data_3H13
# 
_entry.id   3H13 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H13         
RCSB  RCSB052558   
WWPDB D_1000052558 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3H11 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H13 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jeffrey, P.D.' 1 
'Yu, J.W.'      2 
'Shi, Y.'       3 
# 
_citation.id                        primary 
_citation.title                     'Mechanism of procaspase-8 activation by c-FLIPL.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                8169 
_citation.page_last                 8174 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19416807 
_citation.pdbx_database_id_DOI      10.1073/pnas.0812453106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, J.W.'      1 
primary 'Jeffrey, P.D.' 2 
primary 'Shi, Y.'       3 
# 
_cell.entry_id           3H13 
_cell.length_a           101.940 
_cell.length_b           101.940 
_cell.length_c           61.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H13 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CASP8 and FADD-like apoptosis regulator' 31450.217 1  ? ? ? ? 
2 water   nat water                                     18.015    76 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHG
ISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLE
NSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNG
YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHG
ISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLE
NSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNG
YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   GLN n 
1 4   ARG n 
1 5   LEU n 
1 6   LYS n 
1 7   GLU n 
1 8   GLN n 
1 9   LEU n 
1 10  GLY n 
1 11  ALA n 
1 12  GLN n 
1 13  GLN n 
1 14  GLU n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  LYS n 
1 19  SER n 
1 20  ILE n 
1 21  GLN n 
1 22  GLU n 
1 23  SER n 
1 24  GLU n 
1 25  ALA n 
1 26  PHE n 
1 27  LEU n 
1 28  PRO n 
1 29  GLN n 
1 30  SER n 
1 31  ILE n 
1 32  PRO n 
1 33  GLU n 
1 34  GLU n 
1 35  ARG n 
1 36  TYR n 
1 37  LYS n 
1 38  MET n 
1 39  LYS n 
1 40  SER n 
1 41  LYS n 
1 42  PRO n 
1 43  LEU n 
1 44  GLY n 
1 45  ILE n 
1 46  CYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ILE n 
1 50  ASP n 
1 51  CYS n 
1 52  ILE n 
1 53  GLY n 
1 54  ASN n 
1 55  GLU n 
1 56  THR n 
1 57  GLU n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  ASP n 
1 62  THR n 
1 63  PHE n 
1 64  THR n 
1 65  SER n 
1 66  LEU n 
1 67  GLY n 
1 68  TYR n 
1 69  GLU n 
1 70  VAL n 
1 71  GLN n 
1 72  LYS n 
1 73  PHE n 
1 74  LEU n 
1 75  HIS n 
1 76  LEU n 
1 77  SER n 
1 78  MET n 
1 79  HIS n 
1 80  GLY n 
1 81  ILE n 
1 82  SER n 
1 83  GLN n 
1 84  ILE n 
1 85  LEU n 
1 86  GLY n 
1 87  GLN n 
1 88  PHE n 
1 89  ALA n 
1 90  CYS n 
1 91  MET n 
1 92  PRO n 
1 93  GLU n 
1 94  HIS n 
1 95  ARG n 
1 96  ASP n 
1 97  TYR n 
1 98  ASP n 
1 99  SER n 
1 100 PHE n 
1 101 VAL n 
1 102 CYS n 
1 103 VAL n 
1 104 LEU n 
1 105 VAL n 
1 106 SER n 
1 107 ARG n 
1 108 GLY n 
1 109 GLY n 
1 110 SER n 
1 111 GLN n 
1 112 SER n 
1 113 VAL n 
1 114 TYR n 
1 115 GLY n 
1 116 VAL n 
1 117 ASP n 
1 118 GLN n 
1 119 THR n 
1 120 HIS n 
1 121 SER n 
1 122 GLY n 
1 123 LEU n 
1 124 PRO n 
1 125 LEU n 
1 126 HIS n 
1 127 HIS n 
1 128 ILE n 
1 129 ARG n 
1 130 ARG n 
1 131 MET n 
1 132 PHE n 
1 133 MET n 
1 134 GLY n 
1 135 ASP n 
1 136 SER n 
1 137 CYS n 
1 138 PRO n 
1 139 TYR n 
1 140 LEU n 
1 141 ALA n 
1 142 GLY n 
1 143 LYS n 
1 144 PRO n 
1 145 LYS n 
1 146 MET n 
1 147 PHE n 
1 148 PHE n 
1 149 ILE n 
1 150 GLN n 
1 151 ASN n 
1 152 TYR n 
1 153 VAL n 
1 154 VAL n 
1 155 SER n 
1 156 GLU n 
1 157 GLY n 
1 158 GLN n 
1 159 LEU n 
1 160 GLU n 
1 161 ASN n 
1 162 SER n 
1 163 SER n 
1 164 LEU n 
1 165 LEU n 
1 166 GLU n 
1 167 VAL n 
1 168 ASP n 
1 169 GLY n 
1 170 PRO n 
1 171 ALA n 
1 172 MET n 
1 173 LYS n 
1 174 ASN n 
1 175 VAL n 
1 176 GLU n 
1 177 PHE n 
1 178 LYS n 
1 179 ALA n 
1 180 GLN n 
1 181 LYS n 
1 182 ARG n 
1 183 GLY n 
1 184 LEU n 
1 185 CYS n 
1 186 THR n 
1 187 VAL n 
1 188 HIS n 
1 189 ARG n 
1 190 GLU n 
1 191 ALA n 
1 192 ASP n 
1 193 PHE n 
1 194 PHE n 
1 195 TRP n 
1 196 SER n 
1 197 LEU n 
1 198 CYS n 
1 199 THR n 
1 200 ALA n 
1 201 ASP n 
1 202 MET n 
1 203 SER n 
1 204 LEU n 
1 205 LEU n 
1 206 GLU n 
1 207 GLN n 
1 208 SER n 
1 209 HIS n 
1 210 SER n 
1 211 SER n 
1 212 PRO n 
1 213 SER n 
1 214 LEU n 
1 215 TYR n 
1 216 LEU n 
1 217 GLN n 
1 218 CYS n 
1 219 LEU n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 LEU n 
1 224 ARG n 
1 225 GLN n 
1 226 GLU n 
1 227 ARG n 
1 228 LYS n 
1 229 ARG n 
1 230 PRO n 
1 231 LEU n 
1 232 LEU n 
1 233 ASP n 
1 234 LEU n 
1 235 HIS n 
1 236 ILE n 
1 237 GLU n 
1 238 LEU n 
1 239 ASN n 
1 240 GLY n 
1 241 TYR n 
1 242 MET n 
1 243 TYR n 
1 244 ASP n 
1 245 TRP n 
1 246 ASN n 
1 247 SER n 
1 248 ARG n 
1 249 VAL n 
1 250 SER n 
1 251 ALA n 
1 252 LYS n 
1 253 GLU n 
1 254 LYS n 
1 255 TYR n 
1 256 TYR n 
1 257 VAL n 
1 258 TRP n 
1 259 LEU n 
1 260 GLN n 
1 261 HIS n 
1 262 THR n 
1 263 LEU n 
1 264 ARG n 
1 265 LYS n 
1 266 LYS n 
1 267 LEU n 
1 268 ILE n 
1 269 LEU n 
1 270 SER n 
1 271 TYR n 
1 272 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CFLAR, CASH, CASP8AP1, CLARP, MRIT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CFLAR_HUMAN 
_struct_ref.pdbx_db_accession          O15519 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHG
ISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLE
DSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNG
YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
;
_struct_ref.pdbx_align_begin           209 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3H13 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 272 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O15519 
_struct_ref_seq.db_align_beg                  209 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  480 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       209 
_struct_ref_seq.pdbx_auth_seq_align_end       480 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3H13 
_struct_ref_seq_dif.mon_id                       ASN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      161 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O15519 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          369 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            369 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H13 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   57.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;0.1 M Mes, 18% PEG, 5000 monomethyl ether, 0.1 M ammonium sulfate
, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-04-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     3H13 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   19006 
_reflns.number_all                   19006 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        19.4 
_reflns.B_iso_Wilson_estimate        23.7 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.395 
_reflns_shell.meanI_over_sigI_obs    6.8 
_reflns_shell.pdbx_redundancy        6.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1872 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3H13 
_refine.ls_number_reflns_obs                     18283 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1402184.49 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.43 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.220 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  956 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.8 
_refine.aniso_B[1][1]                            -1.64 
_refine.aniso_B[2][2]                            -1.64 
_refine.aniso_B[3][3]                            3.28 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 60.9337 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3H13 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.09 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1704 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               1780 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.43 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.87  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.54  2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.61  3.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.68  3.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            5.25  3.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             2717 
_refine_ls_shell.R_factor_R_work                  0.185 
_refine_ls_shell.percent_reflns_obs               92.0 
_refine_ls_shell.R_factor_R_free                  0.219 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             151 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H13 
_struct.title                     'c-FLIPL protease-like domain' 
_struct.pdbx_descriptor           'CASP8 and FADD-like apoptosis regulator' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H13 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            
'cFLIP-L, dimer, cell death, Alternative splicing, Apoptosis, Host-virus interaction, Polymorphism' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 57  ? GLY A 67  ? GLU A 265 GLY A 275 1 ? 11 
HELX_P HELX_P2 2 SER A 77  ? MET A 91  ? SER A 285 MET A 299 1 ? 15 
HELX_P HELX_P3 3 PRO A 92  ? TYR A 97  ? PRO A 300 TYR A 305 5 ? 6  
HELX_P HELX_P4 4 LEU A 125 ? PHE A 132 ? LEU A 333 PHE A 340 1 ? 8  
HELX_P HELX_P5 5 CYS A 137 ? ALA A 141 ? CYS A 345 ALA A 349 5 ? 5  
HELX_P HELX_P6 6 MET A 202 ? HIS A 209 ? MET A 410 HIS A 417 1 ? 8  
HELX_P HELX_P7 7 SER A 213 ? GLU A 226 ? SER A 421 GLU A 434 1 ? 14 
HELX_P HELX_P8 8 PRO A 230 ? VAL A 249 ? PRO A 438 VAL A 457 1 ? 20 
HELX_P HELX_P9 9 SER A 250 ? GLU A 253 ? SER A 458 GLU A 461 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           41 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            249 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    42 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     250 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 68  ? LEU A 74  ? TYR A 276 LEU A 282 
A 2 GLY A 44  ? ASP A 50  ? GLY A 252 ASP A 258 
A 3 SER A 99  ? GLY A 109 ? SER A 307 GLY A 317 
A 4 SER A 112 ? VAL A 113 ? SER A 320 VAL A 321 
A 5 LEU A 123 ? PRO A 124 ? LEU A 331 PRO A 332 
B 1 TYR A 68  ? LEU A 74  ? TYR A 276 LEU A 282 
B 2 GLY A 44  ? ASP A 50  ? GLY A 252 ASP A 258 
B 3 SER A 99  ? GLY A 109 ? SER A 307 GLY A 317 
B 4 LYS A 145 ? VAL A 153 ? LYS A 353 VAL A 361 
B 5 PHE A 193 ? ASP A 201 ? PHE A 401 ASP A 409 
B 6 TYR A 255 ? HIS A 261 ? TYR A 463 HIS A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 71  ? O GLN A 279 N ILE A 48  ? N ILE A 256 
A 2 3 N LEU A 47  ? N LEU A 255 O VAL A 103 ? O VAL A 311 
A 3 4 N GLY A 109 ? N GLY A 317 O SER A 112 ? O SER A 320 
A 4 5 N VAL A 113 ? N VAL A 321 O LEU A 123 ? O LEU A 331 
B 1 2 O GLN A 71  ? O GLN A 279 N ILE A 48  ? N ILE A 256 
B 2 3 N LEU A 47  ? N LEU A 255 O VAL A 103 ? O VAL A 311 
B 3 4 N PHE A 100 ? N PHE A 308 O MET A 146 ? O MET A 354 
B 4 5 N ILE A 149 ? N ILE A 357 O CYS A 198 ? O CYS A 406 
B 5 6 N LEU A 197 ? N LEU A 405 O TRP A 258 ? O TRP A 466 
# 
_database_PDB_matrix.entry_id          3H13 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H13 
_atom_sites.fract_transf_matrix[1][1]   0.009810 
_atom_sites.fract_transf_matrix[1][2]   0.005664 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011327 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016297 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 32  ? 6.787  -27.616 -9.930  1.00 75.35 ? 240  PRO A N   1 
ATOM   2    C CA  . PRO A 1 32  ? 6.869  -29.079 -10.136 1.00 74.16 ? 240  PRO A CA  1 
ATOM   3    C C   . PRO A 1 32  ? 8.264  -29.638 -10.436 1.00 71.96 ? 240  PRO A C   1 
ATOM   4    O O   . PRO A 1 32  ? 8.761  -30.467 -9.672  1.00 72.35 ? 240  PRO A O   1 
ATOM   5    C CB  . PRO A 1 32  ? 5.897  -29.418 -11.257 1.00 74.48 ? 240  PRO A CB  1 
ATOM   6    C CG  . PRO A 1 32  ? 4.831  -28.360 -11.031 1.00 76.95 ? 240  PRO A CG  1 
ATOM   7    C CD  . PRO A 1 32  ? 5.621  -27.078 -10.655 1.00 77.06 ? 240  PRO A CD  1 
ATOM   8    N N   . GLU A 1 33  ? 8.899  -29.189 -11.523 1.00 67.88 ? 241  GLU A N   1 
ATOM   9    C CA  . GLU A 1 33  ? 10.227 -29.702 -11.898 1.00 64.00 ? 241  GLU A CA  1 
ATOM   10   C C   . GLU A 1 33  ? 11.316 -29.599 -10.826 1.00 57.85 ? 241  GLU A C   1 
ATOM   11   O O   . GLU A 1 33  ? 11.756 -28.512 -10.471 1.00 55.82 ? 241  GLU A O   1 
ATOM   12   C CB  . GLU A 1 33  ? 10.736 -29.032 -13.177 1.00 66.19 ? 241  GLU A CB  1 
ATOM   13   C CG  . GLU A 1 33  ? 12.123 -29.517 -13.569 1.00 68.89 ? 241  GLU A CG  1 
ATOM   14   C CD  . GLU A 1 33  ? 12.568 -29.009 -14.923 1.00 72.70 ? 241  GLU A CD  1 
ATOM   15   O OE1 . GLU A 1 33  ? 12.574 -27.773 -15.117 1.00 74.33 ? 241  GLU A OE1 1 
ATOM   16   O OE2 . GLU A 1 33  ? 12.917 -29.845 -15.789 1.00 71.27 ? 241  GLU A OE2 1 
ATOM   17   N N   . GLU A 1 34  ? 11.754 -30.750 -10.334 1.00 53.27 ? 242  GLU A N   1 
ATOM   18   C CA  . GLU A 1 34  ? 12.787 -30.813 -9.311  1.00 52.59 ? 242  GLU A CA  1 
ATOM   19   C C   . GLU A 1 34  ? 14.165 -30.403 -9.826  1.00 48.68 ? 242  GLU A C   1 
ATOM   20   O O   . GLU A 1 34  ? 14.549 -30.704 -10.958 1.00 41.94 ? 242  GLU A O   1 
ATOM   21   C CB  . GLU A 1 34  ? 12.885 -32.225 -8.738  1.00 59.00 ? 242  GLU A CB  1 
ATOM   22   C CG  . GLU A 1 34  ? 11.600 -32.761 -8.154  1.00 66.69 ? 242  GLU A CG  1 
ATOM   23   C CD  . GLU A 1 34  ? 11.852 -33.968 -7.280  1.00 70.92 ? 242  GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 34  ? 12.517 -33.804 -6.234  1.00 73.28 ? 242  GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 34  ? 11.399 -35.076 -7.641  1.00 74.59 ? 242  GLU A OE2 1 
ATOM   26   N N   . ARG A 1 35  ? 14.915 -29.739 -8.961  1.00 44.42 ? 243  ARG A N   1 
ATOM   27   C CA  . ARG A 1 35  ? 16.243 -29.276 -9.301  1.00 41.58 ? 243  ARG A CA  1 
ATOM   28   C C   . ARG A 1 35  ? 17.138 -29.470 -8.087  1.00 40.21 ? 243  ARG A C   1 
ATOM   29   O O   . ARG A 1 35  ? 16.704 -29.238 -6.958  1.00 38.84 ? 243  ARG A O   1 
ATOM   30   C CB  . ARG A 1 35  ? 16.137 -27.810 -9.692  1.00 47.40 ? 243  ARG A CB  1 
ATOM   31   C CG  . ARG A 1 35  ? 17.417 -27.095 -9.972  1.00 53.58 ? 243  ARG A CG  1 
ATOM   32   C CD  . ARG A 1 35  ? 17.071 -25.804 -10.681 1.00 58.95 ? 243  ARG A CD  1 
ATOM   33   N NE  . ARG A 1 35  ? 18.062 -24.755 -10.467 1.00 63.43 ? 243  ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 35  ? 17.997 -23.559 -11.042 1.00 63.45 ? 243  ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 35  ? 16.990 -23.279 -11.862 1.00 66.62 ? 243  ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 35  ? 18.927 -22.646 -10.795 1.00 65.28 ? 243  ARG A NH2 1 
ATOM   37   N N   . TYR A 1 36  ? 18.373 -29.926 -8.308  1.00 35.70 ? 244  TYR A N   1 
ATOM   38   C CA  . TYR A 1 36  ? 19.307 -30.132 -7.209  1.00 31.99 ? 244  TYR A CA  1 
ATOM   39   C C   . TYR A 1 36  ? 19.574 -28.813 -6.515  1.00 32.41 ? 244  TYR A C   1 
ATOM   40   O O   . TYR A 1 36  ? 19.742 -27.779 -7.162  1.00 32.18 ? 244  TYR A O   1 
ATOM   41   C CB  . TYR A 1 36  ? 20.650 -30.702 -7.699  1.00 28.80 ? 244  TYR A CB  1 
ATOM   42   C CG  . TYR A 1 36  ? 20.621 -32.183 -8.012  1.00 22.27 ? 244  TYR A CG  1 
ATOM   43   C CD1 . TYR A 1 36  ? 20.622 -33.127 -7.000  1.00 22.00 ? 244  TYR A CD1 1 
ATOM   44   C CD2 . TYR A 1 36  ? 20.605 -32.630 -9.326  1.00 23.99 ? 244  TYR A CD2 1 
ATOM   45   C CE1 . TYR A 1 36  ? 20.619 -34.503 -7.281  1.00 23.07 ? 244  TYR A CE1 1 
ATOM   46   C CE2 . TYR A 1 36  ? 20.596 -33.997 -9.628  1.00 23.55 ? 244  TYR A CE2 1 
ATOM   47   C CZ  . TYR A 1 36  ? 20.605 -34.923 -8.611  1.00 23.98 ? 244  TYR A CZ  1 
ATOM   48   O OH  . TYR A 1 36  ? 20.598 -36.264 -8.920  1.00 23.48 ? 244  TYR A OH  1 
ATOM   49   N N   . LYS A 1 37  ? 19.604 -28.855 -5.191  1.00 34.02 ? 245  LYS A N   1 
ATOM   50   C CA  . LYS A 1 37  ? 19.894 -27.657 -4.419  1.00 36.55 ? 245  LYS A CA  1 
ATOM   51   C C   . LYS A 1 37  ? 21.332 -27.235 -4.713  1.00 36.09 ? 245  LYS A C   1 
ATOM   52   O O   . LYS A 1 37  ? 22.257 -28.039 -4.560  1.00 34.43 ? 245  LYS A O   1 
ATOM   53   C CB  . LYS A 1 37  ? 19.757 -27.947 -2.923  1.00 38.53 ? 245  LYS A CB  1 
ATOM   54   C CG  . LYS A 1 37  ? 19.967 -26.710 -2.056  1.00 42.89 ? 245  LYS A CG  1 
ATOM   55   C CD  . LYS A 1 37  ? 19.849 -27.038 -0.584  1.00 41.34 ? 245  LYS A CD  1 
ATOM   56   C CE  . LYS A 1 37  ? 19.949 -25.760 0.223   1.00 48.70 ? 245  LYS A CE  1 
ATOM   57   N NZ  . LYS A 1 37  ? 19.792 -26.032 1.676   1.00 54.46 ? 245  LYS A NZ  1 
ATOM   58   N N   . MET A 1 38  ? 21.510 -25.984 -5.123  1.00 35.71 ? 246  MET A N   1 
ATOM   59   C CA  . MET A 1 38  ? 22.829 -25.431 -5.440  1.00 38.58 ? 246  MET A CA  1 
ATOM   60   C C   . MET A 1 38  ? 22.941 -24.016 -4.874  1.00 40.36 ? 246  MET A C   1 
ATOM   61   O O   . MET A 1 38  ? 22.816 -23.038 -5.606  1.00 42.09 ? 246  MET A O   1 
ATOM   62   C CB  . MET A 1 38  ? 23.047 -25.390 -6.964  1.00 37.61 ? 246  MET A CB  1 
ATOM   63   C CG  . MET A 1 38  ? 23.103 -26.768 -7.640  1.00 39.20 ? 246  MET A CG  1 
ATOM   64   S SD  . MET A 1 38  ? 24.480 -27.832 -7.089  1.00 42.07 ? 246  MET A SD  1 
ATOM   65   C CE  . MET A 1 38  ? 25.815 -27.105 -7.986  1.00 39.14 ? 246  MET A CE  1 
ATOM   66   N N   . LYS A 1 39  ? 23.203 -23.901 -3.575  1.00 42.28 ? 247  LYS A N   1 
ATOM   67   C CA  . LYS A 1 39  ? 23.287 -22.579 -2.960  1.00 45.82 ? 247  LYS A CA  1 
ATOM   68   C C   . LYS A 1 39  ? 24.447 -22.348 -2.015  1.00 42.79 ? 247  LYS A C   1 
ATOM   69   O O   . LYS A 1 39  ? 24.781 -21.201 -1.728  1.00 42.49 ? 247  LYS A O   1 
ATOM   70   C CB  . LYS A 1 39  ? 21.990 -22.267 -2.201  1.00 49.33 ? 247  LYS A CB  1 
ATOM   71   C CG  . LYS A 1 39  ? 20.898 -21.695 -3.067  1.00 55.72 ? 247  LYS A CG  1 
ATOM   72   C CD  . LYS A 1 39  ? 19.735 -22.651 -3.224  1.00 62.56 ? 247  LYS A CD  1 
ATOM   73   C CE  . LYS A 1 39  ? 18.909 -22.763 -1.945  1.00 64.92 ? 247  LYS A CE  1 
ATOM   74   N NZ  . LYS A 1 39  ? 17.745 -23.690 -2.145  1.00 65.09 ? 247  LYS A NZ  1 
ATOM   75   N N   . SER A 1 40  ? 25.045 -23.424 -1.516  1.00 39.13 ? 248  SER A N   1 
ATOM   76   C CA  . SER A 1 40  ? 26.154 -23.291 -0.585  1.00 38.07 ? 248  SER A CA  1 
ATOM   77   C C   . SER A 1 40  ? 27.301 -22.454 -1.154  1.00 38.80 ? 248  SER A C   1 
ATOM   78   O O   . SER A 1 40  ? 27.448 -22.313 -2.368  1.00 38.35 ? 248  SER A O   1 
ATOM   79   C CB  . SER A 1 40  ? 26.679 -24.678 -0.181  1.00 37.25 ? 248  SER A CB  1 
ATOM   80   O OG  . SER A 1 40  ? 27.228 -25.370 -1.298  1.00 35.65 ? 248  SER A OG  1 
ATOM   81   N N   . LYS A 1 41  ? 28.092 -21.872 -0.261  1.00 38.39 ? 249  LYS A N   1 
ATOM   82   C CA  . LYS A 1 41  ? 29.256 -21.093 -0.660  1.00 41.03 ? 249  LYS A CA  1 
ATOM   83   C C   . LYS A 1 41  ? 30.402 -21.691 0.141   1.00 39.99 ? 249  LYS A C   1 
ATOM   84   O O   . LYS A 1 41  ? 30.472 -21.531 1.353   1.00 41.20 ? 249  LYS A O   1 
ATOM   85   C CB  . LYS A 1 41  ? 29.074 -19.613 -0.325  1.00 45.52 ? 249  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 41  ? 27.873 -19.012 -1.012  1.00 53.12 ? 249  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 41  ? 27.809 -17.498 -0.901  1.00 59.51 ? 249  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 41  ? 26.672 -16.970 -1.781  1.00 61.88 ? 249  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 41  ? 26.622 -15.487 -1.861  1.00 65.37 ? 249  LYS A NZ  1 
ATOM   90   N N   . PRO A 1 42  ? 31.314 -22.405 -0.533  1.00 41.05 ? 250  PRO A N   1 
ATOM   91   C CA  . PRO A 1 42  ? 31.293 -22.646 -1.985  1.00 38.00 ? 250  PRO A CA  1 
ATOM   92   C C   . PRO A 1 42  ? 30.266 -23.697 -2.379  1.00 35.72 ? 250  PRO A C   1 
ATOM   93   O O   . PRO A 1 42  ? 29.717 -24.395 -1.510  1.00 30.47 ? 250  PRO A O   1 
ATOM   94   C CB  . PRO A 1 42  ? 32.706 -23.134 -2.252  1.00 40.22 ? 250  PRO A CB  1 
ATOM   95   C CG  . PRO A 1 42  ? 32.915 -24.051 -1.038  1.00 39.94 ? 250  PRO A CG  1 
ATOM   96   C CD  . PRO A 1 42  ? 32.392 -23.183 0.113   1.00 38.26 ? 250  PRO A CD  1 
ATOM   97   N N   . LEU A 1 43  ? 30.020 -23.815 -3.689  1.00 31.81 ? 251  LEU A N   1 
ATOM   98   C CA  . LEU A 1 43  ? 29.091 -24.818 -4.209  1.00 29.52 ? 251  LEU A CA  1 
ATOM   99   C C   . LEU A 1 43  ? 29.619 -26.187 -3.809  1.00 27.33 ? 251  LEU A C   1 
ATOM   100  O O   . LEU A 1 43  ? 28.868 -27.152 -3.651  1.00 27.40 ? 251  LEU A O   1 
ATOM   101  C CB  . LEU A 1 43  ? 29.000 -24.745 -5.740  1.00 31.41 ? 251  LEU A CB  1 
ATOM   102  C CG  . LEU A 1 43  ? 28.070 -23.690 -6.303  1.00 33.67 ? 251  LEU A CG  1 
ATOM   103  C CD1 . LEU A 1 43  ? 27.955 -23.900 -7.814  1.00 33.50 ? 251  LEU A CD1 1 
ATOM   104  C CD2 . LEU A 1 43  ? 26.701 -23.800 -5.623  1.00 33.12 ? 251  LEU A CD2 1 
ATOM   105  N N   . GLY A 1 44  ? 30.936 -26.273 -3.671  1.00 28.43 ? 252  GLY A N   1 
ATOM   106  C CA  . GLY A 1 44  ? 31.535 -27.524 -3.262  1.00 25.95 ? 252  GLY A CA  1 
ATOM   107  C C   . GLY A 1 44  ? 33.019 -27.495 -3.520  1.00 25.77 ? 252  GLY A C   1 
ATOM   108  O O   . GLY A 1 44  ? 33.578 -26.469 -3.875  1.00 26.01 ? 252  GLY A O   1 
ATOM   109  N N   . ILE A 1 45  ? 33.665 -28.632 -3.314  1.00 28.93 ? 253  ILE A N   1 
ATOM   110  C CA  . ILE A 1 45  ? 35.080 -28.739 -3.585  1.00 29.17 ? 253  ILE A CA  1 
ATOM   111  C C   . ILE A 1 45  ? 35.225 -29.270 -5.021  1.00 30.97 ? 253  ILE A C   1 
ATOM   112  O O   . ILE A 1 45  ? 34.433 -30.108 -5.478  1.00 27.14 ? 253  ILE A O   1 
ATOM   113  C CB  . ILE A 1 45  ? 35.746 -29.734 -2.602  1.00 32.20 ? 253  ILE A CB  1 
ATOM   114  C CG1 . ILE A 1 45  ? 35.923 -29.060 -1.235  1.00 32.63 ? 253  ILE A CG1 1 
ATOM   115  C CG2 . ILE A 1 45  ? 37.101 -30.214 -3.152  1.00 28.55 ? 253  ILE A CG2 1 
ATOM   116  C CD1 . ILE A 1 45  ? 36.285 -30.041 -0.125  1.00 37.04 ? 253  ILE A CD1 1 
ATOM   117  N N   . CYS A 1 46  ? 36.203 -28.745 -5.741  1.00 28.19 ? 254  CYS A N   1 
ATOM   118  C CA  . CYS A 1 46  ? 36.492 -29.227 -7.080  1.00 29.13 ? 254  CYS A CA  1 
ATOM   119  C C   . CYS A 1 46  ? 37.919 -29.778 -6.998  1.00 30.04 ? 254  CYS A C   1 
ATOM   120  O O   . CYS A 1 46  ? 38.870 -29.016 -6.856  1.00 28.89 ? 254  CYS A O   1 
ATOM   121  C CB  . CYS A 1 46  ? 36.427 -28.103 -8.111  1.00 29.64 ? 254  CYS A CB  1 
ATOM   122  S SG  . CYS A 1 46  ? 37.098 -28.578 -9.755  1.00 27.57 ? 254  CYS A SG  1 
ATOM   123  N N   . LEU A 1 47  ? 38.044 -31.101 -7.038  1.00 24.89 ? 255  LEU A N   1 
ATOM   124  C CA  . LEU A 1 47  ? 39.332 -31.780 -6.988  1.00 23.32 ? 255  LEU A CA  1 
ATOM   125  C C   . LEU A 1 47  ? 39.860 -31.973 -8.411  1.00 24.45 ? 255  LEU A C   1 
ATOM   126  O O   . LEU A 1 47  ? 39.181 -32.561 -9.260  1.00 24.83 ? 255  LEU A O   1 
ATOM   127  C CB  . LEU A 1 47  ? 39.174 -33.147 -6.313  1.00 20.12 ? 255  LEU A CB  1 
ATOM   128  C CG  . LEU A 1 47  ? 40.350 -34.116 -6.419  1.00 25.54 ? 255  LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 47  ? 41.629 -33.448 -5.851  1.00 21.85 ? 255  LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 47  ? 40.011 -35.407 -5.664  1.00 21.70 ? 255  LEU A CD2 1 
ATOM   131  N N   . ILE A 1 48  ? 41.049 -31.446 -8.678  1.00 22.22 ? 256  ILE A N   1 
