA  . SER A  1  1006 ? -18.062 -14.470  -36.873  1.00 181.30 ? 1006 SER A CA  1 
ATOM   7942  C  C   . SER A  1  1006 ? -18.577 -13.319  -37.715  1.00 165.86 ? 1006 SER A C   1 
ATOM   7943  O  O   . SER A  1  1006 ? -18.448 -12.158  -37.327  1.00 168.46 ? 1006 SER A O   1 
ATOM   7944  C  CB  . SER A  1  1006 ? -18.708 -14.413  -35.488  1.00 161.26 ? 1006 SER A CB  1 
ATOM   7945  O  OG  . SER A  1  1006 ? -20.123 -14.359  -35.602  1.00 106.48 ? 1006 SER A OG  1 
ATOM   7946  N  N   . ASP A  1  1007 ? -19.176 -13.630  -38.864  1.00 149.43 ? 1007 ASP A N   1 
ATOM   7947  C  CA  . ASP A  1  1007 ? -19.324 -15.001  -39.370  1.00 174.93 ? 1007 ASP A CA  1 
ATOM   7948  C  C   . ASP A  1  1007 ? -20.058 -15.954  -38.415  1.00 165.61 ? 1007 ASP A C   1 
ATOM   7949  O  O   . ASP A  1  1007 ? -19.484 -16.933  -37.947  1.00 167.23 ? 1007 ASP A O   1 
ATOM   7950  C  CB  . ASP A  1  1007 ? -17.965 -15.590  -39.798  1.00 194.94 ? 1007 ASP A CB  1 
ATOM   7951  C  CG  . ASP A  1  1007 ? -18.100 -16.753  -40.784  1.00 209.64 ? 1007 ASP A CG  1 
ATOM   7952  O  OD1 . ASP A  1  1007 ? -17.075 -17.397  -41.114  1.00 200.30 ? 1007 ASP A OD1 1 
ATOM   7953  O  OD2 . ASP A  1  1007 ? -19.236 -17.026  -41.230  1.00 218.78 ? 1007 ASP A OD2 1 
ATOM   7954  N  N   . ARG A  1  1008 ? -21.327 -15.663  -38.147  1.00 238.16 ? 1008 ARG A N   1 
ATOM   7955  C  CA  . ARG A  1  1008 ? -22.140 -16.498  -37.263  1.00 232.17 ? 1008 ARG A CA  1 
ATOM   7956  C  C   . ARG A  1  1008 ? -22.048 -17.983  -37.610  1.00 194.36 ? 1008 ARG A C   1 
ATOM   7957  O  O   . ARG A  1  1008 ? -21.667 -18.349  -38.727  1.00 203.44 ? 1008 ARG A O   1 
ATOM   7958  C  CB  . ARG A  1  1008 ? -23.606 -16.049  -37.289  1.00 249.11 ? 1008 ARG A CB  1 
ATOM   7959  C  CG  . ARG A  1  1008 ? -23.849 -14.679  -36.677  1.00 249.73 ? 1008 ARG A CG  1 
ATOM   7960  C  CD  . ARG A  1  1008 ? -25.311 -14.264  -36.791  1.00 267.99 ? 1008 ARG A CD  1 
ATOM   7961  N  NE  . ARG A  1  1008 ? -25.544 -12.921  -36.268  1.00 274.87 ? 1008 ARG A NE  1 
ATOM   7962  C  CZ  . ARG A  1  1008 ? -26.718 -12.293  -36.304  1.00 268.61 ? 1008 ARG A CZ  1 
ATOM   7963  N  NH1 . ARG A  1  1008 ? -27.779 -12.884  -36.846  1.00 297.16 ? 1008 ARG A NH1 1 
ATOM   7964  N  NH2 . ARG A  1  1008 ? -26.835 -11.070  -35.799  1.00 214.07 ? 1008 ARG A NH2 1 
ATOM   7965  N  N   . ILE A  1  1009 ? -22.392 -18.832  -36.646  1.00 81.08  ? 1009 ILE A N   1 
ATOM   7966  C  CA  . ILE A  1  1009 ? -22.337 -20.274  -36.846  1.00 82.05  ? 1009 ILE A CA  1 
ATOM   7967  C  C   . ILE A  1  1009 ? -20.889 -20.803  -36.975  1.00 101.53 ? 1009 ILE A C   1 
ATOM   7968  O  O   . ILE A  1  1009 ? -20.567 -21.898  -36.497  1.00 79.11  ? 1009 ILE A O   1 
ATOM   7969  C  CB  . ILE A  1  1009 ? -23.217 -20.694  -38.041  1.00 107.62 ? 1009 ILE A CB  1 
ATOM   7970  C  CG1 . ILE A  1  1009 ? -24.698 -20.513  -37.694  1.00 90.48  ? 1009 ILE A CG1 1 
ATOM   7971  C  CG2 . ILE A  1  1009 ? -22.946 -22.126  -38.436  1.00 130.31 ? 1009 ILE A CG2 1 
ATOM   7972  C  CD1 . ILE A  1  1009 ? -25.272 -21.583  -36.763  1.00 81.66  ? 1009 ILE A CD1 1 
ATOM   7973  N  N   . THR A  1  1010 ? -20.016 -20.027  -37.613  1.00 174.60 ? 1010 THR A N   1 
ATOM   7974  C  CA  . THR A  1  1010 ? -18.582 -20.342  -37.645  1.00 144.32 ? 1010 THR A CA  1 
ATOM   7975  C  C   . THR A  1  1010 ? -17.993 -20.112  -36.252  1.00 86.91  ? 1010 THR A C   1 
ATOM   7976  O  O   . THR A  1  1010 ? -16.825 -20.360  -36.017  1.00 82.94  ? 1010 THR A O   1 
ATOM   7977  C  CB  . THR A  1  1010 ? -17.809 -19.500  -38.699  1.00 186.06 ? 1010 THR A CB  1 
ATOM   7978  O  OG1 . THR A  1  1010 ? -18.452 -19.618  -39.978  1.00 211.50 ? 1010 THR A OG1 1 
ATOM   7979  C  CG2 . THR A  1  1010 ? -16.352 -19.963  -38.825  1.00 131.49 ? 1010 THR A CG2 1 
ATOM   7980  N  N   . ARG A  1  1011 ? -18.813 -19.634  -35.332  1.00 121.17 ? 1011 ARG A N   1 
ATOM   7981  C  CA  . ARG A  1  1011 ? -18.351 -19.459  -33.973  1.00 128.48 ? 1011 ARG A CA  1 
ATOM   7982  C  C   . ARG A  1  1011 ? -18.656 -20.732  -33.229  1.00 96.73  ? 1011 ARG A C   1 
ATOM   7983  O  O   . ARG A  1  1011 ? -18.243 -20.902  -32.086  1.00 107.75 ? 1011 ARG A O   1 
ATOM   7984  C  CB  . ARG A  1  1011 ? -19.068 -18.302  -33.294  1.00 166.68 ? 1011 ARG A CB  1 
ATOM   7985  C  CG  . ARG A  1  1011 ? -20.508 -18.614  -32.968  1.00 172.16 ? 1011 ARG A CG  1 
ATOM   7986  C  CD  . ARG A  1  1011 ? -21.155 -17.459  -32.235  1.00 152.65 ? 1011 ARG A CD  1 
ATOM   7987  N  NE  . ARG A  1  1011 ? -22.603 -17.614  -32.185  1.00 148.46 ? 1011 ARG A NE  1 
ATOM   7988  C  CZ  . ARG A  1  1011 ? -23.435 -17.099  -33.084  1.00 179.86 ? 1011 ARG A CZ  1 
ATOM   7989  N  NH1 . ARG A  1  1011 ? -22.965 -16.389  -34.100  1.00 184.07 ? 1011 ARG A NH1 1 
ATOM   7990  N  NH2 . ARG A  1  1011 ? -24.741 -17.290  -32.962  1.00 199.86 ? 1011 ARG A NH2 1 
ATOM   7991  N  N   . ASP A  1  1012 ? -19.398 -21.625  -33.875  1.00 81.33  ? 1012 ASP A N   1 
ATOM   7992  C  CA  . ASP A  1  1012 ? -19.722 -22.907  -33.250  1.00 102.65 ? 1012 ASP A CA  1 
ATOM   7993  C  C   . ASP A  1  1012 ? -18.519 -23.834  -33.259  1.00 117.58 ? 1012 ASP A C   1 
ATOM   7994  O  O   . ASP A  1  1012 ? -18.155 -24.389  -32.220  1.00 132.97 ? 1012 ASP A O   1 
ATOM   7995  C  CB  . ASP A  1  1012 ? -20.911 -23.589  -33.936  1.00 121.40 ? 1012 ASP A CB  1 
ATOM   7996  C  CG  . ASP A  1  1012 ? -21.609 -24.603  -33.030  1.00 125.98 ? 1012 ASP A CG  1 
ATOM   7997  O  OD1 . ASP A  1  1012 ? -21.641 -24.385  -31.800  1.00 115.84 ? 1012 ASP A OD1 1 
ATOM   7998  O  OD2 . ASP A  1  1012 ? -22.140 -25.609  -33.549  1.00 122.28 ? 1012 ASP A OD2 1 
ATOM   7999  N  N   . VAL A  1  1013 ? -17.898 -24.000  -34.422  1.00 115.49 ? 1013 VAL A N   1 
ATOM   8000  C  CA  . VAL A  1  1013 ? -16.724 -24.857  -34.513  1.00 110.70 ? 1013 VAL A CA  1 
ATOM   8001  C  C   . VAL A  1  1013 ? -15.728 -24.474  -33.436  1.00 89.98  ? 1013 VAL A C   1 
ATOM   8002  O  O   . VAL A  1  1013 ? -14.951 -25.306  -32.990  1.00 88.18  ? 1013 VAL A O   1 
ATOM   8003  C  CB  . VAL A  1  1013 ? -16.049 -24.773  -35.886  1.00 82.91  ? 1013 VAL A CB  1 
ATOM   8004  C  CG1 . VAL A  1  1013 ? -14.839 -25.698  -35.949  1.00 73.47  ? 1013 VAL A CG1 1 
ATOM   8005  C  CG2 . VAL A  1  1013 ? -17.031 -25.154  -36.957  1.00 94.09  ? 1013 VAL A CG2 1 
ATOM   8006  N  N   . GLN A  1  1014 ? -15.774 -23.216  -33.013  1.00 93.82  ? 1014 GLN A N   1 
ATOM   8007  C  CA  . GLN A  1  1014 ? -14.828 -22.715  -32.029  1.00 126.54 ? 1014 GLN A CA  1 
ATOM   8008  C  C   . GLN A  1  1014 ? -15.312 -22.931  -30.595  1.00 119.96 ? 1014 GLN A C   1 
ATOM   8009  O  O   . GLN A  1  1014 ? -14.533 -23.309  -29.720  1.00 131.74 ? 1014 GLN A O   1 
ATOM   8010  C  CB  . GLN A  1  1014 ? -14.535 -21.234  -32.285  1.00 115.79 ? 1014 GLN A CB  1 
ATOM   8011  C  CG  . GLN A  1  1014 ? -13.298 -20.704  -31.564  1.00 72.79  ? 1014 GLN A CG  1 
ATOM   8012  C  CD  . GLN A  1  1014 ? -13.595 -20.350  -30.122  1.00 98.52  ? 1014 GLN A CD  1 
ATOM   8013  O  OE1 . GLN A  1  1014 ? -12.780 -20.578  -29.228  1.00 90.58  ? 1014 GLN A OE1 1 
ATOM   8014  N  NE2 . GLN A  1  1014 ? -14.778 -19.797  -29.891  1.00 119.53 ? 1014 GLN A NE2 1 
ATOM   8015  N  N   . ASN A  1  1015 ? -16.597 -22.701  -30.366  1.00 119.18 ? 1015 ASN A N   1 
ATOM   8016  C  CA  . ASN A  1  1015 ? -17.163 -22.879  -29.040  1.00 139.06 ? 1015 ASN A CA  1 
ATOM   8017  C  C   . ASN A  1  1015 ? -16.881 -24.262  -28.479  1.00 125.87 ? 1015 ASN A C   1 
ATOM   8018  O  O   . ASN A  1  1015 ? -16.700 -24.426  -27.271  1.00 126.32 ? 1015 ASN A O   1 
ATOM   8019  C  CB  . ASN A  1  1015 ? -18.663 -22.624  -29.068  1.00 192.08 ? 1015 ASN A CB  1 
ATOM   8020  C  CG  . ASN A  1  1015 ? -18.994 -21.169  -29.304  1.00 222.16 ? 1015 ASN A CG  1 
ATOM   8021  O  OD1 . ASN A  1  1015 ? -18.107 -20.353  -29.558  1.00 253.14 ? 1015 ASN A OD1 1 
ATOM   8022  N  ND2 . ASN A  1  1015 ? -20.272 -20.831  -29.215  1.00 207.80 ? 1015 ASN A ND2 1 
ATOM   8023  N  N   . ASN A  1  1016 ? -16.847 -25.259  -29.358  1.00 74.53  ? 1016 ASN A N   1 
ATOM   8024  C  CA  . ASN A  1  1016 ? -16.574 -26.615  -28.909  1.00 72.74  ? 1016 ASN A CA  1 
ATOM   8025  C  C   . ASN A  1  1016 ? -15.293 -27.196  -29.497  1.00 73.98  ? 1016 ASN A C   1 
ATOM   8026  O  O   . ASN A  1  1016 ? -15.070 -28.402  -29.462  1.00 73.06  ? 1016 ASN A O   1 
ATOM   8027  C  CB  . ASN A  1  1016 ? -17.785 -27.524  -29.153  1.00 74.21  ? 1016 ASN A CB  1 
ATOM   8028  C  CG  . ASN A  1  1016 ? -17.916 -27.965  -30.582  1.00 75.75  ? 1016 ASN A CG  1 
ATOM   8029  O  OD1 . ASN A  1  1016 ? -17.041 -27.712  -31.415  1.00 81.71  ? 1016 ASN A OD1 1 
ATOM   8030  N  ND2 . ASN A  1  1016 ? -19.022 -28.651  -30.882  1.00 77.73  ? 1016 ASN A ND2 1 
ATOM   8031  N  N   . ALA A  1  1017 ? -14.449 -26.344  -30.045  1.00 71.11  ? 1017 ALA A N   1 
ATOM   8032  C  CA  . ALA A  1  1017 ? -13.139 -26.805  -30.418  1.00 71.06  ? 1017 ALA A CA  1 
ATOM   8033  C  C   . ALA A  1  1017 ? -12.242 -26.448  -29.272  1.00 70.43  ? 1017 ALA A C   1 
ATOM   8034  O  O   . ALA A  1  1017 ? -11.042 -26.637  -29.315  1.00 70.06  ? 1017 ALA A O   1 
ATOM   8035  C  CB  . ALA A  1  1017 ? -12.670 -26.161  -31.701  1.00 71.36  ? 1017 ALA A CB  1 
ATOM   8036  N  N   . THR A  1  1018 ? -12.838 -25.940  -28.215  1.00 71.27  ? 1018 THR A N   1 
ATOM   8037  C  CA  . THR A  1  1018 ? -12.065 -25.701  -27.021  1.00 69.80  ? 1018 THR A CA  1 
ATOM   8038  C  C   . THR A  1  1018 ? -12.868 -26.084  -25.808  1.00 73.18  ? 1018 THR A C   1 
ATOM   8039  O  O   . THR A  1  1018 ? -12.432 -25.862  -24.675  1.00 73.68  ? 1018 THR A O   1 
ATOM   8040  C  CB  . THR A  1  1018 ? -11.677 -24.249  -26.900  1.00 72.41  ? 1018 THR A CB  1 
ATOM   8041  O  OG1 . THR A  1  1018 ? -12.851 -23.448  -27.091  1.00 73.29  ? 1018 THR A OG1 1 
ATOM   8042  C  CG2 . THR A  1  1018 ? -10.632 -23.903  -27.945  1.00 87.13  ? 1018 THR A CG2 1 
ATOM   8043  N  N   . LEU A  1  1019 ? -14.039 -26.669  -26.054  1.00 74.59  ? 1019 LEU A N   1 
ATOM   8044  C  CA  . LEU A  1  1019 ? -14.954 -27.092  -24.991  1.00 75.25  ? 1019 LEU A CA  1 
ATOM   8045  C  C   . LEU A  1  1019 ? -14.283 -27.899  -23.878  1.00 71.24  ? 1019 LEU A C   1 
ATOM   8046  O  O   . LEU A  1  1019 ? -14.572 -27.701  -22.694  1.00 70.34  ? 1019 LEU A O   1 
ATOM   8047  C  CB  . LEU A  1  1019 ? -16.115 -27.894  -25.565  1.00 77.60  ? 1019 LEU A CB  1 
ATOM   8048  C  CG  . LEU A  1  1019 ? -17.340 -27.970  -24.654  1.00 75.05  ? 1019 LEU A CG  1 
