data_3H1I
# 
_entry.id   3H1I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H1I         
RCSB  RCSB052573   
WWPDB D_1000052573 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3bcc 
;STIGMATELLIN-BOUND CYTOCHROME BC1 COMPLEX FROM CHICKEN.    
The current entry is a further refinement of this structure, which it will make obsolete.
;
unspecified 
PDB 1ppj 'Bovine bc1 complex with antimycin and stigmatellin bound' unspecified 
PDB 3H1H . unspecified 
PDB 3H1J . unspecified 
PDB 3H1K . unspecified 
PDB 3H1L . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H1I 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Z.'         1 
'Huang, L.'         2 
'Shulmeister, V.M.' 3 
'Chi, Y.I.'         4 
'Kim, K.K.'         5 
'Hung, L.W.'        6 
'Crofts, A.R.'      7 
'Berry, E.A.'       8 
'Kim, S.H.'         9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Electron Transfer by Domain Movement in Cytochrome Bc1' Nature               392 677 684 1998 NATUAS UK 0028-0836 0006 ? 
9565029 ? 
1       
;Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial Bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-Bonding Pattern.
;
J.Mol.Biol.          351 573 597 2005 JMOBAK UK 0022-2836 0070 ? ?       ? 
2       'The Structure of the Avian Mitochondrial Cytochrome bc1 Complex.' J.BIOENERG.BIOMEMBR. 31  177 190 1999 ?      US 
0145-479X ?    ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Z.'         1  
primary 'Huang, L.'         2  
primary 'Shulmeister, V.M.' 3  
primary 'Chi, Y.I.'         4  
primary 'Kim, K.K.'         5  
primary 'Hung, L.W.'        6  
primary 'Crofts, A.R.'      7  
primary 'Berry, E.A.'       8  
primary 'Kim, S.H.'         9  
1       'Huang, L.S.'       10 
1       'Cobessi, D.'       11 
1       'Tung, E.Y.'        12 
1       'Berry, E.A.'       13 
2       'Berry, E.A.'       14 
2       'Huang, L.S.'       15 
2       'Zhang, Z.'         16 
2       'Kim, S.H.'         17 
# 
_cell.entry_id           3H1I 
_cell.length_a           174.693 
_cell.length_b           181.666 
_cell.length_c           240.732 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H1I 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MITOCHONDRIAL' 49503.840 2  1.10.2.2 ? ? ? 
2  polymer     nat 'UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2, MITOCHONDRIAL' 46683.809 2  1.10.2.2 ? ? ? 
3  polymer     nat 'Cytochrome b' 42622.977 2  1.10.2.2 ? ?                                   ? 
4  polymer     nat 'CYTOCHROME C1, HEME PROTEIN, MITOCHONDRIAL' 26973.744 2  1.10.2.2 ? ?                                   ? 
5  polymer     nat 'Cytochrome b-c1 complex subunit Rieske, mitochondrial' 21506.188 2  1.10.2.2 ? 
'sequence database residues 77-272' ? 
6  polymer     nat 'UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KDA PROTEIN' 13394.397 2  1.10.2.2 ? ? ? 
7  polymer     nat 'UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX UBIQUINONE-BINDING PROTEIN QP-C' 9498.735  2  1.10.2.2 ? ? ? 
8  polymer     nat 'UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 11 KDA PROTEIN' 9057.119  2  1.10.2.2 ? ? ? 
9  polymer     nat 'Cytochrome b-c1 complex subunit Rieske, mitochondrial' 4785.649  2  1.10.2.2 ? 
'sequence database residues 1-76'   ? 
10 polymer     nat 'UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 7.2 KDA PROTEIN' 7005.963  2  1.10.2.2 ? ? ? 
11 non-polymer syn 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine 749.073   6  ?        ? ?                                   ? 
12 non-polymer syn 'UNKNOWN LIGAND' ?         10 ?        ? ?                                   ? 
13 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4  ?        ? ?                                   ? 
14 non-polymer syn 'STIGMATELLIN A' 514.650   2  ?        ? ?                                   ? 
15 non-polymer syn 
'2-METHYL-BUTYRIC ACID 3-(3-FORMYLAMINO-2-HYDROXY-BENZOYLAMINO)-8-HEPTYL-2,6-DIMETHYL-4,9-DIOXO-[1,5]DIOXONAN-7-YL ESTER' 562.652 
2  ?        ? ?                                   ? 
16 non-polymer syn CARDIOLIPIN 1464.043  4  ?        ? ?                                   ? 
17 non-polymer syn GLYCEROL 92.094    2  ?        ? ?                                   ? 
18 non-polymer syn 'HEME C' 618.503   2  ?        ? ?                                   ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820   2  ?        ? ?                                   ? 
20 non-polymer syn 'DIUNDECYL PHOSPHATIDYL CHOLINE' 622.834   2  ?        ? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'CYTOCHROME BC1 COMPLEX, COMPLEX III' 
2  'COMPLEX III SUBUNIT II' 
3  
;Ubiquinol-cytochrome-c reductase complex cytochrome b subunit, Cytochrome b-c1 complex subunit 3, Complex III subunit 3, Complex III subunit III
;
4  'CYTOCHROME C-1' 
5  'Ubiquinol-cytochrome c reductase iron-sulfur subunit, Rieske iron-sulfur protein, RISP, Complex III subunit 5' 
6  'COMPLEX III SUBUNIT VI' 
7  'UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 9.5 KDA PROTEIN, COMPLEX III SUBUNIT VII' 
8  'MITOCHONDRIAL HINGE PROTEIN, CYTOCHROME C1, NONHEME 11 KDA PROTEIN, COMPLEX III SUBUNIT VIII' 
9  'Ubiquinol-cytochrome c reductase iron-sulfur subunit, Rieske iron-sulfur protein, RISP, Complex III subunit 5' 
10 'CYTOCHROME C1, NONHEME 7 KDA PROTEIN, COMPLEX III SUBUNIT X' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
A,N ? 
2  'polypeptide(L)' no no 
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
B,O ? 
3  'polypeptide(L)' no no 
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
C,P ? 
4  'polypeptide(L)' no no 
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
D,Q ? 
5  'polypeptide(L)' no no 
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
E,R ? 
6  'polypeptide(L)' no no 
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
F,S ? 
7  'polypeptide(L)' no no 
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
G,T ? 
8  'polypeptide(L)' no no LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK 
LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK H,U ? 
9  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)RPLLC
RESMSGRSARRDLVAGISLNAPASVRY
;
XXXXXXXXXXXXXXXRPLLCRESMSGRSARRDLVAGISLNAPASVRY I,V ? 
10 'polypeptide(L)' no no ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE 
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE J,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   ALA n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   THR n 
1  8   LEU n 
1  9   GLN n 
1  10  ASN n 
1  11  ILE n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  ASN n 
1  16  VAL n 
1  17  THR n 
1  18  THR n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLU n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  GLY n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  ASN n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  LYS n 
1  70  ARG n 
1  71  PRO n 
1  72  CYS n 
1  73  ALA n 
1  74  ALA n 
1  75  PHE n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  PHE n 
1  87  ASN n 
1  88  GLY n 
1  89  TYR n 
1  90  THR n 
1  91  SER n 
1  92  ARG n 
1  93  GLU n 
1  94  GLN n 
1  95  THR n 
1  96  ALA n 
1  97  PHE n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 MET n 
1  107 PRO n 
1  108 LYS n 
1  109 VAL n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 VAL n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 ALA n 
1  122 LEU n 
1  123 GLU n 
1  124 GLU n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 GLY n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 LYS n 
1  140 GLU n 
1  141 MET n 
1  142 ASP n 
1  143 ASN n 
1  144 ASP n 
1  145 MET n 
1  146 THR n 
1  147 ASN n 
1  148 VAL n 
1  149 THR n 
1  150 PHE n 
1  151 ASP n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 ALA n 
1  163 LEU n 
1  164 ALA n 
1  165 ARG n 
1  166 THR n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 THR n 
1  171 THR n 
1  172 GLU n 
1  173 ASN n 
1  174 ILE n 
1  175 LYS n 
1  176 HIS n 
1  177 LEU n 
1  178 THR n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 ALA n 
1  184 SER n 
1  185 TYR n 
1  186 ILE n 
1  187 ASP n 
1  188 THR n 
1  189 HIS n 
1  190 PHE n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 ILE n 
1  204 SER n 
1  205 HIS n 
1  206 LYS n 
1  207 GLU n 
1  208 LEU n 
1  209 VAL n 
1  210 ASP n 
1  211 ALA n 
1  212 ALA n 
1  213 ARG n 
1  214 GLN n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 VAL n 
1  220 SER n 
1  221 PHE n 
1  222 THR n 
1  223 TYR n 
1  224 LYS n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 LEU n 
1  232 PRO n 
1  233 ARG n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLU n 
1  241 ILE n 
1  242 ARG n 
1  243 ALA n 
1  244 ARG n 
1  245 ASP n 
1  246 ASP n 
1  247 ALA n 
1  248 LEU n 
1  249 PRO n 
1  250 VAL n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 LEU n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 ASP n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 VAL n 
1  270 LEU n 
1  271 HIS n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 ARG n 
1  280 TYR n 
1  281 ASP n 
1  282 ARG n 
1  283 THR n 
1  284 PHE n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 LYS n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 ARG n 
1  294 LEU n 
1  295 ALA n 
1  296 ALA n 
1  297 LEU n 
1  298 ALA n 
1  299 VAL n 
1  300 GLU n 
1  301 HIS n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 HIS n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 THR n 
1  313 SER n 
1  314 TYR n 
1  315 SER n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 PHE n 
1  321 GLY n 
1  322 PHE n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 ALA n 
1  327 ASP n 
1  328 PRO n 
1  329 LEU n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 CYS n 
1  338 ALA n 
1  339 GLN n 
1  340 GLY n 
1  341 GLU n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 THR n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LYS n 
1  356 ARG n 
1  357 ALA n 
1  358 LYS n 
1  359 ASN n 
1  360 HIS n 
1  361 LEU n 
1  362 ARG n 
1  363 SER n 
1  364 ALA n 
1  365 MET n 
1  366 VAL n 
1  367 ALA n 
1  368 GLN n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 THR n 
1  379 ILE n 
1  380 GLY n 
1  381 SER n 
1  382 HIS n 
1  383 LEU n 
1  384 LEU n 
1  385 ASN n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 SER n 
1  392 LEU n 
1  393 GLU n 
1  394 GLU n 
1  395 TRP n 
1  396 ASP n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 SER n 
1  401 ALA n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 MET n 
1  407 VAL n 
1  408 ARG n 
1  409 ASP n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 ILE n 
1  416 TYR n 
1  417 ASP n 
1  418 LYS n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 LEU n 
1  423 ALA n 
1  424 ALA n 
1  425 VAL n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 LEU n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 TYR n 
1  443 TRP n 
1  444 ILE n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   ALA n 
2  10  VAL n 
2  11  SER n 
2  12  ALA n 
2  13  ALA n 
2  14  ALA n 
2  15  GLU n 
2  16  ARG n 
2  17  VAL n 
2  18  LYS n 
2  19  LEU n 
2  20  CYS n 
2  21  PRO n 
2  22  GLY n 
2  23  ALA n 
2  24  GLU n 
2  25  ASP n 
2  26  LEU n 
2  27  GLU n 
2  28  ILE n 
2  29  THR n 
2  30  LYS n 
2  31  LEU n 
2  32  PRO n 
2  33  ASN n 
2  34  GLY n 
2  35  LEU n 
2  36  ILE n 
2  37  ILE n 
2  38  ALA n 
2  39  SER n 
2  40  LEU n 
2  41  GLU n 
2  42  ASN n 
2  43  PHE n 
2  44  SER n 
2  45  PRO n 
2  46  ALA n 
2  47  SER n 
2  48  ARG n 
2  49  ILE n 
2  50  GLY n 
2  51  VAL n 
2  52  PHE n 
2  53  ILE n 
2  54  LYS n 
2  55  ALA n 
2  56  GLY n 
2  57  SER n 
2  58  ARG n 
2  59  TYR n 
2  60  GLU n 
2  61  THR n 
2  62  THR n 
2  63  ALA n 
2  64  ASN n 
2  65  LEU n 
2  66  GLY n 
2  67  THR n 
2  68  ALA n 
2  69  HIS n 
2  70  LEU n 
2  71  LEU n 
2  72  ARG n 
2  73  LEU n 
2  74  ALA n 
2  75  SER n 
2  76  PRO n 
2  77  LEU n 
2  78  THR n 
2  79  THR n 
2  80  LYS n 
2  81  GLY n 
2  82  ALA n 
2  83  SER n 
2  84  SER n 
2  85  PHE n 
2  86  ARG n 
2  87  ILE n 
2  88  THR n 
2  89  ARG n 
2  90  GLY n 
2  91  ILE n 
2  92  GLU n 
2  93  ALA n 
2  94  VAL n 
2  95  GLY n 
2  96  GLY n 
2  97  SER n 
2  98  LEU n 
2  99  SER n 
2  100 VAL n 
2  101 TYR n 
2  102 SER n 
2  103 THR n 
2  104 ARG n 
2  105 GLU n 
2  106 LYS n 
2  107 MET n 
2  108 THR n 
2  109 TYR n 
2  110 CYS n 
2  111 VAL n 
2  112 GLU n 
2  113 CYS n 
2  114 LEU n 
2  115 ARG n 
2  116 ASP n 
2  117 HIS n 
2  118 VAL n 
2  119 ASP n 
2  120 THR n 
2  121 VAL n 
2  122 MET n 
2  123 GLU n 
2  124 TYR n 
2  125 LEU n 
2  126 LEU n 
2  127 ASN n 
2  128 VAL n 
2  129 THR n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 GLU n 
2  134 PHE n 
2  135 ARG n 
2  136 PRO n 
2  137 TRP n 
2  138 GLU n 
2  139 VAL n 
2  140 THR n 
2  141 ASP n 
2  142 LEU n 
2  143 GLN n 
2  144 PRO n 
2  145 GLN n 
2  146 LEU n 
2  147 LYS n 
2  148 VAL n 
2  149 ASP n 
2  150 LYS n 
2  151 ALA n 
2  152 VAL n 
2  153 ALA n 
2  154 PHE n 
2  155 GLN n 
2  156 SER n 
2  157 PRO n 
2  158 GLN n 
2  159 VAL n 
2  160 GLY n 
2  161 VAL n 
2  162 LEU n 
2  163 GLU n 
2  164 ASN n 
2  165 LEU n 
2  166 HIS n 
2  167 ALA n 
2  168 ALA n 
2  169 ALA n 
2  170 TYR n 
2  171 LYS n 
2  172 THR n 
2  173 ALA n 
2  174 LEU n 
2  175 ALA n 
2  176 ASN n 
2  177 PRO n 
2  178 LEU n 
2  179 TYR n 
2  180 CYS n 
2  181 PRO n 
2  182 ASP n 
2  183 TYR n 
2  184 ARG n 
2  185 ILE n 
2  186 GLY n 
2  187 LYS n 
2  188 ILE n 
2  189 THR n 
2  190 SER n 
2  191 GLU n 
2  192 GLN n 
2  193 LEU n 
2  194 HIS n 
2  195 HIS n 
2  196 PHE n 
2  197 VAL n 
2  198 GLN n 
2  199 ASN n 
2  200 ASN n 
2  201 PHE n 
2  202 THR n 
2  203 SER n 
2  204 ALA n 
2  205 ARG n 
2  206 MET n 
2  207 ALA n 
2  208 LEU n 
2  209 VAL n 
2  210 GLY n 
2  211 ILE n 
2  212 GLY n 
2  213 VAL n 
2  214 LYS n 
2  215 HIS n 
2  216 SER n 
2  217 ASP n 
2  218 LEU n 
2  219 LYS n 
2  220 GLN n 
2  221 VAL n 
2  222 ALA n 
2  223 GLU n 
2  224 GLN n 
2  225 PHE n 
2  226 LEU n 
2  227 ASN n 
2  228 ILE n 
2  229 ARG n 
2  230 SER n 
2  231 GLY n 
2  232 ALA n 
2  233 GLY n 
2  234 THR n 
2  235 SER n 
2  236 SER n 
2  237 ALA n 
2  238 LYS n 
2  239 ALA n 
2  240 THR n 
2  241 TYR n 
2  242 TRP n 
2  243 GLY n 
2  244 GLY n 
2  245 GLU n 
2  246 ILE n 
2  247 ARG n 
2  248 GLU n 
2  249 GLN n 
2  250 ASN n 
2  251 GLY n 
2  252 HIS n 
2  253 SER n 
2  254 LEU n 
2  255 VAL n 
2  256 HIS n 
2  257 ALA n 
2  258 ALA n 
2  259 VAL n 
2  260 VAL n 
2  261 THR n 
2  262 GLU n 
2  263 GLY n 
2  264 ALA n 
2  265 ALA n 
2  266 VAL n 
2  267 GLY n 
2  268 SER n 
2  269 ALA n 
2  270 GLU n 
2  271 ALA n 
2  272 ASN n 
2  273 ALA n 
2  274 PHE n 
2  275 SER n 
2  276 VAL n 
2  277 LEU n 
2  278 GLN n 
2  279 HIS n 
2  280 VAL n 
2  281 LEU n 
2  282 GLY n 
2  283 ALA n 
2  284 GLY n 
2  285 PRO n 
2  286 LEU n 
2  287 ILE n 
2  288 LYS n 
2  289 ARG n 
2  290 GLY n 
2  291 SER n 
2  292 SER n 
2  293 VAL n 
2  294 THR n 
2  295 SER n 
2  296 LYS n 
2  297 LEU n 
2  298 TYR n 
2  299 GLN n 
2  300 GLY n 
2  301 VAL n 
2  302 ALA n 
2  303 LYS n 
2  304 ALA n 
2  305 THR n 
2  306 THR n 
2  307 GLN n 
2  308 PRO n 
2  309 PHE n 
2  310 ASP n 
2  311 ALA n 
2  312 SER n 
2  313 ALA n 
2  314 PHE n 
2  315 ASN n 
2  316 VAL n 
2  317 ASN n 
2  318 TYR n 
2  319 SER n 
2  320 ASP n 
2  321 SER n 
2  322 GLY n 
2  323 LEU n 
2  324 PHE n 
2  325 GLY n 
2  326 PHE n 
2  327 TYR n 
2  328 THR n 
2  329 ILE n 
2  330 SER n 
2  331 GLN n 
2  332 ALA n 
2  333 ALA n 
2  334 HIS n 
2  335 ALA n 
2  336 GLY n 
2  337 GLU n 
2  338 VAL n 
2  339 ILE n 
2  340 ARG n 
2  341 ALA n 
2  342 ALA n 
2  343 MET n 
2  344 ASN n 
2  345 GLN n 
2  346 LEU n 
2  347 LYS n 
2  348 ALA n 
2  349 ALA n 
2  350 ALA n 
2  351 GLN n 
2  352 GLY n 
2  353 GLY n 
2  354 VAL n 
2  355 THR n 
2  356 GLU n 
2  357 GLU n 
2  358 ASP n 
2  359 VAL n 
2  360 THR n 
2  361 LYS n 
2  362 ALA n 
2  363 LYS n 
2  364 ASN n 
2  365 GLN n 
2  366 LEU n 
2  367 LYS n 
2  368 ALA n 
2  369 THR n 
2  370 TYR n 
2  371 LEU n 
2  372 MET n 
2  373 SER n 
2  374 VAL n 
2  375 GLU n 
2  376 THR n 
2  377 ALA n 
2  378 GLN n 
2  379 GLY n 
2  380 LEU n 
2  381 LEU n 
2  382 ASN n 
2  383 GLU n 
2  384 ILE n 
2  385 GLY n 
2  386 SER n 
2  387 GLU n 
2  388 ALA n 
2  389 LEU n 
2  390 LEU n 
2  391 SER n 
2  392 GLY n 
2  393 THR n 
2  394 HIS n 
2  395 THR n 
2  396 ALA n 
2  397 PRO n 
2  398 SER n 
2  399 VAL n 
2  400 VAL n 
2  401 ALA n 
2  402 GLN n 
2  403 LYS n 
2  404 ILE n 
2  405 ASP n 
2  406 SER n 
2  407 VAL n 
2  408 THR n 
2  409 SER n 
2  410 ALA n 
2  411 ASP n 
2  412 VAL n 
2  413 VAL n 
2  414 ASN n 
2  415 ALA n 
2  416 ALA n 
2  417 LYS n 
2  418 LYS n 
2  419 PHE n 
2  420 VAL n 
2  421 SER n 
2  422 GLY n 
2  423 LYS n 
2  424 LYS n 
2  425 SER n 
2  426 MET n 
2  427 ALA n 
2  428 ALA n 
2  429 SER n 
2  430 GLY n 
2  431 ASP n 
2  432 LEU n 
2  433 GLY n 
2  434 SER n 
2  435 THR n 
2  436 PRO n 
2  437 PHE n 
2  438 LEU n 
2  439 ASP n 
2  440 GLU n 
2  441 LEU n 
3  1   MET n 
3  2   ALA n 
3  3   PRO n 
3  4   ASN n 
3  5   ILE n 
3  6   ARG n 
3  7   LYS n 
3  8   SER n 
3  9   HIS n 
3  10  PRO n 
3  11  LEU n 
3  12  LEU n 
3  13  LYS n 
3  14  MET n 
3  15  ILE n 
3  16  ASN n 
3  17  ASN n 
3  18  SER n 
3  19  LEU n 
3  20  ILE n 
3  21  ASP n 
3  22  LEU n 
3  23  PRO n 
3  24  ALA n 
3  25  PRO n 
3  26  SER n 
3  27  ASN n 
3  28  ILE n 
3  29  SER n 
3  30  ALA n 
3  31  TRP n 
3  32  TRP n 
3  33  ASN n 
3  34  PHE n 
3  35  GLY n 
3  36  SER n 
3  37  LEU n 
3  38  LEU n 
3  39  ALA n 
3  40  VAL n 
3  41  CYS n 
3  42  LEU n 
3  43  MET n 
3  44  THR n 
3  45  GLN n 
3  46  ILE n 
3  47  LEU n 
3  48  THR n 
3  49  GLY n 
3  50  LEU n 
3  51  LEU n 
3  52  LEU n 
3  53  ALA n 
3  54  MET n 
3  55  HIS n 
3  56  TYR n 
3  57  THR n 
3  58  ALA n 
3  59  ASP n 
3  60  THR n 
3  61  SER n 
3  62  LEU n 
3  63  ALA n 
3  64  PHE n 
3  65  SER n 
3  66  SER n 
3  67  VAL n 
3  68  ALA n 
3  69  HIS n 
3  70  THR n 
3  71  CYS n 
3  72  ARG n 
3  73  ASN n 
3  74  VAL n 
3  75  GLN n 
3  76  TYR n 
3  77  GLY n 
3  78  TRP n 
3  79  LEU n 
3  80  ILE n 
3  81  ARG n 
3  82  ASN n 
3  83  LEU n 
3  84  HIS n 
3  85  ALA n 
3  86  ASN n 
3  87  GLY n 
3  88  ALA n 
3  89  SER n 
3  90  PHE n 
3  91  PHE n 
3  92  PHE n 
3  93  ILE n 
3  94  CYS n 
3  95  ILE n 
3  96  PHE n 
3  97  LEU n 
3  98  HIS n 
3  99  ILE n 
3  100 GLY n 
3  101 ARG n 
3  102 GLY n 
3  103 LEU n 
3  104 TYR n 
3  105 TYR n 
3  106 GLY n 
3  107 SER n 
3  108 TYR n 
3  109 LEU n 
3  110 TYR n 
3  111 LYS n 
3  112 GLU n 
3  113 THR n 
3  114 TRP n 
3  115 ASN n 
3  116 THR n 
3  117 GLY n 
3  118 VAL n 
3  119 ILE n 
3  120 LEU n 
3  121 LEU n 
3  122 LEU n 
3  123 THR n 
3  124 LEU n 
3  125 MET n 
3  126 ALA n 
3  127 THR n 
3  128 ALA n 
3  129 PHE n 
3  130 VAL n 
3  131 GLY n 
3  132 TYR n 
3  133 VAL n 
3  134 LEU n 
3  135 PRO n 
3  136 TRP n 
3  137 GLY n 
3  138 GLN n 
3  139 MET n 
3  140 SER n 
3  141 PHE n 
3  142 TRP n 
3  143 GLY n 
3  144 ALA n 
3  145 THR n 
3  146 VAL n 
3  147 ILE n 
3  148 THR n 
3  149 ASN n 
3  150 LEU n 
3  151 PHE n 
3  152 SER n 
3  153 ALA n 
3  154 ILE n 
3  155 PRO n 
3  156 TYR n 
3  157 ILE n 
3  158 GLY n 
3  159 HIS n 
3  160 THR n 
3  161 LEU n 
3  162 VAL n 
3  163 GLU n 
3  164 TRP n 
3  165 ALA n 
3  166 TRP n 
3  167 GLY n 
3  168 GLY n 
3  169 PHE n 
3  170 SER n 
3  171 VAL n 
3  172 ASP n 
3  173 ASN n 
3  174 PRO n 
3  175 THR n 
3  176 LEU n 
3  177 THR n 
3  178 ARG n 
3  179 PHE n 
3  180 PHE n 
3  181 ALA n 
3  182 LEU n 
3  183 HIS n 
3  184 PHE n 
3  185 LEU n 
3  186 LEU n 
3  187 PRO n 
3  188 PHE n 
3  189 ALA n 
3  190 ILE n 
3  191 ALA n 
3  192 GLY n 
3  193 ILE n 
3  194 THR n 
3  195 ILE n 
3  196 ILE n 
3  197 HIS n 
3  198 LEU n 
3  199 THR n 
3  200 PHE n 
3  201 LEU n 
3  202 HIS n 
3  203 GLU n 
3  204 SER n 
3  205 GLY n 
3  206 SER n 
3  207 ASN n 
3  208 ASN n 
3  209 PRO n 
3  210 LEU n 
3  211 GLY n 
3  212 ILE n 
3  213 SER n 
3  214 SER n 
3  215 ASP n 
3  216 SER n 
3  217 ASP n 
3  218 LYS n 
3  219 ILE n 
3  220 PRO n 
3  221 PHE n 
3  222 HIS n 
3  223 PRO n 
3  224 TYR n 
3  225 TYR n 
3  226 SER n 
3  227 PHE n 
3  228 LYS n 
3  229 ASP n 
3  230 ILE n 
3  231 LEU n 
3  232 GLY n 
3  233 LEU n 
3  234 THR n 
3  235 LEU n 
3  236 MET n 
3  237 LEU n 
3  238 THR n 
3  239 PRO n 
3  240 PHE n 
3  241 LEU n 
3  242 THR n 
3  243 LEU n 
3  244 ALA n 
3  245 LEU n 
3  246 PHE n 
3  247 SER n 
3  248 PRO n 
3  249 ASN n 
3  250 LEU n 
3  251 LEU n 
3  252 GLY n 
3  253 ASP n 
3  254 PRO n 
3  255 GLU n 
3  256 ASN n 
3  257 PHE n 
3  258 THR n 
3  259 PRO n 
3  260 ALA n 
3  261 ASN n 
3  262 PRO n 
3  263 LEU n 
3  264 VAL n 
3  265 THR n 
3  266 PRO n 
3  267 PRO n 
3  268 HIS n 
3  269 ILE n 
3  270 LYS n 
3  271 PRO n 
3  272 GLU n 
3  273 TRP n 
3  274 TYR n 
3  275 PHE n 
3  276 LEU n 
3  277 PHE n 
3  278 ALA n 
3  279 TYR n 
3  280 ALA n 
3  281 ILE n 
3  282 LEU n 
3  283 ARG n 
3  284 SER n 
3  285 ILE n 
3  286 PRO n 
3  287 ASN n 
3  288 LYS n 
3  289 LEU n 
3  290 GLY n 
3  291 GLY n 
3  292 VAL n 
3  293 LEU n 
3  294 ALA n 
3  295 LEU n 
3  296 ALA n 
3  297 ALA n 
3  298 SER n 
3  299 VAL n 
3  300 LEU n 
3  301 ILE n 
3  302 LEU n 
3  303 PHE n 
3  304 LEU n 
3  305 ILE n 
3  306 PRO n 
3  307 PHE n 
3  308 LEU n 
3  309 HIS n 
3  310 LYS n 
3  311 SER n 
3  312 LYS n 
3  313 GLN n 
3  314 ARG n 
3  315 THR n 
3  316 MET n 
3  317 THR n 
3  318 PHE n 
3  319 ARG n 
3  320 PRO n 
3  321 LEU n 
3  322 SER n 
3  323 GLN n 
3  324 THR n 
3  325 LEU n 
3  326 PHE n 
3  327 TRP n 
3  328 LEU n 
3  329 LEU n 
3  330 VAL n 
3  331 ALA n 
3  332 ASN n 
3  333 LEU n 
3  334 LEU n 
3  335 ILE n 
3  336 LEU n 
3  337 THR n 
3  338 TRP n 
3  339 ILE n 
3  340 GLY n 
3  341 SER n 
3  342 GLN n 
3  343 PRO n 
3  344 VAL n 
3  345 GLU n 
3  346 HIS n 
3  347 PRO n 
3  348 PHE n 
3  349 ILE n 
3  350 ILE n 
3  351 ILE n 
3  352 GLY n 
3  353 GLN n 
3  354 MET n 
3  355 ALA n 
3  356 SER n 
3  357 LEU n 
3  358 SER n 
3  359 TYR n 
3  360 PHE n 
3  361 THR n 
3  362 ILE n 
3  363 LEU n 
3  364 LEU n 
3  365 ILE n 
3  366 LEU n 
3  367 PHE n 
3  368 PRO n 
3  369 THR n 
3  370 ILE n 
3  371 GLY n 
3  372 THR n 
3  373 LEU n 
3  374 GLU n 
3  375 ASN n 
3  376 LYS n 
3  377 MET n 
3  378 LEU n 
3  379 ASN n 
3  380 TYR n 
4  1   GLY n 
4  2   GLU n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   ALA n 
4  10  PHE n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  GLY n 
4  16  GLY n 
4  17  PRO n 
4  18  LEU n 
4  19  SER n 
4  20  ALA n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  SER n 
4  25  SER n 
4  26  VAL n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  ALA n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  PHE n 
4  49  ARG n 
4  50  ASN n 
4  51  LEU n 
4  52  ILE n 
4  53  GLY n 
4  54  VAL n 
4  55  THR n 
4  56  HIS n 
4  57  THR n 
4  58  GLU n 
4  59  ALA n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASP n 
4  76  GLU n 
4  77  ASN n 
4  78  GLY n 
4  79  GLU n 
4  80  LEU n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  ILE n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ASN n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 ASP n 
4  137 PRO n 
4  138 PRO n 
4  139 ALA n 
4  140 GLY n 
4  141 VAL n 
4  142 VAL n 
4  143 VAL n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 HIS n 
4  149 TYR n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 ILE n 
4  169 LEU n 
4  170 GLU n 
4  171 TYR n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 ILE n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 GLN n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 ILE n 
4  212 SER n 
4  213 ALA n 
4  214 LEU n 
4  215 LEU n 
4  216 THR n 
4  217 SER n 
4  218 LEU n 
4  219 LEU n 
4  220 TYR n 
4  221 TYR n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 MET n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   VAL n 
5  2   HIS n 
5  3   ASN n 
5  4   ASP n 
5  5   VAL n 
5  6   THR n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ALA n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  GLU n 
5  17  ASP n 
5  18  VAL n 
5  19  MET n 
5  20  ASP n 
5  21  ALA n 
5  22  THR n 
5  23  THR n 
5  24  SER n 
5  25  SER n 
5  26  GLN n 
5  27  THR n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ASP n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  ALA n 
5  44  CYS n 
5  45  VAL n 
5  46  ALA n 
5  47  THR n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  THR n 
5  57  GLN n 
5  58  PHE n 
5  59  ILE n 
5  60  SER n 
5  61  SER n 
5  62  LEU n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  LEU n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  VAL n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 GLN n 
5  104 ALA n 
5  105 GLU n 
5  106 ILE n 
5  107 ASN n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 GLU n 
5  112 VAL n 
5  113 ASP n 
5  114 VAL n 
5  115 SER n 
5  116 LYS n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 ASP n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 VAL n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 SER n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 TYR n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 THR n 
5  185 TYR n 
5  186 GLN n 
5  187 PHE n 
5  188 VAL n 
5  189 GLY n 
5  190 ASP n 
5  191 ASP n 
5  192 LEU n 
5  193 VAL n 
5  194 VAL n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   ALA n 
6  3   ARG n 
6  4   ALA n 
6  5   THR n 
6  6   VAL n 
6  7   ALA n 
6  8   GLY n 
6  9   GLY n 
6  10  GLY n 
6  11  ARG n 
6  12  LEU n 
6  13  MET n 
6  14  ASP n 
6  15  ARG n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  TYR n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  LEU n 
6  38  TYR n 
6  39  GLU n 
6  40  ASP n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  LEU n 
6  48  LYS n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASP n 
6  54  LEU n 
6  55  TYR n 
6  56  ASN n 
6  57  GLU n 
6  58  ARG n 
6  59  MET n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  LEU n 
6  71  LYS n 
6  72  HIS n 
6  73  ARG n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  VAL n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  PRO n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LEU n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 ALA n 
6  107 TRP n 
6  108 ASN n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ILE n 
7  3   HIS n 
7  4   PHE n 
7  5   GLY n 
7  6   ASN n 
7  7   LEU n 
7  8   ALA n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  ILE n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  ILE n 
7  27  PRO n 
7  28  ASN n 
7  29  ILE n 
7  30  PHE n 
7  31  SER n 
7  32  ASP n 
7  33  ALA n 
7  34  LEU n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  TRP n 
7  39  ARG n 
7  40  ARG n 
7  41  PHE n 
7  42  SER n 
7  43  SER n 
7  44  GLN n 
7  45  VAL n 
7  46  PHE n 
7  47  LYS n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  LEU n 
7  54  GLY n 
7  55  ALA n 
7  56  TYR n 
7  57  LEU n 
7  58  LEU n 
7  59  TYR n 
7  60  SER n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  ARG n 
7  69  LEU n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ASP n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  GLN n 
8  1   LEU n 
8  2   ARG n 
8  3   GLY n 
8  4   SER n 
8  5   GLY n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  LEU n 
8  13  VAL n 
8  14  ASP n 
8  15  PRO n 
8  16  LEU n 
8  17  THR n 
8  18  THR n 
8  19  ILE n 
8  20  ARG n 
8  21  GLU n 
8  22  HIS n 
8  23  CYS n 
8  24  GLU n 
8  25  GLN n 
8  26  THR n 
8  27  GLU n 
8  28  LYS n 
8  29  CYS n 
8  30  VAL n 
8  31  LYS n 
8  32  ALA n 
8  33  ARG n 
8  34  GLU n 
8  35  ARG n 
8  36  LEU n 
8  37  GLU n 
8  38  LEU n 
8  39  CYS n 
8  40  ASP n 
8  41  ALA n 
8  42  ARG n 
8  43  VAL n 
8  44  SER n 
8  45  SER n 
8  46  ARG n 
8  47  SER n 
8  48  HIS n 
8  49  THR n 
8  50  GLU n 
8  51  GLU n 
8  52  GLN n 
8  53  CYS n 
8  54  THR n 
8  55  GLU n 
8  56  GLU n 
8  57  LEU n 
8  58  PHE n 
8  59  ASP n 
8  60  PHE n 
8  61  LEU n 
8  62  HIS n 
8  63  ALA n 
8  64  ARG n 
8  65  ASP n 
8  66  HIS n 
8  67  CYS n 
8  68  VAL n 
8  69  ALA n 
8  70  HIS n 
8  71  LYS n 
8  72  LEU n 
8  73  PHE n 
8  74  ASN n 
8  75  LYS n 
8  76  LEU n 
8  77  LYS n 
9  1   UNK n 
9  2   UNK n 
9  3   UNK n 
9  4   UNK n 
9  5   UNK n 
9  6   UNK n 
9  7   UNK n 
9  8   UNK n 
9  9   UNK n 
9  10  UNK n 
9  11  UNK n 
9  12  UNK n 
9  13  UNK n 
9  14  UNK n 
9  15  UNK n 
9  16  ARG n 
9  17  PRO n 
9  18  LEU n 
9  19  LEU n 
9  20  CYS n 
9  21  ARG n 
9  22  GLU n 
9  23  SER n 
9  24  MET n 
9  25  SER n 
9  26  GLY n 
9  27  ARG n 
9  28  SER n 
9  29  ALA n 
9  30  ARG n 
9  31  ARG n 
9  32  ASP n 
9  33  LEU n 
9  34  VAL n 
9  35  ALA n 
9  36  GLY n 
9  37  ILE n 
9  38  SER n 
9  39  LEU n 
9  40  ASN n 
9  41  ALA n 
9  42  PRO n 
9  43  ALA n 
9  44  SER n 
9  45  VAL n 
9  46  ARG n 
9  47  TYR n 
10 1   ALA n 
10 2   LEU n 
10 3   LEU n 
10 4   ARG n 
10 5   GLN n 
10 6   ALA n 
10 7   TYR n 
10 8   SER n 
10 9   ALA n 
10 10  LEU n 
10 11  PHE n 
10 12  ARG n 
10 13  ARG n 
10 14  THR n 
10 15  SER n 
10 16  THR n 
10 17  PHE n 
10 18  ALA n 
10 19  LEU n 
10 20  THR n 
10 21  VAL n 
10 22  VAL n 
10 23  LEU n 
10 24  GLY n 
10 25  ALA n 
10 26  VAL n 
10 27  LEU n 
10 28  PHE n 
10 29  GLU n 
10 30  ARG n 
10 31  ALA n 
10 32  PHE n 
10 33  ASP n 
10 34  GLN n 
10 35  GLY n 
10 36  ALA n 
10 37  ASP n 
10 38  ALA n 
10 39  ILE n 
10 40  PHE n 
10 41  GLU n 
10 42  HIS n 
10 43  LEU n 
10 44  ASN n 
10 45  GLU n 
10 46  GLY n 
10 47  LYS n 
10 48  LEU n 
10 49  TRP n 
10 50  LYS n 
10 51  HIS n 
10 52  ILE n 
10 53  LYS n 
10 54  HIS n 
10 55  LYS n 
10 56  TYR n 
10 57  GLU n 
10 58  ALA n 
10 59  SER n 
10 60  GLU n 
10 61  GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP CYB_CHICK  P18946 3  
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
1  ? 
2  UNP UCRI_CHICK Q5ZLR5 5  
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
77 ? 
3  UNP UCRI_CHICK Q5ZLR5 9  RPLLCRESMSGRSARRDLVAGISLNAPASVRY 45 ? 
4  PDB 3H1I       3H1I   1  
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
?  ? 
5  PDB 3H1I       3H1I   2  
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
?  ? 
6  PDB 3H1I       3H1I   4  
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
?  ? 
7  PDB 3H1I       3H1I   6  
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
?  ? 
8  PDB 3H1I       3H1I   7  
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
?  ? 
9  PDB 3H1I       3H1I   8  LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK ?  ? 
10 PDB 3H1I       3H1I   10 ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3H1I C 1  ? 380 ? P18946 1  ? 380 ? 1  380 
2  2  3H1I E 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
3  3  3H1I I 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
4  1  3H1I P 1  ? 380 ? P18946 1  ? 380 ? 1  380 
5  2  3H1I R 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
6  3  3H1I V 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
7  4  3H1I A 1  ? 446 ? 3H1I   1  ? 446 ? 1  446 
8  4  3H1I N 1  ? 446 ? 3H1I   1  ? 446 ? 1  446 
9  5  3H1I B 1  ? 441 ? 3H1I   -1 ? 439 ? -1 439 
10 5  3H1I O 1  ? 441 ? 3H1I   -1 ? 439 ? -1 439 
11 6  3H1I D 1  ? 241 ? 3H1I   1  ? 241 ? 1  241 
12 6  3H1I Q 1  ? 241 ? 3H1I   1  ? 241 ? 1  241 
13 7  3H1I F 1  ? 110 ? 3H1I   1  ? 110 ? 1  110 
14 7  3H1I S 1  ? 110 ? 3H1I   1  ? 110 ? 1  110 
15 8  3H1I G 1  ? 81  ? 3H1I   1  ? 81  ? 1  81  
16 8  3H1I T 1  ? 81  ? 3H1I   1  ? 81  ? 1  81  
17 9  3H1I H 1  ? 77  ? 3H1I   2  ? 78  ? 2  78  
18 9  3H1I U 1  ? 77  ? 3H1I   2  ? 78  ? 2  78  
19 10 3H1I J 1  ? 61  ? 3H1I   4  ? 64  ? 4  64  
20 10 3H1I W 1  ? 61  ? 3H1I   4  ? 64  ? 4  64  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                                  'C3 H7 N O2' 
89.093   
ANY non-polymer         . 
'2-METHYL-BUTYRIC ACID 3-(3-FORMYLAMINO-2-HYDROXY-BENZOYLAMINO)-8-HEPTYL-2,6-DIMETHYL-4,9-DIOXO-[1,5]DIOXONAN-7-YL ESTER' 
ANTIMYCIN                                                                          'C29 H42 N2 O9'      562.652  
ARG 'L-peptide linking' y ARGININE ?                                                                                  
'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE ?                                                                                  
'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                                  
'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN 
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CYS 'L-peptide linking' y CYSTEINE ?                                                                                  
'C3 H7 N O2 S'       121.158  
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'             175.820  
GLN 'L-peptide linking' y GLUTAMINE ?                                                                                  
'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                                  
'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE ?                                                                                  'C2 H5 N O2' 
75.067   
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL'                                                    'C3 H8 O3' 
92.094   
HEC non-polymer         . 'HEME C' ?                                                                                  
'C34 H34 Fe N4 O4'   618.503  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4'   616.487  
HIS 'L-peptide linking' y HISTIDINE ?                                                                                  
'C6 H10 N3 O2 1'     156.162  
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                                  
'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE ?                                                                                  'C6 H13 N O2' 
131.173  
LYS 'L-peptide linking' y LYSINE ?                                                                                  
'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE ?                                                                                  
'C5 H11 N O2 S'      149.211  
PEE non-polymer         . 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine DOPE 'C41 H83 N O8 P 1'   749.073  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                                  
'C9 H11 N O2'        165.189  
PLC non-polymer         . 'DIUNDECYL PHOSPHATIDYL CHOLINE' ? 'C32 H65 N O8 P 1'   622.834  
PRO 'L-peptide linking' y PROLINE ?                                                                                  'C5 H9 N O2' 
115.130  
SER 'L-peptide linking' y SERINE ?                                                                                  'C3 H7 N O3' 
105.093  
SMA non-polymer         . 'STIGMATELLIN A' ?                                                                                  
'C30 H42 O7'         514.650  
THR 'L-peptide linking' y THREONINE ?                                                                                  
'C4 H9 N O3'         119.119  
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                                  
'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE ?                                                                                  
'C9 H11 N O3'        181.189  
UNK 'L-peptide linking' . UNKNOWN ?                                                                                  'C4 H9 N O2' 
103.120  
UNL non-polymer         . 'UNKNOWN LIGAND' ?                                                                                  ? ? 
VAL 'L-peptide linking' y VALINE ?                                                                                  'C5 H11 N O2' 
117.146  
# 
_exptl.entry_id          3H1I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.13 
_exptl_crystal.density_percent_sol   70.24 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.7 
_exptl_crystal_grow.pdbx_details    
;20MM KMES PH 6.7, 75MM NACL, 10% GLYCEROL, AND 6% PEG4000, INHIBITORS WERE ADDED FROM ETHANOLIC SOLUTION, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1996-09-29 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.5412 1.0 
2 1.5418 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5412 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3H1I 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             87.039 
_reflns.d_resolution_high            3.500 
_reflns.number_obs                   90316 
_reflns.number_all                   90316 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.229 
_reflns.pdbx_netI_over_sigmaI        7.01 
_reflns.B_iso_Wilson_estimate        73.1 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.50 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   91.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.997 
_reflns_shell.meanI_over_sigI_obs    1.34 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3H1I 
_refine.ls_number_reflns_obs                     85111 
_refine.ls_number_reflns_all                     85111 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               6933881.31 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.99 
_refine.ls_d_res_high                            3.53 
_refine.ls_percent_reflns_obs                    90.6 
_refine.ls_R_factor_obs                          0.264 
_refine.ls_R_factor_all                          0.264 
_refine.ls_R_factor_R_work                       0.263 
_refine.ls_R_factor_R_free                       0.306 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.0 
_refine.ls_number_reflns_R_free                  2551 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               89.2 
_refine.aniso_B[1][1]                            34.71 
_refine.aniso_B[2][2]                            -20.96 
_refine.aniso_B[3][3]                            -13.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.230235 
_refine.solvent_model_param_bsol                 14.3956 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1BCC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3H1I 
_refine_analyze.Luzzati_coordinate_error_obs    0.53 
_refine_analyze.Luzzati_sigma_a_obs             1.00 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.62 
_refine_analyze.Luzzati_sigma_a_free            1.10 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31797 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         904 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               32701 
_refine_hist.d_res_high                       3.53 
_refine_hist.d_res_low                        19.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.05  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.30  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.36  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.42  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.45  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   7 
_refine_ls_shell.d_res_high                       3.53 
_refine_ls_shell.d_res_low                        3.71 
_refine_ls_shell.number_reflns_R_work             10734 
_refine_ls_shell.R_factor_R_work                  0.381 
_refine_ls_shell.percent_reflns_obs               83.3 
_refine_ls_shell.R_factor_R_free                  0.406 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            3.2 
_refine_ls_shell.number_reflns_R_free             351 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param &_1_TOPOLOGY_INFILE_1 'X-RAY DIFFRACTION' 
2 hetero10.par      &_1_TOPOLOGY_INFILE_2 'X-RAY DIFFRACTION' 
3 fnmfmx.par        &_1_TOPOLOGY_INFILE_3 'X-RAY DIFFRACTION' 
4 water.param       &_1_TOPOLOGY_INFILE_4 'X-RAY DIFFRACTION' 
5 prosthw.par       &_1_TOPOLOGY_INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3H1I 
_struct.title                     'Stigmatellin and antimycin bound cytochrome bc1 complex from chicken' 
_struct.pdbx_descriptor           
;UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MITOCHONDRIAL (E.C.1.10.2.2), UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2, MITOCHONDRIAL (E.C.1.10.2.2), Cytochrome b (E.C.1.10.2.2), CYTOCHROME C1, HEME PROTEIN, MITOCHONDRIAL (E.C.1.10.2.2), Cytochrome b-c1 complex subunit Rieske, mitochondrial (E.C.1.10.2.2), UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KDA PROTEIN (E.C.1.10.2.2), UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX UBIQUINONE-BINDING PROTEIN QP-C (E.C.1.10.2.2), UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 11 KDA PROTEIN (E.C.1.10.2.2), UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 7.2 KDA PROTEIN (E.C.1.10.2.2)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H1I 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEASE, UBIQUINONE, OXIDOREDUCTASE, REDOX ENZYME, RESPIRATORY CHAIN, STIGMATELLIN, ANTIMYCIN, Electron transport, Heme, Iron, Membrane, Metal-binding, Mitochondrion, Mitochondrion inner membrane, Transmembrane, Transport, Disulfide bond, Iron-sulfur, Transit peptide
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 11 ? 
V  N N 12 ? 
W  N N 13 ? 
X  N N 13 ? 
Y  N N 14 ? 
Z  N N 15 ? 
AA N N 16 ? 
BA N N 11 ? 
CA N N 12 ? 
DA N N 17 ? 
EA N N 12 ? 
FA N N 12 ? 
GA N N 18 ? 
HA N N 16 ? 
IA N N 19 ? 
JA N N 11 ? 
KA N N 20 ? 
LA N N 12 ? 
MA N N 12 ? 
NA N N 11 ? 
OA N N 13 ? 
PA N N 13 ? 
QA N N 12 ? 
RA N N 14 ? 
SA N N 15 ? 
TA N N 16 ? 
UA N N 11 ? 
VA N N 11 ? 
WA N N 12 ? 
XA N N 17 ? 
YA N N 12 ? 
ZA N N 18 ? 
AB N N 16 ? 
BB N N 19 ? 
CB N N 12 ? 
DB N N 20 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 3   ? ILE A 11  ? THR A 3   ILE A 11  1 ? 9  
HELX_P HELX_P2   2   TYR A 57  ? ALA A 63  ? TYR A 57  ALA A 63  1 ? 7  
HELX_P HELX_P3   3   PRO A 71  ? SER A 81  ? PRO A 71  SER A 81  1 ? 11 
HELX_P HELX_P4   4   ASP A 105 ? GLN A 118 ? ASP A 105 GLN A 118 1 ? 14 
HELX_P HELX_P5   5   GLU A 123 ? ASP A 142 ? GLU A 123 ASP A 142 1 ? 20 
HELX_P HELX_P6   6   ASP A 144 ? PHE A 158 ? ASP A 144 PHE A 158 1 ? 15 
HELX_P HELX_P7   7   THR A 170 ? LEU A 177 ? THR A 170 LEU A 177 1 ? 8  
HELX_P HELX_P8   8   THR A 178 ? PHE A 190 ? THR A 178 PHE A 190 1 ? 13 
HELX_P HELX_P9   9   LYS A 191 ? ARG A 194 ? LYS A 191 ARG A 194 5 ? 4  
HELX_P HELX_P10  10  SER A 204 ? PHE A 216 ? SER A 204 PHE A 216 1 ? 13 
HELX_P HELX_P11  11  TYR A 223 ? ALA A 227 ? TYR A 223 ALA A 227 5 ? 5  
HELX_P HELX_P12  12  PRO A 265 ? ILE A 277 ? PRO A 265 ILE A 277 1 ? 13 
HELX_P HELX_P13  13  GLY A 286 ? LEU A 290 ? GLY A 286 LEU A 290 5 ? 5  
HELX_P HELX_P14  14  SER A 292 ? HIS A 301 ? SER A 292 HIS A 301 1 ? 10 
HELX_P HELX_P15  15  SER A 330 ? THR A 349 ? SER A 330 THR A 349 1 ? 20 
HELX_P HELX_P16  16  THR A 350 ? GLN A 368 ? THR A 350 GLN A 368 1 ? 19 
HELX_P HELX_P17  17  GLY A 371 ? GLY A 387 ? GLY A 371 GLY A 387 1 ? 17 
HELX_P HELX_P18  18  SER A 391 ? VAL A 402 ? SER A 391 VAL A 402 1 ? 12 
HELX_P HELX_P19  19  ASP A 403 ? TYR A 416 ? ASP A 403 TYR A 416 1 ? 14 
HELX_P HELX_P20  20  ASP A 433 ? GLY A 440 ? ASP A 433 GLY A 440 1 ? 8  
HELX_P HELX_P21  21  GLY B 66  ? ALA B 74  ? GLY B 64  ALA B 72  1 ? 9  
HELX_P HELX_P22  22  SER B 83  ? ALA B 93  ? SER B 81  ALA B 91  1 ? 11 
HELX_P HELX_P23  23  LEU B 114 ? ASP B 116 ? LEU B 112 ASP B 114 5 ? 3  
HELX_P HELX_P24  24  HIS B 117 ? ALA B 131 ? HIS B 115 ALA B 129 1 ? 15 
HELX_P HELX_P25  25  ARG B 135 ? GLN B 143 ? ARG B 133 GLN B 141 1 ? 9  
HELX_P HELX_P26  26  GLN B 145 ? PHE B 154 ? GLN B 143 PHE B 152 1 ? 10 
HELX_P HELX_P27  27  SER B 156 ? ALA B 169 ? SER B 154 ALA B 167 1 ? 14 
HELX_P HELX_P28  28  THR B 172 ? ASN B 176 ? THR B 170 ASN B 174 5 ? 5  
HELX_P HELX_P29  29  THR B 189 ? ASN B 199 ? THR B 187 ASN B 197 1 ? 11 
HELX_P HELX_P30  30  LYS B 214 ? LEU B 226 ? LYS B 212 LEU B 224 1 ? 13 
HELX_P HELX_P31  31  SER B 268 ? GLY B 282 ? SER B 266 GLY B 280 1 ? 15 
HELX_P HELX_P32  32  SER B 295 ? LYS B 303 ? SER B 293 LYS B 301 1 ? 9  
HELX_P HELX_P33  33  HIS B 334 ? ALA B 348 ? HIS B 332 ALA B 346 1 ? 15 
HELX_P HELX_P34  34  THR B 355 ? SER B 373 ? THR B 353 SER B 371 1 ? 19 
HELX_P HELX_P35  35  THR B 376 ? SER B 391 ? THR B 374 SER B 389 1 ? 16 
HELX_P HELX_P36  36  SER B 398 ? SER B 406 ? SER B 396 SER B 404 1 ? 9  
HELX_P HELX_P37  37  THR B 408 ? GLY B 422 ? THR B 406 GLY B 420 1 ? 15 
HELX_P HELX_P38  38  PHE B 437 ? LEU B 441 ? PHE B 435 LEU B 439 5 ? 5  
HELX_P HELX_P39  39  ASN C 4   ? HIS C 9   ? ASN C 4   HIS C 9   1 ? 6  
HELX_P HELX_P40  40  LEU C 11  ? ILE C 20  ? LEU C 11  ILE C 20  1 ? 10 
HELX_P HELX_P41  41  SER C 29  ? TRP C 32  ? SER C 29  TRP C 32  5 ? 4  
HELX_P HELX_P42  42  ASN C 33  ? MET C 54  ? ASN C 33  MET C 54  1 ? 22 
HELX_P HELX_P43  43  ASP C 59  ? ASN C 73  ? ASP C 59  ASN C 73  1 ? 15 
HELX_P HELX_P44  44  TYR C 76  ? TYR C 105 ? TYR C 76  TYR C 105 1 ? 30 
HELX_P HELX_P45  45  GLY C 106 ? LEU C 109 ? GLY C 106 LEU C 109 5 ? 4  
HELX_P HELX_P46  46  TYR C 110 ? LEU C 134 ? TYR C 110 LEU C 134 1 ? 25 
HELX_P HELX_P47  47  GLY C 137 ? LEU C 150 ? GLY C 137 LEU C 150 1 ? 14 
HELX_P HELX_P48  48  PHE C 151 ? ILE C 154 ? PHE C 151 ILE C 154 5 ? 4  
HELX_P HELX_P49  49  TYR C 156 ? GLY C 167 ? TYR C 156 GLY C 167 1 ? 12 
HELX_P HELX_P50  50  ASP C 172 ? GLY C 205 ? ASP C 172 GLY C 205 1 ? 34 
HELX_P HELX_P51  51  SER C 214 ? SER C 216 ? SER C 214 SER C 216 5 ? 3  
HELX_P HELX_P52  52  PHE C 221 ? SER C 247 ? PHE C 221 SER C 247 1 ? 27 
HELX_P HELX_P53  53  ASP C 253 ? THR C 258 ? ASP C 253 THR C 258 5 ? 6  
HELX_P HELX_P54  54  GLU C 272 ? TYR C 274 ? GLU C 272 TYR C 274 5 ? 3  
HELX_P HELX_P55  55  PHE C 275 ? ILE C 285 ? PHE C 275 ILE C 285 1 ? 11 
HELX_P HELX_P56  56  ASN C 287 ? ILE C 301 ? ASN C 287 ILE C 301 1 ? 15 
HELX_P HELX_P57  57  LEU C 302 ? LEU C 308 ? LEU C 302 LEU C 308 5 ? 7  
HELX_P HELX_P58  58  THR C 315 ? PHE C 318 ? THR C 315 PHE C 318 5 ? 4  
HELX_P HELX_P59  59  ARG C 319 ? SER C 341 ? ARG C 319 SER C 341 1 ? 23 
HELX_P HELX_P60  60  PRO C 347 ? ILE C 365 ? PRO C 347 ILE C 365 1 ? 19 
HELX_P HELX_P61  61  ILE C 365 ? ASN C 379 ? ILE C 365 ASN C 379 1 ? 15 
HELX_P HELX_P62  62  ASP D 22  ? CYS D 37  ? ASP D 22  CYS D 37  1 ? 16 
HELX_P HELX_P63  63  ALA D 47  ? ILE D 52  ? ALA D 47  ILE D 52  1 ? 6  
HELX_P HELX_P64  64  THR D 57  ? GLU D 67  ? THR D 57  GLU D 67  1 ? 11 
HELX_P HELX_P65  65  ASN D 97  ? ALA D 104 ? ASN D 97  ALA D 104 1 ? 8  
HELX_P HELX_P66  66  TYR D 115 ? ARG D 120 ? TYR D 115 ARG D 120 1 ? 6  
HELX_P HELX_P67  67  GLY D 123 ? TYR D 134 ? GLY D 123 TYR D 134 1 ? 12 
HELX_P HELX_P68  68  THR D 178 ? GLU D 195 ? THR D 178 GLU D 195 1 ? 18 
HELX_P HELX_P69  69  GLU D 197 ? ARG D 233 ? GLU D 197 ARG D 233 1 ? 37 
HELX_P HELX_P70  70  ARG E 15  ? MET E 19  ? ARG E 15  MET E 19  5 ? 5  
HELX_P HELX_P71  71  SER E 24  ? THR E 27  ? SER E 24  THR E 27  5 ? 4  
HELX_P HELX_P72  72  SER E 28  ? SER E 61  ? SER E 28  SER E 61  1 ? 34 
HELX_P HELX_P73  73  THR E 102 ? ASN E 107 ? THR E 102 ASN E 107 1 ? 6  
HELX_P HELX_P74  74  ARG F 11  ? GLY F 25  ? ARG F 11  GLY F 25  1 ? 15 
HELX_P HELX_P75  75  PHE F 26  ? TYR F 29  ? PHE F 26  TYR F 29  5 ? 4  
HELX_P HELX_P76  76  MET F 32  ? LEU F 37  ? MET F 32  LEU F 37  1 ? 6  
HELX_P HELX_P77  77  ASP F 40  ? LEU F 50  ? ASP F 40  LEU F 50  1 ? 11 
HELX_P HELX_P78  78  PRO F 51  ? HIS F 72  ? PRO F 51  HIS F 72  1 ? 22 
HELX_P HELX_P79  79  PRO F 76  ? TRP F 80  ? PRO F 76  TRP F 80  5 ? 5  
HELX_P HELX_P80  80  LYS F 82  ? ASP F 86  ? LYS F 82  ASP F 86  5 ? 5  
HELX_P HELX_P81  81  LEU F 90  ? ASN F 108 ? LEU F 90  ASN F 108 1 ? 19 
HELX_P HELX_P82  82  PRO G 20  ? GLN G 23  ? PRO G 20  GLN G 23  5 ? 4  
HELX_P HELX_P83  83  ASP G 32  ? LEU G 69  ? ASP G 32  LEU G 69  1 ? 38 
HELX_P HELX_P84  84  ASN G 73  ? TYR G 77  ? ASN G 73  TYR G 77  5 ? 5  
HELX_P HELX_P85  85  ASP H 14  ? GLN H 25  ? ASP H 15  GLN H 26  1 ? 12 
HELX_P HELX_P86  86  THR H 26  ? ARG H 46  ? THR H 27  ARG H 47  1 ? 21 
HELX_P HELX_P87  87  CYS H 53  ? HIS H 70  ? CYS H 54  HIS H 71  1 ? 18 
HELX_P HELX_P88  88  CYS I 20  ? SER I 25  ? CYS I 51  SER I 56  1 ? 6  
HELX_P HELX_P89  89  ALA J 1   ? LEU J 10  ? ALA J 4   LEU J 13  1 ? 10 
HELX_P HELX_P90  90  ARG J 13  ? ASN J 44  ? ARG J 16  ASN J 47  1 ? 32 
HELX_P HELX_P91  91  LEU J 48  ? LYS J 53  ? LEU J 51  LYS J 56  1 ? 6  
HELX_P HELX_P92  92  HIS J 54  ? TYR J 56  ? HIS J 57  TYR J 59  5 ? 3  
HELX_P HELX_P93  93  THR K 3   ? ILE K 11  ? THR N 3   ILE N 11  1 ? 9  
HELX_P HELX_P94  94  TYR K 57  ? ALA K 63  ? TYR N 57  ALA N 63  1 ? 7  
HELX_P HELX_P95  95  PRO K 71  ? SER K 81  ? PRO N 71  SER N 81  1 ? 11 
HELX_P HELX_P96  96  ASP K 105 ? GLN K 118 ? ASP N 105 GLN N 118 1 ? 14 
HELX_P HELX_P97  97  GLU K 123 ? ASP K 142 ? GLU N 123 ASP N 142 1 ? 20 
HELX_P HELX_P98  98  ASP K 144 ? PHE K 158 ? ASP N 144 PHE N 158 1 ? 15 
HELX_P HELX_P99  99  THR K 170 ? LEU K 177 ? THR N 170 LEU N 177 1 ? 8  
HELX_P HELX_P100 100 THR K 178 ? PHE K 190 ? THR N 178 PHE N 190 1 ? 13 
HELX_P HELX_P101 101 LYS K 191 ? ARG K 194 ? LYS N 191 ARG N 194 5 ? 4  
HELX_P HELX_P102 102 SER K 204 ? PHE K 216 ? SER N 204 PHE N 216 1 ? 13 
HELX_P HELX_P103 103 TYR K 223 ? ALA K 227 ? TYR N 223 ALA N 227 5 ? 5  
HELX_P HELX_P104 104 PRO K 265 ? ILE K 277 ? PRO N 265 ILE N 277 1 ? 13 
HELX_P HELX_P105 105 GLY K 286 ? LEU K 290 ? GLY N 286 LEU N 290 5 ? 5  
HELX_P HELX_P106 106 SER K 292 ? HIS K 301 ? SER N 292 HIS N 301 1 ? 10 
HELX_P HELX_P107 107 SER K 330 ? THR K 349 ? SER N 330 THR N 349 1 ? 20 
HELX_P HELX_P108 108 THR K 350 ? GLN K 368 ? THR N 350 GLN N 368 1 ? 19 
HELX_P HELX_P109 109 GLY K 371 ? GLY K 387 ? GLY N 371 GLY N 387 1 ? 17 
HELX_P HELX_P110 110 SER K 391 ? VAL K 402 ? SER N 391 VAL N 402 1 ? 12 
HELX_P HELX_P111 111 ASP K 403 ? TYR K 416 ? ASP N 403 TYR N 416 1 ? 14 
HELX_P HELX_P112 112 ASP K 433 ? GLY K 440 ? ASP N 433 GLY N 440 1 ? 8  
HELX_P HELX_P113 113 GLY L 66  ? ALA L 74  ? GLY O 64  ALA O 72  1 ? 9  
HELX_P HELX_P114 114 SER L 83  ? ALA L 93  ? SER O 81  ALA O 91  1 ? 11 
HELX_P HELX_P115 115 LEU L 114 ? ASP L 116 ? LEU O 112 ASP O 114 5 ? 3  
HELX_P HELX_P116 116 HIS L 117 ? ALA L 131 ? HIS O 115 ALA O 129 1 ? 15 
HELX_P HELX_P117 117 ARG L 135 ? GLN L 143 ? ARG O 133 GLN O 141 1 ? 9  
HELX_P HELX_P118 118 GLN L 145 ? PHE L 154 ? GLN O 143 PHE O 152 1 ? 10 
HELX_P HELX_P119 119 SER L 156 ? ALA L 169 ? SER O 154 ALA O 167 1 ? 14 
HELX_P HELX_P120 120 THR L 172 ? ASN L 176 ? THR O 170 ASN O 174 5 ? 5  
HELX_P HELX_P121 121 THR L 189 ? ASN L 199 ? THR O 187 ASN O 197 1 ? 11 
HELX_P HELX_P122 122 LYS L 214 ? LEU L 226 ? LYS O 212 LEU O 224 1 ? 13 
HELX_P HELX_P123 123 ALA L 269 ? GLY L 282 ? ALA O 267 GLY O 280 1 ? 14 
HELX_P HELX_P124 124 SER L 295 ? LYS L 303 ? SER O 293 LYS O 301 1 ? 9  
HELX_P HELX_P125 125 HIS L 334 ? ALA L 348 ? HIS O 332 ALA O 346 1 ? 15 
HELX_P HELX_P126 126 THR L 355 ? VAL L 374 ? THR O 353 VAL O 372 1 ? 20 
HELX_P HELX_P127 127 THR L 376 ? SER L 391 ? THR O 374 SER O 389 1 ? 16 
HELX_P HELX_P128 128 SER L 398 ? SER L 406 ? SER O 396 SER O 404 1 ? 9  
HELX_P HELX_P129 129 THR L 408 ? GLY L 422 ? THR O 406 GLY O 420 1 ? 15 
HELX_P HELX_P130 130 PHE L 437 ? LEU L 441 ? PHE O 435 LEU O 439 5 ? 5  
HELX_P HELX_P131 131 ASN M 4   ? HIS M 9   ? ASN P 4   HIS P 9   1 ? 6  
HELX_P HELX_P132 132 LEU M 11  ? ILE M 20  ? LEU P 11  ILE P 20  1 ? 10 
HELX_P HELX_P133 133 SER M 29  ? TRP M 32  ? SER P 29  TRP P 32  5 ? 4  
HELX_P HELX_P134 134 ASN M 33  ? MET M 54  ? ASN P 33  MET P 54  1 ? 22 
HELX_P HELX_P135 135 ASP M 59  ? ASN M 73  ? ASP P 59  ASN P 73  1 ? 15 
HELX_P HELX_P136 136 TYR M 76  ? TYR M 105 ? TYR P 76  TYR P 105 1 ? 30 
HELX_P HELX_P137 137 GLY M 106 ? LEU M 109 ? GLY P 106 LEU P 109 5 ? 4  
HELX_P HELX_P138 138 TYR M 110 ? LEU M 134 ? TYR P 110 LEU P 134 1 ? 25 
HELX_P HELX_P139 139 GLY M 137 ? LEU M 150 ? GLY P 137 LEU P 150 1 ? 14 
HELX_P HELX_P140 140 PHE M 151 ? ILE M 154 ? PHE P 151 ILE P 154 5 ? 4  
HELX_P HELX_P141 141 GLY M 158 ? GLY M 167 ? GLY P 158 GLY P 167 1 ? 10 
HELX_P HELX_P142 142 ASP M 172 ? GLY M 205 ? ASP P 172 GLY P 205 1 ? 34 
HELX_P HELX_P143 143 SER M 214 ? SER M 216 ? SER P 214 SER P 216 5 ? 3  
HELX_P HELX_P144 144 PRO M 223 ? SER M 247 ? PRO P 223 SER P 247 1 ? 25 
HELX_P HELX_P145 145 ASP M 253 ? THR M 258 ? ASP P 253 THR P 258 5 ? 6  
HELX_P HELX_P146 146 GLU M 272 ? TYR M 274 ? GLU P 272 TYR P 274 5 ? 3  
HELX_P HELX_P147 147 PHE M 275 ? ILE M 285 ? PHE P 275 ILE P 285 1 ? 11 
HELX_P HELX_P148 148 ASN M 287 ? ILE M 301 ? ASN P 287 ILE P 301 1 ? 15 
HELX_P HELX_P149 149 LEU M 302 ? LEU M 308 ? LEU P 302 LEU P 308 5 ? 7  
HELX_P HELX_P150 150 THR M 315 ? PHE M 318 ? THR P 315 PHE P 318 5 ? 4  
HELX_P HELX_P151 151 ARG M 319 ? SER M 341 ? ARG P 319 SER P 341 1 ? 23 
HELX_P HELX_P152 152 PRO M 347 ? ILE M 365 ? PRO P 347 ILE P 365 1 ? 19 
HELX_P HELX_P153 153 ILE M 365 ? ASN M 379 ? ILE P 365 ASN P 379 1 ? 15 
HELX_P HELX_P154 154 ASP N 22  ? CYS N 37  ? ASP Q 22  CYS Q 37  1 ? 16 
HELX_P HELX_P155 155 ALA N 47  ? LEU N 51  ? ALA Q 47  LEU Q 51  5 ? 5  
HELX_P HELX_P156 156 THR N 57  ? GLU N 67  ? THR Q 57  GLU Q 67  1 ? 11 
HELX_P HELX_P157 157 ASN N 97  ? ALA N 104 ? ASN Q 97  ALA Q 104 1 ? 8  
HELX_P HELX_P158 158 TYR N 115 ? ARG N 120 ? TYR Q 115 ARG Q 120 1 ? 6  
HELX_P HELX_P159 159 GLY N 123 ? TYR N 134 ? GLY Q 123 TYR Q 134 1 ? 12 
HELX_P HELX_P160 160 THR N 178 ? ALA N 193 ? THR Q 178 ALA Q 193 1 ? 16 
HELX_P HELX_P161 161 ALA N 194 ? PRO N 196 ? ALA Q 194 PRO Q 196 5 ? 3  
HELX_P HELX_P162 162 GLU N 197 ? SER N 232 ? GLU Q 197 SER Q 232 1 ? 36 
HELX_P HELX_P163 163 ARG O 15  ? MET O 19  ? ARG R 15  MET R 19  5 ? 5  
HELX_P HELX_P164 164 SER O 24  ? THR O 27  ? SER R 24  THR R 27  5 ? 4  
HELX_P HELX_P165 165 SER O 28  ? SER O 61  ? SER R 28  SER R 61  1 ? 34 
HELX_P HELX_P166 166 THR O 102 ? ASN O 107 ? THR R 102 ASN R 107 1 ? 6  
HELX_P HELX_P167 167 HIS O 122 ? VAL O 127 ? HIS R 122 VAL R 127 1 ? 6  
HELX_P HELX_P168 168 LEU P 12  ? GLY P 25  ? LEU S 12  GLY S 25  1 ? 14 
HELX_P HELX_P169 169 PHE P 26  ? GLY P 30  ? PHE S 26  GLY S 30  5 ? 5  
HELX_P HELX_P170 170 MET P 32  ? LEU P 37  ? MET S 32  LEU S 37  1 ? 6  
HELX_P HELX_P171 171 ASP P 40  ? LEU P 50  ? ASP S 40  LEU S 50  1 ? 11 
HELX_P HELX_P172 172 PRO P 51  ? HIS P 72  ? PRO S 51  HIS S 72  1 ? 22 
HELX_P HELX_P173 173 PRO P 76  ? TRP P 80  ? PRO S 76  TRP S 80  5 ? 5  
HELX_P HELX_P174 174 LYS P 82  ? ASP P 86  ? LYS S 82  ASP S 86  5 ? 5  
HELX_P HELX_P175 175 LEU P 90  ? LYS P 110 ? LEU S 90  LYS S 110 1 ? 21 
HELX_P HELX_P176 176 PRO Q 20  ? GLN Q 23  ? PRO T 20  GLN T 23  5 ? 4  
HELX_P HELX_P177 177 ASP Q 32  ? LEU Q 69  ? ASP T 32  LEU T 69  1 ? 38 
HELX_P HELX_P178 178 ASN Q 73  ? TYR Q 77  ? ASN T 73  TYR T 77  5 ? 5  
HELX_P HELX_P179 179 ASP R 14  ? GLN R 25  ? ASP U 15  GLN U 26  1 ? 12 
HELX_P HELX_P180 180 THR R 26  ? ARG R 46  ? THR U 27  ARG U 47  1 ? 21 
HELX_P HELX_P181 181 CYS R 53  ? HIS R 70  ? CYS U 54  HIS U 71  1 ? 18 
HELX_P HELX_P182 182 CYS S 20  ? MET S 24  ? CYS V 51  MET V 55  5 ? 5  
HELX_P HELX_P183 183 ALA T 1   ? LEU T 10  ? ALA W 4   LEU W 13  1 ? 10 
HELX_P HELX_P184 184 ARG T 13  ? ASN T 44  ? ARG W 16  ASN W 47  1 ? 32 
HELX_P HELX_P185 185 LEU T 48  ? LYS T 53  ? LEU W 51  LYS W 56  1 ? 6  
HELX_P HELX_P186 186 HIS T 54  ? TYR T 56  ? HIS W 57  TYR W 59  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E  CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2  disulf ? ? H CYS 23  SG  ? ? ? 1_555 H  CYS 67  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3  disulf ? ? H CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 40  H CYS 54  1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf4  disulf ? ? O CYS 144 SG  ? ? ? 1_555 O  CYS 160 SG  ? ? R CYS 144 R CYS 160 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf5  disulf ? ? R CYS 23  SG  ? ? ? 1_555 R  CYS 67  SG  ? ? U CYS 24  U CYS 68  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6  disulf ? ? R CYS 39  SG  ? ? ? 1_555 R  CYS 53  SG  ? ? U CYS 40  U CYS 54  1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc1  metalc ? ? C HIS 84  NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 84  C HEM 501 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc2  metalc ? ? C HIS 98  NE2 ? ? ? 1_555 X  HEM .   FE  ? ? C HIS 98  C HEM 502 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc3  metalc ? ? C HIS 183 NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 183 C HEM 501 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc4  metalc ? ? C HIS 197 NE2 ? ? ? 1_555 X  HEM .   FE  ? ? C HIS 197 C HEM 502 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc5  metalc ? ? D HIS 41  NE2 ? ? ? 1_555 GA HEC .   FE  ? ? D HIS 41  D HEC 501 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc6  metalc ? ? D MET 160 SD  ? ? ? 1_555 GA HEC .   FE  ? ? D MET 160 D HEC 501 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc7  metalc ? ? E CYS 139 SG  ? ? ? 1_555 IA FES .   FE1 ? ? E CYS 139 E FES 501 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc8  metalc ? ? E HIS 141 ND1 ? ? ? 1_555 IA FES .   FE2 ? ? E HIS 141 E FES 501 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc9  metalc ? ? E CYS 158 SG  ? ? ? 1_555 IA FES .   FE1 ? ? E CYS 158 E FES 501 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc10 metalc ? ? E HIS 161 ND1 ? ? ? 1_555 IA FES .   FE2 ? ? E HIS 161 E FES 501 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc11 metalc ? ? M HIS 84  NE2 ? ? ? 1_555 OA HEM .   FE  ? ? P HIS 84  P HEM 501 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc12 metalc ? ? M HIS 98  NE2 ? ? ? 1_555 PA HEM .   FE  ? ? P HIS 98  P HEM 502 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc13 metalc ? ? M HIS 183 NE2 ? ? ? 1_555 OA HEM .   FE  ? ? P HIS 183 P HEM 501 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc14 metalc ? ? M HIS 197 NE2 ? ? ? 1_555 PA HEM .   FE  ? ? P HIS 197 P HEM 502 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc15 metalc ? ? N HIS 41  NE2 ? ? ? 1_555 ZA HEC .   FE  ? ? Q HIS 41  Q HEC 501 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc16 metalc ? ? N MET 160 SD  ? ? ? 1_555 ZA HEC .   FE  ? ? Q MET 160 Q HEC 501 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc17 metalc ? ? O CYS 139 SG  ? ? ? 1_555 BB FES .   FE1 ? ? R CYS 139 R FES 501 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc18 metalc ? ? O HIS 141 ND1 ? ? ? 1_555 BB FES .   FE2 ? ? R HIS 141 R FES 501 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc19 metalc ? ? O CYS 158 SG  ? ? ? 1_555 BB FES .   FE1 ? ? R CYS 158 R FES 501 1_555 ? ? ? ? ? ? ? 2.240 ? 
metalc20 metalc ? ? O HIS 161 ND1 ? ? ? 1_555 BB FES .   FE2 ? ? R HIS 161 R FES 501 1_555 ? ? ? ? ? ? ? 2.097 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 222 C . ? HIS 222 C PRO 223 C ? PRO 223 C 1 0.35  
2 HIS 346 C . ? HIS 346 C PRO 347 C ? PRO 347 C 1 0.03  
3 GLY 73  D . ? GLY 73  D PRO 74  D ? PRO 74  D 1 0.17  
4 ALA 2   M . ? ALA 2   P PRO 3   M ? PRO 3   P 1 -0.06 
5 HIS 222 M . ? HIS 222 P PRO 223 M ? PRO 223 P 1 0.24  
6 HIS 346 M . ? HIS 346 P PRO 347 M ? PRO 347 P 1 -0.08 
7 GLY 73  N . ? GLY 73  Q PRO 74  N ? PRO 74  Q 1 0.16  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 6 ? 
D ? 5 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 3 ? 
I ? 3 ? 
J ? 4 ? 
K ? 6 ? 
L ? 8 ? 
M ? 2 ? 
N ? 7 ? 
O ? 5 ? 
P ? 2 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 3 ? 
T ? 3 ? 
U ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
N 6 7 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 15  ? THR A 18  ? ASN A 15  THR A 18  
A 2 ARG A 24  ? GLU A 29  ? ARG A 24  GLU A 29  
A 3 VAL A 196 ? GLY A 201 ? VAL A 196 GLY A 201 
A 4 THR A 34  ? VAL A 39  ? THR A 34  VAL A 39  
A 5 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 6 HIS A 85  ? THR A 90  ? HIS A 85  THR A 90  
B 1 ARG A 279 ? ASP A 281 ? ARG A 279 ASP A 281 
B 2 SER A 306 ? SER A 313 ? SER A 306 SER A 313 
B 3 GLY A 318 ? ALA A 326 ? GLY A 318 ALA A 326 
B 4 ALA A 251 ? GLU A 258 ? ALA A 251 GLU A 258 
B 5 ALA A 421 ? GLY A 426 ? ALA A 421 GLY A 426 
B 6 SER A 239 ? ASP A 245 ? SER A 239 ASP A 245 
B 7 ARG G 11  ? LEU G 18  ? ARG G 11  LEU G 18  
B 8 LYS D 234 ? ALA D 236 ? LYS D 234 ALA D 236 
C 1 MET B 206 ? VAL B 209 ? MET B 204 VAL B 207 
C 2 GLY B 50  ? ILE B 53  ? GLY B 48  ILE B 51  
C 3 LYS B 106 ? VAL B 111 ? LYS B 104 VAL B 109 
C 4 LEU B 98  ? THR B 103 ? LEU B 96  THR B 101 
C 5 ALA I 35  ? SER I 38  ? ALA I 66  SER I 69  
C 6 ALA I 43  ? VAL I 45  ? ALA I 74  VAL I 76  
D 1 GLU B 245 ? ARG B 247 ? GLU B 243 ARG B 245 
D 2 LYS B 424 ? SER B 429 ? LYS B 422 SER B 427 
D 3 LEU B 254 ? GLU B 262 ? LEU B 252 GLU B 260 
D 4 SER B 321 ? GLN B 331 ? SER B 319 GLN B 329 
D 5 PHE B 309 ? TYR B 318 ? PHE B 307 TYR B 316 
E 1 PRO C 23  ? PRO C 25  ? PRO C 23  PRO C 25  
E 2 LYS C 218 ? PRO C 220 ? LYS C 218 PRO C 220 
F 1 GLU D 69  ? ASP D 72  ? GLU D 69  ASP D 72  
F 2 PHE D 81  ? PRO D 84  ? PHE D 81  PRO D 84  
G 1 HIS D 148 ? TYR D 149 ? HIS D 148 TYR D 149 
G 2 ALA D 157 ? ILE D 158 ? ALA D 157 ILE D 158 
H 1 ILE E 74  ? LYS E 77  ? ILE E 74  LYS E 77  
H 2 LEU E 192 ? VAL E 195 ? LEU E 192 VAL E 195 
H 3 TYR E 185 ? GLN E 186 ? TYR E 185 GLN E 186 
I 1 ASN E 86  ? ALA E 88  ? ASN E 86  ALA E 88  
I 2 PHE E 97  ? HIS E 100 ? PHE E 97  HIS E 100 
I 3 TRP E 132 ? LEU E 135 ? TRP E 132 LEU E 135 
J 1 ILE E 147 ? ALA E 148 ? ILE E 147 ALA E 148 
J 2 GLY E 154 ? CYS E 158 ? GLY E 154 CYS E 158 
J 3 SER E 163 ? ASP E 166 ? SER E 163 ASP E 166 
J 4 ILE E 171 ? LYS E 173 ? ILE E 171 LYS E 173 
K 1 ASN K 15  ? THR K 18  ? ASN N 15  THR N 18  
K 2 ARG K 24  ? GLU K 29  ? ARG N 24  GLU N 29  
K 3 VAL K 196 ? GLY K 201 ? VAL N 196 GLY N 201 
K 4 THR K 34  ? VAL K 39  ? THR N 34  VAL N 39  
K 5 GLN K 94  ? LEU K 102 ? GLN N 94  LEU N 102 
K 6 HIS K 85  ? SER K 91  ? HIS N 85  SER N 91  
L 1 ARG K 279 ? ASP K 281 ? ARG N 279 ASP N 281 
L 2 SER K 306 ? SER K 313 ? SER N 306 SER N 313 
L 3 GLY K 318 ? ALA K 326 ? GLY N 318 ALA N 326 
L 4 ALA K 251 ? GLU K 258 ? ALA N 251 GLU N 258 
L 5 ALA K 421 ? GLY K 426 ? ALA N 421 GLY N 426 
L 6 SER K 239 ? ASP K 245 ? SER N 239 ASP N 245 
L 7 ARG Q 11  ? LEU Q 18  ? ARG T 11  LEU T 18  
L 8 LYS N 234 ? ALA N 236 ? LYS Q 234 ALA Q 236 
M 1 THR L 29  ? LYS L 30  ? THR O 27  LYS O 28  
M 2 ILE L 36  ? ILE L 37  ? ILE O 34  ILE O 35  
N 1 SER L 39  ? LEU L 40  ? SER O 37  LEU O 38  
N 2 MET L 206 ? ILE L 211 ? MET O 204 ILE O 209 
N 3 ARG L 48  ? ILE L 53  ? ARG O 46  ILE O 51  
N 4 LYS L 106 ? VAL L 111 ? LYS O 104 VAL O 109 
N 5 LEU L 98  ? THR L 103 ? LEU O 96  THR O 101 
N 6 ALA S 35  ? SER S 38  ? ALA V 66  SER V 69  
N 7 ALA S 43  ? VAL S 45  ? ALA V 74  VAL V 76  
O 1 GLU L 245 ? GLN L 249 ? GLU O 243 GLN O 247 
O 2 LYS L 424 ? GLY L 430 ? LYS O 422 GLY O 428 
O 3 LEU L 254 ? GLU L 262 ? LEU O 252 GLU O 260 
O 4 SER L 321 ? GLN L 331 ? SER O 319 GLN O 329 
O 5 PHE L 309 ? TYR L 318 ? PHE O 307 TYR O 316 
P 1 PRO M 23  ? PRO M 25  ? PRO P 23  PRO P 25  
P 2 LYS M 218 ? PRO M 220 ? LYS P 218 PRO P 220 
Q 1 GLU N 69  ? ASP N 72  ? GLU Q 69  ASP Q 72  
Q 2 PHE N 81  ? PRO N 84  ? PHE Q 81  PRO Q 84  
R 1 HIS N 148 ? TYR N 149 ? HIS Q 148 TYR Q 149 
R 2 ALA N 157 ? ILE N 158 ? ALA Q 157 ILE Q 158 
S 1 ILE O 74  ? LYS O 77  ? ILE R 74  LYS R 77  
S 2 LEU O 192 ? VAL O 195 ? LEU R 192 VAL R 195 
S 3 TYR O 185 ? GLN O 186 ? TYR R 185 GLN R 186 
T 1 LYS O 85  ? ALA O 88  ? LYS R 85  ALA R 88  
T 2 PHE O 97  ? HIS O 100 ? PHE R 97  HIS R 100 
T 3 TRP O 132 ? LEU O 135 ? TRP R 132 LEU R 135 
U 1 ILE O 147 ? ALA O 148 ? ILE R 147 ALA R 148 
U 2 GLY O 154 ? CYS O 158 ? GLY R 154 CYS R 158 
U 3 SER O 163 ? ASP O 166 ? SER R 163 ASP R 166 
U 4 ILE O 171 ? LYS O 173 ? ILE R 171 LYS R 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 17  ? N THR A 17  O VAL A 25  ? O VAL A 25  
A 2 3 N ALA A 26  ? N ALA A 26  O LEU A 197 ? O LEU A 197 
A 3 4 O ALA A 198 ? O ALA A 198 N GLY A 38  ? N GLY A 38  
A 4 5 N VAL A 37  ? N VAL A 37  O ILE A 99  ? O ILE A 99  
A 5 6 O LYS A 100 ? O LYS A 100 N HIS A 85  ? N HIS A 85  
B 1 2 N TYR A 280 ? N TYR A 280 O PHE A 307 ? O PHE A 307 
B 2 3 N THR A 312 ? N THR A 312 O LEU A 319 ? O LEU A 319 
B 3 4 O PHE A 320 ? O PHE A 320 N VAL A 257 ? N VAL A 257 
B 4 5 N HIS A 252 ? N HIS A 252 O VAL A 425 ? O VAL A 425 
B 5 6 O ALA A 424 ? O ALA A 424 N ALA A 243 ? N ALA A 243 
B 6 7 N ARG A 242 ? N ARG A 242 O THR G 15  ? O THR G 15  
B 7 8 O TYR G 16  ? O TYR G 16  N LYS D 234 ? N LYS D 234 
C 1 2 O ALA B 207 ? O ALA B 205 N PHE B 52  ? N PHE B 50  
C 2 3 N ILE B 53  ? N ILE B 51  O MET B 107 ? O MET B 105 
C 3 4 O THR B 108 ? O THR B 106 N TYR B 101 ? N TYR B 99  
C 4 5 N VAL B 100 ? N VAL B 98  O ILE I 37  ? O ILE I 68  
C 5 6 N GLY I 36  ? N GLY I 67  O SER I 44  ? O SER I 75  
D 1 2 N ILE B 246 ? N ILE B 244 O MET B 426 ? O MET B 424 
D 2 3 O SER B 425 ? O SER B 423 N VAL B 260 ? N VAL B 258 
D 3 4 N THR B 261 ? N THR B 259 O PHE B 324 ? O PHE B 322 
D 4 5 O GLY B 325 ? O GLY B 323 N PHE B 314 ? N PHE B 312 
E 1 2 N ALA C 24  ? N ALA C 24  O ILE C 219 ? O ILE C 219 
F 1 2 N VAL D 70  ? N VAL D 70  O ARG D 83  ? O ARG D 83  
G 1 2 N HIS D 148 ? N HIS D 148 O ILE D 158 ? O ILE D 158 
H 1 2 N ILE E 76  ? N ILE E 76  O VAL E 193 ? O VAL E 193 
H 2 3 O VAL E 194 ? O VAL E 194 N GLN E 186 ? N GLN E 186 
I 1 2 N VAL E 87  ? N VAL E 87  O VAL E 98  ? O VAL E 98  
I 2 3 N ARG E 99  ? N ARG E 99  O VAL E 133 ? O VAL E 133 
J 1 2 N ILE E 147 ? N ILE E 147 O TYR E 157 ? O TYR E 157 
J 2 3 N TYR E 156 ? N TYR E 156 O TYR E 165 ? O TYR E 165 
J 3 4 N HIS E 164 ? N HIS E 164 O LYS E 173 ? O LYS E 173 
K 1 2 N THR K 17  ? N THR N 17  O VAL K 25  ? O VAL N 25  
K 2 3 N ALA K 26  ? N ALA N 26  O LEU K 197 ? O LEU N 197 
K 3 4 O ALA K 198 ? O ALA N 198 N GLY K 38  ? N GLY N 38  
K 4 5 N VAL K 37  ? N VAL N 37  O ILE K 99  ? O ILE N 99  
K 5 6 O GLN K 94  ? O GLN N 94  N SER K 91  ? N SER N 91  
L 1 2 N TYR K 280 ? N TYR N 280 O PHE K 307 ? O PHE N 307 
L 2 3 N SER K 306 ? N SER N 306 O VAL K 325 ? O VAL N 325 
L 3 4 O PHE K 320 ? O PHE N 320 N VAL K 257 ? N VAL N 257 
L 4 5 N ALA K 256 ? N ALA N 256 O ALA K 421 ? O ALA N 421 
L 5 6 O ALA K 424 ? O ALA N 424 N ALA K 243 ? N ALA N 243 
L 6 7 N ARG K 242 ? N ARG N 242 O THR Q 15  ? O THR T 15  
L 7 8 O TYR Q 16  ? O TYR T 16  N LYS N 234 ? N LYS Q 234 
M 1 2 N THR L 29  ? N THR O 27  O ILE L 37  ? O ILE O 35  
N 1 2 N LEU L 40  ? N LEU O 38  O GLY L 210 ? O GLY O 208 
N 2 3 O ALA L 207 ? O ALA O 205 N PHE L 52  ? N PHE O 50  
N 3 4 N ILE L 53  ? N ILE O 51  O MET L 107 ? O MET O 105 
N 4 5 O THR L 108 ? O THR O 106 N TYR L 101 ? N TYR O 99  
N 5 6 N VAL L 100 ? N VAL O 98  O ILE S 37  ? O ILE V 68  
N 6 7 N GLY S 36  ? N GLY V 67  O SER S 44  ? O SER V 75  
O 1 2 N ILE L 246 ? N ILE O 244 O MET L 426 ? O MET O 424 
O 2 3 O SER L 425 ? O SER O 423 N VAL L 260 ? N VAL O 258 
O 3 4 N ALA L 257 ? N ALA O 255 O THR L 328 ? O THR O 326 
O 4 5 O GLY L 325 ? O GLY O 323 N PHE L 314 ? N PHE O 312 
P 1 2 N ALA M 24  ? N ALA P 24  O ILE M 219 ? O ILE P 219 
Q 1 2 N VAL N 70  ? N VAL Q 70  O ARG N 83  ? O ARG Q 83  
R 1 2 N HIS N 148 ? N HIS Q 148 O ILE N 158 ? O ILE Q 158 
S 1 2 N ILE O 76  ? N ILE R 76  O VAL O 193 ? O VAL R 193 
S 2 3 O VAL O 194 ? O VAL R 194 N GLN O 186 ? N GLN R 186 
T 1 2 N LYS O 85  ? N LYS R 85  O HIS O 100 ? O HIS R 100 
T 2 3 N ARG O 99  ? N ARG R 99  O VAL O 133 ? O VAL R 133 
U 1 2 N ILE O 147 ? N ILE R 147 O TYR O 157 ? O TYR R 157 
U 2 3 N TYR O 156 ? N TYR R 156 O TYR O 165 ? O TYR R 165 
U 3 4 N HIS O 164 ? N HIS R 164 O LYS O 173 ? O LYS R 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 501'  
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM C 502'  
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEC D 501'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE FES E 501'  
AC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM P 501'  
AC6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM P 502'  
AC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEC Q 501'  
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES R 501'  
AC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE SMA C 2001' 
BC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ANY C 2002' 
BC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CDL D 2003' 
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CDL C 2004' 
BC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PEE E 2005' 
BC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PEE C 2007' 
BC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PEE A 2008' 
BC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PLC E 2009' 
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL C 2011' 
BC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL P 2015' 
CC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL R 2103' 
CC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 2104' 
CC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL E 2105' 
CC4 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE SMA P 3001' 
CC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ANY P 3002' 
CC6 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CDL Q 3003' 
CC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CDL P 3004' 
CC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PEE P 3005' 
CC9 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PEE P 3007' 
DC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PEE N 3008' 
DC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PLC R 3009' 
DC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL P 3010' 
DC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL P 3011' 
DC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL C 3015' 
DC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL E 3103' 
DC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL P 3104' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 18 GLN C  45  ? GLN C 45   . ? 1_555 ? 
2   AC1 18 ILE C  46  ? ILE C 46   . ? 1_555 ? 
3   AC1 18 GLY C  49  ? GLY C 49   . ? 1_555 ? 
4   AC1 18 LEU C  52  ? LEU C 52   . ? 1_555 ? 
5   AC1 18 ALA C  53  ? ALA C 53   . ? 1_555 ? 
6   AC1 18 TYR C  56  ? TYR C 56   . ? 1_555 ? 
7   AC1 18 ARG C  81  ? ARG C 81   . ? 1_555 ? 
8   AC1 18 HIS C  84  ? HIS C 84   . ? 1_555 ? 
9   AC1 18 ALA C  85  ? ALA C 85   . ? 1_555 ? 
10  AC1 18 LEU C  124 ? LEU C 124  . ? 1_555 ? 
11  AC1 18 THR C  127 ? THR C 127  . ? 1_555 ? 
12  AC1 18 GLY C  131 ? GLY C 131  . ? 1_555 ? 
13  AC1 18 TYR C  132 ? TYR C 132  . ? 1_555 ? 
14  AC1 18 LEU C  134 ? LEU C 134  . ? 1_555 ? 
15  AC1 18 PRO C  135 ? PRO C 135  . ? 1_555 ? 
16  AC1 18 HIS C  183 ? HIS C 183  . ? 1_555 ? 
17  AC1 18 PHE C  184 ? PHE C 184  . ? 1_555 ? 
18  AC1 18 PRO C  187 ? PRO C 187  . ? 1_555 ? 
19  AC2 20 TRP C  32  ? TRP C 32   . ? 1_555 ? 
20  AC2 20 GLY C  35  ? GLY C 35   . ? 1_555 ? 
21  AC2 20 LEU C  38  ? LEU C 38   . ? 1_555 ? 
22  AC2 20 ALA C  39  ? ALA C 39   . ? 1_555 ? 
23  AC2 20 HIS C  98  ? HIS C 98   . ? 1_555 ? 
24  AC2 20 ARG C  101 ? ARG C 101  . ? 1_555 ? 
25  AC2 20 SER C  107 ? SER C 107  . ? 1_555 ? 
26  AC2 20 THR C  113 ? THR C 113  . ? 1_555 ? 
27  AC2 20 TRP C  114 ? TRP C 114  . ? 1_555 ? 
28  AC2 20 GLY C  117 ? GLY C 117  . ? 1_555 ? 
29  AC2 20 VAL C  118 ? VAL C 118  . ? 1_555 ? 
30  AC2 20 LEU C  120 ? LEU C 120  . ? 1_555 ? 
31  AC2 20 LEU C  121 ? LEU C 121  . ? 1_555 ? 
32  AC2 20 ILE C  190 ? ILE C 190  . ? 1_555 ? 
33  AC2 20 THR C  194 ? THR C 194  . ? 1_555 ? 
34  AC2 20 HIS C  197 ? HIS C 197  . ? 1_555 ? 
35  AC2 20 LEU C  201 ? LEU C 201  . ? 1_555 ? 
36  AC2 20 SER C  206 ? SER C 206  . ? 1_555 ? 
37  AC2 20 ASN C  207 ? ASN C 207  . ? 1_555 ? 
38  AC2 20 ANY Z  .   ? ANY C 2002 . ? 1_555 ? 
39  AC3 14 VAL D  32  ? VAL D 32   . ? 1_555 ? 
40  AC3 14 VAL D  36  ? VAL D 36   . ? 1_555 ? 
41  AC3 14 CYS D  37  ? CYS D 37   . ? 1_555 ? 
42  AC3 14 CYS D  40  ? CYS D 40   . ? 1_555 ? 
43  AC3 14 HIS D  41  ? HIS D 41   . ? 1_555 ? 
44  AC3 14 ASN D  105 ? ASN D 105  . ? 1_555 ? 
45  AC3 14 ALA D  108 ? ALA D 108  . ? 1_555 ? 
46  AC3 14 PRO D  110 ? PRO D 110  . ? 1_555 ? 
47  AC3 14 ARG D  120 ? ARG D 120  . ? 1_555 ? 
48  AC3 14 TYR D  126 ? TYR D 126  . ? 1_555 ? 
49  AC3 14 PHE D  153 ? PHE D 153  . ? 1_555 ? 
50  AC3 14 GLY D  159 ? GLY D 159  . ? 1_555 ? 
51  AC3 14 MET D  160 ? MET D 160  . ? 1_555 ? 
52  AC3 14 PRO D  163 ? PRO D 163  . ? 1_555 ? 
53  AC4 7  CYS E  139 ? CYS E 139  . ? 1_555 ? 
54  AC4 7  HIS E  141 ? HIS E 141  . ? 1_555 ? 
55  AC4 7  LEU E  142 ? LEU E 142  . ? 1_555 ? 
56  AC4 7  CYS E  144 ? CYS E 144  . ? 1_555 ? 
57  AC4 7  CYS E  158 ? CYS E 158  . ? 1_555 ? 
58  AC4 7  HIS E  161 ? HIS E 161  . ? 1_555 ? 
59  AC4 7  SER E  163 ? SER E 163  . ? 1_555 ? 
60  AC5 17 GLN M  45  ? GLN P 45   . ? 1_555 ? 
61  AC5 17 ILE M  46  ? ILE P 46   . ? 1_555 ? 
62  AC5 17 GLY M  49  ? GLY P 49   . ? 1_555 ? 
63  AC5 17 LEU M  52  ? LEU P 52   . ? 1_555 ? 
64  AC5 17 ALA M  53  ? ALA P 53   . ? 1_555 ? 
65  AC5 17 ARG M  81  ? ARG P 81   . ? 1_555 ? 
66  AC5 17 HIS M  84  ? HIS P 84   . ? 1_555 ? 
67  AC5 17 ALA M  85  ? ALA P 85   . ? 1_555 ? 
68  AC5 17 LEU M  124 ? LEU P 124  . ? 1_555 ? 
69  AC5 17 THR M  127 ? THR P 127  . ? 1_555 ? 
70  AC5 17 GLY M  131 ? GLY P 131  . ? 1_555 ? 
71  AC5 17 TYR M  132 ? TYR P 132  . ? 1_555 ? 
72  AC5 17 LEU M  134 ? LEU P 134  . ? 1_555 ? 
73  AC5 17 PRO M  135 ? PRO P 135  . ? 1_555 ? 
74  AC5 17 HIS M  183 ? HIS P 183  . ? 1_555 ? 
75  AC5 17 PHE M  184 ? PHE P 184  . ? 1_555 ? 
76  AC5 17 PRO M  187 ? PRO P 187  . ? 1_555 ? 
77  AC6 18 TRP M  32  ? TRP P 32   . ? 1_555 ? 
78  AC6 18 GLY M  35  ? GLY P 35   . ? 1_555 ? 
79  AC6 18 LEU M  38  ? LEU P 38   . ? 1_555 ? 
80  AC6 18 ALA M  39  ? ALA P 39   . ? 1_555 ? 
81  AC6 18 HIS M  98  ? HIS P 98   . ? 1_555 ? 
82  AC6 18 ARG M  101 ? ARG P 101  . ? 1_555 ? 
83  AC6 18 SER M  107 ? SER P 107  . ? 1_555 ? 
84  AC6 18 THR M  113 ? THR P 113  . ? 1_555 ? 
85  AC6 18 TRP M  114 ? TRP P 114  . ? 1_555 ? 
86  AC6 18 GLY M  117 ? GLY P 117  . ? 1_555 ? 
87  AC6 18 VAL M  118 ? VAL P 118  . ? 1_555 ? 
88  AC6 18 LEU M  120 ? LEU P 120  . ? 1_555 ? 
89  AC6 18 LEU M  121 ? LEU P 121  . ? 1_555 ? 
90  AC6 18 THR M  194 ? THR P 194  . ? 1_555 ? 
91  AC6 18 HIS M  197 ? HIS P 197  . ? 1_555 ? 
92  AC6 18 LEU M  201 ? LEU P 201  . ? 1_555 ? 
93  AC6 18 ASN M  207 ? ASN P 207  . ? 1_555 ? 
94  AC6 18 ANY SA .   ? ANY P 3002 . ? 1_555 ? 
95  AC7 14 VAL N  32  ? VAL Q 32   . ? 1_555 ? 
96  AC7 14 VAL N  36  ? VAL Q 36   . ? 1_555 ? 
97  AC7 14 CYS N  37  ? CYS Q 37   . ? 1_555 ? 
98  AC7 14 CYS N  40  ? CYS Q 40   . ? 1_555 ? 
99  AC7 14 HIS N  41  ? HIS Q 41   . ? 1_555 ? 
100 AC7 14 ASN N  105 ? ASN Q 105  . ? 1_555 ? 
101 AC7 14 ALA N  108 ? ALA Q 108  . ? 1_555 ? 
102 AC7 14 PRO N  110 ? PRO Q 110  . ? 1_555 ? 
103 AC7 14 ARG N  120 ? ARG Q 120  . ? 1_555 ? 
104 AC7 14 TYR N  126 ? TYR Q 126  . ? 1_555 ? 
105 AC7 14 PHE N  153 ? PHE Q 153  . ? 1_555 ? 
106 AC7 14 GLY N  159 ? GLY Q 159  . ? 1_555 ? 
107 AC7 14 MET N  160 ? MET Q 160  . ? 1_555 ? 
108 AC7 14 PRO N  163 ? PRO Q 163  . ? 1_555 ? 
109 AC8 8  CYS O  139 ? CYS R 139  . ? 1_555 ? 
110 AC8 8  HIS O  141 ? HIS R 141  . ? 1_555 ? 
111 AC8 8  LEU O  142 ? LEU R 142  . ? 1_555 ? 
112 AC8 8  GLY O  143 ? GLY R 143  . ? 1_555 ? 
113 AC8 8  CYS O  144 ? CYS R 144  . ? 1_555 ? 
114 AC8 8  CYS O  158 ? CYS R 158  . ? 1_555 ? 
115 AC8 8  HIS O  161 ? HIS R 161  . ? 1_555 ? 
116 AC8 8  SER O  163 ? SER R 163  . ? 1_555 ? 
117 AC9 12 LEU C  122 ? LEU C 122  . ? 1_555 ? 
118 AC9 12 MET C  125 ? MET C 125  . ? 1_555 ? 
119 AC9 12 ALA C  126 ? ALA C 126  . ? 1_555 ? 
120 AC9 12 PHE C  129 ? PHE C 129  . ? 1_555 ? 
121 AC9 12 GLY C  143 ? GLY C 143  . ? 1_555 ? 
122 AC9 12 VAL C  146 ? VAL C 146  . ? 1_555 ? 
123 AC9 12 ILE C  147 ? ILE C 147  . ? 1_555 ? 
124 AC9 12 PRO C  271 ? PRO C 271  . ? 1_555 ? 
125 AC9 12 GLU C  272 ? GLU C 272  . ? 1_555 ? 
126 AC9 12 PHE C  275 ? PHE C 275  . ? 1_555 ? 
127 AC9 12 TYR C  279 ? TYR C 279  . ? 1_555 ? 
128 AC9 12 HIS O  161 ? HIS R 161  . ? 1_555 ? 
129 BC1 14 SER C  18  ? SER C 18   . ? 1_555 ? 
130 BC1 14 LEU C  19  ? LEU C 19   . ? 1_555 ? 
131 BC1 14 ILE C  28  ? ILE C 28   . ? 1_555 ? 
132 BC1 14 TRP C  32  ? TRP C 32   . ? 1_555 ? 
133 BC1 14 SER C  36  ? SER C 36   . ? 1_555 ? 
134 BC1 14 ALA C  39  ? ALA C 39   . ? 1_555 ? 
135 BC1 14 LEU C  42  ? LEU C 42   . ? 1_555 ? 
136 BC1 14 THR C  194 ? THR C 194  . ? 1_555 ? 
137 BC1 14 ILE C  195 ? ILE C 195  . ? 1_555 ? 
138 BC1 14 LEU C  198 ? LEU C 198  . ? 1_555 ? 
139 BC1 14 PHE C  221 ? PHE C 221  . ? 1_555 ? 
140 BC1 14 TYR C  225 ? TYR C 225  . ? 1_555 ? 
141 BC1 14 ASP C  229 ? ASP C 229  . ? 1_555 ? 
142 BC1 14 HEM X  .   ? HEM C 502  . ? 1_555 ? 
143 BC2 12 ALA C  30  ? ALA C 30   . ? 1_555 ? 
144 BC2 12 ASN C  33  ? ASN C 33   . ? 1_555 ? 
145 BC2 12 LEU C  231 ? LEU C 231  . ? 1_555 ? 
146 BC2 12 GLY C  232 ? GLY C 232  . ? 1_555 ? 
147 BC2 12 MET C  236 ? MET C 236  . ? 1_555 ? 
148 BC2 12 CDL AA .   ? CDL C 2004 . ? 1_555 ? 
149 BC2 12 TYR D  220 ? TYR D 220  . ? 1_555 ? 
150 BC2 12 LYS D  223 ? LYS D 223  . ? 1_555 ? 
151 BC2 12 ARG D  224 ? ARG D 224  . ? 1_555 ? 
152 BC2 12 HIS F  72  ? HIS F 72   . ? 1_555 ? 
153 BC2 12 ARG F  73  ? ARG F 73   . ? 1_555 ? 
154 BC2 12 ARG G  40  ? ARG G 40   . ? 1_555 ? 
155 BC3 8  SER C  29  ? SER C 29   . ? 1_555 ? 
156 BC3 8  ALA C  30  ? ALA C 30   . ? 1_555 ? 
157 BC3 8  TRP C  31  ? TRP C 31   . ? 1_555 ? 
158 BC3 8  PEE BA .   ? PEE C 2007 . ? 1_555 ? 
159 BC3 8  CDL HA .   ? CDL D 2003 . ? 1_555 ? 
160 BC3 8  ARG G  40  ? ARG G 40   . ? 1_555 ? 
161 BC3 8  PHE G  41  ? PHE G 41   . ? 1_555 ? 
162 BC3 8  GLN G  44  ? GLN G 44   . ? 1_555 ? 
163 BC4 8  PEE U  .   ? PEE A 2008 . ? 1_555 ? 
164 BC4 8  PHE C  227 ? PHE C 227  . ? 1_555 ? 
165 BC4 8  ILE C  230 ? ILE C 230  . ? 1_555 ? 
166 BC4 8  LYS D  226 ? LYS D 226  . ? 1_555 ? 
167 BC4 8  TYR E  37  ? TYR E 37   . ? 1_555 ? 
168 BC4 8  THR E  40  ? THR E 40   . ? 1_555 ? 
169 BC4 8  THR E  47  ? THR E 47   . ? 1_555 ? 
170 BC4 8  PHE J  11  ? PHE J 14   . ? 1_555 ? 
171 BC5 11 TRP C  31  ? TRP C 31   . ? 1_555 ? 
172 BC5 11 PHE C  96  ? PHE C 96   . ? 1_555 ? 
173 BC5 11 ARG C  101 ? ARG C 101  . ? 1_555 ? 
174 BC5 11 TYR C  104 ? TYR C 104  . ? 1_555 ? 
175 BC5 11 TYR C  105 ? TYR C 105  . ? 1_555 ? 
176 BC5 11 PHE C  277 ? PHE C 277  . ? 1_555 ? 
177 BC5 11 THR C  317 ? THR C 317  . ? 1_555 ? 
178 BC5 11 TRP C  327 ? TRP C 327  . ? 1_555 ? 
179 BC5 11 CDL AA .   ? CDL C 2004 . ? 1_555 ? 
180 BC5 11 TYR F  29  ? TYR F 29   . ? 1_555 ? 
181 BC5 11 GLN G  44  ? GLN G 44   . ? 1_555 ? 
182 BC6 3  TYR A  442 ? TYR A 442  . ? 1_555 ? 
183 BC6 3  HIS C  222 ? HIS C 222  . ? 1_555 ? 
184 BC6 3  PEE JA .   ? PEE E 2005 . ? 1_555 ? 
185 BC7 11 LEU C  79  ? LEU C 79   . ? 1_555 ? 
186 BC7 11 LEU C  241 ? LEU C 241  . ? 1_555 ? 
187 BC7 11 GLN D  200 ? GLN D 200  . ? 1_555 ? 
188 BC7 11 MET D  204 ? MET D 204  . ? 1_555 ? 
189 BC7 11 LYS D  207 ? LYS D 207  . ? 1_555 ? 
190 BC7 11 MET D  208 ? MET D 208  . ? 1_555 ? 
191 BC7 11 TYR E  49  ? TYR E 49   . ? 1_555 ? 
192 BC7 11 ALA E  50  ? ALA E 50   . ? 1_555 ? 
193 BC7 11 VAL E  54  ? VAL E 54   . ? 1_555 ? 
194 BC7 11 GLN E  57  ? GLN E 57   . ? 1_555 ? 
195 BC7 11 ASP J  33  ? ASP J 36   . ? 1_555 ? 
196 BC8 5  PHE C  64  ? PHE C 64   . ? 1_555 ? 
197 BC8 5  ARG C  81  ? ARG C 81   . ? 1_555 ? 
198 BC8 5  ASN C  256 ? ASN C 256  . ? 1_555 ? 
199 BC8 5  PHE C  257 ? PHE C 257  . ? 1_555 ? 
200 BC8 5  TYR D  115 ? TYR D 115  . ? 1_555 ? 
201 BC9 1  THR M  199 ? THR P 199  . ? 1_555 ? 
202 CC1 1  THR O  140 ? THR R 140  . ? 1_555 ? 
203 CC2 1  ASN C  149 ? ASN C 149  . ? 1_555 ? 
204 CC3 1  TYR E  178 ? TYR E 178  . ? 1_555 ? 
205 CC4 14 HIS E  161 ? HIS E 161  . ? 1_555 ? 
206 CC4 14 LEU M  122 ? LEU P 122  . ? 1_555 ? 
207 CC4 14 MET M  125 ? MET P 125  . ? 1_555 ? 
208 CC4 14 ALA M  126 ? ALA P 126  . ? 1_555 ? 
209 CC4 14 PHE M  129 ? PHE P 129  . ? 1_555 ? 
210 CC4 14 GLY M  143 ? GLY P 143  . ? 1_555 ? 
211 CC4 14 VAL M  146 ? VAL P 146  . ? 1_555 ? 
212 CC4 14 ILE M  147 ? ILE P 147  . ? 1_555 ? 
213 CC4 14 LEU M  182 ? LEU P 182  . ? 1_555 ? 
214 CC4 14 LYS M  270 ? LYS P 270  . ? 1_555 ? 
215 CC4 14 PRO M  271 ? PRO P 271  . ? 1_555 ? 
216 CC4 14 GLU M  272 ? GLU P 272  . ? 1_555 ? 
217 CC4 14 PHE M  275 ? PHE P 275  . ? 1_555 ? 
218 CC4 14 TYR M  279 ? TYR P 279  . ? 1_555 ? 
219 CC5 13 LEU M  19  ? LEU P 19   . ? 1_555 ? 
220 CC5 13 ILE M  28  ? ILE P 28   . ? 1_555 ? 
221 CC5 13 TRP M  32  ? TRP P 32   . ? 1_555 ? 
222 CC5 13 SER M  36  ? SER P 36   . ? 1_555 ? 
223 CC5 13 ALA M  39  ? ALA P 39   . ? 1_555 ? 
224 CC5 13 LEU M  42  ? LEU P 42   . ? 1_555 ? 
225 CC5 13 THR M  194 ? THR P 194  . ? 1_555 ? 
226 CC5 13 ILE M  195 ? ILE P 195  . ? 1_555 ? 
227 CC5 13 LEU M  198 ? LEU P 198  . ? 1_555 ? 
228 CC5 13 PHE M  221 ? PHE P 221  . ? 1_555 ? 
229 CC5 13 TYR M  225 ? TYR P 225  . ? 1_555 ? 
230 CC5 13 ASP M  229 ? ASP P 229  . ? 1_555 ? 
231 CC5 13 HEM PA .   ? HEM P 502  . ? 1_555 ? 
232 CC6 12 ALA M  30  ? ALA P 30   . ? 1_555 ? 
233 CC6 12 ASN M  33  ? ASN P 33   . ? 1_555 ? 
234 CC6 12 LEU M  231 ? LEU P 231  . ? 1_555 ? 
235 CC6 12 GLY M  232 ? GLY P 232  . ? 1_555 ? 
236 CC6 12 MET M  236 ? MET P 236  . ? 1_555 ? 
237 CC6 12 CDL TA .   ? CDL P 3004 . ? 1_555 ? 
238 CC6 12 TYR N  220 ? TYR Q 220  . ? 1_555 ? 
239 CC6 12 LYS N  223 ? LYS Q 223  . ? 1_555 ? 
240 CC6 12 ARG N  224 ? ARG Q 224  . ? 1_555 ? 
241 CC6 12 HIS P  72  ? HIS S 72   . ? 1_555 ? 
242 CC6 12 ARG P  73  ? ARG S 73   . ? 1_555 ? 
243 CC6 12 ARG Q  40  ? ARG T 40   . ? 1_555 ? 
244 CC7 9  SER M  29  ? SER P 29   . ? 1_555 ? 
245 CC7 9  ALA M  30  ? ALA P 30   . ? 1_555 ? 
246 CC7 9  TRP M  31  ? TRP P 31   . ? 1_555 ? 
247 CC7 9  PEE VA .   ? PEE P 3007 . ? 1_555 ? 
248 CC7 9  CDL AB .   ? CDL Q 3003 . ? 1_555 ? 
249 CC7 9  HIS P  72  ? HIS S 72   . ? 1_555 ? 
250 CC7 9  ARG Q  40  ? ARG T 40   . ? 1_555 ? 
251 CC7 9  PHE Q  41  ? PHE T 41   . ? 1_555 ? 
252 CC7 9  GLN Q  44  ? GLN T 44   . ? 1_555 ? 
253 CC8 8  PHE M  227 ? PHE P 227  . ? 1_555 ? 
254 CC8 8  ILE M  230 ? ILE P 230  . ? 1_555 ? 
255 CC8 8  LYS N  226 ? LYS Q 226  . ? 1_555 ? 
256 CC8 8  TYR O  37  ? TYR R 37   . ? 1_555 ? 
257 CC8 8  THR O  40  ? THR R 40   . ? 1_555 ? 
258 CC8 8  THR O  47  ? THR R 47   . ? 1_555 ? 
259 CC8 8  PHE T  11  ? PHE W 14   . ? 1_555 ? 
260 CC8 8  GLU T  29  ? GLU W 32   . ? 1_555 ? 
261 CC9 12 TRP M  31  ? TRP P 31   . ? 1_555 ? 
262 CC9 12 PHE M  96  ? PHE P 96   . ? 1_555 ? 
263 CC9 12 ARG M  101 ? ARG P 101  . ? 1_555 ? 
264 CC9 12 TYR M  104 ? TYR P 104  . ? 1_555 ? 
265 CC9 12 TYR M  105 ? TYR P 105  . ? 1_555 ? 
266 CC9 12 PHE M  277 ? PHE P 277  . ? 1_555 ? 
267 CC9 12 THR M  317 ? THR P 317  . ? 1_555 ? 
268 CC9 12 TRP M  327 ? TRP P 327  . ? 1_555 ? 
269 CC9 12 LEU M  333 ? LEU P 333  . ? 1_555 ? 
270 CC9 12 CDL TA .   ? CDL P 3004 . ? 1_555 ? 
271 CC9 12 TYR P  29  ? TYR S 29   . ? 1_555 ? 
272 CC9 12 GLN Q  44  ? GLN T 44   . ? 1_555 ? 
273 DC1 2  TYR K  442 ? TYR N 442  . ? 1_555 ? 
274 DC1 2  HIS M  222 ? HIS P 222  . ? 1_555 ? 
275 DC2 10 THR M  44  ? THR P 44   . ? 1_555 ? 
276 DC2 10 TYR M  76  ? TYR P 76   . ? 1_555 ? 
277 DC2 10 LEU M  79  ? LEU P 79   . ? 1_555 ? 
278 DC2 10 GLN N  200 ? GLN Q 200  . ? 1_555 ? 
279 DC2 10 MET N  204 ? MET Q 204  . ? 1_555 ? 
280 DC2 10 LYS N  207 ? LYS Q 207  . ? 1_555 ? 
281 DC2 10 TYR O  49  ? TYR R 49   . ? 1_555 ? 
282 DC2 10 ALA O  50  ? ALA R 50   . ? 1_555 ? 
283 DC2 10 VAL O  54  ? VAL R 54   . ? 1_555 ? 
284 DC2 10 GLN O  57  ? GLN R 57   . ? 1_555 ? 
285 DC3 1  ALA M  85  ? ALA P 85   . ? 1_555 ? 
286 DC4 4  PHE M  64  ? PHE P 64   . ? 1_555 ? 
287 DC4 4  ARG M  81  ? ARG P 81   . ? 1_555 ? 
288 DC4 4  ASN M  256 ? ASN P 256  . ? 1_555 ? 
289 DC4 4  TYR N  115 ? TYR Q 115  . ? 1_555 ? 
290 DC5 2  THR C  199 ? THR C 199  . ? 1_555 ? 
291 DC5 2  HIS C  202 ? HIS C 202  . ? 1_555 ? 
292 DC6 1  THR E  140 ? THR E 140  . ? 1_555 ? 
293 DC7 2  ASN M  149 ? ASN P 149  . ? 1_555 ? 
294 DC7 2  HIS M  159 ? HIS P 159  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H1I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H1I 
_atom_sites.fract_transf_matrix[1][1]   0.005724 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004154 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1  2   ? 91.653  83.877  53.069  1.00 135.14 ? 2    ALA A N     1 
ATOM   2     C  CA    . ALA A  1  2   ? 90.627  83.416  52.079  1.00 135.99 ? 2    ALA A CA    1 
ATOM   3     C  C     . ALA A  1  2   ? 89.258  84.103  52.296  1.00 136.35 ? 2    ALA A C     1 
ATOM   4     O  O     . ALA A  1  2   ? 88.248  83.430  52.526  1.00 137.24 ? 2    ALA A O     1 
ATOM   5     C  CB    . ALA A  1  2   ? 90.482  81.891  52.179  1.00 135.27 ? 2    ALA A CB    1 
ATOM   6     N  N     . THR A  1  3   ? 89.228  85.436  52.186  1.00 135.90 ? 3    THR A N     1 
ATOM   7     C  CA    . THR A  1  3   ? 88.015  86.247  52.410  1.00 134.07 ? 3    THR A CA    1 
ATOM   8     C  C     . THR A  1  3   ? 86.695  85.808  51.771  1.00 133.19 ? 3    THR A C     1 
ATOM   9     O  O     . THR A  1  3   ? 86.662  85.259  50.669  1.00 132.36 ? 3    THR A O     1 
ATOM   10    C  CB    . THR A  1  3   ? 88.229  87.737  52.005  1.00 133.67 ? 3    THR A CB    1 
ATOM   11    O  OG1   . THR A  1  3   ? 88.027  87.890  50.592  1.00 132.44 ? 3    THR A OG1   1 
ATOM   12    C  CG2   . THR A  1  3   ? 89.636  88.205  52.389  1.00 132.84 ? 3    THR A CG2   1 
ATOM   13    N  N     . TYR A  1  4   ? 85.611  86.079  52.494  1.00 132.62 ? 4    TYR A N     1 
ATOM   14    C  CA    . TYR A  1  4   ? 84.255  85.772  52.062  1.00 132.47 ? 4    TYR A CA    1 
ATOM   15    C  C     . TYR A  1  4   ? 84.159  85.944  50.555  1.00 132.44 ? 4    TYR A C     1 
ATOM   16    O  O     . TYR A  1  4   ? 84.206  84.965  49.808  1.00 132.14 ? 4    TYR A O     1 
ATOM   17    C  CB    . TYR A  1  4   ? 83.270  86.711  52.794  1.00 132.57 ? 4    TYR A CB    1 
ATOM   18    C  CG    . TYR A  1  4   ? 81.870  86.872  52.198  1.00 132.32 ? 4    TYR A CG    1 
ATOM   19    C  CD1   . TYR A  1  4   ? 81.025  85.773  52.004  1.00 132.11 ? 4    TYR A CD1   1 
ATOM   20    C  CD2   . TYR A  1  4   ? 81.381  88.139  51.856  1.00 131.82 ? 4    TYR A CD2   1 
ATOM   21    C  CE1   . TYR A  1  4   ? 79.728  85.933  51.482  1.00 131.02 ? 4    TYR A CE1   1 
ATOM   22    C  CE2   . TYR A  1  4   ? 80.092  88.307  51.338  1.00 131.18 ? 4    TYR A CE2   1 
ATOM   23    C  CZ    . TYR A  1  4   ? 79.276  87.201  51.152  1.00 131.00 ? 4    TYR A CZ    1 
ATOM   24    O  OH    . TYR A  1  4   ? 78.020  87.368  50.615  1.00 130.91 ? 4    TYR A OH    1 
ATOM   25    N  N     . ALA A  1  5   ? 84.053  87.197  50.124  1.00 132.61 ? 5    ALA A N     1 
ATOM   26    C  CA    . ALA A  1  5   ? 83.940  87.545  48.711  1.00 133.09 ? 5    ALA A CA    1 
ATOM   27    C  C     . ALA A  1  5   ? 84.411  86.430  47.784  1.00 133.34 ? 5    ALA A C     1 
ATOM   28    O  O     . ALA A  1  5   ? 83.620  85.785  47.093  1.00 132.97 ? 5    ALA A O     1 
ATOM   29    C  CB    . ALA A  1  5   ? 84.731  88.822  48.431  1.00 133.02 ? 5    ALA A CB    1 
ATOM   30    N  N     . GLN A  1  6   ? 85.715  86.210  47.789  1.00 133.56 ? 6    GLN A N     1 
ATOM   31    C  CA    . GLN A  1  6   ? 86.337  85.197  46.960  1.00 133.50 ? 6    GLN A CA    1 
ATOM   32    C  C     . GLN A  1  6   ? 85.602  83.851  46.931  1.00 133.39 ? 6    GLN A C     1 
ATOM   33    O  O     . GLN A  1  6   ? 85.297  83.340  45.856  1.00 133.37 ? 6    GLN A O     1 
ATOM   34    C  CB    . GLN A  1  6   ? 87.771  85.015  47.429  1.00 133.71 ? 6    GLN A CB    1 
ATOM   35    C  CG    . GLN A  1  6   ? 88.505  86.333  47.531  1.00 134.46 ? 6    GLN A CG    1 
ATOM   36    C  CD    . GLN A  1  6   ? 89.794  86.218  48.309  1.00 135.75 ? 6    GLN A CD    1 
ATOM   37    O  OE1   . GLN A  1  6   ? 89.795  85.788  49.463  1.00 136.38 ? 6    GLN A OE1   1 
ATOM   38    N  NE2   . GLN A  1  6   ? 90.903  86.606  47.687  1.00 136.27 ? 6    GLN A NE2   1 
ATOM   39    N  N     . THR A  1  7   ? 85.311  83.277  48.095  1.00 132.84 ? 7    THR A N     1 
ATOM   40    C  CA    . THR A  1  7   ? 84.627  81.990  48.129  1.00 132.17 ? 7    THR A CA    1 
ATOM   41    C  C     . THR A  1  7   ? 83.375  82.041  47.281  1.00 132.90 ? 7    THR A C     1 
ATOM   42    O  O     . THR A  1  7   ? 82.882  81.009  46.837  1.00 132.51 ? 7    THR A O     1 
ATOM   43    C  CB    . THR A  1  7   ? 84.210  81.601  49.543  1.00 131.17 ? 7    THR A CB    1 
ATOM   44    O  OG1   . THR A  1  7   ? 83.222  82.518  50.007  1.00 130.80 ? 7    THR A OG1   1 
ATOM   45    C  CG2   . THR A  1  7   ? 85.395  81.644  50.475  1.00 130.96 ? 7    THR A CG2   1 
ATOM   46    N  N     . LEU A  1  8   ? 82.864  83.247  47.056  1.00 134.12 ? 8    LEU A N     1 
ATOM   47    C  CA    . LEU A  1  8   ? 81.657  83.427  46.255  1.00 136.29 ? 8    LEU A CA    1 
ATOM   48    C  C     . LEU A  1  8   ? 81.871  83.173  44.770  1.00 137.45 ? 8    LEU A C     1 
ATOM   49    O  O     . LEU A  1  8   ? 81.075  82.481  44.131  1.00 137.87 ? 8    LEU A O     1 
ATOM   50    C  CB    . LEU A  1  8   ? 81.091  84.842  46.426  1.00 136.91 ? 8    LEU A CB    1 
ATOM   51    C  CG    . LEU A  1  8   ? 80.329  85.224  47.700  1.00 137.94 ? 8    LEU A CG    1 
ATOM   52    C  CD1   . LEU A  1  8   ? 79.807  86.648  47.555  1.00 138.19 ? 8    LEU A CD1   1 
ATOM   53    C  CD2   . LEU A  1  8   ? 79.161  84.274  47.937  1.00 137.98 ? 8    LEU A CD2   1 
ATOM   54    N  N     . GLN A  1  9   ? 82.938  83.749  44.222  1.00 138.75 ? 9    GLN A N     1 
ATOM   55    C  CA    . GLN A  1  9   ? 83.254  83.608  42.798  1.00 139.53 ? 9    GLN A CA    1 
ATOM   56    C  C     . GLN A  1  9   ? 83.830  82.240  42.427  1.00 139.80 ? 9    GLN A C     1 
ATOM   57    O  O     . GLN A  1  9   ? 83.868  81.863  41.250  1.00 138.92 ? 9    GLN A O     1 
ATOM   58    C  CB    . GLN A  1  9   ? 84.207  84.735  42.371  1.00 139.50 ? 9    GLN A CB    1 
ATOM   59    C  CG    . GLN A  1  9   ? 85.359  84.991  43.332  1.00 138.91 ? 9    GLN A CG    1 
ATOM   60    C  CD    . GLN A  1  9   ? 86.011  86.335  43.105  1.00 138.71 ? 9    GLN A CD    1 
ATOM   61    O  OE1   . GLN A  1  9   ? 85.401  87.378  43.329  1.00 138.89 ? 9    GLN A OE1   1 
ATOM   62    N  NE2   . GLN A  1  9   ? 87.258  86.318  42.653  1.00 139.12 ? 9    GLN A NE2   1 
ATOM   63    N  N     . ASN A  1  10  ? 84.269  81.503  43.442  1.00 140.47 ? 10   ASN A N     1 
ATOM   64    C  CA    . ASN A  1  10  ? 84.820  80.175  43.236  1.00 141.35 ? 10   ASN A CA    1 
ATOM   65    C  C     . ASN A  1  10  ? 83.678  79.228  42.971  1.00 141.24 ? 10   ASN A C     1 
ATOM   66    O  O     . ASN A  1  10  ? 83.813  78.275  42.208  1.00 141.42 ? 10   ASN A O     1 
ATOM   67    C  CB    . ASN A  1  10  ? 85.571  79.703  44.476  1.00 142.86 ? 10   ASN A CB    1 
ATOM   68    C  CG    . ASN A  1  10  ? 87.019  80.115  44.466  1.00 144.55 ? 10   ASN A CG    1 
ATOM   69    O  OD1   . ASN A  1  10  ? 87.337  81.305  44.452  1.00 145.33 ? 10   ASN A OD1   1 
ATOM   70    N  ND2   . ASN A  1  10  ? 87.914  79.129  44.467  1.00 145.38 ? 10   ASN A ND2   1 
ATOM   71    N  N     . ILE A  1  11  ? 82.554  79.495  43.624  1.00 140.97 ? 11   ILE A N     1 
ATOM   72    C  CA    . ILE A  1  11  ? 81.369  78.668  43.470  1.00 140.77 ? 11   ILE A CA    1 
ATOM   73    C  C     . ILE A  1  11  ? 81.140  78.389  41.988  1.00 139.91 ? 11   ILE A C     1 
ATOM   74    O  O     . ILE A  1  11  ? 80.845  79.296  41.211  1.00 139.57 ? 11   ILE A O     1 
ATOM   75    C  CB    . ILE A  1  11  ? 80.122  79.359  44.092  1.00 141.41 ? 11   ILE A CB    1 
ATOM   76    C  CG1   . ILE A  1  11  ? 80.338  79.554  45.600  1.00 141.40 ? 11   ILE A CG1   1 
ATOM   77    C  CG2   . ILE A  1  11  ? 78.870  78.518  43.849  1.00 141.86 ? 11   ILE A CG2   1 
ATOM   78    C  CD1   . ILE A  1  11  ? 79.135  80.104  46.344  1.00 140.92 ? 11   ILE A CD1   1 
ATOM   79    N  N     . PRO A  1  12  ? 81.285  77.118  41.582  1.00 139.45 ? 12   PRO A N     1 
ATOM   80    C  CA    . PRO A  1  12  ? 81.108  76.669  40.198  1.00 139.41 ? 12   PRO A CA    1 
ATOM   81    C  C     . PRO A  1  12  ? 79.840  77.165  39.509  1.00 139.56 ? 12   PRO A C     1 
ATOM   82    O  O     . PRO A  1  12  ? 78.725  76.838  39.921  1.00 139.84 ? 12   PRO A O     1 
ATOM   83    C  CB    . PRO A  1  12  ? 81.151  75.143  40.320  1.00 139.43 ? 12   PRO A CB    1 
ATOM   84    C  CG    . PRO A  1  12  ? 80.708  74.888  41.739  1.00 139.57 ? 12   PRO A CG    1 
ATOM   85    C  CD    . PRO A  1  12  ? 81.440  75.964  42.486  1.00 139.20 ? 12   PRO A CD    1 
ATOM   86    N  N     . GLU A  1  13  ? 80.024  77.956  38.456  1.00 139.52 ? 13   GLU A N     1 
ATOM   87    C  CA    . GLU A  1  13  ? 78.910  78.502  37.687  1.00 139.38 ? 13   GLU A CA    1 
ATOM   88    C  C     . GLU A  1  13  ? 77.878  77.403  37.478  1.00 138.58 ? 13   GLU A C     1 
ATOM   89    O  O     . GLU A  1  13  ? 78.225  76.225  37.413  1.00 139.16 ? 13   GLU A O     1 
ATOM   90    C  CB    . GLU A  1  13  ? 79.411  79.000  36.326  1.00 140.76 ? 13   GLU A CB    1 
ATOM   91    C  CG    . GLU A  1  13  ? 78.341  79.649  35.454  1.00 143.57 ? 13   GLU A CG    1 
ATOM   92    C  CD    . GLU A  1  13  ? 78.807  79.887  34.016  1.00 145.10 ? 13   GLU A CD    1 
ATOM   93    O  OE1   . GLU A  1  13  ? 79.051  78.893  33.292  1.00 145.86 ? 13   GLU A OE1   1 
ATOM   94    O  OE2   . GLU A  1  13  ? 78.928  81.066  33.610  1.00 145.60 ? 13   GLU A OE2   1 
ATOM   95    N  N     . THR A  1  14  ? 76.609  77.775  37.390  1.00 137.28 ? 14   THR A N     1 
ATOM   96    C  CA    . THR A  1  14  ? 75.576  76.777  37.169  1.00 136.33 ? 14   THR A CA    1 
ATOM   97    C  C     . THR A  1  14  ? 75.283  76.715  35.677  1.00 135.88 ? 14   THR A C     1 
ATOM   98    O  O     . THR A  1  14  ? 74.722  77.650  35.102  1.00 135.54 ? 14   THR A O     1 
ATOM   99    C  CB    . THR A  1  14  ? 74.302  77.117  37.932  1.00 136.16 ? 14   THR A CB    1 
ATOM   100   O  OG1   . THR A  1  14  ? 74.586  77.140  39.337  1.00 135.80 ? 14   THR A OG1   1 
ATOM   101   C  CG2   . THR A  1  14  ? 73.234  76.078  37.652  1.00 136.42 ? 14   THR A CG2   1 
ATOM   102   N  N     . ASN A  1  15  ? 75.674  75.603  35.059  1.00 135.45 ? 15   ASN A N     1 
ATOM   103   C  CA    . ASN A  1  15  ? 75.506  75.401  33.622  1.00 134.27 ? 15   ASN A CA    1 
ATOM   104   C  C     . ASN A  1  15  ? 74.054  75.208  33.189  1.00 132.48 ? 15   ASN A C     1 
ATOM   105   O  O     . ASN A  1  15  ? 73.229  74.671  33.929  1.00 130.95 ? 15   ASN A O     1 
ATOM   106   C  CB    . ASN A  1  15  ? 76.353  74.200  33.149  1.00 135.34 ? 15   ASN A CB    1 
ATOM   107   C  CG    . ASN A  1  15  ? 77.858  74.392  33.384  1.00 135.55 ? 15   ASN A CG    1 
ATOM   108   O  OD1   . ASN A  1  15  ? 78.445  75.401  32.976  1.00 135.71 ? 15   ASN A OD1   1 
ATOM   109   N  ND2   . ASN A  1  15  ? 78.486  73.411  34.034  1.00 135.14 ? 15   ASN A ND2   1 
ATOM   110   N  N     . VAL A  1  16  ? 73.755  75.655  31.975  1.00 131.31 ? 16   VAL A N     1 
ATOM   111   C  CA    . VAL A  1  16  ? 72.414  75.545  31.435  1.00 130.95 ? 16   VAL A CA    1 
ATOM   112   C  C     . VAL A  1  16  ? 72.417  75.383  29.923  1.00 130.88 ? 16   VAL A C     1 
ATOM   113   O  O     . VAL A  1  16  ? 73.236  75.982  29.225  1.00 130.83 ? 16   VAL A O     1 
ATOM   114   C  CB    . VAL A  1  16  ? 71.600  76.793  31.737  1.00 131.30 ? 16   VAL A CB    1 
ATOM   115   C  CG1   . VAL A  1  16  ? 70.131  76.521  31.458  1.00 131.32 ? 16   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A  1  16  ? 71.836  77.236  33.168  1.00 131.80 ? 16   VAL A CG2   1 
ATOM   117   N  N     . THR A  1  17  ? 71.476  74.588  29.422  1.00 130.77 ? 17   THR A N     1 
ATOM   118   C  CA    . THR A  1  17  ? 71.334  74.344  27.986  1.00 130.42 ? 17   THR A CA    1 
ATOM   119   C  C     . THR A  1  17  ? 69.874  74.068  27.679  1.00 129.35 ? 17   THR A C     1 
ATOM   120   O  O     . THR A  1  17  ? 69.060  73.951  28.593  1.00 129.56 ? 17   THR A O     1 
ATOM   121   C  CB    . THR A  1  17  ? 72.159  73.133  27.524  1.00 131.38 ? 17   THR A CB    1 
ATOM   122   O  OG1   . THR A  1  17  ? 71.806  71.984  28.308  1.00 131.59 ? 17   THR A OG1   1 
ATOM   123   C  CG2   . THR A  1  17  ? 73.651  73.421  27.663  1.00 132.43 ? 17   THR A CG2   1 
ATOM   124   N  N     . THR A  1  18  ? 69.544  73.928  26.401  1.00 128.15 ? 18   THR A N     1 
ATOM   125   C  CA    . THR A  1  18  ? 68.155  73.700  26.023  1.00 127.19 ? 18   THR A CA    1 
ATOM   126   C  C     . THR A  1  18  ? 67.934  72.643  24.932  1.00 126.51 ? 18   THR A C     1 
ATOM   127   O  O     . THR A  1  18  ? 68.629  72.631  23.912  1.00 126.46 ? 18   THR A O     1 
ATOM   128   C  CB    . THR A  1  18  ? 67.524  75.027  25.544  1.00 127.27 ? 18   THR A CB    1 
ATOM   129   O  OG1   . THR A  1  18  ? 68.162  76.124  26.211  1.00 126.70 ? 18   THR A OG1   1 
ATOM   130   C  CG2   . THR A  1  18  ? 66.033  75.055  25.851  1.00 127.38 ? 18   THR A CG2   1 
ATOM   131   N  N     . LEU A  1  19  ? 66.963  71.756  25.153  1.00 125.39 ? 19   LEU A N     1 
ATOM   132   C  CA    . LEU A  1  19  ? 66.631  70.733  24.165  1.00 124.28 ? 19   LEU A CA    1 
ATOM   133   C  C     . LEU A  1  19  ? 65.762  71.444  23.135  1.00 124.68 ? 19   LEU A C     1 
ATOM   134   O  O     . LEU A  1  19  ? 65.247  72.529  23.406  1.00 125.13 ? 19   LEU A O     1 
ATOM   135   C  CB    . LEU A  1  19  ? 65.827  69.585  24.786  1.00 122.33 ? 19   LEU A CB    1 
ATOM   136   C  CG    . LEU A  1  19  ? 66.311  68.865  26.043  1.00 121.09 ? 19   LEU A CG    1 
ATOM   137   C  CD1   . LEU A  1  19  ? 65.613  67.523  26.138  1.00 120.42 ? 19   LEU A CD1   1 
ATOM   138   C  CD2   . LEU A  1  19  ? 67.801  68.664  25.993  1.00 120.66 ? 19   LEU A CD2   1 
ATOM   139   N  N     . ASP A  1  20  ? 65.593  70.849  21.958  1.00 124.91 ? 20   ASP A N     1 
ATOM   140   C  CA    . ASP A  1  20  ? 64.773  71.476  20.918  1.00 124.69 ? 20   ASP A CA    1 
ATOM   141   C  C     . ASP A  1  20  ? 63.270  71.445  21.258  1.00 124.37 ? 20   ASP A C     1 
ATOM   142   O  O     . ASP A  1  20  ? 62.489  72.244  20.734  1.00 124.45 ? 20   ASP A O     1 
ATOM   143   C  CB    . ASP A  1  20  ? 65.009  70.806  19.547  1.00 124.14 ? 20   ASP A CB    1 
ATOM   144   C  CG    . ASP A  1  20  ? 66.449  70.940  19.050  1.00 123.21 ? 20   ASP A CG    1 
ATOM   145   O  OD1   . ASP A  1  20  ? 66.662  70.743  17.832  1.00 122.33 ? 20   ASP A OD1   1 
ATOM   146   O  OD2   . ASP A  1  20  ? 67.360  71.224  19.863  1.00 122.59 ? 20   ASP A OD2   1 
ATOM   147   N  N     . ASN A  1  21  ? 62.874  70.530  22.142  1.00 123.77 ? 21   ASN A N     1 
ATOM   148   C  CA    . ASN A  1  21  ? 61.474  70.394  22.540  1.00 122.86 ? 21   ASN A CA    1 
ATOM   149   C  C     . ASN A  1  21  ? 61.003  71.494  23.483  1.00 121.81 ? 21   ASN A C     1 
ATOM   150   O  O     . ASN A  1  21  ? 59.808  71.780  23.557  1.00 121.27 ? 21   ASN A O     1 
ATOM   151   C  CB    . ASN A  1  21  ? 61.244  69.035  23.201  1.00 123.56 ? 21   ASN A CB    1 
ATOM   152   C  CG    . ASN A  1  21  ? 62.149  68.808  24.391  1.00 123.99 ? 21   ASN A CG    1 
ATOM   153   O  OD1   . ASN A  1  21  ? 63.356  68.606  24.247  1.00 124.02 ? 21   ASN A OD1   1 
ATOM   154   N  ND2   . ASN A  1  21  ? 61.567  68.844  25.581  1.00 124.50 ? 21   ASN A ND2   1 
ATOM   155   N  N     . GLY A  1  22  ? 61.940  72.096  24.212  1.00 120.97 ? 22   GLY A N     1 
ATOM   156   C  CA    . GLY A  1  22  ? 61.592  73.166  25.135  1.00 120.00 ? 22   GLY A CA    1 
ATOM   157   C  C     . GLY A  1  22  ? 62.183  73.047  26.534  1.00 118.92 ? 22   GLY A C     1 
ATOM   158   O  O     . GLY A  1  22  ? 62.646  74.041  27.111  1.00 118.89 ? 22   GLY A O     1 
ATOM   159   N  N     . LEU A  1  23  ? 62.155  71.833  27.083  1.00 117.36 ? 23   LEU A N     1 
ATOM   160   C  CA    . LEU A  1  23  ? 62.684  71.570  28.414  1.00 115.28 ? 23   LEU A CA    1 
ATOM   161   C  C     . LEU A  1  23  ? 64.003  72.300  28.585  1.00 114.19 ? 23   LEU A C     1 
ATOM   162   O  O     . LEU A  1  23  ? 64.668  72.639  27.613  1.00 114.21 ? 23   LEU A O     1 
ATOM   163   C  CB    . LEU A  1  23  ? 62.902  70.067  28.605  1.00 114.96 ? 23   LEU A CB    1 
ATOM   164   C  CG    . LEU A  1  23  ? 63.328  69.591  29.994  1.00 114.83 ? 23   LEU A CG    1 
ATOM   165   C  CD1   . LEU A  1  23  ? 62.165  69.754  30.949  1.00 115.51 ? 23   LEU A CD1   1 
ATOM   166   C  CD2   . LEU A  1  23  ? 63.753  68.138  29.940  1.00 114.76 ? 23   LEU A CD2   1 
ATOM   167   N  N     . ARG A  1  24  ? 64.378  72.551  29.826  1.00 113.19 ? 24   ARG A N     1 
ATOM   168   C  CA    . ARG A  1  24  ? 65.626  73.238  30.103  1.00 112.59 ? 24   ARG A CA    1 
ATOM   169   C  C     . ARG A  1  24  ? 66.370  72.474  31.189  1.00 112.08 ? 24   ARG A C     1 
ATOM   170   O  O     . ARG A  1  24  ? 65.803  72.151  32.230  1.00 112.87 ? 24   ARG A O     1 
ATOM   171   C  CB    . ARG A  1  24  ? 65.337  74.673  30.547  1.00 112.72 ? 24   ARG A CB    1 
ATOM   172   C  CG    . ARG A  1  24  ? 64.823  75.565  29.431  1.00 112.41 ? 24   ARG A CG    1 
ATOM   173   C  CD    . ARG A  1  24  ? 64.393  76.921  29.957  1.00 112.13 ? 24   ARG A CD    1 
ATOM   174   N  NE    . ARG A  1  24  ? 63.000  76.919  30.388  1.00 112.19 ? 24   ARG A NE    1 
ATOM   175   C  CZ    . ARG A  1  24  ? 62.406  77.950  30.978  1.00 112.20 ? 24   ARG A CZ    1 
ATOM   176   N  NH1   . ARG A  1  24  ? 63.094  79.061  31.210  1.00 112.42 ? 24   ARG A NH1   1 
ATOM   177   N  NH2   . ARG A  1  24  ? 61.124  77.879  31.318  1.00 111.25 ? 24   ARG A NH2   1 
ATOM   178   N  N     . VAL A  1  25  ? 67.639  72.174  30.952  1.00 110.86 ? 25   VAL A N     1 
ATOM   179   C  CA    . VAL A  1  25  ? 68.397  71.433  31.939  1.00 109.73 ? 25   VAL A CA    1 
ATOM   180   C  C     . VAL A  1  25  ? 69.532  72.259  32.516  1.00 109.16 ? 25   VAL A C     1 
ATOM   181   O  O     . VAL A  1  25  ? 70.250  72.951  31.790  1.00 108.17 ? 25   VAL A O     1 
ATOM   182   C  CB    . VAL A  1  25  ? 68.953  70.130  31.334  1.00 109.47 ? 25   VAL A CB    1 
ATOM   183   C  CG1   . VAL A  1  25  ? 69.695  69.352  32.391  1.00 109.59 ? 25   VAL A CG1   1 
ATOM   184   C  CG2   . VAL A  1  25  ? 67.815  69.286  30.774  1.00 108.56 ? 25   VAL A CG2   1 
ATOM   185   N  N     . ALA A  1  26  ? 69.675  72.191  33.835  1.00 109.24 ? 26   ALA A N     1 
ATOM   186   C  CA    . ALA A  1  26  ? 70.722  72.927  34.531  1.00 110.27 ? 26   ALA A CA    1 
ATOM   187   C  C     . ALA A  1  26  ? 71.091  72.257  35.846  1.00 110.79 ? 26   ALA A C     1 
ATOM   188   O  O     . ALA A  1  26  ? 70.320  71.467  36.397  1.00 110.11 ? 26   ALA A O     1 
ATOM   189   C  CB    . ALA A  1  26  ? 70.280  74.346  34.787  1.00 110.58 ? 26   ALA A CB    1 
ATOM   190   N  N     . SER A  1  27  ? 72.274  72.596  36.353  1.00 111.50 ? 27   SER A N     1 
ATOM   191   C  CA    . SER A  1  27  ? 72.762  72.007  37.588  1.00 112.01 ? 27   SER A CA    1 
ATOM   192   C  C     . SER A  1  27  ? 74.075  72.627  38.064  1.00 112.73 ? 27   SER A C     1 
ATOM   193   O  O     . SER A  1  27  ? 74.732  73.372  37.337  1.00 111.76 ? 27   SER A O     1 
ATOM   194   C  CB    . SER A  1  27  ? 72.957  70.511  37.375  1.00 111.98 ? 27   SER A CB    1 
ATOM   195   O  OG    . SER A  1  27  ? 73.837  70.285  36.288  1.00 113.37 ? 27   SER A OG    1 
ATOM   196   N  N     . GLU A  1  28  ? 74.441  72.304  39.299  1.00 114.67 ? 28   GLU A N     1 
ATOM   197   C  CA    . GLU A  1  28  ? 75.669  72.789  39.921  1.00 116.80 ? 28   GLU A CA    1 
ATOM   198   C  C     . GLU A  1  28  ? 76.462  71.569  40.395  1.00 118.24 ? 28   GLU A C     1 
ATOM   199   O  O     . GLU A  1  28  ? 75.984  70.783  41.220  1.00 118.24 ? 28   GLU A O     1 
ATOM   200   C  CB    . GLU A  1  28  ? 75.336  73.707  41.102  1.00 117.31 ? 28   GLU A CB    1 
ATOM   201   C  CG    . GLU A  1  28  ? 76.547  74.229  41.862  1.00 118.50 ? 28   GLU A CG    1 
ATOM   202   C  CD    . GLU A  1  28  ? 76.198  75.354  42.832  1.00 119.19 ? 28   GLU A CD    1 
ATOM   203   O  OE1   . GLU A  1  28  ? 75.871  76.465  42.357  1.00 119.80 ? 28   GLU A OE1   1 
ATOM   204   O  OE2   . GLU A  1  28  ? 76.250  75.128  44.063  1.00 118.61 ? 28   GLU A OE2   1 
ATOM   205   N  N     . GLU A  1  29  ? 77.671  71.420  39.861  1.00 119.82 ? 29   GLU A N     1 
ATOM   206   C  CA    . GLU A  1  29  ? 78.546  70.288  40.171  1.00 121.21 ? 29   GLU A CA    1 
ATOM   207   C  C     . GLU A  1  29  ? 79.431  70.515  41.402  1.00 121.49 ? 29   GLU A C     1 
ATOM   208   O  O     . GLU A  1  29  ? 80.059  71.566  41.562  1.00 121.04 ? 29   GLU A O     1 
ATOM   209   C  CB    . GLU A  1  29  ? 79.415  69.975  38.940  1.00 122.46 ? 29   GLU A CB    1 
ATOM   210   C  CG    . GLU A  1  29  ? 79.987  68.559  38.856  1.00 123.81 ? 29   GLU A CG    1 
ATOM   211   C  CD    . GLU A  1  29  ? 80.652  68.276  37.503  1.00 124.82 ? 29   GLU A CD    1 
ATOM   212   O  OE1   . GLU A  1  29  ? 79.980  68.406  36.455  1.00 125.14 ? 29   GLU A OE1   1 
ATOM   213   O  OE2   . GLU A  1  29  ? 81.849  67.922  37.487  1.00 125.52 ? 29   GLU A OE2   1 
ATOM   214   N  N     . SER A  1  30  ? 79.468  69.512  42.270  1.00 122.15 ? 30   SER A N     1 
ATOM   215   C  CA    . SER A  1  30  ? 80.266  69.568  43.489  1.00 123.04 ? 30   SER A CA    1 
ATOM   216   C  C     . SER A  1  30  ? 80.966  68.227  43.675  1.00 123.24 ? 30   SER A C     1 
ATOM   217   O  O     . SER A  1  30  ? 80.858  67.339  42.822  1.00 123.74 ? 30   SER A O     1 
ATOM   218   C  CB    . SER A  1  30  ? 79.369  69.847  44.697  1.00 123.70 ? 30   SER A CB    1 
ATOM   219   O  OG    . SER A  1  30  ? 78.441  68.792  44.898  1.00 124.19 ? 30   SER A OG    1 
ATOM   220   N  N     . SER A  1  31  ? 81.682  68.081  44.787  1.00 122.85 ? 31   SER A N     1 
ATOM   221   C  CA    . SER A  1  31  ? 82.386  66.839  45.076  1.00 122.52 ? 31   SER A CA    1 
ATOM   222   C  C     . SER A  1  31  ? 81.533  65.976  45.998  1.00 122.72 ? 31   SER A C     1 
ATOM   223   O  O     . SER A  1  31  ? 82.037  65.077  46.668  1.00 122.70 ? 31   SER A O     1 
ATOM   224   C  CB    . SER A  1  31  ? 83.724  67.134  45.743  1.00 121.76 ? 31   SER A CB    1 
ATOM   225   O  OG    . SER A  1  31  ? 83.524  67.791  46.979  1.00 120.83 ? 31   SER A OG    1 
ATOM   226   N  N     . GLN A  1  32  ? 80.233  66.255  46.022  1.00 123.04 ? 32   GLN A N     1 
ATOM   227   C  CA    . GLN A  1  32  ? 79.307  65.508  46.866  1.00 122.90 ? 32   GLN A CA    1 
ATOM   228   C  C     . GLN A  1  32  ? 78.917  64.168  46.236  1.00 121.67 ? 32   GLN A C     1 
ATOM   229   O  O     . GLN A  1  32  ? 78.287  64.114  45.176  1.00 121.05 ? 32   GLN A O     1 
ATOM   230   C  CB    . GLN A  1  32  ? 78.050  66.346  47.146  1.00 123.86 ? 32   GLN A CB    1 
ATOM   231   C  CG    . GLN A  1  32  ? 77.426  66.147  48.538  1.00 125.41 ? 32   GLN A CG    1 
ATOM   232   C  CD    . GLN A  1  32  ? 78.341  66.590  49.692  1.00 126.61 ? 32   GLN A CD    1 
ATOM   233   O  OE1   . GLN A  1  32  ? 78.906  67.690  49.675  1.00 126.83 ? 32   GLN A OE1   1 
ATOM   234   N  NE2   . GLN A  1  32  ? 78.473  65.734  50.707  1.00 126.54 ? 32   GLN A NE2   1 
ATOM   235   N  N     . PRO A  1  33  ? 79.294  63.065  46.896  1.00 120.93 ? 33   PRO A N     1 
ATOM   236   C  CA    . PRO A  1  33  ? 79.018  61.691  46.464  1.00 120.25 ? 33   PRO A CA    1 
ATOM   237   C  C     . PRO A  1  33  ? 77.522  61.418  46.311  1.00 119.13 ? 33   PRO A C     1 
ATOM   238   O  O     . PRO A  1  33  ? 77.103  60.490  45.609  1.00 118.24 ? 33   PRO A O     1 
ATOM   239   C  CB    . PRO A  1  33  ? 79.653  60.855  47.574  1.00 120.93 ? 33   PRO A CB    1 
ATOM   240   C  CG    . PRO A  1  33  ? 79.533  61.752  48.791  1.00 121.08 ? 33   PRO A CG    1 
ATOM   241   C  CD    . PRO A  1  33  ? 79.956  63.075  48.215  1.00 121.09 ? 33   PRO A CD    1 
ATOM   242   N  N     . THR A  1  34  ? 76.728  62.231  46.997  1.00 118.04 ? 34   THR A N     1 
ATOM   243   C  CA    . THR A  1  34  ? 75.282  62.126  46.956  1.00 116.20 ? 34   THR A CA    1 
ATOM   244   C  C     . THR A  1  34  ? 74.763  63.367  46.253  1.00 115.16 ? 34   THR A C     1 
ATOM   245   O  O     . THR A  1  34  ? 75.533  64.288  45.962  1.00 114.70 ? 34   THR A O     1 
ATOM   246   C  CB    . THR A  1  34  ? 74.684  62.055  48.366  1.00 115.96 ? 34   THR A CB    1 
ATOM   247   O  OG1   . THR A  1  34  ? 73.272  62.274  48.289  1.00 115.80 ? 34   THR A OG1   1 
ATOM   248   C  CG2   . THR A  1  34  ? 75.313  63.101  49.272  1.00 115.57 ? 34   THR A CG2   1 
ATOM   249   N  N     . CYS A  1  35  ? 73.460  63.408  45.999  1.00 113.79 ? 35   CYS A N     1 
ATOM   250   C  CA    . CYS A  1  35  ? 72.890  64.539  45.283  1.00 112.46 ? 35   CYS A CA    1 
ATOM   251   C  C     . CYS A  1  35  ? 71.371  64.622  45.356  1.00 111.62 ? 35   CYS A C     1 
ATOM   252   O  O     . CYS A  1  35  ? 70.728  64.004  46.206  1.00 111.53 ? 35   CYS A O     1 
ATOM   253   C  CB    . CYS A  1  35  ? 73.280  64.425  43.817  1.00 112.43 ? 35   CYS A CB    1 
ATOM   254   S  SG    . CYS A  1  35  ? 72.595  62.908  43.066  1.00 110.41 ? 35   CYS A SG    1 
ATOM   255   N  N     . THR A  1  36  ? 70.817  65.400  44.428  1.00 110.23 ? 36   THR A N     1 
ATOM   256   C  CA    . THR A  1  36  ? 69.382  65.595  44.288  1.00 107.97 ? 36   THR A CA    1 
ATOM   257   C  C     . THR A  1  36  ? 69.097  66.139  42.898  1.00 106.08 ? 36   THR A C     1 
ATOM   258   O  O     . THR A  1  36  ? 69.840  66.971  42.369  1.00 105.36 ? 36   THR A O     1 
ATOM   259   C  CB    . THR A  1  36  ? 68.843  66.575  45.326  1.00 108.58 ? 36   THR A CB    1 
ATOM   260   O  OG1   . THR A  1  36  ? 68.998  66.010  46.632  1.00 108.76 ? 36   THR A OG1   1 
ATOM   261   C  CG2   . THR A  1  36  ? 67.372  66.853  45.073  1.00 108.99 ? 36   THR A CG2   1 
ATOM   262   N  N     . VAL A  1  37  ? 68.024  65.650  42.298  1.00 104.17 ? 37   VAL A N     1 
ATOM   263   C  CA    . VAL A  1  37  ? 67.653  66.090  40.971  1.00 103.63 ? 37   VAL A CA    1 
ATOM   264   C  C     . VAL A  1  37  ? 66.154  66.063  40.856  1.00 103.64 ? 37   VAL A C     1 
ATOM   265   O  O     . VAL A  1  37  ? 65.502  65.173  41.399  1.00 103.67 ? 37   VAL A O     1 
ATOM   266   C  CB    . VAL A  1  37  ? 68.207  65.169  39.910  1.00 103.49 ? 37   VAL A CB    1 
ATOM   267   C  CG1   . VAL A  1  37  ? 69.684  64.983  40.128  1.00 103.91 ? 37   VAL A CG1   1 
ATOM   268   C  CG2   . VAL A  1  37  ? 67.483  63.838  39.954  1.00 103.61 ? 37   VAL A CG2   1 
ATOM   269   N  N     . GLY A  1  38  ? 65.612  67.035  40.135  1.00 103.67 ? 38   GLY A N     1 
ATOM   270   C  CA    . GLY A  1  38  ? 64.177  67.097  39.974  1.00 103.39 ? 38   GLY A CA    1 
ATOM   271   C  C     . GLY A  1  38  ? 63.719  68.009  38.860  1.00 103.05 ? 38   GLY A C     1 
ATOM   272   O  O     . GLY A  1  38  ? 64.472  68.851  38.347  1.00 102.75 ? 38   GLY A O     1 
ATOM   273   N  N     . VAL A  1  39  ? 62.466  67.810  38.473  1.00 102.40 ? 39   VAL A N     1 
ATOM   274   C  CA    . VAL A  1  39  ? 61.849  68.609  37.435  1.00 101.39 ? 39   VAL A CA    1 
ATOM   275   C  C     . VAL A  1  39  ? 61.049  69.689  38.186  1.00 101.39 ? 39   VAL A C     1 
ATOM   276   O  O     . VAL A  1  39  ? 60.349  69.391  39.161  1.00 102.15 ? 39   VAL A O     1 
ATOM   277   C  CB    . VAL A  1  39  ? 60.930  67.725  36.531  1.00 100.08 ? 39   VAL A CB    1 
ATOM   278   C  CG1   . VAL A  1  39  ? 59.728  67.246  37.298  1.00 98.92  ? 39   VAL A CG1   1 
ATOM   279   C  CG2   . VAL A  1  39  ? 60.504  68.497  35.308  1.00 100.14 ? 39   VAL A CG2   1 
ATOM   280   N  N     . TRP A  1  40  ? 61.200  70.945  37.762  1.00 100.10 ? 40   TRP A N     1 
ATOM   281   C  CA    . TRP A  1  40  ? 60.498  72.065  38.382  1.00 97.70  ? 40   TRP A CA    1 
ATOM   282   C  C     . TRP A  1  40  ? 59.494  72.677  37.427  1.00 95.56  ? 40   TRP A C     1 
ATOM   283   O  O     . TRP A  1  40  ? 59.723  73.735  36.843  1.00 95.06  ? 40   TRP A O     1 