ATOM   132  C CA  . ILE A 1 48  ? 41.654 -31.579 -9.992  1.00 21.84 ? 256  ILE A CA  1 
ATOM   133  C C   . ILE A 1 48  ? 42.984 -32.316 -9.873  1.00 25.26 ? 256  ILE A C   1 
ATOM   134  O O   . ILE A 1 48  ? 43.892 -31.889 -9.136  1.00 23.47 ? 256  ILE A O   1 
ATOM   135  C CB  . ILE A 1 48  ? 41.911 -30.195 -10.669 1.00 24.46 ? 256  ILE A CB  1 
ATOM   136  C CG1 . ILE A 1 48  ? 40.596 -29.423 -10.831 1.00 22.43 ? 256  ILE A CG1 1 
ATOM   137  C CG2 . ILE A 1 48  ? 42.546 -30.386 -12.080 1.00 20.59 ? 256  ILE A CG2 1 
ATOM   138  C CD1 . ILE A 1 48  ? 40.786 -28.140 -11.641 1.00 23.94 ? 256  ILE A CD1 1 
ATOM   139  N N   . ILE A 1 49  ? 43.072 -33.439 -10.576 1.00 24.45 ? 257  ILE A N   1 
ATOM   140  C CA  . ILE A 1 49  ? 44.272 -34.247 -10.627 1.00 22.63 ? 257  ILE A CA  1 
ATOM   141  C C   . ILE A 1 49  ? 44.739 -34.253 -12.084 1.00 22.79 ? 257  ILE A C   1 
ATOM   142  O O   . ILE A 1 49  ? 44.102 -34.848 -12.935 1.00 24.43 ? 257  ILE A O   1 
ATOM   143  C CB  . ILE A 1 49  ? 44.001 -35.691 -10.149 1.00 22.26 ? 257  ILE A CB  1 
ATOM   144  C CG1 . ILE A 1 49  ? 43.674 -35.678 -8.650  1.00 24.86 ? 257  ILE A CG1 1 
ATOM   145  C CG2 . ILE A 1 49  ? 45.250 -36.567 -10.377 1.00 25.07 ? 257  ILE A CG2 1 
ATOM   146  C CD1 . ILE A 1 49  ? 43.201 -37.026 -8.088  1.00 21.03 ? 257  ILE A CD1 1 
ATOM   147  N N   . ASP A 1 50  ? 45.838 -33.554 -12.372 1.00 22.92 ? 258  ASP A N   1 
ATOM   148  C CA  . ASP A 1 50  ? 46.372 -33.489 -13.732 1.00 23.91 ? 258  ASP A CA  1 
ATOM   149  C C   . ASP A 1 50  ? 47.697 -34.205 -13.714 1.00 24.53 ? 258  ASP A C   1 
ATOM   150  O O   . ASP A 1 50  ? 48.681 -33.654 -13.245 1.00 25.74 ? 258  ASP A O   1 
ATOM   151  C CB  . ASP A 1 50  ? 46.566 -32.027 -14.178 1.00 21.80 ? 258  ASP A CB  1 
ATOM   152  C CG  . ASP A 1 50  ? 47.168 -31.899 -15.599 1.00 25.18 ? 258  ASP A CG  1 
ATOM   153  O OD1 . ASP A 1 50  ? 47.425 -32.932 -16.255 1.00 23.47 ? 258  ASP A OD1 1 
ATOM   154  O OD2 . ASP A 1 50  ? 47.385 -30.746 -16.066 1.00 25.64 ? 258  ASP A OD2 1 
ATOM   155  N N   . CYS A 1 51  ? 47.711 -35.441 -14.207 1.00 24.99 ? 259  CYS A N   1 
ATOM   156  C CA  . CYS A 1 51  ? 48.931 -36.229 -14.246 1.00 25.89 ? 259  CYS A CA  1 
ATOM   157  C C   . CYS A 1 51  ? 49.683 -36.050 -15.556 1.00 28.99 ? 259  CYS A C   1 
ATOM   158  O O   . CYS A 1 51  ? 50.713 -36.676 -15.776 1.00 32.56 ? 259  CYS A O   1 
ATOM   159  C CB  . CYS A 1 51  ? 48.613 -37.709 -14.007 1.00 22.56 ? 259  CYS A CB  1 
ATOM   160  S SG  . CYS A 1 51  ? 48.050 -38.009 -12.293 1.00 29.31 ? 259  CYS A SG  1 
ATOM   161  N N   . ILE A 1 52  ? 49.181 -35.192 -16.434 1.00 28.09 ? 260  ILE A N   1 
ATOM   162  C CA  . ILE A 1 52  ? 49.868 -34.968 -17.701 1.00 25.47 ? 260  ILE A CA  1 
ATOM   163  C C   . ILE A 1 52  ? 50.515 -33.596 -17.790 1.00 27.13 ? 260  ILE A C   1 
ATOM   164  O O   . ILE A 1 52  ? 51.629 -33.466 -18.301 1.00 28.10 ? 260  ILE A O   1 
ATOM   165  C CB  . ILE A 1 52  ? 48.911 -35.157 -18.893 1.00 28.45 ? 260  ILE A CB  1 
ATOM   166  C CG1 . ILE A 1 52  ? 48.642 -36.661 -19.080 1.00 27.44 ? 260  ILE A CG1 1 
ATOM   167  C CG2 . ILE A 1 52  ? 49.518 -34.538 -20.173 1.00 25.18 ? 260  ILE A CG2 1 
ATOM   168  C CD1 . ILE A 1 52  ? 47.309 -36.920 -19.632 1.00 29.17 ? 260  ILE A CD1 1 
ATOM   169  N N   . GLY A 1 53  ? 49.820 -32.571 -17.301 1.00 25.79 ? 261  GLY A N   1 
ATOM   170  C CA  . GLY A 1 53  ? 50.369 -31.229 -17.363 1.00 23.26 ? 261  GLY A CA  1 
ATOM   171  C C   . GLY A 1 53  ? 49.719 -30.370 -18.425 1.00 26.82 ? 261  GLY A C   1 
ATOM   172  O O   . GLY A 1 53  ? 50.256 -29.325 -18.761 1.00 30.93 ? 261  GLY A O   1 
ATOM   173  N N   . ASN A 1 54  ? 48.575 -30.774 -18.976 1.00 24.73 ? 262  ASN A N   1 
ATOM   174  C CA  . ASN A 1 54  ? 47.954 -29.921 -19.985 1.00 25.53 ? 262  ASN A CA  1 
ATOM   175  C C   . ASN A 1 54  ? 46.590 -29.354 -19.590 1.00 24.28 ? 262  ASN A C   1 
ATOM   176  O O   . ASN A 1 54  ? 45.898 -28.770 -20.431 1.00 26.48 ? 262  ASN A O   1 
ATOM   177  C CB  . ASN A 1 54  ? 47.844 -30.662 -21.343 1.00 25.21 ? 262  ASN A CB  1 
ATOM   178  C CG  . ASN A 1 54  ? 47.023 -31.945 -21.252 1.00 27.68 ? 262  ASN A CG  1 
ATOM   179  O OD1 . ASN A 1 54  ? 46.431 -32.243 -20.216 1.00 22.06 ? 262  ASN A OD1 1 
ATOM   180  N ND2 . ASN A 1 54  ? 46.987 -32.705 -22.339 1.00 27.80 ? 262  ASN A ND2 1 
ATOM   181  N N   . GLU A 1 55  ? 46.205 -29.498 -18.325 1.00 24.50 ? 263  GLU A N   1 
ATOM   182  C CA  . GLU A 1 55  ? 44.895 -28.992 -17.894 1.00 24.87 ? 263  GLU A CA  1 
ATOM   183  C C   . GLU A 1 55  ? 44.830 -27.477 -18.082 1.00 25.20 ? 263  GLU A C   1 
ATOM   184  O O   . GLU A 1 55  ? 43.746 -26.908 -18.175 1.00 26.49 ? 263  GLU A O   1 
ATOM   185  C CB  . GLU A 1 55  ? 44.588 -29.400 -16.451 1.00 21.84 ? 263  GLU A CB  1 
ATOM   186  C CG  . GLU A 1 55  ? 43.201 -28.953 -15.938 1.00 24.78 ? 263  GLU A CG  1 
ATOM   187  C CD  . GLU A 1 55  ? 43.220 -27.540 -15.337 1.00 27.41 ? 263  GLU A CD  1 
ATOM   188  O OE1 . GLU A 1 55  ? 44.308 -27.065 -14.938 1.00 25.07 ? 263  GLU A OE1 1 
ATOM   189  O OE2 . GLU A 1 55  ? 42.144 -26.910 -15.251 1.00 28.58 ? 263  GLU A OE2 1 
ATOM   190  N N   . THR A 1 56  ? 45.996 -26.829 -18.113 1.00 25.83 ? 264  THR A N   1 
ATOM   191  C CA  . THR A 1 56  ? 46.085 -25.397 -18.415 1.00 24.76 ? 264  THR A CA  1 
ATOM   192  C C   . THR A 1 56  ? 45.211 -24.414 -17.577 1.00 24.80 ? 264  THR A C   1 
ATOM   193  O O   . THR A 1 56  ? 44.899 -23.307 -18.033 1.00 23.86 ? 264  THR A O   1 
ATOM   194  C CB  . THR A 1 56  ? 45.774 -25.234 -19.951 1.00 26.47 ? 264  THR A CB  1 
ATOM   195  O OG1 . THR A 1 56  ? 46.546 -26.198 -20.675 1.00 23.55 ? 264  THR A OG1 1 
ATOM   196  C CG2 . THR A 1 56  ? 46.123 -23.819 -20.483 1.00 23.63 ? 264  THR A CG2 1 
ATOM   197  N N   . GLU A 1 57  ? 44.857 -24.800 -16.352 1.00 25.56 ? 265  GLU A N   1 
ATOM   198  C CA  . GLU A 1 57  ? 44.022 -23.967 -15.472 1.00 27.92 ? 265  GLU A CA  1 
ATOM   199  C C   . GLU A 1 57  ? 42.632 -23.732 -16.088 1.00 29.00 ? 265  GLU A C   1 
ATOM   200  O O   . GLU A 1 57  ? 41.842 -22.956 -15.557 1.00 27.97 ? 265  GLU A O   1 
ATOM   201  C CB  . GLU A 1 57  ? 44.679 -22.596 -15.204 1.00 28.68 ? 265  GLU A CB  1 
ATOM   202  C CG  . GLU A 1 57  ? 46.148 -22.647 -14.734 1.00 32.44 ? 265  GLU A CG  1 
ATOM   203  C CD  . GLU A 1 57  ? 46.386 -23.726 -13.680 1.00 36.50 ? 265  GLU A CD  1 
ATOM   204  O OE1 . GLU A 1 57  ? 45.518 -23.923 -12.812 1.00 38.46 ? 265  GLU A OE1 1 
ATOM   205  O OE2 . GLU A 1 57  ? 47.442 -24.391 -13.718 1.00 44.44 ? 265  GLU A OE2 1 
ATOM   206  N N   . LEU A 1 58  ? 42.329 -24.388 -17.206 1.00 26.30 ? 266  LEU A N   1 
ATOM   207  C CA  . LEU A 1 58  ? 41.022 -24.192 -17.832 1.00 26.41 ? 266  LEU A CA  1 
ATOM   208  C C   . LEU A 1 58  ? 39.863 -24.511 -16.890 1.00 25.18 ? 266  LEU A C   1 
ATOM   209  O O   . LEU A 1 58  ? 38.931 -23.716 -16.761 1.00 25.54 ? 266  LEU A O   1 
ATOM   210  C CB  . LEU A 1 58  ? 40.891 -25.042 -19.094 1.00 24.25 ? 266  LEU A CB  1 
ATOM   211  C CG  . LEU A 1 58  ? 41.662 -24.590 -20.333 1.00 26.14 ? 266  LEU A CG  1 
ATOM   212  C CD1 . LEU A 1 58  ? 41.936 -25.799 -21.239 1.00 25.03 ? 266  LEU A CD1 1 
ATOM   213  C CD2 . LEU A 1 58  ? 40.847 -23.524 -21.059 1.00 22.77 ? 266  LEU A CD2 1 
ATOM   214  N N   . LEU A 1 59  ? 39.911 -25.677 -16.246 1.00 24.70 ? 267  LEU A N   1 
ATOM   215  C CA  . LEU A 1 59  ? 38.847 -26.058 -15.338 1.00 24.56 ? 267  LEU A CA  1 
ATOM   216  C C   . LEU A 1 59  ? 39.074 -25.476 -13.939 1.00 27.91 ? 267  LEU A C   1 
ATOM   217  O O   . LEU A 1 59  ? 38.118 -25.294 -13.180 1.00 24.39 ? 267  LEU A O   1 
ATOM   218  C CB  . LEU A 1 59  ? 38.674 -27.587 -15.322 1.00 26.35 ? 267  LEU A CB  1 
ATOM   219  C CG  . LEU A 1 59  ? 38.175 -28.115 -16.701 1.00 32.29 ? 267  LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 59  ? 37.748 -29.558 -16.586 1.00 35.42 ? 267  LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 59  ? 36.984 -27.307 -17.191 1.00 28.25 ? 267  LEU A CD2 1 
ATOM   222  N N   . ARG A 1 60  ? 40.329 -25.185 -13.591 1.00 28.08 ? 268  ARG A N   1 
ATOM   223  C CA  . ARG A 1 60  ? 40.578 -24.550 -12.303 1.00 29.02 ? 268  ARG A CA  1 
ATOM   224  C C   . ARG A 1 60  ? 39.875 -23.189 -12.367 1.00 27.88 ? 268  ARG A C   1 
ATOM   225  O O   . ARG A 1 60  ? 39.137 -22.833 -11.465 1.00 26.09 ? 268  ARG A O   1 
ATOM   226  C CB  . ARG A 1 60  ? 42.067 -24.330 -12.054 1.00 29.69 ? 268  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 60  ? 42.360 -23.480 -10.803 1.00 37.24 ? 268  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 60  ? 43.868 -23.202 -10.649 1.00 46.10 ? 268  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 60  ? 44.365 -23.683 -9.361  1.00 53.80 ? 268  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 60  ? 45.580 -24.187 -9.151  1.00 55.35 ? 268  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 60  ? 46.459 -24.286 -10.149 1.00 53.22 ? 268  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 60  ? 45.909 -24.618 -7.936  1.00 53.77 ? 268  ARG A NH2 1 
ATOM   233  N N   . ASP A 1 61  ? 40.100 -22.442 -13.445 1.00 24.99 ? 269  ASP A N   1 
ATOM   234  C CA  . ASP A 1 61  ? 39.469 -21.138 -13.600 1.00 27.61 ? 269  ASP A CA  1 
ATOM   235  C C   . ASP A 1 61  ? 37.957 -21.243 -13.757 1.00 31.08 ? 269  ASP A C   1 
ATOM   236  O O   . ASP A 1 61  ? 37.209 -20.455 -13.177 1.00 29.40 ? 269  ASP A O   1 
ATOM   237  C CB  . ASP A 1 61  ? 40.031 -20.406 -14.811 1.00 27.26 ? 269  ASP A CB  1 
ATOM   238  C CG  . ASP A 1 61  ? 41.493 -20.062 -14.648 1.00 26.03 ? 269  ASP A CG  1 
ATOM   239  O OD1 . ASP A 1 61  ? 42.006 -20.160 -13.522 1.00 28.65 ? 269  ASP A OD1 1 
ATOM   240  O OD2 . ASP A 1 61  ? 42.132 -19.691 -15.642 1.00 32.54 ? 269  ASP A OD2 1 
ATOM   241  N N   . THR A 1 62  ? 37.499 -22.222 -14.537 1.00 28.89 ? 270  THR A N   1 
ATOM   242  C CA  . THR A 1 62  ? 36.066 -22.370 -14.747 1.00 26.52 ? 270  THR A CA  1 
ATOM   243  C C   . THR A 1 62  ? 35.317 -22.671 -13.467 1.00 25.47 ? 270  THR A C   1 
ATOM   244  O O   . THR A 1 62  ? 34.355 -21.988 -13.125 1.00 28.89 ? 270  THR A O   1 
ATOM   245  C CB  . THR A 1 62  ? 35.748 -23.476 -15.763 1.00 24.29 ? 270  THR A CB  1 
ATOM   246  O OG1 . THR A 1 62  ? 36.113 -23.024 -17.065 1.00 29.55 ? 270  THR A OG1 1 
ATOM   247  C CG2 . THR A 1 62  ? 34.259 -23.824 -15.737 1.00 22.91 ? 270  THR A CG2 1 
ATOM   248  N N   . PHE A 1 63  ? 35.750 -23.692 -12.754 1.00 23.29 ? 271  PHE A N   1 
ATOM   249  C CA  . PHE A 1 63  ? 35.060 -24.031 -11.529 1.00 28.12 ? 271  PHE A CA  1 
ATOM   250  C C   . PHE A 1 63  ? 35.272 -22.991 -10.431 1.00 29.74 ? 271  PHE A C   1 
ATOM   251  O O   . PHE A 1 63  ? 34.392 -22.807 -9.602  1.00 29.16 ? 271  PHE A O   1 
ATOM   252  C CB  . PHE A 1 63  ? 35.439 -25.447 -11.082 1.00 25.72 ? 271  PHE A CB  1 
ATOM   253  C CG  . PHE A 1 63  ? 34.817 -26.524 -11.954 1.00 24.88 ? 271  PHE A CG  1 
ATOM   254  C CD1 . PHE A 1 63  ? 33.433 -26.710 -11.968 1.00 25.55 ? 271  PHE A CD1 1 
ATOM   255  C CD2 . PHE A 1 63  ? 35.606 -27.293 -12.820 1.00 22.38 ? 271  PHE A CD2 1 
ATOM   256  C CE1 . PHE A 1 63  ? 32.827 -27.651 -12.842 1.00 22.25 ? 271  PHE A CE1 1 
ATOM   257  C CE2 . PHE A 1 63  ? 35.018 -28.235 -13.695 1.00 21.46 ? 271  PHE A CE2 1 
ATOM   258  C CZ  . PHE A 1 63  ? 33.629 -28.410 -13.706 1.00 22.83 ? 271  PHE A CZ  1 
ATOM   259  N N   . THR A 1 64  ? 36.415 -22.306 -10.420 1.00 26.43 ? 272  THR A N   1 
ATOM   260  C CA  . THR A 1 64  ? 36.597 -21.274 -9.405  1.00 27.46 ? 272  THR A CA  1 
ATOM   261  C C   . THR A 1 64  ? 35.530 -20.213 -9.695  1.00 28.08 ? 272  THR A C   1 
ATOM   262  O O   . THR A 1 64  ? 34.848 -19.744 -8.788  1.00 25.39 ? 272  THR A O   1 
ATOM   263  C CB  . THR A 1 64  ? 37.992 -20.614 -9.473  1.00 26.69 ? 272  THR A CB  1 
ATOM   264  O OG1 . THR A 1 64  ? 38.987 -21.566 -9.055  1.00 22.74 ? 272  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 64  ? 38.046 -19.374 -8.539  1.00 30.09 ? 272  THR A CG2 1 
ATOM   266  N N   . SER A 1 65  ? 35.364 -19.871 -10.970 1.00 27.18 ? 273  SER A N   1 
ATOM   267  C CA  . SER A 1 65  ? 34.368 -18.880 -11.363 1.00 28.80 ? 273  SER A CA  1 
ATOM   268  C C   . SER A 1 65  ? 32.926 -19.295 -11.066 1.00 32.42 ? 273  SER A C   1 
ATOM   269  O O   . SER A 1 65  ? 32.067 -18.424 -10.856 1.00 33.63 ? 273  SER A O   1 
ATOM   270  C CB  . SER A 1 65  ? 34.479 -18.571 -12.847 1.00 28.92 ? 273  SER A CB  1 
ATOM   271  O OG  . SER A 1 65  ? 33.411 -17.734 -13.250 1.00 34.07 ? 273  SER A OG  1 
ATOM   272  N N   . LEU A 1 66  ? 32.644 -20.602 -11.061 1.00 27.43 ? 274  LEU A N   1 
ATOM   273  C CA  . LEU A 1 66  ? 31.288 -21.066 -10.770 1.00 28.63 ? 274  LEU A CA  1 
ATOM   274  C C   . LEU A 1 66  ? 31.011 -21.074 -9.266  1.00 30.51 ? 274  LEU A C   1 
ATOM   275  O O   . LEU A 1 66  ? 29.857 -21.200 -8.852  1.00 32.15 ? 274  LEU A O   1 
ATOM   276  C CB  . LEU A 1 66  ? 31.047 -22.478 -11.329 1.00 28.78 ? 274  LEU A CB  1 
ATOM   277  C CG  . LEU A 1 66  ? 31.123 -22.680 -12.849 1.00 30.18 ? 274  LEU A CG  1 
ATOM   278  C CD1 . LEU A 1 66  ? 30.823 -24.129 -13.211 1.00 27.38 ? 274  LEU A CD1 1 
ATOM   279  C CD2 . LEU A 1 66  ? 30.131 -21.767 -13.521 1.00 28.96 ? 274  LEU A CD2 1 
ATOM   280  N N   . GLY A 1 67  ? 32.062 -20.963 -8.449  1.00 30.96 ? 275  GLY A N   1 
ATOM   281  C CA  . GLY A 1 67  ? 31.869 -20.937 -7.007  1.00 26.09 ? 275  GLY A CA  1 
ATOM   282  C C   . GLY A 1 67  ? 32.402 -22.141 -6.252  1.00 29.55 ? 275  GLY A C   1 
ATOM   283  O O   . GLY A 1 67  ? 31.994 -22.388 -5.118  1.00 26.17 ? 275  GLY A O   1 
ATOM   284  N N   . TYR A 1 68  ? 33.304 -22.900 -6.869  1.00 26.37 ? 276  TYR A N   1 
ATOM   285  C CA  . TYR A 1 68  ? 33.884 -24.057 -6.200  1.00 29.00 ? 276  TYR A CA  1 
ATOM   286  C C   . TYR A 1 68  ? 35.234 -23.699 -5.592  1.00 29.01 ? 276  TYR A C   1 
ATOM   287  O O   . TYR A 1 68  ? 35.895 -22.751 -6.018  1.00 28.31 ? 276  TYR A O   1 
ATOM   288  C CB  . TYR A 1 68  ? 34.105 -25.228 -7.176  1.00 24.67 ? 276  TYR A CB  1 
ATOM   289  C CG  . TYR A 1 68  ? 32.842 -25.923 -7.608  1.00 25.38 ? 276  TYR A CG  1 
ATOM   290  C CD1 . TYR A 1 68  ? 32.025 -25.372 -8.602  1.00 26.12 ? 276  TYR A CD1 1 
ATOM   291  C CD2 . TYR A 1 68  ? 32.409 -27.082 -6.962  1.00 23.58 ? 276  TYR A CD2 1 
ATOM   292  C CE1 . TYR A 1 68  ? 30.800 -25.949 -8.939  1.00 21.48 ? 276  TYR A CE1 1 
ATOM   293  C CE2 . TYR A 1 68  ? 31.189 -27.665 -7.283  1.00 25.55 ? 276  TYR A CE2 1 
ATOM   294  C CZ  . TYR A 1 68  ? 30.388 -27.087 -8.274  1.00 24.03 ? 276  TYR A CZ  1 
ATOM   295  O OH  . TYR A 1 68  ? 29.158 -27.624 -8.557  1.00 28.55 ? 276  TYR A OH  1 
ATOM   296  N N   . GLU A 1 69  ? 35.635 -24.480 -4.603  1.00 26.57 ? 277  GLU A N   1 
ATOM   297  C CA  . GLU A 1 69  ? 36.930 -24.308 -3.956  1.00 33.00 ? 277  GLU A CA  1 
ATOM   298  C C   . GLU A 1 69  ? 37.800 -25.347 -4.653  1.00 28.90 ? 277  GLU A C   1 
ATOM   299  O O   . GLU A 1 69  ? 37.631 -26.541 -4.434  1.00 26.50 ? 277  GLU A O   1 
ATOM   300  C CB  . GLU A 1 69  ? 36.829 -24.649 -2.467  1.00 35.43 ? 277  GLU A CB  1 
ATOM   301  C CG  . GLU A 1 69  ? 38.175 -24.805 -1.780  1.00 43.76 ? 277  GLU A CG  1 
ATOM   302  C CD  . GLU A 1 69  ? 38.036 -25.384 -0.384  1.00 51.27 ? 277  GLU A CD  1 
ATOM   303  O OE1 . GLU A 1 69  ? 37.316 -24.780 0.447   1.00 52.68 ? 277  GLU A OE1 1 
ATOM   304  O OE2 . GLU A 1 69  ? 38.638 -26.448 -0.124  1.00 54.19 ? 277  GLU A OE2 1 
ATOM   305  N N   . VAL A 1 70  ? 38.724 -24.900 -5.486  1.00 30.19 ? 278  VAL A N   1 
ATOM   306  C CA  . VAL A 1 70  ? 39.565 -25.829 -6.225  1.00 29.05 ? 278  VAL A CA  1 
ATOM   307  C C   . VAL A 1 70  ? 40.880 -26.205 -5.555  1.00 31.58 ? 278  VAL A C   1 
ATOM   308  O O   . VAL A 1 70  ? 41.590 -25.342 -5.040  1.00 29.09 ? 278  VAL A O   1 
ATOM   309  C CB  . VAL A 1 70  ? 39.912 -25.253 -7.629  1.00 30.64 ? 278  VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 70  ? 40.906 -26.165 -8.340  1.00 28.86 ? 278  VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 70  ? 38.640 -25.071 -8.450  1.00 28.08 ? 278  VAL A CG2 1 
ATOM   312  N N   . GLN A 1 71  ? 41.180 -27.501 -5.578  1.00 29.38 ? 279  GLN A N   1 
ATOM   313  C CA  . GLN A 1 71  ? 42.430 -28.048 -5.077  1.00 28.59 ? 279  GLN A CA  1 
ATOM   314  C C   . GLN A 1 71  ? 42.943 -28.923 -6.213  1.00 30.39 ? 279  GLN A C   1 
ATOM   315  O O   . GLN A 1 71  ? 42.274 -29.883 -6.622  1.00 26.60 ? 279  GLN A O   1 
ATOM   316  C CB  . GLN A 1 71  ? 42.210 -28.881 -3.817  1.00 30.27 ? 279  GLN A CB  1 
ATOM   317  C CG  . GLN A 1 71  ? 41.820 -28.010 -2.636  1.00 39.32 ? 279  GLN A CG  1 
ATOM   318  C CD  . GLN A 1 71  ? 41.936 -28.739 -1.327  1.00 41.70 ? 279  GLN A CD  1 
ATOM   319  O OE1 . GLN A 1 71  ? 42.999 -29.261 -1.002  1.00 40.36 ? 279  GLN A OE1 1 
ATOM   320  N NE2 . GLN A 1 71  ? 40.845 -28.781 -0.562  1.00 43.78 ? 279  GLN A NE2 1 
ATOM   321  N N   . LYS A 1 72  ? 44.120 -28.568 -6.725  1.00 28.26 ? 280  LYS A N   1 
ATOM   322  C CA  . LYS A 1 72  ? 44.745 -29.266 -7.833  1.00 28.50 ? 280  LYS A CA  1 
ATOM   323  C C   . LYS A 1 72  ? 46.062 -29.944 -7.461  1.00 27.69 ? 280  LYS A C   1 
ATOM   324  O O   . LYS A 1 72  ? 46.859 -29.400 -6.712  1.00 29.67 ? 280  LYS A O   1 
ATOM   325  C CB  . LYS A 1 72  ? 44.991 -28.277 -8.968  1.00 30.07 ? 280  LYS A CB  1 
ATOM   326  C CG  . LYS A 1 72  ? 45.707 -28.843 -10.200 1.00 30.60 ? 280  LYS A CG  1 
ATOM   327  C CD  . LYS A 1 72  ? 45.696 -27.776 -11.310 1.00 29.62 ? 280  LYS A CD  1 
ATOM   328  C CE  . LYS A 1 72  ? 46.505 -28.186 -12.514 1.00 25.85 ? 280  LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 72  ? 46.575 -27.054 -13.498 1.00 24.37 ? 280  LYS A NZ  1 
ATOM   330  N N   . PHE A 1 73  ? 46.276 -31.131 -8.009  1.00 25.04 ? 281  PHE A N   1 
ATOM   331  C CA  . PHE A 1 73  ? 47.482 -31.897 -7.771  1.00 25.32 ? 281  PHE A CA  1 
ATOM   332  C C   . PHE A 1 73  ? 48.080 -32.326 -9.109  1.00 24.83 ? 281  PHE A C   1 
ATOM   333  O O   . PHE A 1 73  ? 47.348 -32.534 -10.093 1.00 26.99 ? 281  PHE A O   1 
ATOM   334  C CB  . PHE A 1 73  ? 47.154 -33.104 -6.916  1.00 25.57 ? 281  PHE A CB  1 
ATOM   335  C CG  . PHE A 1 73  ? 46.529 -32.742 -5.597  1.00 30.87 ? 281  PHE A CG  1 
ATOM   336  C CD1 . PHE A 1 73  ? 45.155 -32.508 -5.502  1.00 26.30 ? 281  PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1 73  ? 47.324 -32.587 -4.455  1.00 30.15 ? 281  PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1 73  ? 44.572 -32.122 -4.291  1.00 26.68 ? 281  PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1 73  ? 46.762 -32.201 -3.232  1.00 32.27 ? 281  PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1 73  ? 45.373 -31.965 -3.144  1.00 31.74 ? 281  PHE A CZ  1 
ATOM   341  N N   . LEU A 1 74  ? 49.403 -32.455 -9.125  1.00 20.84 ? 282  LEU A N   1 
ATOM   342  C CA  . LEU A 1 74  ? 50.168 -32.819 -10.315 1.00 21.89 ? 282  LEU A CA  1 
ATOM   343  C C   . LEU A 1 74  ? 51.066 -34.016 -10.060 1.00 23.65 ? 282  LEU A C   1 
ATOM   344  O O   . LEU A 1 74  ? 51.364 -34.348 -8.922  1.00 25.27 ? 282  LEU A O   1 
ATOM   345  C CB  . LEU A 1 74  ? 51.089 -31.651 -10.712 1.00 23.06 ? 282  LEU A CB  1 
ATOM   346  C CG  . LEU A 1 74  ? 50.491 -30.292 -11.066 1.00 29.90 ? 282  LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 74  ? 51.633 -29.244 -11.234 1.00 28.52 ? 282  LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 74  ? 49.673 -30.434 -12.359 1.00 24.60 ? 282  LEU A CD2 1 
ATOM   349  N N   . HIS A 1 75  ? 51.523 -34.641 -11.134 1.00 27.27 ? 283  HIS A N   1 
ATOM   350  C CA  . HIS A 1 75  ? 52.460 -35.765 -11.046 1.00 28.92 ? 283  HIS A CA  1 
ATOM   351  C C   . HIS A 1 75  ? 52.193 -36.817 -9.959  1.00 30.34 ? 283  HIS A C   1 
ATOM   352  O O   . HIS A 1 75  ? 53.060 -37.090 -9.110  1.00 27.13 ? 283  HIS A O   1 
ATOM   353  C CB  . HIS A 1 75  ? 53.930 -35.224 -10.945 1.00 28.30 ? 283  HIS A CB  1 
ATOM   354  C CG  . HIS A 1 75  ? 54.192 -34.257 -9.810  1.00 33.61 ? 283  HIS A CG  1 
ATOM   355  N ND1 . HIS A 1 75  ? 54.212 -34.641 -8.479  1.00 35.30 ? 283  HIS A ND1 1 
ATOM   356  C CD2 . HIS A 1 75  ? 54.548 -32.942 -9.820  1.00 35.43 ? 283  HIS A CD2 1 
ATOM   357  C CE1 . HIS A 1 75  ? 54.577 -33.614 -7.724  1.00 34.95 ? 283  HIS A CE1 1 
ATOM   358  N NE2 . HIS A 1 75  ? 54.787 -32.569 -8.510  1.00 33.07 ? 283  HIS A NE2 1 
ATOM   359  N N   . LEU A 1 76  ? 50.996 -37.414 -9.995  1.00 26.52 ? 284  LEU A N   1 
ATOM   360  C CA  . LEU A 1 76  ? 50.633 -38.442 -9.033  1.00 25.82 ? 284  LEU A CA  1 
ATOM   361  C C   . LEU A 1 76  ? 50.677 -39.824 -9.668  1.00 25.64 ? 284  LEU A C   1 
ATOM   362  O O   . LEU A 1 76  ? 50.273 -40.003 -10.824 1.00 22.17 ? 284  LEU A O   1 
ATOM   363  C CB  . LEU A 1 76  ? 49.203 -38.237 -8.496  1.00 28.11 ? 284  LEU A CB  1 
ATOM   364  C CG  . LEU A 1 76  ? 48.826 -36.948 -7.778  1.00 28.38 ? 284  LEU A CG  1 
ATOM   365  C CD1 . LEU A 1 76  ? 47.385 -37.094 -7.274  1.00 23.45 ? 284  LEU A CD1 1 
ATOM   366  C CD2 . LEU A 1 76  ? 49.810 -36.668 -6.615  1.00 23.79 ? 284  LEU A CD2 1 
ATOM   367  N N   . SER A 1 77  ? 51.167 -40.795 -8.907  1.00 22.64 ? 285  SER A N   1 
ATOM   368  C CA  . SER A 1 77  ? 51.187 -42.191 -9.352  1.00 25.01 ? 285  SER A CA  1 
ATOM   369  C C   . SER A 1 77  ? 49.783 -42.728 -9.015  1.00 25.80 ? 285  SER A C   1 
ATOM   370  O O   . SER A 1 77  ? 48.959 -42.013 -8.416  1.00 26.66 ? 285  SER A O   1 
ATOM   371  C CB  . SER A 1 77  ? 52.238 -42.994 -8.564  1.00 21.41 ? 285  SER A CB  1 
ATOM   372  O OG  . SER A 1 77  ? 51.991 -42.924 -7.161  1.00 25.03 ? 285  SER A OG  1 
ATOM   373  N N   . MET A 1 78  ? 49.507 -43.977 -9.376  1.00 26.05 ? 286  MET A N   1 
ATOM   374  C CA  . MET A 1 78  ? 48.205 -44.571 -9.068  1.00 27.82 ? 286  MET A CA  1 
ATOM   375  C C   . MET A 1 78  ? 47.987 -44.518 -7.560  1.00 28.82 ? 286  MET A C   1 
ATOM   376  O O   . MET A 1 78  ? 46.898 -44.173 -7.097  1.00 29.04 ? 286  MET A O   1 
ATOM   377  C CB  . MET A 1 78  ? 48.152 -46.023 -9.548  1.00 31.12 ? 286  MET A CB  1 
ATOM   378  C CG  . MET A 1 78  ? 47.892 -46.146 -11.047 1.00 33.52 ? 286  MET A CG  1 
ATOM   379  S SD  . MET A 1 78  ? 48.088 -47.822 -11.687 1.00 34.97 ? 286  MET A SD  1 
ATOM   380  C CE  . MET A 1 78  ? 47.159 -48.834 -10.418 1.00 38.71 ? 286  MET A CE  1 
ATOM   381  N N   . HIS A 1 79  ? 49.032 -44.853 -6.803  1.00 26.44 ? 287  HIS A N   1 
ATOM   382  C CA  . HIS A 1 79  ? 48.969 -44.846 -5.335  1.00 27.69 ? 287  HIS A CA  1 
ATOM   383  C C   . HIS A 1 79  ? 48.709 -43.412 -4.843  1.00 26.53 ? 287  HIS A C   1 
ATOM   384  O O   . HIS A 1 79  ? 47.928 -43.201 -3.923  1.00 28.98 ? 287  HIS A O   1 
ATOM   385  C CB  . HIS A 1 79  ? 50.295 -45.408 -4.770  1.00 28.27 ? 287  HIS A CB  1 
ATOM   386  C CG  . HIS A 1 79  ? 50.409 -45.370 -3.275  1.00 29.74 ? 287  HIS A CG  1 
ATOM   387  N ND1 . HIS A 1 79  ? 49.685 -46.199 -2.445  1.00 29.54 ? 287  HIS A ND1 1 
ATOM   388  C CD2 . HIS A 1 79  ? 51.221 -44.648 -2.464  1.00 30.87 ? 287  HIS A CD2 1 
ATOM   389  C CE1 . HIS A 1 79  ? 50.045 -45.992 -1.191  1.00 31.06 ? 287  HIS A CE1 1 
ATOM   390  N NE2 . HIS A 1 79  ? 50.978 -45.055 -1.174  1.00 28.17 ? 287  HIS A NE2 1 
ATOM   391  N N   . GLY A 1 80  ? 49.361 -42.429 -5.458  1.00 24.99 ? 288  GLY A N   1 
ATOM   392  C CA  . GLY A 1 80  ? 49.133 -41.049 -5.058  1.00 21.70 ? 288  GLY A CA  1 