ATOM   8049  C  CD1 . LEU A  1  1019 ? -18.660 -27.943  -25.452  1.00 104.81 ? 1019 LEU A CD1 1 
ATOM   8050  C  CD2 . LEU A  1  1019 ? -17.275 -29.174  -23.731  1.00 73.89  ? 1019 LEU A CD2 1 
ATOM   8051  N  N   . LEU A  1  1020 ? -13.392 -28.808  -24.234  1.00 96.92  ? 1020 LEU A N   1 
ATOM   8052  C  CA  . LEU A  1  1020 ? -12.716 -29.557  -23.180  1.00 80.26  ? 1020 LEU A CA  1 
ATOM   8053  C  C   . LEU A  1  1020 ? -11.861 -28.603  -22.360  1.00 82.36  ? 1020 LEU A C   1 
ATOM   8054  O  O   . LEU A  1  1020 ? -12.056 -28.496  -21.151  1.00 73.51  ? 1020 LEU A O   1 
ATOM   8055  C  CB  . LEU A  1  1020 ? -11.895 -30.708  -23.743  1.00 78.82  ? 1020 LEU A CB  1 
ATOM   8056  C  CG  . LEU A  1  1020 ? -11.570 -31.873  -22.804  1.00 80.18  ? 1020 LEU A CG  1 
ATOM   8057  C  CD1 . LEU A  1  1020 ? -10.590 -32.838  -23.496  1.00 95.78  ? 1020 LEU A CD1 1 
ATOM   8058  C  CD2 . LEU A  1  1020 ? -11.041 -31.388  -21.478  1.00 75.80  ? 1020 LEU A CD2 1 
ATOM   8059  N  N   . PHE A  1  1021 ? -10.955 -27.872  -23.012  1.00 72.61  ? 1021 PHE A N   1 
ATOM   8060  C  CA  . PHE A  1  1021 ? -10.079 -26.985  -22.274  1.00 68.98  ? 1021 PHE A CA  1 
ATOM   8061  C  C   . PHE A  1  1021 ? -10.887 -26.104  -21.350  1.00 69.20  ? 1021 PHE A C   1 
ATOM   8062  O  O   . PHE A  1  1021 ? -10.367 -25.591  -20.348  1.00 69.98  ? 1021 PHE A O   1 
ATOM   8063  C  CB  . PHE A  1  1021 ? -9.246  -26.105  -23.194  1.00 77.97  ? 1021 PHE A CB  1 
ATOM   8064  C  CG  . PHE A  1  1021 ? -8.260  -25.238  -22.451  1.00 68.44  ? 1021 PHE A CG  1 
ATOM   8065  C  CD1 . PHE A  1  1021 ? -7.193  -25.799  -21.793  1.00 68.56  ? 1021 PHE A CD1 1 
ATOM   8066  C  CD2 . PHE A  1  1021 ? -8.400  -23.873  -22.403  1.00 69.62  ? 1021 PHE A CD2 1 
ATOM   8067  C  CE1 . PHE A  1  1021 ? -6.286  -25.013  -21.107  1.00 78.05  ? 1021 PHE A CE1 1 
ATOM   8068  C  CE2 . PHE A  1  1021 ? -7.489  -23.095  -21.721  1.00 68.17  ? 1021 PHE A CE2 1 
ATOM   8069  C  CZ  . PHE A  1  1021 ? -6.434  -23.666  -21.077  1.00 69.07  ? 1021 PHE A CZ  1 
ATOM   8070  N  N   . GLN A  1  1022 ? -12.165 -25.958  -21.678  1.00 69.90  ? 1022 GLN A N   1 
ATOM   8071  C  CA  . GLN A  1  1022 ? -13.019 -25.022  -20.989  1.00 70.12  ? 1022 GLN A CA  1 
ATOM   8072  C  C   . GLN A  1  1022 ? -13.491 -25.530  -19.646  1.00 76.64  ? 1022 GLN A C   1 
ATOM   8073  O  O   . GLN A  1  1022 ? -13.439 -24.822  -18.661  1.00 75.69  ? 1022 GLN A O   1 
ATOM   8074  C  CB  . GLN A  1  1022 ? -14.213 -24.657  -21.869  1.00 72.70  ? 1022 GLN A CB  1 
ATOM   8075  C  CG  . GLN A  1  1022 ? -13.821 -24.002  -23.192  1.00 72.55  ? 1022 GLN A CG  1 
ATOM   8076  C  CD  . GLN A  1  1022 ? -14.963 -23.236  -23.820  1.00 73.83  ? 1022 GLN A CD  1 
ATOM   8077  O  OE1 . GLN A  1  1022 ? -15.650 -22.467  -23.142  1.00 72.57  ? 1022 GLN A OE1 1 
ATOM   8078  N  NE2 . GLN A  1  1022 ? -15.166 -23.433  -25.126  1.00 102.43 ? 1022 GLN A NE2 1 
ATOM   8079  N  N   . ILE A  1  1023 ? -13.958 -26.755  -19.606  1.00 114.32 ? 1023 ILE A N   1 
ATOM   8080  C  CA  . ILE A  1  1023 ? -14.464 -27.291  -18.371  1.00 99.98  ? 1023 ILE A CA  1 
ATOM   8081  C  C   . ILE A  1  1023 ? -13.386 -27.274  -17.297  1.00 98.27  ? 1023 ILE A C   1 
ATOM   8082  O  O   . ILE A  1  1023 ? -13.689 -27.387  -16.123  1.00 114.38 ? 1023 ILE A O   1 
ATOM   8083  C  CB  . ILE A  1  1023 ? -14.875 -28.698  -18.591  1.00 133.39 ? 1023 ILE A CB  1 
ATOM   8084  C  CG1 . ILE A  1  1023 ? -13.621 -29.509  -18.835  1.00 73.52  ? 1023 ILE A CG1 1 
ATOM   8085  C  CG2 . ILE A  1  1023 ? -15.787 -28.779  -19.798  1.00 80.55  ? 1023 ILE A CG2 1 
ATOM   8086  C  CD1 . ILE A  1  1023 ? -13.877 -30.845  -19.498  1.00 88.36  ? 1023 ILE A CD1 1 
ATOM   8087  N  N   . LEU A  1  1024 ? -12.130 -27.166  -17.703  1.00 70.97  ? 1024 LEU A N   1 
ATOM   8088  C  CA  . LEU A  1  1024 ? -11.023 -27.024  -16.751  1.00 71.19  ? 1024 LEU A CA  1 
ATOM   8089  C  C   . LEU A  1  1024 ? -11.132 -25.675  -16.060  1.00 97.10  ? 1024 LEU A C   1 
ATOM   8090  O  O   . LEU A  1  1024 ? -11.059 -25.562  -14.836  1.00 115.68 ? 1024 LEU A O   1 
ATOM   8091  C  CB  . LEU A  1  1024 ? -9.674  -27.077  -17.471  1.00 70.60  ? 1024 LEU A CB  1 
ATOM   8092  C  CG  . LEU A  1  1024 ? -8.985  -28.421  -17.368  1.00 88.09  ? 1024 LEU A CG  1 
ATOM   8093  C  CD1 . LEU A  1  1024 ? -7.524  -28.284  -17.701  1.00 69.92  ? 1024 LEU A CD1 1 
ATOM   8094  C  CD2 . LEU A  1  1024 ? -9.159  -28.962  -15.973  1.00 94.25  ? 1024 LEU A CD2 1 
ATOM   8095  N  N   . LEU A  1  1025 ? -11.297 -24.640  -16.865  1.00 70.26  ? 1025 LEU A N   1 
ATOM   8096  C  CA  . LEU A  1  1025 ? -11.301 -23.289  -16.359  1.00 70.35  ? 1025 LEU A CA  1 
ATOM   8097  C  C   . LEU A  1  1025 ? -12.545 -22.941  -15.541  1.00 90.72  ? 1025 LEU A C   1 
ATOM   8098  O  O   . LEU A  1  1025 ? -12.648 -21.832  -15.033  1.00 152.01 ? 1025 LEU A O   1 
ATOM   8099  C  CB  . LEU A  1  1025 ? -11.125 -22.312  -17.522  1.00 78.75  ? 1025 LEU A CB  1 
ATOM   8100  C  CG  . LEU A  1  1025 ? -9.759  -22.351  -18.209  1.00 72.65  ? 1025 LEU A CG  1 
ATOM   8101  C  CD1 . LEU A  1  1025 ? -9.787  -21.565  -19.509  1.00 71.07  ? 1025 LEU A CD1 1 
ATOM   8102  C  CD2 . LEU A  1  1025 ? -8.673  -21.844  -17.256  1.00 74.81  ? 1025 LEU A CD2 1 
ATOM   8103  N  N   . ARG A  1  1026 ? -13.494 -23.854  -15.417  1.00 74.41  ? 1026 ARG A N   1 
ATOM   8104  C  CA  . ARG A  1  1026 ? -14.653 -23.596  -14.564  1.00 77.98  ? 1026 ARG A CA  1 
ATOM   8105  C  C   . ARG A  1  1026 ? -14.603 -24.528  -13.374  1.00 95.41  ? 1026 ARG A C   1 
ATOM   8106  O  O   . ARG A  1  1026 ? -15.559 -24.619  -12.591  1.00 115.72 ? 1026 ARG A O   1 
ATOM   8107  C  CB  . ARG A  1  1026 ? -15.947 -23.829  -15.324  1.00 85.20  ? 1026 ARG A CB  1 
ATOM   8108  C  CG  . ARG A  1  1026 ? -16.198 -22.878  -16.457  1.00 77.99  ? 1026 ARG A CG  1 
ATOM   8109  C  CD  . ARG A  1  1026 ? -17.449 -23.308  -17.178  1.00 77.14  ? 1026 ARG A CD  1 
ATOM   8110  N  NE  . ARG A  1  1026 ? -17.674 -22.509  -18.371  1.00 108.85 ? 1026 ARG A NE  1 
ATOM   8111  C  CZ  . ARG A  1  1026 ? -17.457 -22.940  -19.610  1.00 118.28 ? 1026 ARG A CZ  1 
ATOM   8112  N  NH1 . ARG A  1  1026 ? -17.008 -24.174  -19.812  1.00 71.28  ? 1026 ARG A NH1 1 
ATOM   8113  N  NH2 . ARG A  1  1026 ? -17.692 -22.141  -20.647  1.00 137.27 ? 1026 ARG A NH2 1 
ATOM   8114  N  N   . SER A  1  1027 ? -13.481 -25.233  -13.265  1.00 107.86 ? 1027 SER A N   1 
ATOM   8115  C  CA  . SER A  1  1027 ? -13.291 -26.268  -12.270  1.00 109.71 ? 1027 SER A CA  1 
ATOM   8116  C  C   . SER A  1  1027 ? -12.110 -25.915  -11.397  1.00 98.82  ? 1027 SER A C   1 
ATOM   8117  O  O   . SER A  1  1027 ? -12.034 -26.332  -10.245  1.00 81.90  ? 1027 SER A O   1 
ATOM   8118  C  CB  . SER A  1  1027 ? -13.067 -27.636  -12.931  1.00 83.82  ? 1027 SER A CB  1 
ATOM   8119  O  OG  . SER A  1  1027 ? -12.167 -27.553  -14.027  1.00 121.85 ? 1027 SER A OG  1 
ATOM   8120  N  N   . LYS A  1  1028 ? -11.184 -25.147  -11.945  1.00 94.55  ? 1028 LYS A N   1 
ATOM   8121  C  CA  . LYS A  1  1028 ? -10.069 -24.691  -11.139  1.00 102.02 ? 1028 LYS A CA  1 
ATOM   8122  C  C   . LYS A  1  1028 ? -10.169 -23.196  -10.858  1.00 128.57 ? 1028 LYS A C   1 
ATOM   8123  O  O   . LYS A  1  1028 ? -9.301  -22.626  -10.200  1.00 137.27 ? 1028 LYS A O   1 
ATOM   8124  C  CB  . LYS A  1  1028 ? -8.722  -25.084  -11.760  1.00 119.63 ? 1028 LYS A CB  1 
ATOM   8125  C  CG  . LYS A  1  1028 ? -8.112  -26.335  -11.128  1.00 130.34 ? 1028 LYS A CG  1 
ATOM   8126  C  CD  . LYS A  1  1028 ? -6.954  -26.933  -11.923  1.00 105.92 ? 1028 LYS A CD  1 
ATOM   8127  C  CE  . LYS A  1  1028 ? -7.444  -27.527  -13.227  1.00 103.80 ? 1028 LYS A CE  1 
ATOM   8128  N  NZ  . LYS A  1  1028 ? -7.943  -26.461  -14.141  1.00 115.91 ? 1028 LYS A NZ  1 
ATOM   8129  N  N   . PHE A  1  1029 ? -11.245 -22.576  -11.338  1.00 91.31  ? 1029 PHE A N   1 
ATOM   8130  C  CA  . PHE A  1  1029 ? -11.501 -21.158  -11.079  1.00 79.01  ? 1029 PHE A CA  1 
ATOM   8131  C  C   . PHE A  1  1029 ? -12.958 -20.870  -10.732  1.00 76.70  ? 1029 PHE A C   1 
ATOM   8132  O  O   . PHE A  1  1029 ? -13.358 -19.713  -10.683  1.00 89.51  ? 1029 PHE A O   1 
ATOM   8133  C  CB  . PHE A  1  1029 ? -11.082 -20.294  -12.275  1.00 79.59  ? 1029 PHE A CB  1 
ATOM   8134  C  CG  . PHE A  1  1029 ? -9.615  -20.352  -12.585  1.00 81.44  ? 1029 PHE A CG  1 
ATOM   8135  C  CD1 . PHE A  1  1029 ? -9.162  -20.965  -13.741  1.00 82.67  ? 1029 PHE A CD1 1 
ATOM   8136  C  CD2 . PHE A  1  1029 ? -8.693  -19.797  -11.718  1.00 81.72  ? 1029 PHE A CD2 1 
ATOM   8137  C  CE1 . PHE A  1  1029 ? -7.811  -21.020  -14.016  1.00 80.52  ? 1029 PHE A CE1 1 
ATOM   8138  C  CE2 . PHE A  1  1029 ? -7.335  -19.848  -11.982  1.00 81.44  ? 1029 PHE A CE2 1 
ATOM   8139  C  CZ  . PHE A  1  1029 ? -6.894  -20.457  -13.129  1.00 86.45  ? 1029 PHE A CZ  1 
ATOM   8140  N  N   . ALA A  1  1030 ? -13.754 -21.910  -10.515  1.00 78.34  ? 1030 ALA A N   1 
ATOM   8141  C  CA  . ALA A  1  1030 ? -15.110 -21.726  -10.014  1.00 90.92  ? 1030 ALA A CA  1 
ATOM   8142  C  C   . ALA A  1  1030 ? -15.018 -21.008  -8.659   1.00 95.83  ? 1030 ALA A C   1 
ATOM   8143  O  O   . ALA A  1  1030 ? -13.981 -21.070  -7.988   1.00 92.20  ? 1030 ALA A O   1 
ATOM   8144  C  CB  . ALA A  1  1030 ? -15.829 -23.062  -9.887   1.00 131.07 ? 1030 ALA A CB  1 
ATOM   8145  N  N   . VAL A  1  1031 ? -16.091 -20.333  -8.253   1.00 89.44  ? 1031 VAL A N   1 
ATOM   8146  C  CA  . VAL A  1  1031 ? -16.026 -19.395  -7.119   1.00 106.93 ? 1031 VAL A CA  1 
ATOM   8147  C  C   . VAL A  1  1031 ? -15.464 -19.929  -5.804   1.00 108.76 ? 1031 VAL A C   1 
ATOM   8148  O  O   . VAL A  1  1031 ? -14.387 -19.507  -5.371   1.00 82.23  ? 1031 VAL A O   1 
ATOM   8149  C  CB  . VAL A  1  1031 ? -17.381 -18.770  -6.846   1.00 91.22  ? 1031 VAL A CB  1 
ATOM   8150  C  CG1 . VAL A  1  1031 ? -17.222 -17.540  -5.963   1.00 82.48  ? 1031 VAL A CG1 1 
ATOM   8151  C  CG2 . VAL A  1  1031 ? -18.045 -18.432  -8.154   1.00 108.98 ? 1031 VAL A CG2 1 
ATOM   8152  N  N   . LYS A  1  1032 ? -16.203 -20.833  -5.168   1.00 148.58 ? 1032 LYS A N   1 
ATOM   8153  C  CA  . LYS A  1  1032 ? -15.808 -21.398  -3.883   1.00 149.77 ? 1032 LYS A CA  1 
ATOM   8154  C  C   . LYS A  1  1032 ? -14.361 -21.870  -3.886   1.00 130.40 ? 1032 LYS A C   1 
ATOM   8155  O  O   . LYS A  1  1032 ? -13.734 -21.982  -2.839   1.00 115.92 ? 1032 LYS A O   1 
ATOM   8156  C  CB  . LYS A  1  1032 ? -16.738 -22.550  -3.495   1.00 122.44 ? 1032 LYS A CB  1 