ATOM   284   C  CB    . TRP A  1  40  ? 61.491  73.118  38.859  1.00 98.91  ? 40   TRP A CB    1 
ATOM   285   C  CG    . TRP A  1  40  ? 61.731  72.980  40.297  1.00 101.45 ? 40   TRP A CG    1 
ATOM   286   C  CD1   . TRP A  1  40  ? 60.930  73.422  41.291  1.00 102.08 ? 40   TRP A CD1   1 
ATOM   287   C  CD2   . TRP A  1  40  ? 62.787  72.251  40.922  1.00 103.80 ? 40   TRP A CD2   1 
ATOM   288   N  NE1   . TRP A  1  40  ? 61.408  73.009  42.505  1.00 103.56 ? 40   TRP A NE1   1 
ATOM   289   C  CE2   . TRP A  1  40  ? 62.553  72.287  42.307  1.00 104.19 ? 40   TRP A CE2   1 
ATOM   290   C  CE3   . TRP A  1  40  ? 63.910  71.565  40.443  1.00 106.19 ? 40   TRP A CE3   1 
ATOM   291   C  CZ2   . TRP A  1  40  ? 63.397  71.664  43.228  1.00 105.49 ? 40   TRP A CZ2   1 
ATOM   292   C  CZ3   . TRP A  1  40  ? 64.753  70.943  41.360  1.00 107.31 ? 40   TRP A CZ3   1 
ATOM   293   C  CH2   . TRP A  1  40  ? 64.490  70.998  42.738  1.00 106.86 ? 40   TRP A CH2   1 
ATOM   294   N  N     . ILE A  1  41  ? 58.373  71.985  37.277  1.00 93.04  ? 41   ILE A N     1 
ATOM   295   C  CA    . ILE A  1  41  ? 57.309  72.428  36.399  1.00 90.54  ? 41   ILE A CA    1 
ATOM   296   C  C     . ILE A  1  41  ? 56.836  73.813  36.822  1.00 90.17  ? 41   ILE A C     1 
ATOM   297   O  O     . ILE A  1  41  ? 56.838  74.151  38.009  1.00 90.79  ? 41   ILE A O     1 
ATOM   298   C  CB    . ILE A  1  41  ? 56.095  71.473  36.451  1.00 88.74  ? 41   ILE A CB    1 
ATOM   299   C  CG1   . ILE A  1  41  ? 56.555  70.020  36.449  1.00 87.22  ? 41   ILE A CG1   1 
ATOM   300   C  CG2   . ILE A  1  41  ? 55.210  71.700  35.242  1.00 88.57  ? 41   ILE A CG2   1 
ATOM   301   C  CD1   . ILE A  1  41  ? 55.417  69.031  36.412  1.00 85.00  ? 41   ILE A CD1   1 
ATOM   302   N  N     . GLY A  1  42  ? 56.437  74.614  35.842  1.00 88.76  ? 42   GLY A N     1 
ATOM   303   C  CA    . GLY A  1  42  ? 55.932  75.940  36.134  1.00 86.35  ? 42   GLY A CA    1 
ATOM   304   C  C     . GLY A  1  42  ? 54.418  75.871  36.135  1.00 84.43  ? 42   GLY A C     1 
ATOM   305   O  O     . GLY A  1  42  ? 53.761  76.696  35.511  1.00 84.94  ? 42   GLY A O     1 
ATOM   306   N  N     . ALA A  1  43  ? 53.869  74.874  36.824  1.00 82.15  ? 43   ALA A N     1 
ATOM   307   C  CA    . ALA A  1  43  ? 52.423  74.688  36.895  1.00 79.96  ? 43   ALA A CA    1 
ATOM   308   C  C     . ALA A  1  43  ? 51.939  74.782  38.326  1.00 78.28  ? 43   ALA A C     1 
ATOM   309   O  O     . ALA A  1  43  ? 52.670  74.454  39.255  1.00 78.44  ? 43   ALA A O     1 
ATOM   310   C  CB    . ALA A  1  43  ? 52.031  73.338  36.307  1.00 80.59  ? 43   ALA A CB    1 
ATOM   311   N  N     . GLY A  1  44  ? 50.698  75.224  38.498  1.00 76.12  ? 44   GLY A N     1 
ATOM   312   C  CA    . GLY A  1  44  ? 50.157  75.357  39.832  1.00 73.81  ? 44   GLY A CA    1 
ATOM   313   C  C     . GLY A  1  44  ? 48.656  75.511  39.895  1.00 72.14  ? 44   GLY A C     1 
ATOM   314   O  O     . GLY A  1  44  ? 47.928  75.063  39.021  1.00 71.93  ? 44   GLY A O     1 
ATOM   315   N  N     . SER A  1  45  ? 48.193  76.144  40.959  1.00 70.85  ? 45   SER A N     1 
ATOM   316   C  CA    . SER A  1  45  ? 46.774  76.359  41.141  1.00 69.05  ? 45   SER A CA    1 
ATOM   317   C  C     . SER A  1  45  ? 46.361  77.580  40.346  1.00 67.94  ? 45   SER A C     1 
ATOM   318   O  O     . SER A  1  45  ? 45.279  77.613  39.771  1.00 67.56  ? 45   SER A O     1 
ATOM   319   C  CB    . SER A  1  45  ? 46.449  76.563  42.627  1.00 68.99  ? 45   SER A CB    1 
ATOM   320   O  OG    . SER A  1  45  ? 47.181  77.651  43.166  1.00 68.19  ? 45   SER A OG    1 
ATOM   321   N  N     . ARG A  1  46  ? 47.232  78.583  40.300  1.00 66.61  ? 46   ARG A N     1 
ATOM   322   C  CA    . ARG A  1  46  ? 46.891  79.790  39.576  1.00 65.29  ? 46   ARG A CA    1 
ATOM   323   C  C     . ARG A  1  46  ? 46.489  79.420  38.190  1.00 65.98  ? 46   ARG A C     1 
ATOM   324   O  O     . ARG A  1  46  ? 45.547  79.976  37.646  1.00 65.80  ? 46   ARG A O     1 
ATOM   325   C  CB    . ARG A  1  46  ? 48.057  80.751  39.481  1.00 63.76  ? 46   ARG A CB    1 
ATOM   326   C  CG    . ARG A  1  46  ? 47.663  82.011  38.739  1.00 62.34  ? 46   ARG A CG    1 
ATOM   327   C  CD    . ARG A  1  46  ? 48.809  82.983  38.631  1.00 61.85  ? 46   ARG A CD    1 
ATOM   328   N  NE    . ARG A  1  46  ? 48.396  84.273  38.080  1.00 60.48  ? 46   ARG A NE    1 
ATOM   329   C  CZ    . ARG A  1  46  ? 49.229  85.295  37.892  1.00 59.61  ? 46   ARG A CZ    1 
ATOM   330   N  NH1   . ARG A  1  46  ? 50.516  85.165  38.211  1.00 58.31  ? 46   ARG A NH1   1 
ATOM   331   N  NH2   . ARG A  1  46  ? 48.782  86.442  37.393  1.00 58.06  ? 46   ARG A NH2   1 
ATOM   332   N  N     . TYR A  1  47  ? 47.218  78.472  37.617  1.00 68.03  ? 47   TYR A N     1 
ATOM   333   C  CA    . TYR A  1  47  ? 46.936  78.022  36.261  1.00 70.25  ? 47   TYR A CA    1 
ATOM   334   C  C     . TYR A  1  47  ? 45.614  77.250  36.190  1.00 70.59  ? 47   TYR A C     1 
ATOM   335   O  O     . TYR A  1  47  ? 45.119  76.939  35.106  1.00 70.14  ? 47   TYR A O     1 
ATOM   336   C  CB    . TYR A  1  47  ? 48.078  77.142  35.721  1.00 71.82  ? 47   TYR A CB    1 
ATOM   337   C  CG    . TYR A  1  47  ? 49.429  77.828  35.548  1.00 73.87  ? 47   TYR A CG    1 
ATOM   338   C  CD1   . TYR A  1  47  ? 50.273  78.029  36.638  1.00 75.73  ? 47   TYR A CD1   1 
ATOM   339   C  CD2   . TYR A  1  47  ? 49.871  78.257  34.287  1.00 75.06  ? 47   TYR A CD2   1 
ATOM   340   C  CE1   . TYR A  1  47  ? 51.536  78.641  36.483  1.00 77.21  ? 47   TYR A CE1   1 
ATOM   341   C  CE2   . TYR A  1  47  ? 51.134  78.873  34.117  1.00 76.03  ? 47   TYR A CE2   1 
ATOM   342   C  CZ    . TYR A  1  47  ? 51.960  79.062  35.224  1.00 76.84  ? 47   TYR A CZ    1 
ATOM   343   O  OH    . TYR A  1  47  ? 53.199  79.673  35.099  1.00 77.30  ? 47   TYR A OH    1 
ATOM   344   N  N     . GLU A  1  48  ? 45.044  76.932  37.345  1.00 71.53  ? 48   GLU A N     1 
ATOM   345   C  CA    . GLU A  1  48  ? 43.779  76.214  37.357  1.00 72.85  ? 48   GLU A CA    1 
ATOM   346   C  C     . GLU A  1  48  ? 42.666  77.250  37.241  1.00 73.41  ? 48   GLU A C     1 
ATOM   347   O  O     . GLU A  1  48  ? 42.876  78.433  37.498  1.00 73.29  ? 48   GLU A O     1 
ATOM   348   C  CB    . GLU A  1  48  ? 43.583  75.447  38.672  1.00 73.48  ? 48   GLU A CB    1 
ATOM   349   C  CG    . GLU A  1  48  ? 44.802  74.746  39.228  1.00 73.81  ? 48   GLU A CG    1 
ATOM   350   C  CD    . GLU A  1  48  ? 44.525  74.125  40.585  1.00 74.83  ? 48   GLU A CD    1 
ATOM   351   O  OE1   . GLU A  1  48  ? 43.831  74.776  41.397  1.00 74.88  ? 48   GLU A OE1   1 
ATOM   352   O  OE2   . GLU A  1  48  ? 45.004  73.000  40.845  1.00 75.44  ? 48   GLU A OE2   1 
ATOM   353   N  N     . ASN A  1  49  ? 41.483  76.807  36.848  1.00 74.33  ? 49   ASN A N     1 
ATOM   354   C  CA    . ASN A  1  49  ? 40.355  77.703  36.764  1.00 75.77  ? 49   ASN A CA    1 
ATOM   355   C  C     . ASN A  1  49  ? 39.389  77.286  37.880  1.00 76.94  ? 49   ASN A C     1 
ATOM   356   O  O     . ASN A  1  49  ? 39.777  76.607  38.829  1.00 75.08  ? 49   ASN A O     1 
ATOM   357   C  CB    . ASN A  1  49  ? 39.695  77.640  35.374  1.00 77.09  ? 49   ASN A CB    1 
ATOM   358   C  CG    . ASN A  1  49  ? 38.810  76.407  35.175  1.00 79.65  ? 49   ASN A CG    1 
ATOM   359   O  OD1   . ASN A  1  49  ? 38.134  76.283  34.148  1.00 81.34  ? 49   ASN A OD1   1 
ATOM   360   N  ND2   . ASN A  1  49  ? 38.807  75.497  36.145  1.00 80.64  ? 49   ASN A ND2   1 
ATOM   361   N  N     . GLU A  1  50  ? 38.131  77.679  37.755  1.00 79.47  ? 50   GLU A N     1 
ATOM   362   C  CA    . GLU A  1  50  ? 37.119  77.384  38.760  1.00 81.42  ? 50   GLU A CA    1 
ATOM   363   C  C     . GLU A  1  50  ? 36.593  75.947  38.771  1.00 80.78  ? 50   GLU A C     1 
ATOM   364   O  O     . GLU A  1  50  ? 36.165  75.460  39.815  1.00 80.06  ? 50   GLU A O     1 
ATOM   365   C  CB    . GLU A  1  50  ? 35.961  78.380  38.586  1.00 85.44  ? 50   GLU A CB    1 
ATOM   366   C  CG    . GLU A  1  50  ? 34.718  78.129  39.444  1.00 90.24  ? 50   GLU A CG    1 
ATOM   367   C  CD    . GLU A  1  50  ? 33.629  77.337  38.710  1.00 92.25  ? 50   GLU A CD    1 
ATOM   368   O  OE1   . GLU A  1  50  ? 33.168  77.801  37.631  1.00 91.18  ? 50   GLU A OE1   1 
ATOM   369   O  OE2   . GLU A  1  50  ? 33.238  76.258  39.223  1.00 93.09  ? 50   GLU A OE2   1 
ATOM   370   N  N     . LYS A  1  51  ? 36.613  75.273  37.623  1.00 80.74  ? 51   LYS A N     1 
ATOM   371   C  CA    . LYS A  1  51  ? 36.122  73.893  37.543  1.00 81.08  ? 51   LYS A CA    1 
ATOM   372   C  C     . LYS A  1  51  ? 37.208  72.860  37.819  1.00 79.29  ? 51   LYS A C     1 
ATOM   373   O  O     . LYS A  1  51  ? 36.903  71.721  38.185  1.00 77.89  ? 51   LYS A O     1 
ATOM   374   C  CB    . LYS A  1  51  ? 35.506  73.606  36.164  1.00 84.48  ? 51   LYS A CB    1 
ATOM   375   C  CG    . LYS A  1  51  ? 34.083  74.148  35.939  1.00 87.55  ? 51   LYS A CG    1 
ATOM   376   C  CD    . LYS A  1  51  ? 33.628  73.921  34.490  1.00 90.09  ? 51   LYS A CD    1 
ATOM   377   C  CE    . LYS A  1  51  ? 34.528  74.672  33.493  1.00 91.82  ? 51   LYS A CE    1 
ATOM   378   N  NZ    . LYS A  1  51  ? 34.225  74.342  32.067  1.00 92.64  ? 51   LYS A NZ    1 
ATOM   379   N  N     . ASN A  1  52  ? 38.467  73.262  37.631  1.00 78.10  ? 52   ASN A N     1 
ATOM   380   C  CA    . ASN A  1  52  ? 39.620  72.390  37.869  1.00 76.73  ? 52   ASN A CA    1 
ATOM   381   C  C     . ASN A  1  52  ? 40.558  72.908  38.984  1.00 75.00  ? 52   ASN A C     1 
ATOM   382   O  O     . ASN A  1  52  ? 41.790  72.870  38.862  1.00 73.22  ? 52   ASN A O     1 
ATOM   383   C  CB    . ASN A  1  52  ? 40.405  72.187  36.567  1.00 79.01  ? 52   ASN A CB    1 
ATOM   384   C  CG    . ASN A  1  52  ? 41.355  73.329  36.266  1.00 80.91  ? 52   ASN A CG    1 
ATOM   385   O  OD1   . ASN A  1  52  ? 41.118  74.462  36.670  1.00 82.97  ? 52   ASN A OD1   1 
ATOM   386   N  ND2   . ASN A  1  52  ? 42.432  73.036  35.540  1.00 82.19  ? 52   ASN A ND2   1 
ATOM   387   N  N     . ASN A  1  53  ? 39.952  73.401  40.064  1.00 73.16  ? 53   ASN A N     1 
ATOM   388   C  CA    . ASN A  1  53  ? 40.682  73.882  41.224  1.00 70.43  ? 53   ASN A CA    1 
ATOM   389   C  C     . ASN A  1  53  ? 40.970  72.602  41.968  1.00 69.08  ? 53   ASN A C     1 
ATOM   390   O  O     . ASN A  1  53  ? 40.049  71.918  42.400  1.00 67.04  ? 53   ASN A O     1 
ATOM   391   C  CB    . ASN A  1  53  ? 39.794  74.761  42.095  1.00 71.22  ? 53   ASN A CB    1 
ATOM   392   C  CG    . ASN A  1  53  ? 40.585  75.551  43.127  1.00 72.66  ? 53   ASN A CG    1 
ATOM   393   O  OD1   . ASN A  1  53  ? 40.022  76.065  44.101  1.00 72.15  ? 53   ASN A OD1   1 
ATOM   394   N  ND2   . ASN A  1  53  ? 41.898  75.671  42.907  1.00 72.60  ? 53   ASN A ND2   1 
ATOM   395   N  N     . GLY A  1  54  ? 42.246  72.272  42.100  1.00 69.04  ? 54   GLY A N     1 
ATOM   396   C  CA    . GLY A  1  54  ? 42.625  71.052  42.786  1.00 69.53  ? 54   GLY A CA    1 
ATOM   397   C  C     . GLY A  1  54  ? 43.688  70.343  41.980  1.00 69.94  ? 54   GLY A C     1 
ATOM   398   O  O     . GLY A  1  54  ? 44.875  70.432  42.305  1.00 69.09  ? 54   GLY A O     1 
ATOM   399   N  N     . ALA A  1  55  ? 43.246  69.650  40.928  1.00 70.04  ? 55   ALA A N     1 
ATOM   400   C  CA    . ALA A  1  55  ? 44.118  68.912  40.018  1.00 69.89  ? 55   ALA A CA    1 
ATOM   401   C  C     . ALA A  1  55  ? 45.605  68.956  40.375  1.00 70.05  ? 55   ALA A C     1 
ATOM   402   O  O     . ALA A  1  55  ? 46.161  67.961  40.838  1.00 70.21  ? 55   ALA A O     1 
ATOM   403   C  CB    . ALA A  1  55  ? 43.921  69.421  38.616  1.00 69.44  ? 55   ALA A CB    1 
ATOM   404   N  N     . GLY A  1  56  ? 46.248  70.100  40.149  1.00 69.89  ? 56   GLY A N     1 
ATOM   405   C  CA    . GLY A  1  56  ? 47.663  70.231  40.463  1.00 70.46  ? 56   GLY A CA    1 
ATOM   406   C  C     . GLY A  1  56  ? 48.051  69.517  41.746  1.00 71.09  ? 56   GLY A C     1 
ATOM   407   O  O     . GLY A  1  56  ? 49.210  69.122  41.930  1.00 71.07  ? 56   GLY A O     1 
ATOM   408   N  N     . TYR A  1  57  ? 47.066  69.354  42.631  1.00 70.91  ? 57   TYR A N     1 
ATOM   409   C  CA    . TYR A  1  57  ? 47.234  68.687  43.918  1.00 70.16  ? 57   TYR A CA    1 
ATOM   410   C  C     . TYR A  1  57  ? 46.900  67.200  43.778  1.00 69.90  ? 57   TYR A C     1 
ATOM   411   O  O     . TYR A  1  57  ? 47.730  66.337  44.057  1.00 69.45  ? 57   TYR A O     1 
ATOM   412   C  CB    . TYR A  1  57  ? 46.300  69.323  44.951  1.00 69.68  ? 57   TYR A CB    1 
ATOM   413   C  CG    . TYR A  1  57  ? 46.738  69.141  46.391  1.00 69.09  ? 57   TYR A CG    1 
ATOM   414   C  CD1   . TYR A  1  57  ? 48.020  69.525  46.801  1.00 69.08  ? 57   TYR A CD1   1 
ATOM   415   C  CD2   . TYR A  1  57  ? 45.856  68.648  47.359  1.00 67.58  ? 57   TYR A CD2   1 
ATOM   416   C  CE1   . TYR A  1  57  ? 48.412  69.432  48.142  1.00 68.56  ? 57   TYR A CE1   1 
ATOM   417   C  CE2   . TYR A  1  57  ? 46.235  68.547  48.697  1.00 66.73  ? 57   TYR A CE2   1 
ATOM   418   C  CZ    . TYR A  1  57  ? 47.512  68.944  49.081  1.00 67.89  ? 57   TYR A CZ    1 
ATOM   419   O  OH    . TYR A  1  57  ? 47.898  68.873  50.401  1.00 68.52  ? 57   TYR A OH    1 
ATOM   420   N  N     . PHE A  1  58  ? 45.677  66.912  43.343  1.00 69.72  ? 58   PHE A N     1 
ATOM   421   C  CA    . PHE A  1  58  ? 45.223  65.538  43.156  1.00 69.95  ? 58   PHE A CA    1 
ATOM   422   C  C     . PHE A  1  58  ? 46.299  64.804  42.367  1.00 72.15  ? 58   PHE A C     1 
ATOM   423   O  O     . PHE A  1  58  ? 46.457  63.589  42.471  1.00 72.72  ? 58   PHE A O     1 
ATOM   424   C  CB    . PHE A  1  58  ? 43.902  65.532  42.382  1.00 66.49  ? 58   PHE A CB    1 
ATOM   425   C  CG    . PHE A  1  58  ? 42.917  64.509  42.861  1.00 62.73  ? 58   PHE A CG    1 
ATOM   426   C  CD1   . PHE A  1  58  ? 41.572  64.822  42.970  1.00 61.35  ? 58   PHE A CD1   1 
ATOM   427   C  CD2   . PHE A  1  58  ? 43.324  63.239  43.203  1.00 62.11  ? 58   PHE A CD2   1 
ATOM   428   C  CE1   . PHE A  1  58  ? 40.643  63.880  43.416  1.00 60.42  ? 58   PHE A CE1   1 
ATOM   429   C  CE2   . PHE A  1  58  ? 42.398  62.293  43.651  1.00 61.83  ? 58   PHE A CE2   1 
ATOM   430   C  CZ    . PHE A  1  58  ? 41.053  62.621  43.756  1.00 60.21  ? 58   PHE A CZ    1 
ATOM   431   N  N     . VAL A  1  59  ? 47.043  65.570  41.581  1.00 74.30  ? 59   VAL A N     1 
ATOM   432   C  CA    . VAL A  1  59  ? 48.121  65.041  40.768  1.00 76.31  ? 59   VAL A CA    1 
ATOM   433   C  C     . VAL A  1  59  ? 49.399  64.904  41.590  1.00 77.72  ? 59   VAL A C     1 
ATOM   434   O  O     . VAL A  1  59  ? 50.169  63.958  41.405  1.00 78.52  ? 59   VAL A O     1 
ATOM   435   C  CB    . VAL A  1  59  ? 48.363  65.948  39.548  1.00 76.03  ? 59   VAL A CB    1 
ATOM   436   C  CG1   . VAL A  1  59  ? 49.789  65.783  39.031  1.00 75.88  ? 59   VAL A CG1   1 
ATOM   437   C  CG2   . VAL A  1  59  ? 47.344  65.602  38.458  1.00 75.71  ? 59   VAL A CG2   1 
ATOM   438   N  N     . GLU A  1  60  ? 49.630  65.848  42.493  1.00 78.70  ? 60   GLU A N     1 
ATOM   439   C  CA    . GLU A  1  60  ? 50.808  65.785  43.343  1.00 80.00  ? 60   GLU A CA    1 
ATOM   440   C  C     . GLU A  1  60  ? 50.643  64.522  44.188  1.00 80.50  ? 60   GLU A C     1 
ATOM   441   O  O     . GLU A  1  60  ? 51.617  63.931  44.669  1.00 80.33  ? 60   GLU A O     1 
ATOM   442   C  CB    . GLU A  1  60  ? 50.871  67.015  44.251  1.00 80.40  ? 60   GLU A CB    1 
ATOM   443   C  CG    . GLU A  1  60  ? 52.198  67.188  44.982  1.00 81.37  ? 60   GLU A CG    1 
ATOM   444   C  CD    . GLU A  1  60  ? 52.029  67.626  46.432  1.00 81.23  ? 60   GLU A CD    1 
ATOM   445   O  OE1   . GLU A  1  60  ? 51.558  66.811  47.250  1.00 79.65  ? 60   GLU A OE1   1 
ATOM   446   O  OE2   . GLU A  1  60  ? 52.367  68.783  46.757  1.00 82.52  ? 60   GLU A OE2   1 
ATOM   447   N  N     . HIS A  1  61  ? 49.388  64.111  44.348  1.00 81.32  ? 61   HIS A N     1 
ATOM   448   C  CA    . HIS A  1  61  ? 49.055  62.929  45.131  1.00 82.70  ? 61   HIS A CA    1 
ATOM   449   C  C     . HIS A  1  61  ? 49.299  61.621  44.419  1.00 83.34  ? 61   HIS A C     1 
ATOM   450   O  O     . HIS A  1  61  ? 49.890  60.706  45.000  1.00 84.34  ? 61   HIS A O     1 
ATOM   451   C  CB    . HIS A  1  61  ? 47.596  62.961  45.570  1.00 82.78  ? 61   HIS A CB    1 
ATOM   452   C  CG    . HIS A  1  61  ? 47.400  63.479  46.956  1.00 83.54  ? 61   HIS A CG    1 
ATOM   453   N  ND1   . HIS A  1  61  ? 46.230  63.294  47.656  1.00 84.25  ? 61   HIS A ND1   1 
ATOM   454   C  CD2   . HIS A  1  61  ? 48.224  64.176  47.775  1.00 83.55  ? 61   HIS A CD2   1 
ATOM   455   C  CE1   . HIS A  1  61  ? 46.340  63.854  48.847  1.00 83.89  ? 61   HIS A CE1   1 
ATOM   456   N  NE2   . HIS A  1  61  ? 47.540  64.396  48.945  1.00 82.91  ? 61   HIS A NE2   1 
ATOM   457   N  N     . LEU A  1  62  ? 48.834  61.531  43.172  1.00 82.79  ? 62   LEU A N     1 
ATOM   458   C  CA    . LEU A  1  62  ? 48.986  60.315  42.375  1.00 81.95  ? 62   LEU A CA    1 
ATOM   459   C  C     . LEU A  1  62  ? 50.255  60.273  41.534  1.00 82.92  ? 62   LEU A C     1 
ATOM   460   O  O     . LEU A  1  62  ? 50.421  59.389  40.695  1.00 82.67  ? 62   LEU A O     1 
ATOM   461   C  CB    . LEU A  1  62  ? 47.763  60.135  41.483  1.00 78.85  ? 62   LEU A CB    1 
ATOM   462   C  CG    . LEU A  1  62  ? 46.534  59.725  42.281  1.00 76.94  ? 62   LEU A CG    1 
ATOM   463   C  CD1   . LEU A  1  62  ? 45.279  59.907  41.476  1.00 77.03  ? 62   LEU A CD1   1 
ATOM   464   C  CD2   . LEU A  1  62  ? 46.697  58.295  42.688  1.00 76.02  ? 62   LEU A CD2   1 
ATOM   465   N  N     . ALA A  1  63  ? 51.153  61.221  41.776  1.00 84.55  ? 63   ALA A N     1 
ATOM   466   C  CA    . ALA A  1  63  ? 52.407  61.292  41.047  1.00 87.04  ? 63   ALA A CA    1 
ATOM   467   C  C     . ALA A  1  63  ? 53.440  60.348  41.646  1.00 89.47  ? 63   ALA A C     1 
ATOM   468   O  O     . ALA A  1  63  ? 54.610  60.374  41.271  1.00 89.66  ? 63   ALA A O     1 
ATOM   469   C  CB    . ALA A  1  63  ? 52.928  62.713  41.068  1.00 86.47  ? 63   ALA A CB    1 
ATOM   470   N  N     . PHE A  1  64  ? 53.001  59.507  42.574  1.00 92.57  ? 64   PHE A N     1 
ATOM   471   C  CA    . PHE A  1  64  ? 53.899  58.565  43.227  1.00 95.87  ? 64   PHE A CA    1 
ATOM   472   C  C     . PHE A  1  64  ? 53.286  57.191  43.393  1.00 97.91  ? 64   PHE A C     1 
ATOM   473   O  O     . PHE A  1  64  ? 53.914  56.275  43.915  1.00 97.46  ? 64   PHE A O     1 
ATOM   474   C  CB    . PHE A  1  64  ? 54.312  59.124  44.579  1.00 96.19  ? 64   PHE A CB    1 
ATOM   475   C  CG    . PHE A  1  64  ? 55.220  60.309  44.475  1.00 97.19  ? 64   PHE A CG    1 
ATOM   476   C  CD1   . PHE A  1  64  ? 55.037  61.421  45.294  1.00 97.94  ? 64   PHE A CD1   1 
ATOM   477   C  CD2   . PHE A  1  64  ? 56.275  60.310  43.563  1.00 96.23  ? 64   PHE A CD2   1 
ATOM   478   C  CE1   . PHE A  1  64  ? 55.898  62.520  45.208  1.00 98.05  ? 64   PHE A CE1   1 
ATOM   479   C  CE2   . PHE A  1  64  ? 57.130  61.393  43.470  1.00 96.66  ? 64   PHE A CE2   1 
ATOM   480   C  CZ    . PHE A  1  64  ? 56.947  62.504  44.293  1.00 97.70  ? 64   PHE A CZ    1 
ATOM   481   N  N     . LYS A  1  65  ? 52.045  57.054  42.948  1.00 101.37 ? 65   LYS A N     1 
ATOM   482   C  CA    . LYS A  1  65  ? 51.347  55.780  43.029  1.00 104.64 ? 65   LYS A CA    1 
ATOM   483   C  C     . LYS A  1  65  ? 51.534  55.022  41.716  1.00 106.03 ? 65   LYS A C     1 
ATOM   484   O  O     . LYS A  1  65  ? 50.669  54.249  41.284  1.00 104.84 ? 65   LYS A O     1 
ATOM   485   C  CB    . LYS A  1  65  ? 49.857  56.001  43.339  1.00 105.79 ? 65   LYS A CB    1 
ATOM   486   C  CG    . LYS A  1  65  ? 49.529  56.153  44.843  1.00 105.83 ? 65   LYS A CG    1 
ATOM   487   C  CD    . LYS A  1  65  ? 50.400  57.201  45.531  1.00 106.66 ? 65   LYS A CD    1 
ATOM   488   C  CE    . LYS A  1  65  ? 50.084  57.311  47.015  1.00 106.68 ? 65   LYS A CE    1 
ATOM   489   N  NZ    . LYS A  1  65  ? 50.997  58.267  47.709  1.00 107.02 ? 65   LYS A NZ    1 
ATOM   490   N  N     . GLY A  1  66  ? 52.674  55.288  41.080  1.00 108.21 ? 66   GLY A N     1 
ATOM   491   C  CA    . GLY A  1  66  ? 53.034  54.604  39.849  1.00 111.68 ? 66   GLY A CA    1 
ATOM   492   C  C     . GLY A  1  66  ? 52.844  55.218  38.469  1.00 113.45 ? 66   GLY A C     1 
ATOM   493   O  O     . GLY A  1  66  ? 52.367  56.351  38.328  1.00 114.30 ? 66   GLY A O     1 
ATOM   494   N  N     . THR A  1  67  ? 53.240  54.434  37.455  1.00 114.45 ? 67   THR A N     1 
ATOM   495   C  CA    . THR A  1  67  ? 53.145  54.787  36.033  1.00 115.15 ? 67   THR A CA    1 
ATOM   496   C  C     . THR A  1  67  ? 52.572  53.591  35.264  1.00 116.40 ? 67   THR A C     1 
ATOM   497   O  O     . THR A  1  67  ? 52.228  52.570  35.864  1.00 116.29 ? 67   THR A O     1 
ATOM   498   C  CB    . THR A  1  67  ? 54.532  55.125  35.428  1.00 114.38 ? 67   THR A CB    1 
ATOM   499   O  OG1   . THR A  1  67  ? 55.314  53.932  35.299  1.00 113.43 ? 67   THR A OG1   1 
ATOM   500   C  CG2   . THR A  1  67  ? 55.268  56.099  36.319  1.00 115.32 ? 67   THR A CG2   1 
ATOM   501   N  N     . LYS A  1  68  ? 52.461  53.721  33.941  1.00 118.03 ? 68   LYS A N     1 
ATOM   502   C  CA    . LYS A  1  68  ? 51.940  52.638  33.097  1.00 119.20 ? 68   LYS A CA    1 
ATOM   503   C  C     . LYS A  1  68  ? 53.023  51.570  32.932  1.00 120.25 ? 68   LYS A C     1 
ATOM   504   O  O     . LYS A  1  68  ? 52.722  50.386  32.719  1.00 119.72 ? 68   LYS A O     1 
ATOM   505   C  CB    . LYS A  1  68  ? 51.528  53.170  31.714  1.00 118.86 ? 68   LYS A CB    1 
ATOM   506   C  CG    . LYS A  1  68  ? 50.301  54.078  31.713  1.00 118.52 ? 68   LYS A CG    1 
ATOM   507   C  CD    . LYS A  1  68  ? 50.000  54.612  30.313  1.00 118.38 ? 68   LYS A CD    1 
ATOM   508   C  CE    . LYS A  1  68  ? 48.735  55.470  30.289  1.00 117.75 ? 68   LYS A CE    1 
ATOM   509   N  NZ    . LYS A  1  68  ? 48.412  55.988  28.927  1.00 116.63 ? 68   LYS A NZ    1 
ATOM   510   N  N     . LYS A  1  69  ? 54.282  52.010  33.035  1.00 121.45 ? 69   LYS A N     1 
ATOM   511   C  CA    . LYS A  1  69  ? 55.449  51.133  32.922  1.00 121.90 ? 69   LYS A CA    1 
ATOM   512   C  C     . LYS A  1  69  ? 55.624  50.249  34.157  1.00 121.69 ? 69   LYS A C     1 
ATOM   513   O  O     . LYS A  1  69  ? 55.725  49.024  34.042  1.00 122.43 ? 69   LYS A O     1 
ATOM   514   C  CB    . LYS A  1  69  ? 56.730  51.955  32.718  1.00 122.15 ? 69   LYS A CB    1 
ATOM   515   C  CG    . LYS A  1  69  ? 56.886  52.537  31.325  1.00 123.28 ? 69   LYS A CG    1 
ATOM   516   C  CD    . LYS A  1  69  ? 58.329  52.406  30.815  1.00 124.05 ? 69   LYS A CD    1 
ATOM   517   C  CE    . LYS A  1  69  ? 59.317  53.215  31.648  1.00 124.52 ? 69   LYS A CE    1 
ATOM   518   N  NZ    . LYS A  1  69  ? 60.719  53.127  31.132  1.00 123.65 ? 69   LYS A NZ    1 
ATOM   519   N  N     . ARG A  1  70  ? 55.660  50.878  35.332  1.00 120.49 ? 70   ARG A N     1 
ATOM   520   C  CA    . ARG A  1  70  ? 55.827  50.164  36.593  1.00 118.82 ? 70   ARG A CA    1 
ATOM   521   C  C     . ARG A  1  70  ? 54.796  50.643  37.613  1.00 117.87 ? 70   ARG A C     1 
ATOM   522   O  O     . ARG A  1  70  ? 54.949  51.711  38.195  1.00 117.04 ? 70   ARG A O     1 
ATOM   523   C  CB    . ARG A  1  70  ? 57.242  50.398  37.116  1.00 119.00 ? 70   ARG A CB    1 
ATOM   524   C  CG    . ARG A  1  70  ? 57.597  51.867  37.259  1.00 119.67 ? 70   ARG A CG    1 
ATOM   525   C  CD    . ARG A  1  70  ? 59.079  52.100  37.078  1.00 119.84 ? 70   ARG A CD    1 
ATOM   526   N  NE    . ARG A  1  70  ? 59.410  52.469  35.706  1.00 120.53 ? 70   ARG A NE    1 
ATOM   527   C  CZ    . ARG A  1  70  ? 60.651  52.638  35.265  1.00 121.36 ? 70   ARG A CZ    1 
ATOM   528   N  NH1   . ARG A  1  70  ? 61.673  52.465  36.090  1.00 122.02 ? 70   ARG A NH1   1 
ATOM   529   N  NH2   . ARG A  1  70  ? 60.874  52.988  34.007  1.00 122.12 ? 70   ARG A NH2   1 
ATOM   530   N  N     . PRO A  1  71  ? 53.729  49.852  37.840  1.00 117.80 ? 71   PRO A N     1 
ATOM   531   C  CA    . PRO A  1  71  ? 52.653  50.177  38.787  1.00 118.05 ? 71   PRO A CA    1 
ATOM   532   C  C     . PRO A  1  71  ? 53.094  50.461  40.232  1.00 118.11 ? 71   PRO A C     1 
ATOM   533   O  O     . PRO A  1  71  ? 54.294  50.551  40.514  1.00 118.08 ? 71   PRO A O     1 
ATOM   534   C  CB    . PRO A  1  71  ? 51.703  48.976  38.667  1.00 117.79 ? 71   PRO A CB    1 
ATOM   535   C  CG    . PRO A  1  71  ? 52.599  47.865  38.251  1.00 117.86 ? 71   PRO A CG    1 
ATOM   536   C  CD    . PRO A  1  71  ? 53.500  48.528  37.236  1.00 118.09 ? 71   PRO A CD    1 
ATOM   537   N  N     . CYS A  1  72  ? 52.114  50.599  41.132  1.00 117.87 ? 72   CYS A N     1 
ATOM   538   C  CA    . CYS A  1  72  ? 52.352  50.918  42.548  1.00 117.39 ? 72   CYS A CA    1 
ATOM   539   C  C     . CYS A  1  72  ? 53.637  50.340  43.163  1.00 117.08 ? 72   CYS A C     1 
ATOM   540   O  O     . CYS A  1  72  ? 54.704  50.963  43.088  1.00 117.19 ? 72   CYS A O     1 
ATOM   541   C  CB    . CYS A  1  72  ? 51.138  50.503  43.399  1.00 117.53 ? 72   CYS A CB    1 
ATOM   542   S  SG    . CYS A  1  72  ? 50.997  51.344  45.028  1.00 116.00 ? 72   CYS A SG    1 
ATOM   543   N  N     . ALA A  1  73  ? 53.534  49.162  43.778  1.00 115.91 ? 73   ALA A N     1 
ATOM   544   C  CA    . ALA A  1  73  ? 54.687  48.523  44.412  1.00 114.43 ? 73   ALA A CA    1 
ATOM   545   C  C     . ALA A  1  73  ? 55.991  48.671  43.602  1.00 113.40 ? 73   ALA A C     1 
ATOM   546   O  O     . ALA A  1  73  ? 56.951  49.300  44.059  1.00 112.87 ? 73   ALA A O     1 
ATOM   547   C  CB    . ALA A  1  73  ? 54.380  47.047  44.670  1.00 114.12 ? 73   ALA A CB    1 
ATOM   548   N  N     . ALA A  1  74  ? 56.017  48.099  42.400  1.00 111.84 ? 74   ALA A N     1 
ATOM   549   C  CA    . ALA A  1  74  ? 57.196  48.162  41.539  1.00 109.71 ? 74   ALA A CA    1 
ATOM   550   C  C     . ALA A  1  74  ? 57.890  49.528  41.578  1.00 108.21 ? 74   ALA A C     1 
ATOM   551   O  O     . ALA A  1  74  ? 59.104  49.610  41.773  1.00 107.45 ? 74   ALA A O     1 
ATOM   552   C  CB    . ALA A  1  74  ? 56.809  47.807  40.100  1.00 109.69 ? 74   ALA A CB    1 
ATOM   553   N  N     . PHE A  1  75  ? 57.116  50.594  41.393  1.00 106.63 ? 75   PHE A N     1 
ATOM   554   C  CA    . PHE A  1  75  ? 57.675  51.938  41.405  1.00 105.31 ? 75   PHE A CA    1 
ATOM   555   C  C     . PHE A  1  75  ? 58.342  52.162  42.738  1.00 105.70 ? 75   PHE A C     1 
ATOM   556   O  O     . PHE A  1  75  ? 59.562  52.228  42.829  1.00 105.33 ? 75   PHE A O     1 
ATOM   557   C  CB    . PHE A  1  75  ? 56.577  52.982  41.180  1.00 103.45 ? 75   PHE A CB    1 
ATOM   558   C  CG    . PHE A  1  75  ? 57.079  54.409  41.135  1.00 101.70 ? 75   PHE A CG    1 
ATOM   559   C  CD1   . PHE A  1  75  ? 58.256  54.731  40.480  1.00 101.11 ? 75   PHE A CD1   1 
ATOM   560   C  CD2   . PHE A  1  75  ? 56.353  55.437  41.721  1.00 101.09 ? 75   PHE A CD2   1 
ATOM   561   C  CE1   . PHE A  1  75  ? 58.701  56.050  40.413  1.00 100.26 ? 75   PHE A CE1   1 
ATOM   562   C  CE2   . PHE A  1  75  ? 56.796  56.756  41.653  1.00 100.09 ? 75   PHE A CE2   1 
ATOM   563   C  CZ    . PHE A  1  75  ? 57.970  57.058  40.999  1.00 99.50  ? 75   PHE A CZ    1 
ATOM   564   N  N     . GLU A  1  76  ? 57.533  52.261  43.779  1.00 107.11 ? 76   GLU A N     1 
ATOM   565   C  CA    . GLU A  1  76  ? 58.060  52.476  45.115  1.00 109.38 ? 76   GLU A CA    1 
ATOM   566   C  C     . GLU A  1  76  ? 59.214  51.518  45.413  1.00 110.52 ? 76   GLU A C     1 
ATOM   567   O  O     . GLU A  1  76  ? 60.310  51.959  45.778  1.00 110.50 ? 76   GLU A O     1 
ATOM   568   C  CB    . GLU A  1  76  ? 56.938  52.313  46.147  1.00 109.80 ? 76   GLU A CB    1 
ATOM   569   C  CG    . GLU A  1  76  ? 55.807  53.324  45.965  1.00 110.34 ? 76   GLU A CG    1 
ATOM   570   C  CD    . GLU A  1  76  ? 54.641  53.109  46.913  1.00 110.44 ? 76   GLU A CD    1 
ATOM   571   O  OE1   . GLU A  1  76  ? 53.958  52.070  46.802  1.00 110.65 ? 76   GLU A OE1   1 
ATOM   572   O  OE2   . GLU A  1  76  ? 54.404  53.984  47.768  1.00 110.66 ? 76   GLU A OE2   1 
ATOM   573   N  N     . LYS A  1  77  ? 58.973  50.216  45.243  1.00 111.40 ? 77   LYS A N     1 
ATOM   574   C  CA    . LYS A  1  77  ? 60.006  49.210  45.503  1.00 111.63 ? 77   LYS A CA    1 
ATOM   575   C  C     . LYS A  1  77  ? 61.306  49.622  44.826  1.00 111.75 ? 77   LYS A C     1 
ATOM   576   O  O     . LYS A  1  77  ? 62.314  49.853  45.494  1.00 111.22 ? 77   LYS A O     1 
ATOM   577   C  CB    . LYS A  1  77  ? 59.585  47.831  44.985  1.00 111.54 ? 77   LYS A CB    1 
ATOM   578   C  CG    . LYS A  1  77  ? 60.593  46.739  45.324  1.00 111.78 ? 77   LYS A CG    1 
ATOM   579   C  CD    . LYS A  1  77  ? 60.383  45.463  44.513  1.00 112.64 ? 77   LYS A CD    1 
ATOM   580   C  CE    . LYS A  1  77  ? 61.511  44.460  44.773  1.00 112.87 ? 77   LYS A CE    1 
ATOM   581   N  NZ    . LYS A  1  77  ? 61.486  43.279  43.864  1.00 112.52 ? 77   LYS A NZ    1 
ATOM   582   N  N     . GLU A  1  78  ? 61.274  49.725  43.499  1.00 111.82 ? 78   GLU A N     1 
ATOM   583   C  CA    . GLU A  1  78  ? 62.460  50.121  42.755  1.00 111.72 ? 78   GLU A CA    1 
ATOM   584   C  C     . GLU A  1  78  ? 63.039  51.439  43.282  1.00 111.39 ? 78   GLU A C     1 
ATOM   585   O  O     . GLU A  1  78  ? 64.241  51.682  43.165  1.00 111.79 ? 78   GLU A O     1 
ATOM   586   C  CB    . GLU A  1  78  ? 62.144  50.258  41.260  1.00 111.88 ? 78   GLU A CB    1 
ATOM   587   C  CG    . GLU A  1  78  ? 63.370  50.633  40.421  1.00 113.12 ? 78   GLU A CG    1 
ATOM   588   C  CD    . GLU A  1  78  ? 63.088  50.706  38.930  1.00 113.81 ? 78   GLU A CD    1 
ATOM   589   O  OE1   . GLU A  1  78  ? 64.030  51.029  38.171  1.00 113.24 ? 78   GLU A OE1   1 
ATOM   590   O  OE2   . GLU A  1  78  ? 61.933  50.442  38.519  1.00 114.55 ? 78   GLU A OE2   1 
ATOM   591   N  N     . VAL A  1  79  ? 62.193  52.284  43.866  1.00 110.59 ? 79   VAL A N     1 
ATOM   592   C  CA    . VAL A  1  79  ? 62.654  53.566  44.398  1.00 109.66 ? 79   VAL A CA    1 
ATOM   593   C  C     . VAL A  1  79  ? 63.300  53.391  45.769  1.00 109.04 ? 79   VAL A C     1 
ATOM   594   O  O     . VAL A  1  79  ? 64.451  53.786  45.993  1.00 108.85 ? 79   VAL A O     1 
ATOM   595   C  CB    . VAL A  1  79  ? 61.493  54.580  44.531  1.00 109.47 ? 79   VAL A CB    1 
ATOM   596   C  CG1   . VAL A  1  79  ? 62.004  55.868  45.150  1.00 109.59 ? 79   VAL A CG1   1 
ATOM   597   C  CG2   . VAL A  1  79  ? 60.887  54.870  43.168  1.00 108.95 ? 79   VAL A CG2   1 
ATOM   598   N  N     . GLU A  1  80  ? 62.545  52.800  46.686  1.00 108.02 ? 80   GLU A N     1 
ATOM   599   C  CA    . GLU A  1  80  ? 63.033  52.569  48.036  1.00 107.21 ? 80   GLU A CA    1 
ATOM   600   C  C     . GLU A  1  80  ? 64.311  51.738  48.003  1.00 107.50 ? 80   GLU A C     1 
ATOM   601   O  O     . GLU A  1  80  ? 65.347  52.150  48.533  1.00 107.78 ? 80   GLU A O     1 
ATOM   602   C  CB    . GLU A  1  80  ? 61.970  51.840  48.863  1.00 105.08 ? 80   GLU A CB    1 
ATOM   603   C  CG    . GLU A  1  80  ? 60.676  52.601  49.025  1.00 102.15 ? 80   GLU A CG    1 
ATOM   604   C  CD    . GLU A  1  80  ? 59.627  51.803  49.756  1.00 100.03 ? 80   GLU A CD    1 
ATOM   605   O  OE1   . GLU A  1  80  ? 59.911  51.347  50.879  1.00 98.33  ? 80   GLU A OE1   1 
ATOM   606   O  OE2   . GLU A  1  80  ? 58.519  51.633  49.209  1.00 99.31  ? 80   GLU A OE2   1 
ATOM   607   N  N     . SER A  1  81  ? 64.224  50.577  47.356  1.00 107.07 ? 81   SER A N     1 
ATOM   608   C  CA    . SER A  1  81  ? 65.341  49.641  47.259  1.00 106.62 ? 81   SER A CA    1 
ATOM   609   C  C     . SER A  1  81  ? 66.683  50.227  46.811  1.00 106.43 ? 81   SER A C     1 
ATOM   610   O  O     . SER A  1  81  ? 67.738  49.624  47.045  1.00 106.68 ? 81   SER A O     1 
ATOM   611   C  CB    . SER A  1  81  ? 64.950  48.465  46.361  1.00 106.10 ? 81   SER A CB    1 
ATOM   612   O  OG    . SER A  1  81  ? 64.397  48.921  45.145  1.00 105.48 ? 81   SER A OG    1 
ATOM   613   N  N     . MET A  1  82  ? 66.660  51.388  46.171  1.00 105.60 ? 82   MET A N     1 
ATOM   614   C  CA    . MET A  1  82  ? 67.910  51.996  45.754  1.00 105.28 ? 82   MET A CA    1 
ATOM   615   C  C     . MET A  1  82  ? 68.264  53.088  46.743  1.00 105.91 ? 82   MET A C     1 
ATOM   616   O  O     . MET A  1  82  ? 69.315  53.718  46.645  1.00 106.00 ? 82   MET A O     1 
ATOM   617   C  CB    . MET A  1  82  ? 67.808  52.545  44.328  1.00 104.23 ? 82   MET A CB    1 
ATOM   618   C  CG    . MET A  1  82  ? 66.662  53.500  44.065  1.00 102.79 ? 82   MET A CG    1 
ATOM   619   S  SD    . MET A  1  82  ? 66.456  53.779  42.279  1.00 99.74  ? 82   MET A SD    1 
ATOM   620   C  CE    . MET A  1  82  ? 67.918  54.682  41.944  1.00 101.13 ? 82   MET A CE    1 
ATOM   621   N  N     . GLY A  1  83  ? 67.365  53.299  47.699  1.00 106.69 ? 83   GLY A N     1 
ATOM   622   C  CA    . GLY A  1  83  ? 67.581  54.280  48.746  1.00 108.57 ? 83   GLY A CA    1 
ATOM   623   C  C     . GLY A  1  83  ? 67.471  55.750  48.399  1.00 110.20 ? 83   GLY A C     1 
ATOM   624   O  O     . GLY A  1  83  ? 68.091  56.584  49.069  1.00 110.30 ? 83   GLY A O     1 
ATOM   625   N  N     . ALA A  1  84  ? 66.694  56.080  47.369  1.00 111.37 ? 84   ALA A N     1 
ATOM   626   C  CA    . ALA A  1  84  ? 66.513  57.478  46.969  1.00 112.12 ? 84   ALA A CA    1 
ATOM   627   C  C     . ALA A  1  84  ? 65.229  58.030  47.592  1.00 112.65 ? 84   ALA A C     1 
ATOM   628   O  O     . ALA A  1  84  ? 64.238  57.308  47.728  1.00 112.96 ? 84   ALA A O     1 
ATOM   629   C  CB    . ALA A  1  84  ? 66.452  57.587  45.450  1.00 111.16 ? 84   ALA A CB    1 
ATOM   630   N  N     . HIS A  1  85  ? 65.250  59.303  47.978  1.00 112.97 ? 85   HIS A N     1 
ATOM   631   C  CA    . HIS A  1  85  ? 64.084  59.930  48.586  1.00 112.89 ? 85   HIS A CA    1 
ATOM   632   C  C     . HIS A  1  85  ? 63.282  60.735  47.587  1.00 112.11 ? 85   HIS A C     1 
ATOM   633   O  O     . HIS A  1  85  ? 63.741  61.769  47.098  1.00 110.93 ? 85   HIS A O     1 
ATOM   634   C  CB    . HIS A  1  85  ? 64.511  60.838  49.735  1.00 115.18 ? 85   HIS A CB    1 
ATOM   635   C  CG    . HIS A  1  85  ? 65.018  60.095  50.932  1.00 117.88 ? 85   HIS A CG    1 
ATOM   636   N  ND1   . HIS A  1  85  ? 65.298  60.717  52.130  1.00 119.28 ? 85   HIS A ND1   1 
ATOM   637   C  CD2   . HIS A  1  85  ? 65.290  58.781  51.118  1.00 118.61 ? 85   HIS A CD2   1 
ATOM   638   C  CE1   . HIS A  1  85  ? 65.721  59.819  53.003  1.00 119.28 ? 85   HIS A CE1   1 
ATOM   639   N  NE2   . HIS A  1  85  ? 65.725  58.636  52.414  1.00 119.34 ? 85   HIS A NE2   1 
ATOM   640   N  N     . PHE A  1  86  ? 62.077  60.260  47.287  1.00 112.23 ? 86   PHE A N     1 
ATOM   641   C  CA    . PHE A  1  86  ? 61.217  60.959  46.343  1.00 112.64 ? 86   PHE A CA    1 
ATOM   642   C  C     . PHE A  1  86  ? 60.127  61.752  47.033  1.00 111.31 ? 86   PHE A C     1 
ATOM   643   O  O     . PHE A  1  86  ? 59.257  61.199  47.713  1.00 110.80 ? 86   PHE A O     1 
ATOM   644   C  CB    . PHE A  1  86  ? 60.562  60.006  45.354  1.00 115.39 ? 86   PHE A CB    1 
ATOM   645   C  CG    . PHE A  1  86  ? 60.256  60.653  44.039  1.00 118.29 ? 86   PHE A CG    1 
ATOM   646   C  CD1   . PHE A  1  86  ? 60.225  62.046  43.933  1.00 119.63 ? 86   PHE A CD1   1 
ATOM   647   C  CD2   . PHE A  1  86  ? 60.036  59.886  42.901  1.00 119.72 ? 86   PHE A CD2   1 
ATOM   648   C  CE1   . PHE A  1  86  ? 59.986  62.670  42.711  1.00 121.15 ? 86   PHE A CE1   1 
ATOM   649   C  CE2   . PHE A  1  86  ? 59.796  60.497  41.670  1.00 121.25 ? 86   PHE A CE2   1 
ATOM   650   C  CZ    . PHE A  1  86  ? 59.772  61.895  41.574  1.00 121.47 ? 86   PHE A CZ    1 
ATOM   651   N  N     . ASN A  1  87  ? 60.170  63.058  46.810  1.00 109.54 ? 87   ASN A N     1 
ATOM   652   C  CA    . ASN A  1  87  ? 59.240  63.985  47.420  1.00 107.18 ? 87   ASN A CA    1 
ATOM   653   C  C     . ASN A  1  87  ? 59.145  65.216  46.530  1.00 104.97 ? 87   ASN A C     1 
ATOM   654   O  O     . ASN A  1  87  ? 59.958  65.398  45.624  1.00 104.75 ? 87   ASN A O     1 
ATOM   655   C  CB    . ASN A  1  87  ? 59.769  64.321  48.824  1.00 108.04 ? 87   ASN A CB    1 
ATOM   656   C  CG    . ASN A  1  87  ? 59.359  65.688  49.310  1.00 108.67 ? 87   ASN A CG    1 
ATOM   657   O  OD1   . ASN A  1  87  ? 58.172  65.988  49.447  1.00 109.84 ? 87   ASN A OD1   1 
ATOM   658   N  ND2   . ASN A  1  87  ? 60.350  66.530  49.594  1.00 108.42 ? 87   ASN A ND2   1 
ATOM   659   N  N     . GLY A  1  88  ? 58.137  66.042  46.779  1.00 102.74 ? 88   GLY A N     1 
ATOM   660   C  CA    . GLY A  1  88  ? 57.941  67.245  45.991  1.00 99.84  ? 88   GLY A CA    1 
ATOM   661   C  C     . GLY A  1  88  ? 56.784  68.083  46.508  1.00 97.59  ? 88   GLY A C     1 
ATOM   662   O  O     . GLY A  1  88  ? 56.365  67.933  47.661  1.00 97.48  ? 88   GLY A O     1 
ATOM   663   N  N     . TYR A  1  89  ? 56.255  68.961  45.659  1.00 95.04  ? 89   TYR A N     1 
ATOM   664   C  CA    . TYR A  1  89  ? 55.154  69.814  46.076  1.00 92.03  ? 89   TYR A CA    1 
ATOM   665   C  C     . TYR A  1  89  ? 54.355  70.446  44.954  1.00 90.19  ? 89   TYR A C     1 
ATOM   666   O  O     . TYR A  1  89  ? 54.502  70.091  43.791  1.00 88.95  ? 89   TYR A O     1 
ATOM   667   C  CB    . TYR A  1  89  ? 55.676  70.916  46.993  1.00 91.78  ? 89   TYR A CB    1 
ATOM   668   C  CG    . TYR A  1  89  ? 56.730  71.808  46.369  1.00 89.81  ? 89   TYR A CG    1 
ATOM   669   C  CD1   . TYR A  1  89  ? 56.406  72.703  45.353  1.00 87.83  ? 89   TYR A CD1   1 
ATOM   670   C  CD2   . TYR A  1  89  ? 58.045  71.788  46.838  1.00 88.90  ? 89   TYR A CD2   1 
ATOM   671   C  CE1   . TYR A  1  89  ? 57.356  73.552  44.832  1.00 86.90  ? 89   TYR A CE1   1 
ATOM   672   C  CE2   . TYR A  1  89  ? 59.001  72.632  46.322  1.00 87.16  ? 89   TYR A CE2   1 
ATOM   673   C  CZ    . TYR A  1  89  ? 58.651  73.512  45.325  1.00 86.99  ? 89   TYR A CZ    1 
ATOM   674   O  OH    . TYR A  1  89  ? 59.600  74.371  44.839  1.00 87.10  ? 89   TYR A OH    1 
ATOM   675   N  N     . THR A  1  90  ? 53.516  71.404  45.338  1.00 88.87  ? 90   THR A N     1 
ATOM   676   C  CA    . THR A  1  90  ? 52.644  72.118  44.416  1.00 87.67  ? 90   THR A CA    1 
ATOM   677   C  C     . THR A  1  90  ? 52.124  73.428  45.040  1.00 85.94  ? 90   THR A C     1 
ATOM   678   O  O     . THR A  1  90  ? 51.133  73.414  45.759  1.00 86.48  ? 90   THR A O     1 
ATOM   679   C  CB    . THR A  1  90  ? 51.430  71.206  43.998  1.00 88.29  ? 90   THR A CB    1 
ATOM   680   O  OG1   . THR A  1  90  ? 50.455  71.981  43.291  1.00 88.80  ? 90   THR A OG1   1 
ATOM   681   C  CG2   . THR A  1  90  ? 50.771  70.562  45.220  1.00 87.41  ? 90   THR A CG2   1 
ATOM   682   N  N     . SER A  1  91  ? 52.793  74.553  44.777  1.00 83.57  ? 91   SER A N     1 
ATOM   683   C  CA    . SER A  1  91  ? 52.358  75.848  45.321  1.00 80.61  ? 91   SER A CA    1 
ATOM   684   C  C     . SER A  1  91  ? 51.323  76.463  44.377  1.00 79.02  ? 91   SER A C     1 
ATOM   685   O  O     . SER A  1  91  ? 50.718  75.741  43.586  1.00 78.84  ? 91   SER A O     1 
ATOM   686   C  CB    . SER A  1  91  ? 53.549  76.807  45.503  1.00 80.00  ? 91   SER A CB    1 
ATOM   687   O  OG    . SER A  1  91  ? 53.896  77.475  44.302  1.00 78.35  ? 91   SER A OG    1 
ATOM   688   N  N     . ARG A  1  92  ? 51.118  77.779  44.447  1.00 76.70  ? 92   ARG A N     1 
ATOM   689   C  CA    . ARG A  1  92  ? 50.127  78.442  43.588  1.00 73.58  ? 92   ARG A CA    1 
ATOM   690   C  C     . ARG A  1  92  ? 50.513  78.497  42.113  1.00 72.60  ? 92   ARG A C     1 
ATOM   691   O  O     . ARG A  1  92  ? 49.689  78.274  41.222  1.00 71.18  ? 92   ARG A O     1 
ATOM   692   C  CB    . ARG A  1  92  ? 49.832  79.852  44.104  1.00 71.82  ? 92   ARG A CB    1 
ATOM   693   C  CG    . ARG A  1  92  ? 48.977  79.872  45.364  1.00 69.44  ? 92   ARG A CG    1 
ATOM   694   C  CD    . ARG A  1  92  ? 48.233  81.180  45.501  1.00 66.57  ? 92   ARG A CD    1 
ATOM   695   N  NE    . ARG A  1  92  ? 47.230  81.110  46.552  1.00 64.41  ? 92   ARG A NE    1 
ATOM   696   C  CZ    . ARG A  1  92  ? 47.523  80.998  47.835  1.00 63.75  ? 92   ARG A CZ    1 
ATOM   697   N  NH1   . ARG A  1  92  ? 48.788  80.947  48.207  1.00 63.99  ? 92   ARG A NH1   1 
ATOM   698   N  NH2   . ARG A  1  92  ? 46.557  80.937  48.737  1.00 64.44  ? 92   ARG A NH2   1 
ATOM   699   N  N     . GLU A  1  93  ? 51.768  78.813  41.847  1.00 72.33  ? 93   GLU A N     1 
ATOM   700   C  CA    . GLU A  1  93  ? 52.225  78.846  40.473  1.00 72.42  ? 93   GLU A CA    1 
ATOM   701   C  C     . GLU A  1  93  ? 53.632  78.258  40.375  1.00 72.59  ? 93   GLU A C     1 
ATOM   702   O  O     . GLU A  1  93  ? 54.596  78.976  40.089  1.00 73.36  ? 93   GLU A O     1 
ATOM   703   C  CB    . GLU A  1  93  ? 52.194  80.272  39.926  1.00 71.66  ? 93   GLU A CB    1 
ATOM   704   C  CG    . GLU A  1  93  ? 52.988  81.280  40.722  1.00 73.01  ? 93   GLU A CG    1 
ATOM   705   C  CD    . GLU A  1  93  ? 53.147  82.601  39.975  1.00 74.28  ? 93   GLU A CD    1 
ATOM   706   O  OE1   . GLU A  1  93  ? 52.168  83.058  39.342  1.00 72.63  ? 93   GLU A OE1   1 
ATOM   707   O  OE2   . GLU A  1  93  ? 54.251  83.191  40.026  1.00 75.90  ? 93   GLU A OE2   1 
ATOM   708   N  N     . GLN A  1  94  ? 53.724  76.946  40.627  1.00 71.39  ? 94   GLN A N     1 
ATOM   709   C  CA    . GLN A  1  94  ? 54.972  76.172  40.587  1.00 69.51  ? 94   GLN A CA    1 
ATOM   710   C  C     . GLN A  1  94  ? 54.850  74.863  41.349  1.00 70.52  ? 94   GLN A C     1 
ATOM   711   O  O     . GLN A  1  94  ? 54.658  74.855  42.564  1.00 71.79  ? 94   GLN A O     1 
ATOM   712   C  CB    . GLN A  1  94  ? 56.137  76.948  41.197  1.00 67.12  ? 94   GLN A CB    1 
ATOM   713   C  CG    . GLN A  1  94  ? 57.434  76.169  41.250  1.00 62.16  ? 94   GLN A CG    1 
ATOM   714   C  CD    . GLN A  1  94  ? 58.582  77.028  41.720  1.00 60.68  ? 94   GLN A CD    1 
ATOM   715   O  OE1   . GLN A  1  94  ? 58.821  78.112  41.186  1.00 59.31  ? 94   GLN A OE1   1 
ATOM   716   N  NE2   . GLN A  1  94  ? 59.302  76.552  42.721  1.00 59.48  ? 94   GLN A NE2   1 
ATOM   717   N  N     . THR A  1  95  ? 54.958  73.755  40.630  1.00 70.58  ? 95   THR A N     1 
ATOM   718   C  CA    . THR A  1  95  ? 54.896  72.436  41.241  1.00 70.00  ? 95   THR A CA    1 
ATOM   719   C  C     . THR A  1  95  ? 56.299  71.896  40.986  1.00 71.86  ? 95   THR A C     1 
ATOM   720   O  O     . THR A  1  95  ? 57.083  72.528  40.275  1.00 72.10  ? 95   THR A O     1 
ATOM   721   C  CB    . THR A  1  95  ? 53.849  71.544  40.535  1.00 67.82  ? 95   THR A CB    1 
ATOM   722   O  OG1   . THR A  1  95  ? 52.590  72.219  40.486  1.00 65.54  ? 95   THR A OG1   1 
ATOM   723   C  CG2   . THR A  1  95  ? 53.659  70.258  41.279  1.00 67.56  ? 95   THR A CG2   1 
ATOM   724   N  N     . ALA A  1  96  ? 56.638  70.755  41.571  1.00 73.69  ? 96   ALA A N     1 
ATOM   725   C  CA    . ALA A  1  96  ? 57.959  70.172  41.351  1.00 75.09  ? 96   ALA A CA    1 
ATOM   726   C  C     . ALA A  1  96  ? 58.099  68.806  42.011  1.00 76.25  ? 96   ALA A C     1 
ATOM   727   O  O     . ALA A  1  96  ? 57.602  68.581  43.116  1.00 76.46  ? 96   ALA A O     1 
ATOM   728   C  CB    . ALA A  1  96  ? 59.052  71.113  41.862  1.00 73.80  ? 96   ALA A CB    1 
ATOM   729   N  N     . PHE A  1  97  ? 58.767  67.891  41.320  1.00 77.32  ? 97   PHE A N     1 
ATOM   730   C  CA    . PHE A  1  97  ? 59.001  66.561  41.849  1.00 77.91  ? 97   PHE A CA    1 
ATOM   731   C  C     . PHE A  1  97  ? 60.491  66.302  41.720  1.00 79.58  ? 97   PHE A C     1 
ATOM   732   O  O     . PHE A  1  97  ? 61.055  66.311  40.627  1.00 79.07  ? 97   PHE A O     1 
ATOM   733   C  CB    . PHE A  1  97  ? 58.194  65.531  41.072  1.00 76.33  ? 97   PHE A CB    1 
ATOM   734   C  CG    . PHE A  1  97  ? 56.734  65.862  40.970  1.00 74.99  ? 97   PHE A CG    1 
ATOM   735   C  CD1   . PHE A  1  97  ? 56.281  66.806  40.065  1.00 74.42  ? 97   PHE A CD1   1 
ATOM   736   C  CD2   . PHE A  1  97  ? 55.809  65.224  41.777  1.00 75.41  ? 97   PHE A CD2   1 
ATOM   737   C  CE1   . PHE A  1  97  ? 54.915  67.103  39.966  1.00 75.26  ? 97   PHE A CE1   1 
ATOM   738   C  CE2   . PHE A  1  97  ? 54.440  65.519  41.684  1.00 75.48  ? 97   PHE A CE2   1 
ATOM   739   C  CZ    . PHE A  1  97  ? 53.994  66.454  40.780  1.00 75.06  ? 97   PHE A CZ    1 
ATOM   740   N  N     . TYR A  1  98  ? 61.130  66.088  42.858  1.00 82.06  ? 98   TYR A N     1 
ATOM   741   C  CA    . TYR A  1  98  ? 62.559  65.869  42.879  1.00 85.16  ? 98   TYR A CA    1 
ATOM   742   C  C     . TYR A  1  98  ? 62.945  64.689  43.772  1.00 86.75  ? 98   TYR A C     1 
ATOM   743   O  O     . TYR A  1  98  ? 62.188  64.288  44.664  1.00 86.17  ? 98   TYR A O     1 
ATOM   744   C  CB    . TYR A  1  98  ? 63.242  67.151  43.360  1.00 85.51  ? 98   TYR A CB    1 
ATOM   745   C  CG    . TYR A  1  98  ? 62.852  67.535  44.767  1.00 86.39  ? 98   TYR A CG    1 
ATOM   746   C  CD1   . TYR A  1  98  ? 63.416  66.892  45.873  1.00 87.56  ? 98   TYR A CD1   1 
ATOM   747   C  CD2   . TYR A  1  98  ? 61.880  68.501  44.999  1.00 86.63  ? 98   TYR A CD2   1 
ATOM   748   C  CE1   . TYR A  1  98  ? 63.015  67.202  47.180  1.00 87.89  ? 98   TYR A CE1   1 
ATOM   749   C  CE2   . TYR A  1  98  ? 61.468  68.820  46.305  1.00 86.96  ? 98   TYR A CE2   1 
ATOM   750   C  CZ    . TYR A  1  98  ? 62.041  68.164  47.387  1.00 87.31  ? 98   TYR A CZ    1 
ATOM   751   O  OH    . TYR A  1  98  ? 61.643  68.458  48.671  1.00 86.64  ? 98   TYR A OH    1 
ATOM   752   N  N     . ILE A  1  99  ? 64.131  64.141  43.521  1.00 88.87  ? 99   ILE A N     1 
ATOM   753   C  CA    . ILE A  1  99  ? 64.633  63.021  44.299  1.00 90.61  ? 99   ILE A CA    1 
ATOM   754   C  C     . ILE A  1  99  ? 66.051  63.254  44.827  1.00 91.63  ? 99   ILE A C     1 
ATOM   755   O  O     . ILE A  1  99  ? 66.888  63.898  44.179  1.00 90.52  ? 99   ILE A O     1 
ATOM   756   C  CB    . ILE A  1  99  ? 64.662  61.713  43.471  1.00 90.47  ? 99   ILE A CB    1 
ATOM   757   C  CG1   . ILE A  1  99  ? 63.283  61.414  42.893  1.00 90.09  ? 99   ILE A CG1   1 
ATOM   758   C  CG2   . ILE A  1  99  ? 65.102  60.549  44.356  1.00 91.08  ? 99   ILE A CG2   1 
ATOM   759   C  CD1   . ILE A  1  99  ? 63.200  60.073  42.198  1.00 89.94  ? 99   ILE A CD1   1 
ATOM   760   N  N     . LYS A  1  100 ? 66.292  62.722  46.020  1.00 93.20  ? 100  LYS A N     1 
ATOM   761   C  CA    . LYS A  1  100 ? 67.592  62.780  46.664  1.00 94.54  ? 100  LYS A CA    1 
ATOM   762   C  C     . LYS A  1  100 ? 68.189  61.374  46.520  1.00 95.48  ? 100  LYS A C     1 
ATOM   763   O  O     . LYS A  1  100 ? 67.617  60.389  47.002  1.00 95.72  ? 100  LYS A O     1 
ATOM   764   C  CB    . LYS A  1  100 ? 67.446  63.119  48.145  1.00 94.40  ? 100  LYS A CB    1 
ATOM   765   C  CG    . LYS A  1  100 ? 66.990  64.527  48.421  1.00 94.49  ? 100  LYS A CG    1 
ATOM   766   C  CD    . LYS A  1  100 ? 67.057  64.832  49.913  1.00 95.42  ? 100  LYS A CD    1 
ATOM   767   C  CE    . LYS A  1  100 ? 68.484  64.709  50.463  1.00 96.14  ? 100  LYS A CE    1 
ATOM   768   N  NZ    . LYS A  1  100 ? 69.487  65.611  49.814  1.00 96.53  ? 100  LYS A NZ    1 
ATOM   769   N  N     . ALA A  1  101 ? 69.333  61.274  45.855  1.00 95.83  ? 101  ALA A N     1 
ATOM   770   C  CA    . ALA A  1  101 ? 69.953  59.978  45.673  1.00 95.78  ? 101  ALA A CA    1 
ATOM   771   C  C     . ALA A  1  101 ? 71.470  60.045  45.493  1.00 96.10  ? 101  ALA A C     1 
ATOM   772   O  O     . ALA A  1  101 ? 72.050  61.117  45.304  1.00 96.14  ? 101  ALA A O     1 
ATOM   773   C  CB    . ALA A  1  101 ? 69.316  59.289  44.493  1.00 95.85  ? 101  ALA A CB    1 
ATOM   774   N  N     . LEU A  1  102 ? 72.099  58.878  45.574  1.00 95.93  ? 102  LEU A N     1 
ATOM   775   C  CA    . LEU A  1  102 ? 73.536  58.735  45.414  1.00 96.15  ? 102  LEU A CA    1 
ATOM   776   C  C     . LEU A  1  102 ? 73.902  59.216  44.013  1.00 97.07  ? 102  LEU A C     1 
ATOM   777   O  O     . LEU A  1  102 ? 73.223  58.865  43.043  1.00 96.66  ? 102  LEU A O     1 
ATOM   778   C  CB    . LEU A  1  102 ? 73.887  57.266  45.544  1.00 96.27  ? 102  LEU A CB    1 
ATOM   779   C  CG    . LEU A  1  102 ? 73.109  56.510  46.623  1.00 96.57  ? 102  LEU A CG    1 
ATOM   780   C  CD1   . LEU A  1  102 ? 72.840  55.081  46.168  1.00 97.18  ? 102  LEU A CD1   1 
ATOM   781   C  CD2   . LEU A  1  102 ? 73.894  56.530  47.924  1.00 96.88  ? 102  LEU A CD2   1 
ATOM   782   N  N     . SER A  1  103 ? 74.976  59.999  43.897  1.00 97.96  ? 103  SER A N     1 
ATOM   783   C  CA    . SER A  1  103 ? 75.412  60.525  42.593  1.00 98.48  ? 103  SER A CA    1 
ATOM   784   C  C     . SER A  1  103 ? 75.448  59.450  41.499  1.00 98.58  ? 103  SER A C     1 
ATOM   785   O  O     . SER A  1  103 ? 75.381  59.748  40.304  1.00 97.34  ? 103  SER A O     1 
ATOM   786   C  CB    . SER A  1  103 ? 76.795  61.183  42.718  1.00 98.68  ? 103  SER A CB    1 
ATOM   787   O  OG    . SER A  1  103 ? 76.736  62.428  43.401  1.00 97.85  ? 103  SER A OG    1 
ATOM   788   N  N     . LYS A  1  104 ? 75.563  58.201  41.932  1.00 99.52  ? 104  LYS A N     1 
ATOM   789   C  CA    . LYS A  1  104 ? 75.602  57.056  41.036  1.00 100.16 ? 104  LYS A CA    1 
ATOM   790   C  C     . LYS A  1  104 ? 74.318  56.977  40.231  1.00 100.44 ? 104  LYS A C     1 
ATOM   791   O  O     . LYS A  1  104 ? 74.334  57.142  39.017  1.00 101.11 ? 104  LYS A O     1 
ATOM   792   C  CB    . LYS A  1  104 ? 75.807  55.767  41.855  1.00 100.33 ? 104  LYS A CB    1 
ATOM   793   C  CG    . LYS A  1  104 ? 75.320  54.457  41.214  1.00 99.79  ? 104  LYS A CG    1 
ATOM   794   C  CD    . LYS A  1  104 ? 75.957  53.218  41.893  1.00 99.34  ? 104  LYS A CD    1 
ATOM   795   C  CE    . LYS A  1  104 ? 75.757  53.145  43.424  1.00 97.93  ? 104  LYS A CE    1 
ATOM   796   N  NZ    . LYS A  1  104 ? 74.423  52.632  43.869  1.00 96.22  ? 104  LYS A NZ    1 
ATOM   797   N  N     . ASP A  1  105 ? 73.206  56.746  40.917  1.00 100.46 ? 105  ASP A N     1 
ATOM   798   C  CA    . ASP A  1  105 ? 71.912  56.623  40.263  1.00 100.77 ? 105  ASP A CA    1 
ATOM   799   C  C     . ASP A  1  105 ? 71.538  57.804  39.369  1.00 100.89 ? 105  ASP A C     1 
ATOM   800   O  O     . ASP A  1  105 ? 70.604  57.710  38.570  1.00 100.31 ? 105  ASP A O     1 
ATOM   801   C  CB    . ASP A  1  105 ? 70.830  56.424  41.317  1.00 101.25 ? 105  ASP A CB    1 
ATOM   802   C  CG    . ASP A  1  105 ? 71.057  55.191  42.147  1.00 101.56 ? 105  ASP A CG    1 
ATOM   803   O  OD1   . ASP A  1  105 ? 71.330  54.128  41.542  1.00 103.02 ? 105  ASP A OD1   1 
ATOM   804   O  OD2   . ASP A  1  105 ? 70.948  55.285  43.391  1.00 100.80 ? 105  ASP A OD2   1 
ATOM   805   N  N     . MET A  1  106 ? 72.268  58.906  39.511  1.00 101.05 ? 106  MET A N     1 
ATOM   806   C  CA    . MET A  1  106 ? 72.034  60.127  38.740  1.00 101.29 ? 106  MET A CA    1 
ATOM   807   C  C     . MET A  1  106 ? 71.195  59.935  37.467  1.00 101.19 ? 106  MET A C     1 
ATOM   808   O  O     . MET A  1  106 ? 70.162  60.579  37.296  1.00 100.77 ? 106  MET A O     1 
ATOM   809   C  CB    . MET A  1  106 ? 73.388  60.773  38.413  1.00 101.88 ? 106  MET A CB    1 
ATOM   810   C  CG    . MET A  1  106 ? 73.320  62.121  37.731  1.00 101.71 ? 106  MET A CG    1 
ATOM   811   S  SD    . MET A  1  106 ? 73.173  61.967  35.965  1.00 102.45 ? 106  MET A SD    1 
ATOM   812   C  CE    . MET A  1  106 ? 71.514  62.480  35.716  1.00 100.12 ? 106  MET A CE    1 
ATOM   813   N  N     . PRO A  1  107 ? 71.627  59.041  36.560  1.00 101.58 ? 107  PRO A N     1 
ATOM   814   C  CA    . PRO A  1  107 ? 70.880  58.798  35.320  1.00 101.82 ? 107  PRO A CA    1 
ATOM   815   C  C     . PRO A  1  107 ? 69.585  58.039  35.561  1.00 101.58 ? 107  PRO A C     1 
ATOM   816   O  O     . PRO A  1  107 ? 68.516  58.454  35.110  1.00 101.18 ? 107  PRO A O     1 
ATOM   817   C  CB    . PRO A  1  107 ? 71.862  57.991  34.482  1.00 102.44 ? 107  PRO A CB    1 
ATOM   818   C  CG    . PRO A  1  107 ? 72.586  57.191  35.517  1.00 102.56 ? 107  PRO A CG    1 
ATOM   819   C  CD    . PRO A  1  107 ? 72.863  58.239  36.580  1.00 102.41 ? 107  PRO A CD    1 