ATOM   393  C C   . GLY A 1 80  ? 47.675 -40.660 -5.334  1.00 25.53 ? 288  GLY A C   1 
ATOM   394  O O   . GLY A 1 80  ? 47.032 -39.999 -4.523  1.00 23.62 ? 288  GLY A O   1 
ATOM   395  N N   . ILE A 1 81  ? 47.144 -41.081 -6.478  1.00 25.75 ? 289  ILE A N   1 
ATOM   396  C CA  . ILE A 1 81  ? 45.751 -40.778 -6.834  1.00 26.48 ? 289  ILE A CA  1 
ATOM   397  C C   . ILE A 1 81  ? 44.769 -41.340 -5.792  1.00 26.85 ? 289  ILE A C   1 
ATOM   398  O O   . ILE A 1 81  ? 43.865 -40.635 -5.341  1.00 26.18 ? 289  ILE A O   1 
ATOM   399  C CB  . ILE A 1 81  ? 45.394 -41.355 -8.215  1.00 26.09 ? 289  ILE A CB  1 
ATOM   400  C CG1 . ILE A 1 81  ? 46.134 -40.580 -9.302  1.00 23.29 ? 289  ILE A CG1 1 
ATOM   401  C CG2 . ILE A 1 81  ? 43.865 -41.257 -8.460  1.00 28.17 ? 289  ILE A CG2 1 
ATOM   402  C CD1 . ILE A 1 81  ? 46.021 -41.205 -10.690 1.00 26.51 ? 289  ILE A CD1 1 
ATOM   403  N N   . SER A 1 82  ? 44.949 -42.603 -5.421  1.00 27.96 ? 290  SER A N   1 
ATOM   404  C CA  . SER A 1 82  ? 44.092 -43.235 -4.415  1.00 33.07 ? 290  SER A CA  1 
ATOM   405  C C   . SER A 1 82  ? 44.215 -42.552 -3.064  1.00 32.24 ? 290  SER A C   1 
ATOM   406  O O   . SER A 1 82  ? 43.216 -42.362 -2.383  1.00 34.88 ? 290  SER A O   1 
ATOM   407  C CB  . SER A 1 82  ? 44.443 -44.703 -4.241  1.00 33.21 ? 290  SER A CB  1 
ATOM   408  O OG  . SER A 1 82  ? 44.279 -45.384 -5.462  1.00 45.61 ? 290  SER A OG  1 
ATOM   409  N N   . GLN A 1 83  ? 45.436 -42.192 -2.675  1.00 31.76 ? 291  GLN A N   1 
ATOM   410  C CA  . GLN A 1 83  ? 45.644 -41.521 -1.400  1.00 30.00 ? 291  GLN A CA  1 
ATOM   411  C C   . GLN A 1 83  ? 44.818 -40.240 -1.374  1.00 30.42 ? 291  GLN A C   1 
ATOM   412  O O   . GLN A 1 83  ? 44.064 -39.998 -0.434  1.00 29.64 ? 291  GLN A O   1 
ATOM   413  C CB  . GLN A 1 83  ? 47.127 -41.164 -1.204  1.00 30.72 ? 291  GLN A CB  1 
ATOM   414  C CG  . GLN A 1 83  ? 47.433 -40.347 0.061   1.00 30.13 ? 291  GLN A CG  1 
ATOM   415  C CD  . GLN A 1 83  ? 47.595 -41.200 1.322   1.00 34.02 ? 291  GLN A CD  1 
ATOM   416  O OE1 . GLN A 1 83  ? 47.421 -42.419 1.293   1.00 31.15 ? 291  GLN A OE1 1 
ATOM   417  N NE2 . GLN A 1 83  ? 47.934 -40.553 2.434   1.00 30.68 ? 291  GLN A NE2 1 
ATOM   418  N N   . ILE A 1 84  ? 44.963 -39.421 -2.411  1.00 27.68 ? 292  ILE A N   1 
ATOM   419  C CA  . ILE A 1 84  ? 44.239 -38.165 -2.467  1.00 29.45 ? 292  ILE A CA  1 
ATOM   420  C C   . ILE A 1 84  ? 42.723 -38.352 -2.628  1.00 29.91 ? 292  ILE A C   1 
ATOM   421  O O   . ILE A 1 84  ? 41.946 -37.688 -1.933  1.00 27.02 ? 292  ILE A O   1 
ATOM   422  C CB  . ILE A 1 84  ? 44.865 -37.242 -3.556  1.00 32.82 ? 292  ILE A CB  1 
ATOM   423  C CG1 . ILE A 1 84  ? 46.135 -36.598 -2.969  1.00 32.83 ? 292  ILE A CG1 1 
ATOM   424  C CG2 . ILE A 1 84  ? 43.914 -36.115 -3.955  1.00 31.05 ? 292  ILE A CG2 1 
ATOM   425  C CD1 . ILE A 1 84  ? 47.176 -36.266 -3.990  1.00 41.53 ? 292  ILE A CD1 1 
ATOM   426  N N   . LEU A 1 85  ? 42.295 -39.267 -3.499  1.00 29.45 ? 293  LEU A N   1 
ATOM   427  C CA  . LEU A 1 85  ? 40.857 -39.492 -3.660  1.00 33.82 ? 293  LEU A CA  1 
ATOM   428  C C   . LEU A 1 85  ? 40.274 -39.928 -2.301  1.00 33.17 ? 293  LEU A C   1 
ATOM   429  O O   . LEU A 1 85  ? 39.223 -39.438 -1.890  1.00 34.41 ? 293  LEU A O   1 
ATOM   430  C CB  . LEU A 1 85  ? 40.573 -40.563 -4.731  1.00 30.00 ? 293  LEU A CB  1 
ATOM   431  C CG  . LEU A 1 85  ? 40.821 -40.179 -6.197  1.00 28.45 ? 293  LEU A CG  1 
ATOM   432  C CD1 . LEU A 1 85  ? 40.600 -41.373 -7.087  1.00 30.08 ? 293  LEU A CD1 1 
ATOM   433  C CD2 . LEU A 1 85  ? 39.896 -39.047 -6.587  1.00 28.95 ? 293  LEU A CD2 1 
ATOM   434  N N   . GLY A 1 86  ? 40.972 -40.828 -1.608  1.00 33.56 ? 294  GLY A N   1 
ATOM   435  C CA  . GLY A 1 86  ? 40.520 -41.305 -0.302  1.00 29.25 ? 294  GLY A CA  1 
ATOM   436  C C   . GLY A 1 86  ? 40.351 -40.178 0.698   1.00 34.53 ? 294  GLY A C   1 
ATOM   437  O O   . GLY A 1 86  ? 39.398 -40.154 1.483   1.00 37.31 ? 294  GLY A O   1 
ATOM   438  N N   . GLN A 1 87  ? 41.273 -39.227 0.681   1.00 30.67 ? 295  GLN A N   1 
ATOM   439  C CA  . GLN A 1 87  ? 41.170 -38.110 1.593   1.00 34.14 ? 295  GLN A CA  1 
ATOM   440  C C   . GLN A 1 87  ? 40.013 -37.178 1.249   1.00 34.41 ? 295  GLN A C   1 
ATOM   441  O O   . GLN A 1 87  ? 39.357 -36.634 2.143   1.00 34.94 ? 295  GLN A O   1 
ATOM   442  C CB  . GLN A 1 87  ? 42.473 -37.328 1.595   1.00 32.61 ? 295  GLN A CB  1 
ATOM   443  C CG  . GLN A 1 87  ? 43.594 -38.065 2.282   1.00 37.74 ? 295  GLN A CG  1 
ATOM   444  C CD  . GLN A 1 87  ? 44.931 -37.377 2.062   1.00 33.62 ? 295  GLN A CD  1 
ATOM   445  O OE1 . GLN A 1 87  ? 45.004 -36.361 1.375   1.00 33.83 ? 295  GLN A OE1 1 
ATOM   446  N NE2 . GLN A 1 87  ? 45.983 -37.931 2.633   1.00 31.17 ? 295  GLN A NE2 1 
ATOM   447  N N   . PHE A 1 88  ? 39.756 -36.974 -0.040  1.00 32.28 ? 296  PHE A N   1 
ATOM   448  C CA  . PHE A 1 88  ? 38.670 -36.082 -0.399  1.00 32.23 ? 296  PHE A CA  1 
ATOM   449  C C   . PHE A 1 88  ? 37.304 -36.706 -0.165  1.00 30.87 ? 296  PHE A C   1 
ATOM   450  O O   . PHE A 1 88  ? 36.341 -35.998 0.108   1.00 35.81 ? 296  PHE A O   1 
ATOM   451  C CB  . PHE A 1 88  ? 38.836 -35.560 -1.835  1.00 28.81 ? 296  PHE A CB  1 
ATOM   452  C CG  . PHE A 1 88  ? 39.809 -34.416 -1.931  1.00 27.20 ? 296  PHE A CG  1 
ATOM   453  C CD1 . PHE A 1 88  ? 41.171 -34.636 -1.793  1.00 27.53 ? 296  PHE A CD1 1 
ATOM   454  C CD2 . PHE A 1 88  ? 39.359 -33.114 -2.050  1.00 30.18 ? 296  PHE A CD2 1 
ATOM   455  C CE1 . PHE A 1 88  ? 42.067 -33.584 -1.763  1.00 23.32 ? 296  PHE A CE1 1 
ATOM   456  C CE2 . PHE A 1 88  ? 40.252 -32.049 -2.020  1.00 30.40 ? 296  PHE A CE2 1 
ATOM   457  C CZ  . PHE A 1 88  ? 41.619 -32.293 -1.872  1.00 25.96 ? 296  PHE A CZ  1 
ATOM   458  N N   . ALA A 1 89  ? 37.220 -38.024 -0.253  1.00 32.10 ? 297  ALA A N   1 
ATOM   459  C CA  . ALA A 1 89  ? 35.961 -38.705 0.002   1.00 37.35 ? 297  ALA A CA  1 
ATOM   460  C C   . ALA A 1 89  ? 35.568 -38.615 1.497   1.00 42.31 ? 297  ALA A C   1 
ATOM   461  O O   . ALA A 1 89  ? 34.378 -38.675 1.825   1.00 42.51 ? 297  ALA A O   1 
ATOM   462  C CB  . ALA A 1 89  ? 36.067 -40.167 -0.420  1.00 34.09 ? 297  ALA A CB  1 
ATOM   463  N N   . CYS A 1 90  ? 36.569 -38.463 2.374   1.00 41.79 ? 298  CYS A N   1 
ATOM   464  C CA  . CYS A 1 90  ? 36.395 -38.392 3.836   1.00 44.69 ? 298  CYS A CA  1 
ATOM   465  C C   . CYS A 1 90  ? 36.198 -37.017 4.428   1.00 44.47 ? 298  CYS A C   1 
ATOM   466  O O   . CYS A 1 90  ? 35.874 -36.911 5.601   1.00 45.67 ? 298  CYS A O   1 
ATOM   467  C CB  . CYS A 1 90  ? 37.622 -38.960 4.570   1.00 44.52 ? 298  CYS A CB  1 
ATOM   468  S SG  . CYS A 1 90  ? 37.901 -40.680 4.346   1.00 59.39 ? 298  CYS A SG  1 
ATOM   469  N N   . MET A 1 91  ? 36.433 -35.958 3.669   1.00 44.61 ? 299  MET A N   1 
ATOM   470  C CA  . MET A 1 91  ? 36.287 -34.639 4.262   1.00 44.40 ? 299  MET A CA  1 
ATOM   471  C C   . MET A 1 91  ? 34.892 -34.400 4.828   1.00 47.07 ? 299  MET A C   1 
ATOM   472  O O   . MET A 1 91  ? 33.881 -34.638 4.156   1.00 46.26 ? 299  MET A O   1 
ATOM   473  C CB  . MET A 1 91  ? 36.634 -33.562 3.250   1.00 42.33 ? 299  MET A CB  1 
ATOM   474  C CG  . MET A 1 91  ? 37.999 -33.777 2.674   1.00 44.15 ? 299  MET A CG  1 
ATOM   475  S SD  . MET A 1 91  ? 38.407 -32.593 1.440   1.00 42.64 ? 299  MET A SD  1 
ATOM   476  C CE  . MET A 1 91  ? 40.251 -32.642 1.592   1.00 43.51 ? 299  MET A CE  1 
ATOM   477  N N   . PRO A 1 92  ? 34.823 -33.954 6.094   1.00 46.72 ? 300  PRO A N   1 
ATOM   478  C CA  . PRO A 1 92  ? 33.515 -33.699 6.691   1.00 42.88 ? 300  PRO A CA  1 
ATOM   479  C C   . PRO A 1 92  ? 32.928 -32.392 6.175   1.00 41.52 ? 300  PRO A C   1 
ATOM   480  O O   . PRO A 1 92  ? 31.733 -32.170 6.315   1.00 40.01 ? 300  PRO A O   1 
ATOM   481  C CB  . PRO A 1 92  ? 33.816 -33.664 8.194   1.00 46.41 ? 300  PRO A CB  1 
ATOM   482  C CG  . PRO A 1 92  ? 35.207 -33.089 8.245   1.00 45.12 ? 300  PRO A CG  1 
ATOM   483  C CD  . PRO A 1 92  ? 35.895 -33.857 7.107   1.00 47.23 ? 300  PRO A CD  1 
ATOM   484  N N   . GLU A 1 93  ? 33.743 -31.523 5.575   1.00 38.09 ? 301  GLU A N   1 
ATOM   485  C CA  . GLU A 1 93  ? 33.169 -30.286 5.059   1.00 41.06 ? 301  GLU A CA  1 
ATOM   486  C C   . GLU A 1 93  ? 32.190 -30.478 3.903   1.00 39.78 ? 301  GLU A C   1 
ATOM   487  O O   . GLU A 1 93  ? 31.488 -29.534 3.540   1.00 40.35 ? 301  GLU A O   1 
ATOM   488  C CB  . GLU A 1 93  ? 34.228 -29.265 4.642   1.00 42.84 ? 301  GLU A CB  1 
ATOM   489  C CG  . GLU A 1 93  ? 35.573 -29.806 4.290   1.00 52.66 ? 301  GLU A CG  1 
ATOM   490  C CD  . GLU A 1 93  ? 36.344 -30.246 5.508   1.00 50.89 ? 301  GLU A CD  1 
ATOM   491  O OE1 . GLU A 1 93  ? 36.377 -31.462 5.779   1.00 55.68 ? 301  GLU A OE1 1 
ATOM   492  O OE2 . GLU A 1 93  ? 36.902 -29.374 6.196   1.00 52.41 ? 301  GLU A OE2 1 
ATOM   493  N N   . HIS A 1 94  ? 32.131 -31.674 3.316   1.00 36.68 ? 302  HIS A N   1 
ATOM   494  C CA  . HIS A 1 94  ? 31.179 -31.886 2.221   1.00 37.49 ? 302  HIS A CA  1 
ATOM   495  C C   . HIS A 1 94  ? 29.790 -31.674 2.811   1.00 41.01 ? 302  HIS A C   1 
ATOM   496  O O   . HIS A 1 94  ? 28.878 -31.196 2.135   1.00 40.52 ? 302  HIS A O   1 
ATOM   497  C CB  . HIS A 1 94  ? 31.270 -33.303 1.661   1.00 33.07 ? 302  HIS A CB  1 
ATOM   498  C CG  . HIS A 1 94  ? 32.516 -33.568 0.875   1.00 32.93 ? 302  HIS A CG  1 
ATOM   499  N ND1 . HIS A 1 94  ? 32.949 -32.735 -0.135  1.00 30.25 ? 302  HIS A ND1 1 
ATOM   500  C CD2 . HIS A 1 94  ? 33.418 -34.577 0.948   1.00 30.14 ? 302  HIS A CD2 1 
ATOM   501  C CE1 . HIS A 1 94  ? 34.066 -33.216 -0.651  1.00 32.18 ? 302  HIS A CE1 1 
ATOM   502  N NE2 . HIS A 1 94  ? 34.373 -34.334 -0.011  1.00 35.12 ? 302  HIS A NE2 1 
ATOM   503  N N   . ARG A 1 95  ? 29.652 -32.024 4.089   1.00 41.25 ? 303  ARG A N   1 
ATOM   504  C CA  . ARG A 1 95  ? 28.388 -31.883 4.807   1.00 43.93 ? 303  ARG A CA  1 
ATOM   505  C C   . ARG A 1 95  ? 27.760 -30.520 4.596   1.00 39.53 ? 303  ARG A C   1 
ATOM   506  O O   . ARG A 1 95  ? 26.550 -30.402 4.515   1.00 39.03 ? 303  ARG A O   1 
ATOM   507  C CB  . ARG A 1 95  ? 28.604 -32.107 6.297   1.00 49.98 ? 303  ARG A CB  1 
ATOM   508  C CG  . ARG A 1 95  ? 27.368 -31.904 7.139   1.00 61.77 ? 303  ARG A CG  1 
ATOM   509  C CD  . ARG A 1 95  ? 27.583 -30.777 8.146   1.00 69.12 ? 303  ARG A CD  1 
ATOM   510  N NE  . ARG A 1 95  ? 26.915 -31.066 9.411   1.00 76.48 ? 303  ARG A NE  1 
ATOM   511  C CZ  . ARG A 1 95  ? 27.148 -32.153 10.144  1.00 80.11 ? 303  ARG A CZ  1 
ATOM   512  N NH1 . ARG A 1 95  ? 28.036 -33.057 9.739   1.00 82.30 ? 303  ARG A NH1 1 
ATOM   513  N NH2 . ARG A 1 95  ? 26.495 -32.340 11.284  1.00 82.06 ? 303  ARG A NH2 1 
ATOM   514  N N   . ASP A 1 96  ? 28.592 -29.495 4.488   1.00 38.93 ? 304  ASP A N   1 
ATOM   515  C CA  . ASP A 1 96  ? 28.109 -28.140 4.293   1.00 38.53 ? 304  ASP A CA  1 
ATOM   516  C C   . ASP A 1 96  ? 28.034 -27.690 2.837   1.00 37.83 ? 304  ASP A C   1 
ATOM   517  O O   . ASP A 1 96  ? 27.669 -26.542 2.574   1.00 37.38 ? 304  ASP A O   1 
ATOM   518  C CB  . ASP A 1 96  ? 29.010 -27.165 5.054   1.00 45.00 ? 304  ASP A CB  1 
ATOM   519  C CG  . ASP A 1 96  ? 29.272 -27.613 6.480   1.00 50.70 ? 304  ASP A CG  1 
ATOM   520  O OD1 . ASP A 1 96  ? 28.297 -28.000 7.164   1.00 50.77 ? 304  ASP A OD1 1 
ATOM   521  O OD2 . ASP A 1 96  ? 30.447 -27.575 6.910   1.00 53.98 ? 304  ASP A OD2 1 
ATOM   522  N N   . TYR A 1 97  ? 28.380 -28.570 1.896   1.00 34.92 ? 305  TYR A N   1 
ATOM   523  C CA  . TYR A 1 97  ? 28.355 -28.203 0.472   1.00 34.28 ? 305  TYR A CA  1 
ATOM   524  C C   . TYR A 1 97  ? 27.222 -28.913 -0.271  1.00 31.82 ? 305  TYR A C   1 
ATOM   525  O O   . TYR A 1 97  ? 26.753 -29.964 0.157   1.00 31.07 ? 305  TYR A O   1 
ATOM   526  C CB  . TYR A 1 97  ? 29.700 -28.552 -0.175  1.00 34.16 ? 305  TYR A CB  1 
ATOM   527  C CG  . TYR A 1 97  ? 30.888 -27.907 0.512   1.00 39.38 ? 305  TYR A CG  1 
ATOM   528  C CD1 . TYR A 1 97  ? 32.134 -28.536 0.523   1.00 38.86 ? 305  TYR A CD1 1 
ATOM   529  C CD2 . TYR A 1 97  ? 30.768 -26.673 1.155   1.00 40.80 ? 305  TYR A CD2 1 
ATOM   530  C CE1 . TYR A 1 97  ? 33.227 -27.966 1.155   1.00 41.66 ? 305  TYR A CE1 1 
ATOM   531  C CE2 . TYR A 1 97  ? 31.871 -26.084 1.797   1.00 43.09 ? 305  TYR A CE2 1 
ATOM   532  C CZ  . TYR A 1 97  ? 33.092 -26.742 1.788   1.00 44.26 ? 305  TYR A CZ  1 
ATOM   533  O OH  . TYR A 1 97  ? 34.186 -26.187 2.409   1.00 47.58 ? 305  TYR A OH  1 
ATOM   534  N N   . ASP A 1 98  ? 26.803 -28.350 -1.398  1.00 31.01 ? 306  ASP A N   1 
ATOM   535  C CA  . ASP A 1 98  ? 25.702 -28.928 -2.170  1.00 30.47 ? 306  ASP A CA  1 
ATOM   536  C C   . ASP A 1 98  ? 26.122 -29.897 -3.273  1.00 32.06 ? 306  ASP A C   1 
ATOM   537  O O   . ASP A 1 98  ? 25.276 -30.595 -3.827  1.00 31.51 ? 306  ASP A O   1 
ATOM   538  C CB  . ASP A 1 98  ? 24.860 -27.798 -2.780  1.00 29.17 ? 306  ASP A CB  1 
ATOM   539  C CG  . ASP A 1 98  ? 24.078 -27.010 -1.709  1.00 32.27 ? 306  ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 98  ? 23.744 -27.632 -0.687  1.00 26.99 ? 306  ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 98  ? 23.788 -25.809 -1.895  1.00 31.29 ? 306  ASP A OD2 1 
ATOM   542  N N   . SER A 1 99  ? 27.418 -29.940 -3.589  1.00 30.82 ? 307  SER A N   1 
ATOM   543  C CA  . SER A 1 99  ? 27.907 -30.802 -4.660  1.00 29.83 ? 307  SER A CA  1 
ATOM   544  C C   . SER A 1 99  ? 29.415 -31.032 -4.593  1.00 31.94 ? 307  SER A C   1 
ATOM   545  O O   . SER A 1 99  ? 30.112 -30.428 -3.775  1.00 29.99 ? 307  SER A O   1 
ATOM   546  C CB  . SER A 1 99  ? 27.574 -30.167 -6.006  1.00 27.76 ? 307  SER A CB  1 
ATOM   547  O OG  . SER A 1 99  ? 28.332 -28.979 -6.178  1.00 31.45 ? 307  SER A OG  1 
ATOM   548  N N   . PHE A 1 100 ? 29.896 -31.904 -5.481  1.00 31.54 ? 308  PHE A N   1 
ATOM   549  C CA  . PHE A 1 100 ? 31.310 -32.255 -5.600  1.00 27.10 ? 308  PHE A CA  1 
ATOM   550  C C   . PHE A 1 100 ? 31.704 -32.450 -7.082  1.00 27.31 ? 308  PHE A C   1 
ATOM   551  O O   . PHE A 1 100 ? 30.964 -33.058 -7.872  1.00 22.21 ? 308  PHE A O   1 
ATOM   552  C CB  . PHE A 1 100 ? 31.595 -33.546 -4.834  1.00 25.24 ? 308  PHE A CB  1 
ATOM   553  C CG  . PHE A 1 100 ? 33.006 -34.064 -5.009  1.00 28.75 ? 308  PHE A CG  1 
ATOM   554  C CD1 . PHE A 1 100 ? 34.107 -33.322 -4.554  1.00 29.00 ? 308  PHE A CD1 1 
ATOM   555  C CD2 . PHE A 1 100 ? 33.240 -35.291 -5.634  1.00 27.16 ? 308  PHE A CD2 1 
ATOM   556  C CE1 . PHE A 1 100 ? 35.430 -33.803 -4.719  1.00 29.68 ? 308  PHE A CE1 1 
ATOM   557  C CE2 . PHE A 1 100 ? 34.558 -35.779 -5.806  1.00 27.13 ? 308  PHE A CE2 1 
ATOM   558  C CZ  . PHE A 1 100 ? 35.652 -35.031 -5.345  1.00 28.63 ? 308  PHE A CZ  1 
ATOM   559  N N   . VAL A 1 101 ? 32.868 -31.924 -7.445  1.00 24.85 ? 309  VAL A N   1 
ATOM   560  C CA  . VAL A 1 101 ? 33.398 -32.041 -8.805  1.00 24.11 ? 309  VAL A CA  1 
ATOM   561  C C   . VAL A 1 101 ? 34.822 -32.598 -8.754  1.00 24.74 ? 309  VAL A C   1 
ATOM   562  O O   . VAL A 1 101 ? 35.635 -32.165 -7.931  1.00 23.97 ? 309  VAL A O   1 
ATOM   563  C CB  . VAL A 1 101 ? 33.492 -30.670 -9.542  1.00 23.22 ? 309  VAL A CB  1 
ATOM   564  C CG1 . VAL A 1 101 ? 34.218 -30.862 -10.879 1.00 22.39 ? 309  VAL A CG1 1 
ATOM   565  C CG2 . VAL A 1 101 ? 32.106 -30.067 -9.777  1.00 19.96 ? 309  VAL A CG2 1 
ATOM   566  N N   . CYS A 1 102 ? 35.096 -33.570 -9.623  1.00 24.26 ? 310  CYS A N   1 
ATOM   567  C CA  . CYS A 1 102 ? 36.414 -34.166 -9.766  1.00 24.39 ? 310  CYS A CA  1 
ATOM   568  C C   . CYS A 1 102 ? 36.804 -34.190 -11.260 1.00 24.03 ? 310  CYS A C   1 
ATOM   569  O O   . CYS A 1 102 ? 36.050 -34.681 -12.104 1.00 22.45 ? 310  CYS A O   1 
ATOM   570  C CB  . CYS A 1 102 ? 36.445 -35.593 -9.211  1.00 22.66 ? 310  CYS A CB  1 
ATOM   571  S SG  . CYS A 1 102 ? 38.090 -36.385 -9.385  1.00 28.12 ? 310  CYS A SG  1 
ATOM   572  N N   . VAL A 1 103 ? 37.967 -33.626 -11.560 1.00 22.44 ? 311  VAL A N   1 
ATOM   573  C CA  . VAL A 1 103 ? 38.518 -33.571 -12.907 1.00 22.95 ? 311  VAL A CA  1 
ATOM   574  C C   . VAL A 1 103 ? 39.816 -34.394 -12.844 1.00 27.42 ? 311  VAL A C   1 
ATOM   575  O O   . VAL A 1 103 ? 40.679 -34.175 -11.984 1.00 24.22 ? 311  VAL A O   1 
ATOM   576  C CB  . VAL A 1 103 ? 38.857 -32.132 -13.337 1.00 21.89 ? 311  VAL A CB  1 
ATOM   577  C CG1 . VAL A 1 103 ? 39.483 -32.158 -14.726 1.00 23.21 ? 311  VAL A CG1 1 
ATOM   578  C CG2 . VAL A 1 103 ? 37.585 -31.252 -13.339 1.00 18.42 ? 311  VAL A CG2 1 
ATOM   579  N N   . LEU A 1 104 ? 39.938 -35.358 -13.740 1.00 24.39 ? 312  LEU A N   1 
ATOM   580  C CA  . LEU A 1 104 ? 41.096 -36.236 -13.762 1.00 27.58 ? 312  LEU A CA  1 
ATOM   581  C C   . LEU A 1 104 ? 41.644 -36.268 -15.187 1.00 25.67 ? 312  LEU A C   1 
ATOM   582  O O   . LEU A 1 104 ? 40.903 -36.532 -16.134 1.00 24.40 ? 312  LEU A O   1 
ATOM   583  C CB  . LEU A 1 104 ? 40.664 -37.635 -13.295 1.00 28.93 ? 312  LEU A CB  1 
ATOM   584  C CG  . LEU A 1 104 ? 41.621 -38.811 -13.468 1.00 36.73 ? 312  LEU A CG  1 
ATOM   585  C CD1 . LEU A 1 104 ? 42.942 -38.481 -12.785 1.00 39.12 ? 312  LEU A CD1 1 
ATOM   586  C CD2 . LEU A 1 104 ? 40.998 -40.092 -12.862 1.00 39.74 ? 312  LEU A CD2 1 
ATOM   587  N N   . VAL A 1 105 ? 42.928 -35.955 -15.336 1.00 22.76 ? 313  VAL A N   1 
ATOM   588  C CA  . VAL A 1 105 ? 43.571 -35.945 -16.653 1.00 21.57 ? 313  VAL A CA  1 
ATOM   589  C C   . VAL A 1 105 ? 44.756 -36.903 -16.507 1.00 25.86 ? 313  VAL A C   1 
ATOM   590  O O   . VAL A 1 105 ? 45.675 -36.658 -15.711 1.00 26.60 ? 313  VAL A O   1 
ATOM   591  C CB  . VAL A 1 105 ? 44.055 -34.522 -17.032 1.00 21.74 ? 313  VAL A CB  1 
ATOM   592  C CG1 . VAL A 1 105 ? 44.634 -34.520 -18.460 1.00 20.67 ? 313  VAL A CG1 1 
ATOM   593  C CG2 . VAL A 1 105 ? 42.890 -33.545 -16.944 1.00 20.12 ? 313  VAL A CG2 1 
ATOM   594  N N   . SER A 1 106 ? 44.737 -37.996 -17.266 1.00 23.50 ? 314  SER A N   1 
ATOM   595  C CA  . SER A 1 106 ? 45.772 -38.998 -17.119 1.00 24.58 ? 314  SER A CA  1 
ATOM   596  C C   . SER A 1 106 ? 45.890 -39.953 -18.286 1.00 26.85 ? 314  SER A C   1 
ATOM   597  O O   . SER A 1 106 ? 44.959 -40.110 -19.073 1.00 25.15 ? 314  SER A O   1 
ATOM   598  C CB  . SER A 1 106 ? 45.475 -39.814 -15.844 1.00 24.45 ? 314  SER A CB  1 
ATOM   599  O OG  . SER A 1 106 ? 46.368 -40.903 -15.657 1.00 26.60 ? 314  SER A OG  1 
ATOM   600  N N   . ARG A 1 107 ? 47.057 -40.575 -18.414 1.00 26.36 ? 315  ARG A N   1 
ATOM   601  C CA  . ARG A 1 107 ? 47.209 -41.615 -19.423 1.00 26.74 ? 315  ARG A CA  1 
ATOM   602  C C   . ARG A 1 107 ? 46.513 -42.788 -18.744 1.00 28.54 ? 315  ARG A C   1 
ATOM   603  O O   . ARG A 1 107 ? 46.438 -42.845 -17.503 1.00 23.88 ? 315  ARG A O   1 
ATOM   604  C CB  . ARG A 1 107 ? 48.671 -42.008 -19.633 1.00 29.92 ? 315  ARG A CB  1 
ATOM   605  C CG  . ARG A 1 107 ? 49.503 -40.982 -20.360 1.00 34.95 ? 315  ARG A CG  1 
ATOM   606  C CD  . ARG A 1 107 ? 50.982 -41.405 -20.436 1.00 41.17 ? 315  ARG A CD  1 
ATOM   607  N NE  . ARG A 1 107 ? 51.776 -40.314 -20.992 1.00 51.61 ? 315  ARG A NE  1 
ATOM   608  C CZ  . ARG A 1 107 ? 52.058 -39.186 -20.339 1.00 52.45 ? 315  ARG A CZ  1 
ATOM   609  N NH1 . ARG A 1 107 ? 51.624 -39.002 -19.092 1.00 53.86 ? 315  ARG A NH1 1 
ATOM   610  N NH2 . ARG A 1 107 ? 52.734 -38.222 -20.950 1.00 55.20 ? 315  ARG A NH2 1 
ATOM   611  N N   . GLY A 1 108 ? 46.029 -43.737 -19.532 1.00 29.36 ? 316  GLY A N   1 
ATOM   612  C CA  . GLY A 1 108 ? 45.383 -44.887 -18.926 1.00 35.09 ? 316  GLY A CA  1 
ATOM   613  C C   . GLY A 1 108 ? 45.024 -45.942 -19.945 1.00 36.76 ? 316  GLY A C   1 
ATOM   614  O O   . GLY A 1 108 ? 45.523 -45.941 -21.063 1.00 35.77 ? 316  GLY A O   1 
ATOM   615  N N   . GLY A 1 109 ? 44.173 -46.869 -19.536 1.00 42.46 ? 317  GLY A N   1 
ATOM   616  C CA  . GLY A 1 109 ? 43.717 -47.904 -20.440 1.00 42.99 ? 317  GLY A CA  1 
ATOM   617  C C   . GLY A 1 109 ? 42.231 -47.632 -20.519 1.00 47.39 ? 317  GLY A C   1 
ATOM   618  O O   . GLY A 1 109 ? 41.776 -46.579 -20.055 1.00 41.85 ? 317  GLY A O   1 
ATOM   619  N N   . SER A 1 110 ? 41.465 -48.543 -21.107 1.00 50.01 ? 318  SER A N   1 
ATOM   620  C CA  . SER A 1 110 ? 40.026 -48.328 -21.160 1.00 56.14 ? 318  SER A CA  1 
ATOM   621  C C   . SER A 1 110 ? 39.519 -48.568 -19.740 1.00 57.73 ? 318  SER A C   1 
ATOM   622  O O   . SER A 1 110 ? 39.839 -49.585 -19.113 1.00 59.09 ? 318  SER A O   1 
ATOM   623  C CB  . SER A 1 110 ? 39.359 -49.315 -22.127 1.00 57.55 ? 318  SER A CB  1 
ATOM   624  O OG  . SER A 1 110 ? 39.425 -50.645 -21.636 1.00 61.28 ? 318  SER A OG  1 
ATOM   625  N N   . GLN A 1 111 ? 38.764 -47.619 -19.207 1.00 59.33 ? 319  GLN A N   1 
ATOM   626  C CA  . GLN A 1 111 ? 38.219 -47.794 -17.869 1.00 60.60 ? 319  GLN A CA  1 
ATOM   627  C C   . GLN A 1 111 ? 39.236 -47.773 -16.715 1.00 56.62 ? 319  GLN A C   1 
ATOM   628  O O   . GLN A 1 111 ? 38.925 -48.256 -15.621 1.00 54.59 ? 319  GLN A O   1 
ATOM   629  C CB  . GLN A 1 111 ? 37.441 -49.113 -17.815 1.00 66.98 ? 319  GLN A CB  1 
ATOM   630  C CG  . GLN A 1 111 ? 36.495 -49.327 -18.989 1.00 75.03 ? 319  GLN A CG  1 
ATOM   631  C CD  . GLN A 1 111 ? 35.827 -50.693 -18.956 1.00 80.22 ? 319  GLN A CD  1 
ATOM   632  O OE1 . GLN A 1 111 ? 36.499 -51.734 -18.966 1.00 80.14 ? 319  GLN A OE1 1 
ATOM   633  N NE2 . GLN A 1 111 ? 34.495 -50.696 -18.915 1.00 82.52 ? 319  GLN A NE2 1 
ATOM   634  N N   . SER A 1 112 ? 40.437 -47.238 -16.943 1.00 49.63 ? 320  SER A N   1 
ATOM   635  C CA  . SER A 1 112 ? 41.437 -47.153 -15.868 1.00 44.09 ? 320  SER A CA  1 
ATOM   636  C C   . SER A 1 112 ? 42.443 -46.034 -16.112 1.00 39.97 ? 320  SER A C   1 
ATOM   637  O O   . SER A 1 112 ? 42.631 -45.612 -17.244 1.00 38.91 ? 320  SER A O   1 
ATOM   638  C CB  . SER A 1 112 ? 42.199 -48.470 -15.718 1.00 39.37 ? 320  SER A CB  1 
ATOM   639  O OG  . SER A 1 112 ? 43.180 -48.611 -16.733 1.00 39.63 ? 320  SER A OG  1 
ATOM   640  N N   . VAL A 1 113 ? 43.072 -45.546 -15.046 1.00 34.87 ? 321  VAL A N   1 
ATOM   641  C CA  . VAL A 1 113 ? 44.094 -44.505 -15.181 1.00 35.28 ? 321  VAL A CA  1 
ATOM   642  C C   . VAL A 1 113 ? 45.420 -44.955 -14.553 1.00 31.98 ? 321  VAL A C   1 
ATOM   643  O O   . VAL A 1 113 ? 45.441 -45.640 -13.523 1.00 30.77 ? 321  VAL A O   1 
ATOM   644  C CB  . VAL A 1 113 ? 43.646 -43.164 -14.538 1.00 35.65 ? 321  VAL A CB  1 
ATOM   645  C CG1 . VAL A 1 113 ? 42.481 -42.575 -15.344 1.00 37.00 ? 321  VAL A CG1 1 
ATOM   646  C CG2 . VAL A 1 113 ? 43.251 -43.374 -13.074 1.00 32.67 ? 321  VAL A CG2 1 
ATOM   647  N N   . TYR A 1 114 ? 46.522 -44.564 -15.175 1.00 29.44 ? 322  TYR A N   1 
ATOM   648  C CA  . TYR A 1 114 ? 47.849 -44.938 -14.688 1.00 29.17 ? 322  TYR A CA  1 
ATOM   649  C C   . TYR A 1 114 ? 48.531 -43.837 -13.871 1.00 29.00 ? 322  TYR A C   1 
ATOM   650  O O   . TYR A 1 114 ? 49.568 -44.078 -13.255 1.00 31.81 ? 322  TYR A O   1 
ATOM   651  C CB  . TYR A 1 114 ? 48.789 -45.255 -15.860 1.00 27.90 ? 322  TYR A CB  1 
ATOM   652  C CG  . TYR A 1 114 ? 48.279 -46.220 -16.916 1.00 29.05 ? 322  TYR A CG  1 
ATOM   653  C CD1 . TYR A 1 114 ? 47.471 -47.305 -16.577 1.00 29.92 ? 322  TYR A CD1 1 
ATOM   654  C CD2 . TYR A 1 114 ? 48.662 -46.074 -18.249 1.00 29.55 ? 322  TYR A CD2 1 
ATOM   655  C CE1 . TYR A 1 114 ? 47.061 -48.223 -17.541 1.00 33.54 ? 322  TYR A CE1 1 
ATOM   656  C CE2 . TYR A 1 114 ? 48.267 -46.983 -19.219 1.00 32.14 ? 322  TYR A CE2 1 