ATOM   8157  C  CG  . LYS A  1  1032 ? -16.339 -23.276  -2.219   1.00 109.33 ? 1032 LYS A CG  1 
ATOM   8158  C  CD  . LYS A  1  1032 ? -17.379 -24.327  -1.863   1.00 107.23 ? 1032 LYS A CD  1 
ATOM   8159  C  CE  . LYS A  1  1032 ? -17.022 -25.102  -0.603   1.00 117.10 ? 1032 LYS A CE  1 
ATOM   8160  N  NZ  . LYS A  1  1032 ? -18.194 -25.909  -0.152   1.00 110.60 ? 1032 LYS A NZ  1 
ATOM   8161  N  N   . ARG A  1  1033 ? -13.834 -22.130  -5.068   1.00 79.76  ? 1033 ARG A N   1 
ATOM   8162  C  CA  . ARG A  1  1033 ? -12.507 -22.697  -5.184   1.00 84.72  ? 1033 ARG A CA  1 
ATOM   8163  C  C   . ARG A  1  1033 ? -11.466 -21.624  -4.947   1.00 81.25  ? 1033 ARG A C   1 
ATOM   8164  O  O   . ARG A  1  1033 ? -10.399 -21.900  -4.410   1.00 134.22 ? 1033 ARG A O   1 
ATOM   8165  C  CB  . ARG A  1  1033 ? -12.334 -23.324  -6.572   1.00 116.55 ? 1033 ARG A CB  1 
ATOM   8166  C  CG  . ARG A  1  1033 ? -11.089 -24.181  -6.758   1.00 100.41 ? 1033 ARG A CG  1 
ATOM   8167  C  CD  . ARG A  1  1033 ? -11.235 -25.601  -6.206   1.00 73.78  ? 1033 ARG A CD  1 
ATOM   8168  N  NE  . ARG A  1  1033 ? -9.984  -26.338  -6.371   1.00 70.31  ? 1033 ARG A NE  1 
ATOM   8169  C  CZ  . ARG A  1  1033 ? -9.745  -27.171  -7.373   1.00 70.13  ? 1033 ARG A CZ  1 
ATOM   8170  N  NH1 . ARG A  1  1033 ? -10.679 -27.388  -8.285   1.00 72.40  ? 1033 ARG A NH1 1 
ATOM   8171  N  NH2 . ARG A  1  1033 ? -8.575  -27.795  -7.455   1.00 72.23  ? 1033 ARG A NH2 1 
ATOM   8172  N  N   . VAL A  1  1034 ? -11.762 -20.390  -5.343   1.00 71.19  ? 1034 VAL A N   1 
ATOM   8173  C  CA  . VAL A  1  1034 ? -10.733 -19.352  -5.318   1.00 72.51  ? 1034 VAL A CA  1 
ATOM   8174  C  C   . VAL A  1  1034 ? -10.717 -18.618  -3.973   1.00 73.48  ? 1034 VAL A C   1 
ATOM   8175  O  O   . VAL A  1  1034 ? -9.897  -17.734  -3.725   1.00 72.15  ? 1034 VAL A O   1 
ATOM   8176  C  CB  . VAL A  1  1034 ? -10.880 -18.365  -6.504   1.00 72.20  ? 1034 VAL A CB  1 
ATOM   8177  C  CG1 . VAL A  1  1034 ? -9.654  -17.468  -6.620   1.00 72.16  ? 1034 VAL A CG1 1 
ATOM   8178  C  CG2 . VAL A  1  1034 ? -11.089 -19.129  -7.798   1.00 72.23  ? 1034 VAL A CG2 1 
ATOM   8179  N  N   . ILE A  1  1035 ? -11.607 -19.009  -3.084   1.00 92.77  ? 1035 ILE A N   1 
ATOM   8180  C  CA  . ILE A  1  1035 ? -11.656 -18.341  -1.804   1.00 88.36  ? 1035 ILE A CA  1 
ATOM   8181  C  C   . ILE A  1  1035 ? -11.403 -19.350  -0.684   1.00 119.04 ? 1035 ILE A C   1 
ATOM   8182  O  O   . ILE A  1  1035 ? -10.799 -19.008  0.327    1.00 89.19  ? 1035 ILE A O   1 
ATOM   8183  C  CB  . ILE A  1  1035 ? -13.007 -17.634  -1.596   1.00 120.27 ? 1035 ILE A CB  1 
ATOM   8184  C  CG1 . ILE A  1  1035 ? -13.299 -16.633  -2.714   1.00 94.02  ? 1035 ILE A CG1 1 
ATOM   8185  C  CG2 . ILE A  1  1035 ? -13.045 -16.920  -0.253   1.00 155.87 ? 1035 ILE A CG2 1 
ATOM   8186  C  CD1 . ILE A  1  1035 ? -14.704 -16.148  -2.691   1.00 96.85  ? 1035 ILE A CD1 1 
ATOM   8187  N  N   . MET A  1  1036 ? -11.855 -20.586  -0.859   1.00 175.19 ? 1036 MET A N   1 
ATOM   8188  C  CA  . MET A  1  1036 ? -11.532 -21.631  0.105    1.00 214.69 ? 1036 MET A CA  1 
ATOM   8189  C  C   . MET A  1  1036 ? -10.081 -22.070  -0.108   1.00 210.02 ? 1036 MET A C   1 
ATOM   8190  O  O   . MET A  1  1036 ? -9.235  -21.903  0.770    1.00 223.31 ? 1036 MET A O   1 
ATOM   8191  C  CB  . MET A  1  1036 ? -12.487 -22.819  -0.031   1.00 245.94 ? 1036 MET A CB  1 
ATOM   8192  C  CG  . MET A  1  1036 ? -12.039 -24.103  0.678    1.00 262.16 ? 1036 MET A CG  1 
ATOM   8193  S  SD  . MET A  1  1036 ? -12.226 -24.105  2.477    1.00 351.18 ? 1036 MET A SD  1 
ATOM   8194  C  CE  . MET A  1  1036 ? -11.825 -25.811  2.868    1.00 114.57 ? 1036 MET A CE  1 
ATOM   8195  N  N   . GLU A  1  1037 ? -9.800  -22.628  -1.280   1.00 179.03 ? 1037 GLU A N   1 
ATOM   8196  C  CA  . GLU A  1  1037 ? -8.449  -23.066  -1.622   1.00 120.13 ? 1037 GLU A CA  1 
ATOM   8197  C  C   . GLU A  1  1037 ? -7.698  -21.933  -2.294   1.00 127.68 ? 1037 GLU A C   1 
ATOM   8198  O  O   . GLU A  1  1037 ? -8.235  -21.239  -3.161   1.00 163.00 ? 1037 GLU A O   1 
ATOM   8199  C  CB  . GLU A  1  1037 ? -8.485  -24.287  -2.554   1.00 111.32 ? 1037 GLU A CB  1 
ATOM   8200  C  CG  . GLU A  1  1037 ? -9.125  -25.534  -1.960   1.00 147.08 ? 1037 GLU A CG  1 
ATOM   8201  C  CD  . GLU A  1  1037 ? -9.230  -26.686  -2.950   1.00 165.86 ? 1037 GLU A CD  1 
ATOM   8202  O  OE1 . GLU A  1  1037 ? -9.984  -27.641  -2.667   1.00 193.19 ? 1037 GLU A OE1 1 
ATOM   8203  O  OE2 . GLU A  1  1037 ? -8.560  -26.643  -4.008   1.00 137.71 ? 1037 GLU A OE2 1 
ATOM   8204  N  N   . TYR A  1  1038 ? -6.446  -21.756  -1.898   1.00 94.45  ? 1038 TYR A N   1 
ATOM   8205  C  CA  . TYR A  1  1038 ? -5.589  -20.738  -2.499   1.00 112.66 ? 1038 TYR A CA  1 
ATOM   8206  C  C   . TYR A  1  1038 ? -6.280  -19.393  -2.752   1.00 135.87 ? 1038 TYR A C   1 
ATOM   8207  O  O   . TYR A  1  1038 ? -6.678  -19.087  -3.878   1.00 128.68 ? 1038 TYR A O   1 
ATOM   8208  C  CB  . TYR A  1  1038 ? -4.890  -21.261  -3.770   1.00 148.65 ? 1038 TYR A CB  1 
ATOM   8209  C  CG  . TYR A  1  1038 ? -5.743  -21.913  -4.857   1.00 167.03 ? 1038 TYR A CG  1 
ATOM   8210  C  CD1 . TYR A  1  1038 ? -5.682  -23.288  -5.079   1.00 178.23 ? 1038 TYR A CD1 1 
ATOM   8211  C  CD2 . TYR A  1  1038 ? -6.547  -21.150  -5.692   1.00 113.51 ? 1038 TYR A CD2 1 
ATOM   8212  C  CE1 . TYR A  1  1038 ? -6.420  -23.889  -6.081   1.00 144.03 ? 1038 TYR A CE1 1 
ATOM   8213  C  CE2 . TYR A  1  1038 ? -7.293  -21.743  -6.702   1.00 85.49  ? 1038 TYR A CE2 1 
ATOM   8214  C  CZ  . TYR A  1  1038 ? -7.224  -23.112  -6.896   1.00 101.75 ? 1038 TYR A CZ  1 
ATOM   8215  O  OH  . TYR A  1  1038 ? -7.964  -23.716  -7.890   1.00 87.97  ? 1038 TYR A OH  1 
ATOM   8216  N  N   . ARG A  1  1039 ? -6.413  -18.604  -1.685   1.00 142.36 ? 1039 ARG A N   1 
ATOM   8217  C  CA  . ARG A  1  1039 ? -6.975  -17.257  -1.755   1.00 99.20  ? 1039 ARG A CA  1 
ATOM   8218  C  C   . ARG A  1  1039 ? -6.200  -16.381  -2.729   1.00 97.49  ? 1039 ARG A C   1 
ATOM   8219  O  O   . ARG A  1  1039 ? -4.977  -16.240  -2.606   1.00 111.85 ? 1039 ARG A O   1 
ATOM   8220  C  CB  . ARG A  1  1039 ? -6.953  -16.592  -0.380   1.00 135.86 ? 1039 ARG A CB  1 
ATOM   8221  C  CG  . ARG A  1  1039 ? -7.664  -17.363  0.700    1.00 151.71 ? 1039 ARG A CG  1 
ATOM   8222  C  CD  . ARG A  1  1039 ? -6.791  -18.472  1.258    1.00 141.11 ? 1039 ARG A CD  1 
ATOM   8223  N  NE  . ARG A  1  1039 ? -7.583  -19.361  2.086    1.00 155.66 ? 1039 ARG A NE  1 
ATOM   8224  C  CZ  . ARG A  1  1039 ? -7.982  -19.061  3.318    1.00 178.08 ? 1039 ARG A CZ  1 
ATOM   8225  N  NH1 . ARG A  1  1039 ? -7.644  -17.898  3.860    1.00 175.95 ? 1039 ARG A NH1 1 
ATOM   8226  N  NH2 . ARG A  1  1039 ? -8.709  -19.923  4.011    1.00 197.39 ? 1039 ARG A NH2 1 
ATOM   8227  N  N   . LEU A  1  1040 ? -6.917  -15.798  -3.682   1.00 78.55  ? 1040 LEU A N   1 
ATOM   8228  C  CA  . LEU A  1  1040 ? -6.319  -14.894  -4.660   1.00 100.78 ? 1040 LEU A CA  1 
ATOM   8229  C  C   . LEU A  1  1040 ? -6.769  -13.436  -4.468   1.00 104.25 ? 1040 LEU A C   1 
ATOM   8230  O  O   . LEU A  1  1040 ? -7.773  -13.151  -3.799   1.00 82.62  ? 1040 LEU A O   1 
ATOM   8231  C  CB  . LEU A  1  1040 ? -6.667  -15.361  -6.070   1.00 82.55  ? 1040 LEU A CB  1 
ATOM   8232  C  CG  . LEU A  1  1040 ? -6.187  -16.755  -6.401   1.00 76.14  ? 1040 LEU A CG  1 
ATOM   8233  C  CD1 . LEU A  1  1040 ? -6.310  -16.987  -7.878   1.00 78.54  ? 1040 LEU A CD1 1 
ATOM   8234  C  CD2 . LEU A  1  1040 ? -4.753  -16.858  -5.965   1.00 74.82  ? 1040 LEU A CD2 1 
ATOM   8235  N  N   . ASN A  1  1041 ? -6.031  -12.512  -5.077   1.00 79.16  ? 1041 ASN A N   1 
ATOM   8236  C  CA  . ASN A  1  1041 ? -6.401  -11.113  -5.034   1.00 88.98  ? 1041 ASN A CA  1 
ATOM   8237  C  C   . ASN A  1  1041 ? -6.394  -10.487  -6.432   1.00 89.84  ? 1041 ASN A C   1 
ATOM   8238  O  O   . ASN A  1  1041 ? -5.606  -10.894  -7.295   1.00 72.80  ? 1041 ASN A O   1 
ATOM   8239  C  CB  . ASN A  1  1041 ? -5.475  -10.365  -4.073   1.00 89.73  ? 1041 ASN A CB  1 
ATOM   8240  C  CG  . ASN A  1  1041 ? -4.016  -10.576  -4.386   1.00 82.97  ? 1041 ASN A CG  1 
ATOM   8241  O  OD1 . ASN A  1  1041 ? -3.666  -11.082  -5.442   1.00 71.31  ? 1041 ASN A OD1 1 
ATOM   8242  N  ND2 . ASN A  1  1041 ? -3.152  -10.160  -3.480   1.00 120.85 ? 1041 ASN A ND2 1 
ATOM   8243  N  N   . LYS A  1  1042 ? -7.276  -9.508   -6.641   1.00 112.72 ? 1042 LYS A N   1 
ATOM   8244  C  CA  . LYS A  1  1042 ? -7.400  -8.784   -7.909   1.00 105.51 ? 1042 LYS A CA  1 
ATOM   8245  C  C   . LYS A  1  1042 ? -6.128  -8.823   -8.763   1.00 116.03 ? 1042 LYS A C   1 
ATOM   8246  O  O   . LYS A  1  1042 ? -6.183  -9.172   -9.937   1.00 117.34 ? 1042 LYS A O   1 
ATOM   8247  C  CB  . LYS A  1  1042 ? -7.831  -7.331   -7.655   1.00 122.99 ? 1042 LYS A CB  1 
ATOM   8248  C  CG  . LYS A  1  1042 ? -9.209  -7.166   -7.010   1.00 155.14 ? 1042 LYS A CG  1 
ATOM   8249  C  CD  . LYS A  1  1042 ? -9.625  -5.692   -6.927   1.00 175.93 ? 1042 LYS A CD  1 
ATOM   8250  C  CE  . LYS A  1  1042 ? -11.144 -5.513   -6.822   1.00 147.77 ? 1042 LYS A CE  1 
ATOM   8251  N  NZ  . LYS A  1  1042 ? -11.708 -5.611   -5.445   1.00 98.60  ? 1042 LYS A NZ  1 
ATOM   8252  N  N   . VAL A  1  1043 ? -4.989  -8.479   -8.171   1.00 77.53  ? 1043 VAL A N   1 
ATOM   8253  C  CA  . VAL A  1  1043 ? -3.736  -8.425   -8.909   1.00 76.45  ? 1043 VAL A CA  1 
ATOM   8254  C  C   . VAL A  1  1043 ? -3.295  -9.810   -9.374   1.00 73.31  ? 1043 VAL A C   1 
ATOM   8255  O  O   . VAL A  1  1043 ? -2.978  -10.008  -10.553  1.00 73.24  ? 1043 VAL A O   1 
ATOM   8256  C  CB  . VAL A  1  1043 ? -2.642  -7.760   -8.071   1.00 76.32  ? 1043 VAL A CB  1 
ATOM   8257  C  CG1 . VAL A  1  1043 ? -2.157  -8.705   -6.977   1.00 78.13  ? 1043 VAL A CG1 1 
ATOM   8258  C  CG2 . VAL A  1  1043 ? -1.480  -7.285   -8.969   1.00 81.37  ? 1043 VAL A CG2 1 
ATOM   8259  N  N   . ALA A  1  1044 ? -3.273  -10.759  -8.447   1.00 121.29 ? 1044 ALA A N   1 
ATOM   8260  C  CA  . ALA A  1  1044 ? -2.896  -12.136  -8.742   1.00 90.53  ? 1044 ALA A CA  1 
ATOM   8261  C  C   . ALA A  1  1044 ? -3.785  -12.711  -9.820   1.00 112.32 ? 1044 ALA A C   1 
ATOM   8262  O  O   . ALA A  1  1044 ? -3.335  -13.018  -10.920  1.00 141.60 ? 1044 ALA A O   1 
ATOM   8263  C  CB  . ALA A  1  1044 ? -3.023  -12.966  -7.508   1.00 87.54  ? 1044 ALA A CB  1 