ATOM   820   N  N     . LYS A  1  108 ? 69.694  56.913  36.260  1.00 101.73 ? 108  LYS A N     1 
ATOM   821   C  CA    . LYS A  1  108 ? 68.526  56.098  36.581  1.00 101.81 ? 108  LYS A CA    1 
ATOM   822   C  C     . LYS A  1  108 ? 67.443  57.004  37.190  1.00 100.64 ? 108  LYS A C     1 
ATOM   823   O  O     . LYS A  1  108 ? 66.262  56.896  36.851  1.00 101.63 ? 108  LYS A O     1 
ATOM   824   C  CB    . LYS A  1  108 ? 68.905  54.976  37.572  1.00 102.60 ? 108  LYS A CB    1 
ATOM   825   C  CG    . LYS A  1  108 ? 67.757  53.995  37.920  1.00 102.53 ? 108  LYS A CG    1 
ATOM   826   C  CD    . LYS A  1  108 ? 67.229  53.246  36.683  1.00 102.35 ? 108  LYS A CD    1 
ATOM   827   C  CE    . LYS A  1  108 ? 66.093  52.292  37.039  1.00 101.24 ? 108  LYS A CE    1 
ATOM   828   N  NZ    . LYS A  1  108 ? 65.578  51.532  35.855  1.00 100.49 ? 108  LYS A NZ    1 
ATOM   829   N  N     . VAL A  1  109 ? 67.847  57.900  38.085  1.00 97.78  ? 109  VAL A N     1 
ATOM   830   C  CA    . VAL A  1  109 ? 66.899  58.812  38.698  1.00 94.26  ? 109  VAL A CA    1 
ATOM   831   C  C     . VAL A  1  109 ? 66.135  59.493  37.581  1.00 92.73  ? 109  VAL A C     1 
ATOM   832   O  O     . VAL A  1  109 ? 64.933  59.311  37.446  1.00 92.35  ? 109  VAL A O     1 
ATOM   833   C  CB    . VAL A  1  109 ? 67.600  59.900  39.496  1.00 94.06  ? 109  VAL A CB    1 
ATOM   834   C  CG1   . VAL A  1  109 ? 66.580  60.751  40.193  1.00 93.90  ? 109  VAL A CG1   1 
ATOM   835   C  CG2   . VAL A  1  109 ? 68.541  59.285  40.487  1.00 94.69  ? 109  VAL A CG2   1 
ATOM   836   N  N     . VAL A  1  110 ? 66.858  60.261  36.772  1.00 90.96  ? 110  VAL A N     1 
ATOM   837   C  CA    . VAL A  1  110 ? 66.284  60.997  35.655  1.00 89.37  ? 110  VAL A CA    1 
ATOM   838   C  C     . VAL A  1  110 ? 65.193  60.242  34.913  1.00 88.96  ? 110  VAL A C     1 
ATOM   839   O  O     . VAL A  1  110 ? 64.145  60.802  34.608  1.00 88.57  ? 110  VAL A O     1 
ATOM   840   C  CB    . VAL A  1  110 ? 67.366  61.390  34.660  1.00 88.83  ? 110  VAL A CB    1 
ATOM   841   C  CG1   . VAL A  1  110 ? 66.768  62.238  33.563  1.00 88.93  ? 110  VAL A CG1   1 
ATOM   842   C  CG2   . VAL A  1  110 ? 68.463  62.149  35.376  1.00 87.57  ? 110  VAL A CG2   1 
ATOM   843   N  N     . GLU A  1  111 ? 65.443  58.976  34.613  1.00 89.18  ? 111  GLU A N     1 
ATOM   844   C  CA    . GLU A  1  111 ? 64.454  58.151  33.924  1.00 90.85  ? 111  GLU A CA    1 
ATOM   845   C  C     . GLU A  1  111 ? 63.119  58.274  34.656  1.00 91.39  ? 111  GLU A C     1 
ATOM   846   O  O     . GLU A  1  111 ? 62.099  58.686  34.091  1.00 91.91  ? 111  GLU A O     1 
ATOM   847   C  CB    . GLU A  1  111 ? 64.897  56.684  33.938  1.00 92.03  ? 111  GLU A CB    1 
ATOM   848   C  CG    . GLU A  1  111 ? 64.023  55.737  33.110  1.00 93.92  ? 111  GLU A CG    1 
ATOM   849   C  CD    . GLU A  1  111 ? 64.454  54.278  33.224  1.00 95.00  ? 111  GLU A CD    1 
ATOM   850   O  OE1   . GLU A  1  111 ? 65.673  54.014  33.368  1.00 95.90  ? 111  GLU A OE1   1 
ATOM   851   O  OE2   . GLU A  1  111 ? 63.573  53.392  33.156  1.00 95.49  ? 111  GLU A OE2   1 
ATOM   852   N  N     . LEU A  1  112 ? 63.160  57.898  35.928  1.00 91.33  ? 112  LEU A N     1 
ATOM   853   C  CA    . LEU A  1  112 ? 62.018  57.930  36.830  1.00 90.74  ? 112  LEU A CA    1 
ATOM   854   C  C     . LEU A  1  112 ? 61.263  59.267  36.757  1.00 90.45  ? 112  LEU A C     1 
ATOM   855   O  O     . LEU A  1  112 ? 60.093  59.297  36.364  1.00 90.73  ? 112  LEU A O     1 
ATOM   856   C  CB    . LEU A  1  112 ? 62.534  57.674  38.240  1.00 90.50  ? 112  LEU A CB    1 
ATOM   857   C  CG    . LEU A  1  112 ? 63.604  56.578  38.216  1.00 89.69  ? 112  LEU A CG    1 
ATOM   858   C  CD1   . LEU A  1  112 ? 64.520  56.697  39.421  1.00 90.11  ? 112  LEU A CD1   1 
ATOM   859   C  CD2   . LEU A  1  112 ? 62.928  55.225  38.141  1.00 88.87  ? 112  LEU A CD2   1 
ATOM   860   N  N     . LEU A  1  113 ? 61.936  60.358  37.132  1.00 89.42  ? 113  LEU A N     1 
ATOM   861   C  CA    . LEU A  1  113 ? 61.348  61.702  37.093  1.00 88.32  ? 113  LEU A CA    1 
ATOM   862   C  C     . LEU A  1  113 ? 60.506  61.833  35.828  1.00 87.79  ? 113  LEU A C     1 
ATOM   863   O  O     . LEU A  1  113 ? 59.329  62.195  35.872  1.00 87.21  ? 113  LEU A O     1 
ATOM   864   C  CB    . LEU A  1  113 ? 62.454  62.770  37.062  1.00 87.78  ? 113  LEU A CB    1 
ATOM   865   C  CG    . LEU A  1  113 ? 63.562  62.765  38.124  1.00 87.77  ? 113  LEU A CG    1 
ATOM   866   C  CD1   . LEU A  1  113 ? 64.633  63.778  37.736  1.00 86.50  ? 113  LEU A CD1   1 
ATOM   867   C  CD2   . LEU A  1  113 ? 62.988  63.086  39.502  1.00 87.43  ? 113  LEU A CD2   1 
ATOM   868   N  N     . ALA A  1  114 ? 61.136  61.523  34.702  1.00 87.46  ? 114  ALA A N     1 
ATOM   869   C  CA    . ALA A  1  114 ? 60.500  61.579  33.399  1.00 87.52  ? 114  ALA A CA    1 
ATOM   870   C  C     . ALA A  1  114 ? 59.278  60.670  33.276  1.00 88.00  ? 114  ALA A C     1 
ATOM   871   O  O     . ALA A  1  114 ? 58.303  61.026  32.606  1.00 88.09  ? 114  ALA A O     1 
ATOM   872   C  CB    . ALA A  1  114 ? 61.508  61.215  32.337  1.00 87.25  ? 114  ALA A CB    1 
ATOM   873   N  N     . ASP A  1  115 ? 59.326  59.497  33.904  1.00 87.99  ? 115  ASP A N     1 
ATOM   874   C  CA    . ASP A  1  115 ? 58.201  58.572  33.822  1.00 88.85  ? 115  ASP A CA    1 
ATOM   875   C  C     . ASP A  1  115 ? 57.005  58.954  34.711  1.00 89.68  ? 115  ASP A C     1 
ATOM   876   O  O     . ASP A  1  115 ? 55.954  58.311  34.635  1.00 90.93  ? 115  ASP A O     1 
ATOM   877   C  CB    . ASP A  1  115 ? 58.656  57.132  34.131  1.00 88.03  ? 115  ASP A CB    1 
ATOM   878   C  CG    . ASP A  1  115 ? 57.536  56.092  33.913  1.00 88.03  ? 115  ASP A CG    1 
ATOM   879   O  OD1   . ASP A  1  115 ? 56.734  56.241  32.966  1.00 87.20  ? 115  ASP A OD1   1 
ATOM   880   O  OD2   . ASP A  1  115 ? 57.464  55.107  34.678  1.00 87.52  ? 115  ASP A OD2   1 
ATOM   881   N  N     . VAL A  1  116 ? 57.142  59.997  35.535  1.00 89.28  ? 116  VAL A N     1 
ATOM   882   C  CA    . VAL A  1  116 ? 56.038  60.422  36.404  1.00 87.42  ? 116  VAL A CA    1 
ATOM   883   C  C     . VAL A  1  116 ? 55.350  61.661  35.864  1.00 87.03  ? 116  VAL A C     1 
ATOM   884   O  O     . VAL A  1  116 ? 54.125  61.771  35.923  1.00 85.43  ? 116  VAL A O     1 
ATOM   885   C  CB    . VAL A  1  116 ? 56.509  60.747  37.816  1.00 86.78  ? 116  VAL A CB    1 
ATOM   886   C  CG1   . VAL A  1  116 ? 55.318  61.016  38.684  1.00 85.99  ? 116  VAL A CG1   1 
ATOM   887   C  CG2   . VAL A  1  116 ? 57.320  59.603  38.373  1.00 86.86  ? 116  VAL A CG2   1 
ATOM   888   N  N     . VAL A  1  117 ? 56.152  62.594  35.351  1.00 87.44  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117 ? 55.630  63.827  34.781  1.00 89.14  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117 ? 54.845  63.499  33.510  1.00 92.03  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117 ? 53.816  64.117  33.230  1.00 93.37  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117 ? 56.765  64.832  34.400  1.00 87.40  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117 ? 57.669  65.090  35.568  1.00 86.00  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117 ? 57.569  64.302  33.248  1.00 87.88  ? 117  VAL A CG2   1 
ATOM   895   N  N     . GLN A  1  118 ? 55.331  62.511  32.758  1.00 94.24  ? 118  GLN A N     1 
ATOM   896   C  CA    . GLN A  1  118 ? 54.714  62.096  31.496  1.00 95.65  ? 118  GLN A CA    1 
ATOM   897   C  C     . GLN A  1  118 ? 53.679  60.983  31.585  1.00 96.21  ? 118  GLN A C     1 
ATOM   898   O  O     . GLN A  1  118 ? 52.473  61.220  31.447  1.00 95.63  ? 118  GLN A O     1 
ATOM   899   C  CB    . GLN A  1  118 ? 55.810  61.667  30.526  1.00 96.33  ? 118  GLN A CB    1 
ATOM   900   C  CG    . GLN A  1  118 ? 56.732  62.801  30.145  1.00 99.44  ? 118  GLN A CG    1 
ATOM   901   C  CD    . GLN A  1  118 ? 57.867  62.358  29.253  1.00 100.91 ? 118  GLN A CD    1 
ATOM   902   O  OE1   . GLN A  1  118 ? 58.616  63.189  28.730  1.00 101.90 ? 118  GLN A OE1   1 
ATOM   903   N  NE2   . GLN A  1  118 ? 58.009  61.045  29.075  1.00 101.48 ? 118  GLN A NE2   1 
ATOM   904   N  N     . ASN A  1  119 ? 54.175  59.767  31.804  1.00 97.56  ? 119  ASN A N     1 
ATOM   905   C  CA    . ASN A  1  119 ? 53.343  58.568  31.895  1.00 99.45  ? 119  ASN A CA    1 
ATOM   906   C  C     . ASN A  1  119 ? 52.854  58.242  33.306  1.00 99.27  ? 119  ASN A C     1 
ATOM   907   O  O     . ASN A  1  119 ? 53.198  57.198  33.857  1.00 99.63  ? 119  ASN A O     1 
ATOM   908   C  CB    . ASN A  1  119 ? 54.120  57.362  31.362  1.00 101.74 ? 119  ASN A CB    1 
ATOM   909   C  CG    . ASN A  1  119 ? 54.652  57.582  29.959  1.00 104.34 ? 119  ASN A CG    1 
ATOM   910   O  OD1   . ASN A  1  119 ? 53.881  57.709  29.004  1.00 105.98 ? 119  ASN A OD1   1 
ATOM   911   N  ND2   . ASN A  1  119 ? 55.980  57.632  29.826  1.00 104.92 ? 119  ASN A ND2   1 
ATOM   912   N  N     . CYS A  1  120 ? 52.052  59.120  33.891  1.00 98.68  ? 120  CYS A N     1 
ATOM   913   C  CA    . CYS A  1  120 ? 51.538  58.867  35.223  1.00 97.52  ? 120  CYS A CA    1 
ATOM   914   C  C     . CYS A  1  120 ? 50.388  57.863  35.137  1.00 96.33  ? 120  CYS A C     1 
ATOM   915   O  O     . CYS A  1  120 ? 49.434  58.059  34.393  1.00 95.29  ? 120  CYS A O     1 
ATOM   916   C  CB    . CYS A  1  120 ? 51.071  60.169  35.847  1.00 98.43  ? 120  CYS A CB    1 
ATOM   917   S  SG    . CYS A  1  120 ? 50.554  59.947  37.520  1.00 100.98 ? 120  CYS A SG    1 
ATOM   918   N  N     . ALA A  1  121 ? 50.494  56.784  35.902  1.00 96.43  ? 121  ALA A N     1 
ATOM   919   C  CA    . ALA A  1  121 ? 49.496  55.715  35.903  1.00 97.50  ? 121  ALA A CA    1 
ATOM   920   C  C     . ALA A  1  121 ? 48.075  56.202  35.971  1.00 98.08  ? 121  ALA A C     1 
ATOM   921   O  O     . ALA A  1  121 ? 47.257  55.880  35.118  1.00 97.67  ? 121  ALA A O     1 
ATOM   922   C  CB    . ALA A  1  121 ? 49.746  54.757  37.063  1.00 97.76  ? 121  ALA A CB    1 
ATOM   923   N  N     . LEU A  1  122 ? 47.778  56.965  37.009  1.00 99.70  ? 122  LEU A N     1 
ATOM   924   C  CA    . LEU A  1  122 ? 46.434  57.484  37.194  1.00 101.74 ? 122  LEU A CA    1 
ATOM   925   C  C     . LEU A  1  122 ? 45.423  56.349  37.305  1.00 102.52 ? 122  LEU A C     1 
ATOM   926   O  O     . LEU A  1  122 ? 44.312  56.436  36.770  1.00 102.15 ? 122  LEU A O     1 
ATOM   927   C  CB    . LEU A  1  122 ? 46.034  58.395  36.035  1.00 102.43 ? 122  LEU A CB    1 
ATOM   928   C  CG    . LEU A  1  122 ? 46.937  59.585  35.707  1.00 103.75 ? 122  LEU A CG    1 
ATOM   929   C  CD1   . LEU A  1  122 ? 46.214  60.450  34.687  1.00 105.14 ? 122  LEU A CD1   1 
ATOM   930   C  CD2   . LEU A  1  122 ? 47.258  60.399  36.954  1.00 103.33 ? 122  LEU A CD2   1 
ATOM   931   N  N     . GLU A  1  123 ? 45.803  55.287  38.004  1.00 103.34 ? 123  GLU A N     1 
ATOM   932   C  CA    . GLU A  1  123 ? 44.897  54.168  38.163  1.00 104.19 ? 123  GLU A CA    1 
ATOM   933   C  C     . GLU A  1  123 ? 43.620  54.673  38.825  1.00 102.84 ? 123  GLU A C     1 
ATOM   934   O  O     . GLU A  1  123 ? 43.675  55.223  39.916  1.00 102.64 ? 123  GLU A O     1 
ATOM   935   C  CB    . GLU A  1  123 ? 45.548  53.084  39.022  1.00 106.82 ? 123  GLU A CB    1 
ATOM   936   C  CG    . GLU A  1  123 ? 44.775  51.766  38.990  1.00 112.20 ? 123  GLU A CG    1 
ATOM   937   C  CD    . GLU A  1  123 ? 44.712  51.152  37.589  1.00 115.22 ? 123  GLU A CD    1 
ATOM   938   O  OE1   . GLU A  1  123 ? 43.856  50.262  37.348  1.00 116.26 ? 123  GLU A OE1   1 
ATOM   939   O  OE2   . GLU A  1  123 ? 45.531  51.557  36.731  1.00 117.63 ? 123  GLU A OE2   1 
ATOM   940   N  N     . GLU A  1  124 ? 42.478  54.493  38.165  1.00 101.88 ? 124  GLU A N     1 
ATOM   941   C  CA    . GLU A  1  124 ? 41.198  54.949  38.712  1.00 102.08 ? 124  GLU A CA    1 
ATOM   942   C  C     . GLU A  1  124 ? 40.771  54.230  39.997  1.00 100.57 ? 124  GLU A C     1 
ATOM   943   O  O     . GLU A  1  124 ? 39.758  54.578  40.609  1.00 100.24 ? 124  GLU A O     1 
ATOM   944   C  CB    . GLU A  1  124 ? 40.079  54.804  37.673  1.00 104.78 ? 124  GLU A CB    1 
ATOM   945   C  CG    . GLU A  1  124 ? 38.752  55.469  38.102  1.00 108.36 ? 124  GLU A CG    1 
ATOM   946   C  CD    . GLU A  1  124 ? 37.582  55.166  37.169  1.00 109.93 ? 124  GLU A CD    1 
ATOM   947   O  OE1   . GLU A  1  124 ? 37.112  54.001  37.155  1.00 110.36 ? 124  GLU A OE1   1 
ATOM   948   O  OE2   . GLU A  1  124 ? 37.136  56.098  36.454  1.00 110.74 ? 124  GLU A OE2   1 
ATOM   949   N  N     . SER A  1  125 ? 41.529  53.215  40.392  1.00 99.02  ? 125  SER A N     1 
ATOM   950   C  CA    . SER A  1  125 ? 41.235  52.472  41.614  1.00 97.19  ? 125  SER A CA    1 
ATOM   951   C  C     . SER A  1  125 ? 41.931  53.235  42.735  1.00 95.95  ? 125  SER A C     1 
ATOM   952   O  O     . SER A  1  125 ? 41.548  53.174  43.902  1.00 95.12  ? 125  SER A O     1 
ATOM   953   C  CB    . SER A  1  125 ? 41.815  51.054  41.523  1.00 97.00  ? 125  SER A CB    1 
ATOM   954   O  OG    . SER A  1  125 ? 41.361  50.368  40.367  1.00 95.94  ? 125  SER A OG    1 
ATOM   955   N  N     . GLN A  1  126 ? 42.966  53.963  42.335  1.00 95.27  ? 126  GLN A N     1 
ATOM   956   C  CA    . GLN A  1  126 ? 43.794  54.759  43.222  1.00 94.37  ? 126  GLN A CA    1 
ATOM   957   C  C     . GLN A  1  126 ? 43.159  56.107  43.496  1.00 93.24  ? 126  GLN A C     1 
ATOM   958   O  O     . GLN A  1  126 ? 43.348  56.680  44.558  1.00 93.33  ? 126  GLN A O     1 
ATOM   959   C  CB    . GLN A  1  126 ? 45.154  54.982  42.570  1.00 95.99  ? 126  GLN A CB    1 
ATOM   960   C  CG    . GLN A  1  126 ? 46.206  55.430  43.533  1.00 98.58  ? 126  GLN A CG    1 
ATOM   961   C  CD    . GLN A  1  126 ? 46.578  54.337  44.499  1.00 100.20 ? 126  GLN A CD    1 
ATOM   962   O  OE1   . GLN A  1  126 ? 47.241  53.366  44.129  1.00 101.64 ? 126  GLN A OE1   1 
ATOM   963   N  NE2   . GLN A  1  126 ? 46.145  54.478  45.744  1.00 100.91 ? 126  GLN A NE2   1 
ATOM   964   N  N     . ILE A  1  127 ? 42.417  56.615  42.520  1.00 92.46  ? 127  ILE A N     1 
ATOM   965   C  CA    . ILE A  1  127 ? 41.754  57.909  42.639  1.00 91.05  ? 127  ILE A CA    1 
ATOM   966   C  C     . ILE A  1  127 ? 40.669  57.945  43.703  1.00 91.07  ? 127  ILE A C     1 
ATOM   967   O  O     . ILE A  1  127 ? 40.733  58.776  44.603  1.00 91.48  ? 127  ILE A O     1 
ATOM   968   C  CB    . ILE A  1  127 ? 41.160  58.358  41.281  1.00 89.95  ? 127  ILE A CB    1 
ATOM   969   C  CG1   . ILE A  1  127 ? 42.265  59.000  40.439  1.00 88.59  ? 127  ILE A CG1   1 
ATOM   970   C  CG2   . ILE A  1  127 ? 39.992  59.311  41.497  1.00 89.23  ? 127  ILE A CG2   1 
ATOM   971   C  CD1   . ILE A  1  127 ? 41.860  59.366  39.042  1.00 86.84  ? 127  ILE A CD1   1 
ATOM   972   N  N     . GLU A  1  128 ? 39.683  57.055  43.613  1.00 90.73  ? 128  GLU A N     1 
ATOM   973   C  CA    . GLU A  1  128 ? 38.610  57.040  44.602  1.00 91.28  ? 128  GLU A CA    1 
ATOM   974   C  C     . GLU A  1  128 ? 39.098  56.775  46.028  1.00 91.62  ? 128  GLU A C     1 
ATOM   975   O  O     . GLU A  1  128 ? 38.303  56.699  46.964  1.00 92.26  ? 128  GLU A O     1 
ATOM   976   C  CB    . GLU A  1  128 ? 37.530  56.031  44.214  1.00 91.77  ? 128  GLU A CB    1 
ATOM   977   C  CG    . GLU A  1  128 ? 36.611  56.482  43.060  1.00 93.58  ? 128  GLU A CG    1 
ATOM   978   C  CD    . GLU A  1  128 ? 35.669  57.647  43.420  1.00 94.44  ? 128  GLU A CD    1 
ATOM   979   O  OE1   . GLU A  1  128 ? 35.061  57.614  44.519  1.00 95.17  ? 128  GLU A OE1   1 
ATOM   980   O  OE2   . GLU A  1  128 ? 35.516  58.586  42.593  1.00 92.90  ? 128  GLU A OE2   1 
ATOM   981   N  N     . LYS A  1  129 ? 40.408  56.630  46.190  1.00 91.97  ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A  1  129 ? 41.005  56.433  47.510  1.00 91.82  ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A  1  129 ? 41.649  57.785  47.837  1.00 89.51  ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A  1  129 ? 41.457  58.336  48.918  1.00 89.07  ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A  1  129 ? 42.068  55.314  47.472  1.00 95.43  ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A  1  129 ? 42.797  55.046  48.812  1.00 98.89  ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A  1  129 ? 43.976  54.059  48.655  1.00 100.92 ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A  1  129 ? 44.889  54.043  49.895  1.00 101.51 ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A  1  129 ? 46.087  53.157  49.727  1.00 101.84 ? 129  LYS A NZ    1 
ATOM   990   N  N     . GLU A  1  130 ? 42.401  58.318  46.880  1.00 86.87  ? 130  GLU A N     1 
ATOM   991   C  CA    . GLU A  1  130 ? 43.045  59.605  47.052  1.00 84.99  ? 130  GLU A CA    1 
ATOM   992   C  C     . GLU A  1  130 ? 41.980  60.655  47.241  1.00 85.23  ? 130  GLU A C     1 
ATOM   993   O  O     . GLU A  1  130 ? 42.269  61.777  47.639  1.00 85.10  ? 130  GLU A O     1 
ATOM   994   C  CB    . GLU A  1  130 ? 43.868  59.945  45.825  1.00 83.60  ? 130  GLU A CB    1 
ATOM   995   C  CG    . GLU A  1  130 ? 45.128  59.170  45.770  1.00 83.63  ? 130  GLU A CG    1 
ATOM   996   C  CD    . GLU A  1  130 ? 45.914  59.353  47.029  1.00 82.90  ? 130  GLU A CD    1 
ATOM   997   O  OE1   . GLU A  1  130 ? 46.344  60.498  47.264  1.00 82.32  ? 130  GLU A OE1   1 
ATOM   998   O  OE2   . GLU A  1  130 ? 46.085  58.364  47.778  1.00 82.62  ? 130  GLU A OE2   1 
ATOM   999   N  N     . ARG A  1  131 ? 40.738  60.293  46.944  1.00 85.44  ? 131  ARG A N     1 
ATOM   1000  C  CA    . ARG A  1  131 ? 39.638  61.234  47.095  1.00 85.10  ? 131  ARG A CA    1 
ATOM   1001  C  C     . ARG A  1  131 ? 39.443  61.462  48.573  1.00 84.86  ? 131  ARG A C     1 
ATOM   1002  O  O     . ARG A  1  131 ? 39.614  62.572  49.051  1.00 85.49  ? 131  ARG A O     1 
ATOM   1003  C  CB    . ARG A  1  131 ? 38.350  60.690  46.483  1.00 85.71  ? 131  ARG A CB    1 
ATOM   1004  C  CG    . ARG A  1  131 ? 37.306  61.767  46.253  1.00 86.41  ? 131  ARG A CG    1 
ATOM   1005  C  CD    . ARG A  1  131 ? 36.031  61.255  45.570  1.00 87.31  ? 131  ARG A CD    1 
ATOM   1006  N  NE    . ARG A  1  131 ? 36.221  60.724  44.214  1.00 86.61  ? 131  ARG A NE    1 
ATOM   1007  C  CZ    . ARG A  1  131 ? 36.846  61.352  43.221  1.00 85.82  ? 131  ARG A CZ    1 
ATOM   1008  N  NH1   . ARG A  1  131 ? 37.372  62.556  43.405  1.00 85.65  ? 131  ARG A NH1   1 
ATOM   1009  N  NH2   . ARG A  1  131 ? 36.929  60.777  42.033  1.00 85.14  ? 131  ARG A NH2   1 
ATOM   1010  N  N     . GLY A  1  132 ? 39.095  60.407  49.301  1.00 84.58  ? 132  GLY A N     1 
ATOM   1011  C  CA    . GLY A  1  132 ? 38.912  60.546  50.738  1.00 84.84  ? 132  GLY A CA    1 
ATOM   1012  C  C     . GLY A  1  132 ? 40.152  61.037  51.490  1.00 84.24  ? 132  GLY A C     1 
ATOM   1013  O  O     . GLY A  1  132 ? 40.043  61.685  52.543  1.00 84.47  ? 132  GLY A O     1 
ATOM   1014  N  N     . VAL A  1  133 ? 41.332  60.734  50.950  1.00 82.85  ? 133  VAL A N     1 
ATOM   1015  C  CA    . VAL A  1  133 ? 42.598  61.132  51.561  1.00 80.91  ? 133  VAL A CA    1 
ATOM   1016  C  C     . VAL A  1  133 ? 42.848  62.623  51.514  1.00 79.18  ? 133  VAL A C     1 
ATOM   1017  O  O     . VAL A  1  133 ? 43.287  63.207  52.495  1.00 78.89  ? 133  VAL A O     1 
ATOM   1018  C  CB    . VAL A  1  133 ? 43.785  60.425  50.900  1.00 81.38  ? 133  VAL A CB    1 
ATOM   1019  C  CG1   . VAL A  1  133 ? 45.059  61.217  51.140  1.00 80.85  ? 133  VAL A CG1   1 
ATOM   1020  C  CG2   . VAL A  1  133 ? 43.923  59.019  51.473  1.00 82.56  ? 133  VAL A CG2   1 
ATOM   1021  N  N     . ILE A  1  134 ? 42.600  63.245  50.374  1.00 77.80  ? 134  ILE A N     1 
ATOM   1022  C  CA    . ILE A  1  134 ? 42.807  64.675  50.306  1.00 77.20  ? 134  ILE A CA    1 
ATOM   1023  C  C     . ILE A  1  134 ? 41.773  65.291  51.220  1.00 77.15  ? 134  ILE A C     1 
ATOM   1024  O  O     . ILE A  1  134 ? 42.099  66.165  52.017  1.00 77.63  ? 134  ILE A O     1 
ATOM   1025  C  CB    . ILE A  1  134 ? 42.575  65.234  48.920  1.00 77.01  ? 134  ILE A CB    1 
ATOM   1026  C  CG1   . ILE A  1  134 ? 43.215  64.330  47.880  1.00 77.63  ? 134  ILE A CG1   1 
ATOM   1027  C  CG2   . ILE A  1  134 ? 43.183  66.617  48.832  1.00 77.05  ? 134  ILE A CG2   1 
ATOM   1028  C  CD1   . ILE A  1  134 ? 42.951  64.767  46.461  1.00 78.72  ? 134  ILE A CD1   1 
ATOM   1029  N  N     . LEU A  1  135 ? 40.526  64.824  51.098  1.00 76.76  ? 135  LEU A N     1 
ATOM   1030  C  CA    . LEU A  1  135 ? 39.415  65.318  51.917  1.00 75.80  ? 135  LEU A CA    1 
ATOM   1031  C  C     . LEU A  1  135 ? 39.796  65.298  53.380  1.00 76.32  ? 135  LEU A C     1 
ATOM   1032  O  O     . LEU A  1  135 ? 39.292  66.093  54.173  1.00 77.01  ? 135  LEU A O     1 
ATOM   1033  C  CB    . LEU A  1  135 ? 38.156  64.469  51.740  1.00 74.38  ? 135  LEU A CB    1 
ATOM   1034  C  CG    . LEU A  1  135 ? 37.353  64.582  50.445  1.00 73.85  ? 135  LEU A CG    1 
ATOM   1035  C  CD1   . LEU A  1  135 ? 35.940  64.078  50.702  1.00 73.05  ? 135  LEU A CD1   1 
ATOM   1036  C  CD2   . LEU A  1  135 ? 37.313  66.022  49.969  1.00 73.56  ? 135  LEU A CD2   1 
ATOM   1037  N  N     . GLN A  1  136 ? 40.676  64.366  53.731  1.00 75.87  ? 136  GLN A N     1 
ATOM   1038  C  CA    . GLN A  1  136 ? 41.165  64.241  55.090  1.00 74.78  ? 136  GLN A CA    1 
ATOM   1039  C  C     . GLN A  1  136 ? 42.277  65.273  55.312  1.00 73.64  ? 136  GLN A C     1 
ATOM   1040  O  O     . GLN A  1  136 ? 42.257  66.003  56.288  1.00 73.23  ? 136  GLN A O     1 
ATOM   1041  C  CB    . GLN A  1  136 ? 41.696  62.831  55.314  1.00 75.95  ? 136  GLN A CB    1 
ATOM   1042  C  CG    . GLN A  1  136 ? 42.456  62.646  56.604  1.00 78.44  ? 136  GLN A CG    1 
ATOM   1043  C  CD    . GLN A  1  136 ? 41.556  62.613  57.817  1.00 80.04  ? 136  GLN A CD    1 
ATOM   1044  O  OE1   . GLN A  1  136 ? 40.768  61.682  57.999  1.00 81.25  ? 136  GLN A OE1   1 
ATOM   1045  N  NE2   . GLN A  1  136 ? 41.668  63.632  58.660  1.00 80.86  ? 136  GLN A NE2   1 
ATOM   1046  N  N     . GLU A  1  137 ? 43.237  65.355  54.399  1.00 72.97  ? 137  GLU A N     1 
ATOM   1047  C  CA    . GLU A  1  137 ? 44.320  66.317  54.553  1.00 73.48  ? 137  GLU A CA    1 
ATOM   1048  C  C     . GLU A  1  137 ? 43.796  67.737  54.629  1.00 73.56  ? 137  GLU A C     1 
ATOM   1049  O  O     . GLU A  1  137 ? 44.542  68.661  54.938  1.00 74.32  ? 137  GLU A O     1 
ATOM   1050  C  CB    . GLU A  1  137 ? 45.294  66.232  53.391  1.00 75.18  ? 137  GLU A CB    1 
ATOM   1051  C  CG    . GLU A  1  137 ? 45.892  64.869  53.169  1.00 78.63  ? 137  GLU A CG    1 
ATOM   1052  C  CD    . GLU A  1  137 ? 46.764  64.843  51.933  1.00 79.97  ? 137  GLU A CD    1 
ATOM   1053  O  OE1   . GLU A  1  137 ? 46.333  65.405  50.898  1.00 79.96  ? 137  GLU A OE1   1 
ATOM   1054  O  OE2   . GLU A  1  137 ? 47.870  64.264  51.999  1.00 79.96  ? 137  GLU A OE2   1 
ATOM   1055  N  N     . LEU A  1  138 ? 42.521  67.929  54.319  1.00 73.21  ? 138  LEU A N     1 
ATOM   1056  C  CA    . LEU A  1  138 ? 41.954  69.264  54.391  1.00 72.95  ? 138  LEU A CA    1 
ATOM   1057  C  C     . LEU A  1  138 ? 41.373  69.456  55.764  1.00 74.00  ? 138  LEU A C     1 
ATOM   1058  O  O     . LEU A  1  138 ? 41.618  70.481  56.393  1.00 74.97  ? 138  LEU A O     1 
ATOM   1059  C  CB    . LEU A  1  138 ? 40.882  69.479  53.328  1.00 70.81  ? 138  LEU A CB    1 
ATOM   1060  C  CG    . LEU A  1  138 ? 41.463  69.764  51.943  1.00 69.42  ? 138  LEU A CG    1 
ATOM   1061  C  CD1   . LEU A  1  138 ? 40.348  70.132  50.997  1.00 68.27  ? 138  LEU A CD1   1 
ATOM   1062  C  CD2   . LEU A  1  138 ? 42.479  70.900  52.032  1.00 68.94  ? 138  LEU A CD2   1 
ATOM   1063  N  N     . LYS A  1  139 ? 40.617  68.466  56.236  1.00 75.05  ? 139  LYS A N     1 
ATOM   1064  C  CA    . LYS A  1  139 ? 40.019  68.534  57.569  1.00 76.27  ? 139  LYS A CA    1 
ATOM   1065  C  C     . LYS A  1  139 ? 41.151  68.834  58.539  1.00 76.30  ? 139  LYS A C     1 
ATOM   1066  O  O     . LYS A  1  139 ? 40.932  69.405  59.601  1.00 76.08  ? 139  LYS A O     1 
ATOM   1067  C  CB    . LYS A  1  139 ? 39.369  67.201  57.970  1.00 77.86  ? 139  LYS A CB    1 
ATOM   1068  C  CG    . LYS A  1  139 ? 38.267  66.674  57.050  1.00 80.26  ? 139  LYS A CG    1 
ATOM   1069  C  CD    . LYS A  1  139 ? 36.872  66.972  57.581  1.00 82.32  ? 139  LYS A CD    1 
ATOM   1070  C  CE    . LYS A  1  139 ? 35.807  66.342  56.686  1.00 83.83  ? 139  LYS A CE    1 
ATOM   1071  N  NZ    . LYS A  1  139 ? 34.442  66.832  57.039  1.00 85.74  ? 139  LYS A NZ    1 
ATOM   1072  N  N     . GLU A  1  140 ? 42.362  68.433  58.165  1.00 76.83  ? 140  GLU A N     1 
ATOM   1073  C  CA    . GLU A  1  140 ? 43.535  68.670  58.990  1.00 78.42  ? 140  GLU A CA    1 
ATOM   1074  C  C     . GLU A  1  140 ? 44.049  70.079  58.733  1.00 78.65  ? 140  GLU A C     1 
ATOM   1075  O  O     . GLU A  1  140 ? 43.951  70.947  59.591  1.00 78.74  ? 140  GLU A O     1 
ATOM   1076  C  CB    . GLU A  1  140 ? 44.633  67.632  58.692  1.00 80.37  ? 140  GLU A CB    1 
ATOM   1077  C  CG    . GLU A  1  140 ? 44.372  66.227  59.303  1.00 83.39  ? 140  GLU A CG    1 
ATOM   1078  C  CD    . GLU A  1  140 ? 45.456  65.177  58.963  1.00 84.18  ? 140  GLU A CD    1 
ATOM   1079  O  OE1   . GLU A  1  140 ? 46.661  65.483  59.102  1.00 84.10  ? 140  GLU A OE1   1 
ATOM   1080  O  OE2   . GLU A  1  140 ? 45.106  64.038  58.570  1.00 83.64  ? 140  GLU A OE2   1 
ATOM   1081  N  N     . MET A  1  141 ? 44.571  70.318  57.541  1.00 79.46  ? 141  MET A N     1 
ATOM   1082  C  CA    . MET A  1  141 ? 45.097  71.628  57.194  1.00 80.58  ? 141  MET A CA    1 
ATOM   1083  C  C     . MET A  1  141 ? 44.246  72.801  57.639  1.00 81.20  ? 141  MET A C     1 
ATOM   1084  O  O     . MET A  1  141 ? 44.757  73.920  57.797  1.00 81.45  ? 141  MET A O     1 
ATOM   1085  C  CB    . MET A  1  141 ? 45.286  71.713  55.700  1.00 81.15  ? 141  MET A CB    1 
ATOM   1086  C  CG    . MET A  1  141 ? 46.231  70.690  55.213  1.00 83.51  ? 141  MET A CG    1 
ATOM   1087  S  SD    . MET A  1  141 ? 46.807  71.147  53.628  1.00 88.12  ? 141  MET A SD    1 
ATOM   1088  C  CE    . MET A  1  141 ? 48.357  72.062  54.082  1.00 87.21  ? 141  MET A CE    1 
ATOM   1089  N  N     . ASP A  1  142 ? 42.955  72.548  57.838  1.00 81.32  ? 142  ASP A N     1 
ATOM   1090  C  CA    . ASP A  1  142 ? 42.031  73.601  58.234  1.00 81.67  ? 142  ASP A CA    1 
ATOM   1091  C  C     . ASP A  1  142 ? 42.164  73.988  59.697  1.00 81.54  ? 142  ASP A C     1 
ATOM   1092  O  O     . ASP A  1  142 ? 41.498  74.920  60.152  1.00 82.54  ? 142  ASP A O     1 
ATOM   1093  C  CB    . ASP A  1  142 ? 40.583  73.192  57.931  1.00 82.45  ? 142  ASP A CB    1 
ATOM   1094  C  CG    . ASP A  1  142 ? 39.636  74.388  57.868  1.00 83.01  ? 142  ASP A CG    1 
ATOM   1095  O  OD1   . ASP A  1  142 ? 39.940  75.329  57.101  1.00 83.04  ? 142  ASP A OD1   1 
ATOM   1096  O  OD2   . ASP A  1  142 ? 38.597  74.382  58.572  1.00 82.59  ? 142  ASP A OD2   1 
ATOM   1097  N  N     . ASN A  1  143 ? 43.012  73.282  60.437  1.00 80.78  ? 143  ASN A N     1 
ATOM   1098  C  CA    . ASN A  1  143 ? 43.206  73.622  61.837  1.00 80.89  ? 143  ASN A CA    1 
ATOM   1099  C  C     . ASN A  1  143 ? 44.560  74.269  62.024  1.00 80.65  ? 143  ASN A C     1 
ATOM   1100  O  O     . ASN A  1  143 ? 44.994  74.484  63.145  1.00 80.83  ? 143  ASN A O     1 
ATOM   1101  C  CB    . ASN A  1  143 ? 43.070  72.393  62.749  1.00 81.71  ? 143  ASN A CB    1 
ATOM   1102  C  CG    . ASN A  1  143 ? 41.624  72.131  63.174  1.00 83.35  ? 143  ASN A CG    1 
ATOM   1103  O  OD1   . ASN A  1  143 ? 40.960  73.012  63.725  1.00 85.30  ? 143  ASN A OD1   1 
ATOM   1104  N  ND2   . ASN A  1  143 ? 41.135  70.920  62.923  1.00 83.21  ? 143  ASN A ND2   1 
ATOM   1105  N  N     . ASP A  1  144 ? 45.225  74.577  60.917  1.00 80.93  ? 144  ASP A N     1 
ATOM   1106  C  CA    . ASP A  1  144 ? 46.519  75.233  60.981  1.00 82.14  ? 144  ASP A CA    1 
ATOM   1107  C  C     . ASP A  1  144 ? 46.307  76.699  60.674  1.00 82.84  ? 144  ASP A C     1 
ATOM   1108  O  O     . ASP A  1  144 ? 46.472  77.128  59.532  1.00 82.97  ? 144  ASP A O     1 
ATOM   1109  C  CB    . ASP A  1  144 ? 47.480  74.671  59.956  1.00 83.68  ? 144  ASP A CB    1 
ATOM   1110  C  CG    . ASP A  1  144 ? 48.848  75.300  60.062  1.00 85.55  ? 144  ASP A CG    1 
ATOM   1111  O  OD1   . ASP A  1  144 ? 48.929  76.477  60.491  1.00 85.17  ? 144  ASP A OD1   1 
ATOM   1112  O  OD2   . ASP A  1  144 ? 49.839  74.623  59.712  1.00 87.86  ? 144  ASP A OD2   1 
ATOM   1113  N  N     . MET A  1  145 ? 45.948  77.451  61.710  1.00 83.81  ? 145  MET A N     1 
ATOM   1114  C  CA    . MET A  1  145 ? 45.669  78.885  61.631  1.00 84.09  ? 145  MET A CA    1 
ATOM   1115  C  C     . MET A  1  145 ? 46.557  79.631  60.661  1.00 83.70  ? 145  MET A C     1 
ATOM   1116  O  O     . MET A  1  145 ? 46.070  80.257  59.713  1.00 83.41  ? 145  MET A O     1 
ATOM   1117  C  CB    . MET A  1  145 ? 45.819  79.521  63.012  1.00 85.06  ? 145  MET A CB    1 
ATOM   1118  C  CG    . MET A  1  145 ? 44.987  78.873  64.106  1.00 86.96  ? 145  MET A CG    1 
ATOM   1119  S  SD    . MET A  1  145 ? 43.237  79.218  63.965  1.00 88.62  ? 145  MET A SD    1 
ATOM   1120  C  CE    . MET A  1  145 ? 42.698  77.944  62.726  1.00 89.55  ? 145  MET A CE    1 
ATOM   1121  N  N     . THR A  1  146 ? 47.860  79.567  60.913  1.00 83.00  ? 146  THR A N     1 
ATOM   1122  C  CA    . THR A  1  146 ? 48.822  80.251  60.071  1.00 82.41  ? 146  THR A CA    1 
ATOM   1123  C  C     . THR A  1  146 ? 48.429  80.105  58.603  1.00 81.98  ? 146  THR A C     1 
ATOM   1124  O  O     . THR A  1  146 ? 48.310  81.103  57.893  1.00 82.77  ? 146  THR A O     1 
ATOM   1125  C  CB    . THR A  1  146 ? 50.235  79.700  60.267  1.00 82.32  ? 146  THR A CB    1 
ATOM   1126  O  OG1   . THR A  1  146 ? 50.407  79.263  61.622  1.00 82.97  ? 146  THR A OG1   1 
ATOM   1127  C  CG2   . THR A  1  146 ? 51.247  80.788  59.970  1.00 81.56  ? 146  THR A CG2   1 
ATOM   1128  N  N     . ASN A  1  147 ? 48.212  78.871  58.148  1.00 80.91  ? 147  ASN A N     1 
ATOM   1129  C  CA    . ASN A  1  147 ? 47.817  78.649  56.754  1.00 79.70  ? 147  ASN A CA    1 
ATOM   1130  C  C     . ASN A  1  147 ? 46.458  79.278  56.481  1.00 77.36  ? 147  ASN A C     1 
ATOM   1131  O  O     . ASN A  1  147 ? 46.339  80.197  55.667  1.00 76.86  ? 147  ASN A O     1 
ATOM   1132  C  CB    . ASN A  1  147 ? 47.755  77.150  56.412  1.00 81.60  ? 147  ASN A CB    1 
ATOM   1133  C  CG    . ASN A  1  147 ? 49.134  76.543  56.155  1.00 83.26  ? 147  ASN A CG    1 
ATOM   1134  O  OD1   . ASN A  1  147 ? 50.006  77.171  55.533  1.00 82.05  ? 147  ASN A OD1   1 
ATOM   1135  N  ND2   . ASN A  1  147 ? 49.329  75.307  56.619  1.00 84.50  ? 147  ASN A ND2   1 
ATOM   1136  N  N     . VAL A  1  148 ? 45.437  78.772  57.163  1.00 74.29  ? 148  VAL A N     1 
ATOM   1137  C  CA    . VAL A  1  148 ? 44.096  79.289  57.002  1.00 70.98  ? 148  VAL A CA    1 
ATOM   1138  C  C     . VAL A  1  148 ? 44.159  80.794  56.846  1.00 69.07  ? 148  VAL A C     1 
ATOM   1139  O  O     . VAL A  1  148 ? 43.381  81.374  56.095  1.00 70.59  ? 148  VAL A O     1 
ATOM   1140  C  CB    . VAL A  1  148 ? 43.229  78.924  58.202  1.00 70.84  ? 148  VAL A CB    1 
ATOM   1141  C  CG1   . VAL A  1  148 ? 42.026  79.828  58.281  1.00 71.67  ? 148  VAL A CG1   1 
ATOM   1142  C  CG2   . VAL A  1  148 ? 42.779  77.489  58.066  1.00 70.87  ? 148  VAL A CG2   1 
ATOM   1143  N  N     . THR A  1  149 ? 45.099  81.429  57.537  1.00 65.39  ? 149  THR A N     1 
ATOM   1144  C  CA    . THR A  1  149 ? 45.238  82.871  57.428  1.00 62.24  ? 149  THR A CA    1 
ATOM   1145  C  C     . THR A  1  149 ? 45.732  83.320  56.059  1.00 61.78  ? 149  THR A C     1 
ATOM   1146  O  O     . THR A  1  149 ? 45.096  84.146  55.414  1.00 62.56  ? 149  THR A O     1 
ATOM   1147  C  CB    . THR A  1  149 ? 46.179  83.423  58.482  1.00 60.81  ? 149  THR A CB    1 
ATOM   1148  O  OG1   . THR A  1  149 ? 45.508  83.449  59.745  1.00 59.36  ? 149  THR A OG1   1 
ATOM   1149  C  CG2   . THR A  1  149 ? 46.630  84.824  58.102  1.00 59.15  ? 149  THR A CG2   1 
ATOM   1150  N  N     . PHE A  1  150 ? 46.860  82.789  55.607  1.00 60.73  ? 150  PHE A N     1 
ATOM   1151  C  CA    . PHE A  1  150 ? 47.381  83.181  54.302  1.00 60.25  ? 150  PHE A CA    1 
ATOM   1152  C  C     . PHE A  1  150 ? 46.460  82.913  53.118  1.00 58.92  ? 150  PHE A C     1 
ATOM   1153  O  O     . PHE A  1  150 ? 46.372  83.737  52.199  1.00 58.76  ? 150  PHE A O     1 
ATOM   1154  C  CB    . PHE A  1  150 ? 48.714  82.514  54.036  1.00 61.14  ? 150  PHE A CB    1 
ATOM   1155  C  CG    . PHE A  1  150 ? 49.829  83.096  54.811  1.00 62.52  ? 150  PHE A CG    1 
ATOM   1156  C  CD1   . PHE A  1  150 ? 49.957  82.826  56.164  1.00 63.44  ? 150  PHE A CD1   1 
ATOM   1157  C  CD2   . PHE A  1  150 ? 50.768  83.909  54.186  1.00 64.78  ? 150  PHE A CD2   1 
ATOM   1158  C  CE1   . PHE A  1  150 ? 51.018  83.352  56.898  1.00 65.54  ? 150  PHE A CE1   1 
ATOM   1159  C  CE2   . PHE A  1  150 ? 51.843  84.451  54.903  1.00 66.85  ? 150  PHE A CE2   1 
ATOM   1160  C  CZ    . PHE A  1  150 ? 51.971  84.170  56.265  1.00 67.01  ? 150  PHE A CZ    1 
ATOM   1161  N  N     . ASP A  1  151 ? 45.797  81.761  53.111  1.00 57.14  ? 151  ASP A N     1 
ATOM   1162  C  CA    . ASP A  1  151 ? 44.889  81.468  52.009  1.00 55.79  ? 151  ASP A CA    1 
ATOM   1163  C  C     . ASP A  1  151 ? 43.802  82.548  52.011  1.00 53.24  ? 151  ASP A C     1 
ATOM   1164  O  O     . ASP A  1  151 ? 43.506  83.130  50.958  1.00 53.33  ? 151  ASP A O     1 
ATOM   1165  C  CB    . ASP A  1  151 ? 44.273  80.064  52.147  1.00 57.56  ? 151  ASP A CB    1 
ATOM   1166  C  CG    . ASP A  1  151 ? 45.313  78.944  52.027  1.00 59.15  ? 151  ASP A CG    1 
ATOM   1167  O  OD1   . ASP A  1  151 ? 46.291  79.068  51.243  1.00 58.81  ? 151  ASP A OD1   1 
ATOM   1168  O  OD2   . ASP A  1  151 ? 45.137  77.919  52.714  1.00 60.24  ? 151  ASP A OD2   1 
ATOM   1169  N  N     . TYR A  1  152 ? 43.230  82.813  53.194  1.00 48.95  ? 152  TYR A N     1 
ATOM   1170  C  CA    . TYR A  1  152 ? 42.209  83.838  53.368  1.00 44.31  ? 152  TYR A CA    1 
ATOM   1171  C  C     . TYR A  1  152 ? 42.785  85.161  52.915  1.00 45.55  ? 152  TYR A C     1 
ATOM   1172  O  O     . TYR A  1  152 ? 42.133  85.884  52.158  1.00 47.14  ? 152  TYR A O     1 
ATOM   1173  C  CB    . TYR A  1  152 ? 41.828  83.986  54.818  1.00 38.43  ? 152  TYR A CB    1 
ATOM   1174  C  CG    . TYR A  1  152 ? 40.765  83.068  55.282  1.00 35.54  ? 152  TYR A CG    1 
ATOM   1175  C  CD1   . TYR A  1  152 ? 40.532  82.913  56.640  1.00 36.70  ? 152  TYR A CD1   1 
ATOM   1176  C  CD2   . TYR A  1  152 ? 39.952  82.385  54.391  1.00 35.58  ? 152  TYR A CD2   1 
ATOM   1177  C  CE1   . TYR A  1  152 ? 39.507  82.100  57.122  1.00 36.61  ? 152  TYR A CE1   1 
ATOM   1178  C  CE2   . TYR A  1  152 ? 38.905  81.553  54.857  1.00 36.33  ? 152  TYR A CE2   1 
ATOM   1179  C  CZ    . TYR A  1  152 ? 38.695  81.426  56.232  1.00 36.59  ? 152  TYR A CZ    1 
ATOM   1180  O  OH    . TYR A  1  152 ? 37.673  80.665  56.742  1.00 35.60  ? 152  TYR A OH    1 
ATOM   1181  N  N     . LEU A  1  153 ? 43.994  85.486  53.390  1.00 44.90  ? 153  LEU A N     1 
ATOM   1182  C  CA    . LEU A  1  153 ? 44.662  86.731  53.015  1.00 43.67  ? 153  LEU A CA    1 
ATOM   1183  C  C     . LEU A  1  153 ? 44.658  86.803  51.508  1.00 45.43  ? 153  LEU A C     1 
ATOM   1184  O  O     . LEU A  1  153 ? 44.230  87.790  50.928  1.00 46.08  ? 153  LEU A O     1 
ATOM   1185  C  CB    . LEU A  1  153 ? 46.103  86.761  53.486  1.00 40.65  ? 153  LEU A CB    1 
ATOM   1186  C  CG    . LEU A  1  153 ? 46.834  87.839  52.695  1.00 38.99  ? 153  LEU A CG    1 
ATOM   1187  C  CD1   . LEU A  1  153 ? 46.332  89.171  53.147  1.00 39.87  ? 153  LEU A CD1   1 
ATOM   1188  C  CD2   . LEU A  1  153 ? 48.311  87.752  52.888  1.00 39.53  ? 153  LEU A CD2   1 
ATOM   1189  N  N     . HIS A  1  154 ? 45.147  85.742  50.882  1.00 47.28  ? 154  HIS A N     1 
ATOM   1190  C  CA    . HIS A  1  154 ? 45.185  85.657  49.434  1.00 49.19  ? 154  HIS A CA    1 
ATOM   1191  C  C     . HIS A  1  154 ? 43.795  85.804  48.869  1.00 48.94  ? 154  HIS A C     1 
ATOM   1192  O  O     . HIS A  1  154 ? 43.541  86.606  47.977  1.00 47.72  ? 154  HIS A O     1 
ATOM   1193  C  CB    . HIS A  1  154 ? 45.759  84.315  49.029  1.00 52.31  ? 154  HIS A CB    1 
ATOM   1194  C  CG    . HIS A  1  154 ? 47.238  84.341  48.827  1.00 56.11  ? 154  HIS A CG    1 
ATOM   1195  N  ND1   . HIS A  1  154 ? 48.092  83.443  49.430  1.00 57.10  ? 154  HIS A ND1   1 
ATOM   1196  C  CD2   . HIS A  1  154 ? 48.011  85.142  48.059  1.00 57.63  ? 154  HIS A CD2   1 
ATOM   1197  C  CE1   . HIS A  1  154 ? 49.330  83.690  49.040  1.00 58.86  ? 154  HIS A CE1   1 
ATOM   1198  N  NE2   . HIS A  1  154 ? 49.308  84.715  48.207  1.00 59.86  ? 154  HIS A NE2   1 
ATOM   1199  N  N     . ALA A  1  155 ? 42.891  85.017  49.423  1.00 50.74  ? 155  ALA A N     1 
ATOM   1200  C  CA    . ALA A  1  155 ? 41.496  85.010  49.014  1.00 53.44  ? 155  ALA A CA    1 
ATOM   1201  C  C     . ALA A  1  155 ? 40.790  86.376  49.019  1.00 53.81  ? 155  ALA A C     1 
ATOM   1202  O  O     . ALA A  1  155 ? 39.697  86.506  48.469  1.00 53.58  ? 155  ALA A O     1 
ATOM   1203  C  CB    . ALA A  1  155 ? 40.718  84.015  49.876  1.00 54.26  ? 155  ALA A CB    1 
ATOM   1204  N  N     . THR A  1  156 ? 41.392  87.383  49.638  1.00 53.65  ? 156  THR A N     1 
ATOM   1205  C  CA    . THR A  1  156 ? 40.775  88.696  49.638  1.00 55.03  ? 156  THR A CA    1 
ATOM   1206  C  C     . THR A  1  156 ? 41.736  89.665  48.988  1.00 55.89  ? 156  THR A C     1 
ATOM   1207  O  O     . THR A  1  156 ? 41.321  90.591  48.307  1.00 56.63  ? 156  THR A O     1 
ATOM   1208  C  CB    . THR A  1  156 ? 40.455  89.210  51.061  1.00 55.87  ? 156  THR A CB    1 
ATOM   1209  O  OG1   . THR A  1  156 ? 39.374  90.154  50.999  1.00 57.11  ? 156  THR A OG1   1 
ATOM   1210  C  CG2   . THR A  1  156 ? 41.664  89.930  51.664  1.00 56.99  ? 156  THR A CG2   1 
ATOM   1211  N  N     . ALA A  1  157 ? 43.027  89.450  49.204  1.00 56.95  ? 157  ALA A N     1 
ATOM   1212  C  CA    . ALA A  1  157 ? 44.043  90.330  48.640  1.00 57.36  ? 157  ALA A CA    1 
ATOM   1213  C  C     . ALA A  1  157 ? 43.975  90.296  47.131  1.00 57.66  ? 157  ALA A C     1 
ATOM   1214  O  O     . ALA A  1  157 ? 44.224  91.301  46.470  1.00 57.54  ? 157  ALA A O     1 
ATOM   1215  C  CB    . ALA A  1  157 ? 45.419  89.899  49.093  1.00 57.90  ? 157  ALA A CB    1 
ATOM   1216  N  N     . PHE A  1  158 ? 43.632  89.135  46.590  1.00 57.55  ? 158  PHE A N     1 
ATOM   1217  C  CA    . PHE A  1  158 ? 43.556  88.986  45.154  1.00 57.43  ? 158  PHE A CA    1 
ATOM   1218  C  C     . PHE A  1  158 ? 42.162  88.668  44.678  1.00 59.06  ? 158  PHE A C     1 
ATOM   1219  O  O     . PHE A  1  158 ? 41.955  88.512  43.484  1.00 60.46  ? 158  PHE A O     1 
ATOM   1220  C  CB    . PHE A  1  158 ? 44.525  87.903  44.692  1.00 54.80  ? 158  PHE A CB    1 
ATOM   1221  C  CG    . PHE A  1  158 ? 45.962  88.311  44.789  1.00 52.97  ? 158  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A  1  158 ? 46.852  87.609  45.589  1.00 52.71  ? 158  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A  1  158 ? 46.430  89.401  44.067  1.00 51.58  ? 158  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A  1  158 ? 48.190  87.993  45.662  1.00 52.24  ? 158  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A  1  158 ? 47.766  89.791  44.131  1.00 50.31  ? 158  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A  1  158 ? 48.646  89.088  44.927  1.00 51.02  ? 158  PHE A CZ    1 
ATOM   1227  N  N     . GLN A  1  159 ? 41.212  88.583  45.609  1.00 60.40  ? 159  GLN A N     1 
ATOM   1228  C  CA    . GLN A  1  159 ? 39.795  88.277  45.310  1.00 61.35  ? 159  GLN A CA    1 
ATOM   1229  C  C     . GLN A  1  159 ? 39.346  88.363  43.851  1.00 60.67  ? 159  GLN A C     1 
ATOM   1230  O  O     . GLN A  1  159 ? 39.735  89.272  43.125  1.00 60.31  ? 159  GLN A O     1 
ATOM   1231  C  CB    . GLN A  1  159 ? 38.862  89.176  46.144  1.00 62.95  ? 159  GLN A CB    1 
ATOM   1232  C  CG    . GLN A  1  159 ? 38.899  90.684  45.815  1.00 61.94  ? 159  GLN A CG    1 
ATOM   1233  C  CD    . GLN A  1  159 ? 37.895  91.482  46.637  1.00 60.85  ? 159  GLN A CD    1 
ATOM   1234  O  OE1   . GLN A  1  159 ? 36.687  91.452  46.378  1.00 60.40  ? 159  GLN A OE1   1 
ATOM   1235  N  NE2   . GLN A  1  159 ? 38.393  92.185  47.644  1.00 59.75  ? 159  GLN A NE2   1 
ATOM   1236  N  N     . GLY A  1  160 ? 38.507  87.426  43.430  1.00 60.01  ? 160  GLY A N     1 
ATOM   1237  C  CA    . GLY A  1  160 ? 38.043  87.464  42.058  1.00 62.23  ? 160  GLY A CA    1 
ATOM   1238  C  C     . GLY A  1  160 ? 38.958  86.838  41.019  1.00 63.57  ? 160  GLY A C     1 
ATOM   1239  O  O     . GLY A  1  160 ? 38.470  86.236  40.060  1.00 62.91  ? 160  GLY A O     1 
ATOM   1240  N  N     . THR A  1  161 ? 40.272  86.989  41.172  1.00 65.73  ? 161  THR A N     1 
ATOM   1241  C  CA    . THR A  1  161 ? 41.201  86.384  40.216  1.00 69.45  ? 161  THR A CA    1 
ATOM   1242  C  C     . THR A  1  161 ? 41.597  84.976  40.658  1.00 71.93  ? 161  THR A C     1 
ATOM   1243  O  O     . THR A  1  161 ? 41.087  84.458  41.657  1.00 72.52  ? 161  THR A O     1 
ATOM   1244  C  CB    . THR A  1  161 ? 42.506  87.182  40.039  1.00 69.41  ? 161  THR A CB    1 
ATOM   1245  O  OG1   . THR A  1  161 ? 43.217  87.223  41.281  1.00 69.36  ? 161  THR A OG1   1 
ATOM   1246  C  CG2   . THR A  1  161 ? 42.216  88.578  39.540  1.00 70.19  ? 161  THR A CG2   1 
ATOM   1247  N  N     . ALA A  1  162 ? 42.522  84.369  39.913  1.00 74.06  ? 162  ALA A N     1 
ATOM   1248  C  CA    . ALA A  1  162 ? 42.973  83.004  40.191  1.00 74.83  ? 162  ALA A CA    1 
ATOM   1249  C  C     . ALA A  1  162 ? 43.856  82.874  41.443  1.00 74.88  ? 162  ALA A C     1 
ATOM   1250  O  O     . ALA A  1  162 ? 43.637  81.987  42.279  1.00 74.23  ? 162  ALA A O     1 
ATOM   1251  C  CB    . ALA A  1  162 ? 43.700  82.441  38.951  1.00 75.55  ? 162  ALA A CB    1 
ATOM   1252  N  N     . LEU A  1  163 ? 44.847  83.751  41.573  1.00 74.35  ? 163  LEU A N     1 
ATOM   1253  C  CA    . LEU A  1  163 ? 45.731  83.702  42.724  1.00 74.14  ? 163  LEU A CA    1 
ATOM   1254  C  C     . LEU A  1  163 ? 44.961  83.473  44.007  1.00 75.58  ? 163  LEU A C     1 
ATOM   1255  O  O     . LEU A  1  163 ? 45.418  82.753  44.880  1.00 76.57  ? 163  LEU A O     1 
ATOM   1256  C  CB    . LEU A  1  163 ? 46.533  84.990  42.837  1.00 71.00  ? 163  LEU A CB    1 
ATOM   1257  C  CG    . LEU A  1  163 ? 47.946  84.851  42.282  1.00 68.22  ? 163  LEU A CG    1 
ATOM   1258  C  CD1   . LEU A  1  163 ? 48.562  86.208  42.098  1.00 68.09  ? 163  LEU A CD1   1 
ATOM   1259  C  CD2   . LEU A  1  163 ? 48.778  84.021  43.226  1.00 67.13  ? 163  LEU A CD2   1 
ATOM   1260  N  N     . ALA A  1  164 ? 43.780  84.067  44.109  1.00 77.17  ? 164  ALA A N     1 
ATOM   1261  C  CA    . ALA A  1  164 ? 42.954  83.933  45.307  1.00 78.48  ? 164  ALA A CA    1 
ATOM   1262  C  C     . ALA A  1  164 ? 42.420  82.521  45.590  1.00 79.01  ? 164  ALA A C     1 
ATOM   1263  O  O     . ALA A  1  164 ? 41.481  82.363  46.388  1.00 79.26  ? 164  ALA A O     1 
ATOM   1264  C  CB    . ALA A  1  164 ? 41.794  84.916  45.235  1.00 79.72  ? 164  ALA A CB    1 
ATOM   1265  N  N     . ARG A  1  165 ? 43.010  81.505  44.952  1.00 78.89  ? 165  ARG A N     1 
ATOM   1266  C  CA    . ARG A  1  165 ? 42.576  80.118  45.158  1.00 78.47  ? 165  ARG A CA    1 
ATOM   1267  C  C     . ARG A  1  165 ? 43.496  79.276  46.048  1.00 76.76  ? 165  ARG A C     1 
ATOM   1268  O  O     . ARG A  1  165 ? 44.716  79.456  46.076  1.00 75.56  ? 165  ARG A O     1 
ATOM   1269  C  CB    . ARG A  1  165 ? 42.384  79.397  43.812  1.00 80.21  ? 165  ARG A CB    1 
ATOM   1270  C  CG    . ARG A  1  165 ? 41.223  79.927  42.966  1.00 83.11  ? 165  ARG A CG    1 
ATOM   1271  C  CD    . ARG A  1  165 ? 40.350  78.782  42.453  1.00 86.04  ? 165  ARG A CD    1 
ATOM   1272  N  NE    . ARG A  1  165 ? 39.171  79.218  41.697  1.00 87.52  ? 165  ARG A NE    1 
ATOM   1273  C  CZ    . ARG A  1  165 ? 39.218  79.872  40.540  1.00 88.56  ? 165  ARG A CZ    1 
ATOM   1274  N  NH1   . ARG A  1  165 ? 40.392  80.185  39.986  1.00 88.09  ? 165  ARG A NH1   1 
ATOM   1275  N  NH2   . ARG A  1  165 ? 38.083  80.201  39.934  1.00 89.02  ? 165  ARG A NH2   1 
ATOM   1276  N  N     . THR A  1  166 ? 42.888  78.359  46.790  1.00 75.53  ? 166  THR A N     1 
ATOM   1277  C  CA    . THR A  1  166 ? 43.631  77.463  47.665  1.00 74.89  ? 166  THR A CA    1 
ATOM   1278  C  C     . THR A  1  166 ? 44.295  76.396  46.796  1.00 74.06  ? 166  THR A C     1 
ATOM   1279  O  O     . THR A  1  166 ? 43.638  75.774  45.956  1.00 75.62  ? 166  THR A O     1 
ATOM   1280  C  CB    . THR A  1  166 ? 42.693  76.774  48.679  1.00 74.81  ? 166  THR A CB    1 
ATOM   1281  O  OG1   . THR A  1  166 ? 41.440  76.476  48.048  1.00 74.98  ? 166  THR A OG1   1 
ATOM   1282  C  CG2   . THR A  1  166 ? 42.459  77.672  49.881  1.00 75.44  ? 166  THR A CG2   1 
ATOM   1283  N  N     . VAL A  1  167 ? 45.592  76.181  46.987  1.00 71.48  ? 167  VAL A N     1 
ATOM   1284  C  CA    . VAL A  1  167 ? 46.300  75.197  46.187  1.00 67.64  ? 167  VAL A CA    1 
ATOM   1285  C  C     . VAL A  1  167 ? 45.629  73.850  46.270  1.00 66.60  ? 167  VAL A C     1 
ATOM   1286  O  O     . VAL A  1  167 ? 45.741  73.046  45.358  1.00 67.15  ? 167  VAL A O     1 
ATOM   1287  C  CB    . VAL A  1  167 ? 47.735  75.030  46.636  1.00 65.93  ? 167  VAL A CB    1 
ATOM   1288  C  CG1   . VAL A  1  167 ? 48.415  74.068  45.725  1.00 65.36  ? 167  VAL A CG1   1 
ATOM   1289  C  CG2   . VAL A  1  167 ? 48.451  76.363  46.608  1.00 66.21  ? 167  VAL A CG2   1 
ATOM   1290  N  N     . GLU A  1  168 ? 44.914  73.609  47.360  1.00 66.00  ? 168  GLU A N     1 
ATOM   1291  C  CA    . GLU A  1  168 ? 44.224  72.333  47.548  1.00 66.01  ? 168  GLU A CA    1 
ATOM   1292  C  C     . GLU A  1  168 ? 42.843  72.279  46.890  1.00 64.21  ? 168  GLU A C     1 
ATOM   1293  O  O     . GLU A  1  168 ? 42.267  71.205  46.703  1.00 61.59  ? 168  GLU A O     1 
ATOM   1294  C  CB    . GLU A  1  168 ? 44.103  72.014  49.041  1.00 69.15  ? 168  GLU A CB    1 
ATOM   1295  C  CG    . GLU A  1  168 ? 45.442  71.842  49.767  1.00 71.83  ? 168  GLU A CG    1 
ATOM   1296  C  CD    . GLU A  1  168 ? 46.136  73.163  50.063  1.00 73.66  ? 168  GLU A CD    1 
ATOM   1297  O  OE1   . GLU A  1  168 ? 45.578  73.946  50.870  1.00 75.48  ? 168  GLU A OE1   1 
ATOM   1298  O  OE2   . GLU A  1  168 ? 47.228  73.415  49.496  1.00 73.54  ? 168  GLU A OE2   1 
ATOM   1299  N  N     . GLY A  1  169 ? 42.314  73.452  46.566  1.00 63.73  ? 169  GLY A N     1 
ATOM   1300  C  CA    . GLY A  1  169 ? 41.031  73.541  45.900  1.00 64.84  ? 169  GLY A CA    1 
ATOM   1301  C  C     . GLY A  1  169 ? 39.789  73.227  46.699  1.00 65.79  ? 169  GLY A C     1 
ATOM   1302  O  O     . GLY A  1  169 ? 39.856  72.711  47.803  1.00 66.34  ? 169  GLY A O     1 
ATOM   1303  N  N     . THR A  1  170 ? 38.647  73.535  46.095  1.00 67.05  ? 170  THR A N     1 
ATOM   1304  C  CA    . THR A  1  170 ? 37.319  73.337  46.669  1.00 68.44  ? 170  THR A CA    1 
ATOM   1305  C  C     . THR A  1  170 ? 37.064  71.948  47.219  1.00 68.46  ? 170  THR A C     1 
ATOM   1306  O  O     . THR A  1  170 ? 37.792  71.013  46.926  1.00 67.63  ? 170  THR A O     1 
ATOM   1307  C  CB    . THR A  1  170 ? 36.235  73.599  45.601  1.00 69.95  ? 170  THR A CB    1 
ATOM   1308  O  OG1   . THR A  1  170 ? 36.636  74.700  44.767  1.00 70.54  ? 170  THR A OG1   1 
ATOM   1309  C  CG2   . THR A  1  170 ? 34.881  73.919  46.264  1.00 71.18  ? 170  THR A CG2   1 
ATOM   1310  N  N     . THR A  1  171 ? 36.008  71.822  48.012  1.00 70.25  ? 171  THR A N     1 
ATOM   1311  C  CA    . THR A  1  171 ? 35.631  70.532  48.573  1.00 72.71  ? 171  THR A CA    1 
ATOM   1312  C  C     . THR A  1  171 ? 34.892  69.736  47.511  1.00 73.86  ? 171  THR A C     1 
ATOM   1313  O  O     . THR A  1  171 ? 35.035  68.518  47.421  1.00 73.62  ? 171  THR A O     1 
ATOM   1314  C  CB    . THR A  1  171 ? 34.712  70.685  49.804  1.00 73.01  ? 171  THR A CB    1 
ATOM   1315  O  OG1   . THR A  1  171 ? 35.521  70.769  50.986  1.00 73.60  ? 171  THR A OG1   1 
ATOM   1316  C  CG2   . THR A  1  171 ? 33.742  69.500  49.918  1.00 72.21  ? 171  THR A CG2   1 
ATOM   1317  N  N     . GLU A  1  172 ? 34.104  70.436  46.704  1.00 75.58  ? 172  GLU A N     1 
ATOM   1318  C  CA    . GLU A  1  172 ? 33.343  69.791  45.639  1.00 77.65  ? 172  GLU A CA    1 
ATOM   1319  C  C     . GLU A  1  172 ? 34.231  69.238  44.527  1.00 78.02  ? 172  GLU A C     1 
ATOM   1320  O  O     . GLU A  1  172 ? 34.065  68.094  44.103  1.00 77.82  ? 172  GLU A O     1 
ATOM   1321  C  CB    . GLU A  1  172 ? 32.317  70.766  45.049  1.00 78.29  ? 172  GLU A CB    1 
ATOM   1322  C  CG    . GLU A  1  172 ? 31.190  71.106  46.015  1.00 79.05  ? 172  GLU A CG    1 
ATOM   1323  C  CD    . GLU A  1  172 ? 30.362  69.891  46.421  1.00 79.22  ? 172  GLU A CD    1 
ATOM   1324  O  OE1   . GLU A  1  172 ? 29.625  69.351  45.557  1.00 78.69  ? 172  GLU A OE1   1 
ATOM   1325  O  OE2   . GLU A  1  172 ? 30.457  69.483  47.604  1.00 78.58  ? 172  GLU A OE2   1 
ATOM   1326  N  N     . ASN A  1  173 ? 35.167  70.056  44.055  1.00 78.40  ? 173  ASN A N     1 
ATOM   1327  C  CA    . ASN A  1  173 ? 36.084  69.641  43.000  1.00 78.30  ? 173  ASN A CA    1 
ATOM   1328  C  C     . ASN A  1  173 ? 36.861  68.378  43.395  1.00 78.20  ? 173  ASN A C     1 
ATOM   1329  O  O     . ASN A  1  173 ? 37.043  67.461  42.583  1.00 77.32  ? 173  ASN A O     1 
ATOM   1330  C  CB    . ASN A  1  173 ? 37.040  70.792  42.675  1.00 77.93  ? 173  ASN A CB    1 
ATOM   1331  C  CG    . ASN A  1  173 ? 36.374  71.876  41.863  1.00 77.68  ? 173  ASN A CG    1 
ATOM   1332  O  OD1   . ASN A  1  173 ? 35.230  72.248  42.120  1.00 78.48  ? 173  ASN A OD1   1 
ATOM   1333  N  ND2   . ASN A  1  173 ? 37.086  72.393  40.878  1.00 78.19  ? 173  ASN A ND2   1 
ATOM   1334  N  N     . ILE A  1  174 ? 37.317  68.330  44.641  1.00 77.86  ? 174  ILE A N     1 
ATOM   1335  C  CA    . ILE A  1  174 ? 38.040  67.171  45.104  1.00 77.12  ? 174  ILE A CA    1 
ATOM   1336  C  C     . ILE A  1  174 ? 37.035  66.049  45.199  1.00 77.61  ? 174  ILE A C     1 
ATOM   1337  O  O     . ILE A  1  174 ? 37.384  64.890  45.037  1.00 77.90  ? 174  ILE A O     1 
ATOM   1338  C  CB    . ILE A  1  174 ? 38.710  67.441  46.453  1.00 76.52  ? 174  ILE A CB    1 
ATOM   1339  C  CG1   . ILE A  1  174 ? 40.023  68.185  46.209  1.00 76.70  ? 174  ILE A CG1   1 
ATOM   1340  C  CG2   . ILE A  1  174 ? 38.970  66.154  47.180  1.00 76.80  ? 174  ILE A CG2   1 
ATOM   1341  C  CD1   . ILE A  1  174 ? 40.815  68.474  47.451  1.00 77.84  ? 174  ILE A CD1   1 
ATOM   1342  N  N     . LYS A  1  175 ? 35.773  66.399  45.427  1.00 78.79  ? 175  LYS A N     1 
ATOM   1343  C  CA    . LYS A  1  175 ? 34.713  65.395  45.519  1.00 80.77  ? 175  LYS A CA    1 
ATOM   1344  C  C     . LYS A  1  175 ? 34.260  64.883  44.156  1.00 81.74  ? 175  LYS A C     1 
ATOM   1345  O  O     . LYS A  1  175 ? 33.762  63.762  44.040  1.00 81.62  ? 175  LYS A O     1 
ATOM   1346  C  CB    . LYS A  1  175 ? 33.479  65.952  46.251  1.00 80.96  ? 175  LYS A CB    1 
ATOM   1347  C  CG    . LYS A  1  175 ? 33.575  65.973  47.777  1.00 82.03  ? 175  LYS A CG    1 
ATOM   1348  C  CD    . LYS A  1  175 ? 32.225  66.295  48.442  1.00 80.97  ? 175  LYS A CD    1 
ATOM   1349  C  CE    . LYS A  1  175 ? 31.167  65.223  48.162  1.00 79.21  ? 175  LYS A CE    1 
ATOM   1350  N  NZ    . LYS A  1  175 ? 29.867  65.506  48.836  1.00 78.15  ? 175  LYS A NZ    1 
ATOM   1351  N  N     . HIS A  1  176 ? 34.441  65.694  43.122  1.00 83.07  ? 176  HIS A N     1 
ATOM   1352  C  CA    . HIS A  1  176 ? 33.989  65.304  41.800  1.00 83.91  ? 176  HIS A CA    1 
ATOM   1353  C  C     . HIS A  1  176 ? 35.058  65.170  40.724  1.00 83.84  ? 176  HIS A C     1 
ATOM   1354  O  O     . HIS A  1  176 ? 34.829  64.465  39.749  1.00 84.15  ? 176  HIS A O     1 