ATOM   657  C CZ  . TYR A 1 114 ? 47.466 -48.055 -18.857 1.00 33.83 ? 322  TYR A CZ  1 
ATOM   658  O OH  . TYR A 1 114 ? 47.078 -48.962 -19.807 1.00 37.39 ? 322  TYR A OH  1 
ATOM   659  N N   . GLY A 1 115 ? 47.971 -42.636 -13.846 1.00 27.34 ? 323  GLY A N   1 
ATOM   660  C CA  . GLY A 1 115 ? 48.695 -41.574 -13.164 1.00 25.80 ? 323  GLY A CA  1 
ATOM   661  C C   . GLY A 1 115 ? 50.013 -41.526 -13.939 1.00 26.07 ? 323  GLY A C   1 
ATOM   662  O O   . GLY A 1 115 ? 50.013 -41.748 -15.159 1.00 25.55 ? 323  GLY A O   1 
ATOM   663  N N   . VAL A 1 116 ? 51.137 -41.271 -13.271 1.00 26.43 ? 324  VAL A N   1 
ATOM   664  C CA  . VAL A 1 116 ? 52.412 -41.222 -13.978 1.00 28.54 ? 324  VAL A CA  1 
ATOM   665  C C   . VAL A 1 116 ? 53.138 -42.558 -14.073 1.00 30.14 ? 324  VAL A C   1 
ATOM   666  O O   . VAL A 1 116 ? 54.263 -42.597 -14.547 1.00 30.99 ? 324  VAL A O   1 
ATOM   667  C CB  . VAL A 1 116 ? 53.404 -40.186 -13.359 1.00 29.31 ? 324  VAL A CB  1 
ATOM   668  C CG1 . VAL A 1 116 ? 52.826 -38.787 -13.466 1.00 25.83 ? 324  VAL A CG1 1 
ATOM   669  C CG2 . VAL A 1 116 ? 53.733 -40.556 -11.895 1.00 25.61 ? 324  VAL A CG2 1 
ATOM   670  N N   . ASP A 1 117 ? 52.495 -43.644 -13.642 1.00 31.93 ? 325  ASP A N   1 
ATOM   671  C CA  . ASP A 1 117 ? 53.100 -44.976 -13.684 1.00 31.98 ? 325  ASP A CA  1 
ATOM   672  C C   . ASP A 1 117 ? 53.222 -45.594 -15.063 1.00 35.14 ? 325  ASP A C   1 
ATOM   673  O O   . ASP A 1 117 ? 52.365 -45.403 -15.925 1.00 36.77 ? 325  ASP A O   1 
ATOM   674  C CB  . ASP A 1 117 ? 52.310 -45.967 -12.810 1.00 31.05 ? 325  ASP A CB  1 
ATOM   675  C CG  . ASP A 1 117 ? 52.500 -45.717 -11.338 1.00 33.43 ? 325  ASP A CG  1 
ATOM   676  O OD1 . ASP A 1 117 ? 53.661 -45.530 -10.957 1.00 39.32 ? 325  ASP A OD1 1 
ATOM   677  O OD2 . ASP A 1 117 ? 51.512 -45.712 -10.562 1.00 33.69 ? 325  ASP A OD2 1 
ATOM   678  N N   . GLN A 1 118 ? 54.295 -46.350 -15.265 1.00 36.67 ? 326  GLN A N   1 
ATOM   679  C CA  . GLN A 1 118 ? 54.501 -47.063 -16.521 1.00 40.28 ? 326  GLN A CA  1 
ATOM   680  C C   . GLN A 1 118 ? 53.887 -48.412 -16.189 1.00 40.70 ? 326  GLN A C   1 
ATOM   681  O O   . GLN A 1 118 ? 54.534 -49.272 -15.601 1.00 43.85 ? 326  GLN A O   1 
ATOM   682  C CB  . GLN A 1 118 ? 55.989 -47.227 -16.823 1.00 41.76 ? 326  GLN A CB  1 
ATOM   683  C CG  . GLN A 1 118 ? 56.686 -45.933 -17.194 1.00 46.61 ? 326  GLN A CG  1 
ATOM   684  C CD  . GLN A 1 118 ? 55.960 -45.198 -18.303 1.00 49.36 ? 326  GLN A CD  1 
ATOM   685  O OE1 . GLN A 1 118 ? 55.752 -45.738 -19.389 1.00 51.46 ? 326  GLN A OE1 1 
ATOM   686  N NE2 . GLN A 1 118 ? 55.565 -43.959 -18.033 1.00 50.00 ? 326  GLN A NE2 1 
ATOM   687  N N   . THR A 1 119 ? 52.630 -48.603 -16.548 1.00 40.72 ? 327  THR A N   1 
ATOM   688  C CA  . THR A 1 119 ? 51.978 -49.845 -16.200 1.00 42.45 ? 327  THR A CA  1 
ATOM   689  C C   . THR A 1 119 ? 50.939 -50.195 -17.234 1.00 44.12 ? 327  THR A C   1 
ATOM   690  O O   . THR A 1 119 ? 50.629 -49.376 -18.104 1.00 45.81 ? 327  THR A O   1 
ATOM   691  C CB  . THR A 1 119 ? 51.293 -49.707 -14.809 1.00 42.70 ? 327  THR A CB  1 
ATOM   692  O OG1 . THR A 1 119 ? 50.731 -50.961 -14.415 1.00 41.74 ? 327  THR A OG1 1 
ATOM   693  C CG2 . THR A 1 119 ? 50.190 -48.675 -14.863 1.00 38.15 ? 327  THR A CG2 1 
ATOM   694  N N   . HIS A 1 120 ? 50.408 -51.412 -17.140 1.00 44.78 ? 328  HIS A N   1 
ATOM   695  C CA  . HIS A 1 120 ? 49.370 -51.859 -18.049 1.00 46.98 ? 328  HIS A CA  1 
ATOM   696  C C   . HIS A 1 120 ? 48.126 -52.225 -17.278 1.00 46.14 ? 328  HIS A C   1 
ATOM   697  O O   . HIS A 1 120 ? 47.101 -52.550 -17.862 1.00 45.44 ? 328  HIS A O   1 
ATOM   698  C CB  . HIS A 1 120 ? 49.854 -53.027 -18.901 1.00 52.00 ? 328  HIS A CB  1 
ATOM   699  C CG  . HIS A 1 120 ? 50.650 -52.592 -20.088 1.00 57.56 ? 328  HIS A CG  1 
ATOM   700  N ND1 . HIS A 1 120 ? 50.108 -51.826 -21.098 1.00 58.82 ? 328  HIS A ND1 1 
ATOM   701  C CD2 . HIS A 1 120 ? 51.959 -52.751 -20.396 1.00 61.11 ? 328  HIS A CD2 1 
ATOM   702  C CE1 . HIS A 1 120 ? 51.050 -51.529 -21.976 1.00 61.45 ? 328  HIS A CE1 1 
ATOM   703  N NE2 . HIS A 1 120 ? 52.183 -52.077 -21.573 1.00 62.44 ? 328  HIS A NE2 1 
ATOM   704  N N   . SER A 1 121 ? 48.221 -52.185 -15.955 1.00 46.12 ? 329  SER A N   1 
ATOM   705  C CA  . SER A 1 121 ? 47.057 -52.449 -15.122 1.00 48.62 ? 329  SER A CA  1 
ATOM   706  C C   . SER A 1 121 ? 46.914 -51.192 -14.276 1.00 46.56 ? 329  SER A C   1 
ATOM   707  O O   . SER A 1 121 ? 47.692 -50.952 -13.340 1.00 46.66 ? 329  SER A O   1 
ATOM   708  C CB  . SER A 1 121 ? 47.254 -53.686 -14.246 1.00 49.86 ? 329  SER A CB  1 
ATOM   709  O OG  . SER A 1 121 ? 48.280 -53.473 -13.309 1.00 59.49 ? 329  SER A OG  1 
ATOM   710  N N   . GLY A 1 122 ? 45.929 -50.373 -14.639 1.00 42.04 ? 330  GLY A N   1 
ATOM   711  C CA  . GLY A 1 122 ? 45.718 -49.127 -13.945 1.00 36.97 ? 330  GLY A CA  1 
ATOM   712  C C   . GLY A 1 122 ? 44.677 -49.179 -12.858 1.00 39.06 ? 330  GLY A C   1 
ATOM   713  O O   . GLY A 1 122 ? 44.095 -50.222 -12.560 1.00 38.09 ? 330  GLY A O   1 
ATOM   714  N N   . LEU A 1 123 ? 44.463 -48.019 -12.252 1.00 35.86 ? 331  LEU A N   1 
ATOM   715  C CA  . LEU A 1 123 ? 43.486 -47.850 -11.196 1.00 35.61 ? 331  LEU A CA  1 
ATOM   716  C C   . LEU A 1 123 ? 42.126 -47.871 -11.895 1.00 34.89 ? 331  LEU A C   1 
ATOM   717  O O   . LEU A 1 123 ? 41.822 -46.980 -12.684 1.00 34.74 ? 331  LEU A O   1 
ATOM   718  C CB  . LEU A 1 123 ? 43.734 -46.504 -10.508 1.00 30.98 ? 331  LEU A CB  1 
ATOM   719  C CG  . LEU A 1 123 ? 42.737 -46.024 -9.467  1.00 36.23 ? 331  LEU A CG  1 
ATOM   720  C CD1 . LEU A 1 123 ? 42.561 -47.068 -8.356  1.00 40.49 ? 331  LEU A CD1 1 
ATOM   721  C CD2 . LEU A 1 123 ? 43.271 -44.723 -8.894  1.00 36.99 ? 331  LEU A CD2 1 
ATOM   722  N N   . PRO A 1 124 ? 41.295 -48.893 -11.621 1.00 38.30 ? 332  PRO A N   1 
ATOM   723  C CA  . PRO A 1 124 ? 39.973 -48.985 -12.263 1.00 36.83 ? 332  PRO A CA  1 
ATOM   724  C C   . PRO A 1 124 ? 39.102 -47.762 -11.998 1.00 34.66 ? 332  PRO A C   1 
ATOM   725  O O   . PRO A 1 124 ? 39.025 -47.274 -10.863 1.00 35.35 ? 332  PRO A O   1 
ATOM   726  C CB  . PRO A 1 124 ? 39.369 -50.253 -11.642 1.00 37.02 ? 332  PRO A CB  1 
ATOM   727  C CG  . PRO A 1 124 ? 40.576 -51.059 -11.246 1.00 39.03 ? 332  PRO A CG  1 
ATOM   728  C CD  . PRO A 1 124 ? 41.467 -49.988 -10.647 1.00 38.22 ? 332  PRO A CD  1 
ATOM   729  N N   . LEU A 1 125 ? 38.436 -47.273 -13.036 1.00 31.35 ? 333  LEU A N   1 
ATOM   730  C CA  . LEU A 1 125 ? 37.567 -46.120 -12.860 1.00 36.60 ? 333  LEU A CA  1 
ATOM   731  C C   . LEU A 1 125 ? 36.419 -46.440 -11.911 1.00 36.40 ? 333  LEU A C   1 
ATOM   732  O O   . LEU A 1 125 ? 36.025 -45.598 -11.116 1.00 37.39 ? 333  LEU A O   1 
ATOM   733  C CB  . LEU A 1 125 ? 37.026 -45.638 -14.214 1.00 35.63 ? 333  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 125 ? 38.098 -45.034 -15.131 1.00 42.00 ? 333  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 125 ? 37.505 -44.663 -16.480 1.00 43.66 ? 333  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 125 ? 38.698 -43.806 -14.464 1.00 40.27 ? 333  LEU A CD2 1 
ATOM   737  N N   . HIS A 1 126 ? 35.898 -47.665 -11.959 1.00 41.79 ? 334  HIS A N   1 
ATOM   738  C CA  . HIS A 1 126 ? 34.782 -48.001 -11.080 1.00 45.78 ? 334  HIS A CA  1 
ATOM   739  C C   . HIS A 1 126 ? 35.217 -48.001 -9.628  1.00 46.47 ? 334  HIS A C   1 
ATOM   740  O O   . HIS A 1 126 ? 34.393 -47.810 -8.732  1.00 45.04 ? 334  HIS A O   1 
ATOM   741  C CB  . HIS A 1 126 ? 34.117 -49.342 -11.468 1.00 49.28 ? 334  HIS A CB  1 
ATOM   742  C CG  . HIS A 1 126 ? 34.970 -50.551 -11.241 1.00 54.62 ? 334  HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 126 ? 35.969 -50.936 -12.110 1.00 58.66 ? 334  HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 126 ? 34.958 -51.475 -10.250 1.00 57.60 ? 334  HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 126 ? 36.535 -52.046 -11.666 1.00 57.30 ? 334  HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 126 ? 35.940 -52.393 -10.538 1.00 59.91 ? 334  HIS A NE2 1 
ATOM   747  N N   . HIS A 1 127 ? 36.514 -48.199 -9.387  1.00 47.80 ? 335  HIS A N   1 
ATOM   748  C CA  . HIS A 1 127 ? 37.021 -48.163 -8.019  1.00 49.24 ? 335  HIS A CA  1 
ATOM   749  C C   . HIS A 1 127 ? 37.006 -46.707 -7.575  1.00 47.13 ? 335  HIS A C   1 
ATOM   750  O O   . HIS A 1 127 ? 36.830 -46.402 -6.399  1.00 46.10 ? 335  HIS A O   1 
ATOM   751  C CB  . HIS A 1 127 ? 38.450 -48.706 -7.929  1.00 55.18 ? 335  HIS A CB  1 
ATOM   752  C CG  . HIS A 1 127 ? 38.541 -50.197 -8.040  1.00 61.51 ? 335  HIS A CG  1 
ATOM   753  N ND1 . HIS A 1 127 ? 39.724 -50.885 -7.877  1.00 65.10 ? 335  HIS A ND1 1 
ATOM   754  C CD2 . HIS A 1 127 ? 37.598 -51.133 -8.308  1.00 64.61 ? 335  HIS A CD2 1 
ATOM   755  C CE1 . HIS A 1 127 ? 39.507 -52.179 -8.041  1.00 66.43 ? 335  HIS A CE1 1 
ATOM   756  N NE2 . HIS A 1 127 ? 38.225 -52.356 -8.304  1.00 66.45 ? 335  HIS A NE2 1 
ATOM   757  N N   . ILE A 1 128 ? 37.184 -45.797 -8.523  1.00 46.97 ? 336  ILE A N   1 
ATOM   758  C CA  . ILE A 1 128 ? 37.169 -44.393 -8.167  1.00 46.36 ? 336  ILE A CA  1 
ATOM   759  C C   . ILE A 1 128 ? 35.761 -43.977 -7.749  1.00 47.85 ? 336  ILE A C   1 
ATOM   760  O O   . ILE A 1 128 ? 35.556 -43.517 -6.624  1.00 46.61 ? 336  ILE A O   1 
ATOM   761  C CB  . ILE A 1 128 ? 37.637 -43.499 -9.333  1.00 44.57 ? 336  ILE A CB  1 
ATOM   762  C CG1 . ILE A 1 128 ? 39.119 -43.750 -9.614  1.00 45.77 ? 336  ILE A CG1 1 
ATOM   763  C CG2 . ILE A 1 128 ? 37.401 -42.031 -8.990  1.00 44.13 ? 336  ILE A CG2 1 
ATOM   764  C CD1 . ILE A 1 128 ? 39.659 -43.008 -10.825 1.00 42.80 ? 336  ILE A CD1 1 
ATOM   765  N N   . ARG A 1 129 ? 34.783 -44.154 -8.632  1.00 48.23 ? 337  ARG A N   1 
ATOM   766  C CA  . ARG A 1 129 ? 33.438 -43.735 -8.272  1.00 53.88 ? 337  ARG A CA  1 
ATOM   767  C C   . ARG A 1 129 ? 32.936 -44.460 -7.034  1.00 52.28 ? 337  ARG A C   1 
ATOM   768  O O   . ARG A 1 129 ? 32.157 -43.915 -6.258  1.00 54.39 ? 337  ARG A O   1 
ATOM   769  C CB  . ARG A 1 129 ? 32.466 -43.881 -9.460  1.00 57.77 ? 337  ARG A CB  1 
ATOM   770  C CG  . ARG A 1 129 ? 32.668 -45.086 -10.354 1.00 61.36 ? 337  ARG A CG  1 
ATOM   771  C CD  . ARG A 1 129 ? 31.700 -45.045 -11.552 1.00 62.67 ? 337  ARG A CD  1 
ATOM   772  N NE  . ARG A 1 129 ? 31.671 -46.313 -12.282 1.00 64.33 ? 337  ARG A NE  1 
ATOM   773  C CZ  . ARG A 1 129 ? 32.284 -46.541 -13.442 1.00 66.65 ? 337  ARG A CZ  1 
ATOM   774  N NH1 . ARG A 1 129 ? 32.986 -45.583 -14.037 1.00 66.13 ? 337  ARG A NH1 1 
ATOM   775  N NH2 . ARG A 1 129 ? 32.204 -47.740 -14.006 1.00 65.91 ? 337  ARG A NH2 1 
ATOM   776  N N   . ARG A 1 130 ? 33.423 -45.672 -6.825  1.00 52.13 ? 338  ARG A N   1 
ATOM   777  C CA  . ARG A 1 130 ? 33.041 -46.466 -5.668  1.00 51.87 ? 338  ARG A CA  1 
ATOM   778  C C   . ARG A 1 130 ? 33.353 -45.748 -4.347  1.00 50.55 ? 338  ARG A C   1 
ATOM   779  O O   . ARG A 1 130 ? 32.608 -45.855 -3.371  1.00 51.83 ? 338  ARG A O   1 
ATOM   780  C CB  . ARG A 1 130 ? 33.782 -47.792 -5.744  1.00 59.75 ? 338  ARG A CB  1 
ATOM   781  C CG  . ARG A 1 130 ? 33.741 -48.660 -4.519  1.00 64.34 ? 338  ARG A CG  1 
ATOM   782  C CD  . ARG A 1 130 ? 34.654 -49.830 -4.800  1.00 73.25 ? 338  ARG A CD  1 
ATOM   783  N NE  . ARG A 1 130 ? 34.984 -50.612 -3.617  1.00 79.03 ? 338  ARG A NE  1 
ATOM   784  C CZ  . ARG A 1 130 ? 36.006 -51.456 -3.566  1.00 80.85 ? 338  ARG A CZ  1 
ATOM   785  N NH1 . ARG A 1 130 ? 36.786 -51.611 -4.633  1.00 81.44 ? 338  ARG A NH1 1 
ATOM   786  N NH2 . ARG A 1 130 ? 36.247 -52.141 -2.455  1.00 82.34 ? 338  ARG A NH2 1 
ATOM   787  N N   . MET A 1 131 ? 34.451 -45.005 -4.321  1.00 47.38 ? 339  MET A N   1 
ATOM   788  C CA  . MET A 1 131 ? 34.857 -44.278 -3.129  1.00 42.83 ? 339  MET A CA  1 
ATOM   789  C C   . MET A 1 131 ? 33.914 -43.143 -2.752  1.00 43.67 ? 339  MET A C   1 
ATOM   790  O O   . MET A 1 131 ? 33.908 -42.697 -1.603  1.00 40.74 ? 339  MET A O   1 
ATOM   791  C CB  . MET A 1 131 ? 36.262 -43.706 -3.327  1.00 47.84 ? 339  MET A CB  1 
ATOM   792  C CG  . MET A 1 131 ? 37.349 -44.761 -3.454  1.00 49.44 ? 339  MET A CG  1 
ATOM   793  S SD  . MET A 1 131 ? 38.910 -44.041 -3.992  1.00 57.03 ? 339  MET A SD  1 
ATOM   794  C CE  . MET A 1 131 ? 39.307 -43.121 -2.590  1.00 50.83 ? 339  MET A CE  1 
ATOM   795  N N   . PHE A 1 132 ? 33.119 -42.670 -3.708  1.00 38.89 ? 340  PHE A N   1 
ATOM   796  C CA  . PHE A 1 132 ? 32.213 -41.564 -3.425  1.00 40.23 ? 340  PHE A CA  1 
ATOM   797  C C   . PHE A 1 132 ? 30.733 -41.919 -3.334  1.00 41.03 ? 340  PHE A C   1 
ATOM   798  O O   . PHE A 1 132 ? 29.881 -41.034 -3.307  1.00 37.86 ? 340  PHE A O   1 
ATOM   799  C CB  . PHE A 1 132 ? 32.408 -40.449 -4.457  1.00 37.65 ? 340  PHE A CB  1 
ATOM   800  C CG  . PHE A 1 132 ? 33.751 -39.796 -4.377  1.00 37.43 ? 340  PHE A CG  1 
ATOM   801  C CD1 . PHE A 1 132 ? 34.857 -40.384 -4.977  1.00 33.03 ? 340  PHE A CD1 1 
ATOM   802  C CD2 . PHE A 1 132 ? 33.925 -38.626 -3.638  1.00 35.88 ? 340  PHE A CD2 1 
ATOM   803  C CE1 . PHE A 1 132 ? 36.119 -39.821 -4.838  1.00 37.60 ? 340  PHE A CE1 1 
ATOM   804  C CE2 . PHE A 1 132 ? 35.186 -38.054 -3.489  1.00 36.67 ? 340  PHE A CE2 1 
ATOM   805  C CZ  . PHE A 1 132 ? 36.289 -38.657 -4.093  1.00 35.10 ? 340  PHE A CZ  1 
ATOM   806  N N   . MET A 1 133 ? 30.427 -43.207 -3.290  1.00 45.55 ? 341  MET A N   1 
ATOM   807  C CA  . MET A 1 133 ? 29.040 -43.636 -3.181  1.00 52.32 ? 341  MET A CA  1 
ATOM   808  C C   . MET A 1 133 ? 28.515 -43.342 -1.781  1.00 55.63 ? 341  MET A C   1 
ATOM   809  O O   . MET A 1 133 ? 29.290 -43.208 -0.830  1.00 56.99 ? 341  MET A O   1 
ATOM   810  C CB  . MET A 1 133 ? 28.924 -45.121 -3.490  1.00 50.23 ? 341  MET A CB  1 
ATOM   811  C CG  . MET A 1 133 ? 29.448 -45.451 -4.856  1.00 52.54 ? 341  MET A CG  1 
ATOM   812  S SD  . MET A 1 133 ? 29.150 -47.145 -5.333  1.00 56.60 ? 341  MET A SD  1 
ATOM   813  C CE  . MET A 1 133 ? 28.945 -46.925 -7.111  1.00 56.09 ? 341  MET A CE  1 
ATOM   814  N N   . GLY A 1 134 ? 27.195 -43.235 -1.667  1.00 59.65 ? 342  GLY A N   1 
ATOM   815  C CA  . GLY A 1 134 ? 26.573 -42.928 -0.389  1.00 62.09 ? 342  GLY A CA  1 
ATOM   816  C C   . GLY A 1 134 ? 27.073 -43.669 0.838   1.00 63.63 ? 342  GLY A C   1 
ATOM   817  O O   . GLY A 1 134 ? 27.210 -43.074 1.907   1.00 65.17 ? 342  GLY A O   1 
ATOM   818  N N   . ASP A 1 135 ? 27.345 -44.962 0.710   1.00 65.57 ? 343  ASP A N   1 
ATOM   819  C CA  . ASP A 1 135 ? 27.812 -45.721 1.859   1.00 67.76 ? 343  ASP A CA  1 
ATOM   820  C C   . ASP A 1 135 ? 29.223 -45.336 2.284   1.00 68.59 ? 343  ASP A C   1 
ATOM   821  O O   . ASP A 1 135 ? 29.486 -45.119 3.468   1.00 70.25 ? 343  ASP A O   1 
ATOM   822  C CB  . ASP A 1 135 ? 27.707 -47.228 1.584   1.00 72.03 ? 343  ASP A CB  1 
ATOM   823  C CG  . ASP A 1 135 ? 28.156 -47.610 0.185   1.00 74.82 ? 343  ASP A CG  1 
ATOM   824  O OD1 . ASP A 1 135 ? 27.809 -46.894 -0.779  1.00 77.49 ? 343  ASP A OD1 1 
ATOM   825  O OD2 . ASP A 1 135 ? 28.841 -48.644 0.047   1.00 76.70 ? 343  ASP A OD2 1 
ATOM   826  N N   . SER A 1 136 ? 30.136 -45.230 1.328   1.00 67.18 ? 344  SER A N   1 
ATOM   827  C CA  . SER A 1 136 ? 31.500 -44.853 1.664   1.00 64.36 ? 344  SER A CA  1 
ATOM   828  C C   . SER A 1 136 ? 31.655 -43.335 1.821   1.00 62.13 ? 344  SER A C   1 
ATOM   829  O O   . SER A 1 136 ? 32.635 -42.859 2.393   1.00 61.18 ? 344  SER A O   1 
ATOM   830  C CB  . SER A 1 136 ? 32.466 -45.396 0.604   1.00 64.94 ? 344  SER A CB  1 
ATOM   831  O OG  . SER A 1 136 ? 31.859 -45.423 -0.679  1.00 68.73 ? 344  SER A OG  1 
ATOM   832  N N   . CYS A 1 137 ? 30.683 -42.573 1.327   1.00 57.46 ? 345  CYS A N   1 
ATOM   833  C CA  . CYS A 1 137 ? 30.754 -41.123 1.430   1.00 51.61 ? 345  CYS A CA  1 
ATOM   834  C C   . CYS A 1 137 ? 29.396 -40.516 1.786   1.00 52.08 ? 345  CYS A C   1 
ATOM   835  O O   . CYS A 1 137 ? 28.736 -39.883 0.948   1.00 48.08 ? 345  CYS A O   1 
ATOM   836  C CB  . CYS A 1 137 ? 31.274 -40.525 0.117   1.00 48.73 ? 345  CYS A CB  1 
ATOM   837  S SG  . CYS A 1 137 ? 31.593 -38.766 0.245   1.00 50.92 ? 345  CYS A SG  1 
ATOM   838  N N   . PRO A 1 138 ? 28.966 -40.693 3.054   1.00 51.26 ? 346  PRO A N   1 
ATOM   839  C CA  . PRO A 1 138 ? 27.691 -40.189 3.578   1.00 47.52 ? 346  PRO A CA  1 
ATOM   840  C C   . PRO A 1 138 ? 27.502 -38.695 3.408   1.00 44.61 ? 346  PRO A C   1 
ATOM   841  O O   . PRO A 1 138 ? 26.399 -38.230 3.127   1.00 42.66 ? 346  PRO A O   1 
ATOM   842  C CB  . PRO A 1 138 ? 27.744 -40.576 5.058   1.00 51.58 ? 346  PRO A CB  1 
ATOM   843  C CG  . PRO A 1 138 ? 28.577 -41.829 5.050   1.00 53.22 ? 346  PRO A CG  1 
ATOM   844  C CD  . PRO A 1 138 ? 29.687 -41.458 4.091   1.00 52.27 ? 346  PRO A CD  1 
ATOM   845  N N   . TYR A 1 139 ? 28.582 -37.942 3.577   1.00 43.05 ? 347  TYR A N   1 
ATOM   846  C CA  . TYR A 1 139 ? 28.511 -36.491 3.478   1.00 43.63 ? 347  TYR A CA  1 
ATOM   847  C C   . TYR A 1 139 ? 28.072 -35.933 2.120   1.00 39.39 ? 347  TYR A C   1 
ATOM   848  O O   . TYR A 1 139 ? 27.674 -34.773 2.018   1.00 37.66 ? 347  TYR A O   1 
ATOM   849  C CB  . TYR A 1 139 ? 29.846 -35.896 3.919   1.00 53.05 ? 347  TYR A CB  1 
ATOM   850  C CG  . TYR A 1 139 ? 29.998 -35.851 5.431   1.00 64.89 ? 347  TYR A CG  1 
ATOM   851  C CD1 . TYR A 1 139 ? 29.790 -36.989 6.216   1.00 69.32 ? 347  TYR A CD1 1 
ATOM   852  C CD2 . TYR A 1 139 ? 30.296 -34.660 6.079   1.00 69.71 ? 347  TYR A CD2 1 
ATOM   853  C CE1 . TYR A 1 139 ? 29.870 -36.929 7.618   1.00 72.96 ? 347  TYR A CE1 1 
ATOM   854  C CE2 . TYR A 1 139 ? 30.376 -34.587 7.475   1.00 73.87 ? 347  TYR A CE2 1 
ATOM   855  C CZ  . TYR A 1 139 ? 30.161 -35.719 8.238   1.00 74.02 ? 347  TYR A CZ  1 
ATOM   856  O OH  . TYR A 1 139 ? 30.212 -35.619 9.616   1.00 75.98 ? 347  TYR A OH  1 
ATOM   857  N N   . LEU A 1 140 ? 28.113 -36.761 1.084   1.00 34.59 ? 348  LEU A N   1 
ATOM   858  C CA  . LEU A 1 140 ? 27.694 -36.314 -0.246  1.00 35.13 ? 348  LEU A CA  1 
ATOM   859  C C   . LEU A 1 140 ? 26.449 -37.057 -0.694  1.00 35.59 ? 348  LEU A C   1 
ATOM   860  O O   . LEU A 1 140 ? 26.011 -36.914 -1.838  1.00 35.82 ? 348  LEU A O   1 
ATOM   861  C CB  . LEU A 1 140 ? 28.820 -36.528 -1.266  1.00 27.03 ? 348  LEU A CB  1 
ATOM   862  C CG  . LEU A 1 140 ? 29.975 -35.548 -1.065  1.00 30.19 ? 348  LEU A CG  1 
ATOM   863  C CD1 . LEU A 1 140 ? 31.143 -35.904 -1.984  1.00 26.55 ? 348  LEU A CD1 1 
ATOM   864  C CD2 . LEU A 1 140 ? 29.458 -34.122 -1.304  1.00 26.09 ? 348  LEU A CD2 1 
ATOM   865  N N   . ALA A 1 141 ? 25.889 -37.855 0.212   1.00 35.94 ? 349  ALA A N   1 
ATOM   866  C CA  . ALA A 1 141 ? 24.684 -38.631 -0.079  1.00 37.64 ? 349  ALA A CA  1 
ATOM   867  C C   . ALA A 1 141 ? 23.594 -37.691 -0.577  1.00 34.63 ? 349  ALA A C   1 
ATOM   868  O O   . ALA A 1 141 ? 23.384 -36.632 0.008   1.00 36.18 ? 349  ALA A O   1 
ATOM   869  C CB  . ALA A 1 141 ? 24.217 -39.379 1.186   1.00 37.76 ? 349  ALA A CB  1 
ATOM   870  N N   . GLY A 1 142 ? 22.925 -38.063 -1.673  1.00 36.18 ? 350  GLY A N   1 
ATOM   871  C CA  . GLY A 1 142 ? 21.869 -37.218 -2.223  1.00 28.99 ? 350  GLY A CA  1 
ATOM   872  C C   . GLY A 1 142 ? 22.384 -35.981 -2.939  1.00 31.65 ? 350  GLY A C   1 
ATOM   873  O O   . GLY A 1 142 ? 21.601 -35.127 -3.369  1.00 31.73 ? 350  GLY A O   1 
ATOM   874  N N   . LYS A 1 143 ? 23.704 -35.867 -3.079  1.00 27.55 ? 351  LYS A N   1 
ATOM   875  C CA  . LYS A 1 143 ? 24.278 -34.700 -3.740  1.00 27.62 ? 351  LYS A CA  1 
ATOM   876  C C   . LYS A 1 143 ? 24.968 -35.045 -5.059  1.00 25.26 ? 351  LYS A C   1 
ATOM   877  O O   . LYS A 1 143 ? 25.607 -36.096 -5.191  1.00 23.43 ? 351  LYS A O   1 
ATOM   878  C CB  . LYS A 1 143 ? 25.273 -33.998 -2.810  1.00 28.80 ? 351  LYS A CB  1 
ATOM   879  C CG  . LYS A 1 143 ? 24.643 -33.455 -1.518  1.00 29.33 ? 351  LYS A CG  1 
ATOM   880  C CD  . LYS A 1 143 ? 25.715 -32.910 -0.569  1.00 32.82 ? 351  LYS A CD  1 
ATOM   881  C CE  . LYS A 1 143 ? 25.098 -32.419 0.755   1.00 35.21 ? 351  LYS A CE  1 
ATOM   882  N NZ  . LYS A 1 143 ? 26.120 -31.876 1.697   1.00 30.45 ? 351  LYS A NZ  1 
ATOM   883  N N   . PRO A 1 144 ? 24.886 -34.135 -6.036  1.00 24.66 ? 352  PRO A N   1 
ATOM   884  C CA  . PRO A 1 144 ? 25.512 -34.395 -7.336  1.00 26.28 ? 352  PRO A CA  1 
ATOM   885  C C   . PRO A 1 144 ? 27.018 -34.490 -7.247  1.00 27.74 ? 352  PRO A C   1 
ATOM   886  O O   . PRO A 1 144 ? 27.672 -33.597 -6.722  1.00 26.55 ? 352  PRO A O   1 
ATOM   887  C CB  . PRO A 1 144 ? 25.013 -33.247 -8.214  1.00 26.24 ? 352  PRO A CB  1 
ATOM   888  C CG  . PRO A 1 144 ? 24.730 -32.126 -7.225  1.00 27.64 ? 352  PRO A CG  1 
ATOM   889  C CD  . PRO A 1 144 ? 24.214 -32.821 -5.992  1.00 28.16 ? 352  PRO A CD  1 
ATOM   890  N N   . LYS A 1 145 ? 27.540 -35.623 -7.720  1.00 26.15 ? 353  LYS A N   1 
ATOM   891  C CA  . LYS A 1 145 ? 28.971 -35.910 -7.737  1.00 25.47 ? 353  LYS A CA  1 
ATOM   892  C C   . LYS A 1 145 ? 29.350 -36.007 -9.224  1.00 26.24 ? 353  LYS A C   1 
ATOM   893  O O   . LYS A 1 145 ? 28.988 -36.970 -9.921  1.00 25.18 ? 353  LYS A O   1 
ATOM   894  C CB  . LYS A 1 145 ? 29.238 -37.228 -6.980  1.00 23.22 ? 353  LYS A CB  1 
ATOM   895  C CG  . LYS A 1 145 ? 28.892 -37.139 -5.474  1.00 29.48 ? 353  LYS A CG  1 
ATOM   896  C CD  . LYS A 1 145 ? 28.912 -38.497 -4.751  1.00 24.72 ? 353  LYS A CD  1 
ATOM   897  C CE  . LYS A 1 145 ? 27.579 -39.254 -4.906  1.00 26.21 ? 353  LYS A CE  1 
ATOM   898  N NZ  . LYS A 1 145 ? 26.422 -38.480 -4.330  1.00 23.69 ? 353  LYS A NZ  1 
ATOM   899  N N   . MET A 1 146 ? 30.050 -34.979 -9.702  1.00 23.58 ? 354  MET A N   1 
ATOM   900  C CA  . MET A 1 146 ? 30.452 -34.867 -11.099 1.00 23.10 ? 354  MET A CA  1 
ATOM   901  C C   . MET A 1 146 ? 31.928 -35.196 -11.365 1.00 26.32 ? 354  MET A C   1 
ATOM   902  O O   . MET A 1 146 ? 32.838 -34.627 -10.729 1.00 24.59 ? 354  MET A O   1 
ATOM   903  C CB  . MET A 1 146 ? 30.154 -33.451 -11.591 1.00 21.47 ? 354  MET A CB  1 
ATOM   904  C CG  . MET A 1 146 ? 28.675 -33.061 -11.513 1.00 23.43 ? 354  MET A CG  1 
ATOM   905  S SD  . MET A 1 146 ? 28.445 -31.273 -11.566 1.00 28.18 ? 354  MET A SD  1 
ATOM   906  C CE  . MET A 1 146 ? 28.567 -30.940 -9.796  1.00 28.73 ? 354  MET A CE  1 
ATOM   907  N N   . PHE A 1 147 ? 32.146 -36.118 -12.302 1.00 24.24 ? 355  PHE A N   1 
ATOM   908  C CA  . PHE A 1 147 ? 33.488 -36.549 -12.699 1.00 24.11 ? 355  PHE A CA  1 
ATOM   909  C C   . PHE A 1 147 ? 33.683 -36.238 -14.182 1.00 26.71 ? 355  PHE A C   1 
ATOM   910  O O   . PHE A 1 147 ? 32.845 -36.627 -14.989 1.00 24.35 ? 355  PHE A O   1 
ATOM   911  C CB  . PHE A 1 147 ? 33.654 -38.043 -12.475 1.00 22.96 ? 355  PHE A CB  1 
ATOM   912  C CG  . PHE A 1 147 ? 33.617 -38.441 -11.020 1.00 29.29 ? 355  PHE A CG  1 
ATOM   913  C CD1 . PHE A 1 147 ? 32.406 -38.510 -10.329 1.00 29.69 ? 355  PHE A CD1 1 
ATOM   914  C CD2 . PHE A 1 147 ? 34.799 -38.677 -10.324 1.00 26.12 ? 355  PHE A CD2 1 
ATOM   915  C CE1 . PHE A 1 147 ? 32.375 -38.809 -8.946  1.00 32.04 ? 355  PHE A CE1 1 
ATOM   916  C CE2 . PHE A 1 147 ? 34.788 -38.979 -8.943  1.00 32.43 ? 355  PHE A CE2 1 
ATOM   917  C CZ  . PHE A 1 147 ? 33.577 -39.044 -8.254  1.00 30.54 ? 355  PHE A CZ  1 
ATOM   918  N N   . PHE A 1 148 ? 34.762 -35.515 -14.512 1.00 21.17 ? 356  PHE A N   1 
ATOM   919  C CA  . PHE A 1 148 ? 35.121 -35.137 -15.884 1.00 23.88 ? 356  PHE A CA  1 