ATOM   8264  N  N   . PHE A  1  1045 ? -5.053  -12.875  -9.488   1.00 70.38  ? 1045 PHE A N   1 
ATOM   8265  C  CA  . PHE A  1  1045 ? -6.032  -13.303  -10.458  1.00 71.74  ? 1045 PHE A CA  1 
ATOM   8266  C  C   . PHE A  1  1045 ? -5.918  -12.572  -11.812  1.00 70.71  ? 1045 PHE A C   1 
ATOM   8267  O  O   . PHE A  1  1045 ? -5.872  -13.208  -12.858  1.00 70.37  ? 1045 PHE A O   1 
ATOM   8268  C  CB  . PHE A  1  1045 ? -7.397  -13.080  -9.875   1.00 72.89  ? 1045 PHE A CB  1 
ATOM   8269  C  CG  . PHE A  1  1045 ? -8.488  -13.730  -10.633  1.00 72.85  ? 1045 PHE A CG  1 
ATOM   8270  C  CD1 . PHE A  1  1045 ? -8.686  -15.078  -10.532  1.00 71.62  ? 1045 PHE A CD1 1 
ATOM   8271  C  CD2 . PHE A  1  1045 ? -9.328  -12.984  -11.426  1.00 72.97  ? 1045 PHE A CD2 1 
ATOM   8272  C  CE1 . PHE A  1  1045 ? -9.705  -15.681  -11.223  1.00 71.85  ? 1045 PHE A CE1 1 
ATOM   8273  C  CE2 . PHE A  1  1045 ? -10.363 -13.578  -12.123  1.00 73.75  ? 1045 PHE A CE2 1 
ATOM   8274  C  CZ  . PHE A  1  1045 ? -10.553 -14.931  -12.026  1.00 72.90  ? 1045 PHE A CZ  1 
ATOM   8275  N  N   . GLU A  1  1046 ? -5.868  -11.245  -11.799  1.00 96.59  ? 1046 GLU A N   1 
ATOM   8276  C  CA  . GLU A  1  1046 ? -5.753  -10.498  -13.052  1.00 126.96 ? 1046 GLU A CA  1 
ATOM   8277  C  C   . GLU A  1  1046 ? -4.513  -10.918  -13.835  1.00 85.65  ? 1046 GLU A C   1 
ATOM   8278  O  O   . GLU A  1  1046 ? -4.467  -10.783  -15.051  1.00 83.39  ? 1046 GLU A O   1 
ATOM   8279  C  CB  . GLU A  1  1046 ? -5.721  -8.983   -12.810  1.00 165.84 ? 1046 GLU A CB  1 
ATOM   8280  C  CG  . GLU A  1  1046 ? -7.044  -8.349   -12.371  1.00 160.27 ? 1046 GLU A CG  1 
ATOM   8281  C  CD  . GLU A  1  1046 ? -8.041  -8.158   -13.510  1.00 160.28 ? 1046 GLU A CD  1 
ATOM   8282  O  OE1 . GLU A  1  1046 ? -7.648  -8.261   -14.691  1.00 161.50 ? 1046 GLU A OE1 1 
ATOM   8283  O  OE2 . GLU A  1  1046 ? -9.225  -7.899   -13.210  1.00 139.13 ? 1046 GLU A OE2 1 
ATOM   8284  N  N   . TRP A  1  1047 ? -3.511  -11.419  -13.135  1.00 79.65  ? 1047 TRP A N   1 
ATOM   8285  C  CA  . TRP A  1  1047 ? -2.257  -11.797  -13.779  1.00 92.23  ? 1047 TRP A CA  1 
ATOM   8286  C  C   . TRP A  1  1047 ? -2.281  -13.250  -14.210  1.00 83.47  ? 1047 TRP A C   1 
ATOM   8287  O  O   . TRP A  1  1047 ? -1.670  -13.615  -15.212  1.00 70.84  ? 1047 TRP A O   1 
ATOM   8288  C  CB  . TRP A  1  1047 ? -1.092  -11.570  -12.819  1.00 87.35  ? 1047 TRP A CB  1 
ATOM   8289  C  CG  . TRP A  1  1047 ? 0.203   -12.042  -13.365  1.00 81.36  ? 1047 TRP A CG  1 
ATOM   8290  C  CD1 . TRP A  1  1047 ? 1.188   -11.277  -13.906  1.00 144.86 ? 1047 TRP A CD1 1 
ATOM   8291  C  CD2 . TRP A  1  1047 ? 0.661   -13.384  -13.428  1.00 69.94  ? 1047 TRP A CD2 1 
ATOM   8292  N  NE1 . TRP A  1  1047 ? 2.232   -12.065  -14.309  1.00 143.20 ? 1047 TRP A NE1 1 
ATOM   8293  C  CE2 . TRP A  1  1047 ? 1.933   -13.367  -14.025  1.00 86.65  ? 1047 TRP A CE2 1 
ATOM   8294  C  CE3 . TRP A  1  1047 ? 0.118   -14.600  -13.035  1.00 67.32  ? 1047 TRP A CE3 1 
ATOM   8295  C  CZ2 . TRP A  1  1047 ? 2.676   -14.521  -14.238  1.00 92.63  ? 1047 TRP A CZ2 1 
ATOM   8296  C  CZ3 . TRP A  1  1047 ? 0.847   -15.746  -13.246  1.00 74.36  ? 1047 TRP A CZ3 1 
ATOM   8297  C  CH2 . TRP A  1  1047 ? 2.116   -15.701  -13.850  1.00 130.17 ? 1047 TRP A CH2 1 
ATOM   8298  N  N   . ILE A  1  1048 ? -2.947  -14.074  -13.411  1.00 75.61  ? 1048 ILE A N   1 
ATOM   8299  C  CA  . ILE A  1  1048 ? -3.177  -15.470  -13.745  1.00 82.28  ? 1048 ILE A CA  1 
ATOM   8300  C  C   . ILE A  1  1048 ? -3.890  -15.530  -15.085  1.00 73.29  ? 1048 ILE A C   1 
ATOM   8301  O  O   . ILE A  1  1048 ? -3.330  -16.029  -16.054  1.00 102.85 ? 1048 ILE A O   1 
ATOM   8302  C  CB  . ILE A  1  1048 ? -4.038  -16.206  -12.679  1.00 70.54  ? 1048 ILE A CB  1 
ATOM   8303  C  CG1 . ILE A  1  1048 ? -3.319  -16.279  -11.324  1.00 78.24  ? 1048 ILE A CG1 1 
ATOM   8304  C  CG2 . ILE A  1  1048 ? -4.432  -17.591  -13.157  1.00 69.17  ? 1048 ILE A CG2 1 
ATOM   8305  C  CD1 . ILE A  1  1048 ? -4.021  -17.123  -10.266  1.00 75.27  ? 1048 ILE A CD1 1 
ATOM   8306  N  N   . MET A  1  1049 ? -5.111  -15.009  -15.140  1.00 69.29  ? 1049 MET A N   1 
ATOM   8307  C  CA  . MET A  1  1049 ? -5.894  -15.016  -16.372  1.00 71.31  ? 1049 MET A CA  1 
ATOM   8308  C  C   . MET A  1  1049 ? -5.099  -14.358  -17.504  1.00 79.33  ? 1049 MET A C   1 
ATOM   8309  O  O   . MET A  1  1049 ? -5.490  -14.388  -18.665  1.00 79.65  ? 1049 MET A O   1 
ATOM   8310  C  CB  . MET A  1  1049 ? -7.245  -14.316  -16.161  1.00 71.71  ? 1049 MET A CB  1 
ATOM   8311  C  CG  . MET A  1  1049 ? -8.017  -14.745  -14.898  1.00 89.24  ? 1049 MET A CG  1 
ATOM   8312  S  SD  . MET A  1  1049 ? -9.248  -16.030  -15.201  1.00 80.60  ? 1049 MET A SD  1 
ATOM   8313  C  CE  . MET A  1  1049 ? -9.718  -15.679  -16.891  1.00 72.12  ? 1049 MET A CE  1 
ATOM   8314  N  N   . GLY A  1  1050 ? -3.971  -13.770  -17.145  1.00 73.95  ? 1050 GLY A N   1 
ATOM   8315  C  CA  . GLY A  1  1050 ? -3.120  -13.134  -18.117  1.00 76.71  ? 1050 GLY A CA  1 
ATOM   8316  C  C   . GLY A  1  1050 ? -2.340  -14.196  -18.827  1.00 75.64  ? 1050 GLY A C   1 
ATOM   8317  O  O   . GLY A  1  1050 ? -2.520  -14.379  -20.031  1.00 75.71  ? 1050 GLY A O   1 
ATOM   8318  N  N   . GLU A  1  1051 ? -1.500  -14.906  -18.081  1.00 85.33  ? 1051 GLU A N   1 
ATOM   8319  C  CA  . GLU A  1  1051 ? -0.629  -15.914  -18.678  1.00 94.93  ? 1051 GLU A CA  1 
ATOM   8320  C  C   . GLU A  1  1051 ? -1.430  -16.963  -19.449  1.00 85.55  ? 1051 GLU A C   1 
ATOM   8321  O  O   . GLU A  1  1051 ? -1.051  -17.344  -20.556  1.00 74.55  ? 1051 GLU A O   1 
ATOM   8322  C  CB  . GLU A  1  1051 ? 0.256   -16.575  -17.620  1.00 95.53  ? 1051 GLU A CB  1 
ATOM   8323  C  CG  . GLU A  1  1051 ? 1.126   -15.588  -16.852  1.00 137.29 ? 1051 GLU A CG  1 
ATOM   8324  C  CD  . GLU A  1  1051 ? 2.157   -14.904  -17.722  1.00 156.78 ? 1051 GLU A CD  1 
ATOM   8325  O  OE1 . GLU A  1  1051 ? 2.870   -15.611  -18.465  1.00 131.57 ? 1051 GLU A OE1 1 
ATOM   8326  O  OE2 . GLU A  1  1051 ? 2.255   -13.660  -17.651  1.00 186.20 ? 1051 GLU A OE2 1 
ATOM   8327  N  N   . VAL A  1  1052 ? -2.540  -17.416  -18.872  1.00 68.42  ? 1052 VAL A N   1 
ATOM   8328  C  CA  . VAL A  1  1052 ? -3.384  -18.385  -19.548  1.00 68.88  ? 1052 VAL A CA  1 
ATOM   8329  C  C   . VAL A  1  1052 ? -3.676  -17.919  -20.969  1.00 69.61  ? 1052 VAL A C   1 
ATOM   8330  O  O   . VAL A  1  1052 ? -3.127  -18.481  -21.918  1.00 69.38  ? 1052 VAL A O   1 
ATOM   8331  C  CB  . VAL A  1  1052 ? -4.664  -18.614  -18.788  1.00 68.89  ? 1052 VAL A CB  1 
ATOM   8332  C  CG1 . VAL A  1  1052 ? -5.353  -19.845  -19.270  1.00 68.91  ? 1052 VAL A CG1 1 
ATOM   8333  C  CG2 . VAL A  1  1052 ? -4.341  -18.749  -17.332  1.00 68.41  ? 1052 VAL A CG2 1 
ATOM   8334  N  N   . GLU A  1  1053 ? -4.525  -16.899  -21.123  1.00 81.24  ? 1053 GLU A N   1 
ATOM   8335  C  CA  . GLU A  1  1053 ? -4.796  -16.301  -22.430  1.00 108.74 ? 1053 GLU A CA  1 
ATOM   8336  C  C   . GLU A  1  1053 ? -3.567  -16.380  -23.327  1.00 111.16 ? 1053 GLU A C   1 
ATOM   8337  O  O   . GLU A  1  1053 ? -3.621  -16.944  -24.414  1.00 112.62 ? 1053 GLU A O   1 
ATOM   8338  C  CB  . GLU A  1  1053 ? -5.253  -14.846  -22.264  1.00 112.37 ? 1053 GLU A CB  1 
ATOM   8339  C  CG  . GLU A  1  1053 ? -5.874  -14.213  -23.521  1.00 147.30 ? 1053 GLU A CG  1 
ATOM   8340  C  CD  . GLU A  1  1053 ? -4.911  -13.309  -24.305  1.00 178.26 ? 1053 GLU A CD  1 
ATOM   8341  O  OE1 . GLU A  1  1053 ? -3.904  -12.841  -23.723  1.00 190.58 ? 1053 GLU A OE1 1 
ATOM   8342  O  OE2 . GLU A  1  1053 ? -5.178  -13.054  -25.502  1.00 189.02 ? 1053 GLU A OE2 1 
ATOM   8343  N  N   . ALA A  1  1054 ? -2.451  -15.858  -22.835  1.00 68.88  ? 1054 ALA A N   1 
ATOM   8344  C  CA  . ALA A  1  1054 ? -1.232  -15.752  -23.615  1.00 68.27  ? 1054 ALA A CA  1 
ATOM   8345  C  C   . ALA A  1  1054 ? -0.589  -17.101  -23.952  1.00 67.68  ? 1054 ALA A C   1 
ATOM   8346  O  O   . ALA A  1  1054 ? -0.153  -17.335  -25.076  1.00 67.62  ? 1054 ALA A O   1 
ATOM   8347  C  CB  . ALA A  1  1054 ? -0.244  -14.851  -22.897  1.00 68.09  ? 1054 ALA A CB  1 
ATOM   8348  N  N   . ARG A  1  1055 ? -0.499  -17.980  -22.965  1.00 83.97  ? 1055 ARG A N   1 
ATOM   8349  C  CA  . ARG A  1  1055 ? 0.131   -19.267  -23.186  1.00 73.10  ? 1055 ARG A CA  1 
ATOM   8350  C  C   . ARG A  1  1055 ? -0.730  -20.102  -24.102  1.00 86.19  ? 1055 ARG A C   1 
ATOM   8351  O  O   . ARG A  1  1055 ? -0.235  -20.990  -24.788  1.00 100.11 ? 1055 ARG A O   1 
ATOM   8352  C  CB  . ARG A  1  1055 ? 0.345   -19.977  -21.861  1.00 77.48  ? 1055 ARG A CB  1 
ATOM   8353  C  CG  . ARG A  1  1055 ? 1.404   -19.311  -20.974  1.00 79.36  ? 1055 ARG A CG  1 
ATOM   8354  C  CD  . ARG A  1  1055 ? 2.816   -19.435  -21.565  1.00 95.89  ? 1055 ARG A CD  1 
ATOM   8355  N  NE  . ARG A  1  1055 ? 3.801   -18.656  -20.818  1.00 106.06 ? 1055 ARG A NE  1 
ATOM   8356  C  CZ  . ARG A  1  1055 ? 4.552   -19.129  -19.821  1.00 118.42 ? 1055 ARG A CZ  1 
ATOM   8357  N  NH1 . ARG A  1  1055 ? 4.440   -20.394  -19.443  1.00 104.96 ? 1055 ARG A NH1 1 
ATOM   8358  N  NH2 . ARG A  1  1055 ? 5.416   -18.341  -19.206  1.00 147.89 ? 1055 ARG A NH2 1 
ATOM   8359  N  N   . PHE A  1  1056 ? -2.022  -19.803  -24.125  1.00 75.00  ? 1056 PHE A N   1 
ATOM   8360  C  CA  . PHE A  1  1056 ? -2.938  -20.479  -25.020  1.00 74.90  ? 1056 PHE A CA  1 
ATOM   8361  C  C   . PHE A  1  1056 ? -2.664  -20.123  -26.470  1.00 76.10  ? 1056 PHE A C   1 
ATOM   8362  O  O   . PHE A  1  1056 ? -2.314  -20.994  -27.257  1.00 75.51  ? 1056 PHE A O   1 
ATOM   8363  C  CB  . PHE A  1  1056 ? -4.366  -20.135  -24.679  1.00 74.76  ? 1056 PHE A CB  1 
ATOM   8364  C  CG  . PHE A  1  1056 ? -5.375  -20.950  -25.431  1.00 75.38  ? 1056 PHE A CG  1 
ATOM   8365  C  CD1 . PHE A  1  1056 ? -6.006  -22.021  -24.827  1.00 74.53  ? 1056 PHE A CD1 1 
ATOM   8366  C  CD2 . PHE A  1  1056 ? -5.705  -20.643  -26.739  1.00 77.06  ? 1056 PHE A CD2 1 
ATOM   8367  C  CE1 . PHE A  1  1056 ? -6.958  -22.779  -25.518  1.00 76.75  ? 1056 PHE A CE1 1 
ATOM   8368  C  CE2 . PHE A  1  1056 ? -6.661  -21.389  -27.433  1.00 78.52  ? 1056 PHE A CE2 1 
ATOM   8369  C  CZ  . PHE A  1  1056 ? -7.288  -22.461  -26.821  1.00 77.58  ? 1056 PHE A CZ  1 
ATOM   8370  N  N   . GLN A  1  1057 ? -2.817  -18.853  -26.828  1.00 71.89  ? 1057 GLN A N   1 
ATOM   8371  C  CA  . GLN A  1  1057 ? -2.620  -18.443  -28.218  1.00 90.99  ? 1057 GLN A CA  1 