ATOM   1355  C  CB    . HIS A  1  176 ? 32.910  66.286  41.313  1.00 85.92  ? 176  HIS A CB    1 
ATOM   1356  C  CG    . HIS A  1  176 ? 31.677  66.326  42.170  1.00 87.88  ? 176  HIS A CG    1 
ATOM   1357  N  ND1   . HIS A  1  176 ? 30.820  65.252  42.299  1.00 88.91  ? 176  HIS A ND1   1 
ATOM   1358  C  CD2   . HIS A  1  176 ? 31.149  67.319  42.927  1.00 88.41  ? 176  HIS A CD2   1 
ATOM   1359  C  CE1   . HIS A  1  176 ? 29.819  65.581  43.098  1.00 88.83  ? 176  HIS A CE1   1 
ATOM   1360  N  NE2   . HIS A  1  176 ? 29.995  66.830  43.493  1.00 88.88  ? 176  HIS A NE2   1 
ATOM   1361  N  N     . LEU A  1  177 ? 36.206  65.833  40.876  1.00 83.52  ? 177  LEU A N     1 
ATOM   1362  C  CA    . LEU A  1  177 ? 37.249  65.750  39.853  1.00 84.56  ? 177  LEU A CA    1 
ATOM   1363  C  C     . LEU A  1  177 ? 37.265  64.365  39.207  1.00 87.08  ? 177  LEU A C     1 
ATOM   1364  O  O     . LEU A  1  177 ? 37.193  63.356  39.908  1.00 87.94  ? 177  LEU A O     1 
ATOM   1365  C  CB    . LEU A  1  177 ? 38.621  66.076  40.448  1.00 82.49  ? 177  LEU A CB    1 
ATOM   1366  C  CG    . LEU A  1  177 ? 39.086  67.528  40.265  1.00 81.91  ? 177  LEU A CG    1 
ATOM   1367  C  CD1   . LEU A  1  177 ? 40.491  67.748  40.829  1.00 81.55  ? 177  LEU A CD1   1 
ATOM   1368  C  CD2   . LEU A  1  177 ? 39.083  67.854  38.792  1.00 80.87  ? 177  LEU A CD2   1 
ATOM   1369  N  N     . THR A  1  178 ? 37.341  64.323  37.873  1.00 89.19  ? 178  THR A N     1 
ATOM   1370  C  CA    . THR A  1  178 ? 37.331  63.062  37.115  1.00 90.98  ? 178  THR A CA    1 
ATOM   1371  C  C     . THR A  1  178 ? 38.691  62.628  36.546  1.00 91.75  ? 178  THR A C     1 
ATOM   1372  O  O     . THR A  1  178 ? 39.547  63.465  36.234  1.00 91.20  ? 178  THR A O     1 
ATOM   1373  C  CB    . THR A  1  178 ? 36.324  63.143  35.942  1.00 91.65  ? 178  THR A CB    1 
ATOM   1374  O  OG1   . THR A  1  178 ? 35.021  63.451  36.453  1.00 91.55  ? 178  THR A OG1   1 
ATOM   1375  C  CG2   . THR A  1  178 ? 36.277  61.813  35.172  1.00 92.81  ? 178  THR A CG2   1 
ATOM   1376  N  N     . ARG A  1  179 ? 38.869  61.310  36.406  1.00 92.56  ? 179  ARG A N     1 
ATOM   1377  C  CA    . ARG A  1  179 ? 40.106  60.745  35.877  1.00 93.38  ? 179  ARG A CA    1 
ATOM   1378  C  C     . ARG A  1  179 ? 40.589  61.641  34.755  1.00 92.46  ? 179  ARG A C     1 
ATOM   1379  O  O     . ARG A  1  179 ? 41.767  62.009  34.672  1.00 92.00  ? 179  ARG A O     1 
ATOM   1380  C  CB    . ARG A  1  179 ? 39.870  59.334  35.326  1.00 96.08  ? 179  ARG A CB    1 
ATOM   1381  C  CG    . ARG A  1  179 ? 41.162  58.670  34.814  1.00 101.21 ? 179  ARG A CG    1 
ATOM   1382  C  CD    . ARG A  1  179 ? 40.952  57.265  34.221  1.00 104.73 ? 179  ARG A CD    1 
ATOM   1383  N  NE    . ARG A  1  179 ? 42.217  56.595  33.887  1.00 108.63 ? 179  ARG A NE    1 
ATOM   1384  C  CZ    . ARG A  1  179 ? 43.093  57.028  32.978  1.00 110.88 ? 179  ARG A CZ    1 
ATOM   1385  N  NH1   . ARG A  1  179 ? 42.854  58.142  32.295  1.00 112.45 ? 179  ARG A NH1   1 
ATOM   1386  N  NH2   . ARG A  1  179 ? 44.215  56.349  32.749  1.00 111.54 ? 179  ARG A NH2   1 
ATOM   1387  N  N     . ALA A  1  180 ? 39.645  61.996  33.900  1.00 91.44  ? 180  ALA A N     1 
ATOM   1388  C  CA    . ALA A  1  180 ? 39.918  62.841  32.763  1.00 90.50  ? 180  ALA A CA    1 
ATOM   1389  C  C     . ALA A  1  180 ? 40.566  64.158  33.175  1.00 89.84  ? 180  ALA A C     1 
ATOM   1390  O  O     . ALA A  1  180 ? 41.747  64.386  32.912  1.00 89.89  ? 180  ALA A O     1 
ATOM   1391  C  CB    . ALA A  1  180 ? 38.625  63.105  32.012  1.00 90.82  ? 180  ALA A CB    1 
ATOM   1392  N  N     . ASP A  1  181 ? 39.786  65.010  33.837  1.00 88.47  ? 181  ASP A N     1 
ATOM   1393  C  CA    . ASP A  1  181 ? 40.240  66.334  34.258  1.00 86.45  ? 181  ASP A CA    1 
ATOM   1394  C  C     . ASP A  1  181 ? 41.676  66.396  34.757  1.00 85.13  ? 181  ASP A C     1 
ATOM   1395  O  O     . ASP A  1  181 ? 42.366  67.390  34.514  1.00 84.39  ? 181  ASP A O     1 
ATOM   1396  C  CB    . ASP A  1  181 ? 39.284  66.898  35.308  1.00 86.49  ? 181  ASP A CB    1 
ATOM   1397  C  CG    . ASP A  1  181 ? 37.827  66.825  34.864  1.00 86.77  ? 181  ASP A CG    1 
ATOM   1398  O  OD1   . ASP A  1  181 ? 37.272  65.703  34.798  1.00 86.05  ? 181  ASP A OD1   1 
ATOM   1399  O  OD2   . ASP A  1  181 ? 37.237  67.886  34.570  1.00 86.91  ? 181  ASP A OD2   1 
ATOM   1400  N  N     . LEU A  1  182 ? 42.129  65.347  35.446  1.00 83.88  ? 182  LEU A N     1 
ATOM   1401  C  CA    . LEU A  1  182 ? 43.502  65.323  35.948  1.00 82.84  ? 182  LEU A CA    1 
ATOM   1402  C  C     . LEU A  1  182 ? 44.364  64.949  34.776  1.00 82.39  ? 182  LEU A C     1 
ATOM   1403  O  O     . LEU A  1  182 ? 45.441  65.501  34.574  1.00 81.94  ? 182  LEU A O     1 
ATOM   1404  C  CB    . LEU A  1  182 ? 43.700  64.277  37.035  1.00 81.88  ? 182  LEU A CB    1 
ATOM   1405  C  CG    . LEU A  1  182 ? 42.517  63.743  37.830  1.00 81.75  ? 182  LEU A CG    1 
ATOM   1406  C  CD1   . LEU A  1  182 ? 43.080  63.165  39.118  1.00 81.98  ? 182  LEU A CD1   1 
ATOM   1407  C  CD2   . LEU A  1  182 ? 41.504  64.828  38.146  1.00 82.41  ? 182  LEU A CD2   1 
ATOM   1408  N  N     . ALA A  1  183 ? 43.883  63.977  34.017  1.00 82.22  ? 183  ALA A N     1 
ATOM   1409  C  CA    . ALA A  1  183 ? 44.586  63.548  32.833  1.00 83.17  ? 183  ALA A CA    1 
ATOM   1410  C  C     . ALA A  1  183 ? 44.930  64.821  32.070  1.00 84.03  ? 183  ALA A C     1 
ATOM   1411  O  O     . ALA A  1  183 ? 46.105  65.102  31.801  1.00 83.85  ? 183  ALA A O     1 
ATOM   1412  C  CB    . ALA A  1  183 ? 43.686  62.662  31.996  1.00 83.28  ? 183  ALA A CB    1 
ATOM   1413  N  N     . SER A  1  184 ? 43.893  65.596  31.753  1.00 84.84  ? 184  SER A N     1 
ATOM   1414  C  CA    . SER A  1  184 ? 44.046  66.853  31.022  1.00 85.83  ? 184  SER A CA    1 
ATOM   1415  C  C     . SER A  1  184 ? 45.024  67.817  31.695  1.00 85.84  ? 184  SER A C     1 
ATOM   1416  O  O     . SER A  1  184 ? 45.929  68.335  31.034  1.00 85.88  ? 184  SER A O     1 
ATOM   1417  C  CB    . SER A  1  184 ? 42.688  67.551  30.846  1.00 86.29  ? 184  SER A CB    1 
ATOM   1418  O  OG    . SER A  1  184 ? 42.212  68.085  32.071  1.00 87.95  ? 184  SER A OG    1 
ATOM   1419  N  N     . TYR A  1  185 ? 44.847  68.063  32.996  1.00 85.48  ? 185  TYR A N     1 
ATOM   1420  C  CA    . TYR A  1  185 ? 45.740  68.978  33.710  1.00 84.90  ? 185  TYR A CA    1 
ATOM   1421  C  C     . TYR A  1  185 ? 47.188  68.633  33.359  1.00 85.92  ? 185  TYR A C     1 
ATOM   1422  O  O     . TYR A  1  185 ? 47.997  69.518  33.046  1.00 86.19  ? 185  TYR A O     1 
ATOM   1423  C  CB    . TYR A  1  185 ? 45.545  68.881  35.230  1.00 82.26  ? 185  TYR A CB    1 
ATOM   1424  C  CG    . TYR A  1  185 ? 46.531  69.730  36.024  1.00 81.20  ? 185  TYR A CG    1 
ATOM   1425  C  CD1   . TYR A  1  185 ? 46.218  71.020  36.437  1.00 80.27  ? 185  TYR A CD1   1 
ATOM   1426  C  CD2   . TYR A  1  185 ? 47.792  69.241  36.351  1.00 81.64  ? 185  TYR A CD2   1 
ATOM   1427  C  CE1   . TYR A  1  185 ? 47.150  71.802  37.166  1.00 79.37  ? 185  TYR A CE1   1 
ATOM   1428  C  CE2   . TYR A  1  185 ? 48.726  70.018  37.074  1.00 80.23  ? 185  TYR A CE2   1 
ATOM   1429  C  CZ    . TYR A  1  185 ? 48.401  71.289  37.479  1.00 78.57  ? 185  TYR A CZ    1 
ATOM   1430  O  OH    . TYR A  1  185 ? 49.326  72.019  38.204  1.00 75.28  ? 185  TYR A OH    1 
ATOM   1431  N  N     . ILE A  1  186 ? 47.498  67.338  33.390  1.00 86.26  ? 186  ILE A N     1 
ATOM   1432  C  CA    . ILE A  1  186 ? 48.844  66.873  33.104  1.00 85.65  ? 186  ILE A CA    1 
ATOM   1433  C  C     . ILE A  1  186 ? 49.258  67.264  31.705  1.00 84.90  ? 186  ILE A C     1 
ATOM   1434  O  O     . ILE A  1  186 ? 50.305  67.877  31.518  1.00 83.94  ? 186  ILE A O     1 
ATOM   1435  C  CB    . ILE A  1  186 ? 48.951  65.350  33.274  1.00 86.21  ? 186  ILE A CB    1 
ATOM   1436  C  CG1   . ILE A  1  186 ? 48.339  64.933  34.616  1.00 86.73  ? 186  ILE A CG1   1 
ATOM   1437  C  CG2   . ILE A  1  186 ? 50.412  64.935  33.268  1.00 87.08  ? 186  ILE A CG2   1 
ATOM   1438  C  CD1   . ILE A  1  186 ? 48.559  63.473  34.984  1.00 86.86  ? 186  ILE A CD1   1 
ATOM   1439  N  N     . ASP A  1  187 ? 48.429  66.922  30.727  1.00 85.29  ? 187  ASP A N     1 
ATOM   1440  C  CA    . ASP A  1  187 ? 48.720  67.251  29.336  1.00 87.13  ? 187  ASP A CA    1 
ATOM   1441  C  C     . ASP A  1  187 ? 48.791  68.750  29.122  1.00 86.37  ? 187  ASP A C     1 
ATOM   1442  O  O     . ASP A  1  187 ? 49.797  69.280  28.654  1.00 86.90  ? 187  ASP A O     1 
ATOM   1443  C  CB    . ASP A  1  187 ? 47.643  66.690  28.409  1.00 90.53  ? 187  ASP A CB    1 
ATOM   1444  C  CG    . ASP A  1  187 ? 47.738  65.187  28.241  1.00 94.25  ? 187  ASP A CG    1 
ATOM   1445  O  OD1   . ASP A  1  187 ? 48.838  64.705  27.880  1.00 96.09  ? 187  ASP A OD1   1 
ATOM   1446  O  OD2   . ASP A  1  187 ? 46.716  64.491  28.460  1.00 96.61  ? 187  ASP A OD2   1 
ATOM   1447  N  N     . THR A  1  188 ? 47.697  69.422  29.461  1.00 84.80  ? 188  THR A N     1 
ATOM   1448  C  CA    . THR A  1  188 ? 47.570  70.862  29.309  1.00 82.49  ? 188  THR A CA    1 
ATOM   1449  C  C     . THR A  1  188 ? 48.743  71.634  29.930  1.00 81.99  ? 188  THR A C     1 
ATOM   1450  O  O     . THR A  1  188 ? 49.299  72.537  29.306  1.00 80.20  ? 188  THR A O     1 
ATOM   1451  C  CB    . THR A  1  188 ? 46.235  71.349  29.949  1.00 81.86  ? 188  THR A CB    1 
ATOM   1452  O  OG1   . THR A  1  188 ? 45.148  70.526  29.499  1.00 80.36  ? 188  THR A OG1   1 
ATOM   1453  C  CG2   . THR A  1  188 ? 45.945  72.790  29.567  1.00 81.44  ? 188  THR A CG2   1 
ATOM   1454  N  N     . HIS A  1  189 ? 49.137  71.251  31.142  1.00 82.78  ? 189  HIS A N     1 
ATOM   1455  C  CA    . HIS A  1  189 ? 50.202  71.953  31.855  1.00 83.97  ? 189  HIS A CA    1 
ATOM   1456  C  C     . HIS A  1  189 ? 51.593  71.337  31.899  1.00 85.40  ? 189  HIS A C     1 
ATOM   1457  O  O     . HIS A  1  189 ? 52.573  72.027  31.639  1.00 85.36  ? 189  HIS A O     1 
ATOM   1458  C  CB    . HIS A  1  189 ? 49.728  72.248  33.277  1.00 82.88  ? 189  HIS A CB    1 
ATOM   1459  C  CG    . HIS A  1  189 ? 48.466  73.051  33.322  1.00 82.48  ? 189  HIS A CG    1 
ATOM   1460  N  ND1   . HIS A  1  189 ? 48.387  74.339  32.837  1.00 82.05  ? 189  HIS A ND1   1 
ATOM   1461  C  CD2   . HIS A  1  189 ? 47.215  72.726  33.726  1.00 82.30  ? 189  HIS A CD2   1 
ATOM   1462  C  CE1   . HIS A  1  189 ? 47.143  74.772  32.934  1.00 81.81  ? 189  HIS A CE1   1 
ATOM   1463  N  NE2   . HIS A  1  189 ? 46.410  73.813  33.470  1.00 82.19  ? 189  HIS A NE2   1 
ATOM   1464  N  N     . PHE A  1  190 ? 51.692  70.057  32.236  1.00 87.39  ? 190  PHE A N     1 
ATOM   1465  C  CA    . PHE A  1  190 ? 52.994  69.401  32.307  1.00 90.25  ? 190  PHE A CA    1 
ATOM   1466  C  C     . PHE A  1  190 ? 53.693  69.302  30.961  1.00 92.40  ? 190  PHE A C     1 
ATOM   1467  O  O     . PHE A  1  190 ? 53.688  68.233  30.344  1.00 93.67  ? 190  PHE A O     1 
ATOM   1468  C  CB    . PHE A  1  190 ? 52.843  67.998  32.884  1.00 90.62  ? 190  PHE A CB    1 
ATOM   1469  C  CG    . PHE A  1  190 ? 52.536  67.978  34.343  1.00 91.69  ? 190  PHE A CG    1 
ATOM   1470  C  CD1   . PHE A  1  190 ? 52.417  66.774  35.023  1.00 91.66  ? 190  PHE A CD1   1 
ATOM   1471  C  CD2   . PHE A  1  190 ? 52.385  69.164  35.045  1.00 92.50  ? 190  PHE A CD2   1 
ATOM   1472  C  CE1   . PHE A  1  190 ? 52.155  66.752  36.387  1.00 92.50  ? 190  PHE A CE1   1 
ATOM   1473  C  CE2   . PHE A  1  190 ? 52.123  69.154  36.408  1.00 93.00  ? 190  PHE A CE2   1 
ATOM   1474  C  CZ    . PHE A  1  190 ? 52.008  67.945  37.082  1.00 92.68  ? 190  PHE A CZ    1 
ATOM   1475  N  N     . LYS A  1  191 ? 54.309  70.398  30.514  1.00 94.27  ? 191  LYS A N     1 
ATOM   1476  C  CA    . LYS A  1  191 ? 55.000  70.403  29.221  1.00 95.50  ? 191  LYS A CA    1 
ATOM   1477  C  C     . LYS A  1  191 ? 56.442  70.908  29.248  1.00 94.82  ? 191  LYS A C     1 
ATOM   1478  O  O     . LYS A  1  191 ? 56.769  71.904  29.889  1.00 93.74  ? 191  LYS A O     1 
ATOM   1479  C  CB    . LYS A  1  191 ? 54.178  71.183  28.180  1.00 97.93  ? 191  LYS A CB    1 
ATOM   1480  C  CG    . LYS A  1  191 ? 52.883  70.458  27.741  1.00 100.95 ? 191  LYS A CG    1 
ATOM   1481  C  CD    . LYS A  1  191 ? 52.181  71.139  26.549  1.00 103.19 ? 191  LYS A CD    1 
ATOM   1482  C  CE    . LYS A  1  191 ? 50.989  70.313  26.022  1.00 103.75 ? 191  LYS A CE    1 
ATOM   1483  N  NZ    . LYS A  1  191 ? 50.302  70.927  24.831  1.00 103.54 ? 191  LYS A NZ    1 
ATOM   1484  N  N     . ALA A  1  192 ? 57.287  70.185  28.524  1.00 94.86  ? 192  ALA A N     1 
ATOM   1485  C  CA    . ALA A  1  192 ? 58.715  70.447  28.410  1.00 95.40  ? 192  ALA A CA    1 
ATOM   1486  C  C     . ALA A  1  192 ? 59.209  71.895  28.511  1.00 95.97  ? 192  ALA A C     1 
ATOM   1487  O  O     . ALA A  1  192 ? 60.040  72.209  29.366  1.00 96.44  ? 192  ALA A O     1 
ATOM   1488  C  CB    . ALA A  1  192 ? 59.235  69.813  27.117  1.00 95.07  ? 192  ALA A CB    1 
ATOM   1489  N  N     . PRO A  1  193 ? 58.708  72.797  27.645  1.00 96.32  ? 193  PRO A N     1 
ATOM   1490  C  CA    . PRO A  1  193 ? 59.155  74.201  27.682  1.00 95.78  ? 193  PRO A CA    1 
ATOM   1491  C  C     . PRO A  1  193 ? 58.997  74.892  29.037  1.00 94.92  ? 193  PRO A C     1 
ATOM   1492  O  O     . PRO A  1  193 ? 59.761  75.805  29.391  1.00 94.24  ? 193  PRO A O     1 
ATOM   1493  C  CB    . PRO A  1  193 ? 58.325  74.853  26.573  1.00 96.19  ? 193  PRO A CB    1 
ATOM   1494  C  CG    . PRO A  1  193 ? 57.048  74.038  26.586  1.00 96.31  ? 193  PRO A CG    1 
ATOM   1495  C  CD    . PRO A  1  193 ? 57.560  72.629  26.730  1.00 96.33  ? 193  PRO A CD    1 
ATOM   1496  N  N     . ARG A  1  194 ? 58.001  74.432  29.789  1.00 94.09  ? 194  ARG A N     1 
ATOM   1497  C  CA    . ARG A  1  194 ? 57.699  74.969  31.110  1.00 93.19  ? 194  ARG A CA    1 
ATOM   1498  C  C     . ARG A  1  194 ? 58.354  74.134  32.227  1.00 91.69  ? 194  ARG A C     1 
ATOM   1499  O  O     . ARG A  1  194 ? 58.335  74.523  33.402  1.00 92.87  ? 194  ARG A O     1 
ATOM   1500  C  CB    . ARG A  1  194 ? 56.170  75.028  31.313  1.00 93.27  ? 194  ARG A CB    1 
ATOM   1501  C  CG    . ARG A  1  194 ? 55.461  76.123  30.517  1.00 92.34  ? 194  ARG A CG    1 
ATOM   1502  C  CD    . ARG A  1  194 ? 54.005  75.771  30.243  1.00 92.26  ? 194  ARG A CD    1 
ATOM   1503  N  NE    . ARG A  1  194 ? 53.206  75.622  31.453  1.00 91.56  ? 194  ARG A NE    1 
ATOM   1504  C  CZ    . ARG A  1  194 ? 51.917  75.307  31.444  1.00 91.73  ? 194  ARG A CZ    1 
ATOM   1505  N  NH1   . ARG A  1  194 ? 51.291  75.112  30.288  1.00 91.70  ? 194  ARG A NH1   1 
ATOM   1506  N  NH2   . ARG A  1  194 ? 51.255  75.193  32.584  1.00 91.23  ? 194  ARG A NH2   1 
ATOM   1507  N  N     . MET A  1  195 ? 58.938  72.995  31.869  1.00 87.99  ? 195  MET A N     1 
ATOM   1508  C  CA    . MET A  1  195 ? 59.573  72.155  32.870  1.00 83.72  ? 195  MET A CA    1 
ATOM   1509  C  C     . MET A  1  195 ? 61.072  72.434  32.914  1.00 81.75  ? 195  MET A C     1 
ATOM   1510  O  O     . MET A  1  195 ? 61.647  72.927  31.946  1.00 80.92  ? 195  MET A O     1 
ATOM   1511  C  CB    . MET A  1  195 ? 59.267  70.686  32.564  1.00 82.51  ? 195  MET A CB    1 
ATOM   1512  C  CG    . MET A  1  195 ? 57.769  70.452  32.293  1.00 81.60  ? 195  MET A CG    1 
ATOM   1513  S  SD    . MET A  1  195 ? 57.107  68.823  32.736  1.00 81.12  ? 195  MET A SD    1 
ATOM   1514  C  CE    . MET A  1  195 ? 56.793  68.116  31.163  1.00 81.77  ? 195  MET A CE    1 
ATOM   1515  N  N     . VAL A  1  196 ? 61.692  72.159  34.054  1.00 80.47  ? 196  VAL A N     1 
ATOM   1516  C  CA    . VAL A  1  196 ? 63.125  72.385  34.225  1.00 79.97  ? 196  VAL A CA    1 
ATOM   1517  C  C     . VAL A  1  196 ? 63.786  71.302  35.081  1.00 81.52  ? 196  VAL A C     1 
ATOM   1518  O  O     . VAL A  1  196 ? 63.428  71.087  36.236  1.00 82.29  ? 196  VAL A O     1 
ATOM   1519  C  CB    . VAL A  1  196 ? 63.413  73.760  34.869  1.00 77.57  ? 196  VAL A CB    1 
ATOM   1520  C  CG1   . VAL A  1  196 ? 64.888  73.919  35.113  1.00 76.24  ? 196  VAL A CG1   1 
ATOM   1521  C  CG2   . VAL A  1  196 ? 62.947  74.858  33.963  1.00 76.91  ? 196  VAL A CG2   1 
ATOM   1522  N  N     . LEU A  1  197 ? 64.760  70.619  34.502  1.00 82.62  ? 197  LEU A N     1 
ATOM   1523  C  CA    . LEU A  1  197 ? 65.472  69.574  35.208  1.00 83.35  ? 197  LEU A CA    1 
ATOM   1524  C  C     . LEU A  1  197 ? 66.680  70.209  35.877  1.00 84.18  ? 197  LEU A C     1 
ATOM   1525  O  O     . LEU A  1  197 ? 67.607  70.678  35.206  1.00 83.93  ? 197  LEU A O     1 
ATOM   1526  C  CB    . LEU A  1  197 ? 65.931  68.507  34.220  1.00 84.25  ? 197  LEU A CB    1 
ATOM   1527  C  CG    . LEU A  1  197 ? 66.502  67.223  34.813  1.00 85.09  ? 197  LEU A CG    1 
ATOM   1528  C  CD1   . LEU A  1  197 ? 65.379  66.440  35.479  1.00 86.46  ? 197  LEU A CD1   1 
ATOM   1529  C  CD2   . LEU A  1  197 ? 67.149  66.397  33.717  1.00 85.12  ? 197  LEU A CD2   1 
ATOM   1530  N  N     . ALA A  1  198 ? 66.661  70.249  37.201  1.00 84.80  ? 198  ALA A N     1 
ATOM   1531  C  CA    . ALA A  1  198 ? 67.777  70.818  37.935  1.00 86.71  ? 198  ALA A CA    1 
ATOM   1532  C  C     . ALA A  1  198 ? 68.406  69.698  38.744  1.00 88.35  ? 198  ALA A C     1 
ATOM   1533  O  O     . ALA A  1  198 ? 67.718  68.756  39.139  1.00 89.21  ? 198  ALA A O     1 
ATOM   1534  C  CB    . ALA A  1  198 ? 67.295  71.918  38.850  1.00 86.13  ? 198  ALA A CB    1 
ATOM   1535  N  N     . ALA A  1  199 ? 69.709  69.789  38.988  1.00 89.41  ? 199  ALA A N     1 
ATOM   1536  C  CA    . ALA A  1  199 ? 70.387  68.764  39.759  1.00 90.35  ? 199  ALA A CA    1 
ATOM   1537  C  C     . ALA A  1  199 ? 71.585  69.361  40.436  1.00 91.87  ? 199  ALA A C     1 
ATOM   1538  O  O     . ALA A  1  199 ? 72.251  70.221  39.882  1.00 90.87  ? 199  ALA A O     1 
ATOM   1539  C  CB    . ALA A  1  199 ? 70.815  67.650  38.862  1.00 89.84  ? 199  ALA A CB    1 
ATOM   1540  N  N     . ALA A  1  200 ? 71.859  68.905  41.646  1.00 95.26  ? 200  ALA A N     1 
ATOM   1541  C  CA    . ALA A  1  200 ? 73.001  69.416  42.378  1.00 99.69  ? 200  ALA A CA    1 
ATOM   1542  C  C     . ALA A  1  200 ? 73.667  68.308  43.174  1.00 102.52 ? 200  ALA A C     1 
ATOM   1543  O  O     . ALA A  1  200 ? 72.995  67.438  43.738  1.00 102.29 ? 200  ALA A O     1 
ATOM   1544  C  CB    . ALA A  1  200 ? 72.572  70.539  43.301  1.00 100.29 ? 200  ALA A CB    1 
ATOM   1545  N  N     . GLY A  1  201 ? 74.996  68.361  43.211  1.00 105.58 ? 201  GLY A N     1 
ATOM   1546  C  CA    . GLY A  1  201 ? 75.782  67.365  43.917  1.00 108.89 ? 201  GLY A CA    1 
ATOM   1547  C  C     . GLY A  1  201 ? 76.883  66.859  43.002  1.00 110.89 ? 201  GLY A C     1 
ATOM   1548  O  O     . GLY A  1  201 ? 77.356  67.594  42.130  1.00 110.88 ? 201  GLY A O     1 
ATOM   1549  N  N     . GLY A  1  202 ? 77.293  65.608  43.195  1.00 112.72 ? 202  GLY A N     1 
ATOM   1550  C  CA    . GLY A  1  202 ? 78.333  65.044  42.358  1.00 115.23 ? 202  GLY A CA    1 
ATOM   1551  C  C     . GLY A  1  202 ? 77.731  64.562  41.055  1.00 117.17 ? 202  GLY A C     1 
ATOM   1552  O  O     . GLY A  1  202 ? 77.376  63.391  40.937  1.00 117.03 ? 202  GLY A O     1 
ATOM   1553  N  N     . ILE A  1  203 ? 77.602  65.459  40.079  1.00 119.11 ? 203  ILE A N     1 
ATOM   1554  C  CA    . ILE A  1  203 ? 77.032  65.101  38.783  1.00 121.25 ? 203  ILE A CA    1 
ATOM   1555  C  C     . ILE A  1  203 ? 77.610  65.913  37.628  1.00 123.22 ? 203  ILE A C     1 
ATOM   1556  O  O     . ILE A  1  203 ? 77.742  67.135  37.722  1.00 123.59 ? 203  ILE A O     1 
ATOM   1557  C  CB    . ILE A  1  203 ? 75.516  65.299  38.771  1.00 120.66 ? 203  ILE A CB    1 
ATOM   1558  C  CG1   . ILE A  1  203 ? 74.870  64.397  39.811  1.00 121.27 ? 203  ILE A CG1   1 
ATOM   1559  C  CG2   . ILE A  1  203 ? 74.960  64.972  37.403  1.00 120.28 ? 203  ILE A CG2   1 
ATOM   1560  C  CD1   . ILE A  1  203 ? 73.382  64.591  39.923  1.00 122.38 ? 203  ILE A CD1   1 
ATOM   1561  N  N     . SER A  1  204 ? 77.940  65.223  36.535  1.00 125.22 ? 204  SER A N     1 
ATOM   1562  C  CA    . SER A  1  204 ? 78.494  65.864  35.338  1.00 126.41 ? 204  SER A CA    1 
ATOM   1563  C  C     . SER A  1  204 ? 77.380  66.496  34.522  1.00 126.58 ? 204  SER A C     1 
ATOM   1564  O  O     . SER A  1  204 ? 76.474  65.811  34.048  1.00 125.91 ? 204  SER A O     1 
ATOM   1565  C  CB    . SER A  1  204 ? 79.235  64.841  34.468  1.00 126.84 ? 204  SER A CB    1 
ATOM   1566  O  OG    . SER A  1  204 ? 79.627  65.414  33.230  1.00 126.92 ? 204  SER A OG    1 
ATOM   1567  N  N     . HIS A  1  205 ? 77.452  67.807  34.352  1.00 127.44 ? 205  HIS A N     1 
ATOM   1568  C  CA    . HIS A  1  205 ? 76.429  68.494  33.602  1.00 128.92 ? 205  HIS A CA    1 
ATOM   1569  C  C     . HIS A  1  205 ? 76.084  67.766  32.316  1.00 129.14 ? 205  HIS A C     1 
ATOM   1570  O  O     . HIS A  1  205 ? 74.942  67.362  32.113  1.00 128.62 ? 205  HIS A O     1 
ATOM   1571  C  CB    . HIS A  1  205 ? 76.865  69.913  33.262  1.00 130.74 ? 205  HIS A CB    1 
ATOM   1572  C  CG    . HIS A  1  205 ? 75.869  70.650  32.422  1.00 132.75 ? 205  HIS A CG    1 
ATOM   1573  N  ND1   . HIS A  1  205 ? 74.553  70.803  32.802  1.00 133.53 ? 205  HIS A ND1   1 
ATOM   1574  C  CD2   . HIS A  1  205 ? 75.984  71.248  31.212  1.00 133.45 ? 205  HIS A CD2   1 
ATOM   1575  C  CE1   . HIS A  1  205 ? 73.900  71.463  31.861  1.00 134.12 ? 205  HIS A CE1   1 
ATOM   1576  N  NE2   . HIS A  1  205 ? 74.745  71.745  30.886  1.00 133.85 ? 205  HIS A NE2   1 
ATOM   1577  N  N     . LYS A  1  206 ? 77.065  67.605  31.438  1.00 129.78 ? 206  LYS A N     1 
ATOM   1578  C  CA    . LYS A  1  206 ? 76.794  66.942  30.177  1.00 130.53 ? 206  LYS A CA    1 
ATOM   1579  C  C     . LYS A  1  206 ? 76.168  65.559  30.349  1.00 130.49 ? 206  LYS A C     1 
ATOM   1580  O  O     . LYS A  1  206 ? 75.194  65.235  29.675  1.00 130.02 ? 206  LYS A O     1 
ATOM   1581  C  CB    . LYS A  1  206 ? 78.064  66.836  29.332  1.00 131.26 ? 206  LYS A CB    1 
ATOM   1582  C  CG    . LYS A  1  206 ? 77.870  65.989  28.071  1.00 133.02 ? 206  LYS A CG    1 
ATOM   1583  C  CD    . LYS A  1  206 ? 79.160  65.833  27.270  1.00 134.12 ? 206  LYS A CD    1 
ATOM   1584  C  CE    . LYS A  1  206 ? 79.166  64.557  26.414  1.00 134.70 ? 206  LYS A CE    1 
ATOM   1585  N  NZ    . LYS A  1  206 ? 79.322  63.297  27.214  1.00 134.88 ? 206  LYS A NZ    1 
ATOM   1586  N  N     . GLU A  1  207 ? 76.708  64.738  31.246  1.00 130.70 ? 207  GLU A N     1 
ATOM   1587  C  CA    . GLU A  1  207 ? 76.147  63.397  31.428  1.00 131.03 ? 207  GLU A CA    1 
ATOM   1588  C  C     . GLU A  1  207 ? 74.646  63.528  31.642  1.00 130.66 ? 207  GLU A C     1 
ATOM   1589  O  O     . GLU A  1  207 ? 73.840  62.835  31.013  1.00 130.21 ? 207  GLU A O     1 
ATOM   1590  C  CB    . GLU A  1  207 ? 76.777  62.686  32.636  1.00 131.74 ? 207  GLU A CB    1 
ATOM   1591  C  CG    . GLU A  1  207 ? 77.019  61.185  32.411  1.00 132.29 ? 207  GLU A CG    1 
ATOM   1592  C  CD    . GLU A  1  207 ? 77.332  60.426  33.691  1.00 132.63 ? 207  GLU A CD    1 
ATOM   1593  O  OE1   . GLU A  1  207 ? 76.384  59.954  34.357  1.00 131.90 ? 207  GLU A OE1   1 
ATOM   1594  O  OE2   . GLU A  1  207 ? 78.529  60.309  34.033  1.00 133.50 ? 207  GLU A OE2   1 
ATOM   1595  N  N     . LEU A  1  208 ? 74.287  64.438  32.541  1.00 130.48 ? 208  LEU A N     1 
ATOM   1596  C  CA    . LEU A  1  208 ? 72.895  64.707  32.872  1.00 129.83 ? 208  LEU A CA    1 
ATOM   1597  C  C     . LEU A  1  208 ? 72.106  65.031  31.609  1.00 129.56 ? 208  LEU A C     1 
ATOM   1598  O  O     . LEU A  1  208 ? 71.187  64.299  31.224  1.00 129.17 ? 208  LEU A O     1 
ATOM   1599  C  CB    . LEU A  1  208 ? 72.817  65.884  33.855  1.00 128.95 ? 208  LEU A CB    1 
ATOM   1600  C  CG    . LEU A  1  208 ? 71.442  66.464  34.205  1.00 127.80 ? 208  LEU A CG    1 
ATOM   1601  C  CD1   . LEU A  1  208 ? 70.538  65.395  34.778  1.00 126.68 ? 208  LEU A CD1   1 
ATOM   1602  C  CD2   . LEU A  1  208 ? 71.623  67.591  35.202  1.00 127.73 ? 208  LEU A CD2   1 
ATOM   1603  N  N     . VAL A  1  209 ? 72.481  66.128  30.962  1.00 129.15 ? 209  VAL A N     1 
ATOM   1604  C  CA    . VAL A  1  209 ? 71.805  66.562  29.755  1.00 128.83 ? 209  VAL A CA    1 
ATOM   1605  C  C     . VAL A  1  209 ? 71.538  65.382  28.813  1.00 128.95 ? 209  VAL A C     1 
ATOM   1606  O  O     . VAL A  1  209 ? 70.503  65.328  28.141  1.00 128.18 ? 209  VAL A O     1 
ATOM   1607  C  CB    . VAL A  1  209 ? 72.628  67.685  29.047  1.00 128.42 ? 209  VAL A CB    1 
ATOM   1608  C  CG1   . VAL A  1  209 ? 73.940  67.158  28.534  1.00 128.29 ? 209  VAL A CG1   1 
ATOM   1609  C  CG2   . VAL A  1  209 ? 71.827  68.278  27.924  1.00 129.15 ? 209  VAL A CG2   1 
ATOM   1610  N  N     . ASP A  1  210 ? 72.456  64.420  28.796  1.00 129.63 ? 210  ASP A N     1 
ATOM   1611  C  CA    . ASP A  1  210 ? 72.313  63.244  27.940  1.00 130.14 ? 210  ASP A CA    1 
ATOM   1612  C  C     . ASP A  1  210 ? 71.106  62.402  28.337  1.00 129.71 ? 210  ASP A C     1 
ATOM   1613  O  O     . ASP A  1  210 ? 70.155  62.263  27.564  1.00 129.61 ? 210  ASP A O     1 
ATOM   1614  C  CB    . ASP A  1  210 ? 73.588  62.389  27.987  1.00 131.10 ? 210  ASP A CB    1 
ATOM   1615  C  CG    . ASP A  1  210 ? 74.733  62.996  27.184  1.00 131.91 ? 210  ASP A CG    1 
ATOM   1616  O  OD1   . ASP A  1  210 ? 74.653  63.017  25.933  1.00 131.99 ? 210  ASP A OD1   1 
ATOM   1617  O  OD2   . ASP A  1  210 ? 75.711  63.460  27.805  1.00 132.50 ? 210  ASP A OD2   1 
ATOM   1618  N  N     . ALA A  1  211 ? 71.142  61.843  29.543  1.00 129.05 ? 211  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  211 ? 70.039  61.025  30.016  1.00 128.31 ? 211  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  211 ? 68.764  61.836  29.851  1.00 127.94 ? 211  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  211 ? 67.668  61.284  29.760  1.00 127.28 ? 211  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  211 ? 70.250  60.653  31.465  1.00 128.40 ? 211  ALA A CB    1 
ATOM   1623  N  N     . ALA A  1  212 ? 68.925  63.156  29.803  1.00 127.83 ? 212  ALA A N     1 
ATOM   1624  C  CA    . ALA A  1  212 ? 67.797  64.058  29.628  1.00 128.23 ? 212  ALA A CA    1 
ATOM   1625  C  C     . ALA A  1  212 ? 67.262  63.878  28.224  1.00 128.31 ? 212  ALA A C     1 
ATOM   1626  O  O     . ALA A  1  212 ? 66.093  63.552  28.032  1.00 128.37 ? 212  ALA A O     1 
ATOM   1627  C  CB    . ALA A  1  212 ? 68.232  65.498  29.835  1.00 128.23 ? 212  ALA A CB    1 
ATOM   1628  N  N     . ARG A  1  213 ? 68.130  64.093  27.244  1.00 128.45 ? 213  ARG A N     1 
ATOM   1629  C  CA    . ARG A  1  213 ? 67.745  63.939  25.850  1.00 128.97 ? 213  ARG A CA    1 
ATOM   1630  C  C     . ARG A  1  213 ? 67.119  62.565  25.651  1.00 129.29 ? 213  ARG A C     1 
ATOM   1631  O  O     . ARG A  1  213 ? 66.204  62.395  24.844  1.00 129.00 ? 213  ARG A O     1 
ATOM   1632  C  CB    . ARG A  1  213 ? 68.966  64.022  24.933  1.00 129.14 ? 213  ARG A CB    1 
ATOM   1633  C  CG    . ARG A  1  213 ? 69.788  65.294  24.980  1.00 129.56 ? 213  ARG A CG    1 
ATOM   1634  C  CD    . ARG A  1  213 ? 71.000  65.119  24.060  1.00 130.63 ? 213  ARG A CD    1 
ATOM   1635  N  NE    . ARG A  1  213 ? 71.935  66.251  24.022  1.00 131.19 ? 213  ARG A NE    1 
ATOM   1636  C  CZ    . ARG A  1  213 ? 71.772  67.356  23.294  1.00 131.22 ? 213  ARG A CZ    1 
ATOM   1637  N  NH1   . ARG A  1  213 ? 70.695  67.500  22.531  1.00 131.97 ? 213  ARG A NH1   1 
ATOM   1638  N  NH2   . ARG A  1  213 ? 72.701  68.308  23.305  1.00 130.22 ? 213  ARG A NH2   1 
ATOM   1639  N  N     . GLN A  1  214 ? 67.619  61.588  26.401  1.00 129.82 ? 214  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  214 ? 67.172  60.210  26.273  1.00 130.65 ? 214  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  214 ? 65.753  59.852  26.730  1.00 130.86 ? 214  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  214 ? 65.062  59.114  26.023  1.00 131.34 ? 214  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  214 ? 68.207  59.279  26.936  1.00 131.51 ? 214  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  214 ? 68.185  57.830  26.417  1.00 133.54 ? 214  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  214 ? 69.488  57.073  26.680  1.00 134.41 ? 214  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  214 ? 69.955  56.995  27.815  1.00 135.18 ? 214  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  214 ? 70.072  56.505  25.624  1.00 135.01 ? 214  GLN A NE2   1 
ATOM   1648  N  N     . HIS A  1  215 ? 65.298  60.357  27.877  1.00 130.60 ? 215  HIS A N     1 
ATOM   1649  C  CA    . HIS A  1  215 ? 63.947  60.007  28.334  1.00 130.52 ? 215  HIS A CA    1 
ATOM   1650  C  C     . HIS A  1  215 ? 62.925  61.119  28.212  1.00 130.51 ? 215  HIS A C     1 
ATOM   1651  O  O     . HIS A  1  215 ? 61.723  60.855  28.152  1.00 130.29 ? 215  HIS A O     1 
ATOM   1652  C  CB    . HIS A  1  215 ? 63.976  59.519  29.775  1.00 130.34 ? 215  HIS A CB    1 
ATOM   1653  C  CG    . HIS A  1  215 ? 65.011  58.474  30.029  1.00 130.74 ? 215  HIS A CG    1 
ATOM   1654  N  ND1   . HIS A  1  215 ? 66.357  58.761  30.101  1.00 131.07 ? 215  HIS A ND1   1 
ATOM   1655  C  CD2   . HIS A  1  215 ? 64.900  57.139  30.219  1.00 130.90 ? 215  HIS A CD2   1 
ATOM   1656  C  CE1   . HIS A  1  215 ? 67.032  57.648  30.329  1.00 131.31 ? 215  HIS A CE1   1 
ATOM   1657  N  NE2   . HIS A  1  215 ? 66.171  56.649  30.404  1.00 131.36 ? 215  HIS A NE2   1 
ATOM   1658  N  N     . PHE A  1  216 ? 63.412  62.357  28.192  1.00 130.77 ? 216  PHE A N     1 
ATOM   1659  C  CA    . PHE A  1  216 ? 62.566  63.542  28.054  1.00 131.44 ? 216  PHE A CA    1 
ATOM   1660  C  C     . PHE A  1  216 ? 62.436  63.849  26.561  1.00 131.70 ? 216  PHE A C     1 
ATOM   1661  O  O     . PHE A  1  216 ? 62.620  64.985  26.124  1.00 131.57 ? 216  PHE A O     1 
ATOM   1662  C  CB    . PHE A  1  216 ? 63.208  64.734  28.780  1.00 131.54 ? 216  PHE A CB    1 
ATOM   1663  C  CG    . PHE A  1  216 ? 63.068  64.689  30.283  1.00 131.48 ? 216  PHE A CG    1 
ATOM   1664  C  CD1   . PHE A  1  216 ? 64.119  65.098  31.103  1.00 131.11 ? 216  PHE A CD1   1 
ATOM   1665  C  CD2   . PHE A  1  216 ? 61.881  64.256  30.879  1.00 131.25 ? 216  PHE A CD2   1 
ATOM   1666  C  CE1   . PHE A  1  216 ? 63.993  65.074  32.493  1.00 130.82 ? 216  PHE A CE1   1 
ATOM   1667  C  CE2   . PHE A  1  216 ? 61.743  64.230  32.267  1.00 130.75 ? 216  PHE A CE2   1 
ATOM   1668  C  CZ    . PHE A  1  216 ? 62.799  64.637  33.076  1.00 131.00 ? 216  PHE A CZ    1 
ATOM   1669  N  N     . SER A  1  217 ? 62.112  62.818  25.789  1.00 132.31 ? 217  SER A N     1 
ATOM   1670  C  CA    . SER A  1  217 ? 61.987  62.933  24.339  1.00 132.88 ? 217  SER A CA    1 
ATOM   1671  C  C     . SER A  1  217 ? 60.701  63.575  23.835  1.00 133.08 ? 217  SER A C     1 
ATOM   1672  O  O     . SER A  1  217 ? 59.841  62.893  23.271  1.00 133.37 ? 217  SER A O     1 
ATOM   1673  C  CB    . SER A  1  217 ? 62.125  61.549  23.701  1.00 133.38 ? 217  SER A CB    1 
ATOM   1674  O  OG    . SER A  1  217 ? 61.099  60.679  24.154  1.00 133.56 ? 217  SER A OG    1 
ATOM   1675  N  N     . GLY A  1  218 ? 60.571  64.884  24.029  1.00 132.87 ? 218  GLY A N     1 
ATOM   1676  C  CA    . GLY A  1  218 ? 59.391  65.579  23.549  1.00 132.14 ? 218  GLY A CA    1 
ATOM   1677  C  C     . GLY A  1  218 ? 59.615  66.058  22.119  1.00 131.56 ? 218  GLY A C     1 
ATOM   1678  O  O     . GLY A  1  218 ? 60.722  66.473  21.767  1.00 131.73 ? 218  GLY A O     1 
ATOM   1679  N  N     . VAL A  1  219 ? 58.578  65.983  21.287  1.00 130.52 ? 219  VAL A N     1 
ATOM   1680  C  CA    . VAL A  1  219 ? 58.669  66.433  19.897  1.00 128.82 ? 219  VAL A CA    1 
ATOM   1681  C  C     . VAL A  1  219 ? 57.691  67.584  19.686  1.00 127.95 ? 219  VAL A C     1 
ATOM   1682  O  O     . VAL A  1  219 ? 56.485  67.439  19.886  1.00 128.22 ? 219  VAL A O     1 
ATOM   1683  C  CB    . VAL A  1  219 ? 58.321  65.314  18.913  1.00 128.67 ? 219  VAL A CB    1 
ATOM   1684  C  CG1   . VAL A  1  219 ? 58.506  65.817  17.495  1.00 128.17 ? 219  VAL A CG1   1 
ATOM   1685  C  CG2   . VAL A  1  219 ? 59.190  64.090  19.180  1.00 128.66 ? 219  VAL A CG2   1 
ATOM   1686  N  N     . SER A  1  220 ? 58.221  68.721  19.260  1.00 126.54 ? 220  SER A N     1 
ATOM   1687  C  CA    . SER A  1  220 ? 57.431  69.927  19.064  1.00 125.24 ? 220  SER A CA    1 
ATOM   1688  C  C     . SER A  1  220 ? 57.212  70.297  17.602  1.00 124.39 ? 220  SER A C     1 
ATOM   1689  O  O     . SER A  1  220 ? 58.122  70.791  16.940  1.00 124.04 ? 220  SER A O     1 
ATOM   1690  C  CB    . SER A  1  220 ? 58.135  71.067  19.782  1.00 125.22 ? 220  SER A CB    1 
ATOM   1691  O  OG    . SER A  1  220 ? 59.527  71.018  19.502  1.00 125.75 ? 220  SER A OG    1 
ATOM   1692  N  N     . PHE A  1  221 ? 56.000  70.075  17.103  1.00 123.58 ? 221  PHE A N     1 
ATOM   1693  C  CA    . PHE A  1  221 ? 55.692  70.398  15.719  1.00 123.16 ? 221  PHE A CA    1 
ATOM   1694  C  C     . PHE A  1  221 ? 55.409  71.884  15.542  1.00 123.05 ? 221  PHE A C     1 
ATOM   1695  O  O     . PHE A  1  221 ? 56.312  72.658  15.222  1.00 122.62 ? 221  PHE A O     1 
ATOM   1696  C  CB    . PHE A  1  221 ? 54.488  69.587  15.231  1.00 123.18 ? 221  PHE A CB    1 
ATOM   1697  C  CG    . PHE A  1  221 ? 54.752  68.114  15.114  1.00 123.57 ? 221  PHE A CG    1 
ATOM   1698  C  CD1   . PHE A  1  221 ? 54.855  67.319  16.251  1.00 123.70 ? 221  PHE A CD1   1 
ATOM   1699  C  CD2   . PHE A  1  221 ? 54.897  67.519  13.865  1.00 124.08 ? 221  PHE A CD2   1 
ATOM   1700  C  CE1   . PHE A  1  221 ? 55.095  65.952  16.145  1.00 123.29 ? 221  PHE A CE1   1 
ATOM   1701  C  CE2   . PHE A  1  221 ? 55.138  66.154  13.747  1.00 123.90 ? 221  PHE A CE2   1 
ATOM   1702  C  CZ    . PHE A  1  221 ? 55.236  65.370  14.891  1.00 123.63 ? 221  PHE A CZ    1 
ATOM   1703  N  N     . THR A  1  222 ? 54.154  72.273  15.755  1.00 123.15 ? 222  THR A N     1 
ATOM   1704  C  CA    . THR A  1  222 ? 53.732  73.666  15.612  1.00 123.10 ? 222  THR A CA    1 
ATOM   1705  C  C     . THR A  1  222 ? 54.509  74.600  16.530  1.00 123.95 ? 222  THR A C     1 
ATOM   1706  O  O     . THR A  1  222 ? 55.462  74.185  17.180  1.00 124.31 ? 222  THR A O     1 
ATOM   1707  C  CB    . THR A  1  222 ? 52.218  73.828  15.908  1.00 122.24 ? 222  THR A CB    1 
ATOM   1708  O  OG1   . THR A  1  222 ? 51.855  73.012  17.029  1.00 121.30 ? 222  THR A OG1   1 
ATOM   1709  C  CG2   . THR A  1  222 ? 51.384  73.432  14.697  1.00 121.55 ? 222  THR A CG2   1 
ATOM   1710  N  N     . TYR A  1  223 ? 54.109  75.868  16.561  1.00 124.72 ? 223  TYR A N     1 
ATOM   1711  C  CA    . TYR A  1  223 ? 54.743  76.860  17.423  1.00 125.59 ? 223  TYR A CA    1 
ATOM   1712  C  C     . TYR A  1  223 ? 54.011  76.803  18.763  1.00 126.62 ? 223  TYR A C     1 
ATOM   1713  O  O     . TYR A  1  223 ? 54.580  77.126  19.806  1.00 126.69 ? 223  TYR A O     1 
ATOM   1714  C  CB    . TYR A  1  223 ? 54.591  78.260  16.840  1.00 125.26 ? 223  TYR A CB    1 
ATOM   1715  C  CG    . TYR A  1  223 ? 53.143  78.707  16.747  1.00 126.60 ? 223  TYR A CG    1 
ATOM   1716  C  CD1   . TYR A  1  223 ? 52.739  79.953  17.230  1.00 127.09 ? 223  TYR A CD1   1 
ATOM   1717  C  CD2   . TYR A  1  223 ? 52.171  77.884  16.167  1.00 126.70 ? 223  TYR A CD2   1 
ATOM   1718  C  CE1   . TYR A  1  223 ? 51.399  80.368  17.136  1.00 127.15 ? 223  TYR A CE1   1 
ATOM   1719  C  CE2   . TYR A  1  223 ? 50.834  78.289  16.068  1.00 126.40 ? 223  TYR A CE2   1 
ATOM   1720  C  CZ    . TYR A  1  223 ? 50.456  79.530  16.554  1.00 126.77 ? 223  TYR A CZ    1 
ATOM   1721  O  OH    . TYR A  1  223 ? 49.142  79.938  16.462  1.00 126.70 ? 223  TYR A OH    1 
ATOM   1722  N  N     . LYS A  1  224 ? 52.742  76.389  18.711  1.00 127.72 ? 224  LYS A N     1 
ATOM   1723  C  CA    . LYS A  1  224 ? 51.880  76.268  19.890  1.00 128.98 ? 224  LYS A CA    1 
ATOM   1724  C  C     . LYS A  1  224 ? 52.560  75.548  21.060  1.00 129.89 ? 224  LYS A C     1 
ATOM   1725  O  O     . LYS A  1  224 ? 52.717  76.114  22.140  1.00 130.93 ? 224  LYS A O     1 
ATOM   1726  C  CB    . LYS A  1  224 ? 50.579  75.529  19.531  1.00 128.84 ? 224  LYS A CB    1 
ATOM   1727  C  CG    . LYS A  1  224 ? 49.546  76.342  18.740  1.00 129.27 ? 224  LYS A CG    1 
ATOM   1728  C  CD    . LYS A  1  224 ? 48.848  77.396  19.607  1.00 129.78 ? 224  LYS A CD    1 
ATOM   1729  C  CE    . LYS A  1  224 ? 47.723  78.116  18.853  1.00 130.19 ? 224  LYS A CE    1 
ATOM   1730  N  NZ    . LYS A  1  224 ? 46.574  77.222  18.506  1.00 130.34 ? 224  LYS A NZ    1 
ATOM   1731  N  N     . GLU A  1  225 ? 52.956  74.298  20.843  1.00 130.34 ? 225  GLU A N     1 
ATOM   1732  C  CA    . GLU A  1  225 ? 53.614  73.497  21.877  1.00 130.60 ? 225  GLU A CA    1 
ATOM   1733  C  C     . GLU A  1  225 ? 54.928  74.113  22.371  1.00 130.58 ? 225  GLU A C     1 
ATOM   1734  O  O     . GLU A  1  225 ? 55.550  73.601  23.306  1.00 130.44 ? 225  GLU A O     1 
ATOM   1735  C  CB    . GLU A  1  225 ? 53.898  72.100  21.332  1.00 131.07 ? 225  GLU A CB    1 
ATOM   1736  C  CG    . GLU A  1  225 ? 52.722  71.453  20.629  1.00 131.78 ? 225  GLU A CG    1 
ATOM   1737  C  CD    . GLU A  1  225 ? 53.152  70.695  19.385  1.00 132.56 ? 225  GLU A CD    1 
ATOM   1738  O  OE1   . GLU A  1  225 ? 54.055  69.834  19.491  1.00 132.43 ? 225  GLU A OE1   1 
ATOM   1739  O  OE2   . GLU A  1  225 ? 52.589  70.963  18.300  1.00 132.98 ? 225  GLU A OE2   1 
ATOM   1740  N  N     . ASP A  1  226 ? 55.352  75.202  21.733  1.00 130.41 ? 226  ASP A N     1 
ATOM   1741  C  CA    . ASP A  1  226 ? 56.592  75.882  22.099  1.00 130.72 ? 226  ASP A CA    1 
ATOM   1742  C  C     . ASP A  1  226 ? 56.370  77.187  22.855  1.00 130.69 ? 226  ASP A C     1 
ATOM   1743  O  O     . ASP A  1  226 ? 57.292  77.713  23.488  1.00 130.97 ? 226  ASP A O     1 
ATOM   1744  C  CB    . ASP A  1  226 ? 57.418  76.167  20.848  1.00 131.18 ? 226  ASP A CB    1 
ATOM   1745  C  CG    . ASP A  1  226 ? 58.102  74.932  20.316  1.00 131.93 ? 226  ASP A CG    1 
ATOM   1746  O  OD1   . ASP A  1  226 ? 57.420  73.896  20.180  1.00 132.37 ? 226  ASP A OD1   1 
ATOM   1747  O  OD2   . ASP A  1  226 ? 59.319  74.999  20.034  1.00 132.75 ? 226  ASP A OD2   1 
ATOM   1748  N  N     . ALA A  1  227 ? 55.147  77.702  22.786  1.00 130.25 ? 227  ALA A N     1 
ATOM   1749  C  CA    . ALA A  1  227 ? 54.788  78.951  23.448  1.00 129.56 ? 227  ALA A CA    1 
ATOM   1750  C  C     . ALA A  1  227 ? 54.309  78.759  24.889  1.00 128.87 ? 227  ALA A C     1 
ATOM   1751  O  O     . ALA A  1  227 ? 53.454  77.916  25.179  1.00 128.72 ? 227  ALA A O     1 
ATOM   1752  C  CB    . ALA A  1  227 ? 53.716  79.685  22.630  1.00 129.63 ? 227  ALA A CB    1 
ATOM   1753  N  N     . VAL A  1  228 ? 54.882  79.552  25.786  1.00 127.79 ? 228  VAL A N     1 
ATOM   1754  C  CA    . VAL A  1  228 ? 54.530  79.526  27.195  1.00 126.15 ? 228  VAL A CA    1 
ATOM   1755  C  C     . VAL A  1  228 ? 53.366  80.504  27.398  1.00 125.49 ? 228  VAL A C     1 
ATOM   1756  O  O     . VAL A  1  228 ? 53.564  81.723  27.382  1.00 125.68 ? 228  VAL A O     1 
ATOM   1757  C  CB    . VAL A  1  228 ? 55.741  79.956  28.049  1.00 126.08 ? 228  VAL A CB    1 
ATOM   1758  C  CG1   . VAL A  1  228 ? 56.428  81.160  27.410  1.00 125.84 ? 228  VAL A CG1   1 
ATOM   1759  C  CG2   . VAL A  1  228 ? 55.294  80.288  29.460  1.00 126.56 ? 228  VAL A CG2   1 
ATOM   1760  N  N     . PRO A  1  229 ? 52.135  79.981  27.590  1.00 124.39 ? 229  PRO A N     1 
ATOM   1761  C  CA    . PRO A  1  229 ? 50.938  80.816  27.791  1.00 122.68 ? 229  PRO A CA    1 
ATOM   1762  C  C     . PRO A  1  229 ? 51.084  81.848  28.900  1.00 120.89 ? 229  PRO A C     1 
ATOM   1763  O  O     . PRO A  1  229 ? 51.351  81.498  30.047  1.00 120.60 ? 229  PRO A O     1 
ATOM   1764  C  CB    . PRO A  1  229 ? 49.844  79.791  28.095  1.00 123.10 ? 229  PRO A CB    1 
ATOM   1765  C  CG    . PRO A  1  229 ? 50.599  78.674  28.745  1.00 124.22 ? 229  PRO A CG    1 
ATOM   1766  C  CD    . PRO A  1  229 ? 51.823  78.564  27.854  1.00 124.33 ? 229  PRO A CD    1 
ATOM   1767  N  N     . ILE A  1  230 ? 50.917  83.121  28.555  1.00 119.15 ? 230  ILE A N     1 
ATOM   1768  C  CA    . ILE A  1  230 ? 51.033  84.180  29.545  1.00 117.62 ? 230  ILE A CA    1 
ATOM   1769  C  C     . ILE A  1  230 ? 49.777  84.190  30.412  1.00 116.55 ? 230  ILE A C     1 
ATOM   1770  O  O     . ILE A  1  230 ? 48.666  83.907  29.935  1.00 116.82 ? 230  ILE A O     1 
ATOM   1771  C  CB    . ILE A  1  230 ? 51.267  85.564  28.875  1.00 117.58 ? 230  ILE A CB    1 
ATOM   1772  C  CG1   . ILE A  1  230 ? 52.676  85.606  28.270  1.00 117.60 ? 230  ILE A CG1   1 
ATOM   1773  C  CG2   . ILE A  1  230 ? 51.136  86.679  29.904  1.00 117.91 ? 230  ILE A CG2   1 
ATOM   1774  C  CD1   . ILE A  1  230 ? 53.038  86.911  27.576  1.00 117.29 ? 230  ILE A CD1   1 
ATOM   1775  N  N     . LEU A  1  231 ? 49.973  84.504  31.693  1.00 114.26 ? 231  LEU A N     1 
ATOM   1776  C  CA    . LEU A  1  231 ? 48.898  84.522  32.674  1.00 111.10 ? 231  LEU A CA    1 
ATOM   1777  C  C     . LEU A  1  231 ? 48.155  85.829  32.885  1.00 109.15 ? 231  LEU A C     1 
ATOM   1778  O  O     . LEU A  1  231 ? 48.768  86.890  33.052  1.00 108.18 ? 231  LEU A O     1 
ATOM   1779  C  CB    . LEU A  1  231 ? 49.431  84.038  34.014  1.00 110.98 ? 231  LEU A CB    1 
ATOM   1780  C  CG    . LEU A  1  231 ? 49.179  82.558  34.284  1.00 111.07 ? 231  LEU A CG    1 
ATOM   1781  C  CD1   . LEU A  1  231 ? 50.050  82.117  35.434  1.00 111.38 ? 231  LEU A CD1   1 
ATOM   1782  C  CD2   . LEU A  1  231 ? 47.699  82.310  34.590  1.00 111.24 ? 231  LEU A CD2   1 
ATOM   1783  N  N     . PRO A  1  232 ? 46.810  85.755  32.905  1.00 107.68 ? 232  PRO A N     1 
ATOM   1784  C  CA    . PRO A  1  232 ? 45.954  86.923  33.104  1.00 106.52 ? 232  PRO A CA    1 
ATOM   1785  C  C     . PRO A  1  232 ? 46.258  87.530  34.473  1.00 105.48 ? 232  PRO A C     1 
ATOM   1786  O  O     . PRO A  1  232 ? 45.933  86.946  35.517  1.00 106.60 ? 232  PRO A O     1 
ATOM   1787  C  CB    . PRO A  1  232 ? 44.541  86.335  32.998  1.00 106.15 ? 232  PRO A CB    1 
ATOM   1788  C  CG    . PRO A  1  232 ? 44.709  84.950  33.531  1.00 106.76 ? 232  PRO A CG    1 
ATOM   1789  C  CD    . PRO A  1  232 ? 45.997  84.524  32.851  1.00 107.61 ? 232  PRO A CD    1 
ATOM   1790  N  N     . ARG A  1  233 ? 46.915  88.686  34.455  1.00 103.05 ? 233  ARG A N     1 
ATOM   1791  C  CA    . ARG A  1  233 ? 47.292  89.399  35.673  1.00 100.35 ? 233  ARG A CA    1 
ATOM   1792  C  C     . ARG A  1  233 ? 46.163  89.471  36.719  1.00 98.21  ? 233  ARG A C     1 
ATOM   1793  O  O     . ARG A  1  233 ? 45.005  89.740  36.394  1.00 98.18  ? 233  ARG A O     1 
ATOM   1794  C  CB    . ARG A  1  233 ? 47.778  90.799  35.293  1.00 100.47 ? 233  ARG A CB    1 
ATOM   1795  C  CG    . ARG A  1  233 ? 47.935  91.758  36.442  1.00 100.67 ? 233  ARG A CG    1 
ATOM   1796  C  CD    . ARG A  1  233 ? 48.585  93.042  35.968  1.00 101.72 ? 233  ARG A CD    1 
ATOM   1797  N  NE    . ARG A  1  233 ? 50.036  92.928  35.946  1.00 103.64 ? 233  ARG A NE    1 
ATOM   1798  C  CZ    . ARG A  1  233 ? 50.770  92.633  37.017  1.00 105.84 ? 233  ARG A CZ    1 
ATOM   1799  N  NH1   . ARG A  1  233 ? 50.177  92.421  38.193  1.00 106.21 ? 233  ARG A NH1   1 
ATOM   1800  N  NH2   . ARG A  1  233 ? 52.098  92.555  36.919  1.00 106.67 ? 233  ARG A NH2   1 
ATOM   1801  N  N     . CYS A  1  234 ? 46.510  89.224  37.979  1.00 95.21  ? 234  CYS A N     1 
ATOM   1802  C  CA    . CYS A  1  234 ? 45.537  89.238  39.060  1.00 91.73  ? 234  CYS A CA    1 
ATOM   1803  C  C     . CYS A  1  234 ? 45.450  90.609  39.722  1.00 89.40  ? 234  CYS A C     1 
ATOM   1804  O  O     . CYS A  1  234 ? 46.473  91.237  40.016  1.00 89.43  ? 234  CYS A O     1 
ATOM   1805  C  CB    . CYS A  1  234 ? 45.894  88.150  40.078  1.00 92.30  ? 234  CYS A CB    1 
ATOM   1806  S  SG    . CYS A  1  234 ? 45.546  86.433  39.511  1.00 93.22  ? 234  CYS A SG    1 
ATOM   1807  N  N     . ARG A  1  235 ? 44.217  91.065  39.946  1.00 86.37  ? 235  ARG A N     1 
ATOM   1808  C  CA    . ARG A  1  235 ? 43.938  92.373  40.548  1.00 83.18  ? 235  ARG A CA    1 
ATOM   1809  C  C     . ARG A  1  235 ? 44.019  92.446  42.055  1.00 80.20  ? 235  ARG A C     1 
ATOM   1810  O  O     . ARG A  1  235 ? 43.355  91.690  42.772  1.00 78.62  ? 235  ARG A O     1 
ATOM   1811  C  CB    . ARG A  1  235 ? 42.542  92.862  40.153  1.00 84.73  ? 235  ARG A CB    1 
ATOM   1812  C  CG    . ARG A  1  235 ? 42.083  94.107  40.927  1.00 85.80  ? 235  ARG A CG    1 
ATOM   1813  C  CD    . ARG A  1  235 ? 40.565  94.244  40.918  1.00 86.59  ? 235  ARG A CD    1 
ATOM   1814  N  NE    . ARG A  1  235 ? 39.923  93.202  41.713  1.00 87.88  ? 235  ARG A NE    1 
ATOM   1815  C  CZ    . ARG A  1  235 ? 38.663  92.797  41.558  1.00 88.85  ? 235  ARG A CZ    1 
ATOM   1816  N  NH1   . ARG A  1  235 ? 37.880  93.340  40.635  1.00 88.75  ? 235  ARG A NH1   1 
ATOM   1817  N  NH2   . ARG A  1  235 ? 38.180  91.832  42.328  1.00 90.42  ? 235  ARG A NH2   1 
ATOM   1818  N  N     . PHE A  1  236 ? 44.812  93.388  42.539  1.00 77.36  ? 236  PHE A N     1 
ATOM   1819  C  CA    . PHE A  1  236 ? 44.917  93.549  43.972  1.00 75.59  ? 236  PHE A CA    1 
ATOM   1820  C  C     . PHE A  1  236 ? 43.747  94.395  44.460  1.00 75.00  ? 236  PHE A C     1 
ATOM   1821  O  O     . PHE A  1  236 ? 43.295  95.321  43.777  1.00 75.23  ? 236  PHE A O     1 
ATOM   1822  C  CB    . PHE A  1  236 ? 46.225  94.216  44.357  1.00 74.48  ? 236  PHE A CB    1 
ATOM   1823  C  CG    . PHE A  1  236 ? 46.499  94.174  45.825  1.00 73.04  ? 236  PHE A CG    1 
ATOM   1824  C  CD1   . PHE A  1  236 ? 46.600  92.961  46.482  1.00 72.43  ? 236  PHE A CD1   1 
ATOM   1825  C  CD2   . PHE A  1  236 ? 46.662  95.343  46.551  1.00 72.99  ? 236  PHE A CD2   1 
ATOM   1826  C  CE1   . PHE A  1  236 ? 46.861  92.911  47.836  1.00 71.99  ? 236  PHE A CE1   1 
ATOM   1827  C  CE2   . PHE A  1  236 ? 46.924  95.302  47.906  1.00 72.24  ? 236  PHE A CE2   1 
ATOM   1828  C  CZ    . PHE A  1  236 ? 47.025  94.085  48.549  1.00 72.54  ? 236  PHE A CZ    1 
ATOM   1829  N  N     . THR A  1  237 ? 43.262  94.076  45.652  1.00 73.70  ? 237  THR A N     1 
ATOM   1830  C  CA    . THR A  1  237 ? 42.126  94.778  46.224  1.00 71.20  ? 237  THR A CA    1 
ATOM   1831  C  C     . THR A  1  237 ? 42.317  94.973  47.713  1.00 69.38  ? 237  THR A C     1 
ATOM   1832  O  O     . THR A  1  237 ? 42.016  94.089  48.520  1.00 69.43  ? 237  THR A O     1 
ATOM   1833  C  CB    . THR A  1  237 ? 40.833  93.984  45.998  1.00 71.40  ? 237  THR A CB    1 
ATOM   1834  O  OG1   . THR A  1  237 ? 40.538  93.929  44.594  1.00 71.87  ? 237  THR A OG1   1 
ATOM   1835  C  CG2   . THR A  1  237 ? 39.694  94.626  46.742  1.00 71.52  ? 237  THR A CG2   1 
ATOM   1836  N  N     . GLY A  1  238 ? 42.838  96.131  48.078  1.00 67.23  ? 238  GLY A N     1 
ATOM   1837  C  CA    . GLY A  1  238 ? 43.036  96.404  49.485  1.00 64.86  ? 238  GLY A CA    1 
ATOM   1838  C  C     . GLY A  1  238 ? 41.717  96.195  50.198  1.00 63.16  ? 238  GLY A C     1 
ATOM   1839  O  O     . GLY A  1  238 ? 40.718  96.856  49.897  1.00 63.57  ? 238  GLY A O     1 
ATOM   1840  N  N     . SER A  1  239 ? 41.693  95.260  51.133  1.00 60.49  ? 239  SER A N     1 
ATOM   1841  C  CA    . SER A  1  239 ? 40.466  94.998  51.863  1.00 58.08  ? 239  SER A CA    1 
ATOM   1842  C  C     . SER A  1  239 ? 40.750  93.983  52.928  1.00 56.03  ? 239  SER A C     1 
ATOM   1843  O  O     . SER A  1  239 ? 41.903  93.632  53.156  1.00 56.40  ? 239  SER A O     1 
ATOM   1844  C  CB    . SER A  1  239 ? 39.385  94.454  50.937  1.00 57.87  ? 239  SER A CB    1 
ATOM   1845  O  OG    . SER A  1  239 ? 39.735  93.164  50.477  1.00 58.48  ? 239  SER A OG    1 
ATOM   1846  N  N     . GLU A  1  240 ? 39.696  93.487  53.558  1.00 52.67  ? 240  GLU A N     1 
ATOM   1847  C  CA    . GLU A  1  240 ? 39.890  92.527  54.608  1.00 49.92  ? 240  GLU A CA    1 
ATOM   1848  C  C     . GLU A  1  240 ? 38.921  91.369  54.556  1.00 48.53  ? 240  GLU A C     1 
ATOM   1849  O  O     . GLU A  1  240 ? 37.997  91.337  53.739  1.00 48.08  ? 240  GLU A O     1 
ATOM   1850  C  CB    . GLU A  1  240 ? 39.782  93.240  55.958  1.00 49.70  ? 240  GLU A CB    1 
ATOM   1851  C  CG    . GLU A  1  240 ? 38.506  94.040  56.154  1.00 49.33  ? 240  GLU A CG    1 
ATOM   1852  C  CD    . GLU A  1  240 ? 38.405  94.677  57.545  1.00 50.20  ? 240  GLU A CD    1 
ATOM   1853  O  OE1   . GLU A  1  240 ? 39.264  95.511  57.913  1.00 49.86  ? 240  GLU A OE1   1 
ATOM   1854  O  OE2   . GLU A  1  240 ? 37.454  94.346  58.279  1.00 50.01  ? 240  GLU A OE2   1 
ATOM   1855  N  N     . ILE A  1  241 ? 39.180  90.404  55.430  1.00 46.80  ? 241  ILE A N     1 
ATOM   1856  C  CA    . ILE A  1  241 ? 38.341  89.230  55.606  1.00 44.91  ? 241  ILE A CA    1 
ATOM   1857  C  C     . ILE A  1  241 ? 38.538  88.821  57.072  1.00 45.78  ? 241  ILE A C     1 
ATOM   1858  O  O     . ILE A  1  241 ? 39.657  88.538  57.511  1.00 45.19  ? 241  ILE A O     1 
ATOM   1859  C  CB    . ILE A  1  241 ? 38.757  88.091  54.692  1.00 42.53  ? 241  ILE A CB    1 
ATOM   1860  C  CG1   . ILE A  1  241 ? 37.766  86.935  54.839  1.00 39.36  ? 241  ILE A CG1   1 
ATOM   1861  C  CG2   . ILE A  1  241 ? 40.186  87.683  55.010  1.00 43.30  ? 241  ILE A CG2   1 
ATOM   1862  C  CD1   . ILE A  1  241 ? 38.188  85.661  54.170  1.00 35.96  ? 241  ILE A CD1   1 
ATOM   1863  N  N     . ARG A  1  242 ? 37.450  88.825  57.836  1.00 47.07  ? 242  ARG A N     1 
ATOM   1864  C  CA    . ARG A  1  242 ? 37.504  88.478  59.254  1.00 48.24  ? 242  ARG A CA    1 
ATOM   1865  C  C     . ARG A  1  242 ? 36.751  87.194  59.575  1.00 49.60  ? 242  ARG A C     1 
ATOM   1866  O  O     . ARG A  1  242 ? 35.510  87.137  59.508  1.00 49.94  ? 242  ARG A O     1 
ATOM   1867  C  CB    . ARG A  1  242 ? 36.932  89.614  60.106  1.00 47.31  ? 242  ARG A CB    1 
ATOM   1868  C  CG    . ARG A  1  242 ? 37.513  90.952  59.763  1.00 47.88  ? 242  ARG A CG    1 
ATOM   1869  C  CD    . ARG A  1  242 ? 37.542  91.870  60.960  1.00 49.08  ? 242  ARG A CD    1 
ATOM   1870  N  NE    . ARG A  1  242 ? 38.306  93.088  60.672  1.00 50.72  ? 242  ARG A NE    1 
ATOM   1871  C  CZ    . ARG A  1  242 ? 38.690  93.965  61.597  1.00 51.26  ? 242  ARG A CZ    1 
ATOM   1872  N  NH1   . ARG A  1  242 ? 38.379  93.753  62.875  1.00 50.52  ? 242  ARG A NH1   1 
ATOM   1873  N  NH2   . ARG A  1  242 ? 39.387  95.046  61.246  1.00 51.20  ? 242  ARG A NH2   1 
ATOM   1874  N  N     . ALA A  1  243 ? 37.518  86.162  59.920  1.00 50.18  ? 243  ALA A N     1 
ATOM   1875  C  CA    . ALA A  1  243 ? 36.970  84.860  60.288  1.00 50.03  ? 243  ALA A CA    1 
ATOM   1876  C  C     . ALA A  1  243 ? 37.054  84.860  61.793  1.00 49.23  ? 243  ALA A C     1 
ATOM   1877  O  O     . ALA A  1  243 ? 38.149  84.790  62.340  1.00 50.22  ? 243  ALA A O     1 
ATOM   1878  C  CB    . ALA A  1  243 ? 37.837  83.753  59.720  1.00 51.32  ? 243  ALA A CB    1 
ATOM   1879  N  N     . ARG A  1  244 ? 35.922  84.939  62.477  1.00 47.89  ? 244  ARG A N     1 
ATOM   1880  C  CA    . ARG A  1  244 ? 36.000  85.008  63.925  1.00 46.80  ? 244  ARG A CA    1 
ATOM   1881  C  C     . ARG A  1  244 ? 35.584  83.763  64.630  1.00 45.87  ? 244  ARG A C     1 
ATOM   1882  O  O     . ARG A  1  244 ? 34.712  83.039  64.171  1.00 46.83  ? 244  ARG A O     1 
ATOM   1883  C  CB    . ARG A  1  244 ? 35.174  86.181  64.438  1.00 46.99  ? 244  ARG A CB    1 
ATOM   1884  C  CG    . ARG A  1  244 ? 35.133  86.319  65.947  1.00 47.68  ? 244  ARG A CG    1 
ATOM   1885  C  CD    . ARG A  1  244 ? 34.533  87.679  66.327  1.00 48.58  ? 244  ARG A CD    1 
ATOM   1886  N  NE    . ARG A  1  244 ? 34.296  87.844  67.762  1.00 46.70  ? 244  ARG A NE    1 
ATOM   1887  C  CZ    . ARG A  1  244 ? 33.977  89.005  68.319  1.00 45.36  ? 244  ARG A CZ    1 
ATOM   1888  N  NH1   . ARG A  1  244 ? 33.857  90.091  67.571  1.00 45.68  ? 244  ARG A NH1   1 
ATOM   1889  N  NH2   . ARG A  1  244 ? 33.790  89.084  69.619  1.00 45.22  ? 244  ARG A NH2   1 