ATOM   920  C C   . PHE A 1 148 ? 36.523 -35.707 -16.031 1.00 25.21 ? 356  PHE A C   1 
ATOM   921  O O   . PHE A 1 148 ? 37.468 -35.266 -15.357 1.00 22.08 ? 356  PHE A O   1 
ATOM   922  C CB  . PHE A 1 148 ? 35.149 -33.615 -16.046 1.00 19.38 ? 356  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 148 ? 33.826 -32.959 -15.788 1.00 23.09 ? 356  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 148 ? 32.838 -32.953 -16.765 1.00 17.12 ? 356  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 148 ? 33.565 -32.333 -14.556 1.00 18.81 ? 356  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 148 ? 31.607 -32.331 -16.528 1.00 21.39 ? 356  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 148 ? 32.339 -31.713 -14.314 1.00 21.07 ? 356  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 148 ? 31.357 -31.712 -15.312 1.00 18.92 ? 356  PHE A CZ  1 
ATOM   929  N N   . ILE A 1 149 ? 36.645 -36.694 -16.907 1.00 23.42 ? 357  ILE A N   1 
ATOM   930  C CA  . ILE A 1 149 ? 37.893 -37.405 -17.073 1.00 24.51 ? 357  ILE A CA  1 
ATOM   931  C C   . ILE A 1 149 ? 38.429 -37.375 -18.494 1.00 24.94 ? 357  ILE A C   1 
ATOM   932  O O   . ILE A 1 149 ? 37.702 -37.717 -19.430 1.00 20.02 ? 357  ILE A O   1 
ATOM   933  C CB  . ILE A 1 149 ? 37.690 -38.881 -16.666 1.00 24.85 ? 357  ILE A CB  1 
ATOM   934  C CG1 . ILE A 1 149 ? 37.124 -38.948 -15.239 1.00 31.32 ? 357  ILE A CG1 1 
ATOM   935  C CG2 . ILE A 1 149 ? 38.997 -39.655 -16.745 1.00 23.76 ? 357  ILE A CG2 1 
ATOM   936  C CD1 . ILE A 1 149 ? 36.607 -40.307 -14.864 1.00 31.97 ? 357  ILE A CD1 1 
ATOM   937  N N   . GLN A 1 150 ? 39.687 -36.958 -18.645 1.00 19.83 ? 358  GLN A N   1 
ATOM   938  C CA  . GLN A 1 150 ? 40.347 -36.961 -19.957 1.00 22.33 ? 358  GLN A CA  1 
ATOM   939  C C   . GLN A 1 150 ? 41.412 -38.058 -19.847 1.00 25.33 ? 358  GLN A C   1 
ATOM   940  O O   . GLN A 1 150 ? 42.408 -37.941 -19.121 1.00 21.58 ? 358  GLN A O   1 
ATOM   941  C CB  . GLN A 1 150 ? 41.028 -35.622 -20.275 1.00 26.24 ? 358  GLN A CB  1 
ATOM   942  C CG  . GLN A 1 150 ? 41.869 -35.649 -21.587 1.00 23.99 ? 358  GLN A CG  1 
ATOM   943  C CD  . GLN A 1 150 ? 41.018 -35.902 -22.825 1.00 23.71 ? 358  GLN A CD  1 
ATOM   944  O OE1 . GLN A 1 150 ? 40.244 -35.043 -23.255 1.00 26.55 ? 358  GLN A OE1 1 
ATOM   945  N NE2 . GLN A 1 150 ? 41.142 -37.092 -23.388 1.00 21.10 ? 358  GLN A NE2 1 
ATOM   946  N N   . ASN A 1 151 ? 41.185 -39.136 -20.569 1.00 25.39 ? 359  ASN A N   1 
ATOM   947  C CA  . ASN A 1 151 ? 42.084 -40.272 -20.561 1.00 25.24 ? 359  ASN A CA  1 
ATOM   948  C C   . ASN A 1 151 ? 42.833 -40.319 -21.903 1.00 25.56 ? 359  ASN A C   1 
ATOM   949  O O   . ASN A 1 151 ? 42.277 -39.937 -22.935 1.00 25.82 ? 359  ASN A O   1 
ATOM   950  C CB  . ASN A 1 151 ? 41.223 -41.533 -20.382 1.00 29.68 ? 359  ASN A CB  1 
ATOM   951  C CG  . ASN A 1 151 ? 42.012 -42.722 -19.940 1.00 34.36 ? 359  ASN A CG  1 
ATOM   952  O OD1 . ASN A 1 151 ? 43.185 -42.600 -19.577 1.00 40.24 ? 359  ASN A OD1 1 
ATOM   953  N ND2 . ASN A 1 151 ? 41.378 -43.892 -19.954 1.00 35.73 ? 359  ASN A ND2 1 
ATOM   954  N N   . TYR A 1 152 ? 44.098 -40.744 -21.889 1.00 27.51 ? 360  TYR A N   1 
ATOM   955  C CA  . TYR A 1 152 ? 44.860 -40.894 -23.133 1.00 28.54 ? 360  TYR A CA  1 
ATOM   956  C C   . TYR A 1 152 ? 45.244 -42.369 -23.143 1.00 29.25 ? 360  TYR A C   1 
ATOM   957  O O   . TYR A 1 152 ? 45.871 -42.893 -22.207 1.00 27.67 ? 360  TYR A O   1 
ATOM   958  C CB  . TYR A 1 152 ? 46.091 -39.969 -23.192 1.00 24.35 ? 360  TYR A CB  1 
ATOM   959  C CG  . TYR A 1 152 ? 45.720 -38.501 -23.324 1.00 25.47 ? 360  TYR A CG  1 
ATOM   960  C CD1 . TYR A 1 152 ? 45.464 -37.713 -22.194 1.00 23.20 ? 360  TYR A CD1 1 
ATOM   961  C CD2 . TYR A 1 152 ? 45.655 -37.892 -24.576 1.00 19.24 ? 360  TYR A CD2 1 
ATOM   962  C CE1 . TYR A 1 152 ? 45.169 -36.348 -22.320 1.00 23.74 ? 360  TYR A CE1 1 
ATOM   963  C CE2 . TYR A 1 152 ? 45.358 -36.553 -24.710 1.00 24.91 ? 360  TYR A CE2 1 
ATOM   964  C CZ  . TYR A 1 152 ? 45.119 -35.783 -23.579 1.00 23.95 ? 360  TYR A CZ  1 
ATOM   965  O OH  . TYR A 1 152 ? 44.849 -34.454 -23.729 1.00 26.52 ? 360  TYR A OH  1 
ATOM   966  N N   . VAL A 1 153 ? 44.842 -43.026 -24.220 1.00 27.70 ? 361  VAL A N   1 
ATOM   967  C CA  . VAL A 1 153 ? 44.997 -44.454 -24.385 1.00 31.50 ? 361  VAL A CA  1 
ATOM   968  C C   . VAL A 1 153 ? 45.790 -44.869 -25.634 1.00 35.96 ? 361  VAL A C   1 
ATOM   969  O O   . VAL A 1 153 ? 45.914 -44.105 -26.593 1.00 32.42 ? 361  VAL A O   1 
ATOM   970  C CB  . VAL A 1 153 ? 43.562 -45.072 -24.428 1.00 35.73 ? 361  VAL A CB  1 
ATOM   971  C CG1 . VAL A 1 153 ? 43.614 -46.558 -24.750 1.00 40.57 ? 361  VAL A CG1 1 
ATOM   972  C CG2 . VAL A 1 153 ? 42.847 -44.818 -23.066 1.00 33.53 ? 361  VAL A CG2 1 
ATOM   973  N N   . VAL A 1 154 ? 46.341 -46.080 -25.605 1.00 39.05 ? 362  VAL A N   1 
ATOM   974  C CA  . VAL A 1 154 ? 47.080 -46.612 -26.757 1.00 43.62 ? 362  VAL A CA  1 
ATOM   975  C C   . VAL A 1 154 ? 46.073 -47.226 -27.718 1.00 46.83 ? 362  VAL A C   1 
ATOM   976  O O   . VAL A 1 154 ? 45.280 -48.071 -27.320 1.00 49.36 ? 362  VAL A O   1 
ATOM   977  C CB  . VAL A 1 154 ? 48.064 -47.713 -26.345 1.00 42.05 ? 362  VAL A CB  1 
ATOM   978  C CG1 . VAL A 1 154 ? 48.596 -48.413 -27.584 1.00 43.19 ? 362  VAL A CG1 1 
ATOM   979  C CG2 . VAL A 1 154 ? 49.207 -47.110 -25.554 1.00 42.29 ? 362  VAL A CG2 1 
ATOM   980  N N   . SER A 1 155 ? 46.105 -46.810 -28.979 1.00 52.38 ? 363  SER A N   1 
ATOM   981  C CA  . SER A 1 155 ? 45.162 -47.331 -29.975 1.00 59.95 ? 363  SER A CA  1 
ATOM   982  C C   . SER A 1 155 ? 45.258 -48.843 -30.213 1.00 59.63 ? 363  SER A C   1 
ATOM   983  O O   . SER A 1 155 ? 46.348 -49.397 -30.371 1.00 61.59 ? 363  SER A O   1 
ATOM   984  C CB  . SER A 1 155 ? 45.338 -46.582 -31.305 1.00 61.22 ? 363  SER A CB  1 
ATOM   985  O OG  . SER A 1 155 ? 46.710 -46.442 -31.647 1.00 65.40 ? 363  SER A OG  1 
ATOM   986  N N   . HIS A 1 188 ? 20.789 -47.647 -5.788  1.00 69.87 ? 396  HIS A N   1 
ATOM   987  C CA  . HIS A 1 188 ? 20.469 -46.532 -4.897  1.00 70.20 ? 396  HIS A CA  1 
ATOM   988  C C   . HIS A 1 188 ? 21.703 -45.756 -4.453  1.00 69.01 ? 396  HIS A C   1 
ATOM   989  O O   . HIS A 1 188 ? 21.737 -44.529 -4.544  1.00 67.85 ? 396  HIS A O   1 
ATOM   990  C CB  . HIS A 1 188 ? 19.746 -47.015 -3.639  1.00 71.68 ? 396  HIS A CB  1 
ATOM   991  C CG  . HIS A 1 188 ? 19.716 -45.989 -2.547  1.00 73.96 ? 396  HIS A CG  1 
ATOM   992  N ND1 . HIS A 1 188 ? 18.910 -44.871 -2.599  1.00 74.41 ? 396  HIS A ND1 1 
ATOM   993  C CD2 . HIS A 1 188 ? 20.460 -45.863 -1.422  1.00 73.70 ? 396  HIS A CD2 1 
ATOM   994  C CE1 . HIS A 1 188 ? 19.161 -44.100 -1.556  1.00 74.83 ? 396  HIS A CE1 1 
ATOM   995  N NE2 . HIS A 1 188 ? 20.099 -44.679 -0.827  1.00 74.44 ? 396  HIS A NE2 1 
ATOM   996  N N   . ARG A 1 189 ? 22.695 -46.478 -3.934  1.00 66.99 ? 397  ARG A N   1 
ATOM   997  C CA  . ARG A 1 189 ? 23.934 -45.860 -3.468  1.00 64.10 ? 397  ARG A CA  1 
ATOM   998  C C   . ARG A 1 189 ? 24.635 -45.187 -4.643  1.00 59.59 ? 397  ARG A C   1 
ATOM   999  O O   . ARG A 1 189 ? 25.547 -44.378 -4.451  1.00 56.35 ? 397  ARG A O   1 
ATOM   1000 C CB  . ARG A 1 189 ? 24.865 -46.917 -2.868  1.00 68.27 ? 397  ARG A CB  1 
ATOM   1001 C CG  . ARG A 1 189 ? 25.350 -47.948 -3.878  1.00 74.33 ? 397  ARG A CG  1 
ATOM   1002 C CD  . ARG A 1 189 ? 26.371 -48.903 -3.268  1.00 80.11 ? 397  ARG A CD  1 
ATOM   1003 N NE  . ARG A 1 189 ? 26.912 -49.826 -4.267  1.00 84.92 ? 397  ARG A NE  1 
ATOM   1004 C CZ  . ARG A 1 189 ? 27.898 -50.691 -4.038  1.00 86.83 ? 397  ARG A CZ  1 
ATOM   1005 N NH1 . ARG A 1 189 ? 28.462 -50.760 -2.838  1.00 88.04 ? 397  ARG A NH1 1 
ATOM   1006 N NH2 . ARG A 1 189 ? 28.326 -51.483 -5.014  1.00 87.29 ? 397  ARG A NH2 1 
ATOM   1007 N N   . GLU A 1 190 ? 24.186 -45.526 -5.853  1.00 53.97 ? 398  GLU A N   1 
ATOM   1008 C CA  . GLU A 1 190 ? 24.756 -44.991 -7.073  1.00 50.88 ? 398  GLU A CA  1 
ATOM   1009 C C   . GLU A 1 190 ? 23.989 -43.849 -7.743  1.00 44.32 ? 398  GLU A C   1 
ATOM   1010 O O   . GLU A 1 190 ? 24.305 -43.486 -8.866  1.00 41.90 ? 398  GLU A O   1 
ATOM   1011 C CB  . GLU A 1 190 ? 24.982 -46.121 -8.080  1.00 54.53 ? 398  GLU A CB  1 
ATOM   1012 C CG  . GLU A 1 190 ? 23.732 -46.832 -8.522  1.00 62.07 ? 398  GLU A CG  1 
ATOM   1013 C CD  . GLU A 1 190 ? 24.037 -48.012 -9.440  1.00 67.66 ? 398  GLU A CD  1 
ATOM   1014 O OE1 . GLU A 1 190 ? 24.808 -47.838 -10.421 1.00 67.46 ? 398  GLU A OE1 1 
ATOM   1015 O OE2 . GLU A 1 190 ? 23.497 -49.114 -9.183  1.00 67.92 ? 398  GLU A OE2 1 
ATOM   1016 N N   . ALA A 1 191 ? 22.997 -43.281 -7.062  1.00 38.11 ? 399  ALA A N   1 
ATOM   1017 C CA  . ALA A 1 191 ? 22.234 -42.159 -7.621  1.00 34.63 ? 399  ALA A CA  1 
ATOM   1018 C C   . ALA A 1 191 ? 23.047 -40.867 -7.504  1.00 32.06 ? 399  ALA A C   1 
ATOM   1019 O O   . ALA A 1 191 ? 23.989 -40.796 -6.721  1.00 31.13 ? 399  ALA A O   1 
ATOM   1020 C CB  . ALA A 1 191 ? 20.884 -41.987 -6.873  1.00 30.66 ? 399  ALA A CB  1 
ATOM   1021 N N   . ASP A 1 192 ? 22.692 -39.862 -8.303  1.00 28.01 ? 400  ASP A N   1 
ATOM   1022 C CA  . ASP A 1 192 ? 23.336 -38.555 -8.250  1.00 26.70 ? 400  ASP A CA  1 
ATOM   1023 C C   . ASP A 1 192 ? 24.803 -38.459 -8.734  1.00 28.35 ? 400  ASP A C   1 
ATOM   1024 O O   . ASP A 1 192 ? 25.534 -37.525 -8.349  1.00 26.04 ? 400  ASP A O   1 
ATOM   1025 C CB  . ASP A 1 192 ? 23.211 -38.009 -6.826  1.00 28.33 ? 400  ASP A CB  1 
ATOM   1026 C CG  . ASP A 1 192 ? 21.797 -38.184 -6.257  1.00 29.87 ? 400  ASP A CG  1 
ATOM   1027 O OD1 . ASP A 1 192 ? 21.688 -38.742 -5.159  1.00 29.89 ? 400  ASP A OD1 1 
ATOM   1028 O OD2 . ASP A 1 192 ? 20.808 -37.772 -6.906  1.00 31.93 ? 400  ASP A OD2 1 
ATOM   1029 N N   . PHE A 1 193 ? 25.220 -39.417 -9.561  1.00 27.37 ? 401  PHE A N   1 
ATOM   1030 C CA  . PHE A 1 193 ? 26.562 -39.413 -10.162 1.00 29.23 ? 401  PHE A CA  1 
ATOM   1031 C C   . PHE A 1 193 ? 26.434 -38.891 -11.600 1.00 31.40 ? 401  PHE A C   1 
ATOM   1032 O O   . PHE A 1 193 ? 25.415 -39.124 -12.267 1.00 31.35 ? 401  PHE A O   1 
ATOM   1033 C CB  . PHE A 1 193 ? 27.160 -40.831 -10.213 1.00 28.42 ? 401  PHE A CB  1 
ATOM   1034 C CG  . PHE A 1 193 ? 27.964 -41.209 -8.988  1.00 32.88 ? 401  PHE A CG  1 
ATOM   1035 C CD1 . PHE A 1 193 ? 29.321 -40.887 -8.899  1.00 32.69 ? 401  PHE A CD1 1 
ATOM   1036 C CD2 . PHE A 1 193 ? 27.373 -41.902 -7.934  1.00 31.90 ? 401  PHE A CD2 1 
ATOM   1037 C CE1 . PHE A 1 193 ? 30.078 -41.256 -7.775  1.00 33.00 ? 401  PHE A CE1 1 
ATOM   1038 C CE2 . PHE A 1 193 ? 28.118 -42.281 -6.798  1.00 33.89 ? 401  PHE A CE2 1 
ATOM   1039 C CZ  . PHE A 1 193 ? 29.475 -41.959 -6.719  1.00 30.48 ? 401  PHE A CZ  1 
ATOM   1040 N N   . PHE A 1 194 ? 27.457 -38.167 -12.051 1.00 29.80 ? 402  PHE A N   1 
ATOM   1041 C CA  . PHE A 1 194 ? 27.550 -37.631 -13.409 1.00 30.28 ? 402  PHE A CA  1 
ATOM   1042 C C   . PHE A 1 194 ? 28.988 -38.018 -13.786 1.00 31.60 ? 402  PHE A C   1 
ATOM   1043 O O   . PHE A 1 194 ? 29.966 -37.600 -13.140 1.00 26.95 ? 402  PHE A O   1 
ATOM   1044 C CB  . PHE A 1 194 ? 27.379 -36.116 -13.439 1.00 29.29 ? 402  PHE A CB  1 
ATOM   1045 C CG  . PHE A 1 194 ? 27.371 -35.533 -14.833 1.00 31.92 ? 402  PHE A CG  1 
ATOM   1046 C CD1 . PHE A 1 194 ? 26.180 -35.370 -15.530 1.00 33.39 ? 402  PHE A CD1 1 
ATOM   1047 C CD2 . PHE A 1 194 ? 28.558 -35.145 -15.448 1.00 32.73 ? 402  PHE A CD2 1 
ATOM   1048 C CE1 . PHE A 1 194 ? 26.171 -34.822 -16.832 1.00 34.85 ? 402  PHE A CE1 1 
ATOM   1049 C CE2 . PHE A 1 194 ? 28.556 -34.602 -16.740 1.00 28.48 ? 402  PHE A CE2 1 
ATOM   1050 C CZ  . PHE A 1 194 ? 27.359 -34.442 -17.427 1.00 29.76 ? 402  PHE A CZ  1 
ATOM   1051 N N   . TRP A 1 195 ? 29.099 -38.813 -14.839 1.00 27.52 ? 403  TRP A N   1 
ATOM   1052 C CA  . TRP A 1 195 ? 30.368 -39.360 -15.264 1.00 26.38 ? 403  TRP A CA  1 
ATOM   1053 C C   . TRP A 1 195 ? 30.645 -39.118 -16.745 1.00 27.18 ? 403  TRP A C   1 
ATOM   1054 O O   . TRP A 1 195 ? 30.091 -39.794 -17.621 1.00 23.73 ? 403  TRP A O   1 
ATOM   1055 C CB  . TRP A 1 195 ? 30.317 -40.851 -14.960 1.00 32.84 ? 403  TRP A CB  1 
ATOM   1056 C CG  . TRP A 1 195 ? 31.567 -41.568 -15.117 1.00 37.87 ? 403  TRP A CG  1 
ATOM   1057 C CD1 . TRP A 1 195 ? 32.018 -42.201 -16.240 1.00 41.15 ? 403  TRP A CD1 1 
ATOM   1058 C CD2 . TRP A 1 195 ? 32.569 -41.750 -14.115 1.00 40.76 ? 403  TRP A CD2 1 
ATOM   1059 N NE1 . TRP A 1 195 ? 33.250 -42.769 -15.999 1.00 42.78 ? 403  TRP A NE1 1 
ATOM   1060 C CE2 . TRP A 1 195 ? 33.611 -42.506 -14.700 1.00 45.71 ? 403  TRP A CE2 1 
ATOM   1061 C CE3 . TRP A 1 195 ? 32.691 -41.348 -12.782 1.00 40.76 ? 403  TRP A CE3 1 
ATOM   1062 C CZ2 . TRP A 1 195 ? 34.767 -42.869 -13.985 1.00 47.24 ? 403  TRP A CZ2 1 
ATOM   1063 C CZ3 . TRP A 1 195 ? 33.840 -41.707 -12.073 1.00 41.55 ? 403  TRP A CZ3 1 
ATOM   1064 C CH2 . TRP A 1 195 ? 34.858 -42.458 -12.676 1.00 45.25 ? 403  TRP A CH2 1 
ATOM   1065 N N   . SER A 1 196 ? 31.490 -38.132 -17.015 1.00 23.02 ? 404  SER A N   1 
ATOM   1066 C CA  . SER A 1 196 ? 31.864 -37.788 -18.374 1.00 20.96 ? 404  SER A CA  1 
ATOM   1067 C C   . SER A 1 196 ? 33.305 -38.237 -18.605 1.00 24.20 ? 404  SER A C   1 
ATOM   1068 O O   . SER A 1 196 ? 34.232 -37.758 -17.949 1.00 23.12 ? 404  SER A O   1 
ATOM   1069 C CB  . SER A 1 196 ? 31.757 -36.277 -18.586 1.00 17.49 ? 404  SER A CB  1 
ATOM   1070 O OG  . SER A 1 196 ? 32.244 -35.934 -19.884 1.00 25.15 ? 404  SER A OG  1 
ATOM   1071 N N   . LEU A 1 197 ? 33.493 -39.141 -19.550 1.00 25.37 ? 405  LEU A N   1 
ATOM   1072 C CA  . LEU A 1 197 ? 34.813 -39.665 -19.848 1.00 24.07 ? 405  LEU A CA  1 
ATOM   1073 C C   . LEU A 1 197 ? 35.224 -39.436 -21.303 1.00 28.92 ? 405  LEU A C   1 
ATOM   1074 O O   . LEU A 1 197 ? 34.533 -39.876 -22.232 1.00 24.25 ? 405  LEU A O   1 
ATOM   1075 C CB  . LEU A 1 197 ? 34.844 -41.168 -19.550 1.00 25.39 ? 405  LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 197 ? 36.054 -41.938 -20.084 1.00 30.92 ? 405  LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 197 ? 37.324 -41.515 -19.337 1.00 29.60 ? 405  LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 197 ? 35.806 -43.443 -19.917 1.00 32.78 ? 405  LEU A CD2 1 
ATOM   1079 N N   . CYS A 1 198 ? 36.352 -38.754 -21.505 1.00 23.81 ? 406  CYS A N   1 
ATOM   1080 C CA  . CYS A 1 198 ? 36.837 -38.528 -22.853 1.00 23.45 ? 406  CYS A CA  1 
ATOM   1081 C C   . CYS A 1 198 ? 38.088 -39.369 -23.045 1.00 23.81 ? 406  CYS A C   1 
ATOM   1082 O O   . CYS A 1 198 ? 39.002 -39.355 -22.216 1.00 21.63 ? 406  CYS A O   1 
ATOM   1083 C CB  . CYS A 1 198 ? 37.171 -37.051 -23.101 1.00 22.05 ? 406  CYS A CB  1 
ATOM   1084 S SG  . CYS A 1 198 ? 37.711 -36.699 -24.805 1.00 25.31 ? 406  CYS A SG  1 
ATOM   1085 N N   . THR A 1 199 ? 38.118 -40.121 -24.133 1.00 22.44 ? 407  THR A N   1 
ATOM   1086 C CA  . THR A 1 199 ? 39.279 -40.934 -24.438 1.00 26.00 ? 407  THR A CA  1 
ATOM   1087 C C   . THR A 1 199 ? 39.927 -40.375 -25.709 1.00 26.27 ? 407  THR A C   1 
ATOM   1088 O O   . THR A 1 199 ? 39.227 -39.993 -26.658 1.00 25.15 ? 407  THR A O   1 
ATOM   1089 C CB  . THR A 1 199 ? 38.873 -42.402 -24.651 1.00 29.82 ? 407  THR A CB  1 
ATOM   1090 O OG1 . THR A 1 199 ? 38.359 -42.937 -23.415 1.00 30.27 ? 407  THR A OG1 1 
ATOM   1091 C CG2 . THR A 1 199 ? 40.075 -43.213 -25.081 1.00 31.16 ? 407  THR A CG2 1 
ATOM   1092 N N   . ALA A 1 200 ? 41.252 -40.285 -25.718 1.00 26.68 ? 408  ALA A N   1 
ATOM   1093 C CA  . ALA A 1 200 ? 41.960 -39.781 -26.899 1.00 28.13 ? 408  ALA A CA  1 
ATOM   1094 C C   . ALA A 1 200 ? 43.229 -40.602 -27.099 1.00 27.26 ? 408  ALA A C   1 
ATOM   1095 O O   . ALA A 1 200 ? 43.698 -41.280 -26.187 1.00 24.38 ? 408  ALA A O   1 
ATOM   1096 C CB  . ALA A 1 200 ? 42.295 -38.291 -26.749 1.00 28.07 ? 408  ALA A CB  1 
ATOM   1097 N N   . ASP A 1 201 ? 43.780 -40.551 -28.301 1.00 28.44 ? 409  ASP A N   1 
ATOM   1098 C CA  . ASP A 1 201 ? 44.960 -41.342 -28.597 1.00 27.50 ? 409  ASP A CA  1 
ATOM   1099 C C   . ASP A 1 201 ? 46.212 -40.796 -27.932 1.00 28.12 ? 409  ASP A C   1 
ATOM   1100 O O   . ASP A 1 201 ? 46.469 -39.591 -27.923 1.00 27.77 ? 409  ASP A O   1 
ATOM   1101 C CB  . ASP A 1 201 ? 45.177 -41.429 -30.111 1.00 34.05 ? 409  ASP A CB  1 
ATOM   1102 C CG  . ASP A 1 201 ? 46.244 -42.465 -30.491 1.00 37.44 ? 409  ASP A CG  1 
ATOM   1103 O OD1 . ASP A 1 201 ? 47.422 -42.284 -30.133 1.00 39.10 ? 409  ASP A OD1 1 
ATOM   1104 O OD2 . ASP A 1 201 ? 45.895 -43.465 -31.137 1.00 42.05 ? 409  ASP A OD2 1 
ATOM   1105 N N   . MET A 1 202 ? 46.977 -41.718 -27.370 1.00 29.08 ? 410  MET A N   1 
ATOM   1106 C CA  . MET A 1 202 ? 48.229 -41.436 -26.686 1.00 33.24 ? 410  MET A CA  1 
ATOM   1107 C C   . MET A 1 202 ? 49.229 -40.663 -27.565 1.00 31.99 ? 410  MET A C   1 
ATOM   1108 O O   . MET A 1 202 ? 50.067 -39.913 -27.056 1.00 29.86 ? 410  MET A O   1 
ATOM   1109 C CB  . MET A 1 202 ? 48.851 -42.764 -26.272 1.00 37.71 ? 410  MET A CB  1 
ATOM   1110 C CG  . MET A 1 202 ? 50.047 -42.614 -25.421 1.00 41.69 ? 410  MET A CG  1 
ATOM   1111 S SD  . MET A 1 202 ? 49.426 -42.401 -23.786 1.00 50.68 ? 410  MET A SD  1 
ATOM   1112 C CE  . MET A 1 202 ? 49.270 -44.183 -23.281 1.00 41.25 ? 410  MET A CE  1 
ATOM   1113 N N   . SER A 1 203 ? 49.142 -40.851 -28.883 1.00 32.47 ? 411  SER A N   1 
ATOM   1114 C CA  . SER A 1 203 ? 50.056 -40.168 -29.797 1.00 34.38 ? 411  SER A CA  1 
ATOM   1115 C C   . SER A 1 203 ? 49.966 -38.651 -29.649 1.00 32.70 ? 411  SER A C   1 
ATOM   1116 O O   . SER A 1 203 ? 50.938 -37.955 -29.901 1.00 37.13 ? 411  SER A O   1 
ATOM   1117 C CB  . SER A 1 203 ? 49.794 -40.592 -31.254 1.00 30.68 ? 411  SER A CB  1 
ATOM   1118 O OG  . SER A 1 203 ? 48.505 -40.227 -31.716 1.00 39.77 ? 411  SER A OG  1 
ATOM   1119 N N   . LEU A 1 204 ? 48.813 -38.135 -29.221 1.00 34.37 ? 412  LEU A N   1 
ATOM   1120 C CA  . LEU A 1 204 ? 48.652 -36.685 -29.022 1.00 31.05 ? 412  LEU A CA  1 
ATOM   1121 C C   . LEU A 1 204 ? 49.621 -36.126 -27.968 1.00 33.86 ? 412  LEU A C   1 
ATOM   1122 O O   . LEU A 1 204 ? 50.032 -34.966 -28.033 1.00 35.84 ? 412  LEU A O   1 
ATOM   1123 C CB  . LEU A 1 204 ? 47.218 -36.367 -28.596 1.00 33.43 ? 412  LEU A CB  1 
ATOM   1124 C CG  . LEU A 1 204 ? 46.155 -36.435 -29.693 1.00 32.99 ? 412  LEU A CG  1 
ATOM   1125 C CD1 . LEU A 1 204 ? 44.776 -36.298 -29.094 1.00 33.28 ? 412  LEU A CD1 1 
ATOM   1126 C CD2 . LEU A 1 204 ? 46.406 -35.302 -30.697 1.00 33.82 ? 412  LEU A CD2 1 
ATOM   1127 N N   . LEU A 1 205 ? 49.986 -36.951 -26.995 1.00 32.04 ? 413  LEU A N   1 
ATOM   1128 C CA  . LEU A 1 205 ? 50.882 -36.519 -25.937 1.00 34.89 ? 413  LEU A CA  1 
ATOM   1129 C C   . LEU A 1 205 ? 52.334 -36.512 -26.385 1.00 37.52 ? 413  LEU A C   1 
ATOM   1130 O O   . LEU A 1 205 ? 53.151 -35.737 -25.870 1.00 35.25 ? 413  LEU A O   1 
ATOM   1131 C CB  . LEU A 1 205 ? 50.743 -37.432 -24.715 1.00 32.13 ? 413  LEU A CB  1 
ATOM   1132 C CG  . LEU A 1 205 ? 49.363 -37.438 -24.060 1.00 32.73 ? 413  LEU A CG  1 
ATOM   1133 C CD1 . LEU A 1 205 ? 49.426 -38.247 -22.755 1.00 29.82 ? 413  LEU A CD1 1 
ATOM   1134 C CD2 . LEU A 1 205 ? 48.936 -35.998 -23.794 1.00 29.14 ? 413  LEU A CD2 1 
ATOM   1135 N N   . GLU A 1 206 ? 52.649 -37.397 -27.323 1.00 38.14 ? 414  GLU A N   1 
ATOM   1136 C CA  . GLU A 1 206 ? 53.996 -37.502 -27.865 1.00 43.22 ? 414  GLU A CA  1 
ATOM   1137 C C   . GLU A 1 206 ? 54.230 -36.244 -28.684 1.00 41.22 ? 414  GLU A C   1 
ATOM   1138 O O   . GLU A 1 206 ? 55.308 -35.666 -28.683 1.00 40.00 ? 414  GLU A O   1 
ATOM   1139 C CB  . GLU A 1 206 ? 54.102 -38.742 -28.757 1.00 45.73 ? 414  GLU A CB  1 
ATOM   1140 C CG  . GLU A 1 206 ? 54.075 -40.050 -27.975 1.00 56.17 ? 414  GLU A CG  1 
ATOM   1141 C CD  . GLU A 1 206 ? 53.766 -41.264 -28.850 1.00 63.04 ? 414  GLU A CD  1 
ATOM   1142 O OE1 . GLU A 1 206 ? 54.199 -41.276 -30.031 1.00 64.69 ? 414  GLU A OE1 1 
ATOM   1143 O OE2 . GLU A 1 206 ? 53.098 -42.208 -28.349 1.00 62.79 ? 414  GLU A OE2 1 
ATOM   1144 N N   . GLN A 1 207 ? 53.188 -35.824 -29.378 1.00 39.80 ? 415  GLN A N   1 
ATOM   1145 C CA  . GLN A 1 207 ? 53.244 -34.629 -30.202 1.00 41.67 ? 415  GLN A CA  1 
ATOM   1146 C C   . GLN A 1 207 ? 53.330 -33.358 -29.340 1.00 41.83 ? 415  GLN A C   1 
ATOM   1147 O O   . GLN A 1 207 ? 54.174 -32.501 -29.570 1.00 40.08 ? 415  GLN A O   1 
ATOM   1148 C CB  . GLN A 1 207 ? 51.995 -34.593 -31.065 1.00 43.44 ? 415  GLN A CB  1 
ATOM   1149 C CG  . GLN A 1 207 ? 51.857 -33.382 -31.933 1.00 46.48 ? 415  GLN A CG  1 
ATOM   1150 C CD  . GLN A 1 207 ? 50.613 -33.470 -32.798 1.00 47.36 ? 415  GLN A CD  1 
ATOM   1151 O OE1 . GLN A 1 207 ? 49.507 -33.704 -32.299 1.00 45.98 ? 415  GLN A OE1 1 
ATOM   1152 N NE2 . GLN A 1 207 ? 50.785 -33.278 -34.100 1.00 46.17 ? 415  GLN A NE2 1 
ATOM   1153 N N   . SER A 1 208 ? 52.447 -33.238 -28.350 1.00 38.49 ? 416  SER A N   1 
ATOM   1154 C CA  . SER A 1 208 ? 52.452 -32.064 -27.468 1.00 38.42 ? 416  SER A CA  1 
ATOM   1155 C C   . SER A 1 208 ? 51.714 -32.391 -26.176 1.00 34.86 ? 416  SER A C   1 
ATOM   1156 O O   . SER A 1 208 ? 50.490 -32.328 -26.116 1.00 41.30 ? 416  SER A O   1 
ATOM   1157 C CB  . SER A 1 208 ? 51.776 -30.867 -28.157 1.00 35.22 ? 416  SER A CB  1 
ATOM   1158 O OG  . SER A 1 208 ? 51.712 -29.761 -27.271 1.00 35.46 ? 416  SER A OG  1 
ATOM   1159 N N   . HIS A 1 209 ? 52.453 -32.731 -25.136 1.00 32.03 ? 417  HIS A N   1 
ATOM   1160 C CA  . HIS A 1 209 ? 51.819 -33.088 -23.882 1.00 37.34 ? 417  HIS A CA  1 
ATOM   1161 C C   . HIS A 1 209 ? 51.352 -31.860 -23.070 1.00 36.76 ? 417  HIS A C   1 
ATOM   1162 O O   . HIS A 1 209 ? 50.681 -32.004 -22.048 1.00 38.93 ? 417  HIS A O   1 
ATOM   1163 C CB  . HIS A 1 209 ? 52.778 -33.969 -23.062 1.00 41.01 ? 417  HIS A CB  1 
ATOM   1164 C CG  . HIS A 1 209 ? 53.874 -33.205 -22.395 1.00 46.97 ? 417  HIS A CG  1 
ATOM   1165 N ND1 . HIS A 1 209 ? 53.751 -32.690 -21.121 1.00 52.71 ? 417  HIS A ND1 1 
ATOM   1166 C CD2 . HIS A 1 209 ? 55.096 -32.827 -22.838 1.00 49.32 ? 417  HIS A CD2 1 
ATOM   1167 C CE1 . HIS A 1 209 ? 54.851 -32.028 -20.808 1.00 51.90 ? 417  HIS A CE1 1 
ATOM   1168 N NE2 . HIS A 1 209 ? 55.683 -32.095 -21.833 1.00 52.08 ? 417  HIS A NE2 1 
ATOM   1169 N N   . SER A 1 210 ? 51.681 -30.651 -23.522 1.00 34.12 ? 418  SER A N   1 
ATOM   1170 C CA  . SER A 1 210 ? 51.253 -29.462 -22.787 1.00 35.38 ? 418  SER A CA  1 
ATOM   1171 C C   . SER A 1 210 ? 50.037 -28.791 -23.423 1.00 30.00 ? 418  SER A C   1 
ATOM   1172 O O   . SER A 1 210 ? 49.514 -27.821 -22.891 1.00 29.41 ? 418  SER A O   1 
ATOM   1173 C CB  . SER A 1 210 ? 52.402 -28.450 -22.672 1.00 37.37 ? 418  SER A CB  1 
ATOM   1174 O OG  . SER A 1 210 ? 52.755 -27.956 -23.955 1.00 49.55 ? 418  SER A OG  1 
ATOM   1175 N N   . SER A 1 211 ? 49.577 -29.309 -24.557 1.00 29.62 ? 419  SER A N   1 
ATOM   1176 C CA  . SER A 1 211 ? 48.413 -28.726 -25.218 1.00 27.09 ? 419  SER A CA  1 
ATOM   1177 C C   . SER A 1 211 ? 47.112 -29.352 -24.670 1.00 25.22 ? 419  SER A C   1 
ATOM   1178 O O   . SER A 1 211 ? 46.938 -30.567 -24.714 1.00 24.29 ? 419  SER A O   1 
ATOM   1179 C CB  . SER A 1 211 ? 48.500 -28.941 -26.735 1.00 25.47 ? 419  SER A CB  1 
ATOM   1180 O OG  . SER A 1 211 ? 49.657 -28.302 -27.277 1.00 25.43 ? 419  SER A OG  1 
ATOM   1181 N N   . PRO A 1 212 ? 46.187 -28.521 -24.138 1.00 23.37 ? 420  PRO A N   1 