ATOM   8372  C  C   . GLN A  1  1057 ? -1.211  -18.750  -28.722  1.00 95.11  ? 1057 GLN A C   1 
ATOM   8373  O  O   . GLN A  1  1057 ? -0.979  -18.848  -29.936  1.00 123.35 ? 1057 GLN A O   1 
ATOM   8374  C  CB  . GLN A  1  1057 ? -2.930  -16.956  -28.408  1.00 94.92  ? 1057 GLN A CB  1 
ATOM   8375  C  CG  . GLN A  1  1057 ? -4.383  -16.559  -28.149  1.00 132.59 ? 1057 GLN A CG  1 
ATOM   8376  C  CD  . GLN A  1  1057 ? -5.314  -16.829  -29.328  1.00 167.66 ? 1057 GLN A CD  1 
ATOM   8377  O  OE1 . GLN A  1  1057 ? -4.875  -17.191  -30.423  1.00 176.26 ? 1057 GLN A OE1 1 
ATOM   8378  N  NE2 . GLN A  1  1057 ? -6.615  -16.643  -29.104  1.00 168.53 ? 1057 GLN A NE2 1 
ATOM   8379  N  N   . GLN A  1  1058 ? -0.277  -18.891  -27.784  1.00 69.20  ? 1058 GLN A N   1 
ATOM   8380  C  CA  . GLN A  1  1058 ? 1.098   -19.243  -28.113  1.00 125.68 ? 1058 GLN A CA  1 
ATOM   8381  C  C   . GLN A  1  1058 ? 1.186   -20.747  -28.364  1.00 94.73  ? 1058 GLN A C   1 
ATOM   8382  O  O   . GLN A  1  1058 ? 2.236   -21.256  -28.759  1.00 74.90  ? 1058 GLN A O   1 
ATOM   8383  C  CB  . GLN A  1  1058 ? 2.049   -18.834  -26.977  1.00 159.10 ? 1058 GLN A CB  1 
ATOM   8384  C  CG  . GLN A  1  1058 ? 2.350   -17.344  -26.903  1.00 173.31 ? 1058 GLN A CG  1 
ATOM   8385  C  CD  . GLN A  1  1058 ? 3.249   -16.999  -25.741  1.00 159.48 ? 1058 GLN A CD  1 
ATOM   8386  O  OE1 . GLN A  1  1058 ? 3.835   -17.886  -25.122  1.00 141.35 ? 1058 GLN A OE1 1 
ATOM   8387  N  NE2 . GLN A  1  1058 ? 3.361   -15.711  -25.436  1.00 160.46 ? 1058 GLN A NE2 1 
ATOM   8388  N  N   . ALA A  1  1059 ? 0.071   -21.444  -28.141  1.00 67.46  ? 1059 ALA A N   1 
ATOM   8389  C  CA  . ALA A  1  1059 ? -0.006  -22.897  -28.272  1.00 68.48  ? 1059 ALA A CA  1 
ATOM   8390  C  C   . ALA A  1  1059 ? -0.816  -23.306  -29.505  1.00 68.37  ? 1059 ALA A C   1 
ATOM   8391  O  O   . ALA A  1  1059 ? -0.878  -24.470  -29.847  1.00 68.52  ? 1059 ALA A O   1 
ATOM   8392  C  CB  . ALA A  1  1059 ? -0.598  -23.518  -27.006  1.00 68.34  ? 1059 ALA A CB  1 
ATOM   8393  N  N   . VAL A  1  1060 ? -1.436  -22.343  -30.179  1.00 85.52  ? 1060 VAL A N   1 
ATOM   8394  C  CA  . VAL A  1  1060 ? -2.191  -22.627  -31.398  1.00 114.47 ? 1060 VAL A CA  1 
ATOM   8395  C  C   . VAL A  1  1060 ? -1.235  -22.972  -32.512  1.00 112.50 ? 1060 VAL A C   1 
ATOM   8396  O  O   . VAL A  1  1060 ? -0.330  -22.191  -32.820  1.00 137.42 ? 1060 VAL A O   1 
ATOM   8397  C  CB  . VAL A  1  1060 ? -3.052  -21.432  -31.847  1.00 129.05 ? 1060 VAL A CB  1 
ATOM   8398  C  CG1 . VAL A  1  1060 ? -3.849  -21.794  -33.096  1.00 96.98  ? 1060 VAL A CG1 1 
ATOM   8399  C  CG2 . VAL A  1  1060 ? -3.986  -21.002  -30.720  1.00 130.25 ? 1060 VAL A CG2 1 
ATOM   8400  N  N   . VAL A  1  1061 ? -1.459  -24.126  -33.132  1.00 77.09  ? 1061 VAL A N   1 
ATOM   8401  C  CA  . VAL A  1  1061 ? -0.534  -24.646  -34.127  1.00 78.86  ? 1061 VAL A CA  1 
ATOM   8402  C  C   . VAL A  1  1061 ? -0.690  -23.959  -35.456  1.00 82.64  ? 1061 VAL A C   1 
ATOM   8403  O  O   . VAL A  1  1061 ? -1.817  -23.697  -35.858  1.00 75.26  ? 1061 VAL A O   1 
ATOM   8404  C  CB  . VAL A  1  1061 ? -0.849  -26.096  -34.416  1.00 85.59  ? 1061 VAL A CB  1 
ATOM   8405  C  CG1 . VAL A  1  1061 ? -2.300  -26.223  -34.792  1.00 81.94  ? 1061 VAL A CG1 1 
ATOM   8406  C  CG2 . VAL A  1  1061 ? 0.027   -26.627  -35.537  1.00 122.23 ? 1061 VAL A CG2 1 
ATOM   8407  N  N   . SER A  1  1062 ? 0.417   -23.686  -36.142  1.00 70.62  ? 1062 SER A N   1 
ATOM   8408  C  CA  . SER A  1  1062 ? 0.322   -23.388  -37.567  1.00 74.74  ? 1062 SER A CA  1 
ATOM   8409  C  C   . SER A  1  1062 ? -0.498  -22.106  -37.788  1.00 75.69  ? 1062 SER A C   1 
ATOM   8410  O  O   . SER A  1  1062 ? -0.582  -21.293  -36.865  1.00 111.26 ? 1062 SER A O   1 
ATOM   8411  C  CB  . SER A  1  1062 ? -0.328  -24.581  -38.287  1.00 150.84 ? 1062 SER A CB  1 
ATOM   8412  O  OG  . SER A  1  1062 ? -1.749  -24.557  -38.193  1.00 212.54 ? 1062 SER A OG  1 
ATOM   8413  N  N   . PRO A  1  1063 ? -1.078  -21.881  -39.003  1.00 76.86  ? 1063 PRO A N   1 
ATOM   8414  C  CA  . PRO A  1  1063 ? -1.023  -22.570  -40.307  1.00 83.14  ? 1063 PRO A CA  1 
ATOM   8415  C  C   . PRO A  1  1063 ? 0.382   -22.908  -40.626  1.00 74.83  ? 1063 PRO A C   1 
ATOM   8416  O  O   . PRO A  1  1063 ? 1.268   -22.580  -39.863  1.00 74.79  ? 1063 PRO A O   1 
ATOM   8417  C  CB  . PRO A  1  1063 ? -1.523  -21.518  -41.273  1.00 78.22  ? 1063 PRO A CB  1 
ATOM   8418  C  CG  . PRO A  1  1063 ? -2.549  -20.797  -40.484  1.00 74.00  ? 1063 PRO A CG  1 
ATOM   8419  C  CD  . PRO A  1  1063 ? -2.057  -20.780  -39.049  1.00 97.89  ? 1063 PRO A CD  1 
ATOM   8420  N  N   . GLY A  1  1064 ? 0.599   -23.567  -41.760  1.00 83.89  ? 1064 GLY A N   1 
ATOM   8421  C  CA  . GLY A  1  1064 ? 1.935   -23.952  -42.174  1.00 85.75  ? 1064 GLY A CA  1 
ATOM   8422  C  C   . GLY A  1  1064 ? 1.925   -24.901  -43.356  1.00 92.03  ? 1064 GLY A C   1 
ATOM   8423  O  O   . GLY A  1  1064 ? 1.574   -24.514  -44.471  1.00 128.63 ? 1064 GLY A O   1 
ATOM   8424  N  N   . GLU A  1  1065 ? 2.314   -26.148  -43.112  1.00 83.54  ? 1065 GLU A N   1 
ATOM   8425  C  CA  . GLU A  1  1065 ? 2.723   -26.575  -41.778  1.00 79.65  ? 1065 GLU A CA  1 
ATOM   8426  C  C   . GLU A  1  1065 ? 3.282   -27.993  -41.801  1.00 80.52  ? 1065 GLU A C   1 
ATOM   8427  O  O   . GLU A  1  1065 ? 4.420   -28.228  -41.396  1.00 92.71  ? 1065 GLU A O   1 
ATOM   8428  C  CB  . GLU A  1  1065 ? 1.547   -26.488  -40.803  1.00 77.37  ? 1065 GLU A CB  1 
ATOM   8429  C  CG  . GLU A  1  1065 ? 1.662   -27.422  -39.609  1.00 95.47  ? 1065 GLU A CG  1 
ATOM   8430  C  CD  . GLU A  1  1065 ? 2.532   -26.853  -38.506  1.00 129.09 ? 1065 GLU A CD  1 
ATOM   8431  O  OE1 . GLU A  1  1065 ? 2.601   -25.612  -38.381  1.00 194.79 ? 1065 GLU A OE1 1 
ATOM   8432  O  OE2 . GLU A  1  1065 ? 3.150   -27.646  -37.763  1.00 72.18  ? 1065 GLU A OE2 1 
ATOM   8433  N  N   . MET A  1  1066 ? 2.475   -28.934  -42.277  1.00 70.87  ? 1066 MET A N   1 
ATOM   8434  C  CA  . MET A  1  1066 ? 2.887   -30.331  -42.355  1.00 72.11  ? 1066 MET A CA  1 
ATOM   8435  C  C   . MET A  1  1066 ? 2.608   -31.062  -41.046  1.00 70.46  ? 1066 MET A C   1 
ATOM   8436  O  O   . MET A  1  1066 ? 3.524   -31.332  -40.269  1.00 76.26  ? 1066 MET A O   1 
ATOM   8437  C  CB  . MET A  1  1066 ? 4.373   -30.431  -42.708  1.00 70.71  ? 1066 MET A CB  1 
ATOM   8438  C  CG  . MET A  1  1066 ? 4.643   -30.920  -44.123  1.00 71.60  ? 1066 MET A CG  1 
ATOM   8439  S  SD  . MET A  1  1066 ? 4.462   -29.618  -45.355  1.00 73.58  ? 1066 MET A SD  1 
ATOM   8440  C  CE  . MET A  1  1066 ? 6.030   -28.769  -45.185  1.00 72.35  ? 1066 MET A CE  1 
ATOM   8441  N  N   . VAL A  1  1067 ? 1.341   -31.380  -40.811  1.00 115.16 ? 1067 VAL A N   1 
ATOM   8442  C  CA  . VAL A  1  1067 ? 0.940   -32.081  -39.597  1.00 112.80 ? 1067 VAL A CA  1 
ATOM   8443  C  C   . VAL A  1  1067 ? 0.982   -33.593  -39.794  1.00 116.62 ? 1067 VAL A C   1 
ATOM   8444  O  O   . VAL A  1  1067 ? 1.007   -34.355  -38.827  1.00 115.06 ? 1067 VAL A O   1 
ATOM   8445  C  CB  . VAL A  1  1067 ? -0.476  -31.672  -39.150  1.00 112.09 ? 1067 VAL A CB  1 
ATOM   8446  C  CG1 . VAL A  1  1067 ? -0.645  -31.896  -37.655  1.00 105.72 ? 1067 VAL A CG1 1 
ATOM   8447  C  CG2 . VAL A  1  1067 ? -0.748  -30.220  -39.513  1.00 112.01 ? 1067 VAL A CG2 1 
ATOM   8448  N  N   . GLY A  1  1068 ? 0.992   -34.020  -41.052  1.00 90.63  ? 1068 GLY A N   1 
ATOM   8449  C  CA  . GLY A  1  1068 ? 1.034   -35.433  -41.379  1.00 90.69  ? 1068 GLY A CA  1 
ATOM   8450  C  C   . GLY A  1  1068 ? 2.445   -35.986  -41.382  1.00 87.60  ? 1068 GLY A C   1 
ATOM   8451  O  O   . GLY A  1  1068 ? 2.714   -37.034  -40.794  1.00 87.75  ? 1068 GLY A O   1 
ATOM   8452  N  N   . THR A  1  1069 ? 3.352   -35.278  -42.049  1.00 96.29  ? 1069 THR A N   1 
ATOM   8453  C  CA  . THR A  1  1069 ? 4.745   -35.698  -42.128  1.00 96.03  ? 1069 THR A CA  1 
ATOM   8454  C  C   . THR A  1  1069 ? 5.333   -35.927  -40.738  1.00 95.08  ? 1069 THR A C   1 
ATOM   8455  O  O   . THR A  1  1069 ? 5.775   -37.029  -40.416  1.00 95.37  ? 1069 THR A O   1 
ATOM   8456  C  CB  . THR A  1  1069 ? 5.605   -34.663  -42.876  1.00 96.13  ? 1069 THR A CB  1 
ATOM   8457  O  OG1 . THR A  1  1069 ? 5.694   -33.463  -42.098  1.00 95.35  ? 1069 THR A OG1 1 
ATOM   8458  C  CG2 . THR A  1  1069 ? 4.995   -34.341  -44.230  1.00 97.20  ? 1069 THR A CG2 1 
ATOM   8459  N  N   . LEU A  1  1070 ? 5.332   -34.879  -39.923  1.00 126.72 ? 1070 LEU A N   1 
ATOM   8460  C  CA  . LEU A  1  1070 ? 5.864   -34.964  -38.568  1.00 125.60 ? 1070 LEU A CA  1 
ATOM   8461  C  C   . LEU A  1  1070 ? 5.142   -36.040  -37.759  1.00 125.60 ? 1070 LEU A C   1 
ATOM   8462  O  O   . LEU A  1  1070 ? 5.774   -36.859  -37.096  1.00 125.57 ? 1070 LEU A O   1 
ATOM   8463  C  CB  . LEU A  1  1070 ? 5.748   -33.612  -37.861  1.00 124.50 ? 1070 LEU A CB  1 
ATOM   8464  C  CG  . LEU A  1  1070 ? 4.330   -33.069  -37.666  1.00 124.40 ? 1070 LEU A CG  1 
ATOM   8465  C  CD1 . LEU A  1  1070 ? 3.660   -33.732  -36.472  1.00 123.43 ? 1070 LEU A CD1 1 
ATOM   8466  C  CD2 . LEU A  1  1070 ? 4.352   -31.557  -37.502  1.00 124.39 ? 1070 LEU A CD2 1 
ATOM   8467  N  N   . ALA A  1  1071 ? 3.814   -36.029  -37.824  1.00 89.04  ? 1071 ALA A N   1 
ATOM   8468  C  CA  . ALA A  1  1071 ? 3.005   -37.004  -37.102  1.00 89.30  ? 1071 ALA A CA  1 
ATOM   8469  C  C   . ALA A  1  1071 ? 3.312   -38.424  -37.566  1.00 90.72  ? 1071 ALA A C   1 
ATOM   8470  O  O   . ALA A  1  1071 ? 3.416   -39.343  -36.754  1.00 90.87  ? 1071 ALA A O   1 
ATOM   8471  C  CB  . ALA A  1  1071 ? 1.525   -36.695  -37.272  1.00 89.48  ? 1071 ALA A CB  1 
ATOM   8472  N  N   . ALA A  1  1072 ? 3.454   -38.596  -38.876  1.00 80.57  ? 1072 ALA A N   1 
ATOM   8473  C  CA  . ALA A  1  1072 ? 3.750   -39.902  -39.450  1.00 81.84  ? 1072 ALA A CA  1 
ATOM   8474  C  C   . ALA A  1  1072 ? 5.085   -40.437  -38.942  1.00 81.88  ? 1072 ALA A C   1 
ATOM   8475  O  O   . ALA A  1  1072 ? 5.204   -41.614  -38.600  1.00 82.91  ? 1072 ALA A O   1 
ATOM   8476  C  CB  . ALA A  1  1072 ? 3.751   -39.827  -40.969  1.00 82.83  ? 1072 ALA A CB  1 
ATOM   8477  N  N   . GLN A  1  1073 ? 6.086   -39.565  -38.892  1.00 74.81  ? 1073 GLN A N   1 
ATOM   8478  C  CA  . GLN A  1  1073 ? 7.413   -39.947  -38.423  1.00 74.78  ? 1073 GLN A CA  1 
ATOM   8479  C  C   . GLN A  1  1073 ? 7.367   -40.432  -36.978  1.00 74.46  ? 1073 GLN A C   1 