ATOM   1890  N  N     . ASP A  1  245 ? 36.249  83.511  65.742  1.00 44.35  ? 245  ASP A N     1 
ATOM   1891  C  CA    . ASP A  1  245 ? 35.949  82.370  66.571  1.00 45.95  ? 245  ASP A CA    1 
ATOM   1892  C  C     . ASP A  1  245 ? 36.607  82.655  67.890  1.00 47.40  ? 245  ASP A C     1 
ATOM   1893  O  O     . ASP A  1  245 ? 37.761  82.298  68.099  1.00 48.10  ? 245  ASP A O     1 
ATOM   1894  C  CB    . ASP A  1  245 ? 36.526  81.076  66.013  1.00 45.30  ? 245  ASP A CB    1 
ATOM   1895  C  CG    . ASP A  1  245 ? 36.039  79.854  66.784  1.00 44.56  ? 245  ASP A CG    1 
ATOM   1896  O  OD1   . ASP A  1  245 ? 35.695  80.010  67.975  1.00 42.63  ? 245  ASP A OD1   1 
ATOM   1897  O  OD2   . ASP A  1  245 ? 35.999  78.743  66.209  1.00 44.28  ? 245  ASP A OD2   1 
ATOM   1898  N  N     . ASP A  1  246 ? 35.878  83.315  68.776  1.00 48.44  ? 246  ASP A N     1 
ATOM   1899  C  CA    . ASP A  1  246 ? 36.418  83.647  70.071  1.00 49.44  ? 246  ASP A CA    1 
ATOM   1900  C  C     . ASP A  1  246 ? 36.864  82.397  70.831  1.00 51.12  ? 246  ASP A C     1 
ATOM   1901  O  O     . ASP A  1  246 ? 37.697  82.469  71.738  1.00 51.61  ? 246  ASP A O     1 
ATOM   1902  C  CB    . ASP A  1  246 ? 35.373  84.420  70.876  1.00 48.93  ? 246  ASP A CB    1 
ATOM   1903  C  CG    . ASP A  1  246 ? 35.367  85.903  70.562  1.00 48.03  ? 246  ASP A CG    1 
ATOM   1904  O  OD1   . ASP A  1  246 ? 36.213  86.367  69.769  1.00 45.30  ? 246  ASP A OD1   1 
ATOM   1905  O  OD2   . ASP A  1  246 ? 34.516  86.612  71.130  1.00 49.29  ? 246  ASP A OD2   1 
ATOM   1906  N  N     . ALA A  1  247 ? 36.334  81.243  70.452  1.00 53.25  ? 247  ALA A N     1 
ATOM   1907  C  CA    . ALA A  1  247 ? 36.687  80.009  71.151  1.00 55.41  ? 247  ALA A CA    1 
ATOM   1908  C  C     . ALA A  1  247 ? 38.058  79.440  70.799  1.00 56.21  ? 247  ALA A C     1 
ATOM   1909  O  O     . ALA A  1  247 ? 38.361  78.299  71.159  1.00 57.07  ? 247  ALA A O     1 
ATOM   1910  C  CB    . ALA A  1  247 ? 35.607  78.950  70.930  1.00 56.21  ? 247  ALA A CB    1 
ATOM   1911  N  N     . LEU A  1  248 ? 38.879  80.224  70.097  1.00 56.20  ? 248  LEU A N     1 
ATOM   1912  C  CA    . LEU A  1  248 ? 40.222  79.780  69.732  1.00 55.15  ? 248  LEU A CA    1 
ATOM   1913  C  C     . LEU A  1  248 ? 41.241  80.454  70.631  1.00 54.72  ? 248  LEU A C     1 
ATOM   1914  O  O     . LEU A  1  248 ? 41.096  81.615  71.005  1.00 53.82  ? 248  LEU A O     1 
ATOM   1915  C  CB    . LEU A  1  248 ? 40.530  80.087  68.268  1.00 54.86  ? 248  LEU A CB    1 
ATOM   1916  C  CG    . LEU A  1  248 ? 39.650  79.348  67.269  1.00 53.24  ? 248  LEU A CG    1 
ATOM   1917  C  CD1   . LEU A  1  248 ? 40.152  79.635  65.874  1.00 53.53  ? 248  LEU A CD1   1 
ATOM   1918  C  CD2   . LEU A  1  248 ? 39.677  77.862  67.572  1.00 51.55  ? 248  LEU A CD2   1 
ATOM   1919  N  N     . PRO A  1  249 ? 42.302  79.724  70.968  1.00 55.19  ? 249  PRO A N     1 
ATOM   1920  C  CA    . PRO A  1  249 ? 43.411  80.137  71.829  1.00 54.91  ? 249  PRO A CA    1 
ATOM   1921  C  C     . PRO A  1  249 ? 43.994  81.490  71.502  1.00 53.37  ? 249  PRO A C     1 
ATOM   1922  O  O     . PRO A  1  249 ? 44.089  82.352  72.366  1.00 53.25  ? 249  PRO A O     1 
ATOM   1923  C  CB    . PRO A  1  249 ? 44.423  79.017  71.643  1.00 57.20  ? 249  PRO A CB    1 
ATOM   1924  C  CG    . PRO A  1  249 ? 44.200  78.632  70.194  1.00 58.84  ? 249  PRO A CG    1 
ATOM   1925  C  CD    . PRO A  1  249 ? 42.691  78.570  70.140  1.00 57.02  ? 249  PRO A CD    1 
ATOM   1926  N  N     . VAL A  1  250 ? 44.404  81.675  70.259  1.00 51.82  ? 250  VAL A N     1 
ATOM   1927  C  CA    . VAL A  1  250 ? 44.973  82.943  69.868  1.00 51.14  ? 250  VAL A CA    1 
ATOM   1928  C  C     . VAL A  1  250 ? 44.403  83.363  68.553  1.00 51.65  ? 250  VAL A C     1 
ATOM   1929  O  O     . VAL A  1  250 ? 43.863  82.551  67.797  1.00 51.76  ? 250  VAL A O     1 
ATOM   1930  C  CB    . VAL A  1  250 ? 46.496  82.873  69.725  1.00 49.76  ? 250  VAL A CB    1 
ATOM   1931  C  CG1   . VAL A  1  250 ? 47.118  82.535  71.043  1.00 49.91  ? 250  VAL A CG1   1 
ATOM   1932  C  CG2   . VAL A  1  250 ? 46.863  81.834  68.720  1.00 50.02  ? 250  VAL A CG2   1 
ATOM   1933  N  N     . ALA A  1  251 ? 44.520  84.650  68.291  1.00 52.05  ? 251  ALA A N     1 
ATOM   1934  C  CA    . ALA A  1  251 ? 44.036  85.189  67.052  1.00 53.86  ? 251  ALA A CA    1 
ATOM   1935  C  C     . ALA A  1  251 ? 45.269  85.364  66.161  1.00 54.98  ? 251  ALA A C     1 
ATOM   1936  O  O     . ALA A  1  251 ? 46.386  85.584  66.660  1.00 55.63  ? 251  ALA A O     1 
ATOM   1937  C  CB    . ALA A  1  251 ? 43.334  86.527  67.305  1.00 52.78  ? 251  ALA A CB    1 
ATOM   1938  N  N     . HIS A  1  252 ? 45.064  85.225  64.852  1.00 54.85  ? 252  HIS A N     1 
ATOM   1939  C  CA    . HIS A  1  252 ? 46.124  85.384  63.871  1.00 54.67  ? 252  HIS A CA    1 
ATOM   1940  C  C     . HIS A  1  252 ? 45.779  86.563  62.988  1.00 53.42  ? 252  HIS A C     1 
ATOM   1941  O  O     . HIS A  1  252 ? 44.638  86.724  62.583  1.00 52.80  ? 252  HIS A O     1 
ATOM   1942  C  CB    . HIS A  1  252 ? 46.239  84.145  62.994  1.00 57.43  ? 252  HIS A CB    1 
ATOM   1943  C  CG    . HIS A  1  252 ? 46.845  82.965  63.683  1.00 59.65  ? 252  HIS A CG    1 
ATOM   1944  N  ND1   . HIS A  1  252 ? 48.025  82.384  63.265  1.00 59.64  ? 252  HIS A ND1   1 
ATOM   1945  C  CD2   . HIS A  1  252 ? 46.422  82.237  64.743  1.00 60.31  ? 252  HIS A CD2   1 
ATOM   1946  C  CE1   . HIS A  1  252 ? 48.300  81.348  64.037  1.00 60.38  ? 252  HIS A CE1   1 
ATOM   1947  N  NE2   . HIS A  1  252 ? 47.344  81.237  64.942  1.00 60.91  ? 252  HIS A NE2   1 
ATOM   1948  N  N     . VAL A  1  253 ? 46.771  87.379  62.672  1.00 52.96  ? 253  VAL A N     1 
ATOM   1949  C  CA    . VAL A  1  253 ? 46.540  88.541  61.834  1.00 51.86  ? 253  VAL A CA    1 
ATOM   1950  C  C     . VAL A  1  253 ? 47.601  88.684  60.770  1.00 51.90  ? 253  VAL A C     1 
ATOM   1951  O  O     . VAL A  1  253 ? 48.791  88.586  61.041  1.00 52.46  ? 253  VAL A O     1 
ATOM   1952  C  CB    . VAL A  1  253 ? 46.529  89.817  62.667  1.00 50.70  ? 253  VAL A CB    1 
ATOM   1953  C  CG1   . VAL A  1  253 ? 46.175  90.981  61.797  1.00 50.03  ? 253  VAL A CG1   1 
ATOM   1954  C  CG2   . VAL A  1  253 ? 45.539  89.681  63.795  1.00 50.02  ? 253  VAL A CG2   1 
ATOM   1955  N  N     . ALA A  1  254 ? 47.165  88.928  59.551  1.00 52.43  ? 254  ALA A N     1 
ATOM   1956  C  CA    . ALA A  1  254 ? 48.093  89.091  58.451  1.00 54.20  ? 254  ALA A CA    1 
ATOM   1957  C  C     . ALA A  1  254 ? 47.712  90.347  57.663  1.00 55.74  ? 254  ALA A C     1 
ATOM   1958  O  O     . ALA A  1  254 ? 46.537  90.561  57.336  1.00 56.45  ? 254  ALA A O     1 
ATOM   1959  C  CB    . ALA A  1  254 ? 48.053  87.860  57.555  1.00 53.93  ? 254  ALA A CB    1 
ATOM   1960  N  N     . LEU A  1  255 ? 48.701  91.191  57.382  1.00 56.59  ? 255  LEU A N     1 
ATOM   1961  C  CA    . LEU A  1  255 ? 48.461  92.423  56.634  1.00 56.97  ? 255  LEU A CA    1 
ATOM   1962  C  C     . LEU A  1  255 ? 49.496  92.493  55.519  1.00 58.08  ? 255  LEU A C     1 
ATOM   1963  O  O     . LEU A  1  255 ? 50.646  92.095  55.720  1.00 59.80  ? 255  LEU A O     1 
ATOM   1964  C  CB    . LEU A  1  255 ? 48.600  93.647  57.550  1.00 53.87  ? 255  LEU A CB    1 
ATOM   1965  C  CG    . LEU A  1  255 ? 47.997  94.951  57.031  1.00 51.44  ? 255  LEU A CG    1 
ATOM   1966  C  CD1   . LEU A  1  255 ? 46.494  94.816  56.960  1.00 49.28  ? 255  LEU A CD1   1 
ATOM   1967  C  CD2   . LEU A  1  255 ? 48.388  96.094  57.941  1.00 50.23  ? 255  LEU A CD2   1 
ATOM   1968  N  N     . ALA A  1  256 ? 49.100  92.995  54.352  1.00 57.87  ? 256  ALA A N     1 
ATOM   1969  C  CA    . ALA A  1  256 ? 50.032  93.086  53.245  1.00 56.82  ? 256  ALA A CA    1 
ATOM   1970  C  C     . ALA A  1  256 ? 49.631  94.099  52.181  1.00 56.51  ? 256  ALA A C     1 
ATOM   1971  O  O     . ALA A  1  256 ? 48.469  94.469  52.074  1.00 54.96  ? 256  ALA A O     1 
ATOM   1972  C  CB    . ALA A  1  256 ? 50.195  91.709  52.626  1.00 56.91  ? 256  ALA A CB    1 
ATOM   1973  N  N     . VAL A  1  257 ? 50.622  94.542  51.410  1.00 57.39  ? 257  VAL A N     1 
ATOM   1974  C  CA    . VAL A  1  257 ? 50.449  95.483  50.302  1.00 59.67  ? 257  VAL A CA    1 
ATOM   1975  C  C     . VAL A  1  257 ? 50.833  94.746  49.018  1.00 62.85  ? 257  VAL A C     1 
ATOM   1976  O  O     . VAL A  1  257 ? 51.554  93.749  49.092  1.00 64.05  ? 257  VAL A O     1 
ATOM   1977  C  CB    . VAL A  1  257 ? 51.374  96.677  50.457  1.00 57.96  ? 257  VAL A CB    1 
ATOM   1978  C  CG1   . VAL A  1  257 ? 50.810  97.624  51.467  1.00 57.59  ? 257  VAL A CG1   1 
ATOM   1979  C  CG2   . VAL A  1  257 ? 52.740  96.210  50.901  1.00 56.08  ? 257  VAL A CG2   1 
ATOM   1980  N  N     . GLU A  1  258 ? 50.386  95.206  47.849  1.00 65.47  ? 258  GLU A N     1 
ATOM   1981  C  CA    . GLU A  1  258 ? 50.746  94.476  46.633  1.00 69.40  ? 258  GLU A CA    1 
ATOM   1982  C  C     . GLU A  1  258 ? 52.255  94.463  46.405  1.00 71.44  ? 258  GLU A C     1 
ATOM   1983  O  O     . GLU A  1  258 ? 52.913  95.492  46.568  1.00 71.05  ? 258  GLU A O     1 
ATOM   1984  C  CB    . GLU A  1  258 ? 50.055  95.049  45.386  1.00 70.89  ? 258  GLU A CB    1 
ATOM   1985  C  CG    . GLU A  1  258 ? 50.255  94.139  44.145  1.00 74.56  ? 258  GLU A CG    1 
ATOM   1986  C  CD    . GLU A  1  258 ? 49.665  94.680  42.834  1.00 76.86  ? 258  GLU A CD    1 
ATOM   1987  O  OE1   . GLU A  1  258 ? 48.438  94.939  42.775  1.00 77.98  ? 258  GLU A OE1   1 
ATOM   1988  O  OE2   . GLU A  1  258 ? 50.437  94.827  41.851  1.00 77.04  ? 258  GLU A OE2   1 
ATOM   1989  N  N     . GLY A  1  259 ? 52.785  93.288  46.040  1.00 73.96  ? 259  GLY A N     1 
ATOM   1990  C  CA    . GLY A  1  259 ? 54.211  93.113  45.777  1.00 76.84  ? 259  GLY A CA    1 
ATOM   1991  C  C     . GLY A  1  259 ? 54.522  93.288  44.293  1.00 79.20  ? 259  GLY A C     1 
ATOM   1992  O  O     . GLY A  1  259 ? 53.628  93.105  43.459  1.00 79.97  ? 259  GLY A O     1 
ATOM   1993  N  N     . PRO A  1  260 ? 55.776  93.623  43.923  1.00 79.93  ? 260  PRO A N     1 
ATOM   1994  C  CA    . PRO A  1  260 ? 56.196  93.830  42.530  1.00 80.34  ? 260  PRO A CA    1 
ATOM   1995  C  C     . PRO A  1  260 ? 56.250  92.615  41.595  1.00 81.71  ? 260  PRO A C     1 
ATOM   1996  O  O     . PRO A  1  260 ? 55.770  92.682  40.462  1.00 82.04  ? 260  PRO A O     1 
ATOM   1997  C  CB    . PRO A  1  260 ? 57.553  94.492  42.689  1.00 79.27  ? 260  PRO A CB    1 
ATOM   1998  C  CG    . PRO A  1  260 ? 58.089  93.802  43.898  1.00 79.32  ? 260  PRO A CG    1 
ATOM   1999  C  CD    . PRO A  1  260 ? 56.911  93.828  44.840  1.00 79.34  ? 260  PRO A CD    1 
ATOM   2000  N  N     . GLY A  1  261 ? 56.832  91.511  42.054  1.00 83.40  ? 261  GLY A N     1 
ATOM   2001  C  CA    . GLY A  1  261 ? 56.936  90.331  41.206  1.00 85.04  ? 261  GLY A CA    1 
ATOM   2002  C  C     . GLY A  1  261 ? 58.398  90.032  40.932  1.00 86.40  ? 261  GLY A C     1 
ATOM   2003  O  O     . GLY A  1  261 ? 59.164  90.956  40.660  1.00 87.49  ? 261  GLY A O     1 
ATOM   2004  N  N     . TRP A  1  262 ? 58.791  88.760  40.995  1.00 86.66  ? 262  TRP A N     1 
ATOM   2005  C  CA    . TRP A  1  262 ? 60.187  88.364  40.797  1.00 86.51  ? 262  TRP A CA    1 
ATOM   2006  C  C     . TRP A  1  262 ? 61.041  89.357  40.020  1.00 86.27  ? 262  TRP A C     1 
ATOM   2007  O  O     . TRP A  1  262 ? 62.023  89.888  40.539  1.00 85.51  ? 262  TRP A O     1 
ATOM   2008  C  CB    . TRP A  1  262 ? 60.253  87.000  40.132  1.00 86.93  ? 262  TRP A CB    1 
ATOM   2009  C  CG    . TRP A  1  262 ? 59.596  85.965  40.940  1.00 88.70  ? 262  TRP A CG    1 
ATOM   2010  C  CD1   . TRP A  1  262 ? 58.351  85.457  40.755  1.00 89.70  ? 262  TRP A CD1   1 
ATOM   2011  C  CD2   . TRP A  1  262 ? 60.123  85.328  42.103  1.00 90.01  ? 262  TRP A CD2   1 
ATOM   2012  N  NE1   . TRP A  1  262 ? 58.061  84.538  41.732  1.00 90.65  ? 262  TRP A NE1   1 
ATOM   2013  C  CE2   . TRP A  1  262 ? 59.135  84.439  42.575  1.00 90.77  ? 262  TRP A CE2   1 
ATOM   2014  C  CE3   . TRP A  1  262 ? 61.335  85.422  42.794  1.00 91.35  ? 262  TRP A CE3   1 
ATOM   2015  C  CZ2   . TRP A  1  262 ? 59.319  83.642  43.712  1.00 91.83  ? 262  TRP A CZ2   1 
ATOM   2016  C  CZ3   . TRP A  1  262 ? 61.524  84.629  43.926  1.00 92.93  ? 262  TRP A CZ3   1 
ATOM   2017  C  CH2   . TRP A  1  262 ? 60.516  83.749  44.373  1.00 92.94  ? 262  TRP A CH2   1 
ATOM   2018  N  N     . ALA A  1  263 ? 60.654  89.610  38.777  1.00 86.36  ? 263  ALA A N     1 
ATOM   2019  C  CA    . ALA A  1  263 ? 61.373  90.541  37.917  1.00 86.65  ? 263  ALA A CA    1 
ATOM   2020  C  C     . ALA A  1  263 ? 62.066  91.703  38.660  1.00 87.12  ? 263  ALA A C     1 
ATOM   2021  O  O     . ALA A  1  263 ? 63.296  91.737  38.778  1.00 87.49  ? 263  ALA A O     1 
ATOM   2022  C  CB    . ALA A  1  263 ? 60.408  91.093  36.845  1.00 85.88  ? 263  ALA A CB    1 
ATOM   2023  N  N     . ASP A  1  264 ? 61.262  92.641  39.160  1.00 87.55  ? 264  ASP A N     1 
ATOM   2024  C  CA    . ASP A  1  264 ? 61.731  93.846  39.861  1.00 87.02  ? 264  ASP A CA    1 
ATOM   2025  C  C     . ASP A  1  264 ? 62.962  93.691  40.751  1.00 85.35  ? 264  ASP A C     1 
ATOM   2026  O  O     . ASP A  1  264 ? 62.999  92.853  41.642  1.00 84.49  ? 264  ASP A O     1 
ATOM   2027  C  CB    . ASP A  1  264 ? 60.579  94.457  40.682  1.00 88.53  ? 264  ASP A CB    1 
ATOM   2028  C  CG    . ASP A  1  264 ? 60.318  95.935  40.345  1.00 88.68  ? 264  ASP A CG    1 
ATOM   2029  O  OD1   . ASP A  1  264 ? 61.218  96.771  40.599  1.00 86.99  ? 264  ASP A OD1   1 
ATOM   2030  O  OD2   . ASP A  1  264 ? 59.211  96.249  39.833  1.00 88.76  ? 264  ASP A OD2   1 
ATOM   2031  N  N     . PRO A  1  265 ? 63.983  94.522  40.511  1.00 84.52  ? 265  PRO A N     1 
ATOM   2032  C  CA    . PRO A  1  265 ? 65.257  94.565  41.230  1.00 84.84  ? 265  PRO A CA    1 
ATOM   2033  C  C     . PRO A  1  265 ? 65.012  95.164  42.596  1.00 85.10  ? 265  PRO A C     1 
ATOM   2034  O  O     . PRO A  1  265 ? 65.924  95.261  43.428  1.00 84.53  ? 265  PRO A O     1 
ATOM   2035  C  CB    . PRO A  1  265 ? 66.111  95.496  40.380  1.00 85.39  ? 265  PRO A CB    1 
ATOM   2036  C  CG    . PRO A  1  265 ? 65.432  95.492  39.036  1.00 85.75  ? 265  PRO A CG    1 
ATOM   2037  C  CD    . PRO A  1  265 ? 63.992  95.489  39.407  1.00 85.09  ? 265  PRO A CD    1 
ATOM   2038  N  N     . ASP A  1  266 ? 63.774  95.605  42.800  1.00 85.33  ? 266  ASP A N     1 
ATOM   2039  C  CA    . ASP A  1  266 ? 63.387  96.197  44.067  1.00 85.30  ? 266  ASP A CA    1 
ATOM   2040  C  C     . ASP A  1  266 ? 63.279  95.092  45.109  1.00 84.08  ? 266  ASP A C     1 
ATOM   2041  O  O     . ASP A  1  266 ? 63.671  95.288  46.261  1.00 85.10  ? 266  ASP A O     1 
ATOM   2042  C  CB    . ASP A  1  266 ? 62.043  96.938  43.953  1.00 86.43  ? 266  ASP A CB    1 
ATOM   2043  C  CG    . ASP A  1  266 ? 62.152  98.246  43.187  1.00 88.00  ? 266  ASP A CG    1 
ATOM   2044  O  OD1   . ASP A  1  266 ? 63.170  98.959  43.355  1.00 89.94  ? 266  ASP A OD1   1 
ATOM   2045  O  OD2   . ASP A  1  266 ? 61.208  98.570  42.432  1.00 88.21  ? 266  ASP A OD2   1 
ATOM   2046  N  N     . ASN A  1  267 ? 62.763  93.930  44.707  1.00 81.11  ? 267  ASN A N     1 
ATOM   2047  C  CA    . ASN A  1  267 ? 62.617  92.828  45.642  1.00 78.98  ? 267  ASN A CA    1 
ATOM   2048  C  C     . ASN A  1  267 ? 63.798  92.767  46.582  1.00 78.72  ? 267  ASN A C     1 
ATOM   2049  O  O     . ASN A  1  267 ? 63.639  92.493  47.770  1.00 78.34  ? 267  ASN A O     1 
ATOM   2050  C  CB    . ASN A  1  267 ? 62.464  91.513  44.902  1.00 78.51  ? 267  ASN A CB    1 
ATOM   2051  C  CG    . ASN A  1  267 ? 61.059  91.302  44.414  1.00 78.54  ? 267  ASN A CG    1 
ATOM   2052  O  OD1   . ASN A  1  267 ? 60.136  91.108  45.204  1.00 77.59  ? 267  ASN A OD1   1 
ATOM   2053  N  ND2   . ASN A  1  267 ? 60.880  91.356  43.105  1.00 79.38  ? 267  ASN A ND2   1 
ATOM   2054  N  N     . VAL A  1  268 ? 64.984  93.041  46.051  1.00 78.60  ? 268  VAL A N     1 
ATOM   2055  C  CA    . VAL A  1  268 ? 66.187  93.043  46.871  1.00 78.63  ? 268  VAL A CA    1 
ATOM   2056  C  C     . VAL A  1  268 ? 65.879  93.916  48.086  1.00 77.74  ? 268  VAL A C     1 
ATOM   2057  O  O     . VAL A  1  268 ? 65.662  93.414  49.196  1.00 77.34  ? 268  VAL A O     1 
ATOM   2058  C  CB    . VAL A  1  268 ? 67.390  93.663  46.115  1.00 79.21  ? 268  VAL A CB    1 
ATOM   2059  C  CG1   . VAL A  1  268 ? 68.675  93.467  46.916  1.00 80.27  ? 268  VAL A CG1   1 
ATOM   2060  C  CG2   . VAL A  1  268 ? 67.521  93.040  44.746  1.00 79.74  ? 268  VAL A CG2   1 
ATOM   2061  N  N     . VAL A  1  269 ? 65.841  95.225  47.848  1.00 76.44  ? 269  VAL A N     1 
ATOM   2062  C  CA    . VAL A  1  269 ? 65.561  96.212  48.886  1.00 75.17  ? 269  VAL A CA    1 
ATOM   2063  C  C     . VAL A  1  269 ? 64.510  95.713  49.862  1.00 74.35  ? 269  VAL A C     1 
ATOM   2064  O  O     . VAL A  1  269 ? 64.745  95.648  51.071  1.00 74.29  ? 269  VAL A O     1 
ATOM   2065  C  CB    . VAL A  1  269 ? 65.044  97.522  48.282  1.00 75.00  ? 269  VAL A CB    1 
ATOM   2066  C  CG1   . VAL A  1  269 ? 64.987  98.598  49.349  1.00 74.49  ? 269  VAL A CG1   1 
ATOM   2067  C  CG2   . VAL A  1  269 ? 65.933  97.942  47.135  1.00 75.86  ? 269  VAL A CG2   1 
ATOM   2068  N  N     . LEU A  1  270 ? 63.346  95.365  49.333  1.00 72.82  ? 270  LEU A N     1 
ATOM   2069  C  CA    . LEU A  1  270 ? 62.277  94.879  50.179  1.00 71.60  ? 270  LEU A CA    1 
ATOM   2070  C  C     . LEU A  1  270 ? 62.786  93.843  51.177  1.00 71.79  ? 270  LEU A C     1 
ATOM   2071  O  O     . LEU A  1  270 ? 62.514  93.947  52.372  1.00 71.09  ? 270  LEU A O     1 
ATOM   2072  C  CB    . LEU A  1  270 ? 61.150  94.294  49.324  1.00 69.54  ? 270  LEU A CB    1 
ATOM   2073  C  CG    . LEU A  1  270 ? 60.489  95.301  48.379  1.00 67.77  ? 270  LEU A CG    1 
ATOM   2074  C  CD1   . LEU A  1  270 ? 59.222  94.708  47.840  1.00 67.44  ? 270  LEU A CD1   1 
ATOM   2075  C  CD2   . LEU A  1  270 ? 60.170  96.584  49.100  1.00 67.23  ? 270  LEU A CD2   1 
ATOM   2076  N  N     . HIS A  1  271 ? 63.544  92.859  50.704  1.00 72.22  ? 271  HIS A N     1 
ATOM   2077  C  CA    . HIS A  1  271 ? 64.047  91.835  51.610  1.00 72.64  ? 271  HIS A CA    1 
ATOM   2078  C  C     . HIS A  1  271 ? 64.975  92.417  52.652  1.00 70.86  ? 271  HIS A C     1 
ATOM   2079  O  O     . HIS A  1  271 ? 65.006  91.937  53.783  1.00 69.70  ? 271  HIS A O     1 
ATOM   2080  C  CB    . HIS A  1  271 ? 64.741  90.708  50.840  1.00 76.32  ? 271  HIS A CB    1 
ATOM   2081  C  CG    . HIS A  1  271 ? 63.789  89.697  50.264  1.00 80.51  ? 271  HIS A CG    1 
ATOM   2082  N  ND1   . HIS A  1  271 ? 63.527  89.598  48.912  1.00 81.53  ? 271  HIS A ND1   1 
ATOM   2083  C  CD2   . HIS A  1  271 ? 63.018  88.755  50.863  1.00 82.08  ? 271  HIS A CD2   1 
ATOM   2084  C  CE1   . HIS A  1  271 ? 62.639  88.641  48.702  1.00 81.60  ? 271  HIS A CE1   1 
ATOM   2085  N  NE2   . HIS A  1  271 ? 62.314  88.113  49.869  1.00 83.00  ? 271  HIS A NE2   1 
ATOM   2086  N  N     . VAL A  1  272 ? 65.726  93.448  52.270  1.00 69.72  ? 272  VAL A N     1 
ATOM   2087  C  CA    . VAL A  1  272 ? 66.633  94.112  53.202  1.00 69.07  ? 272  VAL A CA    1 
ATOM   2088  C  C     . VAL A  1  272 ? 65.760  94.681  54.304  1.00 69.25  ? 272  VAL A C     1 
ATOM   2089  O  O     . VAL A  1  272 ? 66.028  94.501  55.495  1.00 69.63  ? 272  VAL A O     1 
ATOM   2090  C  CB    . VAL A  1  272 ? 67.382  95.285  52.544  1.00 68.34  ? 272  VAL A CB    1 
ATOM   2091  C  CG1   . VAL A  1  272 ? 68.151  96.074  53.599  1.00 67.57  ? 272  VAL A CG1   1 
ATOM   2092  C  CG2   . VAL A  1  272 ? 68.321  94.762  51.485  1.00 67.97  ? 272  VAL A CG2   1 
ATOM   2093  N  N     . ALA A  1  273 ? 64.708  95.378  53.892  1.00 68.08  ? 273  ALA A N     1 
ATOM   2094  C  CA    . ALA A  1  273 ? 63.782  95.962  54.842  1.00 66.03  ? 273  ALA A CA    1 
ATOM   2095  C  C     . ALA A  1  273 ? 63.305  94.845  55.763  1.00 64.86  ? 273  ALA A C     1 
ATOM   2096  O  O     . ALA A  1  273 ? 63.568  94.865  56.958  1.00 62.77  ? 273  ALA A O     1 
ATOM   2097  C  CB    . ALA A  1  273 ? 62.617  96.577  54.103  1.00 65.79  ? 273  ALA A CB    1 
ATOM   2098  N  N     . ASN A  1  274 ? 62.626  93.862  55.182  1.00 65.10  ? 274  ASN A N     1 
ATOM   2099  C  CA    . ASN A  1  274 ? 62.101  92.719  55.918  1.00 65.51  ? 274  ASN A CA    1 
ATOM   2100  C  C     . ASN A  1  274 ? 63.107  92.130  56.893  1.00 64.61  ? 274  ASN A C     1 
ATOM   2101  O  O     . ASN A  1  274 ? 62.743  91.372  57.781  1.00 63.18  ? 274  ASN A O     1 
ATOM   2102  C  CB    . ASN A  1  274 ? 61.656  91.627  54.936  1.00 68.89  ? 274  ASN A CB    1 
ATOM   2103  C  CG    . ASN A  1  274 ? 60.172  91.717  54.569  1.00 71.56  ? 274  ASN A CG    1 
ATOM   2104  O  OD1   . ASN A  1  274 ? 59.692  90.970  53.703  1.00 72.45  ? 274  ASN A OD1   1 
ATOM   2105  N  ND2   . ASN A  1  274 ? 59.439  92.617  55.230  1.00 72.59  ? 274  ASN A ND2   1 
ATOM   2106  N  N     . ALA A  1  275 ? 64.377  92.462  56.718  1.00 64.95  ? 275  ALA A N     1 
ATOM   2107  C  CA    . ALA A  1  275 ? 65.415  91.948  57.604  1.00 65.20  ? 275  ALA A CA    1 
ATOM   2108  C  C     . ALA A  1  275 ? 65.534  92.832  58.845  1.00 65.46  ? 275  ALA A C     1 
ATOM   2109  O  O     . ALA A  1  275 ? 65.931  92.363  59.918  1.00 64.87  ? 275  ALA A O     1 
ATOM   2110  C  CB    . ALA A  1  275 ? 66.740  91.899  56.871  1.00 65.34  ? 275  ALA A CB    1 
ATOM   2111  N  N     . ILE A  1  276 ? 65.189  94.110  58.679  1.00 65.26  ? 276  ILE A N     1 
ATOM   2112  C  CA    . ILE A  1  276 ? 65.231  95.093  59.758  1.00 64.61  ? 276  ILE A CA    1 
ATOM   2113  C  C     . ILE A  1  276 ? 64.154  94.823  60.815  1.00 65.61  ? 276  ILE A C     1 
ATOM   2114  O  O     . ILE A  1  276 ? 64.417  94.911  62.012  1.00 65.76  ? 276  ILE A O     1 
ATOM   2115  C  CB    . ILE A  1  276 ? 65.013  96.503  59.215  1.00 63.16  ? 276  ILE A CB    1 
ATOM   2116  C  CG1   . ILE A  1  276 ? 66.096  96.833  58.195  1.00 62.13  ? 276  ILE A CG1   1 
ATOM   2117  C  CG2   . ILE A  1  276 ? 65.004  97.493  60.356  1.00 63.11  ? 276  ILE A CG2   1 
ATOM   2118  C  CD1   . ILE A  1  276 ? 65.941  98.195  57.554  1.00 61.90  ? 276  ILE A CD1   1 
ATOM   2119  N  N     . ILE A  1  277 ? 62.939  94.515  60.361  1.00 66.73  ? 277  ILE A N     1 
ATOM   2120  C  CA    . ILE A  1  277 ? 61.811  94.221  61.248  1.00 66.82  ? 277  ILE A CA    1 
ATOM   2121  C  C     . ILE A  1  277 ? 61.885  92.765  61.666  1.00 68.44  ? 277  ILE A C     1 
ATOM   2122  O  O     . ILE A  1  277 ? 61.273  92.359  62.649  1.00 68.90  ? 277  ILE A O     1 
ATOM   2123  C  CB    . ILE A  1  277 ? 60.464  94.450  60.540  1.00 65.14  ? 277  ILE A CB    1 
ATOM   2124  C  CG1   . ILE A  1  277 ? 60.288  95.933  60.234  1.00 65.59  ? 277  ILE A CG1   1 
ATOM   2125  C  CG2   . ILE A  1  277 ? 59.332  93.968  61.405  1.00 63.72  ? 277  ILE A CG2   1 
ATOM   2126  C  CD1   . ILE A  1  277 ? 59.075  96.234  59.385  1.00 65.15  ? 277  ILE A CD1   1 
ATOM   2127  N  N     . GLY A  1  278 ? 62.635  91.986  60.893  1.00 70.47  ? 278  GLY A N     1 
ATOM   2128  C  CA    . GLY A  1  278 ? 62.816  90.570  61.170  1.00 72.62  ? 278  GLY A CA    1 
ATOM   2129  C  C     . GLY A  1  278 ? 61.593  89.767  61.582  1.00 73.42  ? 278  GLY A C     1 
ATOM   2130  O  O     . GLY A  1  278 ? 60.480  89.943  61.069  1.00 72.70  ? 278  GLY A O     1 
ATOM   2131  N  N     . ARG A  1  279 ? 61.817  88.852  62.513  1.00 74.30  ? 279  ARG A N     1 
ATOM   2132  C  CA    . ARG A  1  279 ? 60.746  88.015  63.009  1.00 75.74  ? 279  ARG A CA    1 
ATOM   2133  C  C     . ARG A  1  279 ? 61.058  87.643  64.452  1.00 74.66  ? 279  ARG A C     1 
ATOM   2134  O  O     . ARG A  1  279 ? 62.220  87.612  64.848  1.00 75.21  ? 279  ARG A O     1 
ATOM   2135  C  CB    . ARG A  1  279 ? 60.598  86.777  62.116  1.00 79.04  ? 279  ARG A CB    1 
ATOM   2136  C  CG    . ARG A  1  279 ? 61.838  85.908  61.999  1.00 84.16  ? 279  ARG A CG    1 
ATOM   2137  C  CD    . ARG A  1  279 ? 61.779  84.990  60.772  1.00 88.25  ? 279  ARG A CD    1 
ATOM   2138  N  NE    . ARG A  1  279 ? 62.685  83.840  60.893  1.00 92.00  ? 279  ARG A NE    1 
ATOM   2139  C  CZ    . ARG A  1  279 ? 62.415  82.727  61.586  1.00 92.61  ? 279  ARG A CZ    1 
ATOM   2140  N  NH1   . ARG A  1  279 ? 61.257  82.592  62.231  1.00 92.07  ? 279  ARG A NH1   1 
ATOM   2141  N  NH2   . ARG A  1  279 ? 63.308  81.743  61.632  1.00 92.84  ? 279  ARG A NH2   1 
ATOM   2142  N  N     . TYR A  1  280 ? 60.020  87.399  65.243  1.00 73.25  ? 280  TYR A N     1 
ATOM   2143  C  CA    . TYR A  1  280 ? 60.196  87.049  66.644  1.00 71.70  ? 280  TYR A CA    1 
ATOM   2144  C  C     . TYR A  1  280 ? 59.266  85.925  67.041  1.00 71.04  ? 280  TYR A C     1 
ATOM   2145  O  O     . TYR A  1  280 ? 58.297  85.630  66.345  1.00 70.40  ? 280  TYR A O     1 
ATOM   2146  C  CB    . TYR A  1  280 ? 59.931  88.259  67.535  1.00 71.43  ? 280  TYR A CB    1 
ATOM   2147  C  CG    . TYR A  1  280 ? 59.769  87.900  68.991  1.00 71.68  ? 280  TYR A CG    1 
ATOM   2148  C  CD1   . TYR A  1  280 ? 60.867  87.635  69.791  1.00 71.98  ? 280  TYR A CD1   1 
ATOM   2149  C  CD2   . TYR A  1  280 ? 58.509  87.787  69.560  1.00 72.20  ? 280  TYR A CD2   1 
ATOM   2150  C  CE1   . TYR A  1  280 ? 60.709  87.265  71.131  1.00 72.47  ? 280  TYR A CE1   1 
ATOM   2151  C  CE2   . TYR A  1  280 ? 58.343  87.419  70.889  1.00 72.10  ? 280  TYR A CE2   1 
ATOM   2152  C  CZ    . TYR A  1  280 ? 59.442  87.161  71.670  1.00 72.08  ? 280  TYR A CZ    1 
ATOM   2153  O  OH    . TYR A  1  280 ? 59.270  86.812  72.992  1.00 73.05  ? 280  TYR A OH    1 
ATOM   2154  N  N     . ASP A  1  281 ? 59.560  85.317  68.182  1.00 70.99  ? 281  ASP A N     1 
ATOM   2155  C  CA    . ASP A  1  281 ? 58.776  84.209  68.673  1.00 72.37  ? 281  ASP A CA    1 
ATOM   2156  C  C     . ASP A  1  281 ? 59.239  83.775  70.058  1.00 73.69  ? 281  ASP A C     1 
ATOM   2157  O  O     . ASP A  1  281 ? 60.419  83.524  70.273  1.00 74.67  ? 281  ASP A O     1 
ATOM   2158  C  CB    . ASP A  1  281 ? 58.894  83.053  67.678  1.00 73.17  ? 281  ASP A CB    1 
ATOM   2159  C  CG    . ASP A  1  281 ? 59.174  81.727  68.344  1.00 73.22  ? 281  ASP A CG    1 
ATOM   2160  O  OD1   . ASP A  1  281 ? 58.338  81.309  69.172  1.00 74.90  ? 281  ASP A OD1   1 
ATOM   2161  O  OD2   . ASP A  1  281 ? 60.216  81.107  68.033  1.00 71.51  ? 281  ASP A OD2   1 
ATOM   2162  N  N     . ARG A  1  282 ? 58.293  83.689  70.988  1.00 74.76  ? 282  ARG A N     1 
ATOM   2163  C  CA    . ARG A  1  282 ? 58.533  83.278  72.376  1.00 75.94  ? 282  ARG A CA    1 
ATOM   2164  C  C     . ARG A  1  282 ? 59.883  82.651  72.781  1.00 76.78  ? 282  ARG A C     1 
ATOM   2165  O  O     . ARG A  1  282 ? 60.499  83.100  73.756  1.00 77.56  ? 282  ARG A O     1 
ATOM   2166  C  CB    . ARG A  1  282 ? 57.427  82.317  72.803  1.00 76.16  ? 282  ARG A CB    1 
ATOM   2167  C  CG    . ARG A  1  282 ? 56.087  82.936  72.805  1.00 78.75  ? 282  ARG A CG    1 
ATOM   2168  C  CD    . ARG A  1  282 ? 56.019  83.946  73.915  1.00 81.49  ? 282  ARG A CD    1 
ATOM   2169  N  NE    . ARG A  1  282 ? 55.302  83.400  75.062  1.00 84.65  ? 282  ARG A NE    1 
ATOM   2170  C  CZ    . ARG A  1  282 ? 55.011  84.091  76.158  1.00 86.20  ? 282  ARG A CZ    1 
ATOM   2171  N  NH1   . ARG A  1  282 ? 55.383  85.364  76.258  1.00 87.64  ? 282  ARG A NH1   1 
ATOM   2172  N  NH2   . ARG A  1  282 ? 54.344  83.509  77.150  1.00 86.32  ? 282  ARG A NH2   1 
ATOM   2173  N  N     . THR A  1  283 ? 60.331  81.619  72.050  1.00 76.19  ? 283  THR A N     1 
ATOM   2174  C  CA    . THR A  1  283 ? 61.570  80.891  72.377  1.00 73.89  ? 283  THR A CA    1 
ATOM   2175  C  C     . THR A  1  283 ? 62.906  81.571  72.109  1.00 73.84  ? 283  THR A C     1 
ATOM   2176  O  O     . THR A  1  283 ? 63.912  81.181  72.699  1.00 74.00  ? 283  THR A O     1 
ATOM   2177  C  CB    . THR A  1  283 ? 61.617  79.523  71.689  1.00 71.81  ? 283  THR A CB    1 
ATOM   2178  O  OG1   . THR A  1  283 ? 61.777  79.715  70.289  1.00 70.83  ? 283  THR A OG1   1 
ATOM   2179  C  CG2   . THR A  1  283 ? 60.338  78.744  71.939  1.00 70.08  ? 283  THR A CG2   1 
ATOM   2180  N  N     . PHE A  1  284 ? 62.938  82.556  71.217  1.00 73.22  ? 284  PHE A N     1 
ATOM   2181  C  CA    . PHE A  1  284 ? 64.184  83.267  70.959  1.00 73.74  ? 284  PHE A CA    1 
ATOM   2182  C  C     . PHE A  1  284 ? 64.737  83.633  72.322  1.00 75.25  ? 284  PHE A C     1 
ATOM   2183  O  O     . PHE A  1  284 ? 63.999  84.135  73.168  1.00 76.52  ? 284  PHE A O     1 
ATOM   2184  C  CB    . PHE A  1  284 ? 63.930  84.558  70.193  1.00 72.74  ? 284  PHE A CB    1 
ATOM   2185  C  CG    . PHE A  1  284 ? 63.534  84.351  68.775  1.00 72.41  ? 284  PHE A CG    1 
ATOM   2186  C  CD1   . PHE A  1  284 ? 62.481  83.503  68.449  1.00 72.83  ? 284  PHE A CD1   1 
ATOM   2187  C  CD2   . PHE A  1  284 ? 64.204  85.006  67.759  1.00 71.77  ? 284  PHE A CD2   1 
ATOM   2188  C  CE1   . PHE A  1  284 ? 62.099  83.309  67.130  1.00 72.18  ? 284  PHE A CE1   1 
ATOM   2189  C  CE2   . PHE A  1  284 ? 63.830  84.819  66.442  1.00 72.16  ? 284  PHE A CE2   1 
ATOM   2190  C  CZ    . PHE A  1  284 ? 62.772  83.965  66.126  1.00 72.12  ? 284  PHE A CZ    1 
ATOM   2191  N  N     . GLY A  1  285 ? 66.023  83.382  72.543  1.00 75.79  ? 285  GLY A N     1 
ATOM   2192  C  CA    . GLY A  1  285 ? 66.614  83.707  73.830  1.00 75.92  ? 285  GLY A CA    1 
ATOM   2193  C  C     . GLY A  1  285 ? 67.038  85.162  73.913  1.00 76.00  ? 285  GLY A C     1 
ATOM   2194  O  O     . GLY A  1  285 ? 67.184  85.723  75.014  1.00 74.60  ? 285  GLY A O     1 
ATOM   2195  N  N     . GLY A  1  286 ? 67.226  85.769  72.741  1.00 76.17  ? 286  GLY A N     1 
ATOM   2196  C  CA    . GLY A  1  286 ? 67.645  87.157  72.673  1.00 78.49  ? 286  GLY A CA    1 
ATOM   2197  C  C     . GLY A  1  286 ? 66.828  88.049  73.582  1.00 79.97  ? 286  GLY A C     1 
ATOM   2198  O  O     . GLY A  1  286 ? 67.377  88.834  74.366  1.00 80.94  ? 286  GLY A O     1 
ATOM   2199  N  N     . GLY A  1  287 ? 65.507  87.924  73.458  1.00 80.44  ? 287  GLY A N     1 
ATOM   2200  C  CA    . GLY A  1  287 ? 64.577  88.692  74.269  1.00 78.87  ? 287  GLY A CA    1 
ATOM   2201  C  C     . GLY A  1  287 ? 64.684  90.196  74.151  1.00 77.99  ? 287  GLY A C     1 
ATOM   2202  O  O     . GLY A  1  287 ? 65.041  90.732  73.102  1.00 76.77  ? 287  GLY A O     1 
ATOM   2203  N  N     . LYS A  1  288 ? 64.374  90.864  75.259  1.00 77.87  ? 288  LYS A N     1 
ATOM   2204  C  CA    . LYS A  1  288 ? 64.394  92.320  75.367  1.00 77.87  ? 288  LYS A CA    1 
ATOM   2205  C  C     . LYS A  1  288 ? 65.578  92.978  74.693  1.00 76.53  ? 288  LYS A C     1 
ATOM   2206  O  O     . LYS A  1  288 ? 65.601  94.189  74.524  1.00 75.48  ? 288  LYS A O     1 
ATOM   2207  C  CB    . LYS A  1  288 ? 64.396  92.735  76.840  1.00 80.43  ? 288  LYS A CB    1 
ATOM   2208  C  CG    . LYS A  1  288 ? 65.660  92.286  77.615  1.00 84.71  ? 288  LYS A CG    1 
ATOM   2209  C  CD    . LYS A  1  288 ? 65.800  92.935  79.029  1.00 86.92  ? 288  LYS A CD    1 
ATOM   2210  C  CE    . LYS A  1  288 ? 67.088  92.472  79.757  1.00 87.15  ? 288  LYS A CE    1 
ATOM   2211  N  NZ    . LYS A  1  288 ? 67.387  93.205  81.029  1.00 87.80  ? 288  LYS A NZ    1 
ATOM   2212  N  N     . HIS A  1  289 ? 66.566  92.187  74.311  1.00 76.51  ? 289  HIS A N     1 
ATOM   2213  C  CA    . HIS A  1  289 ? 67.748  92.749  73.694  1.00 77.13  ? 289  HIS A CA    1 
ATOM   2214  C  C     . HIS A  1  289 ? 67.815  92.706  72.173  1.00 76.03  ? 289  HIS A C     1 
ATOM   2215  O  O     . HIS A  1  289 ? 68.550  93.485  71.563  1.00 76.26  ? 289  HIS A O     1 
ATOM   2216  C  CB    . HIS A  1  289 ? 68.989  92.094  74.296  1.00 79.80  ? 289  HIS A CB    1 
ATOM   2217  C  CG    . HIS A  1  289 ? 69.273  92.529  75.702  1.00 82.60  ? 289  HIS A CG    1 
ATOM   2218  N  ND1   . HIS A  1  289 ? 69.269  93.855  76.085  1.00 83.76  ? 289  HIS A ND1   1 
ATOM   2219  C  CD2   . HIS A  1  289 ? 69.598  91.819  76.809  1.00 83.75  ? 289  HIS A CD2   1 
ATOM   2220  C  CE1   . HIS A  1  289 ? 69.581  93.942  77.367  1.00 84.46  ? 289  HIS A CE1   1 
ATOM   2221  N  NE2   . HIS A  1  289 ? 69.786  92.721  77.830  1.00 84.67  ? 289  HIS A NE2   1 
ATOM   2222  N  N     . LEU A  1  290 ? 67.057  91.808  71.558  1.00 74.15  ? 290  LEU A N     1 
ATOM   2223  C  CA    . LEU A  1  290 ? 67.050  91.701  70.105  1.00 72.45  ? 290  LEU A CA    1 
ATOM   2224  C  C     . LEU A  1  290 ? 67.231  93.049  69.423  1.00 71.44  ? 290  LEU A C     1 
ATOM   2225  O  O     . LEU A  1  290 ? 66.929  94.097  69.985  1.00 70.91  ? 290  LEU A O     1 
ATOM   2226  C  CB    . LEU A  1  290 ? 65.748  91.071  69.655  1.00 72.83  ? 290  LEU A CB    1 
ATOM   2227  C  CG    . LEU A  1  290 ? 65.687  89.622  70.096  1.00 73.04  ? 290  LEU A CG    1 
ATOM   2228  C  CD1   . LEU A  1  290 ? 64.256  89.128  70.138  1.00 73.91  ? 290  LEU A CD1   1 
ATOM   2229  C  CD2   . LEU A  1  290 ? 66.532  88.819  69.136  1.00 73.19  ? 290  LEU A CD2   1 
ATOM   2230  N  N     . SER A  1  291 ? 67.717  93.017  68.197  1.00 70.92  ? 291  SER A N     1 
ATOM   2231  C  CA    . SER A  1  291 ? 67.956  94.247  67.457  1.00 71.17  ? 291  SER A CA    1 
ATOM   2232  C  C     . SER A  1  291 ? 66.750  94.710  66.623  1.00 70.49  ? 291  SER A C     1 
ATOM   2233  O  O     . SER A  1  291 ? 66.704  95.844  66.124  1.00 69.11  ? 291  SER A O     1 
ATOM   2234  C  CB    . SER A  1  291 ? 69.186  94.054  66.571  1.00 72.71  ? 291  SER A CB    1 
ATOM   2235  O  OG    . SER A  1  291 ? 70.309  93.631  67.341  1.00 73.29  ? 291  SER A OG    1 
ATOM   2236  N  N     . SER A  1  292 ? 65.780  93.820  66.467  1.00 70.50  ? 292  SER A N     1 
ATOM   2237  C  CA    . SER A  1  292 ? 64.572  94.149  65.728  1.00 70.49  ? 292  SER A CA    1 
ATOM   2238  C  C     . SER A  1  292 ? 63.617  94.968  66.593  1.00 70.17  ? 292  SER A C     1 
ATOM   2239  O  O     . SER A  1  292 ? 63.014  94.460  67.546  1.00 68.97  ? 292  SER A O     1 
ATOM   2240  C  CB    . SER A  1  292 ? 63.860  92.882  65.265  1.00 71.18  ? 292  SER A CB    1 
ATOM   2241  O  OG    . SER A  1  292 ? 62.529  93.187  64.880  1.00 71.37  ? 292  SER A OG    1 
ATOM   2242  N  N     . ARG A  1  293 ? 63.487  96.243  66.249  1.00 70.22  ? 293  ARG A N     1 
ATOM   2243  C  CA    . ARG A  1  293 ? 62.610  97.140  66.977  1.00 69.67  ? 293  ARG A CA    1 
ATOM   2244  C  C     . ARG A  1  293 ? 61.367  96.400  67.420  1.00 67.97  ? 293  ARG A C     1 
ATOM   2245  O  O     . ARG A  1  293 ? 61.182  96.182  68.610  1.00 68.44  ? 293  ARG A O     1 
ATOM   2246  C  CB    . ARG A  1  293 ? 62.203  98.324  66.101  1.00 72.24  ? 293  ARG A CB    1 
ATOM   2247  C  CG    . ARG A  1  293 ? 63.368  99.169  65.587  1.00 77.52  ? 293  ARG A CG    1 
ATOM   2248  C  CD    . ARG A  1  293 ? 62.881  100.485 64.954  1.00 80.93  ? 293  ARG A CD    1 
ATOM   2249  N  NE    . ARG A  1  293 ? 62.074  101.286 65.886  1.00 83.28  ? 293  ARG A NE    1 
ATOM   2250  C  CZ    . ARG A  1  293 ? 62.552  101.981 66.923  1.00 83.52  ? 293  ARG A CZ    1 
ATOM   2251  N  NH1   . ARG A  1  293 ? 63.855  101.999 67.187  1.00 83.93  ? 293  ARG A NH1   1 
ATOM   2252  N  NH2   . ARG A  1  293 ? 61.720  102.656 67.710  1.00 82.74  ? 293  ARG A NH2   1 
ATOM   2253  N  N     . LEU A  1  294 ? 60.533  96.003  66.456  1.00 65.65  ? 294  LEU A N     1 
ATOM   2254  C  CA    . LEU A  1  294 ? 59.280  95.304  66.736  1.00 62.61  ? 294  LEU A CA    1 
ATOM   2255  C  C     . LEU A  1  294 ? 59.462  94.121  67.669  1.00 61.59  ? 294  LEU A C     1 
ATOM   2256  O  O     . LEU A  1  294 ? 58.620  93.873  68.529  1.00 60.99  ? 294  LEU A O     1 
ATOM   2257  C  CB    . LEU A  1  294 ? 58.627  94.828  65.441  1.00 61.61  ? 294  LEU A CB    1 
ATOM   2258  C  CG    . LEU A  1  294 ? 57.293  94.108  65.633  1.00 61.08  ? 294  LEU A CG    1 
ATOM   2259  C  CD1   . LEU A  1  294 ? 56.258  95.080  66.126  1.00 60.60  ? 294  LEU A CD1   1 
ATOM   2260  C  CD2   . LEU A  1  294 ? 56.847  93.504  64.330  1.00 61.08  ? 294  LEU A CD2   1 
ATOM   2261  N  N     . ALA A  1  295 ? 60.559  93.390  67.507  1.00 60.26  ? 295  ALA A N     1 
ATOM   2262  C  CA    . ALA A  1  295 ? 60.805  92.241  68.361  1.00 59.84  ? 295  ALA A CA    1 
ATOM   2263  C  C     . ALA A  1  295 ? 60.917  92.698  69.801  1.00 60.42  ? 295  ALA A C     1 
ATOM   2264  O  O     . ALA A  1  295 ? 60.297  92.120  70.690  1.00 60.58  ? 295  ALA A O     1 
ATOM   2265  C  CB    . ALA A  1  295 ? 62.061  91.549  67.945  1.00 59.58  ? 295  ALA A CB    1 
ATOM   2266  N  N     . ALA A  1  296 ? 61.708  93.747  70.024  1.00 61.43  ? 296  ALA A N     1 
ATOM   2267  C  CA    . ALA A  1  296 ? 61.911  94.313  71.368  1.00 61.27  ? 296  ALA A CA    1 
ATOM   2268  C  C     . ALA A  1  296 ? 60.579  94.572  72.067  1.00 60.10  ? 296  ALA A C     1 
ATOM   2269  O  O     . ALA A  1  296 ? 60.248  93.918  73.052  1.00 59.06  ? 296  ALA A O     1 
ATOM   2270  C  CB    . ALA A  1  296 ? 62.724  95.631  71.280  1.00 61.57  ? 296  ALA A CB    1 
ATOM   2271  N  N     . LEU A  1  297 ? 59.825  95.534  71.543  1.00 59.00  ? 297  LEU A N     1 
ATOM   2272  C  CA    . LEU A  1  297 ? 58.536  95.877  72.102  1.00 58.20  ? 297  LEU A CA    1 
ATOM   2273  C  C     . LEU A  1  297 ? 57.748  94.607  72.239  1.00 58.28  ? 297  LEU A C     1 
ATOM   2274  O  O     . LEU A  1  297 ? 57.126  94.354  73.263  1.00 58.59  ? 297  LEU A O     1 
ATOM   2275  C  CB    . LEU A  1  297 ? 57.782  96.818  71.180  1.00 57.11  ? 297  LEU A CB    1 
ATOM   2276  C  CG    . LEU A  1  297 ? 58.608  97.860  70.433  1.00 58.28  ? 297  LEU A CG    1 
ATOM   2277  C  CD1   . LEU A  1  297 ? 57.640  98.852  69.787  1.00 58.55  ? 297  LEU A CD1   1 
ATOM   2278  C  CD2   . LEU A  1  297 ? 59.592  98.574  71.375  1.00 58.73  ? 297  LEU A CD2   1 
ATOM   2279  N  N     . ALA A  1  298 ? 57.778  93.794  71.199  1.00 59.27  ? 298  ALA A N     1 
ATOM   2280  C  CA    . ALA A  1  298 ? 57.034  92.542  71.229  1.00 61.77  ? 298  ALA A CA    1 
ATOM   2281  C  C     . ALA A  1  298 ? 57.262  91.819  72.550  1.00 62.58  ? 298  ALA A C     1 
ATOM   2282  O  O     . ALA A  1  298 ? 56.332  91.269  73.150  1.00 62.07  ? 298  ALA A O     1 
ATOM   2283  C  CB    . ALA A  1  298 ? 57.456  91.660  70.068  1.00 62.19  ? 298  ALA A CB    1 
ATOM   2284  N  N     . VAL A  1  299 ? 58.515  91.839  72.991  1.00 64.25  ? 299  VAL A N     1 
ATOM   2285  C  CA    . VAL A  1  299 ? 58.935  91.198  74.233  1.00 65.12  ? 299  VAL A CA    1 
ATOM   2286  C  C     . VAL A  1  299 ? 58.533  92.017  75.441  1.00 65.11  ? 299  VAL A C     1 
ATOM   2287  O  O     . VAL A  1  299 ? 57.818  91.538  76.322  1.00 64.38  ? 299  VAL A O     1 
ATOM   2288  C  CB    . VAL A  1  299 ? 60.461  91.042  74.270  1.00 65.27  ? 299  VAL A CB    1 
ATOM   2289  C  CG1   . VAL A  1  299 ? 60.935  90.863  75.705  1.00 65.43  ? 299  VAL A CG1   1 
ATOM   2290  C  CG2   . VAL A  1  299 ? 60.873  89.858  73.422  1.00 65.82  ? 299  VAL A CG2   1 
ATOM   2291  N  N     . GLU A  1  300 ? 59.024  93.255  75.453  1.00 65.45  ? 300  GLU A N     1 
ATOM   2292  C  CA    . GLU A  1  300 ? 58.795  94.215  76.520  1.00 65.65  ? 300  GLU A CA    1 
ATOM   2293  C  C     . GLU A  1  300 ? 57.370  94.221  77.033  1.00 64.49  ? 300  GLU A C     1 
ATOM   2294  O  O     . GLU A  1  300 ? 57.164  94.183  78.244  1.00 65.33  ? 300  GLU A O     1 
ATOM   2295  C  CB    . GLU A  1  300 ? 59.213  95.631  76.063  1.00 68.09  ? 300  GLU A CB    1 
ATOM   2296  C  CG    . GLU A  1  300 ? 58.927  96.743  77.090  1.00 72.61  ? 300  GLU A CG    1 
ATOM   2297  C  CD    . GLU A  1  300 ? 59.552  98.119  76.757  1.00 74.88  ? 300  GLU A CD    1 
ATOM   2298  O  OE1   . GLU A  1  300 ? 59.491  98.583  75.584  1.00 75.02  ? 300  GLU A OE1   1 
ATOM   2299  O  OE2   . GLU A  1  300 ? 60.088  98.750  77.702  1.00 75.63  ? 300  GLU A OE2   1 
ATOM   2300  N  N     . HIS A  1  301 ? 56.390  94.245  76.132  1.00 62.89  ? 301  HIS A N     1 
ATOM   2301  C  CA    . HIS A  1  301 ? 54.985  94.273  76.539  1.00 61.74  ? 301  HIS A CA    1 
ATOM   2302  C  C     . HIS A  1  301 ? 54.230  92.980  76.262  1.00 62.88  ? 301  HIS A C     1 
ATOM   2303  O  O     . HIS A  1  301 ? 52.996  92.983  76.233  1.00 62.34  ? 301  HIS A O     1 
ATOM   2304  C  CB    . HIS A  1  301 ? 54.261  95.419  75.835  1.00 58.20  ? 301  HIS A CB    1 
ATOM   2305  C  CG    . HIS A  1  301 ? 55.033  96.698  75.812  1.00 53.70  ? 301  HIS A CG    1 
ATOM   2306  N  ND1   . HIS A  1  301 ? 55.444  97.339  76.957  1.00 51.84  ? 301  HIS A ND1   1 
ATOM   2307  C  CD2   . HIS A  1  301 ? 55.460  97.462  74.779  1.00 52.53  ? 301  HIS A CD2   1 
ATOM   2308  C  CE1   . HIS A  1  301 ? 56.089  98.444  76.632  1.00 51.73  ? 301  HIS A CE1   1 
ATOM   2309  N  NE2   . HIS A  1  301 ? 56.113  98.542  75.316  1.00 50.98  ? 301  HIS A NE2   1 
ATOM   2310  N  N     . LYS A  1  302 ? 54.963  91.883  76.064  1.00 65.23  ? 302  LYS A N     1 
ATOM   2311  C  CA    . LYS A  1  302 ? 54.347  90.581  75.776  1.00 68.31  ? 302  LYS A CA    1 
ATOM   2312  C  C     . LYS A  1  302 ? 53.299  90.739  74.657  1.00 69.12  ? 302  LYS A C     1 
ATOM   2313  O  O     . LYS A  1  302 ? 52.155  90.250  74.764  1.00 69.64  ? 302  LYS A O     1 
ATOM   2314  C  CB    . LYS A  1  302 ? 53.670  90.005  77.035  1.00 69.40  ? 302  LYS A CB    1 
ATOM   2315  C  CG    . LYS A  1  302 ? 54.605  89.458  78.135  1.00 70.03  ? 302  LYS A CG    1 
ATOM   2316  C  CD    . LYS A  1  302 ? 55.573  90.519  78.674  1.00 70.68  ? 302  LYS A CD    1 
ATOM   2317  C  CE    . LYS A  1  302 ? 56.213  90.113  80.013  1.00 69.86  ? 302  LYS A CE    1 
ATOM   2318  N  NZ    . LYS A  1  302 ? 55.273  90.174  81.179  1.00 68.77  ? 302  LYS A NZ    1 
ATOM   2319  N  N     . LEU A  1  303 ? 53.706  91.420  73.586  1.00 68.61  ? 303  LEU A N     1 
ATOM   2320  C  CA    . LEU A  1  303 ? 52.826  91.680  72.457  1.00 67.65  ? 303  LEU A CA    1 
ATOM   2321  C  C     . LEU A  1  303 ? 52.296  90.434  71.767  1.00 67.25  ? 303  LEU A C     1 
ATOM   2322  O  O     . LEU A  1  303 ? 51.096  90.127  71.855  1.00 68.71  ? 303  LEU A O     1 
ATOM   2323  C  CB    . LEU A  1  303 ? 53.527  92.574  71.430  1.00 67.02  ? 303  LEU A CB    1 
ATOM   2324  C  CG    . LEU A  1  303 ? 53.950  93.941  71.976  1.00 67.02  ? 303  LEU A CG    1 
ATOM   2325  C  CD1   . LEU A  1  303 ? 54.224  94.898  70.835  1.00 66.81  ? 303  LEU A CD1   1 
ATOM   2326  C  CD2   . LEU A  1  303 ? 52.849  94.500  72.840  1.00 67.46  ? 303  LEU A CD2   1 
ATOM   2327  N  N     . CYS A  1  304 ? 53.184  89.705  71.099  1.00 64.37  ? 304  CYS A N     1 
ATOM   2328  C  CA    . CYS A  1  304 ? 52.762  88.518  70.375  1.00 61.96  ? 304  CYS A CA    1 
ATOM   2329  C  C     . CYS A  1  304 ? 53.479  87.251  70.783  1.00 60.89  ? 304  CYS A C     1 
ATOM   2330  O  O     . CYS A  1  304 ? 54.498  87.285  71.456  1.00 61.37  ? 304  CYS A O     1 
ATOM   2331  C  CB    . CYS A  1  304 ? 53.019  88.724  68.908  1.00 61.65  ? 304  CYS A CB    1 
ATOM   2332  S  SG    . CYS A  1  304 ? 54.766  88.934  68.669  1.00 60.73  ? 304  CYS A SG    1 
ATOM   2333  N  N     . HIS A  1  305 ? 52.926  86.129  70.348  1.00 58.91  ? 305  HIS A N     1 
ATOM   2334  C  CA    . HIS A  1  305 ? 53.490  84.823  70.601  1.00 56.74  ? 305  HIS A CA    1 
ATOM   2335  C  C     . HIS A  1  305 ? 54.549  84.655  69.531  1.00 57.22  ? 305  HIS A C     1 
ATOM   2336  O  O     . HIS A  1  305 ? 55.480  83.854  69.665  1.00 57.53  ? 305  HIS A O     1 
ATOM   2337  C  CB    . HIS A  1  305 ? 52.429  83.760  70.390  1.00 55.75  ? 305  HIS A CB    1 
ATOM   2338  C  CG    . HIS A  1  305 ? 51.587  83.496  71.589  1.00 55.13  ? 305  HIS A CG    1 
ATOM   2339  N  ND1   . HIS A  1  305 ? 52.094  82.930  72.736  1.00 56.98  ? 305  HIS A ND1   1 
ATOM   2340  C  CD2   . HIS A  1  305 ? 50.263  83.658  71.801  1.00 55.17  ? 305  HIS A CD2   1 
ATOM   2341  C  CE1   . HIS A  1  305 ? 51.116  82.750  73.605  1.00 57.07  ? 305  HIS A CE1   1 
ATOM   2342  N  NE2   . HIS A  1  305 ? 49.994  83.184  73.062  1.00 55.72  ? 305  HIS A NE2   1 
ATOM   2343  N  N     . SER A  1  306 ? 54.383  85.428  68.462  1.00 57.22  ? 306  SER A N     1 
ATOM   2344  C  CA    . SER A  1  306 ? 55.273  85.375  67.318  1.00 57.38  ? 306  SER A CA    1 
ATOM   2345  C  C     . SER A  1  306 ? 54.788  86.355  66.270  1.00 58.14  ? 306  SER A C     1 
ATOM   2346  O  O     . SER A  1  306 ? 53.619  86.730  66.260  1.00 58.55  ? 306  SER A O     1 
ATOM   2347  C  CB    . SER A  1  306 ? 55.246  83.968  66.713  1.00 57.11  ? 306  SER A CB    1 
ATOM   2348  O  OG    . SER A  1  306 ? 53.949  83.633  66.218  1.00 55.73  ? 306  SER A OG    1 
ATOM   2349  N  N     . PHE A  1  307 ? 55.692  86.776  65.396  1.00 58.75  ? 307  PHE A N     1 
ATOM   2350  C  CA    . PHE A  1  307 ? 55.328  87.663  64.307  1.00 59.49  ? 307  PHE A CA    1 
ATOM   2351  C  C     . PHE A  1  307 ? 56.380  87.432  63.253  1.00 60.29  ? 307  PHE A C     1 
ATOM   2352  O  O     . PHE A  1  307 ? 57.490  87.027  63.579  1.00 60.13  ? 307  PHE A O     1 
ATOM   2353  C  CB    . PHE A  1  307 ? 55.286  89.120  64.767  1.00 58.79  ? 307  PHE A CB    1 
ATOM   2354  C  CG    . PHE A  1  307 ? 56.624  89.801  64.811  1.00 59.34  ? 307  PHE A CG    1 
ATOM   2355  C  CD1   . PHE A  1  307 ? 57.344  90.054  63.642  1.00 59.75  ? 307  PHE A CD1   1 
ATOM   2356  C  CD2   . PHE A  1  307 ? 57.138  90.257  66.012  1.00 58.78  ? 307  PHE A CD2   1 
ATOM   2357  C  CE1   . PHE A  1  307 ? 58.555  90.756  63.676  1.00 58.53  ? 307  PHE A CE1   1 
ATOM   2358  C  CE2   . PHE A  1  307 ? 58.346  90.957  66.052  1.00 58.70  ? 307  PHE A CE2   1 
ATOM   2359  C  CZ    . PHE A  1  307 ? 59.052  91.207  64.883  1.00 57.78  ? 307  PHE A CZ    1 
ATOM   2360  N  N     . GLN A  1  308 ? 56.040  87.669  61.993  1.00 62.51  ? 308  GLN A N     1 
ATOM   2361  C  CA    . GLN A  1  308 ? 56.998  87.447  60.923  1.00 65.82  ? 308  GLN A CA    1 
ATOM   2362  C  C     . GLN A  1  308 ? 56.793  88.294  59.694  1.00 65.61  ? 308  GLN A C     1 
ATOM   2363  O  O     . GLN A  1  308 ? 55.664  88.542  59.275  1.00 65.96  ? 308  GLN A O     1 
ATOM   2364  C  CB    . GLN A  1  308 ? 56.981  85.983  60.500  1.00 69.82  ? 308  GLN A CB    1 
ATOM   2365  C  CG    . GLN A  1  308 ? 55.586  85.418  60.269  1.00 75.38  ? 308  GLN A CG    1 
ATOM   2366  C  CD    . GLN A  1  308 ? 55.624  83.996  59.718  1.00 78.81  ? 308  GLN A CD    1 
ATOM   2367  O  OE1   . GLN A  1  308 ? 54.668  83.227  59.871  1.00 80.71  ? 308  GLN A OE1   1 
ATOM   2368  N  NE2   . GLN A  1  308 ? 56.730  83.646  59.060  1.00 79.69  ? 308  GLN A NE2   1 
ATOM   2369  N  N     . THR A  1  309 ? 57.905  88.722  59.114  1.00 65.23  ? 309  THR A N     1 
ATOM   2370  C  CA    . THR A  1  309 ? 57.874  89.528  57.912  1.00 65.51  ? 309  THR A CA    1 
ATOM   2371  C  C     . THR A  1  309 ? 57.869  88.565  56.755  1.00 65.70  ? 309  THR A C     1 
ATOM   2372  O  O     . THR A  1  309 ? 58.288  87.421  56.905  1.00 66.47  ? 309  THR A O     1 
ATOM   2373  C  CB    . THR A  1  309 ? 59.112  90.368  57.812  1.00 65.94  ? 309  THR A CB    1 
ATOM   2374  O  OG1   . THR A  1  309 ? 60.252  89.534  58.050  1.00 66.39  ? 309  THR A OG1   1 
ATOM   2375  C  CG2   . THR A  1  309 ? 59.074  91.483  58.836  1.00 67.88  ? 309  THR A CG2   1 
ATOM   2376  N  N     . PHE A  1  310 ? 57.398  89.017  55.600  1.00 65.99  ? 310  PHE A N     1 
ATOM   2377  C  CA    . PHE A  1  310 ? 57.364  88.147  54.433  1.00 66.65  ? 310  PHE A CA    1 
ATOM   2378  C  C     . PHE A  1  310 ? 57.106  88.919  53.145  1.00 67.26  ? 310  PHE A C     1 
ATOM   2379  O  O     . PHE A  1  310 ? 56.303  89.866  53.120  1.00 66.98  ? 310  PHE A O     1 
ATOM   2380  C  CB    . PHE A  1  310 ? 56.293  87.053  54.605  1.00 65.66  ? 310  PHE A CB    1 
ATOM   2381  C  CG    . PHE A  1  310 ? 54.879  87.563  54.528  1.00 64.75  ? 310  PHE A CG    1 
ATOM   2382  C  CD1   . PHE A  1  310 ? 54.339  88.347  55.536  1.00 64.55  ? 310  PHE A CD1   1 
ATOM   2383  C  CD2   . PHE A  1  310 ? 54.092  87.272  53.439  1.00 64.86  ? 310  PHE A CD2   1 
ATOM   2384  C  CE1   . PHE A  1  310 ? 53.036  88.828  55.451  1.00 63.00  ? 310  PHE A CE1   1 
ATOM   2385  C  CE2   . PHE A  1  310 ? 52.790  87.758  53.359  1.00 65.05  ? 310  PHE A CE2   1 
ATOM   2386  C  CZ    . PHE A  1  310 ? 52.269  88.536  54.371  1.00 63.49  ? 310  PHE A CZ    1 
ATOM   2387  N  N     . ASN A  1  311 ? 57.815  88.522  52.088  1.00 67.75  ? 311  ASN A N     1 
ATOM   2388  C  CA    . ASN A  1  311 ? 57.650  89.129  50.772  1.00 68.38  ? 311  ASN A CA    1 
ATOM   2389  C  C     . ASN A  1  311 ? 57.429  88.052  49.717  1.00 67.84  ? 311  ASN A C     1 
ATOM   2390  O  O     . ASN A  1  311 ? 58.257  87.831  48.835  1.00 67.91  ? 311  ASN A O     1 
ATOM   2391  C  CB    . ASN A  1  311 ? 58.853  90.001  50.384  1.00 69.20  ? 311  ASN A CB    1 
ATOM   2392  C  CG    . ASN A  1  311 ? 58.702  90.609  48.980  1.00 69.73  ? 311  ASN A CG    1 
ATOM   2393  O  OD1   . ASN A  1  311 ? 57.580  90.796  48.482  1.00 69.10  ? 311  ASN A OD1   1 
ATOM   2394  N  ND2   . ASN A  1  311 ? 59.829  90.928  48.347  1.00 70.17  ? 311  ASN A ND2   1 
ATOM   2395  N  N     . THR A  1  312 ? 56.300  87.372  49.827  1.00 67.40  ? 312  THR A N     1 
ATOM   2396  C  CA    . THR A  1  312 ? 55.947  86.335  48.877  1.00 68.58  ? 312  THR A CA    1 
ATOM   2397  C  C     . THR A  1  312 ? 55.881  86.971  47.493  1.00 69.01  ? 312  THR A C     1 
ATOM   2398  O  O     . THR A  1  312 ? 55.076  87.876  47.262  1.00 70.14  ? 312  THR A O     1 
ATOM   2399  C  CB    . THR A  1  312 ? 54.568  85.734  49.211  1.00 69.56  ? 312  THR A CB    1 
ATOM   2400  O  OG1   . THR A  1  312 ? 54.607  85.140  50.518  1.00 70.01  ? 312  THR A OG1   1 
ATOM   2401  C  CG2   . THR A  1  312 ? 54.163  84.692  48.163  1.00 69.22  ? 312  THR A CG2   1 
ATOM   2402  N  N     . SER A  1  313 ? 56.728  86.509  46.576  1.00 68.69  ? 313  SER A N     1 
ATOM   2403  C  CA    . SER A  1  313 ? 56.747  87.059  45.223  1.00 67.53  ? 313  SER A CA    1 
ATOM   2404  C  C     . SER A  1  313 ? 56.066  86.148  44.224  1.00 66.87  ? 313  SER A C     1 
ATOM   2405  O  O     . SER A  1  313 ? 55.870  84.957  44.468  1.00 67.44  ? 313  SER A O     1 
ATOM   2406  C  CB    . SER A  1  313 ? 58.186  87.309  44.761  1.00 66.98  ? 313  SER A CB    1 
ATOM   2407  O  OG    . SER A  1  313 ? 58.751  88.435  45.407  1.00 67.04  ? 313  SER A OG    1 
ATOM   2408  N  N     . TYR A  1  314 ? 55.684  86.727  43.099  1.00 65.64  ? 314  TYR A N     1 
ATOM   2409  C  CA    . TYR A  1  314 ? 55.069  85.963  42.035  1.00 64.97  ? 314  TYR A CA    1 
ATOM   2410  C  C     . TYR A  1  314 ? 55.528  86.534  40.709  1.00 65.78  ? 314  TYR A C     1 
ATOM   2411  O  O     . TYR A  1  314 ? 56.149  87.606  40.643  1.00 66.90  ? 314  TYR A O     1 
ATOM   2412  C  CB    . TYR A  1  314 ? 53.549  86.028  42.100  1.00 63.07  ? 314  TYR A CB    1 
ATOM   2413  C  CG    . TYR A  1  314 ? 52.942  85.227  43.213  1.00 61.64  ? 314  TYR A CG    1 
ATOM   2414  C  CD1   . TYR A  1  314 ? 52.542  85.839  44.393  1.00 62.75  ? 314  TYR A CD1   1 
ATOM   2415  C  CD2   . TYR A  1  314 ? 52.734  83.866  43.081  1.00 60.98  ? 314  TYR A CD2   1 
ATOM   2416  C  CE1   . TYR A  1  314 ? 51.941  85.113  45.424  1.00 61.44  ? 314  TYR A CE1   1 
ATOM   2417  C  CE2   . TYR A  1  314 ? 52.129  83.129  44.099  1.00 61.18  ? 314  TYR A CE2   1 
ATOM   2418  C  CZ    . TYR A  1  314 ? 51.733  83.764  45.272  1.00 60.78  ? 314  TYR A CZ    1 
ATOM   2419  O  OH    . TYR A  1  314 ? 51.119  83.070  46.294  1.00 59.50  ? 314  TYR A OH    1 
ATOM   2420  N  N     . SER A  1  315 ? 55.228  85.791  39.656  1.00 64.83  ? 315  SER A N     1 
ATOM   2421  C  CA    . SER A  1  315 ? 55.556  86.174  38.297  1.00 63.80  ? 315  SER A CA    1 
ATOM   2422  C  C     . SER A  1  315 ? 55.320  87.664  38.016  1.00 64.68  ? 315  SER A C     1 
ATOM   2423  O  O     . SER A  1  315 ? 56.259  88.428  37.733  1.00 64.99  ? 315  SER A O     1 
ATOM   2424  C  CB    . SER A  1  315 ? 54.682  85.345  37.380  1.00 62.23  ? 315  SER A CB    1 
ATOM   2425  O  OG    . SER A  1  315 ? 53.390  85.229  37.959  1.00 57.57  ? 315  SER A OG    1 