ATOM   1182 C CA  . PRO A 1 212 ? 44.920 -29.058 -23.596 1.00 23.55 ? 420  PRO A CA  1 
ATOM   1183 C C   . PRO A 1 212 ? 44.052 -29.733 -24.646 1.00 23.03 ? 420  PRO A C   1 
ATOM   1184 O O   . PRO A 1 212 ? 43.928 -29.246 -25.779 1.00 22.61 ? 420  PRO A O   1 
ATOM   1185 C CB  . PRO A 1 212 ? 44.216 -27.820 -23.026 1.00 26.24 ? 420  PRO A CB  1 
ATOM   1186 C CG  . PRO A 1 212 ? 44.757 -26.680 -23.916 1.00 22.78 ? 420  PRO A CG  1 
ATOM   1187 C CD  . PRO A 1 212 ? 46.236 -27.054 -24.014 1.00 18.46 ? 420  PRO A CD  1 
ATOM   1188 N N   . SER A 1 213 ? 43.419 -30.840 -24.273 1.00 22.52 ? 421  SER A N   1 
ATOM   1189 C CA  . SER A 1 213 ? 42.540 -31.504 -25.230 1.00 25.40 ? 421  SER A CA  1 
ATOM   1190 C C   . SER A 1 213 ? 41.379 -30.561 -25.534 1.00 25.93 ? 421  SER A C   1 
ATOM   1191 O O   . SER A 1 213 ? 41.071 -29.654 -24.748 1.00 23.55 ? 421  SER A O   1 
ATOM   1192 C CB  . SER A 1 213 ? 41.985 -32.811 -24.655 1.00 29.60 ? 421  SER A CB  1 
ATOM   1193 O OG  . SER A 1 213 ? 41.040 -32.557 -23.631 1.00 26.63 ? 421  SER A OG  1 
ATOM   1194 N N   . LEU A 1 214 ? 40.738 -30.778 -26.676 1.00 23.96 ? 422  LEU A N   1 
ATOM   1195 C CA  . LEU A 1 214 ? 39.595 -29.980 -27.067 1.00 25.03 ? 422  LEU A CA  1 
ATOM   1196 C C   . LEU A 1 214 ? 38.439 -30.228 -26.104 1.00 21.52 ? 422  LEU A C   1 
ATOM   1197 O O   . LEU A 1 214 ? 37.607 -29.353 -25.878 1.00 25.15 ? 422  LEU A O   1 
ATOM   1198 C CB  . LEU A 1 214 ? 39.124 -30.352 -28.472 1.00 26.26 ? 422  LEU A CB  1 
ATOM   1199 C CG  . LEU A 1 214 ? 39.343 -29.394 -29.626 1.00 34.60 ? 422  LEU A CG  1 
ATOM   1200 C CD1 . LEU A 1 214 ? 38.353 -29.814 -30.728 1.00 38.08 ? 422  LEU A CD1 1 
ATOM   1201 C CD2 . LEU A 1 214 ? 39.105 -27.939 -29.216 1.00 33.71 ? 422  LEU A CD2 1 
ATOM   1202 N N   . TYR A 1 215 ? 38.367 -31.441 -25.568 1.00 24.88 ? 423  TYR A N   1 
ATOM   1203 C CA  . TYR A 1 215 ? 37.309 -31.781 -24.619 1.00 24.43 ? 423  TYR A CA  1 
ATOM   1204 C C   . TYR A 1 215 ? 37.402 -30.838 -23.421 1.00 21.02 ? 423  TYR A C   1 
ATOM   1205 O O   . TYR A 1 215 ? 36.415 -30.208 -23.055 1.00 22.09 ? 423  TYR A O   1 
ATOM   1206 C CB  . TYR A 1 215 ? 37.445 -33.242 -24.171 1.00 23.44 ? 423  TYR A CB  1 
ATOM   1207 C CG  . TYR A 1 215 ? 36.666 -33.611 -22.917 1.00 22.58 ? 423  TYR A CG  1 
ATOM   1208 C CD1 . TYR A 1 215 ? 35.272 -33.787 -22.949 1.00 23.12 ? 423  TYR A CD1 1 
ATOM   1209 C CD2 . TYR A 1 215 ? 37.332 -33.838 -21.714 1.00 22.27 ? 423  TYR A CD2 1 
ATOM   1210 C CE1 . TYR A 1 215 ? 34.576 -34.185 -21.808 1.00 19.51 ? 423  TYR A CE1 1 
ATOM   1211 C CE2 . TYR A 1 215 ? 36.657 -34.237 -20.577 1.00 22.03 ? 423  TYR A CE2 1 
ATOM   1212 C CZ  . TYR A 1 215 ? 35.279 -34.410 -20.626 1.00 24.15 ? 423  TYR A CZ  1 
ATOM   1213 O OH  . TYR A 1 215 ? 34.626 -34.815 -19.495 1.00 21.42 ? 423  TYR A OH  1 
ATOM   1214 N N   . LEU A 1 216 ? 38.587 -30.720 -22.822 1.00 22.04 ? 424  LEU A N   1 
ATOM   1215 C CA  . LEU A 1 216 ? 38.753 -29.810 -21.667 1.00 24.62 ? 424  LEU A CA  1 
ATOM   1216 C C   . LEU A 1 216 ? 38.496 -28.353 -22.062 1.00 25.55 ? 424  LEU A C   1 
ATOM   1217 O O   . LEU A 1 216 ? 37.932 -27.575 -21.295 1.00 24.74 ? 424  LEU A O   1 
ATOM   1218 C CB  . LEU A 1 216 ? 40.165 -29.909 -21.071 1.00 22.52 ? 424  LEU A CB  1 
ATOM   1219 C CG  . LEU A 1 216 ? 40.581 -31.280 -20.509 1.00 24.74 ? 424  LEU A CG  1 
ATOM   1220 C CD1 . LEU A 1 216 ? 41.994 -31.157 -19.935 1.00 27.09 ? 424  LEU A CD1 1 
ATOM   1221 C CD2 . LEU A 1 216 ? 39.597 -31.736 -19.396 1.00 21.65 ? 424  LEU A CD2 1 
ATOM   1222 N N   . GLN A 1 217 ? 38.903 -27.973 -23.265 1.00 27.68 ? 425  GLN A N   1 
ATOM   1223 C CA  . GLN A 1 217 ? 38.687 -26.591 -23.687 1.00 26.53 ? 425  GLN A CA  1 
ATOM   1224 C C   . GLN A 1 217 ? 37.199 -26.304 -23.873 1.00 26.62 ? 425  GLN A C   1 
ATOM   1225 O O   . GLN A 1 217 ? 36.693 -25.277 -23.429 1.00 24.91 ? 425  GLN A O   1 
ATOM   1226 C CB  . GLN A 1 217 ? 39.426 -26.310 -24.999 1.00 24.62 ? 425  GLN A CB  1 
ATOM   1227 C CG  . GLN A 1 217 ? 40.946 -26.291 -24.902 1.00 23.28 ? 425  GLN A CG  1 
ATOM   1228 C CD  . GLN A 1 217 ? 41.574 -26.136 -26.284 1.00 26.42 ? 425  GLN A CD  1 
ATOM   1229 O OE1 . GLN A 1 217 ? 41.488 -25.071 -26.878 1.00 24.94 ? 425  GLN A OE1 1 
ATOM   1230 N NE2 . GLN A 1 217 ? 42.172 -27.220 -26.815 1.00 22.81 ? 425  GLN A NE2 1 
ATOM   1231 N N   . CYS A 1 218 ? 36.503 -27.215 -24.549 1.00 27.01 ? 426  CYS A N   1 
ATOM   1232 C CA  . CYS A 1 218 ? 35.076 -27.034 -24.803 1.00 25.20 ? 426  CYS A CA  1 
ATOM   1233 C C   . CYS A 1 218 ? 34.274 -27.033 -23.487 1.00 23.18 ? 426  CYS A C   1 
ATOM   1234 O O   . CYS A 1 218 ? 33.351 -26.244 -23.303 1.00 23.90 ? 426  CYS A O   1 
ATOM   1235 C CB  . CYS A 1 218 ? 34.571 -28.158 -25.724 1.00 28.37 ? 426  CYS A CB  1 
ATOM   1236 S SG  . CYS A 1 218 ? 32.786 -28.062 -26.099 1.00 32.17 ? 426  CYS A SG  1 
ATOM   1237 N N   . LEU A 1 219 ? 34.643 -27.926 -22.580 1.00 23.13 ? 427  LEU A N   1 
ATOM   1238 C CA  . LEU A 1 219 ? 33.977 -28.044 -21.292 1.00 25.71 ? 427  LEU A CA  1 
ATOM   1239 C C   . LEU A 1 219 ? 34.116 -26.740 -20.520 1.00 28.83 ? 427  LEU A C   1 
ATOM   1240 O O   . LEU A 1 219 ? 33.141 -26.222 -19.957 1.00 25.23 ? 427  LEU A O   1 
ATOM   1241 C CB  . LEU A 1 219 ? 34.613 -29.180 -20.527 1.00 27.30 ? 427  LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 219 ? 33.970 -29.672 -19.251 1.00 32.56 ? 427  LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 219 ? 32.519 -30.128 -19.522 1.00 28.29 ? 427  LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 219 ? 34.819 -30.821 -18.746 1.00 27.70 ? 427  LEU A CD2 1 
ATOM   1245 N N   . SER A 1 220 ? 35.340 -26.209 -20.500 1.00 25.83 ? 428  SER A N   1 
ATOM   1246 C CA  . SER A 1 220 ? 35.610 -24.946 -19.835 1.00 25.08 ? 428  SER A CA  1 
ATOM   1247 C C   . SER A 1 220 ? 34.777 -23.839 -20.473 1.00 26.47 ? 428  SER A C   1 
ATOM   1248 O O   . SER A 1 220 ? 34.152 -23.035 -19.774 1.00 30.44 ? 428  SER A O   1 
ATOM   1249 C CB  . SER A 1 220 ? 37.104 -24.597 -19.953 1.00 27.28 ? 428  SER A CB  1 
ATOM   1250 O OG  . SER A 1 220 ? 37.349 -23.235 -19.623 1.00 22.42 ? 428  SER A OG  1 
ATOM   1251 N N   . GLN A 1 221 ? 34.755 -23.792 -21.803 1.00 24.99 ? 429  GLN A N   1 
ATOM   1252 C CA  . GLN A 1 221 ? 34.001 -22.742 -22.510 1.00 27.11 ? 429  GLN A CA  1 
ATOM   1253 C C   . GLN A 1 221 ? 32.498 -22.753 -22.184 1.00 24.99 ? 429  GLN A C   1 
ATOM   1254 O O   . GLN A 1 221 ? 31.905 -21.719 -21.865 1.00 26.22 ? 429  GLN A O   1 
ATOM   1255 C CB  . GLN A 1 221 ? 34.171 -22.905 -24.028 1.00 27.82 ? 429  GLN A CB  1 
ATOM   1256 C CG  . GLN A 1 221 ? 33.537 -21.801 -24.881 1.00 34.53 ? 429  GLN A CG  1 
ATOM   1257 C CD  . GLN A 1 221 ? 33.626 -22.107 -26.393 1.00 41.21 ? 429  GLN A CD  1 
ATOM   1258 O OE1 . GLN A 1 221 ? 34.606 -22.684 -26.876 1.00 40.17 ? 429  GLN A OE1 1 
ATOM   1259 N NE2 . GLN A 1 221 ? 32.602 -21.709 -27.133 1.00 41.81 ? 429  GLN A NE2 1 
ATOM   1260 N N   . LYS A 1 222 ? 31.892 -23.927 -22.297 1.00 23.19 ? 430  LYS A N   1 
ATOM   1261 C CA  . LYS A 1 222 ? 30.466 -24.099 -22.050 1.00 24.68 ? 430  LYS A CA  1 
ATOM   1262 C C   . LYS A 1 222 ? 30.079 -23.739 -20.621 1.00 24.71 ? 430  LYS A C   1 
ATOM   1263 O O   . LYS A 1 222 ? 29.179 -22.934 -20.406 1.00 27.19 ? 430  LYS A O   1 
ATOM   1264 C CB  . LYS A 1 222 ? 30.049 -25.553 -22.306 1.00 25.57 ? 430  LYS A CB  1 
ATOM   1265 C CG  . LYS A 1 222 ? 30.229 -26.028 -23.735 1.00 34.52 ? 430  LYS A CG  1 
ATOM   1266 C CD  . LYS A 1 222 ? 29.271 -25.331 -24.650 1.00 34.29 ? 430  LYS A CD  1 
ATOM   1267 C CE  . LYS A 1 222 ? 29.377 -25.860 -26.068 1.00 39.60 ? 430  LYS A CE  1 
ATOM   1268 N NZ  . LYS A 1 222 ? 28.446 -25.084 -26.940 1.00 42.39 ? 430  LYS A NZ  1 
ATOM   1269 N N   . LEU A 1 223 ? 30.753 -24.337 -19.645 1.00 23.39 ? 431  LEU A N   1 
ATOM   1270 C CA  . LEU A 1 223 ? 30.414 -24.070 -18.247 1.00 27.85 ? 431  LEU A CA  1 
ATOM   1271 C C   . LEU A 1 223 ? 30.630 -22.616 -17.871 1.00 31.38 ? 431  LEU A C   1 
ATOM   1272 O O   . LEU A 1 223 ? 29.815 -22.022 -17.160 1.00 31.76 ? 431  LEU A O   1 
ATOM   1273 C CB  . LEU A 1 223 ? 31.210 -24.976 -17.311 1.00 24.61 ? 431  LEU A CB  1 
ATOM   1274 C CG  . LEU A 1 223 ? 30.765 -26.440 -17.373 1.00 28.83 ? 431  LEU A CG  1 
ATOM   1275 C CD1 . LEU A 1 223 ? 31.653 -27.331 -16.502 1.00 29.54 ? 431  LEU A CD1 1 
ATOM   1276 C CD2 . LEU A 1 223 ? 29.325 -26.516 -16.918 1.00 34.84 ? 431  LEU A CD2 1 
ATOM   1277 N N   . ARG A 1 224 ? 31.713 -22.034 -18.373 1.00 32.58 ? 432  ARG A N   1 
ATOM   1278 C CA  . ARG A 1 224 ? 32.018 -20.652 -18.046 1.00 36.17 ? 432  ARG A CA  1 
ATOM   1279 C C   . ARG A 1 224 ? 31.103 -19.668 -18.769 1.00 37.44 ? 432  ARG A C   1 
ATOM   1280 O O   . ARG A 1 224 ? 30.707 -18.660 -18.197 1.00 39.45 ? 432  ARG A O   1 
ATOM   1281 C CB  . ARG A 1 224 ? 33.489 -20.338 -18.367 1.00 36.25 ? 432  ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 224 ? 34.182 -19.505 -17.306 1.00 36.90 ? 432  ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 224 ? 35.594 -19.096 -17.711 1.00 39.05 ? 432  ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 224 ? 36.586 -20.178 -17.712 1.00 36.39 ? 432  ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 224 ? 37.855 -19.986 -18.081 1.00 38.99 ? 432  ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 224 ? 38.246 -18.774 -18.471 1.00 35.23 ? 432  ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 224 ? 38.746 -20.976 -18.041 1.00 34.72 ? 432  ARG A NH2 1 
ATOM   1288 N N   . GLN A 1 225 ? 30.736 -19.959 -20.007 1.00 37.36 ? 433  GLN A N   1 
ATOM   1289 C CA  . GLN A 1 225 ? 29.893 -19.017 -20.736 1.00 42.36 ? 433  GLN A CA  1 
ATOM   1290 C C   . GLN A 1 225 ? 28.400 -19.231 -20.605 1.00 43.29 ? 433  GLN A C   1 
ATOM   1291 O O   . GLN A 1 225 ? 27.623 -18.321 -20.864 1.00 44.41 ? 433  GLN A O   1 
ATOM   1292 C CB  . GLN A 1 225 ? 30.278 -19.008 -22.221 1.00 45.67 ? 433  GLN A CB  1 
ATOM   1293 C CG  . GLN A 1 225 ? 31.794 -18.880 -22.426 1.00 51.78 ? 433  GLN A CG  1 
ATOM   1294 C CD  . GLN A 1 225 ? 32.211 -18.797 -23.884 1.00 56.67 ? 433  GLN A CD  1 
ATOM   1295 O OE1 . GLN A 1 225 ? 31.533 -19.328 -24.776 1.00 54.76 ? 433  GLN A OE1 1 
ATOM   1296 N NE2 . GLN A 1 225 ? 33.352 -18.142 -24.135 1.00 58.22 ? 433  GLN A NE2 1 
ATOM   1297 N N   . GLU A 1 226 ? 27.991 -20.417 -20.174 1.00 43.77 ? 434  GLU A N   1 
ATOM   1298 C CA  . GLU A 1 226 ? 26.569 -20.706 -20.074 1.00 42.84 ? 434  GLU A CA  1 
ATOM   1299 C C   . GLU A 1 226 ? 26.172 -21.402 -18.776 1.00 38.21 ? 434  GLU A C   1 
ATOM   1300 O O   . GLU A 1 226 ? 25.328 -22.292 -18.785 1.00 37.11 ? 434  GLU A O   1 
ATOM   1301 C CB  . GLU A 1 226 ? 26.181 -21.575 -21.267 1.00 46.80 ? 434  GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 226 ? 26.936 -21.198 -22.528 1.00 52.54 ? 434  GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 226 ? 26.441 -21.930 -23.744 1.00 56.13 ? 434  GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 226 ? 25.218 -21.891 -23.993 1.00 59.08 ? 434  GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 226 ? 27.270 -22.535 -24.455 1.00 57.62 ? 434  GLU A OE2 1 
ATOM   1306 N N   . ARG A 1 227 ? 26.753 -20.969 -17.665 1.00 37.74 ? 435  ARG A N   1 
ATOM   1307 C CA  . ARG A 1 227 ? 26.491 -21.583 -16.365 1.00 37.20 ? 435  ARG A CA  1 
ATOM   1308 C C   . ARG A 1 227 ? 25.026 -21.711 -15.933 1.00 35.02 ? 435  ARG A C   1 
ATOM   1309 O O   . ARG A 1 227 ? 24.739 -22.444 -14.996 1.00 35.98 ? 435  ARG A O   1 
ATOM   1310 C CB  . ARG A 1 227 ? 27.296 -20.859 -15.273 1.00 36.87 ? 435  ARG A CB  1 
ATOM   1311 C CG  . ARG A 1 227 ? 26.822 -19.445 -14.919 1.00 40.09 ? 435  ARG A CG  1 
ATOM   1312 C CD  . ARG A 1 227 ? 27.901 -18.702 -14.117 1.00 37.35 ? 435  ARG A CD  1 
ATOM   1313 N NE  . ARG A 1 227 ? 29.079 -18.441 -14.943 1.00 38.15 ? 435  ARG A NE  1 
ATOM   1314 C CZ  . ARG A 1 227 ? 30.268 -18.079 -14.468 1.00 37.34 ? 435  ARG A CZ  1 
ATOM   1315 N NH1 . ARG A 1 227 ? 30.439 -17.933 -13.160 1.00 34.19 ? 435  ARG A NH1 1 
ATOM   1316 N NH2 . ARG A 1 227 ? 31.292 -17.879 -15.299 1.00 30.54 ? 435  ARG A NH2 1 
ATOM   1317 N N   . LYS A 1 228 ? 24.110 -21.023 -16.612 1.00 33.67 ? 436  LYS A N   1 
ATOM   1318 C CA  . LYS A 1 228 ? 22.684 -21.085 -16.268 1.00 38.29 ? 436  LYS A CA  1 
ATOM   1319 C C   . LYS A 1 228 ? 21.939 -22.233 -16.945 1.00 37.84 ? 436  LYS A C   1 
ATOM   1320 O O   . LYS A 1 228 ? 20.823 -22.561 -16.557 1.00 39.27 ? 436  LYS A O   1 
ATOM   1321 C CB  . LYS A 1 228 ? 21.979 -19.775 -16.625 1.00 42.09 ? 436  LYS A CB  1 
ATOM   1322 C CG  . LYS A 1 228 ? 22.411 -18.581 -15.790 1.00 50.56 ? 436  LYS A CG  1 
ATOM   1323 C CD  . LYS A 1 228 ? 21.635 -17.339 -16.207 1.00 56.51 ? 436  LYS A CD  1 
ATOM   1324 C CE  . LYS A 1 228 ? 21.968 -16.141 -15.325 1.00 60.20 ? 436  LYS A CE  1 
ATOM   1325 N NZ  . LYS A 1 228 ? 21.057 -14.993 -15.646 1.00 65.07 ? 436  LYS A NZ  1 
ATOM   1326 N N   . ARG A 1 229 ? 22.533 -22.834 -17.970 1.00 34.14 ? 437  ARG A N   1 
ATOM   1327 C CA  . ARG A 1 229 ? 21.874 -23.953 -18.633 1.00 32.41 ? 437  ARG A CA  1 
ATOM   1328 C C   . ARG A 1 229 ? 22.219 -25.252 -17.904 1.00 31.39 ? 437  ARG A C   1 
ATOM   1329 O O   . ARG A 1 229 ? 23.273 -25.363 -17.293 1.00 32.92 ? 437  ARG A O   1 
ATOM   1330 C CB  . ARG A 1 229 ? 22.301 -24.003 -20.095 1.00 30.89 ? 437  ARG A CB  1 
ATOM   1331 C CG  . ARG A 1 229 ? 21.932 -22.707 -20.819 1.00 34.79 ? 437  ARG A CG  1 
ATOM   1332 C CD  . ARG A 1 229 ? 22.520 -22.695 -22.210 1.00 38.25 ? 437  ARG A CD  1 
ATOM   1333 N NE  . ARG A 1 229 ? 22.117 -23.910 -22.895 1.00 43.65 ? 437  ARG A NE  1 
ATOM   1334 C CZ  . ARG A 1 229 ? 22.525 -24.260 -24.105 1.00 48.05 ? 437  ARG A CZ  1 
ATOM   1335 N NH1 . ARG A 1 229 ? 23.362 -23.474 -24.784 1.00 45.92 ? 437  ARG A NH1 1 
ATOM   1336 N NH2 . ARG A 1 229 ? 22.095 -25.404 -24.627 1.00 47.34 ? 437  ARG A NH2 1 
ATOM   1337 N N   . PRO A 1 230 ? 21.312 -26.238 -17.923 1.00 29.62 ? 438  PRO A N   1 
ATOM   1338 C CA  . PRO A 1 230 ? 21.649 -27.476 -17.224 1.00 27.94 ? 438  PRO A CA  1 
ATOM   1339 C C   . PRO A 1 230 ? 22.913 -28.150 -17.763 1.00 28.34 ? 438  PRO A C   1 
ATOM   1340 O O   . PRO A 1 230 ? 23.218 -28.088 -18.961 1.00 28.40 ? 438  PRO A O   1 
ATOM   1341 C CB  . PRO A 1 230 ? 20.381 -28.331 -17.355 1.00 26.14 ? 438  PRO A CB  1 
ATOM   1342 C CG  . PRO A 1 230 ? 19.481 -27.581 -18.291 1.00 33.05 ? 438  PRO A CG  1 
ATOM   1343 C CD  . PRO A 1 230 ? 19.878 -26.161 -18.251 1.00 32.43 ? 438  PRO A CD  1 
ATOM   1344 N N   . LEU A 1 231 ? 23.662 -28.775 -16.861 1.00 26.33 ? 439  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 231 ? 24.906 -29.427 -17.237 1.00 27.77 ? 439  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 231 ? 24.698 -30.413 -18.389 1.00 27.99 ? 439  LEU A C   1 
ATOM   1347 O O   . LEU A 1 231 ? 25.493 -30.454 -19.324 1.00 28.14 ? 439  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 231 ? 25.509 -30.158 -16.028 1.00 26.09 ? 439  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 231 ? 26.792 -30.953 -16.309 1.00 26.73 ? 439  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 231 ? 27.879 -29.989 -16.775 1.00 26.35 ? 439  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 231 ? 27.235 -31.697 -15.045 1.00 25.10 ? 439  LEU A CD2 1 
ATOM   1352 N N   . LEU A 1 232 ? 23.617 -31.185 -18.316 1.00 27.46 ? 440  LEU A N   1 
ATOM   1353 C CA  . LEU A 1 232 ? 23.295 -32.179 -19.332 1.00 30.36 ? 440  LEU A CA  1 
ATOM   1354 C C   . LEU A 1 232 ? 23.116 -31.569 -20.726 1.00 29.28 ? 440  LEU A C   1 
ATOM   1355 O O   . LEU A 1 232 ? 23.561 -32.150 -21.720 1.00 27.17 ? 440  LEU A O   1 
ATOM   1356 C CB  . LEU A 1 232 ? 22.026 -32.918 -18.926 1.00 34.74 ? 440  LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 232 ? 21.828 -34.328 -19.464 1.00 41.78 ? 440  LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 232 ? 23.122 -35.121 -19.239 1.00 44.29 ? 440  LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 232 ? 20.656 -35.014 -18.714 1.00 43.59 ? 440  LEU A CD2 1 
ATOM   1360 N N   . ASP A 1 233 ? 22.454 -30.414 -20.799 1.00 25.87 ? 441  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 233 ? 22.246 -29.737 -22.079 1.00 28.06 ? 441  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 233 ? 23.576 -29.234 -22.646 1.00 28.89 ? 441  ASP A C   1 
ATOM   1363 O O   . ASP A 1 233 ? 23.786 -29.254 -23.872 1.00 27.63 ? 441  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 233 ? 21.288 -28.553 -21.923 1.00 31.80 ? 441  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 233 ? 19.870 -28.989 -21.567 1.00 38.34 ? 441  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 233 ? 19.566 -30.190 -21.694 1.00 43.92 ? 441  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 233 ? 19.053 -28.134 -21.180 1.00 40.41 ? 441  ASP A OD2 1 
ATOM   1368 N N   . LEU A 1 234 ? 24.468 -28.782 -21.761 1.00 25.90 ? 442  LEU A N   1 
ATOM   1369 C CA  . LEU A 1 234 ? 25.789 -28.284 -22.192 1.00 26.03 ? 442  LEU A CA  1 
ATOM   1370 C C   . LEU A 1 234 ? 26.580 -29.469 -22.718 1.00 21.76 ? 442  LEU A C   1 
ATOM   1371 O O   . LEU A 1 234 ? 27.279 -29.377 -23.717 1.00 23.84 ? 442  LEU A O   1 
ATOM   1372 C CB  . LEU A 1 234 ? 26.557 -27.641 -21.014 1.00 23.87 ? 442  LEU A CB  1 
ATOM   1373 C CG  . LEU A 1 234 ? 25.922 -26.359 -20.432 1.00 27.61 ? 442  LEU A CG  1 
ATOM   1374 C CD1 . LEU A 1 234 ? 26.723 -25.874 -19.230 1.00 28.13 ? 442  LEU A CD1 1 
ATOM   1375 C CD2 . LEU A 1 234 ? 25.855 -25.285 -21.508 1.00 25.90 ? 442  LEU A CD2 1 
ATOM   1376 N N   . HIS A 1 235 ? 26.449 -30.601 -22.045 1.00 21.32 ? 443  HIS A N   1 
ATOM   1377 C CA  . HIS A 1 235 ? 27.179 -31.774 -22.474 1.00 24.43 ? 443  HIS A CA  1 
ATOM   1378 C C   . HIS A 1 235 ? 26.696 -32.275 -23.843 1.00 22.28 ? 443  HIS A C   1 
ATOM   1379 O O   . HIS A 1 235 ? 27.490 -32.812 -24.615 1.00 25.68 ? 443  HIS A O   1 
ATOM   1380 C CB  . HIS A 1 235 ? 27.084 -32.869 -21.415 1.00 22.38 ? 443  HIS A CB  1 
ATOM   1381 C CG  . HIS A 1 235 ? 28.240 -33.817 -21.442 1.00 26.53 ? 443  HIS A CG  1 
ATOM   1382 N ND1 . HIS A 1 235 ? 28.354 -34.827 -22.373 1.00 24.45 ? 443  HIS A ND1 1 
ATOM   1383 C CD2 . HIS A 1 235 ? 29.340 -33.902 -20.656 1.00 25.18 ? 443  HIS A CD2 1 
ATOM   1384 C CE1 . HIS A 1 235 ? 29.470 -35.503 -22.152 1.00 28.09 ? 443  HIS A CE1 1 
ATOM   1385 N NE2 . HIS A 1 235 ? 30.086 -34.964 -21.114 1.00 22.95 ? 443  HIS A NE2 1 
ATOM   1386 N N   . ILE A 1 236 ? 25.411 -32.083 -24.148 1.00 23.94 ? 444  ILE A N   1 
ATOM   1387 C CA  . ILE A 1 236 ? 24.846 -32.481 -25.459 1.00 24.31 ? 444  ILE A CA  1 
ATOM   1388 C C   . ILE A 1 236 ? 25.529 -31.633 -26.544 1.00 24.72 ? 444  ILE A C   1 
ATOM   1389 O O   . ILE A 1 236 ? 25.934 -32.147 -27.591 1.00 27.24 ? 444  ILE A O   1 
ATOM   1390 C CB  . ILE A 1 236 ? 23.324 -32.195 -25.557 1.00 26.18 ? 444  ILE A CB  1 
ATOM   1391 C CG1 . ILE A 1 236 ? 22.535 -33.154 -24.670 1.00 34.21 ? 444  ILE A CG1 1 
ATOM   1392 C CG2 . ILE A 1 236 ? 22.859 -32.280 -27.024 1.00 24.85 ? 444  ILE A CG2 1 
ATOM   1393 C CD1 . ILE A 1 236 ? 22.719 -34.573 -25.008 1.00 33.83 ? 444  ILE A CD1 1 
ATOM   1394 N N   . GLU A 1 237 ? 25.638 -30.330 -26.286 1.00 24.50 ? 445  GLU A N   1 
ATOM   1395 C CA  . GLU A 1 237 ? 26.308 -29.423 -27.225 1.00 27.55 ? 445  GLU A CA  1 
ATOM   1396 C C   . GLU A 1 237 ? 27.775 -29.821 -27.330 1.00 25.42 ? 445  GLU A C   1 
ATOM   1397 O O   . GLU A 1 237 ? 28.343 -29.791 -28.419 1.00 26.77 ? 445  GLU A O   1 
ATOM   1398 C CB  . GLU A 1 237 ? 26.183 -27.979 -26.755 1.00 26.38 ? 445  GLU A CB  1 
ATOM   1399 C CG  . GLU A 1 237 ? 24.737 -27.609 -26.468 1.00 35.21 ? 445  GLU A CG  1 
ATOM   1400 C CD  . GLU A 1 237 ? 24.541 -26.126 -26.251 1.00 39.23 ? 445  GLU A CD  1 
ATOM   1401 O OE1 . GLU A 1 237 ? 25.418 -25.477 -25.644 1.00 41.59 ? 445  GLU A OE1 1 
ATOM   1402 O OE2 . GLU A 1 237 ? 23.495 -25.612 -26.693 1.00 48.58 ? 445  GLU A OE2 1 
ATOM   1403 N N   . LEU A 1 238 ? 28.393 -30.201 -26.213 1.00 24.20 ? 446  LEU A N   1 
ATOM   1404 C CA  . LEU A 1 238 ? 29.790 -30.641 -26.285 1.00 26.14 ? 446  LEU A CA  1 
ATOM   1405 C C   . LEU A 1 238 ? 29.873 -31.885 -27.192 1.00 25.58 ? 446  LEU A C   1 
ATOM   1406 O O   . LEU A 1 238 ? 30.800 -31.987 -27.990 1.00 23.45 ? 446  LEU A O   1 
ATOM   1407 C CB  . LEU A 1 238 ? 30.342 -30.958 -24.894 1.00 25.25 ? 446  LEU A CB  1 
ATOM   1408 C CG  . LEU A 1 238 ? 31.802 -31.430 -24.792 1.00 29.06 ? 446  LEU A CG  1 
ATOM   1409 C CD1 . LEU A 1 238 ? 32.377 -31.008 -23.439 1.00 31.27 ? 446  LEU A CD1 1 
ATOM   1410 C CD2 . LEU A 1 238 ? 31.880 -32.930 -24.932 1.00 29.56 ? 446  LEU A CD2 1 
ATOM   1411 N N   . ASN A 1 239 ? 28.894 -32.799 -27.085 1.00 25.76 ? 447  ASN A N   1 
ATOM   1412 C CA  . ASN A 1 239 ? 28.842 -34.023 -27.925 1.00 25.29 ? 447  ASN A CA  1 
ATOM   1413 C C   . ASN A 1 239 ? 28.878 -33.589 -29.394 1.00 24.59 ? 447  ASN A C   1 
ATOM   1414 O O   . ASN A 1 239 ? 29.682 -34.080 -30.169 1.00 24.49 ? 447  ASN A O   1 
ATOM   1415 C CB  . ASN A 1 239 ? 27.521 -34.811 -27.780 1.00 27.32 ? 447  ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 239 ? 27.441 -35.652 -26.532 1.00 36.24 ? 447  ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 239 ? 28.428 -35.816 -25.801 1.00 36.13 ? 447  ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 239 ? 26.236 -36.226 -26.283 1.00 31.83 ? 447  ASN A ND2 1 
ATOM   1419 N N   . GLY A 1 240 ? 27.973 -32.678 -29.747 1.00 22.33 ? 448  GLY A N   1 
ATOM   1420 C CA  . GLY A 1 240 ? 27.879 -32.182 -31.110 1.00 26.38 ? 448  GLY A CA  1 
ATOM   1421 C C   . GLY A 1 240 ? 29.179 -31.524 -31.551 1.00 29.32 ? 448  GLY A C   1 
ATOM   1422 O O   . GLY A 1 240 ? 29.627 -31.731 -32.673 1.00 26.82 ? 448  GLY A O   1 
ATOM   1423 N N   . TYR A 1 241 ? 29.785 -30.745 -30.656 1.00 30.07 ? 449  TYR A N   1 
ATOM   1424 C CA  . TYR A 1 241 ? 31.056 -30.076 -30.930 1.00 30.74 ? 449  TYR A CA  1 
ATOM   1425 C C   . TYR A 1 241 ? 32.158 -31.115 -31.216 1.00 31.18 ? 449  TYR A C   1 
ATOM   1426 O O   . TYR A 1 241 ? 32.903 -30.980 -32.191 1.00 28.99 ? 449  TYR A O   1 
ATOM   1427 C CB  . TYR A 1 241 ? 31.430 -29.211 -29.728 1.00 37.75 ? 449  TYR A CB  1 
ATOM   1428 C CG  . TYR A 1 241 ? 32.670 -28.362 -29.893 1.00 44.11 ? 449  TYR A CG  1 
ATOM   1429 C CD1 . TYR A 1 241 ? 32.575 -27.008 -30.221 1.00 47.76 ? 449  TYR A CD1 1 
ATOM   1430 C CD2 . TYR A 1 241 ? 33.938 -28.898 -29.680 1.00 45.33 ? 449  TYR A CD2 1 
ATOM   1431 C CE1 . TYR A 1 241 ? 33.721 -26.208 -30.322 1.00 48.57 ? 449  TYR A CE1 1 
ATOM   1432 C CE2 . TYR A 1 241 ? 35.081 -28.112 -29.781 1.00 49.57 ? 449  TYR A CE2 1 
ATOM   1433 C CZ  . TYR A 1 241 ? 34.967 -26.767 -30.098 1.00 50.33 ? 449  TYR A CZ  1 
ATOM   1434 O OH  . TYR A 1 241 ? 36.099 -25.979 -30.169 1.00 52.56 ? 449  TYR A OH  1 
ATOM   1435 N N   . MET A 1 242 ? 32.256 -32.162 -30.390 1.00 28.14 ? 450  MET A N   1 
ATOM   1436 C CA  . MET A 1 242 ? 33.283 -33.201 -30.607 1.00 27.89 ? 450  MET A CA  1 
ATOM   1437 C C   . MET A 1 242 ? 33.044 -34.033 -31.875 1.00 27.89 ? 450  MET A C   1 
ATOM   1438 O O   . MET A 1 242 ? 33.998 -34.464 -32.523 1.00 29.07 ? 450  MET A O   1 
ATOM   1439 C CB  . MET A 1 242 ? 33.370 -34.162 -29.410 1.00 28.12 ? 450  MET A CB  1 
ATOM   1440 C CG  . MET A 1 242 ? 33.886 -33.555 -28.111 1.00 33.02 ? 450  MET A CG  1 
ATOM   1441 S SD  . MET A 1 242 ? 35.512 -32.735 -28.297 1.00 37.74 ? 450  MET A SD  1 