ATOM   8480  O  O   . GLN A  1  1073 ? 7.996   -41.430  -36.627  1.00 75.40  ? 1073 GLN A O   1 
ATOM   8481  C  CB  . GLN A  1  1073 ? 8.386   -38.772  -38.553  1.00 73.65  ? 1073 GLN A CB  1 
ATOM   8482  C  CG  . GLN A  1  1073 ? 8.547   -38.256  -39.972  1.00 74.04  ? 1073 GLN A CG  1 
ATOM   8483  C  CD  . GLN A  1  1073 ? 9.404   -37.007  -40.042  1.00 72.97  ? 1073 GLN A CD  1 
ATOM   8484  O  OE1 . GLN A  1  1073 ? 9.415   -36.194  -39.118  1.00 71.96  ? 1073 GLN A OE1 1 
ATOM   8485  N  NE2 . GLN A  1  1073 ? 10.129  -36.846  -41.144  1.00 73.39  ? 1073 GLN A NE2 1 
ATOM   8486  N  N   . SER A  1  1074 ? 6.617   -39.718  -36.144  1.00 69.62  ? 1074 SER A N   1 
ATOM   8487  C  CA  . SER A  1  1074 ? 6.488   -40.075  -34.736  1.00 68.95  ? 1074 SER A CA  1 
ATOM   8488  C  C   . SER A  1  1074 ? 5.787   -41.419  -34.568  1.00 69.75  ? 1074 SER A C   1 
ATOM   8489  O  O   . SER A  1  1074 ? 6.059   -42.160  -33.624  1.00 69.92  ? 1074 SER A O   1 
ATOM   8490  C  CB  . SER A  1  1074 ? 5.727   -38.987  -33.975  1.00 67.40  ? 1074 SER A CB  1 
ATOM   8491  O  OG  . SER A  1  1074 ? 4.386   -38.894  -34.424  1.00 67.72  ? 1074 SER A OG  1 
ATOM   8492  N  N   . ILE A  1  1075 ? 4.881   -41.727  -35.490  1.00 71.10  ? 1075 ILE A N   1 
ATOM   8493  C  CA  . ILE A  1  1075 ? 4.138   -42.981  -35.446  1.00 69.80  ? 1075 ILE A CA  1 
ATOM   8494  C  C   . ILE A  1  1075 ? 5.030   -44.163  -35.817  1.00 70.94  ? 1075 ILE A C   1 
ATOM   8495  O  O   . ILE A  1  1075 ? 4.781   -45.294  -35.402  1.00 70.06  ? 1075 ILE A O   1 
ATOM   8496  C  CB  . ILE A  1  1075 ? 2.923   -42.951  -36.392  1.00 70.26  ? 1075 ILE A CB  1 
ATOM   8497  C  CG1 . ILE A  1  1075 ? 1.895   -41.930  -35.906  1.00 68.90  ? 1075 ILE A CG1 1 
ATOM   8498  C  CG2 . ILE A  1  1075 ? 2.298   -44.334  -36.499  1.00 71.31  ? 1075 ILE A CG2 1 
ATOM   8499  C  CD1 . ILE A  1  1075 ? 0.842   -41.586  -36.937  1.00 71.90  ? 1075 ILE A CD1 1 
ATOM   8500  N  N   . GLY A  1  1076 ? 6.069   -43.890  -36.600  1.00 70.94  ? 1076 GLY A N   1 
ATOM   8501  C  CA  . GLY A  1  1076 ? 6.994   -44.925  -37.024  1.00 70.44  ? 1076 GLY A CA  1 
ATOM   8502  C  C   . GLY A  1  1076 ? 7.965   -45.320  -35.929  1.00 69.33  ? 1076 GLY A C   1 
ATOM   8503  O  O   . GLY A  1  1076 ? 8.271   -46.499  -35.754  1.00 69.82  ? 1076 GLY A O   1 
ATOM   8504  N  N   . GLU A  1  1077 ? 8.451   -44.328  -35.191  1.00 221.69 ? 1077 GLU A N   1 
ATOM   8505  C  CA  . GLU A  1  1077 ? 9.395   -44.572  -34.106  1.00 221.27 ? 1077 GLU A CA  1 
ATOM   8506  C  C   . GLU A  1  1077 ? 8.784   -45.469  -33.037  1.00 221.71 ? 1077 GLU A C   1 
ATOM   8507  O  O   . GLU A  1  1077 ? 9.434   -46.389  -32.540  1.00 222.83 ? 1077 GLU A O   1 
ATOM   8508  C  CB  . GLU A  1  1077 ? 9.851   -43.249  -33.486  1.00 218.91 ? 1077 GLU A CB  1 
ATOM   8509  C  CG  . GLU A  1  1077 ? 10.657  -42.368  -34.427  1.00 218.48 ? 1077 GLU A CG  1 
ATOM   8510  C  CD  . GLU A  1  1077 ? 10.893  -40.980  -33.864  1.00 216.27 ? 1077 GLU A CD  1 
ATOM   8511  O  OE1 . GLU A  1  1077 ? 10.275  -40.640  -32.833  1.00 215.13 ? 1077 GLU A OE1 1 
ATOM   8512  O  OE2 . GLU A  1  1077 ? 11.697  -40.227  -34.453  1.00 215.82 ? 1077 GLU A OE2 1 
ATOM   8513  N  N   . PRO A  1  1078 ? 7.532   -45.197  -32.686  1.00 207.55 ? 1078 PRO A N   1 
ATOM   8514  C  CA  . PRO A  1  1078 ? 6.827   -45.984  -31.669  1.00 207.85 ? 1078 PRO A CA  1 
ATOM   8515  C  C   . PRO A  1  1078 ? 6.794   -47.466  -32.025  1.00 210.43 ? 1078 PRO A C   1 
ATOM   8516  O  O   . PRO A  1  1078 ? 7.123   -48.308  -31.188  1.00 211.19 ? 1078 PRO A O   1 
ATOM   8517  C  CB  . PRO A  1  1078 ? 5.411   -45.403  -31.702  1.00 206.90 ? 1078 PRO A CB  1 
ATOM   8518  C  CG  . PRO A  1  1078 ? 5.253   -44.896  -33.093  1.00 207.22 ? 1078 PRO A CG  1 
ATOM   8519  C  CD  . PRO A  1  1078 ? 6.607   -44.391  -33.504  1.00 206.94 ? 1078 PRO A CD  1 
ATOM   8520  N  N   . ALA A  1  1079 ? 6.399   -47.776  -33.256  1.00 158.62 ? 1079 ALA A N   1 
ATOM   8521  C  CA  . ALA A  1  1079 ? 6.326   -49.160  -33.711  1.00 161.40 ? 1079 ALA A CA  1 
ATOM   8522  C  C   . ALA A  1  1079 ? 7.656   -49.878  -33.504  1.00 162.75 ? 1079 ALA A C   1 
ATOM   8523  O  O   . ALA A  1  1079 ? 7.692   -51.005  -33.007  1.00 164.37 ? 1079 ALA A O   1 
ATOM   8524  C  CB  . ALA A  1  1079 ? 5.914   -49.215  -35.174  1.00 162.81 ? 1079 ALA A CB  1 
ATOM   8525  N  N   . THR A  1  1080 ? 8.744   -49.221  -33.886  1.00 287.00 ? 1080 THR A N   1 
ATOM   8526  C  CA  . THR A  1  1080 ? 10.077  -49.796  -33.743  1.00 288.22 ? 1080 THR A CA  1 
ATOM   8527  C  C   . THR A  1  1080 ? 10.369  -50.152  -32.289  1.00 287.60 ? 1080 THR A C   1 
ATOM   8528  O  O   . THR A  1  1080 ? 11.058  -51.133  -32.008  1.00 289.35 ? 1080 THR A O   1 
ATOM   8529  C  CB  . THR A  1  1080 ? 11.165  -48.832  -34.253  1.00 287.14 ? 1080 THR A CB  1 
ATOM   8530  O  OG1 . THR A  1  1080 ? 11.208  -47.670  -33.415  1.00 284.31 ? 1080 THR A OG1 1 
ATOM   8531  C  CG2 . THR A  1  1080 ? 10.873  -48.409  -35.684  1.00 287.66 ? 1080 THR A CG2 1 
ATOM   8532  N  N   . GLN A  1  1081 ? 9.842   -49.352  -31.370  1.00 401.89 ? 1081 GLN A N   1 
ATOM   8533  C  CA  . GLN A  1  1081 ? 10.044  -49.583  -29.944  1.00 401.15 ? 1081 GLN A CA  1 
ATOM   8534  C  C   . GLN A  1  1081 ? 9.297   -50.826  -29.475  1.00 402.82 ? 1081 GLN A C   1 
ATOM   8535  O  O   . GLN A  1  1081 ? 9.714   -51.492  -28.528  1.00 403.32 ? 1081 GLN A O   1 
ATOM   8536  C  CB  . GLN A  1  1081 ? 9.595   -48.363  -29.135  1.00 398.36 ? 1081 GLN A CB  1 
ATOM   8537  C  CG  . GLN A  1  1081 ? 10.456  -47.129  -29.343  1.00 396.67 ? 1081 GLN A CG  1 
ATOM   8538  C  CD  . GLN A  1  1081 ? 9.895   -45.903  -28.649  1.00 394.23 ? 1081 GLN A CD  1 
ATOM   8539  O  OE1 . GLN A  1  1081 ? 8.701   -45.833  -28.359  1.00 393.78 ? 1081 GLN A OE1 1 
ATOM   8540  N  NE2 . GLN A  1  1081 ? 10.757  -44.930  -28.376  1.00 392.76 ? 1081 GLN A NE2 1 
ATOM   8541  N  N   . MET A  1  1082 ? 8.192   -51.135  -30.145  1.00 264.87 ? 1082 MET A N   1 
ATOM   8542  C  CA  . MET A  1  1082 ? 7.386   -52.299  -29.799  1.00 266.53 ? 1082 MET A CA  1 
ATOM   8543  C  C   . MET A  1  1082 ? 7.941   -53.567  -30.442  1.00 269.66 ? 1082 MET A C   1 
ATOM   8544  O  O   . MET A  1  1082 ? 8.316   -54.512  -29.748  1.00 270.96 ? 1082 MET A O   1 
ATOM   8545  C  CB  . MET A  1  1082 ? 5.930   -52.090  -30.223  1.00 266.21 ? 1082 MET A CB  1 
ATOM   8546  C  CG  . MET A  1  1082 ? 5.247   -50.919  -29.535  1.00 263.38 ? 1082 MET A CG  1 
ATOM   8547  S  SD  . MET A  1  1082 ? 4.967   -51.212  -27.778  1.00 262.41 ? 1082 MET A SD  1 
ATOM   8548  C  CE  . MET A  1  1082 ? 3.974   -52.701  -27.836  1.00 264.86 ? 1082 MET A CE  1 
ATOM   8549  N  N   . THR A  1  1083 ? 7.991   -53.577  -31.770  1.00 460.32 ? 1083 THR A N   1 
ATOM   8550  C  CA  . THR A  1  1083 ? 8.499   -54.727  -32.508  1.00 463.55 ? 1083 THR A CA  1 
ATOM   8551  C  C   . THR A  1  1083 ? 9.470   -55.543  -31.660  1.00 464.63 ? 1083 THR A C   1 
ATOM   8552  O  O   . THR A  1  1083 ? 9.209   -56.703  -31.343  1.00 466.64 ? 1083 THR A O   1 
ATOM   8553  C  CB  . THR A  1  1083 ? 9.206   -54.296  -33.807  1.00 464.22 ? 1083 THR A CB  1 
ATOM   8554  O  OG1 . THR A  1  1083 ? 9.530   -55.455  -34.586  1.00 467.66 ? 1083 THR A OG1 1 
ATOM   8555  C  CG2 . THR A  1  1083 ? 10.482  -53.530  -33.492  1.00 462.65 ? 1083 THR A CG2 1 
ATOM   8556  N  N   . LEU A  1  1084 ? 10.591  -54.929  -31.296  1.00 300.85 ? 1084 LEU A N   1 
ATOM   8557  C  CA  . LEU A  1  1084 ? 11.602  -55.596  -30.485  1.00 301.71 ? 1084 LEU A CA  1 
ATOM   8558  C  C   . LEU A  1  1084 ? 10.985  -56.232  -29.245  1.00 301.60 ? 1084 LEU A C   1 
ATOM   8559  O  O   . LEU A  1  1084 ? 11.067  -57.444  -29.051  1.00 303.96 ? 1084 LEU A O   1 
ATOM   8560  C  CB  . LEU A  1  1084 ? 12.700  -54.610  -30.080  1.00 299.61 ? 1084 LEU A CB  1 
ATOM   8561  C  CG  . LEU A  1  1084 ? 13.571  -54.062  -31.211  1.00 299.85 ? 1084 LEU A CG  1 
ATOM   8562  C  CD1 . LEU A  1  1084 ? 14.495  -52.968  -30.697  1.00 297.40 ? 1084 LEU A CD1 1 
ATOM   8563  C  CD2 . LEU A  1  1084 ? 14.370  -55.179  -31.864  1.00 303.12 ? 1084 LEU A CD2 1 
ATOM   8564  N  N   . ASN A  1  1085 ? 10.367  -55.404  -28.408  1.00 271.83 ? 1085 ASN A N   1 
ATOM   8565  C  CA  . ASN A  1  1085 ? 9.734   -55.885  -27.184  1.00 271.47 ? 1085 ASN A CA  1 
ATOM   8566  C  C   . ASN A  1  1085 ? 8.799   -57.061  -27.442  1.00 273.82 ? 1085 ASN A C   1 
ATOM   8567  O  O   . ASN A  1  1085 ? 8.988   -58.148  -26.893  1.00 275.54 ? 1085 ASN A O   1 
ATOM   8568  C  CB  . ASN A  1  1085 ? 8.975   -54.750  -26.493  1.00 268.45 ? 1085 ASN A CB  1 
ATOM   8569  C  CG  . ASN A  1  1085 ? 9.890   -53.824  -25.717  1.00 266.30 ? 1085 ASN A CG  1 
ATOM   8570  O  OD1 . ASN A  1  1085 ? 11.002  -54.201  -25.343  1.00 266.98 ? 1085 ASN A OD1 1 
ATOM   8571  N  ND2 . ASN A  1  1085 ? 9.428   -52.604  -25.470  1.00 263.78 ? 1085 ASN A ND2 1 
ATOM   8572  N  N   . THR A  1  1086 ? 7.790   -56.837  -28.278  1.00 337.65 ? 1086 THR A N   1 
ATOM   8573  C  CA  . THR A  1  1086 ? 6.825   -57.878  -28.609  1.00 339.86 ? 1086 THR A CA  1 
ATOM   8574  C  C   . THR A  1  1086 ? 7.520   -59.208  -28.883  1.00 343.13 ? 1086 THR A C   1 
ATOM   8575  O  O   . THR A  1  1086 ? 6.875   -60.254  -28.949  1.00 345.22 ? 1086 THR A O   1 
ATOM   8576  C  CB  . THR A  1  1086 ? 5.976   -57.491  -29.836  1.00 340.11 ? 1086 THR A CB  1 
ATOM   8577  O  OG1 . THR A  1  1086 ? 6.594   -57.996  -31.026  1.00 342.59 ? 1086 THR A OG1 1 
ATOM   8578  C  CG2 . THR A  1  1086 ? 5.846   -55.979  -29.938  1.00 337.06 ? 1086 THR A CG2 1 
ATOM   8579  N  N   . PHE A  1  1087 ? 8.839   -59.159  -29.040  1.00 240.17 ? 1087 PHE A N   1 
ATOM   8580  C  CA  . PHE A  1  1087 ? 9.624   -60.357  -29.304  1.00 243.31 ? 1087 PHE A CA  1 
ATOM   8581  C  C   . PHE A  1  1087 ? 10.698  -60.557  -28.240  1.00 242.93 ? 1087 PHE A C   1 
ATOM   8582  O  O   . PHE A  1  1087 ? 10.873  -61.658  -27.719  1.00 244.82 ? 1087 PHE A O   1 
ATOM   8583  C  CB  . PHE A  1  1087 ? 10.266  -60.284  -30.691  1.00 244.94 ? 1087 PHE A CB  1 
ATOM   8584  C  CG  . PHE A  1  1087 ? 9.612   -61.173  -31.710  1.00 248.03 ? 1087 PHE A CG  1 
ATOM   8585  C  CD1 . PHE A  1  1087 ? 8.234   -61.290  -31.763  1.00 248.57 ? 1087 PHE A CD1 1 
ATOM   8586  C  CD2 . PHE A  1  1087 ? 10.377  -61.890  -32.615  1.00 250.50 ? 1087 PHE A CD2 1 
ATOM   8587  C  CE1 . PHE A  1  1087 ? 7.629   -62.107  -32.700  1.00 251.52 ? 1087 PHE A CE1 1 