ATOM   2426  N  N     . ASP A  1  316 ? 54.048  88.052  38.120  1.00 64.64  ? 316  ASP A N     1 
ATOM   2427  C  CA    . ASP A  1  316 ? 53.580  89.409  37.855  1.00 63.85  ? 316  ASP A CA    1 
ATOM   2428  C  C     . ASP A  1  316 ? 53.255  90.262  39.078  1.00 63.86  ? 316  ASP A C     1 
ATOM   2429  O  O     . ASP A  1  316 ? 53.294  91.488  38.986  1.00 64.03  ? 316  ASP A O     1 
ATOM   2430  C  CB    . ASP A  1  316 ? 52.335  89.327  36.970  1.00 62.86  ? 316  ASP A CB    1 
ATOM   2431  C  CG    . ASP A  1  316 ? 51.289  88.371  37.530  1.00 61.93  ? 316  ASP A CG    1 
ATOM   2432  O  OD1   . ASP A  1  316 ? 51.621  87.190  37.737  1.00 60.99  ? 316  ASP A OD1   1 
ATOM   2433  O  OD2   . ASP A  1  316 ? 50.140  88.788  37.771  1.00 62.48  ? 316  ASP A OD2   1 
ATOM   2434  N  N     . THR A  1  317 ? 52.947  89.620  40.209  1.00 63.82  ? 317  THR A N     1 
ATOM   2435  C  CA    . THR A  1  317 ? 52.569  90.326  41.443  1.00 63.86  ? 317  THR A CA    1 
ATOM   2436  C  C     . THR A  1  317 ? 53.398  89.995  42.715  1.00 62.54  ? 317  THR A C     1 
ATOM   2437  O  O     . THR A  1  317 ? 54.555  89.580  42.632  1.00 62.82  ? 317  THR A O     1 
ATOM   2438  C  CB    . THR A  1  317 ? 51.074  90.064  41.741  1.00 65.21  ? 317  THR A CB    1 
ATOM   2439  O  OG1   . THR A  1  317 ? 50.611  90.974  42.747  1.00 66.57  ? 317  THR A OG1   1 
ATOM   2440  C  CG2   . THR A  1  317 ? 50.876  88.623  42.222  1.00 64.83  ? 317  THR A CG2   1 
ATOM   2441  N  N     . GLY A  1  318 ? 52.795  90.196  43.890  1.00 61.03  ? 318  GLY A N     1 
ATOM   2442  C  CA    . GLY A  1  318 ? 53.468  89.926  45.158  1.00 58.65  ? 318  GLY A CA    1 
ATOM   2443  C  C     . GLY A  1  318 ? 52.601  90.233  46.377  1.00 56.98  ? 318  GLY A C     1 
ATOM   2444  O  O     . GLY A  1  318 ? 51.549  90.839  46.247  1.00 57.58  ? 318  GLY A O     1 
ATOM   2445  N  N     . LEU A  1  319 ? 53.022  89.815  47.564  1.00 54.74  ? 319  LEU A N     1 
ATOM   2446  C  CA    . LEU A  1  319 ? 52.249  90.078  48.773  1.00 52.29  ? 319  LEU A CA    1 
ATOM   2447  C  C     . LEU A  1  319 ? 53.166  90.473  49.887  1.00 52.86  ? 319  LEU A C     1 
ATOM   2448  O  O     . LEU A  1  319 ? 53.475  89.659  50.734  1.00 54.13  ? 319  LEU A O     1 
ATOM   2449  C  CB    . LEU A  1  319 ? 51.473  88.844  49.220  1.00 49.21  ? 319  LEU A CB    1 
ATOM   2450  C  CG    . LEU A  1  319 ? 50.144  88.633  48.526  1.00 48.29  ? 319  LEU A CG    1 
ATOM   2451  C  CD1   . LEU A  1  319 ? 49.261  87.722  49.335  1.00 47.43  ? 319  LEU A CD1   1 
ATOM   2452  C  CD2   . LEU A  1  319 ? 49.479  89.969  48.394  1.00 49.45  ? 319  LEU A CD2   1 
ATOM   2453  N  N     . PHE A  1  320 ? 53.608  91.718  49.898  1.00 53.45  ? 320  PHE A N     1 
ATOM   2454  C  CA    . PHE A  1  320 ? 54.513  92.181  50.943  1.00 54.80  ? 320  PHE A CA    1 
ATOM   2455  C  C     . PHE A  1  320 ? 53.747  92.508  52.217  1.00 54.96  ? 320  PHE A C     1 
ATOM   2456  O  O     . PHE A  1  320 ? 52.805  93.309  52.186  1.00 56.11  ? 320  PHE A O     1 
ATOM   2457  C  CB    . PHE A  1  320 ? 55.236  93.430  50.463  1.00 56.42  ? 320  PHE A CB    1 
ATOM   2458  C  CG    . PHE A  1  320 ? 56.305  93.916  51.398  1.00 58.92  ? 320  PHE A CG    1 
ATOM   2459  C  CD1   . PHE A  1  320 ? 57.636  93.612  51.161  1.00 60.27  ? 320  PHE A CD1   1 
ATOM   2460  C  CD2   . PHE A  1  320 ? 55.990  94.695  52.502  1.00 60.65  ? 320  PHE A CD2   1 
ATOM   2461  C  CE1   . PHE A  1  320 ? 58.640  94.082  52.007  1.00 60.58  ? 320  PHE A CE1   1 
ATOM   2462  C  CE2   . PHE A  1  320 ? 56.991  95.168  53.354  1.00 60.58  ? 320  PHE A CE2   1 
ATOM   2463  C  CZ    . PHE A  1  320 ? 58.314  94.860  53.102  1.00 59.96  ? 320  PHE A CZ    1 
ATOM   2464  N  N     . GLY A  1  321 ? 54.146  91.919  53.342  1.00 53.62  ? 321  GLY A N     1 
ATOM   2465  C  CA    . GLY A  1  321 ? 53.426  92.219  54.566  1.00 53.79  ? 321  GLY A CA    1 
ATOM   2466  C  C     . GLY A  1  321 ? 54.006  91.656  55.845  1.00 53.34  ? 321  GLY A C     1 
ATOM   2467  O  O     . GLY A  1  321 ? 55.229  91.655  56.028  1.00 55.16  ? 321  GLY A O     1 
ATOM   2468  N  N     . PHE A  1  322 ? 53.120  91.213  56.742  1.00 50.66  ? 322  PHE A N     1 
ATOM   2469  C  CA    . PHE A  1  322 ? 53.525  90.623  58.002  1.00 47.70  ? 322  PHE A CA    1 
ATOM   2470  C  C     . PHE A  1  322 ? 52.390  89.897  58.677  1.00 46.04  ? 322  PHE A C     1 
ATOM   2471  O  O     . PHE A  1  322 ? 51.226  90.243  58.497  1.00 44.05  ? 322  PHE A O     1 
ATOM   2472  C  CB    . PHE A  1  322 ? 54.123  91.677  58.935  1.00 49.60  ? 322  PHE A CB    1 
ATOM   2473  C  CG    . PHE A  1  322 ? 53.152  92.738  59.396  1.00 52.00  ? 322  PHE A CG    1 
ATOM   2474  C  CD1   . PHE A  1  322 ? 52.106  92.433  60.260  1.00 52.05  ? 322  PHE A CD1   1 
ATOM   2475  C  CD2   . PHE A  1  322 ? 53.348  94.071  59.041  1.00 52.73  ? 322  PHE A CD2   1 
ATOM   2476  C  CE1   . PHE A  1  322 ? 51.284  93.437  60.767  1.00 50.56  ? 322  PHE A CE1   1 
ATOM   2477  C  CE2   . PHE A  1  322 ? 52.528  95.073  59.547  1.00 51.19  ? 322  PHE A CE2   1 
ATOM   2478  C  CZ    . PHE A  1  322 ? 51.500  94.751  60.410  1.00 50.50  ? 322  PHE A CZ    1 
ATOM   2479  N  N     . HIS A  1  323 ? 52.760  88.880  59.453  1.00 45.83  ? 323  HIS A N     1 
ATOM   2480  C  CA    . HIS A  1  323 ? 51.824  88.019  60.178  1.00 45.82  ? 323  HIS A CA    1 
ATOM   2481  C  C     . HIS A  1  323 ? 52.245  87.760  61.606  1.00 45.43  ? 323  HIS A C     1 
ATOM   2482  O  O     . HIS A  1  323 ? 53.355  87.299  61.842  1.00 46.30  ? 323  HIS A O     1 
ATOM   2483  C  CB    . HIS A  1  323 ? 51.706  86.670  59.469  1.00 45.32  ? 323  HIS A CB    1 
ATOM   2484  C  CG    . HIS A  1  323 ? 51.092  85.590  60.306  1.00 45.71  ? 323  HIS A CG    1 
ATOM   2485  N  ND1   . HIS A  1  323 ? 51.842  84.732  61.077  1.00 46.13  ? 323  HIS A ND1   1 
ATOM   2486  C  CD2   . HIS A  1  323 ? 49.804  85.198  60.456  1.00 46.70  ? 323  HIS A CD2   1 
ATOM   2487  C  CE1   . HIS A  1  323 ? 51.044  83.851  61.656  1.00 46.99  ? 323  HIS A CE1   1 
ATOM   2488  N  NE2   . HIS A  1  323 ? 49.801  84.111  61.296  1.00 45.86  ? 323  HIS A NE2   1 
ATOM   2489  N  N     . PHE A  1  324 ? 51.347  88.028  62.550  1.00 44.63  ? 324  PHE A N     1 
ATOM   2490  C  CA    . PHE A  1  324 ? 51.629  87.801  63.956  1.00 44.94  ? 324  PHE A CA    1 
ATOM   2491  C  C     . PHE A  1  324 ? 50.480  87.070  64.648  1.00 45.95  ? 324  PHE A C     1 
ATOM   2492  O  O     . PHE A  1  324 ? 49.332  87.148  64.242  1.00 45.26  ? 324  PHE A O     1 
ATOM   2493  C  CB    . PHE A  1  324 ? 51.919  89.129  64.662  1.00 43.73  ? 324  PHE A CB    1 
ATOM   2494  C  CG    . PHE A  1  324 ? 50.742  90.049  64.727  1.00 43.05  ? 324  PHE A CG    1 
ATOM   2495  C  CD1   . PHE A  1  324 ? 49.760  89.866  65.681  1.00 40.86  ? 324  PHE A CD1   1 
ATOM   2496  C  CD2   . PHE A  1  324 ? 50.599  91.083  63.808  1.00 43.26  ? 324  PHE A CD2   1 
ATOM   2497  C  CE1   . PHE A  1  324 ? 48.670  90.687  65.714  1.00 40.37  ? 324  PHE A CE1   1 
ATOM   2498  C  CE2   . PHE A  1  324 ? 49.501  91.913  63.838  1.00 41.42  ? 324  PHE A CE2   1 
ATOM   2499  C  CZ    . PHE A  1  324 ? 48.538  91.715  64.789  1.00 41.23  ? 324  PHE A CZ    1 
ATOM   2500  N  N     . VAL A  1  325 ? 50.802  86.355  65.708  1.00 48.38  ? 325  VAL A N     1 
ATOM   2501  C  CA    . VAL A  1  325 ? 49.803  85.606  66.440  1.00 50.95  ? 325  VAL A CA    1 
ATOM   2502  C  C     . VAL A  1  325 ? 49.875  86.027  67.888  1.00 52.47  ? 325  VAL A C     1 
ATOM   2503  O  O     . VAL A  1  325 ? 50.928  85.901  68.506  1.00 53.53  ? 325  VAL A O     1 
ATOM   2504  C  CB    . VAL A  1  325 ? 50.114  84.127  66.395  1.00 51.30  ? 325  VAL A CB    1 
ATOM   2505  C  CG1   . VAL A  1  325 ? 48.945  83.358  66.908  1.00 53.14  ? 325  VAL A CG1   1 
ATOM   2506  C  CG2   . VAL A  1  325 ? 50.486  83.718  65.004  1.00 51.04  ? 325  VAL A CG2   1 
ATOM   2507  N  N     . ALA A  1  326 ? 48.782  86.516  68.453  1.00 53.74  ? 326  ALA A N     1 
ATOM   2508  C  CA    . ALA A  1  326 ? 48.858  86.918  69.848  1.00 56.08  ? 326  ALA A CA    1 
ATOM   2509  C  C     . ALA A  1  326 ? 47.574  86.673  70.602  1.00 57.80  ? 326  ALA A C     1 
ATOM   2510  O  O     . ALA A  1  326 ? 46.567  86.287  69.999  1.00 57.98  ? 326  ALA A O     1 
ATOM   2511  C  CB    . ALA A  1  326 ? 49.252  88.378  69.955  1.00 54.66  ? 326  ALA A CB    1 
ATOM   2512  N  N     . ASP A  1  327 ? 47.640  86.876  71.922  1.00 59.17  ? 327  ASP A N     1 
ATOM   2513  C  CA    . ASP A  1  327 ? 46.496  86.708  72.810  1.00 60.74  ? 327  ASP A CA    1 
ATOM   2514  C  C     . ASP A  1  327 ? 45.432  87.704  72.404  1.00 60.48  ? 327  ASP A C     1 
ATOM   2515  O  O     . ASP A  1  327 ? 45.732  88.839  72.050  1.00 61.55  ? 327  ASP A O     1 
ATOM   2516  C  CB    . ASP A  1  327 ? 46.899  86.959  74.255  1.00 65.40  ? 327  ASP A CB    1 
ATOM   2517  C  CG    . ASP A  1  327 ? 47.730  85.830  74.829  1.00 69.83  ? 327  ASP A CG    1 
ATOM   2518  O  OD1   . ASP A  1  327 ? 47.165  84.729  75.021  1.00 71.57  ? 327  ASP A OD1   1 
ATOM   2519  O  OD2   . ASP A  1  327 ? 48.944  86.037  75.082  1.00 72.91  ? 327  ASP A OD2   1 
ATOM   2520  N  N     . PRO A  1  328 ? 44.165  87.309  72.499  1.00 59.78  ? 328  PRO A N     1 
ATOM   2521  C  CA    . PRO A  1  328 ? 43.039  88.170  72.122  1.00 59.15  ? 328  PRO A CA    1 
ATOM   2522  C  C     . PRO A  1  328 ? 43.104  89.610  72.592  1.00 57.85  ? 328  PRO A C     1 
ATOM   2523  O  O     . PRO A  1  328 ? 42.595  90.506  71.918  1.00 58.30  ? 328  PRO A O     1 
ATOM   2524  C  CB    . PRO A  1  328 ? 41.835  87.440  72.708  1.00 60.19  ? 328  PRO A CB    1 
ATOM   2525  C  CG    . PRO A  1  328 ? 42.420  86.812  73.938  1.00 62.19  ? 328  PRO A CG    1 
ATOM   2526  C  CD    . PRO A  1  328 ? 43.721  86.246  73.414  1.00 60.55  ? 328  PRO A CD    1 
ATOM   2527  N  N     . LEU A  1  329 ? 43.754  89.825  73.732  1.00 56.16  ? 329  LEU A N     1 
ATOM   2528  C  CA    . LEU A  1  329 ? 43.829  91.142  74.351  1.00 53.82  ? 329  LEU A CA    1 
ATOM   2529  C  C     . LEU A  1  329 ? 45.025  92.046  74.106  1.00 52.83  ? 329  LEU A C     1 
ATOM   2530  O  O     . LEU A  1  329 ? 45.256  92.974  74.873  1.00 53.40  ? 329  LEU A O     1 
ATOM   2531  C  CB    . LEU A  1  329 ? 43.628  90.979  75.853  1.00 53.16  ? 329  LEU A CB    1 
ATOM   2532  C  CG    . LEU A  1  329 ? 42.203  90.576  76.214  1.00 52.54  ? 329  LEU A CG    1 
ATOM   2533  C  CD1   . LEU A  1  329 ? 42.136  89.965  77.591  1.00 53.79  ? 329  LEU A CD1   1 
ATOM   2534  C  CD2   . LEU A  1  329 ? 41.338  91.801  76.120  1.00 52.39  ? 329  LEU A CD2   1 
ATOM   2535  N  N     . SER A  1  330 ? 45.790  91.806  73.054  1.00 51.55  ? 330  SER A N     1 
ATOM   2536  C  CA    . SER A  1  330 ? 46.925  92.684  72.786  1.00 50.29  ? 330  SER A CA    1 
ATOM   2537  C  C     . SER A  1  330 ? 46.996  92.940  71.299  1.00 48.88  ? 330  SER A C     1 
ATOM   2538  O  O     . SER A  1  330 ? 47.699  93.851  70.855  1.00 48.44  ? 330  SER A O     1 
ATOM   2539  C  CB    . SER A  1  330 ? 48.247  92.065  73.285  1.00 50.26  ? 330  SER A CB    1 
ATOM   2540  O  OG    . SER A  1  330 ? 48.631  90.919  72.547  1.00 49.20  ? 330  SER A OG    1 
ATOM   2541  N  N     . ILE A  1  331 ? 46.234  92.143  70.548  1.00 46.66  ? 331  ILE A N     1 
ATOM   2542  C  CA    . ILE A  1  331 ? 46.200  92.234  69.096  1.00 43.94  ? 331  ILE A CA    1 
ATOM   2543  C  C     . ILE A  1  331 ? 46.401  93.663  68.689  1.00 44.57  ? 331  ILE A C     1 
ATOM   2544  O  O     . ILE A  1  331 ? 47.255  93.976  67.873  1.00 42.92  ? 331  ILE A O     1 
ATOM   2545  C  CB    . ILE A  1  331 ? 44.862  91.800  68.498  1.00 41.51  ? 331  ILE A CB    1 
ATOM   2546  C  CG1   . ILE A  1  331 ? 44.393  90.471  69.074  1.00 41.12  ? 331  ILE A CG1   1 
ATOM   2547  C  CG2   . ILE A  1  331 ? 45.023  91.619  67.027  1.00 40.69  ? 331  ILE A CG2   1 
ATOM   2548  C  CD1   . ILE A  1  331 ? 43.095  89.951  68.427  1.00 38.97  ? 331  ILE A CD1   1 
ATOM   2549  N  N     . ASP A  1  332 ? 45.622  94.542  69.293  1.00 46.94  ? 332  ASP A N     1 
ATOM   2550  C  CA    . ASP A  1  332 ? 45.727  95.931  68.943  1.00 50.87  ? 332  ASP A CA    1 
ATOM   2551  C  C     . ASP A  1  332 ? 47.133  96.476  69.181  1.00 52.39  ? 332  ASP A C     1 
ATOM   2552  O  O     . ASP A  1  332 ? 47.905  96.595  68.229  1.00 53.81  ? 332  ASP A O     1 
ATOM   2553  C  CB    . ASP A  1  332 ? 44.671  96.756  69.683  1.00 52.67  ? 332  ASP A CB    1 
ATOM   2554  C  CG    . ASP A  1  332 ? 44.439  98.114  69.030  1.00 55.87  ? 332  ASP A CG    1 
ATOM   2555  O  OD1   . ASP A  1  332 ? 44.233  98.151  67.782  1.00 58.44  ? 332  ASP A OD1   1 
ATOM   2556  O  OD2   . ASP A  1  332 ? 44.467  99.136  69.761  1.00 56.38  ? 332  ASP A OD2   1 
ATOM   2557  N  N     . ASP A  1  333 ? 47.488  96.791  70.423  1.00 53.34  ? 333  ASP A N     1 
ATOM   2558  C  CA    . ASP A  1  333 ? 48.815  97.342  70.681  1.00 53.82  ? 333  ASP A CA    1 
ATOM   2559  C  C     . ASP A  1  333 ? 49.832  96.771  69.695  1.00 53.90  ? 333  ASP A C     1 
ATOM   2560  O  O     . ASP A  1  333 ? 50.586  97.522  69.080  1.00 53.75  ? 333  ASP A O     1 
ATOM   2561  C  CB    . ASP A  1  333 ? 49.270  97.036  72.110  1.00 55.39  ? 333  ASP A CB    1 
ATOM   2562  C  CG    . ASP A  1  333 ? 48.387  97.681  73.161  1.00 56.81  ? 333  ASP A CG    1 
ATOM   2563  O  OD1   . ASP A  1  333 ? 48.189  98.914  73.092  1.00 56.00  ? 333  ASP A OD1   1 
ATOM   2564  O  OD2   . ASP A  1  333 ? 47.899  96.953  74.058  1.00 58.18  ? 333  ASP A OD2   1 
ATOM   2565  N  N     . MET A  1  334 ? 49.832  95.443  69.535  1.00 54.08  ? 334  MET A N     1 
ATOM   2566  C  CA    . MET A  1  334 ? 50.761  94.754  68.621  1.00 53.41  ? 334  MET A CA    1 
ATOM   2567  C  C     . MET A  1  334 ? 50.699  95.365  67.231  1.00 52.44  ? 334  MET A C     1 
ATOM   2568  O  O     . MET A  1  334 ? 51.633  96.044  66.786  1.00 51.97  ? 334  MET A O     1 
ATOM   2569  C  CB    . MET A  1  334 ? 50.437  93.250  68.537  1.00 52.31  ? 334  MET A CB    1 
ATOM   2570  C  CG    . MET A  1  334 ? 51.279  92.467  67.516  1.00 51.15  ? 334  MET A CG    1 
ATOM   2571  S  SD    . MET A  1  334 ? 53.096  92.622  67.751  1.00 52.01  ? 334  MET A SD    1 
ATOM   2572  C  CE    . MET A  1  334 ? 53.562  93.424  66.249  1.00 51.43  ? 334  MET A CE    1 
ATOM   2573  N  N     . MET A  1  335 ? 49.597  95.105  66.547  1.00 51.49  ? 335  MET A N     1 
ATOM   2574  C  CA    . MET A  1  335 ? 49.391  95.648  65.223  1.00 51.64  ? 335  MET A CA    1 
ATOM   2575  C  C     . MET A  1  335 ? 49.974  97.047  65.194  1.00 51.69  ? 335  MET A C     1 
ATOM   2576  O  O     . MET A  1  335 ? 50.840  97.365  64.393  1.00 51.14  ? 335  MET A O     1 
ATOM   2577  C  CB    . MET A  1  335 ? 47.907  95.731  64.940  1.00 51.91  ? 335  MET A CB    1 
ATOM   2578  C  CG    . MET A  1  335 ? 47.582  96.430  63.656  1.00 52.95  ? 335  MET A CG    1 
ATOM   2579  S  SD    . MET A  1  335 ? 48.095  95.431  62.300  1.00 54.08  ? 335  MET A SD    1 
ATOM   2580  C  CE    . MET A  1  335 ? 46.876  94.088  62.432  1.00 54.28  ? 335  MET A CE    1 
ATOM   2581  N  N     . PHE A  1  336 ? 49.489  97.875  66.102  1.00 53.05  ? 336  PHE A N     1 
ATOM   2582  C  CA    . PHE A  1  336 ? 49.930  99.250  66.206  1.00 54.64  ? 336  PHE A CA    1 
ATOM   2583  C  C     . PHE A  1  336 ? 51.444  99.419  66.091  1.00 54.21  ? 336  PHE A C     1 
ATOM   2584  O  O     . PHE A  1  336 ? 51.922  100.168 65.242  1.00 55.08  ? 336  PHE A O     1 
ATOM   2585  C  CB    . PHE A  1  336 ? 49.452  99.854  67.530  1.00 57.66  ? 336  PHE A CB    1 
ATOM   2586  C  CG    . PHE A  1  336 ? 49.939  101.253 67.753  1.00 61.03  ? 336  PHE A CG    1 
ATOM   2587  C  CD1   . PHE A  1  336 ? 49.476  102.295 66.963  1.00 63.23  ? 336  PHE A CD1   1 
ATOM   2588  C  CD2   . PHE A  1  336 ? 50.899  101.524 68.712  1.00 62.66  ? 336  PHE A CD2   1 
ATOM   2589  C  CE1   . PHE A  1  336 ? 49.965  103.589 67.126  1.00 64.21  ? 336  PHE A CE1   1 
ATOM   2590  C  CE2   . PHE A  1  336 ? 51.397  102.812 68.881  1.00 64.03  ? 336  PHE A CE2   1 
ATOM   2591  C  CZ    . PHE A  1  336 ? 50.930  103.844 68.089  1.00 64.62  ? 336  PHE A CZ    1 
ATOM   2592  N  N     . CYS A  1  337 ? 52.200  98.739  66.947  1.00 52.98  ? 337  CYS A N     1 
ATOM   2593  C  CA    . CYS A  1  337 ? 53.647  98.863  66.913  1.00 51.05  ? 337  CYS A CA    1 
ATOM   2594  C  C     . CYS A  1  337 ? 54.144  98.433  65.562  1.00 51.26  ? 337  CYS A C     1 
ATOM   2595  O  O     . CYS A  1  337 ? 55.004  99.092  64.980  1.00 52.42  ? 337  CYS A O     1 
ATOM   2596  C  CB    . CYS A  1  337 ? 54.281  97.991  67.976  1.00 50.17  ? 337  CYS A CB    1 
ATOM   2597  S  SG    . CYS A  1  337 ? 53.835  98.440  69.635  1.00 48.97  ? 337  CYS A SG    1 
ATOM   2598  N  N     . ALA A  1  338 ? 53.595  97.327  65.066  1.00 50.30  ? 338  ALA A N     1 
ATOM   2599  C  CA    . ALA A  1  338 ? 53.976  96.799  63.762  1.00 50.12  ? 338  ALA A CA    1 
ATOM   2600  C  C     . ALA A  1  338 ? 53.835  97.876  62.696  1.00 50.73  ? 338  ALA A C     1 
ATOM   2601  O  O     . ALA A  1  338 ? 54.829  98.370  62.176  1.00 51.06  ? 338  ALA A O     1 
ATOM   2602  C  CB    . ALA A  1  338 ? 53.115  95.601  63.405  1.00 49.44  ? 338  ALA A CB    1 
ATOM   2603  N  N     . GLN A  1  339 ? 52.598  98.249  62.383  1.00 51.62  ? 339  GLN A N     1 
ATOM   2604  C  CA    . GLN A  1  339 ? 52.330  99.271  61.375  1.00 52.73  ? 339  GLN A CA    1 
ATOM   2605  C  C     . GLN A  1  339 ? 53.205  100.472 61.578  1.00 53.15  ? 339  GLN A C     1 
ATOM   2606  O  O     . GLN A  1  339 ? 53.501  101.195 60.636  1.00 52.98  ? 339  GLN A O     1 
ATOM   2607  C  CB    . GLN A  1  339 ? 50.873  99.706  61.421  1.00 53.89  ? 339  GLN A CB    1 
ATOM   2608  C  CG    . GLN A  1  339 ? 49.926  98.550  61.202  1.00 57.50  ? 339  GLN A CG    1 
ATOM   2609  C  CD    . GLN A  1  339 ? 48.545  98.996  60.819  1.00 59.35  ? 339  GLN A CD    1 
ATOM   2610  O  OE1   . GLN A  1  339 ? 48.383  99.862  59.963  1.00 61.69  ? 339  GLN A OE1   1 
ATOM   2611  N  NE2   . GLN A  1  339 ? 47.534  98.400  61.439  1.00 59.83  ? 339  GLN A NE2   1 
ATOM   2612  N  N     . GLY A  1  340 ? 53.605  100.690 62.824  1.00 54.47  ? 340  GLY A N     1 
ATOM   2613  C  CA    . GLY A  1  340 ? 54.480  101.800 63.127  1.00 55.78  ? 340  GLY A CA    1 
ATOM   2614  C  C     . GLY A  1  340 ? 55.809  101.522 62.455  1.00 56.49  ? 340  GLY A C     1 
ATOM   2615  O  O     . GLY A  1  340 ? 56.310  102.321 61.661  1.00 56.91  ? 340  GLY A O     1 
ATOM   2616  N  N     . GLU A  1  341 ? 56.376  100.365 62.755  1.00 56.61  ? 341  GLU A N     1 
ATOM   2617  C  CA    . GLU A  1  341 ? 57.643  100.014 62.163  1.00 58.34  ? 341  GLU A CA    1 
ATOM   2618  C  C     . GLU A  1  341 ? 57.603  100.236 60.660  1.00 58.73  ? 341  GLU A C     1 
ATOM   2619  O  O     . GLU A  1  341 ? 58.476  100.894 60.096  1.00 59.05  ? 341  GLU A O     1 
ATOM   2620  C  CB    . GLU A  1  341 ? 57.992  98.580  62.528  1.00 59.06  ? 341  GLU A CB    1 
ATOM   2621  C  CG    . GLU A  1  341 ? 58.124  98.426  64.031  1.00 62.52  ? 341  GLU A CG    1 
ATOM   2622  C  CD    . GLU A  1  341 ? 58.830  99.633  64.676  1.00 64.79  ? 341  GLU A CD    1 
ATOM   2623  O  OE1   . GLU A  1  341 ? 60.020  99.857  64.335  1.00 65.46  ? 341  GLU A OE1   1 
ATOM   2624  O  OE2   . GLU A  1  341 ? 58.200  100.351 65.507  1.00 63.54  ? 341  GLU A OE2   1 
ATOM   2625  N  N     . TRP A  1  342 ? 56.583  99.711  60.004  1.00 59.66  ? 342  TRP A N     1 
ATOM   2626  C  CA    . TRP A  1  342 ? 56.477  99.931  58.577  1.00 61.52  ? 342  TRP A CA    1 
ATOM   2627  C  C     . TRP A  1  342 ? 56.657  101.423 58.334  1.00 62.25  ? 342  TRP A C     1 
ATOM   2628  O  O     . TRP A  1  342 ? 57.532  101.836 57.581  1.00 62.97  ? 342  TRP A O     1 
ATOM   2629  C  CB    . TRP A  1  342 ? 55.107  99.498  58.062  1.00 62.78  ? 342  TRP A CB    1 
ATOM   2630  C  CG    . TRP A  1  342 ? 55.091  98.167  57.411  1.00 62.62  ? 342  TRP A CG    1 
ATOM   2631  C  CD1   . TRP A  1  342 ? 56.146  97.328  57.227  1.00 64.17  ? 342  TRP A CD1   1 
ATOM   2632  C  CD2   . TRP A  1  342 ? 53.958  97.517  56.857  1.00 62.12  ? 342  TRP A CD2   1 
ATOM   2633  N  NE1   . TRP A  1  342 ? 55.739  96.183  56.589  1.00 64.09  ? 342  TRP A NE1   1 
ATOM   2634  C  CE2   . TRP A  1  342 ? 54.396  96.275  56.349  1.00 62.83  ? 342  TRP A CE2   1 
ATOM   2635  C  CE3   . TRP A  1  342 ? 52.613  97.859  56.742  1.00 62.20  ? 342  TRP A CE3   1 
ATOM   2636  C  CZ2   . TRP A  1  342 ? 53.537  95.373  55.737  1.00 63.17  ? 342  TRP A CZ2   1 
ATOM   2637  C  CZ3   . TRP A  1  342 ? 51.755  96.965  56.136  1.00 64.33  ? 342  TRP A CZ3   1 
ATOM   2638  C  CH2   . TRP A  1  342 ? 52.221  95.729  55.638  1.00 64.28  ? 342  TRP A CH2   1 
ATOM   2639  N  N     . MET A  1  343 ? 55.829  102.232 58.979  1.00 62.63  ? 343  MET A N     1 
ATOM   2640  C  CA    . MET A  1  343 ? 55.937  103.666 58.809  1.00 64.34  ? 343  MET A CA    1 
ATOM   2641  C  C     . MET A  1  343 ? 57.363  104.124 59.058  1.00 66.98  ? 343  MET A C     1 
ATOM   2642  O  O     . MET A  1  343 ? 57.942  104.832 58.241  1.00 67.26  ? 343  MET A O     1 
ATOM   2643  C  CB    . MET A  1  343 ? 55.003  104.399 59.764  1.00 62.69  ? 343  MET A CB    1 
ATOM   2644  C  CG    . MET A  1  343 ? 53.549  104.211 59.452  1.00 59.92  ? 343  MET A CG    1 
ATOM   2645  S  SD    . MET A  1  343 ? 53.254  104.618 57.766  1.00 56.25  ? 343  MET A SD    1 
ATOM   2646  C  CE    . MET A  1  343 ? 53.278  103.007 57.061  1.00 57.11  ? 343  MET A CE    1 
ATOM   2647  N  N     . ARG A  1  344 ? 57.943  103.720 60.181  1.00 69.66  ? 344  ARG A N     1 
ATOM   2648  C  CA    . ARG A  1  344 ? 59.295  104.155 60.464  1.00 73.01  ? 344  ARG A CA    1 
ATOM   2649  C  C     . ARG A  1  344 ? 60.210  103.767 59.314  1.00 74.33  ? 344  ARG A C     1 
ATOM   2650  O  O     . ARG A  1  344 ? 61.120  104.519 58.972  1.00 74.33  ? 344  ARG A O     1 
ATOM   2651  C  CB    . ARG A  1  344 ? 59.789  103.576 61.788  1.00 75.35  ? 344  ARG A CB    1 
ATOM   2652  C  CG    . ARG A  1  344 ? 60.599  104.588 62.597  1.00 79.93  ? 344  ARG A CG    1 
ATOM   2653  C  CD    . ARG A  1  344 ? 60.872  104.123 64.033  1.00 84.66  ? 344  ARG A CD    1 
ATOM   2654  N  NE    . ARG A  1  344 ? 59.709  104.154 64.942  1.00 87.54  ? 344  ARG A NE    1 
ATOM   2655  C  CZ    . ARG A  1  344 ? 59.430  105.132 65.815  1.00 88.41  ? 344  ARG A CZ    1 
ATOM   2656  N  NH1   . ARG A  1  344 ? 60.220  106.201 65.918  1.00 88.46  ? 344  ARG A NH1   1 
ATOM   2657  N  NH2   . ARG A  1  344 ? 58.368  105.029 66.617  1.00 87.58  ? 344  ARG A NH2   1 
ATOM   2658  N  N     . LEU A  1  345 ? 59.951  102.613 58.700  1.00 75.90  ? 345  LEU A N     1 
ATOM   2659  C  CA    . LEU A  1  345 ? 60.749  102.153 57.563  1.00 77.89  ? 345  LEU A CA    1 
ATOM   2660  C  C     . LEU A  1  345 ? 60.711  103.151 56.425  1.00 79.53  ? 345  LEU A C     1 
ATOM   2661  O  O     . LEU A  1  345 ? 61.745  103.519 55.877  1.00 80.91  ? 345  LEU A O     1 
ATOM   2662  C  CB    . LEU A  1  345 ? 60.229  100.832 57.020  1.00 78.10  ? 345  LEU A CB    1 
ATOM   2663  C  CG    . LEU A  1  345 ? 60.617  99.576  57.776  1.00 79.66  ? 345  LEU A CG    1 
ATOM   2664  C  CD1   . LEU A  1  345 ? 59.977  98.374  57.109  1.00 79.89  ? 345  LEU A CD1   1 
ATOM   2665  C  CD2   . LEU A  1  345 ? 62.123  99.454  57.781  1.00 80.81  ? 345  LEU A CD2   1 
ATOM   2666  N  N     . CYS A  1  346 ? 59.507  103.580 56.067  1.00 80.80  ? 346  CYS A N     1 
ATOM   2667  C  CA    . CYS A  1  346 ? 59.328  104.526 54.975  1.00 81.85  ? 346  CYS A CA    1 
ATOM   2668  C  C     . CYS A  1  346 ? 59.697  105.962 55.363  1.00 83.83  ? 346  CYS A C     1 
ATOM   2669  O  O     . CYS A  1  346 ? 59.617  106.866 54.523  1.00 83.64  ? 346  CYS A O     1 
ATOM   2670  C  CB    . CYS A  1  346 ? 57.873  104.490 54.490  1.00 80.36  ? 346  CYS A CB    1 
ATOM   2671  S  SG    . CYS A  1  346 ? 57.195  102.838 54.123  1.00 77.58  ? 346  CYS A SG    1 
ATOM   2672  N  N     . THR A  1  347 ? 60.119  106.172 56.615  1.00 85.82  ? 347  THR A N     1 
ATOM   2673  C  CA    . THR A  1  347 ? 60.443  107.522 57.079  1.00 88.15  ? 347  THR A CA    1 
ATOM   2674  C  C     . THR A  1  347 ? 61.773  107.819 57.775  1.00 90.03  ? 347  THR A C     1 
ATOM   2675  O  O     . THR A  1  347 ? 62.355  108.884 57.548  1.00 90.05  ? 347  THR A O     1 
ATOM   2676  C  CB    . THR A  1  347 ? 59.324  108.068 58.012  1.00 88.00  ? 347  THR A CB    1 
ATOM   2677  O  OG1   . THR A  1  347 ? 58.954  107.066 58.970  1.00 86.49  ? 347  THR A OG1   1 
ATOM   2678  C  CG2   . THR A  1  347 ? 58.102  108.483 57.207  1.00 89.10  ? 347  THR A CG2   1 
ATOM   2679  N  N     . SER A  1  348 ? 62.256  106.915 58.625  1.00 92.37  ? 348  SER A N     1 
ATOM   2680  C  CA    . SER A  1  348 ? 63.505  107.194 59.341  1.00 95.07  ? 348  SER A CA    1 
ATOM   2681  C  C     . SER A  1  348 ? 64.508  106.051 59.485  1.00 96.91  ? 348  SER A C     1 
ATOM   2682  O  O     . SER A  1  348 ? 65.271  106.024 60.452  1.00 97.22  ? 348  SER A O     1 
ATOM   2683  C  CB    . SER A  1  348 ? 63.194  107.728 60.741  1.00 94.76  ? 348  SER A CB    1 
ATOM   2684  O  OG    . SER A  1  348 ? 62.739  106.682 61.591  1.00 94.13  ? 348  SER A OG    1 
ATOM   2685  N  N     . THR A  1  349 ? 64.514  105.116 58.540  1.00 98.61  ? 349  THR A N     1 
ATOM   2686  C  CA    . THR A  1  349 ? 65.458  104.004 58.590  1.00 99.59  ? 349  THR A CA    1 
ATOM   2687  C  C     . THR A  1  349 ? 66.866  104.611 58.552  1.00 100.19 ? 349  THR A C     1 
ATOM   2688  O  O     . THR A  1  349 ? 67.113  105.532 57.773  1.00 100.01 ? 349  THR A O     1 
ATOM   2689  C  CB    . THR A  1  349 ? 65.257  103.057 57.376  1.00 99.77  ? 349  THR A CB    1 
ATOM   2690  O  OG1   . THR A  1  349 ? 63.929  102.520 57.400  1.00 99.75  ? 349  THR A OG1   1 
ATOM   2691  C  CG2   . THR A  1  349 ? 66.238  101.904 57.423  1.00 100.74 ? 349  THR A CG2   1 
ATOM   2692  N  N     . THR A  1  350 ? 67.777  104.115 59.395  1.00 100.94 ? 350  THR A N     1 
ATOM   2693  C  CA    . THR A  1  350 ? 69.156  104.634 59.448  1.00 102.10 ? 350  THR A CA    1 
ATOM   2694  C  C     . THR A  1  350 ? 70.172  103.771 58.721  1.00 101.82 ? 350  THR A C     1 
ATOM   2695  O  O     . THR A  1  350 ? 69.864  102.661 58.286  1.00 103.54 ? 350  THR A O     1 
ATOM   2696  C  CB    . THR A  1  350 ? 69.672  104.755 60.878  1.00 103.00 ? 350  THR A CB    1 
ATOM   2697  O  OG1   . THR A  1  350 ? 69.734  103.449 61.471  1.00 103.83 ? 350  THR A OG1   1 
ATOM   2698  C  CG2   . THR A  1  350 ? 68.765  105.653 61.691  1.00 104.50 ? 350  THR A CG2   1 
ATOM   2699  N  N     . GLU A  1  351 ? 71.399  104.268 58.613  1.00 100.13 ? 351  GLU A N     1 
ATOM   2700  C  CA    . GLU A  1  351 ? 72.430  103.509 57.925  1.00 98.36  ? 351  GLU A CA    1 
ATOM   2701  C  C     . GLU A  1  351 ? 72.791  102.260 58.718  1.00 97.02  ? 351  GLU A C     1 
ATOM   2702  O  O     . GLU A  1  351 ? 73.055  101.203 58.147  1.00 95.75  ? 351  GLU A O     1 
ATOM   2703  C  CB    . GLU A  1  351 ? 73.674  104.373 57.708  1.00 98.62  ? 351  GLU A CB    1 
ATOM   2704  C  CG    . GLU A  1  351 ? 73.489  105.550 56.739  1.00 97.74  ? 351  GLU A CG    1 
ATOM   2705  C  CD    . GLU A  1  351 ? 72.974  105.132 55.364  1.00 96.82  ? 351  GLU A CD    1 
ATOM   2706  O  OE1   . GLU A  1  351 ? 73.285  104.001 54.935  1.00 95.84  ? 351  GLU A OE1   1 
ATOM   2707  O  OE2   . GLU A  1  351 ? 72.276  105.942 54.707  1.00 95.78  ? 351  GLU A OE2   1 
ATOM   2708  N  N     . SER A  1  352 ? 72.787  102.382 60.039  1.00 95.94  ? 352  SER A N     1 
ATOM   2709  C  CA    . SER A  1  352 ? 73.126  101.260 60.897  1.00 95.77  ? 352  SER A CA    1 
ATOM   2710  C  C     . SER A  1  352 ? 72.081  100.174 60.810  1.00 95.53  ? 352  SER A C     1 
ATOM   2711  O  O     . SER A  1  352 ? 72.392  98.994  60.938  1.00 95.51  ? 352  SER A O     1 
ATOM   2712  C  CB    . SER A  1  352 ? 73.252  101.725 62.340  1.00 96.25  ? 352  SER A CB    1 
ATOM   2713  O  OG    . SER A  1  352 ? 74.123  102.835 62.420  1.00 97.37  ? 352  SER A OG    1 
ATOM   2714  N  N     . GLU A  1  353 ? 70.832  100.572 60.607  1.00 95.80  ? 353  GLU A N     1 
ATOM   2715  C  CA    . GLU A  1  353 ? 69.758  99.598  60.512  1.00 96.35  ? 353  GLU A CA    1 
ATOM   2716  C  C     . GLU A  1  353 ? 69.957  98.739  59.268  1.00 95.70  ? 353  GLU A C     1 
ATOM   2717  O  O     . GLU A  1  353 ? 69.914  97.515  59.343  1.00 95.60  ? 353  GLU A O     1 
ATOM   2718  C  CB    . GLU A  1  353 ? 68.376  100.287 60.477  1.00 97.97  ? 353  GLU A CB    1 
ATOM   2719  C  CG    . GLU A  1  353 ? 67.856  100.798 61.843  1.00 99.84  ? 353  GLU A CG    1 
ATOM   2720  C  CD    . GLU A  1  353 ? 66.346  101.090 61.860  1.00 101.22 ? 353  GLU A CD    1 
ATOM   2721  O  OE1   . GLU A  1  353 ? 65.888  101.926 61.048  1.00 102.46 ? 353  GLU A OE1   1 
ATOM   2722  O  OE2   . GLU A  1  353 ? 65.616  100.488 62.687  1.00 101.01 ? 353  GLU A OE2   1 
ATOM   2723  N  N     . VAL A  1  354 ? 70.197  99.372  58.126  1.00 95.25  ? 354  VAL A N     1 
ATOM   2724  C  CA    . VAL A  1  354 ? 70.386  98.616  56.896  1.00 95.07  ? 354  VAL A CA    1 
ATOM   2725  C  C     . VAL A  1  354 ? 71.662  97.783  56.933  1.00 95.45  ? 354  VAL A C     1 
ATOM   2726  O  O     . VAL A  1  354 ? 71.655  96.615  56.538  1.00 95.58  ? 354  VAL A O     1 
ATOM   2727  C  CB    . VAL A  1  354 ? 70.423  99.536  55.653  1.00 94.56  ? 354  VAL A CB    1 
ATOM   2728  C  CG1   . VAL A  1  354 ? 69.097  100.258 55.505  1.00 93.76  ? 354  VAL A CG1   1 
ATOM   2729  C  CG2   . VAL A  1  354 ? 71.563  100.532 55.769  1.00 94.43  ? 354  VAL A CG2   1 
ATOM   2730  N  N     . LYS A  1  355 ? 72.754  98.374  57.414  1.00 95.71  ? 355  LYS A N     1 
ATOM   2731  C  CA    . LYS A  1  355 ? 74.019  97.650  57.475  1.00 95.10  ? 355  LYS A CA    1 
ATOM   2732  C  C     . LYS A  1  355 ? 73.783  96.251  58.016  1.00 94.79  ? 355  LYS A C     1 
ATOM   2733  O  O     . LYS A  1  355 ? 74.194  95.276  57.398  1.00 94.94  ? 355  LYS A O     1 
ATOM   2734  C  CB    . LYS A  1  355 ? 75.045  98.371  58.354  1.00 94.85  ? 355  LYS A CB    1 
ATOM   2735  C  CG    . LYS A  1  355 ? 76.401  97.667  58.369  1.00 94.74  ? 355  LYS A CG    1 
ATOM   2736  C  CD    . LYS A  1  355 ? 77.410  98.298  59.320  1.00 94.22  ? 355  LYS A CD    1 
ATOM   2737  C  CE    . LYS A  1  355 ? 78.683  97.452  59.397  1.00 93.26  ? 355  LYS A CE    1 
ATOM   2738  N  NZ    . LYS A  1  355 ? 79.676  98.001  60.354  1.00 92.75  ? 355  LYS A NZ    1 
ATOM   2739  N  N     . ARG A  1  356 ? 73.111  96.151  59.160  1.00 94.66  ? 356  ARG A N     1 
ATOM   2740  C  CA    . ARG A  1  356 ? 72.831  94.847  59.746  1.00 95.22  ? 356  ARG A CA    1 
ATOM   2741  C  C     . ARG A  1  356 ? 71.986  93.976  58.816  1.00 95.10  ? 356  ARG A C     1 
ATOM   2742  O  O     . ARG A  1  356 ? 72.439  92.931  58.346  1.00 94.90  ? 356  ARG A O     1 
ATOM   2743  C  CB    . ARG A  1  356 ? 72.104  94.987  61.084  1.00 96.35  ? 356  ARG A CB    1 
ATOM   2744  C  CG    . ARG A  1  356 ? 71.738  93.630  61.671  1.00 98.25  ? 356  ARG A CG    1 
ATOM   2745  C  CD    . ARG A  1  356 ? 70.981  93.714  62.984  1.00 100.16 ? 356  ARG A CD    1 
ATOM   2746  N  NE    . ARG A  1  356 ? 69.555  93.989  62.817  1.00 102.07 ? 356  ARG A NE    1 
ATOM   2747  C  CZ    . ARG A  1  356 ? 68.991  95.170  63.052  1.00 103.59 ? 356  ARG A CZ    1 
ATOM   2748  N  NH1   . ARG A  1  356 ? 69.736  96.192  63.463  1.00 103.92 ? 356  ARG A NH1   1 
ATOM   2749  N  NH2   . ARG A  1  356 ? 67.680  95.326  62.891  1.00 104.80 ? 356  ARG A NH2   1 
ATOM   2750  N  N     . ALA A  1  357 ? 70.752  94.402  58.570  1.00 95.16  ? 357  ALA A N     1 
ATOM   2751  C  CA    . ALA A  1  357 ? 69.852  93.659  57.696  1.00 95.43  ? 357  ALA A CA    1 
ATOM   2752  C  C     . ALA A  1  357 ? 70.679  93.004  56.608  1.00 95.31  ? 357  ALA A C     1 
ATOM   2753  O  O     . ALA A  1  357 ? 70.682  91.786  56.459  1.00 94.87  ? 357  ALA A O     1 
ATOM   2754  C  CB    . ALA A  1  357 ? 68.824  94.600  57.076  1.00 95.95  ? 357  ALA A CB    1 
ATOM   2755  N  N     . LYS A  1  358 ? 71.400  93.828  55.861  1.00 95.70  ? 358  LYS A N     1 
ATOM   2756  C  CA    . LYS A  1  358 ? 72.249  93.332  54.800  1.00 96.26  ? 358  LYS A CA    1 
ATOM   2757  C  C     . LYS A  1  358 ? 72.962  92.068  55.262  1.00 96.30  ? 358  LYS A C     1 
ATOM   2758  O  O     . LYS A  1  358 ? 72.775  91.004  54.680  1.00 95.90  ? 358  LYS A O     1 
ATOM   2759  C  CB    . LYS A  1  358 ? 73.268  94.405  54.409  1.00 97.11  ? 358  LYS A CB    1 
ATOM   2760  C  CG    . LYS A  1  358 ? 72.688  95.533  53.563  1.00 98.95  ? 358  LYS A CG    1 
ATOM   2761  C  CD    . LYS A  1  358 ? 73.686  96.685  53.369  1.00 100.95 ? 358  LYS A CD    1 
ATOM   2762  C  CE    . LYS A  1  358 ? 75.012  96.230  52.736  1.00 101.81 ? 358  LYS A CE    1 
ATOM   2763  N  NZ    . LYS A  1  358 ? 76.006  97.339  52.563  1.00 101.33 ? 358  LYS A NZ    1 
ATOM   2764  N  N     . ASN A  1  359 ? 73.754  92.180  56.324  1.00 96.82  ? 359  ASN A N     1 
ATOM   2765  C  CA    . ASN A  1  359 ? 74.499  91.036  56.839  1.00 97.35  ? 359  ASN A CA    1 
ATOM   2766  C  C     . ASN A  1  359 ? 73.603  89.895  57.238  1.00 97.77  ? 359  ASN A C     1 
ATOM   2767  O  O     . ASN A  1  359 ? 73.997  88.736  57.145  1.00 96.94  ? 359  ASN A O     1 
ATOM   2768  C  CB    . ASN A  1  359 ? 75.361  91.433  58.031  1.00 97.30  ? 359  ASN A CB    1 
ATOM   2769  C  CG    . ASN A  1  359 ? 76.287  92.577  57.712  1.00 98.16  ? 359  ASN A CG    1 
ATOM   2770  O  OD1   . ASN A  1  359 ? 76.791  92.699  56.590  1.00 98.50  ? 359  ASN A OD1   1 
ATOM   2771  N  ND2   . ASN A  1  359 ? 76.530  93.424  58.701  1.00 98.82  ? 359  ASN A ND2   1 
ATOM   2772  N  N     . HIS A  1  360 ? 72.402  90.214  57.698  1.00 99.24  ? 360  HIS A N     1 
ATOM   2773  C  CA    . HIS A  1  360 ? 71.476  89.161  58.078  1.00 101.85 ? 360  HIS A CA    1 
ATOM   2774  C  C     . HIS A  1  360 ? 71.012  88.477  56.793  1.00 102.59 ? 360  HIS A C     1 
ATOM   2775  O  O     . HIS A  1  360 ? 71.083  87.249  56.663  1.00 103.31 ? 360  HIS A O     1 
ATOM   2776  C  CB    . HIS A  1  360 ? 70.270  89.736  58.830  1.00 103.13 ? 360  HIS A CB    1 
ATOM   2777  C  CG    . HIS A  1  360 ? 69.219  88.719  59.165  1.00 104.71 ? 360  HIS A CG    1 
ATOM   2778  N  ND1   . HIS A  1  360 ? 69.436  87.685  60.052  1.00 105.07 ? 360  HIS A ND1   1 
ATOM   2779  C  CD2   . HIS A  1  360 ? 67.942  88.580  58.731  1.00 105.39 ? 360  HIS A CD2   1 
ATOM   2780  C  CE1   . HIS A  1  360 ? 68.339  86.954  60.149  1.00 106.24 ? 360  HIS A CE1   1 
ATOM   2781  N  NE2   . HIS A  1  360 ? 67.417  87.476  59.358  1.00 106.35 ? 360  HIS A NE2   1 
ATOM   2782  N  N     . LEU A  1  361 ? 70.558  89.285  55.838  1.00 102.58 ? 361  LEU A N     1 
ATOM   2783  C  CA    . LEU A  1  361 ? 70.069  88.771  54.562  1.00 101.83 ? 361  LEU A CA    1 
ATOM   2784  C  C     . LEU A  1  361 ? 71.106  87.895  53.878  1.00 102.70 ? 361  LEU A C     1 
ATOM   2785  O  O     . LEU A  1  361 ? 70.800  86.785  53.442  1.00 102.72 ? 361  LEU A O     1 
ATOM   2786  C  CB    . LEU A  1  361 ? 69.672  89.926  53.642  1.00 99.25  ? 361  LEU A CB    1 
ATOM   2787  C  CG    . LEU A  1  361 ? 69.056  89.547  52.297  1.00 96.83  ? 361  LEU A CG    1 
ATOM   2788  C  CD1   . LEU A  1  361 ? 68.070  88.414  52.450  1.00 96.06  ? 361  LEU A CD1   1 
ATOM   2789  C  CD2   . LEU A  1  361 ? 68.374  90.761  51.722  1.00 97.12  ? 361  LEU A CD2   1 
ATOM   2790  N  N     . ARG A  1  362 ? 72.336  88.391  53.791  1.00 103.77 ? 362  ARG A N     1 
ATOM   2791  C  CA    . ARG A  1  362 ? 73.396  87.627  53.157  1.00 104.68 ? 362  ARG A CA    1 
ATOM   2792  C  C     . ARG A  1  362 ? 73.407  86.203  53.690  1.00 105.19 ? 362  ARG A C     1 
ATOM   2793  O  O     . ARG A  1  362 ? 73.450  85.257  52.909  1.00 105.31 ? 362  ARG A O     1 
ATOM   2794  C  CB    . ARG A  1  362 ? 74.762  88.279  53.392  1.00 105.35 ? 362  ARG A CB    1 
ATOM   2795  C  CG    . ARG A  1  362 ? 74.989  89.587  52.634  1.00 106.15 ? 362  ARG A CG    1 
ATOM   2796  C  CD    . ARG A  1  362 ? 76.482  89.877  52.505  1.00 107.50 ? 362  ARG A CD    1 
ATOM   2797  N  NE    . ARG A  1  362 ? 76.776  91.150  51.846  1.00 109.15 ? 362  ARG A NE    1 
ATOM   2798  C  CZ    . ARG A  1  362 ? 76.744  92.339  52.448  1.00 110.49 ? 362  ARG A CZ    1 
ATOM   2799  N  NH1   . ARG A  1  362 ? 76.429  92.430  53.736  1.00 111.46 ? 362  ARG A NH1   1 
ATOM   2800  N  NH2   . ARG A  1  362 ? 77.035  93.441  51.764  1.00 110.25 ? 362  ARG A NH2   1 
ATOM   2801  N  N     . SER A  1  363 ? 73.351  86.054  55.014  1.00 105.94 ? 363  SER A N     1 
ATOM   2802  C  CA    . SER A  1  363 ? 73.364  84.730  55.647  1.00 106.83 ? 363  SER A CA    1 
ATOM   2803  C  C     . SER A  1  363 ? 72.232  83.805  55.210  1.00 106.67 ? 363  SER A C     1 
ATOM   2804  O  O     . SER A  1  363 ? 72.481  82.653  54.844  1.00 106.52 ? 363  SER A O     1 
ATOM   2805  C  CB    . SER A  1  363 ? 73.349  84.853  57.174  1.00 107.28 ? 363  SER A CB    1 
ATOM   2806  O  OG    . SER A  1  363 ? 74.641  84.619  57.708  1.00 108.64 ? 363  SER A OG    1 
ATOM   2807  N  N     . ALA A  1  364 ? 70.995  84.292  55.266  1.00 106.42 ? 364  ALA A N     1 
ATOM   2808  C  CA    . ALA A  1  364 ? 69.862  83.479  54.841  1.00 106.54 ? 364  ALA A CA    1 
ATOM   2809  C  C     . ALA A  1  364 ? 70.121  83.135  53.383  1.00 106.45 ? 364  ALA A C     1 
ATOM   2810  O  O     . ALA A  1  364 ? 69.917  82.002  52.956  1.00 106.82 ? 364  ALA A O     1 
ATOM   2811  C  CB    . ALA A  1  364 ? 68.567  84.253  54.975  1.00 106.69 ? 364  ALA A CB    1 
ATOM   2812  N  N     . MET A  1  365 ? 70.579  84.132  52.632  1.00 106.19 ? 365  MET A N     1 
ATOM   2813  C  CA    . MET A  1  365 ? 70.909  83.969  51.221  1.00 105.95 ? 365  MET A CA    1 
ATOM   2814  C  C     . MET A  1  365 ? 71.743  82.703  51.079  1.00 106.73 ? 365  MET A C     1 
ATOM   2815  O  O     . MET A  1  365 ? 71.465  81.845  50.237  1.00 107.09 ? 365  MET A O     1 
ATOM   2816  C  CB    . MET A  1  365 ? 71.710  85.182  50.746  1.00 104.58 ? 365  MET A CB    1 
ATOM   2817  C  CG    . MET A  1  365 ? 72.365  85.046  49.388  1.00 103.47 ? 365  MET A CG    1 
ATOM   2818  S  SD    . MET A  1  365 ? 73.189  86.583  48.890  1.00 102.47 ? 365  MET A SD    1 
ATOM   2819  C  CE    . MET A  1  365 ? 74.673  86.516  49.880  1.00 103.47 ? 365  MET A CE    1 
ATOM   2820  N  N     . VAL A  1  366 ? 72.763  82.595  51.925  1.00 107.20 ? 366  VAL A N     1 
ATOM   2821  C  CA    . VAL A  1  366 ? 73.652  81.443  51.934  1.00 106.95 ? 366  VAL A CA    1 
ATOM   2822  C  C     . VAL A  1  366 ? 72.925  80.210  52.457  1.00 107.54 ? 366  VAL A C     1 
ATOM   2823  O  O     . VAL A  1  366 ? 72.915  79.173  51.798  1.00 107.59 ? 366  VAL A O     1 
ATOM   2824  C  CB    . VAL A  1  366 ? 74.892  81.709  52.815  1.00 105.85 ? 366  VAL A CB    1 
ATOM   2825  C  CG1   . VAL A  1  366 ? 75.702  80.445  52.955  1.00 105.56 ? 366  VAL A CG1   1 
ATOM   2826  C  CG2   . VAL A  1  366 ? 75.740  82.807  52.199  1.00 104.91 ? 366  VAL A CG2   1 
ATOM   2827  N  N     . ALA A  1  367 ? 72.306  80.335  53.631  1.00 108.36 ? 367  ALA A N     1 
ATOM   2828  C  CA    . ALA A  1  367 ? 71.582  79.225  54.265  1.00 109.17 ? 367  ALA A CA    1 
ATOM   2829  C  C     . ALA A  1  367 ? 70.475  78.610  53.405  1.00 109.34 ? 367  ALA A C     1 
ATOM   2830  O  O     . ALA A  1  367 ? 69.949  77.546  53.729  1.00 108.41 ? 367  ALA A O     1 
ATOM   2831  C  CB    . ALA A  1  367 ? 71.007  79.671  55.614  1.00 108.79 ? 367  ALA A CB    1 
ATOM   2832  N  N     . GLN A  1  368 ? 70.113  79.279  52.320  1.00 110.46 ? 368  GLN A N     1 
ATOM   2833  C  CA    . GLN A  1  368 ? 69.084  78.750  51.437  1.00 112.11 ? 368  GLN A CA    1 
ATOM   2834  C  C     . GLN A  1  368 ? 69.777  77.741  50.539  1.00 111.99 ? 368  GLN A C     1 
ATOM   2835  O  O     . GLN A  1  368 ? 69.148  76.834  49.986  1.00 111.81 ? 368  GLN A O     1 
ATOM   2836  C  CB    . GLN A  1  368 ? 68.459  79.877  50.605  1.00 114.00 ? 368  GLN A CB    1 
ATOM   2837  C  CG    . GLN A  1  368 ? 67.530  80.811  51.401  1.00 116.39 ? 368  GLN A CG    1 
ATOM   2838  C  CD    . GLN A  1  368 ? 66.126  80.233  51.630  1.00 117.38 ? 368  GLN A CD    1 
ATOM   2839  O  OE1   . GLN A  1  368 ? 65.303  80.180  50.708  1.00 117.68 ? 368  GLN A OE1   1 
ATOM   2840  N  NE2   . GLN A  1  368 ? 65.853  79.797  52.863  1.00 117.18 ? 368  GLN A NE2   1 
ATOM   2841  N  N     . LEU A  1  369 ? 71.089  77.921  50.412  1.00 111.76 ? 369  LEU A N     1 
ATOM   2842  C  CA    . LEU A  1  369 ? 71.939  77.053  49.611  1.00 111.80 ? 369  LEU A CA    1 
ATOM   2843  C  C     . LEU A  1  369 ? 72.832  76.240  50.563  1.00 112.20 ? 369  LEU A C     1 
ATOM   2844  O  O     . LEU A  1  369 ? 74.061  76.383  50.591  1.00 112.58 ? 369  LEU A O     1 
ATOM   2845  C  CB    . LEU A  1  369 ? 72.789  77.904  48.669  1.00 111.24 ? 369  LEU A CB    1 
ATOM   2846  C  CG    . LEU A  1  369 ? 71.993  78.850  47.775  1.00 110.43 ? 369  LEU A CG    1 
ATOM   2847  C  CD1   . LEU A  1  369 ? 72.928  79.604  46.860  1.00 110.20 ? 369  LEU A CD1   1 
ATOM   2848  C  CD2   . LEU A  1  369 ? 70.999  78.050  46.960  1.00 110.12 ? 369  LEU A CD2   1 
ATOM   2849  N  N     . ASP A  1  370 ? 72.187  75.386  51.351  1.00 112.14 ? 370  ASP A N     1 
ATOM   2850  C  CA    . ASP A  1  370 ? 72.875  74.553  52.327  1.00 111.13 ? 370  ASP A CA    1 
ATOM   2851  C  C     . ASP A  1  370 ? 72.539  73.099  52.044  1.00 110.38 ? 370  ASP A C     1 
ATOM   2852  O  O     . ASP A  1  370 ? 71.607  72.526  52.623  1.00 109.73 ? 370  ASP A O     1 
ATOM   2853  C  CB    . ASP A  1  370 ? 72.421  74.934  53.735  1.00 111.51 ? 370  ASP A CB    1 
ATOM   2854  C  CG    . ASP A  1  370 ? 73.366  74.452  54.801  1.00 110.96 ? 370  ASP A CG    1 
ATOM   2855  O  OD1   . ASP A  1  370 ? 74.579  74.748  54.691  1.00 110.34 ? 370  ASP A OD1   1 
ATOM   2856  O  OD2   . ASP A  1  370 ? 72.886  73.792  55.747  1.00 111.06 ? 370  ASP A OD2   1 
ATOM   2857  N  N     . GLY A  1  371 ? 73.304  72.515  51.131  1.00 109.68 ? 371  GLY A N     1 
ATOM   2858  C  CA    . GLY A  1  371 ? 73.091  71.132  50.767  1.00 108.81 ? 371  GLY A CA    1 
ATOM   2859  C  C     . GLY A  1  371 ? 72.696  71.018  49.317  1.00 108.20 ? 371  GLY A C     1 
ATOM   2860  O  O     . GLY A  1  371 ? 72.764  71.993  48.571  1.00 107.88 ? 371  GLY A O     1 
ATOM   2861  N  N     . THR A  1  372 ? 72.281  69.821  48.921  1.00 107.94 ? 372  THR A N     1 
ATOM   2862  C  CA    . THR A  1  372 ? 71.866  69.577  47.547  1.00 107.64 ? 372  THR A CA    1 
ATOM   2863  C  C     . THR A  1  372 ? 70.440  70.062  47.282  1.00 106.83 ? 372  THR A C     1 
ATOM   2864  O  O     . THR A  1  372 ? 70.238  71.043  46.560  1.00 107.70 ? 372  THR A O     1 
ATOM   2865  C  CB    . THR A  1  372 ? 71.963  68.077  47.186  1.00 107.54 ? 372  THR A CB    1 
ATOM   2866  O  OG1   . THR A  1  372 ? 71.331  67.296  48.206  1.00 107.87 ? 372  THR A OG1   1 
ATOM   2867  C  CG2   . THR A  1  372 ? 73.419  67.655  47.047  1.00 107.40 ? 372  THR A CG2   1 
ATOM   2868  N  N     . THR A  1  373 ? 69.452  69.390  47.868  1.00 104.75 ? 373  THR A N     1 
ATOM   2869  C  CA    . THR A  1  373 ? 68.066  69.779  47.649  1.00 102.39 ? 373  THR A CA    1 
ATOM   2870  C  C     . THR A  1  373 ? 67.931  71.290  47.584  1.00 101.46 ? 373  THR A C     1 
ATOM   2871  O  O     . THR A  1  373 ? 67.522  71.822  46.558  1.00 101.75 ? 373  THR A O     1 
ATOM   2872  C  CB    . THR A  1  373 ? 67.141  69.255  48.749  1.00 102.04 ? 373  THR A CB    1 
ATOM   2873  O  OG1   . THR A  1  373 ? 67.391  67.865  48.948  1.00 102.95 ? 373  THR A OG1   1 
ATOM   2874  C  CG2   . THR A  1  373 ? 65.693  69.423  48.349  1.00 100.86 ? 373  THR A CG2   1 
ATOM   2875  N  N     . PRO A  1  374 ? 68.312  72.006  48.661  1.00 100.16 ? 374  PRO A N     1 
ATOM   2876  C  CA    . PRO A  1  374 ? 68.199  73.469  48.659  1.00 99.17  ? 374  PRO A CA    1 
ATOM   2877  C  C     . PRO A  1  374 ? 68.694  74.140  47.370  1.00 98.35  ? 374  PRO A C     1 
ATOM   2878  O  O     . PRO A  1  374 ? 67.957  74.903  46.735  1.00 99.00  ? 374  PRO A O     1 
ATOM   2879  C  CB    . PRO A  1  374 ? 69.015  73.877  49.883  1.00 99.18  ? 374  PRO A CB    1 
ATOM   2880  C  CG    . PRO A  1  374 ? 68.800  72.737  50.815  1.00 99.46  ? 374  PRO A CG    1 
ATOM   2881  C  CD    . PRO A  1  374 ? 68.969  71.543  49.898  1.00 99.77  ? 374  PRO A CD    1 
ATOM   2882  N  N     . VAL A  1  375 ? 69.938  73.856  46.991  1.00 96.05  ? 375  VAL A N     1 
ATOM   2883  C  CA    . VAL A  1  375 ? 70.522  74.428  45.782  1.00 93.34  ? 375  VAL A CA    1 
ATOM   2884  C  C     . VAL A  1  375 ? 69.634  74.152  44.585  1.00 91.25  ? 375  VAL A C     1 
ATOM   2885  O  O     . VAL A  1  375 ? 69.203  75.062  43.883  1.00 90.71  ? 375  VAL A O     1 
ATOM   2886  C  CB    . VAL A  1  375 ? 71.899  73.821  45.500  1.00 93.84  ? 375  VAL A CB    1 
ATOM   2887  C  CG1   . VAL A  1  375 ? 72.430  74.323  44.167  1.00 94.49  ? 375  VAL A CG1   1 
ATOM   2888  C  CG2   . VAL A  1  375 ? 72.851  74.178  46.618  1.00 94.61  ? 375  VAL A CG2   1 
ATOM   2889  N  N     . CYS A  1  376 ? 69.371  72.875  44.366  1.00 89.06  ? 376  CYS A N     1 
ATOM   2890  C  CA    . CYS A  1  376 ? 68.547  72.425  43.269  1.00 87.79  ? 376  CYS A CA    1 
ATOM   2891  C  C     . CYS A  1  376 ? 67.243  73.200  43.206  1.00 87.01  ? 376  CYS A C     1 
ATOM   2892  O  O     . CYS A  1  376 ? 66.787  73.591  42.135  1.00 86.54  ? 376  CYS A O     1 
ATOM   2893  C  CB    . CYS A  1  376 ? 68.253  70.955  43.452  1.00 87.83  ? 376  CYS A CB    1 
ATOM   2894  S  SG    . CYS A  1  376 ? 67.808  70.185  41.937  1.00 92.00  ? 376  CYS A SG    1 
ATOM   2895  N  N     . GLU A  1  377 ? 66.636  73.405  44.368  1.00 86.78  ? 377  GLU A N     1 
ATOM   2896  C  CA    . GLU A  1  377 ? 65.384  74.148  44.461  1.00 86.05  ? 377  GLU A CA    1 
ATOM   2897  C  C     . GLU A  1  377 ? 65.606  75.526  43.895  1.00 85.44  ? 377  GLU A C     1 
ATOM   2898  O  O     . GLU A  1  377 ? 64.898  75.947  42.987  1.00 85.49  ? 377  GLU A O     1 
ATOM   2899  C  CB    . GLU A  1  377 ? 64.936  74.280  45.920  1.00 86.34  ? 377  GLU A CB    1 
ATOM   2900  C  CG    . GLU A  1  377 ? 63.915  75.385  46.156  1.00 86.62  ? 377  GLU A CG    1 
ATOM   2901  C  CD    . GLU A  1  377 ? 62.634  75.202  45.358  1.00 86.07  ? 377  GLU A CD    1 
ATOM   2902  O  OE1   . GLU A  1  377 ? 61.846  74.289  45.684  1.00 85.72  ? 377  GLU A OE1   1 
ATOM   2903  O  OE2   . GLU A  1  377 ? 62.414  75.973  44.404  1.00 85.48  ? 377  GLU A OE2   1 
ATOM   2904  N  N     . THR A  1  378 ? 66.595  76.219  44.452  1.00 84.72  ? 378  THR A N     1 
ATOM   2905  C  CA    . THR A  1  378 ? 66.941  77.564  44.024  1.00 84.31  ? 378  THR A CA    1 
ATOM   2906  C  C     . THR A  1  378 ? 67.084  77.631  42.507  1.00 83.63  ? 378  THR A C     1 
ATOM   2907  O  O     . THR A  1  378 ? 66.569  78.548  41.856  1.00 83.48  ? 378  THR A O     1 
ATOM   2908  C  CB    . THR A  1  378 ? 68.255  78.025  44.685  1.00 84.81  ? 378  THR A CB    1 
ATOM   2909  O  OG1   . THR A  1  378 ? 68.054  78.157  46.099  1.00 84.92  ? 378  THR A OG1   1 
ATOM   2910  C  CG2   . THR A  1  378 ? 68.707  79.365  44.109  1.00 85.54  ? 378  THR A CG2   1 
ATOM   2911  N  N     . ILE A  1  379 ? 67.786  76.654  41.946  1.00 82.70  ? 379  ILE A N     1 
ATOM   2912  C  CA    . ILE A  1  379 ? 67.976  76.609  40.507  1.00 81.80  ? 379  ILE A CA    1 
ATOM   2913  C  C     . ILE A  1  379 ? 66.641  76.320  39.846  1.00 81.41  ? 379  ILE A C     1 
ATOM   2914  O  O     . ILE A  1  379 ? 66.202  77.061  38.965  1.00 80.55  ? 379  ILE A O     1 
ATOM   2915  C  CB    . ILE A  1  379 ? 69.011  75.542  40.131  1.00 81.53  ? 379  ILE A CB    1 
ATOM   2916  C  CG1   . ILE A  1  379 ? 70.368  75.959  40.708  1.00 81.55  ? 379  ILE A CG1   1 
ATOM   2917  C  CG2   . ILE A  1  379 ? 69.078  75.380  38.623  1.00 80.89  ? 379  ILE A CG2   1 
ATOM   2918  C  CD1   . ILE A  1  379 ? 71.489  75.010  40.435  1.00 82.21  ? 379  ILE A CD1   1 
ATOM   2919  N  N     . GLY A  1  380 ? 65.986  75.256  40.295  1.00 81.56  ? 380  GLY A N     1 
ATOM   2920  C  CA    . GLY A  1  380 ? 64.696  74.906  39.738  1.00 82.37  ? 380  GLY A CA    1 
ATOM   2921  C  C     . GLY A  1  380 ? 63.834  76.143  39.632  1.00 82.73  ? 380  GLY A C     1 
ATOM   2922  O  O     . GLY A  1  380 ? 63.191  76.389  38.610  1.00 82.85  ? 380  GLY A O     1 
ATOM   2923  N  N     . SER A  1  381 ? 63.846  76.941  40.695  1.00 83.09  ? 381  SER A N     1 
ATOM   2924  C  CA    . SER A  1  381 ? 63.057  78.162  40.737  1.00 82.91  ? 381  SER A CA    1 
ATOM   2925  C  C     . SER A  1  381 ? 63.737  79.375  40.128  1.00 82.30  ? 381  SER A C     1 
ATOM   2926  O  O     . SER A  1  381 ? 63.063  80.320  39.752  1.00 82.95  ? 381  SER A O     1 
ATOM   2927  C  CB    . SER A  1  381 ? 62.637  78.488  42.176  1.00 83.35  ? 381  SER A CB    1 
ATOM   2928  O  OG    . SER A  1  381 ? 61.697  77.543  42.661  1.00 83.88  ? 381  SER A OG    1 
ATOM   2929  N  N     . HIS A  1  382 ? 65.056  79.384  40.027  1.00 81.24  ? 382  HIS A N     1 
ATOM   2930  C  CA    . HIS A  1  382 ? 65.667  80.553  39.437  1.00 81.32  ? 382  HIS A CA    1 
ATOM   2931  C  C     . HIS A  1  382 ? 65.286  80.638  37.980  1.00 82.26  ? 382  HIS A C     1 
ATOM   2932  O  O     . HIS A  1  382 ? 64.752  81.641  37.521  1.00 81.57  ? 382  HIS A O     1 
ATOM   2933  C  CB    . HIS A  1  382 ? 67.176  80.517  39.568  1.00 80.76  ? 382  HIS A CB    1 
ATOM   2934  C  CG    . HIS A  1  382 ? 67.686  81.265  40.754  1.00 81.27  ? 382  HIS A CG    1 
ATOM   2935  N  ND1   . HIS A  1  382 ? 68.934  81.845  40.787  1.00 82.49  ? 382  HIS A ND1   1 
ATOM   2936  C  CD2   . HIS A  1  382 ? 67.122  81.519  41.957  1.00 81.81  ? 382  HIS A CD2   1 
ATOM   2937  C  CE1   . HIS A  1  382 ? 69.119  82.425  41.960  1.00 82.93  ? 382  HIS A CE1   1 
ATOM   2938  N  NE2   . HIS A  1  382 ? 68.034  82.241  42.690  1.00 82.94  ? 382  HIS A NE2   1 
ATOM   2939  N  N     . LEU A  1  383 ? 65.548  79.566  37.252  1.00 84.55  ? 383  LEU A N     1 
ATOM   2940  C  CA    . LEU A  1  383 ? 65.250  79.521  35.825  1.00 87.16  ? 383  LEU A CA    1 
ATOM   2941  C  C     . LEU A  1  383 ? 63.776  79.743  35.544  1.00 87.92  ? 383  LEU A C     1 
ATOM   2942  O  O     . LEU A  1  383 ? 63.394  80.499  34.649  1.00 88.56  ? 383  LEU A O     1 
ATOM   2943  C  CB    . LEU A  1  383 ? 65.658  78.165  35.243  1.00 87.53  ? 383  LEU A CB    1 
ATOM   2944  C  CG    . LEU A  1  383 ? 67.104  77.729  35.482  1.00 87.65  ? 383  LEU A CG    1 
ATOM   2945  C  CD1   . LEU A  1  383 ? 67.247  76.274  35.084  1.00 87.60  ? 383  LEU A CD1   1 
ATOM   2946  C  CD2   . LEU A  1  383 ? 68.068  78.630  34.708  1.00 86.43  ? 383  LEU A CD2   1 
ATOM   2947  N  N     . LEU A  1  384 ? 62.951  79.068  36.322  1.00 88.65  ? 384  LEU A N     1 
ATOM   2948  C  CA    . LEU A  1  384 ? 61.519  79.146  36.150  1.00 89.96  ? 384  LEU A CA    1 
ATOM   2949  C  C     . LEU A  1  384 ? 60.899  80.554  36.332  1.00 92.14  ? 384  LEU A C     1 
ATOM   2950  O  O     . LEU A  1  384 ? 59.949  80.910  35.618  1.00 93.17  ? 384  LEU A O     1 
ATOM   2951  C  CB    . LEU A  1  384 ? 60.876  78.122  37.093  1.00 87.57  ? 384  LEU A CB    1 
ATOM   2952  C  CG    . LEU A  1  384 ? 59.469  77.628  36.770  1.00 86.39  ? 384  LEU A CG    1 
ATOM   2953  C  CD1   . LEU A  1  384 ? 59.336  77.329  35.297  1.00 86.48  ? 384  LEU A CD1   1 
ATOM   2954  C  CD2   . LEU A  1  384 ? 59.183  76.392  37.577  1.00 85.40  ? 384  LEU A CD2   1 
ATOM   2955  N  N     . ASN A  1  385 ? 61.436  81.357  37.260  1.00 93.52  ? 385  ASN A N     1 
ATOM   2956  C  CA    . ASN A  1  385 ? 60.902  82.704  37.546  1.00 93.51  ? 385  ASN A CA    1 
ATOM   2957  C  C     . ASN A  1  385 ? 61.772  83.869  37.087  1.00 94.08  ? 385  ASN A C     1 
ATOM   2958  O  O     . ASN A  1  385 ? 61.284  84.757  36.399  1.00 93.65  ? 385  ASN A O     1 
ATOM   2959  C  CB    . ASN A  1  385 ? 60.626  82.874  39.055  1.00 93.42  ? 385  ASN A CB    1 
ATOM   2960  C  CG    . ASN A  1  385 ? 59.353  82.164  39.513  1.00 93.69  ? 385  ASN A CG    1 
ATOM   2961  O  OD1   . ASN A  1  385 ? 58.256  82.467  39.042  1.00 93.68  ? 385  ASN A OD1   1 