ATOM   1442 C CE  . MET A 1 242 ? 35.089 -31.291 -27.788 1.00 27.16 ? 450  MET A CE  1 
ATOM   1443 N N   . TYR A 1 243 ? 31.778 -34.292 -32.207 1.00 27.09 ? 451  TYR A N   1 
ATOM   1444 C CA  . TYR A 1 243 ? 31.447 -35.052 -33.408 1.00 31.07 ? 451  TYR A CA  1 
ATOM   1445 C C   . TYR A 1 243 ? 31.872 -34.255 -34.644 1.00 30.54 ? 451  TYR A C   1 
ATOM   1446 O O   . TYR A 1 243 ? 32.361 -34.828 -35.618 1.00 30.67 ? 451  TYR A O   1 
ATOM   1447 C CB  . TYR A 1 243 ? 29.929 -35.323 -33.516 1.00 35.14 ? 451  TYR A CB  1 
ATOM   1448 C CG  . TYR A 1 243 ? 29.451 -36.621 -32.889 1.00 44.07 ? 451  TYR A CG  1 
ATOM   1449 C CD1 . TYR A 1 243 ? 28.639 -36.614 -31.742 1.00 45.83 ? 451  TYR A CD1 1 
ATOM   1450 C CD2 . TYR A 1 243 ? 29.795 -37.861 -33.448 1.00 44.51 ? 451  TYR A CD2 1 
ATOM   1451 C CE1 . TYR A 1 243 ? 28.173 -37.810 -31.167 1.00 44.86 ? 451  TYR A CE1 1 
ATOM   1452 C CE2 . TYR A 1 243 ? 29.350 -39.057 -32.885 1.00 44.57 ? 451  TYR A CE2 1 
ATOM   1453 C CZ  . TYR A 1 243 ? 28.535 -39.028 -31.746 1.00 48.43 ? 451  TYR A CZ  1 
ATOM   1454 O OH  . TYR A 1 243 ? 28.069 -40.214 -31.210 1.00 46.09 ? 451  TYR A OH  1 
ATOM   1455 N N   . ASP A 1 244 ? 31.653 -32.939 -34.610 1.00 29.15 ? 452  ASP A N   1 
ATOM   1456 C CA  . ASP A 1 244 ? 32.012 -32.096 -35.741 1.00 31.22 ? 452  ASP A CA  1 
ATOM   1457 C C   . ASP A 1 244 ? 33.534 -32.062 -35.903 1.00 32.32 ? 452  ASP A C   1 
ATOM   1458 O O   . ASP A 1 244 ? 34.050 -32.167 -37.016 1.00 32.42 ? 452  ASP A O   1 
ATOM   1459 C CB  . ASP A 1 244 ? 31.451 -30.690 -35.556 1.00 37.11 ? 452  ASP A CB  1 
ATOM   1460 C CG  . ASP A 1 244 ? 31.610 -29.836 -36.805 1.00 47.07 ? 452  ASP A CG  1 
ATOM   1461 O OD1 . ASP A 1 244 ? 32.514 -28.977 -36.836 1.00 51.53 ? 452  ASP A OD1 1 
ATOM   1462 O OD2 . ASP A 1 244 ? 30.837 -30.033 -37.768 1.00 51.07 ? 452  ASP A OD2 1 
ATOM   1463 N N   . TRP A 1 245 ? 34.252 -31.945 -34.791 1.00 27.03 ? 453  TRP A N   1 
ATOM   1464 C CA  . TRP A 1 245 ? 35.703 -31.946 -34.845 1.00 27.80 ? 453  TRP A CA  1 
ATOM   1465 C C   . TRP A 1 245 ? 36.191 -33.275 -35.429 1.00 30.81 ? 453  TRP A C   1 
ATOM   1466 O O   . TRP A 1 245 ? 37.017 -33.298 -36.346 1.00 28.97 ? 453  TRP A O   1 
ATOM   1467 C CB  . TRP A 1 245 ? 36.303 -31.761 -33.443 1.00 24.24 ? 453  TRP A CB  1 
ATOM   1468 C CG  . TRP A 1 245 ? 37.751 -32.195 -33.342 1.00 25.68 ? 453  TRP A CG  1 
ATOM   1469 C CD1 . TRP A 1 245 ? 38.218 -33.374 -32.854 1.00 25.96 ? 453  TRP A CD1 1 
ATOM   1470 C CD2 . TRP A 1 245 ? 38.907 -31.426 -33.714 1.00 23.76 ? 453  TRP A CD2 1 
ATOM   1471 N NE1 . TRP A 1 245 ? 39.594 -33.389 -32.884 1.00 25.65 ? 453  TRP A NE1 1 
ATOM   1472 C CE2 . TRP A 1 245 ? 40.038 -32.203 -33.411 1.00 27.57 ? 453  TRP A CE2 1 
ATOM   1473 C CE3 . TRP A 1 245 ? 39.087 -30.149 -34.277 1.00 27.34 ? 453  TRP A CE3 1 
ATOM   1474 C CZ2 . TRP A 1 245 ? 41.348 -31.751 -33.650 1.00 29.67 ? 453  TRP A CZ2 1 
ATOM   1475 C CZ3 . TRP A 1 245 ? 40.383 -29.699 -34.519 1.00 27.95 ? 453  TRP A CZ3 1 
ATOM   1476 C CH2 . TRP A 1 245 ? 41.497 -30.498 -34.205 1.00 31.07 ? 453  TRP A CH2 1 
ATOM   1477 N N   . ASN A 1 246 ? 35.660 -34.376 -34.900 1.00 28.66 ? 454  ASN A N   1 
ATOM   1478 C CA  . ASN A 1 246 ? 36.059 -35.705 -35.346 1.00 29.87 ? 454  ASN A CA  1 
ATOM   1479 C C   . ASN A 1 246 ? 35.847 -35.943 -36.837 1.00 31.06 ? 454  ASN A C   1 
ATOM   1480 O O   . ASN A 1 246 ? 36.619 -36.666 -37.476 1.00 29.53 ? 454  ASN A O   1 
ATOM   1481 C CB  . ASN A 1 246 ? 35.290 -36.776 -34.574 1.00 27.50 ? 454  ASN A CB  1 
ATOM   1482 C CG  . ASN A 1 246 ? 35.831 -36.994 -33.181 1.00 32.12 ? 454  ASN A CG  1 
ATOM   1483 O OD1 . ASN A 1 246 ? 36.853 -36.412 -32.789 1.00 31.71 ? 454  ASN A OD1 1 
ATOM   1484 N ND2 . ASN A 1 246 ? 35.153 -37.851 -32.415 1.00 31.14 ? 454  ASN A ND2 1 
ATOM   1485 N N   . SER A 1 247 ? 34.804 -35.339 -37.392 1.00 31.57 ? 455  SER A N   1 
ATOM   1486 C CA  . SER A 1 247 ? 34.519 -35.542 -38.799 1.00 34.56 ? 455  SER A CA  1 
ATOM   1487 C C   . SER A 1 247 ? 35.506 -34.824 -39.727 1.00 37.82 ? 455  SER A C   1 
ATOM   1488 O O   . SER A 1 247 ? 35.544 -35.119 -40.912 1.00 35.86 ? 455  SER A O   1 
ATOM   1489 C CB  . SER A 1 247 ? 33.098 -35.079 -39.122 1.00 34.56 ? 455  SER A CB  1 
ATOM   1490 O OG  . SER A 1 247 ? 33.031 -33.668 -39.080 1.00 33.32 ? 455  SER A OG  1 
ATOM   1491 N N   . ARG A 1 248 ? 36.305 -33.900 -39.195 1.00 35.92 ? 456  ARG A N   1 
ATOM   1492 C CA  . ARG A 1 248 ? 37.251 -33.160 -40.029 1.00 37.72 ? 456  ARG A CA  1 
ATOM   1493 C C   . ARG A 1 248 ? 38.714 -33.544 -39.860 1.00 35.07 ? 456  ARG A C   1 
ATOM   1494 O O   . ARG A 1 248 ? 39.560 -33.004 -40.554 1.00 39.03 ? 456  ARG A O   1 
ATOM   1495 C CB  . ARG A 1 248 ? 37.136 -31.656 -39.753 1.00 37.06 ? 456  ARG A CB  1 
ATOM   1496 C CG  . ARG A 1 248 ? 35.728 -31.094 -39.850 1.00 42.47 ? 456  ARG A CG  1 
ATOM   1497 C CD  . ARG A 1 248 ? 35.668 -29.731 -39.174 1.00 46.95 ? 456  ARG A CD  1 
ATOM   1498 N NE  . ARG A 1 248 ? 34.301 -29.225 -39.079 1.00 53.29 ? 456  ARG A NE  1 
ATOM   1499 C CZ  . ARG A 1 248 ? 33.574 -28.824 -40.119 1.00 56.37 ? 456  ARG A CZ  1 
ATOM   1500 N NH1 . ARG A 1 248 ? 34.081 -28.864 -41.346 1.00 59.66 ? 456  ARG A NH1 1 
ATOM   1501 N NH2 . ARG A 1 248 ? 32.338 -28.378 -39.934 1.00 59.11 ? 456  ARG A NH2 1 
ATOM   1502 N N   . VAL A 1 249 ? 39.032 -34.465 -38.960 1.00 36.18 ? 457  VAL A N   1 
ATOM   1503 C CA  . VAL A 1 249 ? 40.436 -34.792 -38.745 1.00 32.55 ? 457  VAL A CA  1 
ATOM   1504 C C   . VAL A 1 249 ? 40.782 -36.256 -38.856 1.00 34.11 ? 457  VAL A C   1 
ATOM   1505 O O   . VAL A 1 249 ? 39.901 -37.101 -38.985 1.00 36.30 ? 457  VAL A O   1 
ATOM   1506 C CB  . VAL A 1 249 ? 40.885 -34.275 -37.363 1.00 34.30 ? 457  VAL A CB  1 
ATOM   1507 C CG1 . VAL A 1 249 ? 40.547 -32.786 -37.252 1.00 31.69 ? 457  VAL A CG1 1 
ATOM   1508 C CG2 . VAL A 1 249 ? 40.202 -35.065 -36.254 1.00 27.55 ? 457  VAL A CG2 1 
ATOM   1509 N N   . SER A 1 250 ? 42.074 -36.557 -38.797 1.00 33.83 ? 458  SER A N   1 
ATOM   1510 C CA  . SER A 1 250 ? 42.532 -37.940 -38.894 1.00 39.03 ? 458  SER A CA  1 
ATOM   1511 C C   . SER A 1 250 ? 42.224 -38.714 -37.610 1.00 39.44 ? 458  SER A C   1 
ATOM   1512 O O   . SER A 1 250 ? 42.111 -38.130 -36.530 1.00 38.23 ? 458  SER A O   1 
ATOM   1513 C CB  . SER A 1 250 ? 44.038 -37.977 -39.171 1.00 39.60 ? 458  SER A CB  1 
ATOM   1514 O OG  . SER A 1 250 ? 44.760 -37.369 -38.107 1.00 47.26 ? 458  SER A OG  1 
ATOM   1515 N N   . ALA A 1 251 ? 42.105 -40.032 -37.740 1.00 41.37 ? 459  ALA A N   1 
ATOM   1516 C CA  . ALA A 1 251 ? 41.790 -40.919 -36.624 1.00 42.02 ? 459  ALA A CA  1 
ATOM   1517 C C   . ALA A 1 251 ? 42.504 -40.595 -35.305 1.00 45.53 ? 459  ALA A C   1 
ATOM   1518 O O   . ALA A 1 251 ? 41.891 -40.564 -34.233 1.00 46.92 ? 459  ALA A O   1 
ATOM   1519 C CB  . ALA A 1 251 ? 42.093 -42.350 -37.026 1.00 42.73 ? 459  ALA A CB  1 
ATOM   1520 N N   . LYS A 1 252 ? 43.802 -40.347 -35.387 1.00 44.20 ? 460  LYS A N   1 
ATOM   1521 C CA  . LYS A 1 252 ? 44.584 -40.069 -34.200 1.00 44.67 ? 460  LYS A CA  1 
ATOM   1522 C C   . LYS A 1 252 ? 44.309 -38.757 -33.482 1.00 41.74 ? 460  LYS A C   1 
ATOM   1523 O O   . LYS A 1 252 ? 44.694 -38.594 -32.333 1.00 39.77 ? 460  LYS A O   1 
ATOM   1524 C CB  . LYS A 1 252 ? 46.071 -40.162 -34.538 1.00 45.48 ? 460  LYS A CB  1 
ATOM   1525 C CG  . LYS A 1 252 ? 46.578 -41.588 -34.563 1.00 52.99 ? 460  LYS A CG  1 
ATOM   1526 C CD  . LYS A 1 252 ? 48.103 -41.612 -34.539 1.00 58.01 ? 460  LYS A CD  1 
ATOM   1527 C CE  . LYS A 1 252 ? 48.642 -43.016 -34.319 1.00 58.87 ? 460  LYS A CE  1 
ATOM   1528 N NZ  . LYS A 1 252 ? 50.141 -42.990 -34.247 1.00 63.60 ? 460  LYS A NZ  1 
ATOM   1529 N N   . GLU A 1 253 ? 43.657 -37.819 -34.153 1.00 38.14 ? 461  GLU A N   1 
ATOM   1530 C CA  . GLU A 1 253 ? 43.361 -36.536 -33.535 1.00 37.49 ? 461  GLU A CA  1 
ATOM   1531 C C   . GLU A 1 253 ? 41.964 -36.487 -32.928 1.00 33.34 ? 461  GLU A C   1 
ATOM   1532 O O   . GLU A 1 253 ? 41.567 -35.462 -32.368 1.00 32.84 ? 461  GLU A O   1 
ATOM   1533 C CB  . GLU A 1 253 ? 43.468 -35.426 -34.577 1.00 39.89 ? 461  GLU A CB  1 
ATOM   1534 C CG  . GLU A 1 253 ? 44.873 -35.105 -35.031 1.00 46.86 ? 461  GLU A CG  1 
ATOM   1535 C CD  . GLU A 1 253 ? 44.856 -34.211 -36.244 1.00 52.15 ? 461  GLU A CD  1 
ATOM   1536 O OE1 . GLU A 1 253 ? 44.647 -34.745 -37.357 1.00 55.17 ? 461  GLU A OE1 1 
ATOM   1537 O OE2 . GLU A 1 253 ? 45.020 -32.978 -36.088 1.00 55.06 ? 461  GLU A OE2 1 
ATOM   1538 N N   . LYS A 1 254 ? 41.225 -37.585 -33.040 1.00 31.11 ? 462  LYS A N   1 
ATOM   1539 C CA  . LYS A 1 254 ? 39.846 -37.622 -32.553 1.00 34.03 ? 462  LYS A CA  1 
ATOM   1540 C C   . LYS A 1 254 ? 39.661 -37.739 -31.044 1.00 33.19 ? 462  LYS A C   1 
ATOM   1541 O O   . LYS A 1 254 ? 40.556 -38.168 -30.334 1.00 32.27 ? 462  LYS A O   1 
ATOM   1542 C CB  . LYS A 1 254 ? 39.080 -38.756 -33.248 1.00 30.11 ? 462  LYS A CB  1 
ATOM   1543 C CG  . LYS A 1 254 ? 38.909 -38.503 -34.727 1.00 30.85 ? 462  LYS A CG  1 
ATOM   1544 C CD  . LYS A 1 254 ? 38.171 -39.616 -35.441 1.00 32.44 ? 462  LYS A CD  1 
ATOM   1545 C CE  . LYS A 1 254 ? 38.107 -39.322 -36.946 1.00 36.48 ? 462  LYS A CE  1 
ATOM   1546 N NZ  . LYS A 1 254 ? 37.374 -40.381 -37.697 1.00 39.15 ? 462  LYS A NZ  1 
ATOM   1547 N N   . TYR A 1 255 ? 38.483 -37.343 -30.572 1.00 34.51 ? 463  TYR A N   1 
ATOM   1548 C CA  . TYR A 1 255 ? 38.148 -37.432 -29.158 1.00 32.00 ? 463  TYR A CA  1 
ATOM   1549 C C   . TYR A 1 255 ? 36.830 -38.156 -29.063 1.00 34.00 ? 463  TYR A C   1 
ATOM   1550 O O   . TYR A 1 255 ? 35.878 -37.799 -29.744 1.00 35.46 ? 463  TYR A O   1 
ATOM   1551 C CB  . TYR A 1 255 ? 37.996 -36.049 -28.511 1.00 31.36 ? 463  TYR A CB  1 
ATOM   1552 C CG  . TYR A 1 255 ? 39.272 -35.247 -28.456 1.00 31.57 ? 463  TYR A CG  1 
ATOM   1553 C CD1 . TYR A 1 255 ? 39.557 -34.286 -29.425 1.00 34.65 ? 463  TYR A CD1 1 
ATOM   1554 C CD2 . TYR A 1 255 ? 40.211 -35.466 -27.455 1.00 31.59 ? 463  TYR A CD2 1 
ATOM   1555 C CE1 . TYR A 1 255 ? 40.751 -33.557 -29.393 1.00 32.41 ? 463  TYR A CE1 1 
ATOM   1556 C CE2 . TYR A 1 255 ? 41.416 -34.751 -27.420 1.00 31.46 ? 463  TYR A CE2 1 
ATOM   1557 C CZ  . TYR A 1 255 ? 41.675 -33.799 -28.390 1.00 32.82 ? 463  TYR A CZ  1 
ATOM   1558 O OH  . TYR A 1 255 ? 42.864 -33.092 -28.366 1.00 37.65 ? 463  TYR A OH  1 
ATOM   1559 N N   . TYR A 1 256 ? 36.789 -39.180 -28.222 1.00 29.84 ? 464  TYR A N   1 
ATOM   1560 C CA  . TYR A 1 256 ? 35.588 -39.963 -28.009 1.00 30.59 ? 464  TYR A CA  1 
ATOM   1561 C C   . TYR A 1 256 ? 35.045 -39.658 -26.616 1.00 29.53 ? 464  TYR A C   1 
ATOM   1562 O O   . TYR A 1 256 ? 35.757 -39.791 -25.610 1.00 31.91 ? 464  TYR A O   1 
ATOM   1563 C CB  . TYR A 1 256 ? 35.928 -41.443 -28.152 1.00 32.94 ? 464  TYR A CB  1 
ATOM   1564 C CG  . TYR A 1 256 ? 36.416 -41.743 -29.545 1.00 38.53 ? 464  TYR A CG  1 
ATOM   1565 C CD1 . TYR A 1 256 ? 37.780 -41.838 -29.832 1.00 38.41 ? 464  TYR A CD1 1 
ATOM   1566 C CD2 . TYR A 1 256 ? 35.508 -41.845 -30.602 1.00 39.55 ? 464  TYR A CD2 1 
ATOM   1567 C CE1 . TYR A 1 256 ? 38.223 -42.029 -31.154 1.00 42.03 ? 464  TYR A CE1 1 
ATOM   1568 C CE2 . TYR A 1 256 ? 35.937 -42.029 -31.919 1.00 39.79 ? 464  TYR A CE2 1 
ATOM   1569 C CZ  . TYR A 1 256 ? 37.286 -42.123 -32.185 1.00 39.29 ? 464  TYR A CZ  1 
ATOM   1570 O OH  . TYR A 1 256 ? 37.683 -42.341 -33.481 1.00 45.31 ? 464  TYR A OH  1 
ATOM   1571 N N   . VAL A 1 257 ? 33.791 -39.242 -26.558 1.00 27.53 ? 465  VAL A N   1 
ATOM   1572 C CA  . VAL A 1 257 ? 33.187 -38.890 -25.289 1.00 31.23 ? 465  VAL A CA  1 
ATOM   1573 C C   . VAL A 1 257 ? 32.079 -39.826 -24.878 1.00 32.48 ? 465  VAL A C   1 
ATOM   1574 O O   . VAL A 1 257 ? 31.119 -40.034 -25.622 1.00 33.93 ? 465  VAL A O   1 
ATOM   1575 C CB  . VAL A 1 257 ? 32.640 -37.448 -25.331 1.00 30.99 ? 465  VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 257 ? 32.134 -37.033 -23.943 1.00 33.16 ? 465  VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 257 ? 33.738 -36.508 -25.783 1.00 27.32 ? 465  VAL A CG2 1 
ATOM   1578 N N   . TRP A 1 258 ? 32.224 -40.391 -23.687 1.00 32.57 ? 466  TRP A N   1 
ATOM   1579 C CA  . TRP A 1 258 ? 31.242 -41.308 -23.130 1.00 34.70 ? 466  TRP A CA  1 
ATOM   1580 C C   . TRP A 1 258 ? 30.604 -40.657 -21.911 1.00 34.89 ? 466  TRP A C   1 
ATOM   1581 O O   . TRP A 1 258 ? 31.307 -40.200 -20.997 1.00 30.75 ? 466  TRP A O   1 
ATOM   1582 C CB  . TRP A 1 258 ? 31.907 -42.608 -22.674 1.00 39.81 ? 466  TRP A CB  1 
ATOM   1583 C CG  . TRP A 1 258 ? 30.925 -43.654 -22.139 1.00 50.20 ? 466  TRP A CG  1 
ATOM   1584 C CD1 . TRP A 1 258 ? 29.997 -44.357 -22.865 1.00 52.60 ? 466  TRP A CD1 1 
ATOM   1585 C CD2 . TRP A 1 258 ? 30.833 -44.152 -20.791 1.00 53.68 ? 466  TRP A CD2 1 
ATOM   1586 N NE1 . TRP A 1 258 ? 29.345 -45.264 -22.057 1.00 55.56 ? 466  TRP A NE1 1 
ATOM   1587 C CE2 . TRP A 1 258 ? 29.837 -45.161 -20.783 1.00 54.64 ? 466  TRP A CE2 1 
ATOM   1588 C CE3 . TRP A 1 258 ? 31.495 -43.847 -19.593 1.00 56.45 ? 466  TRP A CE3 1 
ATOM   1589 C CZ2 . TRP A 1 258 ? 29.491 -45.871 -19.622 1.00 59.09 ? 466  TRP A CZ2 1 
ATOM   1590 C CZ3 . TRP A 1 258 ? 31.147 -44.560 -18.428 1.00 60.70 ? 466  TRP A CZ3 1 
ATOM   1591 C CH2 . TRP A 1 258 ? 30.155 -45.559 -18.457 1.00 59.06 ? 466  TRP A CH2 1 
ATOM   1592 N N   . LEU A 1 259 ? 29.277 -40.611 -21.895 1.00 29.72 ? 467  LEU A N   1 
ATOM   1593 C CA  . LEU A 1 259 ? 28.570 -40.046 -20.751 1.00 30.36 ? 467  LEU A CA  1 
ATOM   1594 C C   . LEU A 1 259 ? 27.605 -41.048 -20.121 1.00 30.47 ? 467  LEU A C   1 
ATOM   1595 O O   . LEU A 1 259 ? 26.791 -41.683 -20.804 1.00 25.80 ? 467  LEU A O   1 
ATOM   1596 C CB  . LEU A 1 259 ? 27.800 -38.776 -21.134 1.00 27.43 ? 467  LEU A CB  1 
ATOM   1597 C CG  . LEU A 1 259 ? 26.861 -38.258 -20.025 1.00 29.91 ? 467  LEU A CG  1 
ATOM   1598 C CD1 . LEU A 1 259 ? 27.658 -37.711 -18.825 1.00 26.89 ? 467  LEU A CD1 1 
ATOM   1599 C CD2 . LEU A 1 259 ? 25.961 -37.173 -20.614 1.00 26.84 ? 467  LEU A CD2 1 
ATOM   1600 N N   . GLN A 1 260 ? 27.713 -41.176 -18.803 1.00 32.42 ? 468  GLN A N   1 
ATOM   1601 C CA  . GLN A 1 260 ? 26.858 -42.054 -18.033 1.00 32.90 ? 468  GLN A CA  1 
ATOM   1602 C C   . GLN A 1 260 ? 26.453 -41.266 -16.774 1.00 33.89 ? 468  GLN A C   1 
ATOM   1603 O O   . GLN A 1 260 ? 27.316 -40.649 -16.142 1.00 33.24 ? 468  GLN A O   1 
ATOM   1604 C CB  . GLN A 1 260 ? 27.663 -43.300 -17.646 1.00 38.23 ? 468  GLN A CB  1 
ATOM   1605 C CG  . GLN A 1 260 ? 26.843 -44.518 -17.290 1.00 50.84 ? 468  GLN A CG  1 
ATOM   1606 C CD  . GLN A 1 260 ? 25.941 -44.970 -18.437 1.00 56.80 ? 468  GLN A CD  1 
ATOM   1607 O OE1 . GLN A 1 260 ? 26.309 -44.869 -19.613 1.00 59.33 ? 468  GLN A OE1 1 
ATOM   1608 N NE2 . GLN A 1 260 ? 24.757 -45.476 -18.097 1.00 59.01 ? 468  GLN A NE2 1 
ATOM   1609 N N   . HIS A 1 261 ? 25.165 -41.238 -16.424 1.00 26.79 ? 469  HIS A N   1 
ATOM   1610 C CA  . HIS A 1 261 ? 24.760 -40.557 -15.200 1.00 27.67 ? 469  HIS A CA  1 
ATOM   1611 C C   . HIS A 1 261 ? 23.539 -41.192 -14.520 1.00 30.69 ? 469  HIS A C   1 
ATOM   1612 O O   . HIS A 1 261 ? 22.818 -42.013 -15.114 1.00 27.59 ? 469  HIS A O   1 
ATOM   1613 C CB  . HIS A 1 261 ? 24.531 -39.060 -15.453 1.00 24.96 ? 469  HIS A CB  1 
ATOM   1614 C CG  . HIS A 1 261 ? 23.265 -38.750 -16.180 1.00 29.92 ? 469  HIS A CG  1 
ATOM   1615 N ND1 . HIS A 1 261 ? 22.039 -38.706 -15.550 1.00 32.91 ? 469  HIS A ND1 1 
ATOM   1616 C CD2 . HIS A 1 261 ? 23.027 -38.492 -17.489 1.00 26.39 ? 469  HIS A CD2 1 
ATOM   1617 C CE1 . HIS A 1 261 ? 21.100 -38.434 -16.437 1.00 30.56 ? 469  HIS A CE1 1 
ATOM   1618 N NE2 . HIS A 1 261 ? 21.671 -38.301 -17.622 1.00 30.13 ? 469  HIS A NE2 1 
ATOM   1619 N N   . THR A 1 262 ? 23.343 -40.837 -13.254 1.00 27.91 ? 470  THR A N   1 
ATOM   1620 C CA  . THR A 1 262 ? 22.220 -41.324 -12.482 1.00 25.10 ? 470  THR A CA  1 
ATOM   1621 C C   . THR A 1 262 ? 21.531 -40.141 -11.799 1.00 27.78 ? 470  THR A C   1 
ATOM   1622 O O   . THR A 1 262 ? 21.041 -40.250 -10.673 1.00 29.42 ? 470  THR A O   1 
ATOM   1623 C CB  . THR A 1 262 ? 22.671 -42.363 -11.436 1.00 24.84 ? 470  THR A CB  1 
ATOM   1624 O OG1 . THR A 1 262 ? 23.774 -41.845 -10.681 1.00 22.81 ? 470  THR A OG1 1 
ATOM   1625 C CG2 . THR A 1 262 ? 23.084 -43.672 -12.132 1.00 26.04 ? 470  THR A CG2 1 
ATOM   1626 N N   . LEU A 1 263 ? 21.486 -39.008 -12.492 1.00 23.14 ? 471  LEU A N   1 
ATOM   1627 C CA  . LEU A 1 263 ? 20.853 -37.820 -11.943 1.00 25.55 ? 471  LEU A CA  1 
ATOM   1628 C C   . LEU A 1 263 ? 19.368 -38.076 -11.764 1.00 28.79 ? 471  LEU A C   1 
ATOM   1629 O O   . LEU A 1 263 ? 18.762 -38.806 -12.554 1.00 28.21 ? 471  LEU A O   1 
ATOM   1630 C CB  . LEU A 1 263 ? 21.052 -36.624 -12.867 1.00 26.64 ? 471  LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 263 ? 22.520 -36.225 -13.024 1.00 30.23 ? 471  LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 263 ? 22.607 -34.917 -13.828 1.00 24.75 ? 471  LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 263 ? 23.157 -36.092 -11.626 1.00 23.56 ? 471  LEU A CD2 1 
ATOM   1634 N N   . ARG A 1 264 ? 18.789 -37.431 -10.750 1.00 26.75 ? 472  ARG A N   1 
ATOM   1635 C CA  . ARG A 1 264 ? 17.382 -37.605 -10.419 1.00 32.69 ? 472  ARG A CA  1 
ATOM   1636 C C   . ARG A 1 264 ? 16.661 -36.288 -10.505 1.00 30.47 ? 472  ARG A C   1 
ATOM   1637 O O   . ARG A 1 264 ? 15.453 -36.240 -10.335 1.00 31.94 ? 472  ARG A O   1 
ATOM   1638 C CB  . ARG A 1 264 ? 17.226 -38.143 -8.984  1.00 35.29 ? 472  ARG A CB  1 
ATOM   1639 C CG  . ARG A 1 264 ? 17.857 -39.493 -8.737  1.00 38.54 ? 472  ARG A CG  1 
ATOM   1640 C CD  . ARG A 1 264 ? 17.589 -39.971 -7.300  1.00 42.81 ? 472  ARG A CD  1 
ATOM   1641 N NE  . ARG A 1 264 ? 18.380 -39.230 -6.326  1.00 46.29 ? 472  ARG A NE  1 
ATOM   1642 C CZ  . ARG A 1 264 ? 17.897 -38.339 -5.461  1.00 54.21 ? 472  ARG A CZ  1 
ATOM   1643 N NH1 . ARG A 1 264 ? 16.594 -38.065 -5.428  1.00 55.02 ? 472  ARG A NH1 1 
ATOM   1644 N NH2 . ARG A 1 264 ? 18.726 -37.693 -4.642  1.00 50.83 ? 472  ARG A NH2 1 
ATOM   1645 N N   . LYS A 1 265 ? 17.404 -35.216 -10.738 1.00 27.63 ? 473  LYS A N   1 
ATOM   1646 C CA  . LYS A 1 265 ? 16.804 -33.896 -10.818 1.00 26.29 ? 473  LYS A CA  1 
ATOM   1647 C C   . LYS A 1 265 ? 17.598 -33.077 -11.813 1.00 29.36 ? 473  LYS A C   1 
ATOM   1648 O O   . LYS A 1 265 ? 18.707 -33.457 -12.201 1.00 27.25 ? 473  LYS A O   1 
ATOM   1649 C CB  . LYS A 1 265 ? 16.877 -33.174 -9.460  1.00 28.72 ? 473  LYS A CB  1 
ATOM   1650 C CG  . LYS A 1 265 ? 16.419 -33.977 -8.243  1.00 33.74 ? 473  LYS A CG  1 
ATOM   1651 C CD  . LYS A 1 265 ? 16.534 -33.121 -6.978  1.00 34.96 ? 473  LYS A CD  1 
ATOM   1652 C CE  . LYS A 1 265 ? 16.254 -33.943 -5.723  1.00 39.49 ? 473  LYS A CE  1 
ATOM   1653 N NZ  . LYS A 1 265 ? 16.488 -33.154 -4.479  1.00 41.71 ? 473  LYS A NZ  1 
ATOM   1654 N N   . LYS A 1 266 ? 17.039 -31.945 -12.213 1.00 27.63 ? 474  LYS A N   1 
ATOM   1655 C CA  . LYS A 1 266 ? 17.728 -31.072 -13.128 1.00 28.97 ? 474  LYS A CA  1 
ATOM   1656 C C   . LYS A 1 266 ? 18.971 -30.514 -12.414 1.00 29.72 ? 474  LYS A C   1 
ATOM   1657 O O   . LYS A 1 266 ? 18.896 -30.012 -11.283 1.00 30.48 ? 474  LYS A O   1 
ATOM   1658 C CB  . LYS A 1 266 ? 16.819 -29.936 -13.549 1.00 30.42 ? 474  LYS A CB  1 
ATOM   1659 C CG  . LYS A 1 266 ? 17.534 -28.894 -14.400 1.00 35.83 ? 474  LYS A CG  1 
ATOM   1660 C CD  . LYS A 1 266 ? 16.557 -28.080 -15.216 1.00 35.74 ? 474  LYS A CD  1 
ATOM   1661 C CE  . LYS A 1 266 ? 15.865 -28.973 -16.223 1.00 35.68 ? 474  LYS A CE  1 
ATOM   1662 N NZ  . LYS A 1 266 ? 15.151 -28.169 -17.232 1.00 43.52 ? 474  LYS A NZ  1 
ATOM   1663 N N   . LEU A 1 267 ? 20.111 -30.594 -13.082 1.00 25.31 ? 475  LEU A N   1 
ATOM   1664 C CA  . LEU A 1 267 ? 21.362 -30.112 -12.505 1.00 25.83 ? 475  LEU A CA  1 
ATOM   1665 C C   . LEU A 1 267 ? 21.922 -28.883 -13.221 1.00 29.00 ? 475  LEU A C   1 
ATOM   1666 O O   . LEU A 1 267 ? 22.309 -28.931 -14.403 1.00 29.04 ? 475  LEU A O   1 
ATOM   1667 C CB  . LEU A 1 267 ? 22.391 -31.246 -12.513 1.00 24.20 ? 475  LEU A CB  1 
ATOM   1668 C CG  . LEU A 1 267 ? 23.804 -30.864 -12.066 1.00 24.19 ? 475  LEU A CG  1 
ATOM   1669 C CD1 . LEU A 1 267 ? 23.737 -30.277 -10.623 1.00 26.84 ? 475  LEU A CD1 1 
ATOM   1670 C CD2 . LEU A 1 267 ? 24.713 -32.091 -12.107 1.00 24.22 ? 475  LEU A CD2 1 
ATOM   1671 N N   . ILE A 1 268 ? 21.945 -27.773 -12.496 1.00 28.40 ? 476  ILE A N   1 
ATOM   1672 C CA  . ILE A 1 268 ? 22.451 -26.503 -13.011 1.00 29.08 ? 476  ILE A CA  1 
ATOM   1673 C C   . ILE A 1 268 ? 23.516 -25.990 -12.033 1.00 32.28 ? 476  ILE A C   1 
ATOM   1674 O O   . ILE A 1 268 ? 23.250 -25.827 -10.826 1.00 31.16 ? 476  ILE A O   1 
ATOM   1675 C CB  . ILE A 1 268 ? 21.309 -25.482 -13.140 1.00 32.66 ? 476  ILE A CB  1 
ATOM   1676 C CG1 . ILE A 1 268 ? 20.272 -25.993 -14.162 1.00 31.29 ? 476  ILE A CG1 1 
ATOM   1677 C CG2 . ILE A 1 268 ? 21.861 -24.132 -13.578 1.00 33.22 ? 476  ILE A CG2 1 
ATOM   1678 C CD1 . ILE A 1 268 ? 18.997 -25.139 -14.236 1.00 32.54 ? 476  ILE A CD1 1 
ATOM   1679 N N   . LEU A 1 269 ? 24.719 -25.750 -12.550 1.00 32.25 ? 477  LEU A N   1 
ATOM   1680 C CA  . LEU A 1 269 ? 25.845 -25.303 -11.722 1.00 38.70 ? 477  LEU A CA  1 
ATOM   1681 C C   . LEU A 1 269 ? 25.881 -23.804 -11.409 1.00 41.11 ? 477  LEU A C   1 
ATOM   1682 O O   . LEU A 1 269 ? 26.825 -23.114 -11.750 1.00 44.26 ? 477  LEU A O   1 
ATOM   1683 C CB  . LEU A 1 269 ? 27.184 -25.729 -12.366 1.00 34.41 ? 477  LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 269 ? 27.355 -27.218 -12.709 1.00 35.53 ? 477  LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 269 ? 28.820 -27.548 -12.935 1.00 34.31 ? 477  LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 269 ? 26.822 -28.072 -11.576 1.00 34.65 ? 477  LEU A CD2 1 
ATOM   1687 N N   . SER A 1 270 ? 24.837 -23.314 -10.759 1.00 48.62 ? 478  SER A N   1 
ATOM   1688 C CA  . SER A 1 270 ? 24.741 -21.911 -10.364 1.00 55.17 ? 478  SER A CA  1 
ATOM   1689 C C   . SER A 1 270 ? 23.407 -21.756 -9.646  1.00 60.54 ? 478  SER A C   1 
ATOM   1690 O O   . SER A 1 270 ? 22.630 -22.714 -9.566  1.00 60.01 ? 478  SER A O   1 
ATOM   1691 C CB  . SER A 1 270 ? 24.788 -20.988 -11.586 1.00 52.59 ? 478  SER A CB  1 
ATOM   1692 O OG  . SER A 1 270 ? 23.655 -21.172 -12.406 1.00 53.07 ? 478  SER A OG  1 
ATOM   1693 N N   . TYR A 1 271 ? 23.136 -20.574 -9.103  1.00 66.87 ? 479  TYR A N   1 
ATOM   1694 C CA  . TYR A 1 271 ? 21.854 -20.390 -8.436  1.00 74.38 ? 479  TYR A CA  1 
ATOM   1695 C C   . TYR A 1 271 ? 20.848 -19.783 -9.413  1.00 75.42 ? 479  TYR A C   1 
ATOM   1696 O O   . TYR A 1 271 ? 21.295 -19.153 -10.396 1.00 76.43 ? 479  TYR A O   1 
ATOM   1697 C CB  . TYR A 1 271 ? 21.990 -19.486 -7.214  1.00 78.15 ? 479  TYR A CB  1 
ATOM   1698 C CG  . TYR A 1 271 ? 20.677 -19.307 -6.492  1.00 83.99 ? 479  TYR A CG  1 
ATOM   1699 C CD1 . TYR A 1 271 ? 20.022 -20.401 -5.923  1.00 85.89 ? 479  TYR A CD1 1 
ATOM   1700 C CD2 . TYR A 1 271 ? 20.061 -18.052 -6.416  1.00 86.49 ? 479  TYR A CD2 1 
ATOM   1701 C CE1 . TYR A 1 271 ? 18.782 -20.253 -5.296  1.00 88.61 ? 479  TYR A CE1 1 
ATOM   1702 C CE2 . TYR A 1 271 ? 18.820 -17.891 -5.792  1.00 88.10 ? 479  TYR A CE2 1 
ATOM   1703 C CZ  . TYR A 1 271 ? 18.187 -18.997 -5.234  1.00 89.77 ? 479  TYR A CZ  1 
ATOM   1704 O OH  . TYR A 1 271 ? 16.963 -18.852 -4.614  1.00 91.55 ? 479  TYR A OH  1 