ATOM   8588  C  CE2 . PHE A  1  1087 ? 9.778   -62.710  -33.554  1.00 253.52 ? 1087 PHE A CE2 1 
ATOM   8589  C  CZ  . PHE A  1  1087 ? 8.403   -62.819  -33.596  1.00 254.03 ? 1087 PHE A CZ  1 
ATOM   8590  N  N   . HIS A  1  1088 ? 11.416  -59.484  -27.924  1.00 310.10 ? 1088 HIS A N   1 
ATOM   8591  C  CA  . HIS A  1  1088 ? 12.473  -59.538  -26.921  1.00 309.52 ? 1088 HIS A CA  1 
ATOM   8592  C  C   . HIS A  1  1088 ? 12.715  -60.968  -26.451  1.00 312.21 ? 1088 HIS A C   1 
ATOM   8593  O  O   . HIS A  1  1088 ? 13.246  -61.795  -27.193  1.00 314.98 ? 1088 HIS A O   1 
ATOM   8594  C  CB  . HIS A  1  1088 ? 12.128  -58.643  -25.730  1.00 306.36 ? 1088 HIS A CB  1 
ATOM   8595  C  CG  . HIS A  1  1088 ? 12.812  -57.310  -25.756  1.00 303.86 ? 1088 HIS A CG  1 
ATOM   8596  N  ND1 . HIS A  1  1088 ? 14.175  -57.177  -25.906  1.00 304.12 ? 1088 HIS A ND1 1 
ATOM   8597  C  CD2 . HIS A  1  1088 ? 12.319  -56.054  -25.650  1.00 301.13 ? 1088 HIS A CD2 1 
ATOM   8598  C  CE1 . HIS A  1  1088 ? 14.493  -55.895  -25.893  1.00 301.63 ? 1088 HIS A CE1 1 
ATOM   8599  N  NE2 . HIS A  1  1088 ? 13.384  -55.192  -25.739  1.00 299.81 ? 1088 HIS A NE2 1 
ATOM   8600  N  N   . TYR A  1  1089 ? 12.323  -61.252  -25.214  1.00 192.27 ? 1089 TYR A N   1 
ATOM   8601  C  CA  . TYR A  1  1089 ? 12.496  -62.582  -24.640  1.00 203.46 ? 1089 TYR A CA  1 
ATOM   8602  C  C   . TYR A  1  1089 ? 12.087  -62.608  -23.173  1.00 198.97 ? 1089 TYR A C   1 
ATOM   8603  O  O   . TYR A  1  1089 ? 12.906  -62.370  -22.285  1.00 191.34 ? 1089 TYR A O   1 
ATOM   8604  C  CB  . TYR A  1  1089 ? 13.948  -63.044  -24.789  1.00 204.07 ? 1089 TYR A CB  1 
ATOM   8605  C  CG  . TYR A  1  1089 ? 14.644  -63.311  -23.475  1.00 198.42 ? 1089 TYR A CG  1 
ATOM   8606  C  CD1 . TYR A  1  1089 ? 15.773  -62.591  -23.106  1.00 187.53 ? 1089 TYR A CD1 1 
ATOM   8607  C  CD2 . TYR A  1  1089 ? 14.172  -64.281  -22.601  1.00 204.53 ? 1089 TYR A CD2 1 
ATOM   8608  C  CE1 . TYR A  1  1089 ? 16.413  -62.830  -21.905  1.00 182.54 ? 1089 TYR A CE1 1 
ATOM   8609  C  CE2 . TYR A  1  1089 ? 14.805  -64.527  -21.397  1.00 199.36 ? 1089 TYR A CE2 1 
ATOM   8610  C  CZ  . TYR A  1  1089 ? 15.924  -63.799  -21.055  1.00 188.12 ? 1089 TYR A CZ  1 
ATOM   8611  O  OH  . TYR A  1  1089 ? 16.557  -64.041  -19.857  1.00 183.07 ? 1089 TYR A OH  1 
ATOM   8612  N  N   . ALA A  1  1090 ? 10.814  -62.898  -22.924  1.00 192.96 ? 1090 ALA A N   1 
ATOM   8613  C  CA  . ALA A  1  1090 ? 9.867   -63.176  -23.998  1.00 194.10 ? 1090 ALA A CA  1 
ATOM   8614  C  C   . ALA A  1  1090 ? 9.736   -64.675  -24.243  1.00 196.96 ? 1090 ALA A C   1 
ATOM   8615  O  O   . ALA A  1  1090 ? 10.728  -65.363  -24.484  1.00 198.76 ? 1090 ALA A O   1 
ATOM   8616  C  CB  . ALA A  1  1090 ? 10.287  -62.461  -25.273  1.00 194.05 ? 1090 ALA A CB  1 
ATOM   8617  N  N   . GLY A  1  1091 ? 8.505   -65.174  -24.183  1.00 225.95 ? 1091 GLY A N   1 
ATOM   8618  C  CA  . GLY A  1  1091 ? 8.243   -66.585  -24.399  1.00 228.67 ? 1091 GLY A CA  1 
ATOM   8619  C  C   . GLY A  1  1091 ? 7.735   -66.874  -25.797  1.00 230.45 ? 1091 GLY A C   1 
ATOM   8620  O  O   . GLY A  1  1091 ? 8.207   -66.290  -26.772  1.00 230.36 ? 1091 GLY A O   1 
ATOM   8621  N  N   . VAL A  1  1092 ? 6.768   -67.780  -25.893  1.00 234.53 ? 1092 VAL A N   1 
ATOM   8622  C  CA  . VAL A  1  1092 ? 6.229   -68.454  -24.717  1.00 201.51 ? 1092 VAL A CA  1 
ATOM   8623  C  C   . VAL A  1  1092 ? 4.992   -67.734  -24.189  1.00 203.42 ? 1092 VAL A C   1 
ATOM   8624  O  O   . VAL A  1  1092 ? 5.093   -66.657  -23.602  1.00 200.59 ? 1092 VAL A O   1 
ATOM   8625  C  CB  . VAL A  1  1092 ? 7.274   -68.549  -23.592  1.00 144.02 ? 1092 VAL A CB  1 
ATOM   8626  C  CG1 . VAL A  1  1092 ? 6.617   -68.993  -22.294  1.00 124.41 ? 1092 VAL A CG1 1 
ATOM   8627  C  CG2 . VAL A  1  1092 ? 8.390   -69.505  -23.986  1.00 162.50 ? 1092 VAL A CG2 1 
ATOM   8628  N  N   . SER A  1  1093 ? 3.827   -68.337  -24.401  1.00 210.81 ? 1093 SER A N   1 
ATOM   8629  C  CA  . SER A  1  1093 ? 2.570   -67.755  -23.947  1.00 212.44 ? 1093 SER A CA  1 
ATOM   8630  C  C   . SER A  1  1093 ? 1.375   -68.461  -24.580  1.00 218.98 ? 1093 SER A C   1 
ATOM   8631  O  O   . SER A  1  1093 ? 1.529   -69.476  -25.255  1.00 230.34 ? 1093 SER A O   1 
ATOM   8632  C  CB  . SER A  1  1093 ? 2.526   -66.259  -24.265  1.00 201.26 ? 1093 SER A CB  1 
ATOM   8633  O  OG  . SER A  1  1093 ? 3.416   -65.937  -25.319  1.00 197.47 ? 1093 SER A OG  1 
ATOM   8634  N  N   . SER A  1  1094 ? 0.185   -67.913  -24.356  1.00 329.38 ? 1094 SER A N   1 
ATOM   8635  C  CA  . SER A  1  1094 ? -1.038  -68.487  -24.905  1.00 337.19 ? 1094 SER A CA  1 
ATOM   8636  C  C   . SER A  1  1094 ? -2.227  -67.556  -24.698  1.00 321.13 ? 1094 SER A C   1 
ATOM   8637  O  O   . SER A  1  1094 ? -2.191  -66.667  -23.848  1.00 305.69 ? 1094 SER A O   1 
ATOM   8638  C  CB  . SER A  1  1094 ? -1.323  -69.850  -24.268  1.00 350.04 ? 1094 SER A CB  1 
ATOM   8639  O  OG  . SER A  1  1094 ? -0.135  -70.613  -24.143  1.00 360.62 ? 1094 SER A OG  1 
ATOM   8640  N  N   . LYS A  1  1095 ? -3.279  -67.763  -25.483  1.00 205.14 ? 1095 LYS A N   1 
ATOM   8641  C  CA  . LYS A  1  1095 ? -4.480  -66.941  -25.390  1.00 197.10 ? 1095 LYS A CA  1 
ATOM   8642  C  C   . LYS A  1  1095 ? -4.156  -65.466  -25.599  1.00 191.48 ? 1095 LYS A C   1 
ATOM   8643  O  O   . LYS A  1  1095 ? -3.068  -65.005  -25.256  1.00 194.52 ? 1095 LYS A O   1 
ATOM   8644  C  CB  . LYS A  1  1095 ? -5.161  -67.143  -24.035  1.00 187.72 ? 1095 LYS A CB  1 
ATOM   8645  C  CG  . LYS A  1  1095 ? -4.198  -67.232  -22.863  1.00 188.87 ? 1095 LYS A CG  1 
ATOM   8646  C  CD  . LYS A  1  1095 ? -3.910  -65.860  -22.278  1.00 177.24 ? 1095 LYS A CD  1 
ATOM   8647  C  CE  . LYS A  1  1095 ? -3.519  -65.954  -20.812  1.00 171.09 ? 1095 LYS A CE  1 
ATOM   8648  N  NZ  . LYS A  1  1095 ? -3.278  -64.613  -20.214  1.00 171.74 ? 1095 LYS A NZ  1 
ATOM   8649  N  N   . ASN A  1  1096 ? -5.108  -64.731  -26.164  1.00 367.15 ? 1096 ASN A N   1 
ATOM   8650  C  CA  . ASN A  1  1096 ? -4.927  -63.307  -26.420  1.00 377.70 ? 1096 ASN A CA  1 
ATOM   8651  C  C   . ASN A  1  1096 ? -3.811  -63.041  -27.425  1.00 366.60 ? 1096 ASN A C   1 
ATOM   8652  O  O   . ASN A  1  1096 ? -3.721  -61.952  -27.992  1.00 343.67 ? 1096 ASN A O   1 
ATOM   8653  C  CB  . ASN A  1  1096 ? -4.648  -62.559  -25.115  1.00 384.99 ? 1096 ASN A CB  1 
ATOM   8654  C  CG  . ASN A  1  1096 ? -5.689  -62.838  -24.049  1.00 390.44 ? 1096 ASN A CG  1 
ATOM   8655  O  OD1 . ASN A  1  1096 ? -6.852  -63.097  -24.355  1.00 380.39 ? 1096 ASN A OD1 1 
ATOM   8656  N  ND2 . ASN A  1  1096 ? -5.274  -62.787  -22.789  1.00 401.09 ? 1096 ASN A ND2 1 
ATOM   8657  N  N   . VAL A  1  1097 ? -2.964  -64.042  -27.640  1.00 199.49 ? 1097 VAL A N   1 
ATOM   8658  C  CA  . VAL A  1  1097 ? -1.853  -63.916  -28.575  1.00 199.77 ? 1097 VAL A CA  1 
ATOM   8659  C  C   . VAL A  1  1097 ? -2.226  -63.032  -29.761  1.00 200.13 ? 1097 VAL A C   1 
ATOM   8660  O  O   . VAL A  1  1097 ? -3.387  -62.979  -30.167  1.00 203.75 ? 1097 VAL A O   1 
ATOM   8661  C  CB  . VAL A  1  1097 ? -1.396  -65.291  -29.097  1.00 207.52 ? 1097 VAL A CB  1 
ATOM   8662  C  CG1 . VAL A  1  1097 ? -0.324  -65.874  -28.188  1.00 209.73 ? 1097 VAL A CG1 1 
ATOM   8663  C  CG2 . VAL A  1  1097 ? -2.582  -66.236  -29.207  1.00 212.48 ? 1097 VAL A CG2 1 
ATOM   8664  N  N   . THR A  1  1098 ? -1.234  -62.340  -30.311  1.00 219.81 ? 1098 THR A N   1 
ATOM   8665  C  CA  . THR A  1  1098 ? -1.457  -61.457  -31.450  1.00 217.00 ? 1098 THR A CA  1 
ATOM   8666  C  C   . THR A  1  1098 ? -0.138  -60.925  -32.003  1.00 215.17 ? 1098 THR A C   1 
ATOM   8667  O  O   . THR A  1  1098 ? 0.162   -61.090  -33.186  1.00 220.60 ? 1098 THR A O   1 
ATOM   8668  C  CB  . THR A  1  1098 ? -2.360  -60.268  -31.076  1.00 205.21 ? 1098 THR A CB  1 
ATOM   8669  O  OG1 . THR A  1  1098 ? -2.335  -60.073  -29.656  1.00 199.18 ? 1098 THR A OG1 1 
ATOM   8670  C  CG2 . THR A  1  1098 ? -3.791  -60.525  -31.521  1.00 207.32 ? 1098 THR A CG2 1 
ATOM   8671  N  N   . LEU A  1  1099 ? 0.646   -60.288  -31.139  1.00 191.30 ? 1099 LEU A N   1 
ATOM   8672  C  CA  . LEU A  1  1099 ? 1.934   -59.733  -31.538  1.00 189.12 ? 1099 LEU A CA  1 
ATOM   8673  C  C   . LEU A  1  1099 ? 1.802   -58.268  -31.939  1.00 179.41 ? 1099 LEU A C   1 
ATOM   8674  O  O   . LEU A  1  1099 ? 0.695   -57.761  -32.123  1.00 175.13 ? 1099 LEU A O   1 
ATOM   8675  C  CB  . LEU A  1  1099 ? 2.531   -60.542  -32.692  1.00 199.38 ? 1099 LEU A CB  1 
ATOM   8676  C  CG  . LEU A  1  1099 ? 3.427   -61.719  -32.303  1.00 206.71 ? 1099 LEU A CG  1 
ATOM   8677  C  CD1 . LEU A  1  1099 ? 2.633   -62.772  -31.545  1.00 211.37 ? 1099 LEU A CD1 1 
ATOM   8678  C  CD2 . LEU A  1  1099 ? 4.088   -62.322  -33.532  1.00 216.26 ? 1099 LEU A CD2 1 
ATOM   8679  N  N   . GLY A  1  1100 ? 2.939   -57.591  -32.071  1.00 117.99 ? 1100 GLY A N   1 
ATOM   8680  C  CA  . GLY A  1  1100 ? 2.953   -56.190  -32.445  1.00 106.83 ? 1100 GLY A CA  1 
ATOM   8681  C  C   . GLY A  1  1100 ? 3.482   -55.970  -33.848  1.00 108.08 ? 1100 GLY A C   1 
ATOM   8682  O  O   . GLY A  1  1100 ? 3.085   -56.660  -34.787  1.00 115.74 ? 1100 GLY A O   1 
ATOM   8683  N  N   . VAL A  1  1101 ? 4.382   -55.002  -33.992  1.00 117.99 ? 1101 VAL A N   1 
ATOM   8684  C  CA  . VAL A  1  1101 ? 4.971   -54.688  -35.289  1.00 114.71 ? 1101 VAL A CA  1 
ATOM   8685  C  C   . VAL A  1  1101 ? 4.531   -55.687  -36.353  1.00 123.40 ? 1101 VAL A C   1 
ATOM   8686  O  O   . VAL A  1  1101 ? 3.682   -55.381  -37.191  1.00 122.39 ? 1101 VAL A O   1 
ATOM   8687  C  CB  . VAL A  1  1101 ? 6.510   -54.669  -35.220  1.00 114.99 ? 1101 VAL A CB  1 
ATOM   8688  C  CG1 . VAL A  1  1101 ? 7.067   -56.071  -35.407  1.00 128.31 ? 1101 VAL A CG1 1 
ATOM   8689  C  CG2 . VAL A  1  1101 ? 7.075   -53.719  -36.267  1.00 109.66 ? 1101 VAL A CG2 1 
ATOM   8690  N  N   . PRO A  1  1102 ? 5.115   -56.880  -36.317  1.00 165.20 ? 1102 PRO A N   1 
ATOM   8691  C  CA  . PRO A  1  1102 ? 4.786   -57.930  -37.286  1.00 174.47 ? 1102 PRO A CA  1 
ATOM   8692  C  C   . PRO A  1  1102 ? 3.338   -57.833  -37.760  1.00 170.18 ? 1102 PRO A C   1 
ATOM   8693  O  O   . PRO A  1  1102 ? 3.030   -58.228  -38.884  1.00 175.54 ? 1102 PRO A O   1 
ATOM   8694  C  CB  . PRO A  1  1102 ? 4.991   -59.217  -36.484  1.00 186.49 ? 1102 PRO A CB  1 
ATOM   8695  C  CG  . PRO A  1  1102 ? 4.743   -58.818  -35.073  1.00 179.66 ? 1102 PRO A CG  1 
ATOM   8696  C  CD  . PRO A  1  1102 ? 5.253   -57.411  -34.950  1.00 166.77 ? 1102 PRO A CD  1 
ATOM   8697  N  N   . ARG A  1  1103 ? 2.465   -57.312  -36.903  1.00 166.53 ? 1103 ARG A N   1 
ATOM   8698  C  CA  . ARG A  1  1103 ? 1.054   -57.170  -37.242  1.00 160.89 ? 1103 ARG A CA  1 
ATOM   8699  C  C   . ARG A  1  1103 ? 0.796   -55.870  -37.999  1.00 148.20 ? 1103 ARG A C   1 
ATOM   8700  O  O   . ARG A  1  1103 ? 0.113   -55.863  -39.024  1.00 148.49 ? 1103 ARG A O   1 
ATOM   8701  C  CB  . ARG A  1  1103 ? 0.193   -57.222  -35.979  1.00 156.78 ? 1103 ARG A CB  1 
ATOM   8702  C  CG  . ARG A  1  1103 ? -0.167  -55.855  -35.416  1.00 143.41 ? 1103 ARG A CG  1 
ATOM   8703  C  CD  . ARG A  1  1103 ? -1.670  -55.633  -35.425  1.00 140.47 ? 1103 ARG A CD  1 
ATOM   8704  N  NE  . ARG A  1  1103 ? -2.411  -56.891  -35.389  1.00 145.96 ? 1103 ARG A NE  1 
ATOM   8705  C  CZ  . ARG A  1  1103 ? -3.686  -57.017  -35.740  1.00 146.77 ? 1103 ARG A CZ  1 
ATOM   8706  N  NH1 . ARG A  1  1103 ? -4.369  -55.960  -36.156  1.00 138.80 ? 1103 ARG A NH1 1 
ATOM   8707  N  NH2 . ARG A  1  1103 ? -4.279  -58.201  -35.673  1.00 153.85 ? 1103 ARG A NH2 1 
ATOM   8708  N  N   . LEU A  1  1104 ? 1.347   -54.774  -37.488  1.00 115.34 ? 1104 LEU A N   1 
ATOM   8709  C  CA  . LEU A  1  1104 ? 1.176   -53.468  -38.113  1.00 102.38 ? 1104 LEU A CA  1 
ATOM   8710  C  C   . LEU A  1  1104 ? 0.897   -53.604  -39.606  1.00 106.33 ? 1104 LEU A C   1 
ATOM   8711  O  O   . LEU A  1  1104 ? -0.184  -53.253  -40.081  1.00 101.32 ? 1104 LEU A O   1 
ATOM   8712  C  CB  . LEU A  1  1104 ? 2.415   -52.600  -37.887  1.00 97.62  ? 1104 LEU A CB  1 
ATOM   8713  C  CG  . LEU A  1  1104 ? 2.450   -51.263  -38.629  1.00 85.25  ? 1104 LEU A CG  1 
ATOM   8714  C  CD1 . LEU A  1  1104 ? 1.196   -51.081  -39.470  1.00 83.64  ? 1104 LEU A CD1 1 
ATOM   8715  C  CD2 . LEU A  1  1104 ? 2.617   -50.109  -37.651  1.00 76.96  ? 1104 LEU A CD2 1 
ATOM   8716  N  N   . LYS A  1  1105 ? 1.878   -54.116  -40.343  1.00 78.58  ? 1105 LYS A N   1 
ATOM   8717  C  CA  . LYS A  1  1105 ? 1.740   -54.298  -41.783  1.00 84.75  ? 1105 LYS A CA  1 
ATOM   8718  C  C   . LYS A  1  1105 ? 0.376   -54.882  -42.138  1.00 89.37  ? 1105 LYS A C   1 
ATOM   8719  O  O   . LYS A  1  1105 ? -0.233  -54.499  -43.135  1.00 85.77  ? 1105 LYS A O   1 
ATOM   8720  C  CB  . LYS A  1  1105 ? 2.854   -55.201  -42.318  1.00 98.26  ? 1105 LYS A CB  1 
ATOM   8721  C  CG  . LYS A  1  1105 ? 4.236   -54.570  -42.279  1.00 96.87  ? 1105 LYS A CG  1 
ATOM   8722  C  CD  . LYS A  1  1105 ? 5.322   -55.627  -42.163  1.00 110.31 ? 1105 LYS A CD  1 
ATOM   8723  C  CE  . LYS A  1  1105 ? 6.707   -55.002  -42.198  1.00 105.63 ? 1105 LYS A CE  1 
ATOM   8724  N  NZ  . LYS A  1  1105 ? 7.768   -56.016  -42.446  1.00 116.87 ? 1105 LYS A NZ  1 
ATOM   8725  N  N   . GLU A  1  1106 ? -0.095  -55.812  -41.314  1.00 110.02 ? 1106 GLU A N   1 
ATOM   8726  C  CA  . GLU A  1  1106 ? -1.387  -56.450  -41.539  1.00 115.95 ? 1106 GLU A CA  1 
ATOM   8727  C  C   . GLU A  1  1106 ? -2.516  -55.424  -41.544  1.00 102.25 ? 1106 GLU A C   1 
ATOM   8728  O  O   . GLU A  1  1106 ? -3.408  -55.475  -42.391  1.00 102.03 ? 1106 GLU A O   1 
ATOM   8729  C  CB  . GLU A  1  1106 ? -1.651  -57.515  -40.472  1.00 126.37 ? 1106 GLU A CB  1 
ATOM   8730  C  CG  . GLU A  1  1106 ? -1.620  -58.941  -40.998  1.00 145.72 ? 1106 GLU A CG  1 
ATOM   8731  C  CD  . GLU A  1  1106 ? -1.741  -59.973  -39.895  1.00 154.91 ? 1106 GLU A CD  1 
ATOM   8732  O  OE1 . GLU A  1  1106 ? -2.358  -59.662  -38.853  1.00 148.34 ? 1106 GLU A OE1 1 
ATOM   8733  O  OE2 . GLU A  1  1106 ? -1.219  -61.094  -40.065  1.00 168.22 ? 1106 GLU A OE2 1 
ATOM   8734  N  N   . ILE A  1  1107 ? -2.470  -54.496  -40.595  1.00 167.23 ? 1107 ILE A N   1 
ATOM   8735  C  CA  . ILE A  1  1107 ? -3.488  -53.458  -40.491  1.00 152.89 ? 1107 ILE A CA  1 
ATOM   8736  C  C   . ILE A  1  1107 ? -3.433  -52.508  -41.683  1.00 144.96 ? 1107 ILE A C   1 
ATOM   8737  O  O   . ILE A  1  1107 ? -4.453  -52.225  -42.311  1.00 141.63 ? 1107 ILE A O   1 
ATOM   8738  C  CB  . ILE A  1  1107 ? -3.333  -52.644  -39.193  1.00 143.30 ? 1107 ILE A CB  1 
ATOM   8739  C  CG1 . ILE A  1  1107 ? -3.378  -53.570  -37.975  1.00 149.59 ? 1107 ILE A CG1 1 
ATOM   8740  C  CG2 . ILE A  1  1107 ? -4.415  -51.579  -39.097  1.00 133.50 ? 1107 ILE A CG2 1 
ATOM   8741  C  CD1 . ILE A  1  1107 ? -2.984  -52.896  -36.680  1.00 141.82 ? 1107 ILE A CD1 1 
ATOM   8742  N  N   . LEU A  1  1108 ? -2.236  -52.019  -41.989  1.00 113.27 ? 1108 LEU A N   1 
ATOM   8743  C  CA  . LEU A  1  1108 ? -2.045  -51.102  -43.106  1.00 108.28 ? 1108 LEU A CA  1 
ATOM   8744  C  C   . LEU A  1  1108 ? -2.381  -51.772  -44.434  1.00 117.17 ? 1108 LEU A C   1 
ATOM   8745  O  O   . LEU A  1  1108 ? -2.870  -51.125  -45.360  1.00 114.18 ? 1108 LEU A O   1 
ATOM   8746  C  CB  . LEU A  1  1108 ? -0.607  -50.578  -43.130  1.00 102.41 ? 1108 LEU A CB  1 
ATOM   8747  C  CG  . LEU A  1  1108 ? -0.171  -49.739  -41.928  1.00 93.15  ? 1108 LEU A CG  1 
ATOM   8748  C  CD1 . LEU A  1  1108 ? 1.340   -49.568  -41.912  1.00 92.95  ? 1108 LEU A CD1 1 
ATOM   8749  C  CD2 . LEU A  1  1108 ? -0.867  -48.387  -41.935  1.00 83.16  ? 1108 LEU A CD2 1 
ATOM   8750  N  N   . ASN A  1  1109 ? -2.116  -53.071  -44.520  1.00 78.00  ? 1109 ASN A N   1 
ATOM   8751  C  CA  . ASN A  1  1109 ? -2.391  -53.831  -45.734  1.00 77.96  ? 1109 ASN A CA  1 
ATOM   8752  C  C   . ASN A  1  1109 ? -3.837  -54.306  -45.802  1.00 82.36  ? 1109 ASN A C   1 
ATOM   8753  O  O   . ASN A  1  1109 ? -4.259  -54.904  -46.791  1.00 89.13  ? 1109 ASN A O   1 
ATOM   8754  C  CB  . ASN A  1  1109 ? -1.439  -55.026  -45.843  1.00 92.14  ? 1109 ASN A CB  1 
ATOM   8755  C  CG  . ASN A  1  1109 ? 0.013   -54.606  -45.957  1.00 90.59  ? 1109 ASN A CG  1 
ATOM   8756  O  OD1 . ASN A  1  1109 ? 0.362   -53.753  -46.774  1.00 83.13  ? 1109 ASN A OD1 1 
ATOM   8757  N  ND2 . ASN A  1  1109 ? 0.868   -55.204  -45.137  1.00 97.54  ? 1109 ASN A ND2 1 
ATOM   8758  N  N   . VAL A  1  1110 ? -4.594  -54.035  -44.743  1.00 78.38  ? 1110 VAL A N   1 
ATOM   8759  C  CA  . VAL A  1  1110 ? -5.995  -54.433  -44.681  1.00 81.58  ? 1110 VAL A CA  1 
ATOM   8760  C  C   . VAL A  1  1110 ? -6.194  -55.841  -45.230  1.00 97.27  ? 1110 VAL A C   1 
ATOM   8761  O  O   . VAL A  1  1110 ? -7.297  -56.213  -45.631  1.00 100.01 ? 1110 VAL A O   1 
ATOM   8762  C  CB  . VAL A  1  1110 ? -6.895  -53.456  -45.460  1.00 77.38  ? 1110 VAL A CB  1 
ATOM   8763  C  CG1 . VAL A  1  1110 ? -8.336  -53.946  -45.458  1.00 78.83  ? 1110 VAL A CG1 1 
ATOM   8764  C  CG2 . VAL A  1  1110 ? -6.798  -52.059  -44.869  1.00 76.66  ? 1110 VAL A CG2 1 
ATOM   8765  N  N   . ALA A  1  1111 ? -5.119  -56.622  -45.246  1.00 78.53  ? 1111 ALA A N   1 
ATOM   8766  C  CA  . ALA A  1  1111 ? -5.173  -57.992  -45.748  1.00 117.11 ? 1111 ALA A CA  1 
ATOM   8767  C  C   . ALA A  1  1111 ? -6.200  -58.815  -44.978  1.00 107.51 ? 1111 ALA A C   1 
ATOM   8768  O  O   . ALA A  1  1111 ? -6.409  -58.609  -43.783  1.00 78.51  ? 1111 ALA A O   1 
ATOM   8769  C  CB  . ALA A  1  1111 ? -3.799  -58.641  -45.664  1.00 164.80 ? 1111 ALA A CB  1 
ATOM   8770  N  N   . LYS A  1  1112 ? -6.838  -59.754  -45.674  1.00 144.48 ? 1112 LYS A N   1 
ATOM   8771  C  CA  . LYS A  1  1112 ? -7.843  -60.614  -45.059  1.00 176.02 ? 1112 LYS A CA  1 
ATOM   8772  C  C   . LYS A  1  1112 ? -7.216  -61.555  -44.039  1.00 191.94 ? 1112 LYS A C   1 
ATOM   8773  O  O   . LYS A  1  1112 ? -7.680  -61.648  -42.902  1.00 168.42 ? 1112 LYS A O   1 
ATOM   8774  C  CB  . LYS A  1  1112 ? -8.586  -61.418  -46.128  1.00 208.66 ? 1112 LYS A CB  1 
ATOM   8775  C  CG  . LYS A  1  1112 ? -7.677  -62.182  -47.076  1.00 254.92 ? 1112 LYS A CG  1 
ATOM   8776  C  CD  . LYS A  1  1112 ? -6.830  -61.237  -47.914  1.00 227.30 ? 1112 LYS A CD  1 
ATOM   8777  C  CE  . LYS A  1  1112 ? -5.897  -62.002  -48.834  1.00 223.28 ? 1112 LYS A CE  1 
ATOM   8778  N  NZ  . LYS A  1  1112 ? -5.332  -61.136  -49.904  1.00 215.82 ? 1112 LYS A NZ  1 
ATOM   8779  N  N   . ASN A  1  1113 ? -6.161  -62.251  -44.451  1.00 126.03 ? 1113 ASN A N   1 
ATOM   8780  C  CA  . ASN A  1  1113 ? -5.472  -63.183  -43.573  1.00 142.32 ? 1113 ASN A CA  1 
ATOM   8781  C  C   . ASN A  1  1113 ? -4.559  -62.474  -42.577  1.00 118.96 ? 1113 ASN A C   1 
ATOM   8782  O  O   . ASN A  1  1113 ? -3.381  -62.242  -42.851  1.00 158.68 ? 1113 ASN A O   1 
ATOM   8783  C  CB  . ASN A  1  1113 ? -4.665  -64.195  -44.393  1.00 188.58 ? 1113 ASN A CB  1 
ATOM   8784  C  CG  . ASN A  1  1113 ? -3.585  -64.877  -43.578  1.00 213.13 ? 1113 ASN A CG  1 
ATOM   8785  O  OD1 . ASN A  1  1113 ? -3.701  -65.011  -42.360  1.00 185.25 ? 1113 ASN A OD1 1 
ATOM   8786  N  ND2 . ASN A  1  1113 ? -2.523  -65.312  -44.250  1.00 249.79 ? 1113 ASN A ND2 1 
ATOM   8787  N  N   . ILE A  1  1114 ? -5.113  -62.128  -41.419  1.00 131.04 ? 1114 ILE A N   1 
ATOM   8788  C  CA  . ILE A  1  1114 ? -4.352  -61.445  -40.379  1.00 145.52 ? 1114 ILE A CA  1 
ATOM   8789  C  C   . ILE A  1  1114 ? -4.056  -62.377  -39.210  1.00 146.29 ? 1114 ILE A C   1 
ATOM   8790  O  O   . ILE A  1  1114 ? -4.495  -62.137  -38.085  1.00 98.12  ? 1114 ILE A O   1 
ATOM   8791  C  CB  . ILE A  1  1114 ? -5.096  -60.201  -39.859  1.00 124.71 ? 1114 ILE A CB  1 
ATOM   8792  C  CG1 . ILE A  1  1114 ? -6.387  -60.614  -39.152  1.00 111.81 ? 1114 ILE A CG1 1 
ATOM   8793  C  CG2 . ILE A  1  1114 ? -5.392  -59.239  -41.000  1.00 88.06  ? 1114 ILE A CG2 1 
ATOM   8794  C  CD1 . ILE A  1  1114 ? -7.599  -60.645  -40.058  1.00 80.47  ? 1114 ILE A CD1 1 
ATOM   8795  N  N   . LYS A  1  1115 ? -3.311  -63.443  -39.484  1.00 106.30 ? 1115 LYS A N   1 
ATOM   8796  C  CA  . LYS A  1  1115 ? -2.956  -64.414  -38.454  1.00 120.95 ? 1115 LYS A CA  1 
ATOM   8797  C  C   . LYS A  1  1115 ? -3.997  -64.440  -37.337  1.00 96.27  ? 1115 LYS A C   1 
ATOM   8798  O  O   . LYS A  1  1115 ? -4.984  -65.170  -37.416  1.00 130.98 ? 1115 LYS A O   1 
ATOM   8799  C  CB  . LYS A  1  1115 ? -1.574  -64.105  -37.878  1.00 122.36 ? 1115 LYS A CB  1 
ATOM   8800  C  CG  . LYS A  1  1115 ? -1.023  -65.187  -36.965  1.00 175.43 ? 1115 LYS A CG  1 
ATOM   8801  C  CD  . LYS A  1  1115 ? 0.402   -64.880  -36.535  1.00 164.17 ? 1115 LYS A CD  1 
ATOM   8802  C  CE  . LYS A  1  1115 ? 0.901   -65.889  -35.519  1.00 161.80 ? 1115 LYS A CE  1 
ATOM   8803  N  NZ  . LYS A  1