HETATM 1705 O O   . HOH B 2 .   ? 48.809 -27.194 -17.625 1.00 24.69 ? 1001 HOH A O   1 
HETATM 1706 O O   . HOH B 2 .   ? 48.464 -28.372 -15.202 1.00 25.20 ? 1002 HOH A O   1 
HETATM 1707 O O   . HOH B 2 .   ? 49.496 -39.825 -17.035 1.00 27.19 ? 1003 HOH A O   1 
HETATM 1708 O O   . HOH B 2 .   ? 49.206 -26.433 -20.553 1.00 27.23 ? 1004 HOH A O   1 
HETATM 1709 O O   . HOH B 2 .   ? 36.499 -24.462 -26.605 1.00 29.21 ? 1005 HOH A O   1 
HETATM 1710 O O   . HOH B 2 .   ? 25.259 -25.370 -15.390 1.00 28.71 ? 1006 HOH A O   1 
HETATM 1711 O O   . HOH B 2 .   ? 43.033 -39.017 -30.317 1.00 30.26 ? 1007 HOH A O   1 
HETATM 1712 O O   . HOH B 2 .   ? 21.963 -31.249 -15.940 1.00 30.75 ? 1008 HOH A O   1 
HETATM 1713 O O   . HOH B 2 .   ? 36.121 -21.316 -28.467 1.00 29.35 ? 1009 HOH A O   1 
HETATM 1714 O O   . HOH B 2 .   ? 24.974 -41.053 -22.581 1.00 29.86 ? 1010 HOH A O   1 
HETATM 1715 O O   . HOH B 2 .   ? 20.416 -41.821 -16.734 1.00 29.71 ? 1011 HOH A O   1 
HETATM 1716 O O   . HOH B 2 .   ? 32.258 -30.643 -2.033  1.00 31.17 ? 1012 HOH A O   1 
HETATM 1717 O O   . HOH B 2 .   ? 20.537 -27.626 -9.889  1.00 29.73 ? 1013 HOH A O   1 
HETATM 1718 O O   . HOH B 2 .   ? 45.085 -33.758 -26.189 1.00 31.48 ? 1014 HOH A O   1 
HETATM 1719 O O   . HOH B 2 .   ? 20.902 -32.307 -3.172  1.00 34.06 ? 1015 HOH A O   1 
HETATM 1720 O O   . HOH B 2 .   ? 22.512 -30.470 -3.974  1.00 33.19 ? 1016 HOH A O   1 
HETATM 1721 O O   . HOH B 2 .   ? 21.417 -29.197 -25.652 1.00 33.76 ? 1017 HOH A O   1 
HETATM 1722 O O   . HOH B 2 .   ? 51.850 -43.093 -17.320 1.00 34.60 ? 1018 HOH A O   1 
HETATM 1723 O O   . HOH B 2 .   ? 44.007 -41.766 1.705   1.00 35.08 ? 1019 HOH A O   1 
HETATM 1724 O O   . HOH B 2 .   ? 28.768 -38.077 -24.498 1.00 36.79 ? 1020 HOH A O   1 
HETATM 1725 O O   . HOH B 2 .   ? 28.056 -40.001 -1.814  1.00 35.16 ? 1021 HOH A O   1 
HETATM 1726 O O   . HOH B 2 .   ? 19.818 -31.188 -24.774 1.00 35.27 ? 1022 HOH A O   1 
HETATM 1727 O O   . HOH B 2 .   ? 23.862 -39.941 -3.739  1.00 37.52 ? 1023 HOH A O   1 
HETATM 1728 O O   . HOH B 2 .   ? 45.621 -26.234 -5.557  1.00 38.03 ? 1024 HOH A O   1 
HETATM 1729 O O   . HOH B 2 .   ? 44.803 -19.713 -12.603 1.00 40.16 ? 1025 HOH A O   1 
HETATM 1730 O O   . HOH B 2 .   ? 32.163 -37.374 -36.360 1.00 36.33 ? 1026 HOH A O   1 
HETATM 1731 O O   . HOH B 2 .   ? 28.091 -18.209 -17.782 1.00 37.64 ? 1027 HOH A O   1 
HETATM 1732 O O   . HOH B 2 .   ? 52.672 -31.036 -14.515 1.00 37.06 ? 1028 HOH A O   1 
HETATM 1733 O O   . HOH B 2 .   ? 51.340 -28.681 -14.773 1.00 37.60 ? 1029 HOH A O   1 
HETATM 1734 O O   . HOH B 2 .   ? 27.742 -21.044 -10.216 1.00 37.49 ? 1030 HOH A O   1 
HETATM 1735 O O   . HOH B 2 .   ? 18.844 -31.207 -3.991  1.00 38.26 ? 1031 HOH A O   1 
HETATM 1736 O O   . HOH B 2 .   ? 27.001 -21.888 2.531   1.00 37.48 ? 1032 HOH A O   1 
HETATM 1737 O O   . HOH B 2 .   ? 36.661 -49.420 -14.082 1.00 40.23 ? 1033 HOH A O   1 
HETATM 1738 O O   . HOH B 2 .   ? 51.770 -44.268 -19.404 1.00 39.41 ? 1034 HOH A O   1 
HETATM 1739 O O   . HOH B 2 .   ? 17.435 -31.468 -22.520 1.00 41.42 ? 1035 HOH A O   1 
HETATM 1740 O O   . HOH B 2 .   ? 27.720 -41.473 -24.078 1.00 40.21 ? 1036 HOH A O   1 
HETATM 1741 O O   . HOH B 2 .   ? 19.368 -25.711 -22.410 1.00 40.34 ? 1037 HOH A O   1 
HETATM 1742 O O   . HOH B 2 .   ? 39.210 -22.201 -6.300  1.00 39.53 ? 1038 HOH A O   1 
HETATM 1743 O O   . HOH B 2 .   ? 35.162 -20.078 -5.969  1.00 40.22 ? 1039 HOH A O   1 
HETATM 1744 O O   . HOH B 2 .   ? 35.277 -42.403 -24.080 1.00 41.32 ? 1040 HOH A O   1 
HETATM 1745 O O   . HOH B 2 .   ? 27.069 -28.458 -30.514 1.00 41.14 ? 1041 HOH A O   1 
HETATM 1746 O O   . HOH B 2 .   ? 40.336 -36.554 4.640   1.00 38.83 ? 1042 HOH A O   1 
HETATM 1747 O O   . HOH B 2 .   ? 23.712 -35.024 -21.848 1.00 40.55 ? 1043 HOH A O   1 
HETATM 1748 O O   . HOH B 2 .   ? 46.543 -19.070 -14.639 1.00 43.91 ? 1044 HOH A O   1 
HETATM 1749 O O   . HOH B 2 .   ? 38.273 -17.998 -12.186 1.00 45.00 ? 1045 HOH A O   1 
HETATM 1750 O O   . HOH B 2 .   ? 54.522 -25.244 -22.080 1.00 41.60 ? 1046 HOH A O   1 
HETATM 1751 O O   . HOH B 2 .   ? 48.902 -32.828 -29.165 1.00 44.12 ? 1047 HOH A O   1 
HETATM 1752 O O   . HOH B 2 .   ? 27.641 -32.479 -34.611 1.00 43.86 ? 1048 HOH A O   1 
HETATM 1753 O O   . HOH B 2 .   ? 53.395 -35.248 -14.383 1.00 42.47 ? 1049 HOH A O   1 
HETATM 1754 O O   . HOH B 2 .   ? 51.744 -33.361 -13.886 1.00 43.19 ? 1050 HOH A O   1 
HETATM 1755 O O   . HOH B 2 .   ? 55.442 -30.632 -6.181  1.00 45.24 ? 1051 HOH A O   1 
HETATM 1756 O O   . HOH B 2 .   ? 56.392 -42.186 -16.321 1.00 46.87 ? 1052 HOH A O   1 
HETATM 1757 O O   . HOH B 2 .   ? 13.017 -35.271 -10.992 1.00 44.35 ? 1053 HOH A O   1 
HETATM 1758 O O   . HOH B 2 .   ? 54.200 -28.472 -27.384 1.00 46.53 ? 1054 HOH A O   1 
HETATM 1759 O O   . HOH B 2 .   ? 54.285 -26.029 -24.568 1.00 43.52 ? 1055 HOH A O   1 
HETATM 1760 O O   . HOH B 2 .   ? 18.258 -40.212 -17.532 1.00 45.10 ? 1056 HOH A O   1 
HETATM 1761 O O   . HOH B 2 .   ? 22.526 -30.103 -0.881  1.00 44.13 ? 1057 HOH A O   1 
HETATM 1762 O O   . HOH B 2 .   ? 51.827 -47.162 -19.240 1.00 47.13 ? 1058 HOH A O   1 
HETATM 1763 O O   . HOH B 2 .   ? 46.323 -47.647 -22.955 1.00 45.48 ? 1059 HOH A O   1 
HETATM 1764 O O   . HOH B 2 .   ? 29.800 -21.153 -25.037 1.00 45.54 ? 1060 HOH A O   1 
HETATM 1765 O O   . HOH B 2 .   ? 46.839 -34.176 2.582   1.00 45.68 ? 1061 HOH A O   1 
HETATM 1766 O O   . HOH B 2 .   ? 43.754 -33.420 -31.534 1.00 45.04 ? 1062 HOH A O   1 
HETATM 1767 O O   . HOH B 2 .   ? 44.487 -18.875 -16.251 1.00 45.51 ? 1063 HOH A O   1 
HETATM 1768 O O   . HOH B 2 .   ? 24.234 -35.863 2.522   1.00 46.47 ? 1064 HOH A O   1 
HETATM 1769 O O   . HOH B 2 .   ? 27.910 -20.696 -4.343  1.00 46.77 ? 1065 HOH A O   1 
HETATM 1770 O O   . HOH B 2 .   ? 13.768 -32.850 -12.693 1.00 49.57 ? 1066 HOH A O   1 
HETATM 1771 O O   . HOH B 2 .   ? 36.764 -27.000 2.143   1.00 50.72 ? 1067 HOH A O   1 
HETATM 1772 O O   . HOH B 2 .   ? 47.667 -32.013 -32.999 1.00 44.97 ? 1068 HOH A O   1 
HETATM 1773 O O   . HOH B 2 .   ? 54.865 -29.768 -24.464 1.00 47.06 ? 1069 HOH A O   1 
HETATM 1774 O O   . HOH B 2 .   ? 52.921 -28.737 -19.316 1.00 50.33 ? 1070 HOH A O   1 
HETATM 1775 O O   . HOH B 2 .   ? 40.817 -17.891 -17.221 1.00 48.47 ? 1071 HOH A O   1 
HETATM 1776 O O   . HOH B 2 .   ? 45.202 -51.261 -19.036 1.00 51.39 ? 1072 HOH A O   1 
HETATM 1777 O O   . HOH B 2 .   ? 45.813 -40.320 -37.649 1.00 48.85 ? 1073 HOH A O   1 
HETATM 1778 O O   . HOH B 2 .   ? 36.348 -22.419 -0.078  1.00 53.85 ? 1074 HOH A O   1 
HETATM 1779 O O   . HOH B 2 .   ? 41.618 -51.064 -17.866 1.00 53.78 ? 1075 HOH A O   1 
HETATM 1780 O O   . HOH B 2 .   ? 32.669 -50.394 -8.819  1.00 69.55 ? 1076 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   209 ?   ?   ?   A . n 
A 1 2   GLU 2   210 ?   ?   ?   A . n 
A 1 3   GLN 3   211 ?   ?   ?   A . n 
A 1 4   ARG 4   212 ?   ?   ?   A . n 
A 1 5   LEU 5   213 ?   ?   ?   A . n 
A 1 6   LYS 6   214 ?   ?   ?   A . n 
A 1 7   GLU 7   215 ?   ?   ?   A . n 
A 1 8   GLN 8   216 ?   ?   ?   A . n 
A 1 9   LEU 9   217 ?   ?   ?   A . n 
A 1 10  GLY 10  218 ?   ?   ?   A . n 
A 1 11  ALA 11  219 ?   ?   ?   A . n 
A 1 12  GLN 12  220 ?   ?   ?   A . n 
A 1 13  GLN 13  221 ?   ?   ?   A . n 
A 1 14  GLU 14  222 ?   ?   ?   A . n 
A 1 15  PRO 15  223 ?   ?   ?   A . n 
A 1 16  VAL 16  224 ?   ?   ?   A . n 
A 1 17  LYS 17  225 ?   ?   ?   A . n 
A 1 18  LYS 18  226 ?   ?   ?   A . n 
A 1 19  SER 19  227 ?   ?   ?   A . n 
A 1 20  ILE 20  228 ?   ?   ?   A . n 
A 1 21  GLN 21  229 ?   ?   ?   A . n 
A 1 22  GLU 22  230 ?   ?   ?   A . n 
A 1 23  SER 23  231 ?   ?   ?   A . n 
A 1 24  GLU 24  232 ?   ?   ?   A . n 
A 1 25  ALA 25  233 ?   ?   ?   A . n 
A 1 26  PHE 26  234 ?   ?   ?   A . n 
A 1 27  LEU 27  235 ?   ?   ?   A . n 
A 1 28  PRO 28  236 ?   ?   ?   A . n 
A 1 29  GLN 29  237 ?   ?   ?   A . n 
A 1 30  SER 30  238 ?   ?   ?   A . n 
A 1 31  ILE 31  239 ?   ?   ?   A . n 
A 1 32  PRO 32  240 240 PRO PRO A . n 
A 1 33  GLU 33  241 241 GLU GLU A . n 
A 1 34  GLU 34  242 242 GLU GLU A . n 
A 1 35  ARG 35  243 243 ARG ARG A . n 
A 1 36  TYR 36  244 244 TYR TYR A . n 
A 1 37  LYS 37  245 245 LYS LYS A . n 
A 1 38  MET 38  246 246 MET MET A . n 
A 1 39  LYS 39  247 247 LYS LYS A . n 
A 1 40  SER 40  248 248 SER SER A . n 
A 1 41  LYS 41  249 249 LYS LYS A . n 
A 1 42  PRO 42  250 250 PRO PRO A . n 
A 1 43  LEU 43  251 251 LEU LEU A . n 
A 1 44  GLY 44  252 252 GLY GLY A . n 
A 1 45  ILE 45  253 253 ILE ILE A . n 
A 1 46  CYS 46  254 254 CYS CYS A . n 
A 1 47  LEU 47  255 255 LEU LEU A . n 
A 1 48  ILE 48  256 256 ILE ILE A . n 
A 1 49  ILE 49  257 257 ILE ILE A . n 
A 1 50  ASP 50  258 258 ASP ASP A . n 
A 1 51  CYS 51  259 259 CYS CYS A . n 
A 1 52  ILE 52  260 260 ILE ILE A . n 
A 1 53  GLY 53  261 261 GLY GLY A . n 
A 1 54  ASN 54  262 262 ASN ASN A . n 
A 1 55  GLU 55  263 263 GLU GLU A . n 
A 1 56  THR 56  264 264 THR THR A . n 
A 1 57  GLU 57  265 265 GLU GLU A . n 
A 1 58  LEU 58  266 266 LEU LEU A . n 
A 1 59  LEU 59  267 267 LEU LEU A . n 
A 1 60  ARG 60  268 268 ARG ARG A . n 
A 1 61  ASP 61  269 269 ASP ASP A . n 
A 1 62  THR 62  270 270 THR THR A . n 
A 1 63  PHE 63  271 271 PHE PHE A . n 
A 1 64  THR 64  272 272 THR THR A . n 
A 1 65  SER 65  273 273 SER SER A . n 
A 1 66  LEU 66  274 274 LEU LEU A . n 
A 1 67  GLY 67  275 275 GLY GLY A . n 
A 1 68  TYR 68  276 276 TYR TYR A . n 
A 1 69  GLU 69  277 277 GLU GLU A . n 
A 1 70  VAL 70  278 278 VAL VAL A . n 
A 1 71  GLN 71  279 279 GLN GLN A . n 
A 1 72  LYS 72  280 280 LYS LYS A . n 
A 1 73  PHE 73  281 281 PHE PHE A . n 
A 1 74  LEU 74  282 282 LEU LEU A . n 
A 1 75  HIS 75  283 283 HIS HIS A . n 
A 1 76  LEU 76  284 284 LEU LEU A . n 
A 1 77  SER 77  285 285 SER SER A . n 
A 1 78  MET 78  286 286 MET MET A . n 
A 1 79  HIS 79  287 287 HIS HIS A . n 
A 1 80  GLY 80  288 288 GLY GLY A . n 
A 1 81  ILE 81  289 289 ILE ILE A . n 
A 1 82  SER 82  290 290 SER SER A . n 
A 1 83  GLN 83  291 291 GLN GLN A . n 
A 1 84  ILE 84  292 292 ILE ILE A . n 
A 1 85  LEU 85  293 293 LEU LEU A . n 
A 1 86  GLY 86  294 294 GLY GLY A . n 
A 1 87  GLN 87  295 295 GLN GLN A . n 
A 1 88  PHE 88  296 296 PHE PHE A . n 
A 1 89  ALA 89  297 297 ALA ALA A . n 
A 1 90  CYS 90  298 298 CYS CYS A . n 
A 1 91  MET 91  299 299 MET MET A . n 
A 1 92  PRO 92  300 300 PRO PRO A . n 
A 1 93  GLU 93  301 301 GLU GLU A . n 
A 1 94  HIS 94  302 302 HIS HIS A . n 
A 1 95  ARG 95  303 303 ARG ARG A . n 
A 1 96  ASP 96  304 304 ASP ASP A . n 
A 1 97  TYR 97  305 305 TYR TYR A . n 
A 1 98  ASP 98  306 306 ASP ASP A . n 
A 1 99  SER 99  307 307 SER SER A . n 
A 1 100 PHE 100 308 308 PHE PHE A . n 
A 1 101 VAL 101 309 309 VAL VAL A . n 
A 1 102 CYS 102 310 310 CYS CYS A . n 
A 1 103 VAL 103 311 311 VAL VAL A . n 
A 1 104 LEU 104 312 312 LEU LEU A . n 
A 1 105 VAL 105 313 313 VAL VAL A . n 
A 1 106 SER 106 314 314 SER SER A . n 
A 1 107 ARG 107 315 315 ARG ARG A . n 
A 1 108 GLY 108 316 316 GLY GLY A . n 
A 1 109 GLY 109 317 317 GLY GLY A . n 
A 1 110 SER 110 318 318 SER SER A . n 
A 1 111 GLN 111 319 319 GLN GLN A . n 
A 1 112 SER 112 320 320 SER SER A . n 
A 1 113 VAL 113 321 321 VAL VAL A . n 
A 1 114 TYR 114 322 322 TYR TYR A . n 
A 1 115 GLY 115 323 323 GLY GLY A . n 
A 1 116 VAL 116 324 324 VAL VAL A . n 
A 1 117 ASP 117 325 325 ASP ASP A . n 
A 1 118 GLN 118 326 326 GLN GLN A . n 
A 1 119 THR 119 327 327 THR THR A . n 
A 1 120 HIS 120 328 328 HIS HIS A . n 
A 1 121 SER 121 329 329 SER SER A . n 
A 1 122 GLY 122 330 330 GLY GLY A . n 
A 1 123 LEU 123 331 331 LEU LEU A . n 
A 1 124 PRO 124 332 332 PRO PRO A . n 
A 1 125 LEU 125 333 333 LEU LEU A . n 
A 1 126 HIS 126 334 334 HIS HIS A . n 
A 1 127 HIS 127 335 335 HIS HIS A . n 
A 1 128 ILE 128 336 336 ILE ILE A . n 
A 1 129 ARG 129 337 337 ARG ARG A . n 
A 1 130 ARG 130 338 338 ARG ARG A . n 
A 1 131 MET 131 339 339 MET MET A . n 
A 1 132 PHE 132 340 340 PHE PHE A . n 
A 1 133 MET 133 341 341 MET MET A . n 
A 1 134 GLY 134 342 342 GLY GLY A . n 
A 1 135 ASP 135 343 343 ASP ASP A . n 
A 1 136 SER 136 344 344 SER SER A . n 
A 1 137 CYS 137 345 345 CYS CYS A . n 
A 1 138 PRO 138 346 346 PRO PRO A . n 
A 1 139 TYR 139 347 347 TYR TYR A . n 
A 1 140 LEU 140 348 348 LEU LEU A . n 
A 1 141 ALA 141 349 349 ALA ALA A . n 
A 1 142 GLY 142 350 350 GLY GLY A . n 
A 1 143 LYS 143 351 351 LYS LYS A . n 
A 1 144 PRO 144 352 352 PRO PRO A . n 
A 1 145 LYS 145 353 353 LYS LYS A . n 
A 1 146 MET 146 354 354 MET MET A . n 
A 1 147 PHE 147 355 355 PHE PHE A . n 
A 1 148 PHE 148 356 356 PHE PHE A . n 
A 1 149 ILE 149 357 357 ILE ILE A . n 
A 1 150 GLN 150 358 358 GLN GLN A . n 
A 1 151 ASN 151 359 359 ASN ASN A . n 
A 1 152 TYR 152 360 360 TYR TYR A . n 
A 1 153 VAL 153 361 361 VAL VAL A . n 
A 1 154 VAL 154 362 362 VAL VAL A . n 
A 1 155 SER 155 363 363 SER SER A . n 
A 1 156 GLU 156 364 ?   ?   ?   A . n 
A 1 157 GLY 157 365 ?   ?   ?   A . n 
A 1 158 GLN 158 366 ?   ?   ?   A . n 
A 1 159 LEU 159 367 ?   ?   ?   A . n 
A 1 160 GLU 160 368 ?   ?   ?   A . n 
A 1 161 ASN 161 369 ?   ?   ?   A . n 
A 1 162 SER 162 370 ?   ?   ?   A . n 
A 1 163 SER 163 371 ?   ?   ?   A . n 
A 1 164 LEU 164 372 ?   ?   ?   A . n 
A 1 165 LEU 165 373 ?   ?   ?   A . n 
A 1 166 GLU 166 374 ?   ?   ?   A . n 
A 1 167 VAL 167 375 ?   ?   ?   A . n 
A 1 168 ASP 168 376 ?   ?   ?   A . n 
A 1 169 GLY 169 377 ?   ?   ?   A . n 
A 1 170 PRO 170 378 ?   ?   ?   A . n 
A 1 171 ALA 171 379 ?   ?   ?   A . n 
A 1 172 MET 172 380 ?   ?   ?   A . n 
A 1 173 LYS 173 381 ?   ?   ?   A . n 
A 1 174 ASN 174 382 ?   ?   ?   A . n 
A 1 175 VAL 175 383 ?   ?   ?   A . n 
A 1 176 GLU 176 384 ?   ?   ?   A . n 
A 1 177 PHE 177 385 ?   ?   ?   A . n 
A 1 178 LYS 178 386 ?   ?   ?   A . n 
A 1 179 ALA 179 387 ?   ?   ?   A . n 
A 1 180 GLN 180 388 ?   ?   ?   A . n 
A 1 181 LYS 181 389 ?   ?   ?   A . n 
A 1 182 ARG 182 390 ?   ?   ?   A . n 
A 1 183 GLY 183 391 ?   ?   ?   A . n 
A 1 184 LEU 184 392 ?   ?   ?   A . n 
A 1 185 CYS 185 393 ?   ?   ?   A . n 
A 1 186 THR 186 394 ?   ?   ?   A . n 
A 1 187 VAL 187 395 ?   ?   ?   A . n 
A 1 188 HIS 188 396 396 HIS HIS A . n 
A 1 189 ARG 189 397 397 ARG ARG A . n 
A 1 190 GLU 190 398 398 GLU GLU A . n 
A 1 191 ALA 191 399 399 ALA ALA A . n 
A 1 192 ASP 192 400 400 ASP ASP A . n 
A 1 193 PHE 193 401 401 PHE PHE A . n 
A 1 194 PHE 194 402 402 PHE PHE A . n 
A 1 195 TRP 195 403 403 TRP TRP A . n 
A 1 196 SER 196 404 404 SER SER A . n 
A 1 197 LEU 197 405 405 LEU LEU A . n 
A 1 198 CYS 198 406 406 CYS CYS A . n 
A 1 199 THR 199 407 407 THR THR A . n 
A 1 200 ALA 200 408 408 ALA ALA A . n 
A 1 201 ASP 201 409 409 ASP ASP A . n 
A 1 202 MET 202 410 410 MET MET A . n 
A 1 203 SER 203 411 411 SER SER A . n 
A 1 204 LEU 204 412 412 LEU LEU A . n 
A 1 205 LEU 205 413 413 LEU LEU A . n 
A 1 206 GLU 206 414 414 GLU GLU A . n 
A 1 207 GLN 207 415 415 GLN GLN A . n 
A 1 208 SER 208 416 416 SER SER A . n 
A 1 209 HIS 209 417 417 HIS HIS A . n 
A 1 210 SER 210 418 418 SER SER A . n 
A 1 211 SER 211 419 419 SER SER A . n 
A 1 212 PRO 212 420 420 PRO PRO A . n 
A 1 213 SER 213 421 421 SER SER A . n 
A 1 214 LEU 214 422 422 LEU LEU A . n 
A 1 215 TYR 215 423 423 TYR TYR A . n 
A 1 216 LEU 216 424 424 LEU LEU A . n 
A 1 217 GLN 217 425 425 GLN GLN A . n 
A 1 218 CYS 218 426 426 CYS CYS A . n 
A 1 219 LEU 219 427 427 LEU LEU A . n 
A 1 220 SER 220 428 428 SER SER A . n 
A 1 221 GLN 221 429 429 GLN GLN A . n 
A 1 222 LYS 222 430 430 LYS LYS A . n 
A 1 223 LEU 223 431 431 LEU LEU A . n 
A 1 224 ARG 224 432 432 ARG ARG A . n 
A 1 225 GLN 225 433 433 GLN GLN A . n 
A 1 226 GLU 226 434 434 GLU GLU A . n 
A 1 227 ARG 227 435 435 ARG ARG A . n 
A 1 228 LYS 228 436 436 LYS LYS A . n 
A 1 229 ARG 229 437 437 ARG ARG A . n 
A 1 230 PRO 230 438 438 PRO PRO A . n 
A 1 231 LEU 231 439 439 LEU LEU A . n 
A 1 232 LEU 232 440 440 LEU LEU A . n 
A 1 233 ASP 233 441 441 ASP ASP A . n 
A 1 234 LEU 234 442 442 LEU LEU A . n 
A 1 235 HIS 235 443 443 HIS HIS A . n 
A 1 236 ILE 236 444 444 ILE ILE A . n 
A 1 237 GLU 237 445 445 GLU GLU A . n 
A 1 238 LEU 238 446 446 LEU LEU A . n 
A 1 239 ASN 239 447 447 ASN ASN A . n 
A 1 240 GLY 240 448 448 GLY GLY A . n 
A 1 241 TYR 241 449 449 TYR TYR A . n 
A 1 242 MET 242 450 450 MET MET A . n 
A 1 243 TYR 243 451 451 TYR TYR A . n 
A 1 244 ASP 244 452 452 ASP ASP A . n 
A 1 245 TRP 245 453 453 TRP TRP A . n 
A 1 246 ASN 246 454 454 ASN ASN A . n 
A 1 247 SER 247 455 455 SER SER A . n 
A 1 248 ARG 248 456 456 ARG ARG A . n 
A 1 249 VAL 249 457 457 VAL VAL A . n 
A 1 250 SER 250 458 458 SER SER A . n 
A 1 251 ALA 251 459 459 ALA ALA A . n 
A 1 252 LYS 252 460 460 LYS LYS A . n 
A 1 253 GLU 253 461 461 GLU GLU A . n 
A 1 254 LYS 254 462 462 LYS LYS A . n 
A 1 255 TYR 255 463 463 TYR TYR A . n 
A 1 256 TYR 256 464 464 TYR TYR A . n 
A 1 257 VAL 257 465 465 VAL VAL A . n 
A 1 258 TRP 258 466 466 TRP TRP A . n 
A 1 259 LEU 259 467 467 LEU LEU A . n 
A 1 260 GLN 260 468 468 GLN GLN A . n 
A 1 261 HIS 261 469 469 HIS HIS A . n 
A 1 262 THR 262 470 470 THR THR A . n 
A 1 263 LEU 263 471 471 LEU LEU A . n 
A 1 264 ARG 264 472 472 ARG ARG A . n 
A 1 265 LYS 265 473 473 LYS LYS A . n 
A 1 266 LYS 266 474 474 LYS LYS A . n 
A 1 267 LEU 267 475 475 LEU LEU A . n 
A 1 268 ILE 268 476 476 ILE ILE A . n 
A 1 269 LEU 269 477 477 LEU LEU A . n 
A 1 270 SER 270 478 478 SER SER A . n 
A 1 271 TYR 271 479 479 TYR TYR A . n 
A 1 272 THR 272 480 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_554 -x,-x+y,-z-2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -40.9066666667 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-04-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS     'data collection' .   ? 1 
PHASER    phasing           .   ? 2 
CNS       refinement        1.2 ? 3 
DENZO     'data reduction'  .   ? 4 
SCALEPACK 'data scaling'    .   ? 5 
# 
_pdbx_entry_details.sequence_details     
;AUTHORS STATE THAT THIS SEQUENCE DISCREPANCY MAY BE DUE TO VARIATIONS AMONG DIFFERENT CONSTRUCTS IN THE DATABASES. RESIDUE 369 IS ASN IN GENBANK ENTRY CAA74366.1
;
_pdbx_entry_details.entry_id             3H13 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLN 
_pdbx_validate_symm_contact.auth_seq_id_1     468 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLN 
_pdbx_validate_symm_contact.auth_seq_id_2     468 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_554 
_pdbx_validate_symm_contact.dist              1.82 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     416 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -160.13 
_pdbx_validate_torsion.psi             98.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 209 ? A LYS 1   
2  1 Y 1 A GLU 210 ? A GLU 2   
3  1 Y 1 A GLN 211 ? A GLN 3   
4  1 Y 1 A ARG 212 ? A ARG 4   
5  1 Y 1 A LEU 213 ? A LEU 5   
6  1 Y 1 A LYS 214 ? A LYS 6   
7  1 Y 1 A GLU 215 ? A GLU 7   
8  1 Y 1 A GLN 216 ? A GLN 8   
9  1 Y 1 A LEU 217 ? A LEU 9   
10 1 Y 1 A GLY 218 ? A GLY 10  
11 1 Y 1 A ALA 219 ? A ALA 11  
12 1 Y 1 A GLN 220 ? A GLN 12  
13 1 Y 1 A GLN 221 ? A GLN 13  
14 1 Y 1 A GLU 222 ? A GLU 14  
15 1 Y 1 A PRO 223 ? A PRO 15  
16 1 Y 1 A VAL 224 ? A VAL 16  
17 1 Y 1 A LYS 225 ? A LYS 17  
18 1 Y 1 A LYS 226 ? A LYS 18  
19 1 Y 1 A SER 227 ? A SER 19  
20 1 Y 1 A ILE 228 ? A ILE 20  
21 1 Y 1 A GLN 229 ? A GLN 21  
22 1 Y 1 A GLU 230 ? A GLU 22  
23 1 Y 1 A SER 231 ? A SER 23  
24 1 Y 1 A GLU 232 ? A GLU 24  
25 1 Y 1 A ALA 233 ? A ALA 25  
26 1 Y 1 A PHE 234 ? A PHE 26  
27 1 Y 1 A LEU 235 ? A LEU 27  
28 1 Y 1 A PRO 236 ? A PRO 28  
29 1 Y 1 A GLN 237 ? A GLN 29  
30 1 Y 1 A SER 238 ? A SER 30  
31 1 Y 1 A ILE 239 ? A ILE 31  
32 1 Y 1 A GLU 364 ? A GLU 156 
33 1 Y 1 A GLY 365 ? A GLY 157 
34 1 Y 1 A GLN 366 ? A GLN 158 
35 1 Y 1 A LEU 367 ? A LEU 159 
36 1 Y 1 A GLU 368 ? A GLU 160 
37 1 Y 1 A ASN 369 ? A ASN 161 
38 1 Y 1 A SER 370 ? A SER 162 
39 1 Y 1 A SER 371 ? A SER 163 
40 1 Y 1 A LEU 372 ? A LEU 164 
41 1 Y 1 A LEU 373 ? A LEU 165 
42 1 Y 1 A GLU 374 ? A GLU 166 
43 1 Y 1 A VAL 375 ? A VAL 167 
44 1 Y 1 A ASP 376 ? A ASP 168 
45 1 Y 1 A GLY 377 ? A GLY 169 
46 1 Y 1 A PRO 378 ? A PRO 170 
47 1 Y 1 A ALA 379 ? A ALA 171 
48 1 Y 1 A MET 380 ? A MET 172 
49 1 Y 1 A LYS 381 ? A LYS 173 
50 1 Y 1 A ASN 382 ? A ASN 174 
51 1 Y 1 A VAL 383 ? A VAL 175 
52 1 Y 1 A GLU 384 ? A GLU 176 
53 1 Y 1 A PHE 385 ? A PHE 177 
54 1 Y 1 A LYS 386 ? A LYS 178 
55 1 Y 1 A ALA 387 ? A ALA 179 
56 1 Y 1 A GLN 388 ? A GLN 180 
57 1 Y 1 A LYS 389 ? A LYS 181 
58 1 Y 1 A ARG 390 ? A ARG 182 
59 1 Y 1 A GLY 391 ? A GLY 183 
60 1 Y 1 A LEU 392 ? A LEU 184 
61 1 Y 1 A CYS 393 ? A CYS 185 
62 1 Y 1 A THR 394 ? A THR 186 
63 1 Y 1 A VAL 395 ? A VAL 187 
64 1 Y 1 A THR 480 ? A THR 272 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1001 1001 HOH WAT A . 
B 2 HOH 2  1002 1002 HOH WAT A . 
B 2 HOH 3  1003 1003 HOH WAT A . 
B 2 HOH 4  1004 1004 HOH WAT A . 
B 2 HOH 5  1005 1005 HOH WAT A . 
B 2 HOH 6  1006 1006 HOH WAT A . 
B 2 HOH 7  1007 1007 HOH WAT A . 
B 2 HOH 8  1008 1008 HOH WAT A . 
B 2 HOH 9  1009 1009 HOH WAT A . 
B 2 HOH 10 1010 1010 HOH WAT A . 
B 2 HOH 11 1011 1011 HOH WAT A . 
B 2 HOH 12 1012 1012 HOH WAT A . 
B 2 HOH 13 1013 1013 HOH WAT A . 
B 2 HOH 14 1014 1014 HOH WAT A . 
B 2 HOH 15 1015 1015 HOH WAT A . 
B 2 HOH 16 1016 1016 HOH WAT A . 
B 2 HOH 17 1017 1017 HOH WAT A . 
B 2 HOH 18 1018 1018 HOH WAT A . 
B 2 HOH 19 1019 1019 HOH WAT A . 
B 2 HOH 20 1020 1020 HOH WAT A . 
B 2 HOH 21 1021 1021 HOH WAT A . 
B 2 HOH 22 1022 1022 HOH WAT A . 
B 2 HOH 23 1023 1023 HOH WAT A . 
B 2 HOH 24 1024 1024 HOH WAT A . 
B 2 HOH 25 1025 1025 HOH WAT A . 
B 2 HOH 26 1026 1026 HOH WAT A . 
B 2 HOH 27 1027 1027 HOH WAT A . 
B 2 HOH 28 1028 1028 HOH WAT A . 
B 2 HOH 29 1029 1029 HOH WAT A . 
B 2 HOH 30 1030 1030 HOH WAT A . 
B 2 HOH 31 1031 1031 HOH WAT A . 
B 2 HOH 32 1032 1032 HOH WAT A . 
B 2 HOH 33 1033 1033 HOH WAT A . 
B 2 HOH 34 1034 1034 HOH WAT A . 
B 2 HOH 35 1035 1035 HOH WAT A . 
B 2 HOH 36 1036 1036 HOH WAT A . 
B 2 HOH 37 1037 1037 HOH WAT A . 
B 2 HOH 38 1038 1038 HOH WAT A . 
B 2 HOH 39 1039 1039 HOH WAT A . 
B 2 HOH 40 1040 1040 HOH WAT A . 
B 2 HOH 41 1041 1041 HOH WAT A . 
B 2 HOH 42 1042 1042 HOH WAT A . 
B 2 HOH 43 1043 1043 HOH WAT A . 
B 2 HOH 44 1044 1044 HOH WAT A . 
B 2 HOH 45 1045 1045 HOH WAT A . 
B 2 HOH 46 1046 1046 HOH WAT A . 
B 2 HOH 47 1047 1047 HOH WAT A . 
B 2 HOH 48 1048 1048 HOH WAT A . 
B 2 HOH 49 1049 1049 HOH WAT A . 
B 2 HOH 50 1050 1050 HOH WAT A . 
B 2 HOH 51 1051 1051 HOH WAT A . 
B 2 HOH 52 1052 1052 HOH WAT A . 
B 2 HOH 53 1053 1053 HOH WAT A . 
B 2 HOH 54 1054 1054 HOH WAT A . 
B 2 HOH 55 1055 1055 HOH WAT A . 
B 2 HOH 56 1056 1056 HOH WAT A . 
B 2 HOH 57 1057 1057 HOH WAT A . 
B 2 HOH 58 1058 1058 HOH WAT A . 
B 2 HOH 59 1059 1059 HOH WAT A . 
B 2 HOH 60 1060 1060 HOH WAT A . 
B 2 HOH 61 1061 1061 HOH WAT A . 
B 2 HOH 62 1062 1062 HOH WAT A . 
B 2 HOH 63 1063 1063 HOH WAT A . 
B 2 HOH 64 1064 1064 HOH WAT A . 
B 2 HOH 65 1065 1065 HOH WAT A . 
B 2 HOH 66 1066 1066 HOH WAT A . 
B 2 HOH 67 1067 1067 HOH WAT A . 
B 2 HOH 68 1068 1068 HOH WAT A . 
B 2 HOH 69 1069 1069 HOH WAT A . 
B 2 HOH 70 1070 1070 HOH WAT A . 
B 2 HOH 71 1071 1071 HOH WAT A . 
B 2 HOH 72 1072 1072 HOH WAT A . 
B 2 HOH 73 1073 1073 HOH WAT A . 
B 2 HOH 74 1074 1074 HOH WAT A . 
B 2 HOH 75 1075 1075 HOH WAT A . 
B 2 HOH 76 1076 1076 HOH WAT A . 
#