ATOM   2962  N  ND2   . ASN A  1  385 ? 59.498  81.219  40.440  1.00 93.34  ? 385  ASN A ND2   1 
ATOM   2963  N  N     . TYR A  1  386 ? 63.047  83.868  37.480  1.00 95.48  ? 386  TYR A N     1 
ATOM   2964  C  CA    . TYR A  1  386 ? 63.983  84.937  37.125  1.00 96.96  ? 386  TYR A CA    1 
ATOM   2965  C  C     . TYR A  1  386 ? 64.566  84.850  35.713  1.00 99.06  ? 386  TYR A C     1 
ATOM   2966  O  O     . TYR A  1  386 ? 65.147  85.824  35.227  1.00 99.75  ? 386  TYR A O     1 
ATOM   2967  C  CB    . TYR A  1  386 ? 65.137  84.977  38.126  1.00 96.30  ? 386  TYR A CB    1 
ATOM   2968  C  CG    . TYR A  1  386 ? 64.793  85.581  39.466  1.00 97.79  ? 386  TYR A CG    1 
ATOM   2969  C  CD1   . TYR A  1  386 ? 64.543  86.943  39.594  1.00 99.33  ? 386  TYR A CD1   1 
ATOM   2970  C  CD2   . TYR A  1  386 ? 64.748  84.797  40.619  1.00 98.89  ? 386  TYR A CD2   1 
ATOM   2971  C  CE1   . TYR A  1  386 ? 64.256  87.522  40.854  1.00 100.88 ? 386  TYR A CE1   1 
ATOM   2972  C  CE2   . TYR A  1  386 ? 64.462  85.361  41.884  1.00 99.78  ? 386  TYR A CE2   1 
ATOM   2973  C  CZ    . TYR A  1  386 ? 64.217  86.727  41.993  1.00 100.51 ? 386  TYR A CZ    1 
ATOM   2974  O  OH    . TYR A  1  386 ? 63.929  87.301  43.220  1.00 99.48  ? 386  TYR A OH    1 
ATOM   2975  N  N     . GLY A  1  387 ? 64.423  83.694  35.061  1.00 100.98 ? 387  GLY A N     1 
ATOM   2976  C  CA    . GLY A  1  387 ? 64.946  83.527  33.708  1.00 102.18 ? 387  GLY A CA    1 
ATOM   2977  C  C     . GLY A  1  387 ? 66.181  82.644  33.635  1.00 102.96 ? 387  GLY A C     1 
ATOM   2978  O  O     . GLY A  1  387 ? 66.198  81.643  32.919  1.00 102.58 ? 387  GLY A O     1 
ATOM   2979  N  N     . ARG A  1  388 ? 67.219  83.025  34.373  1.00 104.24 ? 388  ARG A N     1 
ATOM   2980  C  CA    . ARG A  1  388 ? 68.464  82.263  34.420  1.00 105.83 ? 388  ARG A CA    1 
ATOM   2981  C  C     . ARG A  1  388 ? 68.780  81.874  35.865  1.00 106.07 ? 388  ARG A C     1 
ATOM   2982  O  O     . ARG A  1  388 ? 67.881  81.619  36.666  1.00 106.24 ? 388  ARG A O     1 
ATOM   2983  C  CB    . ARG A  1  388 ? 69.623  83.094  33.859  1.00 107.27 ? 388  ARG A CB    1 
ATOM   2984  C  CG    . ARG A  1  388 ? 69.873  84.408  34.583  1.00 109.12 ? 388  ARG A CG    1 
ATOM   2985  C  CD    . ARG A  1  388 ? 68.984  85.527  34.041  1.00 111.37 ? 388  ARG A CD    1 
ATOM   2986  N  NE    . ARG A  1  388 ? 69.181  86.782  34.763  1.00 113.94 ? 388  ARG A NE    1 
ATOM   2987  C  CZ    . ARG A  1  388 ? 70.371  87.286  35.089  1.00 115.23 ? 388  ARG A CZ    1 
ATOM   2988  N  NH1   . ARG A  1  388 ? 70.443  88.438  35.747  1.00 116.31 ? 388  ARG A NH1   1 
ATOM   2989  N  NH2   . ARG A  1  388 ? 71.492  86.645  34.770  1.00 114.98 ? 388  ARG A NH2   1 
ATOM   2990  N  N     . ARG A  1  389 ? 70.065  81.822  36.194  1.00 106.66 ? 389  ARG A N     1 
ATOM   2991  C  CA    . ARG A  1  389 ? 70.492  81.498  37.551  1.00 107.22 ? 389  ARG A CA    1 
ATOM   2992  C  C     . ARG A  1  389 ? 71.247  82.686  38.122  1.00 107.47 ? 389  ARG A C     1 
ATOM   2993  O  O     . ARG A  1  389 ? 72.206  83.186  37.529  1.00 107.24 ? 389  ARG A O     1 
ATOM   2994  C  CB    . ARG A  1  389 ? 71.394  80.260  37.569  1.00 107.69 ? 389  ARG A CB    1 
ATOM   2995  C  CG    . ARG A  1  389 ? 72.068  79.946  38.926  1.00 107.27 ? 389  ARG A CG    1 
ATOM   2996  C  CD    . ARG A  1  389 ? 71.069  79.580  40.022  1.00 106.59 ? 389  ARG A CD    1 
ATOM   2997  N  NE    . ARG A  1  389 ? 71.675  78.830  41.128  1.00 105.94 ? 389  ARG A NE    1 
ATOM   2998  C  CZ    . ARG A  1  389 ? 72.561  79.318  41.995  1.00 106.16 ? 389  ARG A CZ    1 
ATOM   2999  N  NH1   . ARG A  1  389 ? 72.975  80.575  41.909  1.00 106.27 ? 389  ARG A NH1   1 
ATOM   3000  N  NH2   . ARG A  1  389 ? 73.033  78.544  42.963  1.00 106.35 ? 389  ARG A NH2   1 
ATOM   3001  N  N     . ILE A  1  390 ? 70.798  83.131  39.284  1.00 107.88 ? 390  ILE A N     1 
ATOM   3002  C  CA    . ILE A  1  390 ? 71.398  84.261  39.960  1.00 108.34 ? 390  ILE A CA    1 
ATOM   3003  C  C     . ILE A  1  390 ? 72.360  83.755  41.027  1.00 108.61 ? 390  ILE A C     1 
ATOM   3004  O  O     . ILE A  1  390 ? 71.948  83.220  42.058  1.00 108.77 ? 390  ILE A O     1 
ATOM   3005  C  CB    . ILE A  1  390 ? 70.300  85.128  40.582  1.00 108.44 ? 390  ILE A CB    1 
ATOM   3006  C  CG1   . ILE A  1  390 ? 69.288  85.500  39.495  1.00 109.05 ? 390  ILE A CG1   1 
ATOM   3007  C  CG2   . ILE A  1  390 ? 70.890  86.371  41.193  1.00 108.55 ? 390  ILE A CG2   1 
ATOM   3008  C  CD1   . ILE A  1  390 ? 68.100  86.290  39.990  1.00 109.72 ? 390  ILE A CD1   1 
ATOM   3009  N  N     . SER A  1  391 ? 73.651  83.922  40.760  1.00 109.07 ? 391  SER A N     1 
ATOM   3010  C  CA    . SER A  1  391 ? 74.707  83.478  41.667  1.00 109.02 ? 391  SER A CA    1 
ATOM   3011  C  C     . SER A  1  391 ? 74.784  84.300  42.932  1.00 107.81 ? 391  SER A C     1 
ATOM   3012  O  O     . SER A  1  391 ? 74.347  85.448  42.979  1.00 106.84 ? 391  SER A O     1 
ATOM   3013  C  CB    . SER A  1  391 ? 76.069  83.580  40.995  1.00 110.50 ? 391  SER A CB    1 
ATOM   3014  O  OG    . SER A  1  391 ? 76.575  84.900  41.149  1.00 111.73 ? 391  SER A OG    1 
ATOM   3015  N  N     . LEU A  1  392 ? 75.392  83.717  43.951  1.00 107.11 ? 392  LEU A N     1 
ATOM   3016  C  CA    . LEU A  1  392 ? 75.532  84.425  45.198  1.00 107.08 ? 392  LEU A CA    1 
ATOM   3017  C  C     . LEU A  1  392 ? 76.428  85.633  45.000  1.00 105.64 ? 392  LEU A C     1 
ATOM   3018  O  O     . LEU A  1  392 ? 76.192  86.690  45.581  1.00 105.47 ? 392  LEU A O     1 
ATOM   3019  C  CB    . LEU A  1  392 ? 76.095  83.495  46.271  1.00 109.15 ? 392  LEU A CB    1 
ATOM   3020  C  CG    . LEU A  1  392 ? 75.187  82.303  46.621  1.00 111.05 ? 392  LEU A CG    1 
ATOM   3021  C  CD1   . LEU A  1  392 ? 75.667  81.669  47.924  1.00 112.17 ? 392  LEU A CD1   1 
ATOM   3022  C  CD2   . LEU A  1  392 ? 73.732  82.762  46.783  1.00 112.51 ? 392  LEU A CD2   1 
ATOM   3023  N  N     . GLU A  1  393 ? 77.456  85.491  44.176  1.00 104.35 ? 393  GLU A N     1 
ATOM   3024  C  CA    . GLU A  1  393 ? 78.325  86.630  43.946  1.00 103.32 ? 393  GLU A CA    1 
ATOM   3025  C  C     . GLU A  1  393 ? 77.459  87.788  43.473  1.00 102.17 ? 393  GLU A C     1 
ATOM   3026  O  O     . GLU A  1  393 ? 77.628  88.924  43.923  1.00 101.94 ? 393  GLU A O     1 
ATOM   3027  C  CB    . GLU A  1  393 ? 79.402  86.325  42.892  1.00 104.04 ? 393  GLU A CB    1 
ATOM   3028  C  CG    . GLU A  1  393 ? 80.135  87.590  42.401  1.00 103.85 ? 393  GLU A CG    1 
ATOM   3029  C  CD    . GLU A  1  393 ? 81.401  87.315  41.601  1.00 102.92 ? 393  GLU A CD    1 
ATOM   3030  O  OE1   . GLU A  1  393 ? 81.357  86.485  40.664  1.00 102.13 ? 393  GLU A OE1   1 
ATOM   3031  O  OE2   . GLU A  1  393 ? 82.436  87.950  41.908  1.00 102.43 ? 393  GLU A OE2   1 
ATOM   3032  N  N     . GLU A  1  394 ? 76.524  87.493  42.573  1.00 100.72 ? 394  GLU A N     1 
ATOM   3033  C  CA    . GLU A  1  394 ? 75.637  88.524  42.045  1.00 99.63  ? 394  GLU A CA    1 
ATOM   3034  C  C     . GLU A  1  394 ? 74.743  89.063  43.157  1.00 99.30  ? 394  GLU A C     1 
ATOM   3035  O  O     . GLU A  1  394 ? 74.865  90.233  43.536  1.00 99.56  ? 394  GLU A O     1 
ATOM   3036  C  CB    . GLU A  1  394 ? 74.785  87.972  40.895  1.00 98.51  ? 394  GLU A CB    1 
ATOM   3037  C  CG    . GLU A  1  394 ? 73.763  88.964  40.343  1.00 96.46  ? 394  GLU A CG    1 
ATOM   3038  C  CD    . GLU A  1  394 ? 72.929  88.389  39.203  1.00 95.43  ? 394  GLU A CD    1 
ATOM   3039  O  OE1   . GLU A  1  394 ? 72.665  87.171  39.200  1.00 95.08  ? 394  GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A  1  394 ? 72.520  89.159  38.314  1.00 93.82  ? 394  GLU A OE2   1 
ATOM   3041  N  N     . TRP A  1  395 ? 73.852  88.215  43.676  1.00 98.03  ? 395  TRP A N     1 
ATOM   3042  C  CA    . TRP A  1  395 ? 72.955  88.621  44.757  1.00 96.47  ? 395  TRP A CA    1 
ATOM   3043  C  C     . TRP A  1  395 ? 73.713  89.599  45.651  1.00 96.54  ? 395  TRP A C     1 
ATOM   3044  O  O     . TRP A  1  395 ? 73.277  90.730  45.845  1.00 97.12  ? 395  TRP A O     1 
ATOM   3045  C  CB    . TRP A  1  395 ? 72.511  87.409  45.593  1.00 94.61  ? 395  TRP A CB    1 
ATOM   3046  C  CG    . TRP A  1  395 ? 71.213  86.737  45.171  1.00 92.84  ? 395  TRP A CG    1 
ATOM   3047  C  CD1   . TRP A  1  395 ? 70.867  85.414  45.363  1.00 92.70  ? 395  TRP A CD1   1 
ATOM   3048  C  CD2   . TRP A  1  395 ? 70.077  87.353  44.551  1.00 91.26  ? 395  TRP A CD2   1 
ATOM   3049  N  NE1   . TRP A  1  395 ? 69.592  85.178  44.901  1.00 91.17  ? 395  TRP A NE1   1 
ATOM   3050  C  CE2   . TRP A  1  395 ? 69.084  86.349  44.398  1.00 91.02  ? 395  TRP A CE2   1 
ATOM   3051  C  CE3   . TRP A  1  395 ? 69.797  88.653  44.113  1.00 89.21  ? 395  TRP A CE3   1 
ATOM   3052  C  CZ2   . TRP A  1  395 ? 67.839  86.610  43.827  1.00 89.72  ? 395  TRP A CZ2   1 
ATOM   3053  C  CZ3   . TRP A  1  395 ? 68.556  88.909  43.545  1.00 89.30  ? 395  TRP A CZ3   1 
ATOM   3054  C  CH2   . TRP A  1  395 ? 67.593  87.891  43.408  1.00 89.15  ? 395  TRP A CH2   1 
ATOM   3055  N  N     . ASP A  1  396 ? 74.873  89.174  46.153  1.00 96.08  ? 396  ASP A N     1 
ATOM   3056  C  CA    . ASP A  1  396 ? 75.673  90.016  47.039  1.00 95.62  ? 396  ASP A CA    1 
ATOM   3057  C  C     . ASP A  1  396 ? 75.932  91.440  46.561  1.00 95.89  ? 396  ASP A C     1 
ATOM   3058  O  O     . ASP A  1  396 ? 75.825  92.378  47.347  1.00 96.51  ? 396  ASP A O     1 
ATOM   3059  C  CB    . ASP A  1  396 ? 77.011  89.361  47.369  1.00 94.56  ? 396  ASP A CB    1 
ATOM   3060  C  CG    . ASP A  1  396 ? 77.868  90.238  48.263  1.00 93.53  ? 396  ASP A CG    1 
ATOM   3061  O  OD1   . ASP A  1  396 ? 78.362  91.281  47.778  1.00 94.13  ? 396  ASP A OD1   1 
ATOM   3062  O  OD2   . ASP A  1  396 ? 78.031  89.897  49.452  1.00 91.73  ? 396  ASP A OD2   1 
ATOM   3063  N  N     . SER A  1  397 ? 76.300  91.624  45.302  1.00 96.11  ? 397  SER A N     1 
ATOM   3064  C  CA    . SER A  1  397 ? 76.525  92.983  44.835  1.00 97.18  ? 397  SER A CA    1 
ATOM   3065  C  C     . SER A  1  397 ? 75.254  93.775  45.088  1.00 98.14  ? 397  SER A C     1 
ATOM   3066  O  O     . SER A  1  397 ? 75.266  94.779  45.802  1.00 98.44  ? 397  SER A O     1 
ATOM   3067  C  CB    . SER A  1  397 ? 76.820  93.016  43.341  1.00 97.72  ? 397  SER A CB    1 
ATOM   3068  O  OG    . SER A  1  397 ? 76.780  94.355  42.857  1.00 97.81  ? 397  SER A OG    1 
ATOM   3069  N  N     . ARG A  1  398 ? 74.161  93.303  44.491  1.00 98.70  ? 398  ARG A N     1 
ATOM   3070  C  CA    . ARG A  1  398 ? 72.845  93.929  44.608  1.00 98.61  ? 398  ARG A CA    1 
ATOM   3071  C  C     . ARG A  1  398 ? 72.492  94.334  46.034  1.00 97.62  ? 398  ARG A C     1 
ATOM   3072  O  O     . ARG A  1  398 ? 71.759  95.292  46.244  1.00 96.93  ? 398  ARG A O     1 
ATOM   3073  C  CB    . ARG A  1  398 ? 71.781  92.977  44.077  1.00 100.04 ? 398  ARG A CB    1 
ATOM   3074  C  CG    . ARG A  1  398 ? 71.901  92.668  42.604  1.00 102.66 ? 398  ARG A CG    1 
ATOM   3075  C  CD    . ARG A  1  398 ? 70.910  91.580  42.241  1.00 106.12 ? 398  ARG A CD    1 
ATOM   3076  N  NE    . ARG A  1  398 ? 70.567  91.556  40.820  1.00 109.51 ? 398  ARG A NE    1 
ATOM   3077  C  CZ    . ARG A  1  398 ? 70.074  92.596  40.150  1.00 111.39 ? 398  ARG A CZ    1 
ATOM   3078  N  NH1   . ARG A  1  398 ? 69.877  93.751  40.771  1.00 112.92 ? 398  ARG A NH1   1 
ATOM   3079  N  NH2   . ARG A  1  398 ? 69.746  92.477  38.867  1.00 112.77 ? 398  ARG A NH2   1 
ATOM   3080  N  N     . ILE A  1  399 ? 73.011  93.590  47.005  1.00 97.15  ? 399  ILE A N     1 
ATOM   3081  C  CA    . ILE A  1  399 ? 72.762  93.866  48.413  1.00 96.73  ? 399  ILE A CA    1 
ATOM   3082  C  C     . ILE A  1  399 ? 73.712  94.917  48.970  1.00 98.24  ? 399  ILE A C     1 
ATOM   3083  O  O     . ILE A  1  399 ? 73.280  95.830  49.663  1.00 98.49  ? 399  ILE A O     1 
ATOM   3084  C  CB    . ILE A  1  399 ? 72.881  92.590  49.254  1.00 94.75  ? 399  ILE A CB    1 
ATOM   3085  C  CG1   . ILE A  1  399 ? 71.665  91.708  49.004  1.00 93.04  ? 399  ILE A CG1   1 
ATOM   3086  C  CG2   . ILE A  1  399 ? 73.007  92.935  50.724  1.00 93.66  ? 399  ILE A CG2   1 
ATOM   3087  C  CD1   . ILE A  1  399 ? 71.680  90.443  49.797  1.00 93.19  ? 399  ILE A CD1   1 
ATOM   3088  N  N     . SER A  1  400 ? 75.005  94.792  48.690  1.00 100.18 ? 400  SER A N     1 
ATOM   3089  C  CA    . SER A  1  400 ? 75.956  95.790  49.180  1.00 102.44 ? 400  SER A CA    1 
ATOM   3090  C  C     . SER A  1  400 ? 75.569  97.152  48.590  1.00 103.32 ? 400  SER A C     1 
ATOM   3091  O  O     . SER A  1  400 ? 76.019  98.208  49.064  1.00 103.50 ? 400  SER A O     1 
ATOM   3092  C  CB    . SER A  1  400 ? 77.396  95.428  48.769  1.00 103.24 ? 400  SER A CB    1 
ATOM   3093  O  OG    . SER A  1  400 ? 77.944  94.419  49.603  1.00 103.08 ? 400  SER A OG    1 
ATOM   3094  N  N     . ALA A  1  401 ? 74.726  97.112  47.557  1.00 103.46 ? 401  ALA A N     1 
ATOM   3095  C  CA    . ALA A  1  401 ? 74.258  98.315  46.885  1.00 104.15 ? 401  ALA A CA    1 
ATOM   3096  C  C     . ALA A  1  401 ? 73.332  99.083  47.802  1.00 105.42 ? 401  ALA A C     1 
ATOM   3097  O  O     . ALA A  1  401 ? 73.619  100.219 48.169  1.00 105.98 ? 401  ALA A O     1 
ATOM   3098  C  CB    . ALA A  1  401 ? 73.527  97.952  45.605  1.00 102.81 ? 401  ALA A CB    1 
ATOM   3099  N  N     . VAL A  1  402 ? 72.227  98.439  48.174  1.00 107.25 ? 402  VAL A N     1 
ATOM   3100  C  CA    . VAL A  1  402 ? 71.201  99.015  49.046  1.00 108.60 ? 402  VAL A CA    1 
ATOM   3101  C  C     . VAL A  1  402 ? 71.714  99.760  50.270  1.00 109.86 ? 402  VAL A C     1 
ATOM   3102  O  O     . VAL A  1  402 ? 72.590  99.284  50.999  1.00 109.96 ? 402  VAL A O     1 
ATOM   3103  C  CB    . VAL A  1  402 ? 70.226  97.936  49.556  1.00 108.49 ? 402  VAL A CB    1 
ATOM   3104  C  CG1   . VAL A  1  402 ? 69.119  98.580  50.362  1.00 108.30 ? 402  VAL A CG1   1 
ATOM   3105  C  CG2   . VAL A  1  402 ? 69.649  97.163  48.391  1.00 109.23 ? 402  VAL A CG2   1 
ATOM   3106  N  N     . ASP A  1  403 ? 71.139  100.937 50.486  1.00 111.21 ? 403  ASP A N     1 
ATOM   3107  C  CA    . ASP A  1  403 ? 71.490  101.775 51.619  1.00 113.02 ? 403  ASP A CA    1 
ATOM   3108  C  C     . ASP A  1  403 ? 70.197  102.395 52.140  1.00 113.97 ? 403  ASP A C     1 
ATOM   3109  O  O     . ASP A  1  403 ? 69.116  102.112 51.624  1.00 113.74 ? 403  ASP A O     1 
ATOM   3110  C  CB    . ASP A  1  403 ? 72.475  102.875 51.198  1.00 113.50 ? 403  ASP A CB    1 
ATOM   3111  C  CG    . ASP A  1  403 ? 71.815  103.974 50.378  1.00 114.24 ? 403  ASP A CG    1 
ATOM   3112  O  OD1   . ASP A  1  403 ? 71.219  103.664 49.323  1.00 114.50 ? 403  ASP A OD1   1 
ATOM   3113  O  OD2   . ASP A  1  403 ? 71.892  105.154 50.788  1.00 114.69 ? 403  ASP A OD2   1 
ATOM   3114  N  N     . ALA A  1  404 ? 70.313  103.240 53.159  1.00 115.30 ? 404  ALA A N     1 
ATOM   3115  C  CA    . ALA A  1  404 ? 69.154  103.896 53.751  1.00 116.07 ? 404  ALA A CA    1 
ATOM   3116  C  C     . ALA A  1  404 ? 68.231  104.468 52.686  1.00 116.70 ? 404  ALA A C     1 
ATOM   3117  O  O     . ALA A  1  404 ? 67.236  103.845 52.314  1.00 116.07 ? 404  ALA A O     1 
ATOM   3118  C  CB    . ALA A  1  404 ? 69.608  105.005 54.682  1.00 116.46 ? 404  ALA A CB    1 
ATOM   3119  N  N     . ARG A  1  405 ? 68.572  105.662 52.209  1.00 118.05 ? 405  ARG A N     1 
ATOM   3120  C  CA    . ARG A  1  405 ? 67.793  106.358 51.181  1.00 119.63 ? 405  ARG A CA    1 
ATOM   3121  C  C     . ARG A  1  405 ? 66.942  105.361 50.374  1.00 118.82 ? 405  ARG A C     1 
ATOM   3122  O  O     . ARG A  1  405 ? 65.714  105.482 50.295  1.00 118.71 ? 405  ARG A O     1 
ATOM   3123  C  CB    . ARG A  1  405 ? 68.750  107.156 50.260  1.00 122.03 ? 405  ARG A CB    1 
ATOM   3124  C  CG    . ARG A  1  405 ? 68.107  108.008 49.132  1.00 125.53 ? 405  ARG A CG    1 
ATOM   3125  C  CD    . ARG A  1  405 ? 67.397  109.287 49.620  1.00 128.81 ? 405  ARG A CD    1 
ATOM   3126  N  NE    . ARG A  1  405 ? 66.012  109.039 50.040  1.00 132.99 ? 405  ARG A NE    1 
ATOM   3127  C  CZ    . ARG A  1  405 ? 65.152  109.977 50.446  1.00 134.67 ? 405  ARG A CZ    1 
ATOM   3128  N  NH1   . ARG A  1  405 ? 65.526  111.252 50.492  1.00 136.12 ? 405  ARG A NH1   1 
ATOM   3129  N  NH2   . ARG A  1  405 ? 63.913  109.643 50.814  1.00 134.86 ? 405  ARG A NH2   1 
ATOM   3130  N  N     . MET A  1  406 ? 67.593  104.353 49.810  1.00 118.11 ? 406  MET A N     1 
ATOM   3131  C  CA    . MET A  1  406 ? 66.898  103.354 49.014  1.00 117.37 ? 406  MET A CA    1 
ATOM   3132  C  C     . MET A  1  406 ? 65.743  102.716 49.778  1.00 116.08 ? 406  MET A C     1 
ATOM   3133  O  O     . MET A  1  406 ? 64.587  102.831 49.371  1.00 116.55 ? 406  MET A O     1 
ATOM   3134  C  CB    . MET A  1  406 ? 67.882  102.279 48.563  1.00 118.56 ? 406  MET A CB    1 
ATOM   3135  C  CG    . MET A  1  406 ? 67.385  101.430 47.416  1.00 119.62 ? 406  MET A CG    1 
ATOM   3136  S  SD    . MET A  1  406 ? 68.731  100.449 46.753  1.00 121.26 ? 406  MET A SD    1 
ATOM   3137  C  CE    . MET A  1  406 ? 69.863  101.746 46.263  1.00 120.78 ? 406  MET A CE    1 
ATOM   3138  N  N     . VAL A  1  407 ? 66.052  102.047 50.884  1.00 114.08 ? 407  VAL A N     1 
ATOM   3139  C  CA    . VAL A  1  407 ? 65.018  101.399 51.684  1.00 111.86 ? 407  VAL A CA    1 
ATOM   3140  C  C     . VAL A  1  407 ? 63.837  102.344 51.861  1.00 110.16 ? 407  VAL A C     1 
ATOM   3141  O  O     . VAL A  1  407 ? 62.702  101.990 51.544  1.00 110.10 ? 407  VAL A O     1 
ATOM   3142  C  CB    . VAL A  1  407 ? 65.552  100.985 53.073  1.00 111.79 ? 407  VAL A CB    1 
ATOM   3143  C  CG1   . VAL A  1  407 ? 64.480  100.249 53.846  1.00 111.18 ? 407  VAL A CG1   1 
ATOM   3144  C  CG2   . VAL A  1  407 ? 66.777  100.100 52.911  1.00 112.52 ? 407  VAL A CG2   1 
ATOM   3145  N  N     . ARG A  1  408 ? 64.105  103.551 52.350  1.00 108.13 ? 408  ARG A N     1 
ATOM   3146  C  CA    . ARG A  1  408 ? 63.037  104.520 52.542  1.00 106.22 ? 408  ARG A CA    1 
ATOM   3147  C  C     . ARG A  1  408 ? 62.217  104.625 51.269  1.00 104.39 ? 408  ARG A C     1 
ATOM   3148  O  O     . ARG A  1  408 ? 61.064  104.202 51.233  1.00 104.59 ? 408  ARG A O     1 
ATOM   3149  C  CB    . ARG A  1  408 ? 63.598  105.898 52.911  1.00 107.08 ? 408  ARG A CB    1 
ATOM   3150  C  CG    . ARG A  1  408 ? 64.147  105.999 54.337  1.00 108.48 ? 408  ARG A CG    1 
ATOM   3151  C  CD    . ARG A  1  408 ? 64.365  107.460 54.763  1.00 109.95 ? 408  ARG A CD    1 
ATOM   3152  N  NE    . ARG A  1  408 ? 65.593  108.066 54.233  1.00 110.82 ? 408  ARG A NE    1 
ATOM   3153  C  CZ    . ARG A  1  408 ? 66.748  108.144 54.898  1.00 111.22 ? 408  ARG A CZ    1 
ATOM   3154  N  NH1   . ARG A  1  408 ? 66.843  107.657 56.127  1.00 111.24 ? 408  ARG A NH1   1 
ATOM   3155  N  NH2   . ARG A  1  408 ? 67.812  108.715 54.339  1.00 111.00 ? 408  ARG A NH2   1 
ATOM   3156  N  N     . ASP A  1  409 ? 62.817  105.172 50.220  1.00 102.14 ? 409  ASP A N     1 
ATOM   3157  C  CA    . ASP A  1  409 ? 62.121  105.326 48.946  1.00 100.65 ? 409  ASP A CA    1 
ATOM   3158  C  C     . ASP A  1  409 ? 61.323  104.087 48.528  1.00 99.00  ? 409  ASP A C     1 
ATOM   3159  O  O     . ASP A  1  409 ? 60.139  104.186 48.189  1.00 99.53  ? 409  ASP A O     1 
ATOM   3160  C  CB    . ASP A  1  409 ? 63.109  105.663 47.822  1.00 101.23 ? 409  ASP A CB    1 
ATOM   3161  C  CG    . ASP A  1  409 ? 63.699  107.057 47.945  1.00 101.58 ? 409  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A  1  409 ? 62.929  108.038 48.045  1.00 100.97 ? 409  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A  1  409 ? 64.942  107.171 47.922  1.00 102.63 ? 409  ASP A OD2   1 
ATOM   3164  N  N     . VAL A  1  410 ? 61.975  102.928 48.548  1.00 96.29  ? 410  VAL A N     1 
ATOM   3165  C  CA    . VAL A  1  410 ? 61.347  101.671 48.145  1.00 93.63  ? 410  VAL A CA    1 
ATOM   3166  C  C     . VAL A  1  410 ? 60.141  101.256 48.978  1.00 91.76  ? 410  VAL A C     1 
ATOM   3167  O  O     . VAL A  1  410 ? 59.096  100.898 48.428  1.00 91.63  ? 410  VAL A O     1 
ATOM   3168  C  CB    . VAL A  1  410 ? 62.351  100.522 48.182  1.00 93.82  ? 410  VAL A CB    1 
ATOM   3169  C  CG1   . VAL A  1  410 ? 61.724  99.274  47.582  1.00 94.76  ? 410  VAL A CG1   1 
ATOM   3170  C  CG2   . VAL A  1  410 ? 63.603  100.912 47.437  1.00 94.04  ? 410  VAL A CG2   1 
ATOM   3171  N  N     . CYS A  1  411 ? 60.294  101.273 50.300  1.00 89.15  ? 411  CYS A N     1 
ATOM   3172  C  CA    . CYS A  1  411 ? 59.200  100.912 51.202  1.00 86.09  ? 411  CYS A CA    1 
ATOM   3173  C  C     . CYS A  1  411 ? 58.086  101.931 51.039  1.00 83.96  ? 411  CYS A C     1 
ATOM   3174  O  O     . CYS A  1  411 ? 56.909  101.582 50.980  1.00 82.96  ? 411  CYS A O     1 
ATOM   3175  C  CB    . CYS A  1  411 ? 59.674  100.915 52.651  1.00 86.29  ? 411  CYS A CB    1 
ATOM   3176  S  SG    . CYS A  1  411 ? 60.932  99.703  53.005  1.00 85.68  ? 411  CYS A SG    1 
ATOM   3177  N  N     . SER A  1  412 ? 58.473  103.201 50.985  1.00 81.29  ? 412  SER A N     1 
ATOM   3178  C  CA    . SER A  1  412 ? 57.513  104.268 50.789  1.00 78.72  ? 412  SER A CA    1 
ATOM   3179  C  C     . SER A  1  412 ? 56.801  103.890 49.492  1.00 77.28  ? 412  SER A C     1 
ATOM   3180  O  O     . SER A  1  412 ? 55.578  103.771 49.433  1.00 76.78  ? 412  SER A O     1 
ATOM   3181  C  CB    . SER A  1  412 ? 58.235  105.610 50.612  1.00 78.40  ? 412  SER A CB    1 
ATOM   3182  O  OG    . SER A  1  412 ? 59.092  105.890 51.705  1.00 77.45  ? 412  SER A OG    1 
ATOM   3183  N  N     . LYS A  1  413 ? 57.603  103.682 48.457  1.00 75.42  ? 413  LYS A N     1 
ATOM   3184  C  CA    . LYS A  1  413 ? 57.102  103.318 47.154  1.00 74.17  ? 413  LYS A CA    1 
ATOM   3185  C  C     . LYS A  1  413 ? 55.952  102.317 47.271  1.00 73.39  ? 413  LYS A C     1 
ATOM   3186  O  O     . LYS A  1  413 ? 54.897  102.548 46.693  1.00 73.51  ? 413  LYS A O     1 
ATOM   3187  C  CB    . LYS A  1  413 ? 58.250  102.738 46.312  1.00 75.68  ? 413  LYS A CB    1 
ATOM   3188  C  CG    . LYS A  1  413 ? 57.949  102.517 44.817  1.00 77.64  ? 413  LYS A CG    1 
ATOM   3189  C  CD    . LYS A  1  413 ? 59.174  101.936 44.041  1.00 78.31  ? 413  LYS A CD    1 
ATOM   3190  C  CE    . LYS A  1  413 ? 58.900  101.768 42.524  1.00 77.86  ? 413  LYS A CE    1 
ATOM   3191  N  NZ    . LYS A  1  413 ? 60.086  101.340 41.707  1.00 75.75  ? 413  LYS A NZ    1 
ATOM   3192  N  N     . TYR A  1  414 ? 56.133  101.241 48.046  1.00 72.35  ? 414  TYR A N     1 
ATOM   3193  C  CA    . TYR A  1  414 ? 55.107  100.188 48.168  1.00 71.19  ? 414  TYR A CA    1 
ATOM   3194  C  C     . TYR A  1  414 ? 54.230  100.120 49.411  1.00 70.41  ? 414  TYR A C     1 
ATOM   3195  O  O     . TYR A  1  414 ? 53.219  99.417  49.393  1.00 70.59  ? 414  TYR A O     1 
ATOM   3196  C  CB    . TYR A  1  414 ? 55.734  98.796  48.022  1.00 72.01  ? 414  TYR A CB    1 
ATOM   3197  C  CG    . TYR A  1  414 ? 56.473  98.534  46.736  1.00 72.85  ? 414  TYR A CG    1 
ATOM   3198  C  CD1   . TYR A  1  414 ? 57.779  98.990  46.553  1.00 72.81  ? 414  TYR A CD1   1 
ATOM   3199  C  CD2   . TYR A  1  414 ? 55.843  97.883  45.678  1.00 73.91  ? 414  TYR A CD2   1 
ATOM   3200  C  CE1   . TYR A  1  414 ? 58.437  98.818  45.343  1.00 74.71  ? 414  TYR A CE1   1 
ATOM   3201  C  CE2   . TYR A  1  414 ? 56.488  97.704  44.458  1.00 75.60  ? 414  TYR A CE2   1 
ATOM   3202  C  CZ    . TYR A  1  414 ? 57.785  98.180  44.293  1.00 76.02  ? 414  TYR A CZ    1 
ATOM   3203  O  OH    . TYR A  1  414 ? 58.404  98.064  43.065  1.00 76.97  ? 414  TYR A OH    1 
ATOM   3204  N  N     . ILE A  1  415 ? 54.603  100.814 50.484  1.00 69.51  ? 415  ILE A N     1 
ATOM   3205  C  CA    . ILE A  1  415 ? 53.829  100.761 51.737  1.00 67.99  ? 415  ILE A CA    1 
ATOM   3206  C  C     . ILE A  1  415 ? 53.042  102.015 52.130  1.00 64.91  ? 415  ILE A C     1 
ATOM   3207  O  O     . ILE A  1  415 ? 51.951  101.923 52.674  1.00 63.45  ? 415  ILE A O     1 
ATOM   3208  C  CB    . ILE A  1  415 ? 54.748  100.436 52.936  1.00 70.04  ? 415  ILE A CB    1 
ATOM   3209  C  CG1   . ILE A  1  415 ? 55.790  99.397  52.523  1.00 71.88  ? 415  ILE A CG1   1 
ATOM   3210  C  CG2   . ILE A  1  415 ? 53.918  99.906  54.107  1.00 70.25  ? 415  ILE A CG2   1 
ATOM   3211  C  CD1   . ILE A  1  415 ? 56.783  99.060  53.614  1.00 73.72  ? 415  ILE A CD1   1 
ATOM   3212  N  N     . TYR A  1  416 ? 53.603  103.183 51.855  1.00 62.31  ? 416  TYR A N     1 
ATOM   3213  C  CA    . TYR A  1  416 ? 52.966  104.428 52.231  1.00 59.55  ? 416  TYR A CA    1 
ATOM   3214  C  C     . TYR A  1  416 ? 51.638  104.737 51.604  1.00 56.67  ? 416  TYR A C     1 
ATOM   3215  O  O     . TYR A  1  416 ? 51.508  104.800 50.391  1.00 56.57  ? 416  TYR A O     1 
ATOM   3216  C  CB    . TYR A  1  416 ? 53.879  105.610 51.954  1.00 62.16  ? 416  TYR A CB    1 
ATOM   3217  C  CG    . TYR A  1  416 ? 53.600  106.774 52.871  1.00 65.90  ? 416  TYR A CG    1 
ATOM   3218  C  CD1   . TYR A  1  416 ? 54.306  106.933 54.068  1.00 68.27  ? 416  TYR A CD1   1 
ATOM   3219  C  CD2   . TYR A  1  416 ? 52.600  107.689 52.580  1.00 67.40  ? 416  TYR A CD2   1 
ATOM   3220  C  CE1   . TYR A  1  416 ? 54.025  107.973 54.954  1.00 69.42  ? 416  TYR A CE1   1 
ATOM   3221  C  CE2   . TYR A  1  416 ? 52.308  108.738 53.462  1.00 70.06  ? 416  TYR A CE2   1 
ATOM   3222  C  CZ    . TYR A  1  416 ? 53.026  108.870 54.647  1.00 70.63  ? 416  TYR A CZ    1 
ATOM   3223  O  OH    . TYR A  1  416 ? 52.735  109.892 55.526  1.00 72.90  ? 416  TYR A OH    1 
ATOM   3224  N  N     . ASP A  1  417 ? 50.664  104.966 52.470  1.00 53.45  ? 417  ASP A N     1 
ATOM   3225  C  CA    . ASP A  1  417 ? 49.314  105.327 52.088  1.00 49.74  ? 417  ASP A CA    1 
ATOM   3226  C  C     . ASP A  1  417 ? 48.689  104.403 51.082  1.00 48.35  ? 417  ASP A C     1 
ATOM   3227  O  O     . ASP A  1  417 ? 47.927  104.831 50.230  1.00 47.55  ? 417  ASP A O     1 
ATOM   3228  C  CB    . ASP A  1  417 ? 49.295  106.747 51.543  1.00 47.83  ? 417  ASP A CB    1 
ATOM   3229  C  CG    . ASP A  1  417 ? 47.927  107.360 51.601  1.00 46.42  ? 417  ASP A CG    1 
ATOM   3230  O  OD1   . ASP A  1  417 ? 47.769  108.504 51.146  1.00 46.53  ? 417  ASP A OD1   1 
ATOM   3231  O  OD2   . ASP A  1  417 ? 47.006  106.698 52.113  1.00 46.11  ? 417  ASP A OD2   1 
ATOM   3232  N  N     . LYS A  1  418 ? 49.014  103.130 51.163  1.00 48.26  ? 418  LYS A N     1 
ATOM   3233  C  CA    . LYS A  1  418 ? 48.422  102.187 50.237  1.00 50.27  ? 418  LYS A CA    1 
ATOM   3234  C  C     . LYS A  1  418 ? 47.317  101.490 50.994  1.00 49.40  ? 418  LYS A C     1 
ATOM   3235  O  O     . LYS A  1  418 ? 47.411  101.319 52.202  1.00 48.48  ? 418  LYS A O     1 
ATOM   3236  C  CB    . LYS A  1  418 ? 49.452  101.145 49.784  1.00 53.25  ? 418  LYS A CB    1 
ATOM   3237  C  CG    . LYS A  1  418 ? 50.559  101.669 48.883  1.00 56.20  ? 418  LYS A CG    1 
ATOM   3238  C  CD    . LYS A  1  418 ? 50.024  102.029 47.505  1.00 59.01  ? 418  LYS A CD    1 
ATOM   3239  C  CE    . LYS A  1  418 ? 51.123  102.600 46.615  1.00 60.80  ? 418  LYS A CE    1 
ATOM   3240  N  NZ    . LYS A  1  418 ? 50.615  102.932 45.255  1.00 61.64  ? 418  LYS A NZ    1 
ATOM   3241  N  N     . CYS A  1  419 ? 46.264  101.095 50.297  1.00 48.93  ? 419  CYS A N     1 
ATOM   3242  C  CA    . CYS A  1  419 ? 45.192  100.376 50.962  1.00 48.62  ? 419  CYS A CA    1 
ATOM   3243  C  C     . CYS A  1  419 ? 45.718  98.949  51.080  1.00 48.09  ? 419  CYS A C     1 
ATOM   3244  O  O     . CYS A  1  419 ? 46.064  98.339  50.078  1.00 48.81  ? 419  CYS A O     1 
ATOM   3245  C  CB    . CYS A  1  419 ? 43.939  100.425 50.104  1.00 49.29  ? 419  CYS A CB    1 
ATOM   3246  S  SG    . CYS A  1  419 ? 43.464  102.102 49.707  1.00 49.44  ? 419  CYS A SG    1 
ATOM   3247  N  N     . PRO A  1  420 ? 45.799  98.401  52.301  1.00 47.40  ? 420  PRO A N     1 
ATOM   3248  C  CA    . PRO A  1  420 ? 46.313  97.042  52.425  1.00 47.40  ? 420  PRO A CA    1 
ATOM   3249  C  C     . PRO A  1  420 ? 45.268  95.947  52.529  1.00 47.43  ? 420  PRO A C     1 
ATOM   3250  O  O     . PRO A  1  420 ? 44.060  96.207  52.563  1.00 45.65  ? 420  PRO A O     1 
ATOM   3251  C  CB    . PRO A  1  420 ? 47.154  97.129  53.683  1.00 47.02  ? 420  PRO A CB    1 
ATOM   3252  C  CG    . PRO A  1  420 ? 46.271  97.923  54.547  1.00 46.23  ? 420  PRO A CG    1 
ATOM   3253  C  CD    . PRO A  1  420 ? 45.772  99.043  53.622  1.00 46.86  ? 420  PRO A CD    1 
ATOM   3254  N  N     . ALA A  1  421 ? 45.767  94.713  52.573  1.00 48.19  ? 421  ALA A N     1 
ATOM   3255  C  CA    . ALA A  1  421 ? 44.926  93.533  52.691  1.00 48.42  ? 421  ALA A CA    1 
ATOM   3256  C  C     . ALA A  1  421 ? 45.088  93.033  54.111  1.00 48.01  ? 421  ALA A C     1 
ATOM   3257  O  O     . ALA A  1  421 ? 46.205  92.932  54.628  1.00 47.70  ? 421  ALA A O     1 
ATOM   3258  C  CB    . ALA A  1  421 ? 45.354  92.456  51.703  1.00 48.55  ? 421  ALA A CB    1 
ATOM   3259  N  N     . LEU A  1  422 ? 43.957  92.729  54.734  1.00 47.55  ? 422  LEU A N     1 
ATOM   3260  C  CA    . LEU A  1  422 ? 43.937  92.253  56.100  1.00 45.27  ? 422  LEU A CA    1 
ATOM   3261  C  C     . LEU A  1  422 ? 43.259  90.906  56.230  1.00 44.09  ? 422  LEU A C     1 
ATOM   3262  O  O     . LEU A  1  422 ? 42.205  90.635  55.635  1.00 41.41  ? 422  LEU A O     1 
ATOM   3263  C  CB    . LEU A  1  422 ? 43.221  93.250  56.988  1.00 46.26  ? 422  LEU A CB    1 
ATOM   3264  C  CG    . LEU A  1  422 ? 43.305  92.800  58.433  1.00 47.51  ? 422  LEU A CG    1 
ATOM   3265  C  CD1   . LEU A  1  422 ? 44.749  92.926  58.874  1.00 48.47  ? 422  LEU A CD1   1 
ATOM   3266  C  CD2   . LEU A  1  422 ? 42.376  93.635  59.303  1.00 48.60  ? 422  LEU A CD2   1 
ATOM   3267  N  N     . ALA A  1  423 ? 43.881  90.065  57.035  1.00 44.25  ? 423  ALA A N     1 
ATOM   3268  C  CA    . ALA A  1  423 ? 43.376  88.731  57.275  1.00 45.37  ? 423  ALA A CA    1 
ATOM   3269  C  C     . ALA A  1  423 ? 43.336  88.482  58.785  1.00 45.44  ? 423  ALA A C     1 
ATOM   3270  O  O     . ALA A  1  423 ? 44.366  88.492  59.469  1.00 45.66  ? 423  ALA A O     1 
ATOM   3271  C  CB    . ALA A  1  423 ? 44.271  87.702  56.573  1.00 45.14  ? 423  ALA A CB    1 
ATOM   3272  N  N     . ALA A  1  424 ? 42.136  88.284  59.308  1.00 44.90  ? 424  ALA A N     1 
ATOM   3273  C  CA    . ALA A  1  424 ? 41.999  88.040  60.723  1.00 44.87  ? 424  ALA A CA    1 
ATOM   3274  C  C     . ALA A  1  424 ? 41.255  86.742  60.953  1.00 45.33  ? 424  ALA A C     1 
ATOM   3275  O  O     . ALA A  1  424 ? 40.259  86.453  60.286  1.00 44.48  ? 424  ALA A O     1 
ATOM   3276  C  CB    . ALA A  1  424 ? 41.286  89.188  61.380  1.00 44.47  ? 424  ALA A CB    1 
ATOM   3277  N  N     . VAL A  1  425 ? 41.773  85.961  61.899  1.00 46.11  ? 425  VAL A N     1 
ATOM   3278  C  CA    . VAL A  1  425 ? 41.221  84.668  62.269  1.00 46.04  ? 425  VAL A CA    1 
ATOM   3279  C  C     . VAL A  1  425 ? 41.395  84.417  63.761  1.00 47.71  ? 425  VAL A C     1 
ATOM   3280  O  O     . VAL A  1  425 ? 42.469  84.638  64.316  1.00 47.45  ? 425  VAL A O     1 
ATOM   3281  C  CB    . VAL A  1  425 ? 41.935  83.544  61.548  1.00 44.55  ? 425  VAL A CB    1 
ATOM   3282  C  CG1   . VAL A  1  425 ? 41.164  82.266  61.707  1.00 43.54  ? 425  VAL A CG1   1 
ATOM   3283  C  CG2   . VAL A  1  425 ? 42.105  83.898  60.097  1.00 45.43  ? 425  VAL A CG2   1 
ATOM   3284  N  N     . GLY A  1  426 ? 40.333  83.935  64.394  1.00 49.96  ? 426  GLY A N     1 
ATOM   3285  C  CA    . GLY A  1  426 ? 40.364  83.645  65.812  1.00 51.61  ? 426  GLY A CA    1 
ATOM   3286  C  C     . GLY A  1  426 ? 39.495  84.624  66.569  1.00 53.89  ? 426  GLY A C     1 
ATOM   3287  O  O     . GLY A  1  426 ? 38.514  85.132  66.007  1.00 54.71  ? 426  GLY A O     1 
ATOM   3288  N  N     . PRO A  1  427 ? 39.827  84.904  67.850  1.00 54.94  ? 427  PRO A N     1 
ATOM   3289  C  CA    . PRO A  1  427 ? 39.142  85.817  68.783  1.00 54.89  ? 427  PRO A CA    1 
ATOM   3290  C  C     . PRO A  1  427 ? 39.652  87.246  68.619  1.00 54.64  ? 427  PRO A C     1 
ATOM   3291  O  O     . PRO A  1  427 ? 40.196  87.850  69.531  1.00 54.99  ? 427  PRO A O     1 
ATOM   3292  C  CB    . PRO A  1  427 ? 39.491  85.223  70.135  1.00 55.13  ? 427  PRO A CB    1 
ATOM   3293  C  CG    . PRO A  1  427 ? 40.903  84.766  69.913  1.00 54.48  ? 427  PRO A CG    1 
ATOM   3294  C  CD    . PRO A  1  427 ? 40.859  84.119  68.556  1.00 54.61  ? 427  PRO A CD    1 
ATOM   3295  N  N     . ILE A  1  428 ? 39.423  87.779  67.437  1.00 55.04  ? 428  ILE A N     1 
ATOM   3296  C  CA    . ILE A  1  428 ? 39.884  89.094  67.043  1.00 55.96  ? 428  ILE A CA    1 
ATOM   3297  C  C     . ILE A  1  428 ? 39.115  90.350  67.482  1.00 56.51  ? 428  ILE A C     1 
ATOM   3298  O  O     . ILE A  1  428 ? 39.400  91.452  66.989  1.00 56.94  ? 428  ILE A O     1 
ATOM   3299  C  CB    . ILE A  1  428 ? 39.989  89.087  65.526  1.00 55.59  ? 428  ILE A CB    1 
ATOM   3300  C  CG1   . ILE A  1  428 ? 38.634  88.718  64.928  1.00 54.33  ? 428  ILE A CG1   1 
ATOM   3301  C  CG2   . ILE A  1  428 ? 40.964  88.016  65.088  1.00 56.05  ? 428  ILE A CG2   1 
ATOM   3302  C  CD1   . ILE A  1  428 ? 38.705  88.340  63.482  1.00 54.83  ? 428  ILE A CD1   1 
ATOM   3303  N  N     . GLU A  1  429 ? 38.176  90.221  68.414  1.00 55.78  ? 429  GLU A N     1 
ATOM   3304  C  CA    . GLU A  1  429 ? 37.401  91.394  68.798  1.00 54.53  ? 429  GLU A CA    1 
ATOM   3305  C  C     . GLU A  1  429 ? 38.230  92.647  68.985  1.00 53.01  ? 429  GLU A C     1 
ATOM   3306  O  O     . GLU A  1  429 ? 37.918  93.672  68.406  1.00 52.34  ? 429  GLU A O     1 
ATOM   3307  C  CB    . GLU A  1  429 ? 36.566  91.135  70.060  1.00 55.15  ? 429  GLU A CB    1 
ATOM   3308  C  CG    . GLU A  1  429 ? 35.486  92.203  70.298  1.00 56.69  ? 429  GLU A CG    1 
ATOM   3309  C  CD    . GLU A  1  429 ? 34.209  91.661  70.973  1.00 58.97  ? 429  GLU A CD    1 
ATOM   3310  O  OE1   . GLU A  1  429 ? 34.212  91.460  72.212  1.00 59.67  ? 429  GLU A OE1   1 
ATOM   3311  O  OE2   . GLU A  1  429 ? 33.197  91.436  70.258  1.00 59.23  ? 429  GLU A OE2   1 
ATOM   3312  N  N     . GLN A  1  430 ? 39.313  92.560  69.741  1.00 52.09  ? 430  GLN A N     1 
ATOM   3313  C  CA    . GLN A  1  430 ? 40.115  93.746  70.008  1.00 52.70  ? 430  GLN A CA    1 
ATOM   3314  C  C     . GLN A  1  430 ? 40.608  94.598  68.836  1.00 52.15  ? 430  GLN A C     1 
ATOM   3315  O  O     . GLN A  1  430 ? 40.586  95.824  68.933  1.00 51.67  ? 430  GLN A O     1 
ATOM   3316  C  CB    . GLN A  1  430 ? 41.308  93.395  70.902  1.00 54.69  ? 430  GLN A CB    1 
ATOM   3317  C  CG    . GLN A  1  430 ? 41.931  94.617  71.616  1.00 56.41  ? 430  GLN A CG    1 
ATOM   3318  C  CD    . GLN A  1  430 ? 43.211  94.296  72.416  1.00 57.54  ? 430  GLN A CD    1 
ATOM   3319  O  OE1   . GLN A  1  430 ? 44.318  94.199  71.863  1.00 57.11  ? 430  GLN A OE1   1 
ATOM   3320  N  NE2   . GLN A  1  430 ? 43.054  94.134  73.726  1.00 57.88  ? 430  GLN A NE2   1 
ATOM   3321  N  N     . LEU A  1  431 ? 41.076  93.985  67.751  1.00 52.13  ? 431  LEU A N     1 
ATOM   3322  C  CA    . LEU A  1  431 ? 41.570  94.764  66.596  1.00 52.42  ? 431  LEU A CA    1 
ATOM   3323  C  C     . LEU A  1  431 ? 40.393  95.130  65.741  1.00 52.78  ? 431  LEU A C     1 
ATOM   3324  O  O     . LEU A  1  431 ? 39.652  94.225  65.335  1.00 54.17  ? 431  LEU A O     1 
ATOM   3325  C  CB    . LEU A  1  431 ? 42.522  93.943  65.718  1.00 52.19  ? 431  LEU A CB    1 
ATOM   3326  C  CG    . LEU A  1  431 ? 42.436  94.202  64.203  1.00 50.99  ? 431  LEU A CG    1 
ATOM   3327  C  CD1   . LEU A  1  431 ? 43.763  94.679  63.685  1.00 50.25  ? 431  LEU A CD1   1 
ATOM   3328  C  CD2   . LEU A  1  431 ? 42.014  92.932  63.480  1.00 49.32  ? 431  LEU A CD2   1 
ATOM   3329  N  N     . LEU A  1  432 ? 40.194  96.414  65.438  1.00 51.14  ? 432  LEU A N     1 
ATOM   3330  C  CA    . LEU A  1  432 ? 39.038  96.717  64.601  1.00 49.53  ? 432  LEU A CA    1 
ATOM   3331  C  C     . LEU A  1  432 ? 39.118  97.884  63.642  1.00 48.64  ? 432  LEU A C     1 
ATOM   3332  O  O     . LEU A  1  432 ? 40.029  98.706  63.692  1.00 48.98  ? 432  LEU A O     1 
ATOM   3333  C  CB    . LEU A  1  432 ? 37.742  96.812  65.453  1.00 48.67  ? 432  LEU A CB    1 
ATOM   3334  C  CG    . LEU A  1  432 ? 36.549  95.903  65.036  1.00 46.88  ? 432  LEU A CG    1 
ATOM   3335  C  CD1   . LEU A  1  432 ? 35.887  95.226  66.228  1.00 44.42  ? 432  LEU A CD1   1 
ATOM   3336  C  CD2   . LEU A  1  432 ? 35.537  96.721  64.282  1.00 45.97  ? 432  LEU A CD2   1 
ATOM   3337  N  N     . ASP A  1  433 ? 38.123  97.897  62.758  1.00 47.32  ? 433  ASP A N     1 
ATOM   3338  C  CA    . ASP A  1  433 ? 37.947  98.862  61.700  1.00 45.04  ? 433  ASP A CA    1 
ATOM   3339  C  C     . ASP A  1  433 ? 39.142  98.969  60.784  1.00 43.64  ? 433  ASP A C     1 
ATOM   3340  O  O     . ASP A  1  433 ? 40.237  99.361  61.191  1.00 42.27  ? 433  ASP A O     1 
ATOM   3341  C  CB    . ASP A  1  433 ? 37.632  100.249 62.237  1.00 46.55  ? 433  ASP A CB    1 
ATOM   3342  C  CG    . ASP A  1  433 ? 37.270  101.224 61.118  1.00 48.59  ? 433  ASP A CG    1 
ATOM   3343  O  OD1   . ASP A  1  433 ? 36.981  102.411 61.378  1.00 50.56  ? 433  ASP A OD1   1 
ATOM   3344  O  OD2   . ASP A  1  433 ? 37.267  100.798 59.952  1.00 48.99  ? 433  ASP A OD2   1 
ATOM   3345  N  N     . TYR A  1  434 ? 38.902  98.607  59.532  1.00 41.84  ? 434  TYR A N     1 
ATOM   3346  C  CA    . TYR A  1  434 ? 39.896  98.693  58.474  1.00 39.13  ? 434  TYR A CA    1 
ATOM   3347  C  C     . TYR A  1  434 ? 40.293  100.158 58.370  1.00 38.72  ? 434  TYR A C     1 
ATOM   3348  O  O     . TYR A  1  434 ? 41.458  100.477 58.212  1.00 36.81  ? 434  TYR A O     1 
ATOM   3349  C  CB    . TYR A  1  434 ? 39.270  98.269  57.161  1.00 37.36  ? 434  TYR A CB    1 
ATOM   3350  C  CG    . TYR A  1  434 ? 40.202  98.329  56.012  1.00 36.64  ? 434  TYR A CG    1 
ATOM   3351  C  CD1   . TYR A  1  434 ? 40.844  97.188  55.579  1.00 38.57  ? 434  TYR A CD1   1 
ATOM   3352  C  CD2   . TYR A  1  434 ? 40.475  99.531  55.376  1.00 37.33  ? 434  TYR A CD2   1 
ATOM   3353  C  CE1   . TYR A  1  434 ? 41.752  97.231  54.531  1.00 42.00  ? 434  TYR A CE1   1 
ATOM   3354  C  CE2   . TYR A  1  434 ? 41.380  99.600  54.329  1.00 40.51  ? 434  TYR A CE2   1 
ATOM   3355  C  CZ    . TYR A  1  434 ? 42.024  98.439  53.908  1.00 42.83  ? 434  TYR A CZ    1 
ATOM   3356  O  OH    . TYR A  1  434 ? 42.971  98.458  52.898  1.00 44.79  ? 434  TYR A OH    1 
ATOM   3357  N  N     . ASN A  1  435 ? 39.294  101.037 58.445  1.00 40.04  ? 435  ASN A N     1 
ATOM   3358  C  CA    . ASN A  1  435 ? 39.494  102.482 58.367  1.00 42.34  ? 435  ASN A CA    1 
ATOM   3359  C  C     . ASN A  1  435 ? 40.624  102.877 59.251  1.00 43.09  ? 435  ASN A C     1 
ATOM   3360  O  O     . ASN A  1  435 ? 41.517  103.620 58.859  1.00 42.77  ? 435  ASN A O     1 
ATOM   3361  C  CB    . ASN A  1  435 ? 38.266  103.235 58.848  1.00 43.17  ? 435  ASN A CB    1 
ATOM   3362  C  CG    . ASN A  1  435 ? 37.263  103.445 57.764  1.00 44.88  ? 435  ASN A CG    1 
ATOM   3363  O  OD1   . ASN A  1  435 ? 37.559  104.069 56.733  1.00 44.39  ? 435  ASN A OD1   1 
ATOM   3364  N  ND2   . ASN A  1  435 ? 36.058  102.932 57.979  1.00 45.17  ? 435  ASN A ND2   1 
ATOM   3365  N  N     . ARG A  1  436 ? 40.545  102.385 60.475  1.00 44.65  ? 436  ARG A N     1 
ATOM   3366  C  CA    . ARG A  1  436 ? 41.554  102.670 61.462  1.00 46.71  ? 436  ARG A CA    1 
ATOM   3367  C  C     . ARG A  1  436 ? 42.874  102.022 61.067  1.00 48.22  ? 436  ARG A C     1 
ATOM   3368  O  O     . ARG A  1  436 ? 43.932  102.667 61.137  1.00 49.29  ? 436  ARG A O     1 
ATOM   3369  C  CB    . ARG A  1  436 ? 41.065  102.195 62.830  1.00 45.45  ? 436  ARG A CB    1 
ATOM   3370  C  CG    . ARG A  1  436 ? 40.081  103.175 63.466  1.00 43.49  ? 436  ARG A CG    1 
ATOM   3371  C  CD    . ARG A  1  436 ? 40.765  104.513 63.790  1.00 42.01  ? 436  ARG A CD    1 
ATOM   3372  N  NE    . ARG A  1  436 ? 41.644  104.363 64.942  1.00 42.23  ? 436  ARG A NE    1 
ATOM   3373  C  CZ    . ARG A  1  436 ? 41.213  104.325 66.201  1.00 42.89  ? 436  ARG A CZ    1 
ATOM   3374  N  NH1   . ARG A  1  436 ? 39.919  104.449 66.456  1.00 43.02  ? 436  ARG A NH1   1 
ATOM   3375  N  NH2   . ARG A  1  436 ? 42.063  104.119 67.205  1.00 42.59  ? 436  ARG A NH2   1 
ATOM   3376  N  N     . ILE A  1  437 ? 42.817  100.763 60.634  1.00 48.73  ? 437  ILE A N     1 
ATOM   3377  C  CA    . ILE A  1  437 ? 44.034  100.071 60.217  1.00 48.75  ? 437  ILE A CA    1 
ATOM   3378  C  C     . ILE A  1  437 ? 44.632  100.860 59.059  1.00 49.52  ? 437  ILE A C     1 
ATOM   3379  O  O     . ILE A  1  437 ? 45.837  101.105 59.007  1.00 48.94  ? 437  ILE A O     1 
ATOM   3380  C  CB    . ILE A  1  437 ? 43.728  98.639  59.765  1.00 48.25  ? 437  ILE A CB    1 
ATOM   3381  C  CG1   . ILE A  1  437 ? 42.984  97.915  60.888  1.00 48.93  ? 437  ILE A CG1   1 
ATOM   3382  C  CG2   . ILE A  1  437 ? 45.011  97.921  59.407  1.00 46.68  ? 437  ILE A CG2   1 
ATOM   3383  C  CD1   . ILE A  1  437 ? 42.665  96.475  60.607  1.00 49.80  ? 437  ILE A CD1   1 
ATOM   3384  N  N     . ARG A  1  438 ? 43.768  101.285 58.146  1.00 50.22  ? 438  ARG A N     1 
ATOM   3385  C  CA    . ARG A  1  438 ? 44.197  102.049 56.993  1.00 50.61  ? 438  ARG A CA    1 
ATOM   3386  C  C     . ARG A  1  438 ? 44.965  103.271 57.451  1.00 51.07  ? 438  ARG A C     1 
ATOM   3387  O  O     . ARG A  1  438 ? 46.102  103.475 57.059  1.00 49.69  ? 438  ARG A O     1 
ATOM   3388  C  CB    . ARG A  1  438 ? 42.982  102.455 56.171  1.00 50.35  ? 438  ARG A CB    1 
ATOM   3389  C  CG    . ARG A  1  438 ? 43.321  103.152 54.891  1.00 51.13  ? 438  ARG A CG    1 
ATOM   3390  C  CD    . ARG A  1  438 ? 44.182  102.283 54.012  1.00 51.60  ? 438  ARG A CD    1 
ATOM   3391  N  NE    . ARG A  1  438 ? 44.440  102.916 52.724  1.00 54.28  ? 438  ARG A NE    1 
ATOM   3392  C  CZ    . ARG A  1  438 ? 44.990  104.117 52.574  1.00 55.98  ? 438  ARG A CZ    1 
ATOM   3393  N  NH1   . ARG A  1  438 ? 45.353  104.834 53.633  1.00 56.34  ? 438  ARG A NH1   1 
ATOM   3394  N  NH2   . ARG A  1  438 ? 45.165  104.605 51.358  1.00 57.31  ? 438  ARG A NH2   1 
ATOM   3395  N  N     . SER A  1  439 ? 44.336  104.067 58.304  1.00 54.30  ? 439  SER A N     1 
ATOM   3396  C  CA    . SER A  1  439 ? 44.939  105.283 58.838  1.00 58.43  ? 439  SER A CA    1 
ATOM   3397  C  C     . SER A  1  439 ? 46.337  105.009 59.395  1.00 60.07  ? 439  SER A C     1 
ATOM   3398  O  O     . SER A  1  439 ? 47.181  105.910 59.478  1.00 59.90  ? 439  SER A O     1 
ATOM   3399  C  CB    . SER A  1  439 ? 44.048  105.872 59.950  1.00 60.52  ? 439  SER A CB    1 
ATOM   3400  O  OG    . SER A  1  439 ? 42.731  106.188 59.501  1.00 62.37  ? 439  SER A OG    1 
ATOM   3401  N  N     . GLY A  1  440 ? 46.582  103.762 59.781  1.00 62.08  ? 440  GLY A N     1 
ATOM   3402  C  CA    . GLY A  1  440 ? 47.885  103.410 60.320  1.00 64.58  ? 440  GLY A CA    1 
ATOM   3403  C  C     . GLY A  1  440 ? 48.921  103.229 59.225  1.00 65.69  ? 440  GLY A C     1 
ATOM   3404  O  O     . GLY A  1  440 ? 49.992  102.666 59.456  1.00 66.02  ? 440  GLY A O     1 
ATOM   3405  N  N     . MET A  1  441 ? 48.602  103.710 58.029  1.00 66.24  ? 441  MET A N     1 
ATOM   3406  C  CA    . MET A  1  441 ? 49.499  103.588 56.897  1.00 66.59  ? 441  MET A CA    1 
ATOM   3407  C  C     . MET A  1  441 ? 50.265  104.859 56.563  1.00 68.94  ? 441  MET A C     1 
ATOM   3408  O  O     . MET A  1  441 ? 50.996  104.893 55.585  1.00 69.34  ? 441  MET A O     1 
ATOM   3409  C  CB    . MET A  1  441 ? 48.717  103.127 55.675  1.00 64.02  ? 441  MET A CB    1 
ATOM   3410  C  CG    . MET A  1  441 ? 48.073  101.767 55.847  1.00 62.37  ? 441  MET A CG    1 
ATOM   3411  S  SD    . MET A  1  441 ? 49.211  100.358 55.958  1.00 59.71  ? 441  MET A SD    1 
ATOM   3412  C  CE    . MET A  1  441 ? 49.382  99.945  54.234  1.00 61.45  ? 441  MET A CE    1 
ATOM   3413  N  N     . TYR A  1  442 ? 50.105  105.909 57.358  1.00 72.10  ? 442  TYR A N     1 
ATOM   3414  C  CA    . TYR A  1  442 ? 50.841  107.140 57.087  1.00 76.15  ? 442  TYR A CA    1 
ATOM   3415  C  C     . TYR A  1  442 ? 51.144  107.971 58.346  1.00 78.78  ? 442  TYR A C     1 
ATOM   3416  O  O     . TYR A  1  442 ? 50.379  107.957 59.320  1.00 79.75  ? 442  TYR A O     1 
ATOM   3417  C  CB    . TYR A  1  442 ? 50.113  107.980 56.015  1.00 76.13  ? 442  TYR A CB    1 
ATOM   3418  C  CG    . TYR A  1  442 ? 48.696  108.350 56.353  1.00 77.18  ? 442  TYR A CG    1 
ATOM   3419  C  CD1   . TYR A  1  442 ? 48.411  109.505 57.071  1.00 78.32  ? 442  TYR A CD1   1 
ATOM   3420  C  CD2   . TYR A  1  442 ? 47.645  107.500 56.034  1.00 77.92  ? 442  TYR A CD2   1 
ATOM   3421  C  CE1   . TYR A  1  442 ? 47.109  109.801 57.477  1.00 79.46  ? 442  TYR A CE1   1 
ATOM   3422  C  CE2   . TYR A  1  442 ? 46.340  107.782 56.436  1.00 79.34  ? 442  TYR A CE2   1 
ATOM   3423  C  CZ    . TYR A  1  442 ? 46.078  108.929 57.162  1.00 79.52  ? 442  TYR A CZ    1 
ATOM   3424  O  OH    . TYR A  1  442 ? 44.797  109.166 57.614  1.00 79.60  ? 442  TYR A OH    1 
ATOM   3425  N  N     . TRP A  1  443 ? 52.293  108.656 58.312  1.00 80.82  ? 443  TRP A N     1 
ATOM   3426  C  CA    . TRP A  1  443 ? 52.819  109.509 59.393  1.00 81.87  ? 443  TRP A CA    1 
ATOM   3427  C  C     . TRP A  1  443 ? 53.556  108.738 60.537  1.00 82.09  ? 443  TRP A C     1 
ATOM   3428  O  O     . TRP A  1  443 ? 52.909  108.186 61.426  1.00 83.34  ? 443  TRP A O     1 
ATOM   3429  C  CB    . TRP A  1  443 ? 51.694  110.388 59.977  1.00 82.25  ? 443  TRP A CB    1 
ATOM   3430  C  CG    . TRP A  1  443 ? 52.182  111.747 60.426  1.00 84.46  ? 443  TRP A CG    1 
ATOM   3431  C  CD1   . TRP A  1  443 ? 51.594  112.568 61.352  1.00 83.83  ? 443  TRP A CD1   1 
ATOM   3432  C  CD2   . TRP A  1  443 ? 53.377  112.433 59.980  1.00 85.31  ? 443  TRP A CD2   1 
ATOM   3433  N  NE1   . TRP A  1  443 ? 52.350  113.711 61.514  1.00 83.97  ? 443  TRP A NE1   1 
ATOM   3434  C  CE2   . TRP A  1  443 ? 53.445  113.656 60.690  1.00 84.72  ? 443  TRP A CE2   1 
ATOM   3435  C  CE3   . TRP A  1  443 ? 54.394  112.129 59.051  1.00 85.41  ? 443  TRP A CE3   1 
ATOM   3436  C  CZ2   . TRP A  1  443 ? 54.490  114.577 60.505  1.00 84.33  ? 443  TRP A CZ2   1 
ATOM   3437  C  CZ3   . TRP A  1  443 ? 55.431  113.042 58.866  1.00 85.64  ? 443  TRP A CZ3   1 
ATOM   3438  C  CH2   . TRP A  1  443 ? 55.470  114.254 59.593  1.00 85.78  ? 443  TRP A CH2   1 
ATOM   3439  N  N     . ILE A  1  444 ? 54.897  108.713 60.516  1.00 81.09  ? 444  ILE A N     1 
ATOM   3440  C  CA    . ILE A  1  444 ? 55.688  108.019 61.538  1.00 77.78  ? 444  ILE A CA    1 
ATOM   3441  N  N     . PRO B  2  21  ? 90.493  76.503  44.770  1.00 143.10 ? 19   PRO B N     1 
ATOM   3442  C  CA    . PRO B  2  21  ? 91.315  75.304  45.090  1.00 142.69 ? 19   PRO B CA    1 
ATOM   3443  C  C     . PRO B  2  21  ? 90.507  74.126  45.667  1.00 142.17 ? 19   PRO B C     1 
ATOM   3444  O  O     . PRO B  2  21  ? 90.558  73.855  46.871  1.00 142.23 ? 19   PRO B O     1 
ATOM   3445  C  CB    . PRO B  2  21  ? 92.394  75.771  46.061  1.00 142.53 ? 19   PRO B CB    1 
ATOM   3446  C  CG    . PRO B  2  21  ? 92.573  77.229  45.612  1.00 142.70 ? 19   PRO B CG    1 
ATOM   3447  C  CD    . PRO B  2  21  ? 91.143  77.720  45.296  1.00 142.80 ? 19   PRO B CD    1 
ATOM   3448  N  N     . GLY B  2  22  ? 89.774  73.439  44.786  1.00 141.11 ? 20   GLY B N     1 
ATOM   3449  C  CA    . GLY B  2  22  ? 88.953  72.292  45.156  1.00 139.46 ? 20   GLY B CA    1 
ATOM   3450  C  C     . GLY B  2  22  ? 88.763  71.979  46.631  1.00 138.82 ? 20   GLY B C     1 
ATOM   3451  O  O     . GLY B  2  22  ? 88.278  72.811  47.399  1.00 138.04 ? 20   GLY B O     1 
ATOM   3452  N  N     . ALA B  2  23  ? 89.146  70.765  47.026  1.00 138.45 ? 21   ALA B N     1 
ATOM   3453  C  CA    . ALA B  2  23  ? 89.012  70.317  48.413  1.00 137.63 ? 21   ALA B CA    1 
ATOM   3454  C  C     . ALA B  2  23  ? 90.356  70.158  49.136  1.00 137.01 ? 21   ALA B C     1 
ATOM   3455  O  O     . ALA B  2  23  ? 91.292  69.546  48.613  1.00 136.72 ? 21   ALA B O     1 
ATOM   3456  C  CB    . ALA B  2  23  ? 88.234  68.990  48.458  1.00 137.08 ? 21   ALA B CB    1 
ATOM   3457  N  N     . GLU B  2  24  ? 90.441  70.720  50.340  1.00 136.28 ? 22   GLU B N     1 
ATOM   3458  C  CA    . GLU B  2  24  ? 91.647  70.630  51.159  1.00 135.67 ? 22   GLU B CA    1 
ATOM   3459  C  C     . GLU B  2  24  ? 91.552  69.382  52.024  1.00 136.30 ? 22   GLU B C     1 
ATOM   3460  O  O     . GLU B  2  24  ? 91.002  68.372  51.592  1.00 136.74 ? 22   GLU B O     1 
ATOM   3461  C  CB    . GLU B  2  24  ? 91.785  71.851  52.062  1.00 134.12 ? 22   GLU B CB    1 
ATOM   3462  C  CG    . GLU B  2  24  ? 91.987  73.148  51.330  1.00 132.12 ? 22   GLU B CG    1 
ATOM   3463  C  CD    . GLU B  2  24  ? 93.054  73.983  51.983  1.00 131.11 ? 22   GLU B CD    1 
ATOM   3464  O  OE1   . GLU B  2  24  ? 93.158  73.921  53.228  1.00 130.21 ? 22   GLU B OE1   1 
ATOM   3465  O  OE2   . GLU B  2  24  ? 93.777  74.698  51.259  1.00 130.11 ? 22   GLU B OE2   1 
ATOM   3466  N  N     . ASP B  2  25  ? 92.070  69.447  53.248  1.00 136.80 ? 23   ASP B N     1 
ATOM   3467  C  CA    . ASP B  2  25  ? 92.019  68.286  54.131  1.00 137.57 ? 23   ASP B CA    1 
ATOM   3468  C  C     . ASP B  2  25  ? 91.684  68.599  55.592  1.00 137.62 ? 23   ASP B C     1 
ATOM   3469  O  O     . ASP B  2  25  ? 92.002  69.672  56.110  1.00 137.53 ? 23   ASP B O     1 
ATOM   3470  C  CB    . ASP B  2  25  ? 93.330  67.491  54.033  1.00 138.56 ? 23   ASP B CB    1 
ATOM   3471  C  CG    . ASP B  2  25  ? 93.358  66.541  52.827  1.00 139.11 ? 23   ASP B CG    1 
ATOM   3472  O  OD1   . ASP B  2  25  ? 92.488  65.642  52.754  1.00 139.62 ? 23   ASP B OD1   1 
ATOM   3473  O  OD2   . ASP B  2  25  ? 94.247  66.687  51.956  1.00 138.81 ? 23   ASP B OD2   1 
ATOM   3474  N  N     . LEU B  2  26  ? 91.054  67.625  56.244  1.00 137.67 ? 24   LEU B N     1 
ATOM   3475  C  CA    . LEU B  2  26  ? 90.590  67.729  57.624  1.00 137.91 ? 24   LEU B CA    1 
ATOM   3476  C  C     . LEU B  2  26  ? 91.609  67.421  58.727  1.00 138.66 ? 24   LEU B C     1 
ATOM   3477  O  O     . LEU B  2  26  ? 91.709  66.275  59.179  1.00 139.55 ? 24   LEU B O     1 
ATOM   3478  C  CB    . LEU B  2  26  ? 89.377  66.811  57.787  1.00 137.28 ? 24   LEU B CB    1 
ATOM   3479  C  CG    . LEU B  2  26  ? 88.759  66.647  59.172  1.00 136.96 ? 24   LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  2  26  ? 88.248  67.982  59.685  1.00 137.43 ? 24   LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  2  26  ? 87.630  65.658  59.080  1.00 136.71 ? 24   LEU B CD2   1 
ATOM   3482  N  N     . GLU B  2  27  ? 92.339  68.444  59.175  1.00 138.64 ? 25   GLU B N     1 
ATOM   3483  C  CA    . GLU B  2  27  ? 93.343  68.280  60.235  1.00 138.79 ? 25   GLU B CA    1 
ATOM   3484  C  C     . GLU B  2  27  ? 92.668  68.114  61.598  1.00 138.70 ? 25   GLU B C     1 
ATOM   3485  O  O     . GLU B  2  27  ? 91.487  68.412  61.742  1.00 139.17 ? 25   GLU B O     1 
ATOM   3486  C  CB    . GLU B  2  27  ? 94.262  69.498  60.276  1.00 139.21 ? 25   GLU B CB    1 
ATOM   3487  C  CG    . GLU B  2  27  ? 94.904  69.828  58.942  1.00 140.29 ? 25   GLU B CG    1 
ATOM   3488  C  CD    . GLU B  2  27  ? 95.627  71.163  58.951  1.00 140.93 ? 25   GLU B CD    1 
ATOM   3489  O  OE1   . GLU B  2  27  ? 96.537  71.345  59.793  1.00 141.11 ? 25   GLU B OE1   1 
ATOM   3490  O  OE2   . GLU B  2  27  ? 95.285  72.027  58.112  1.00 140.85 ? 25   GLU B OE2   1 
ATOM   3491  N  N     . ILE B  2  28  ? 93.413  67.650  62.599  1.00 138.46 ? 26   ILE B N     1 
ATOM   3492  C  CA    . ILE B  2  28  ? 92.842  67.457  63.935  1.00 138.15 ? 26   ILE B CA    1 
ATOM   3493  C  C     . ILE B  2  28  ? 93.903  67.333  65.044  1.00 138.09 ? 26   ILE B C     1 
ATOM   3494  O  O     . ILE B  2  28  ? 94.289  66.230  65.440  1.00 137.87 ? 26   ILE B O     1 
ATOM   3495  C  CB    . ILE B  2  28  ? 91.885  66.209  63.949  1.00 137.90 ? 26   ILE B CB    1 
ATOM   3496  C  CG1   . ILE B  2  28  ? 91.354  65.946  65.361  1.00 137.46 ? 26   ILE B CG1   1 
ATOM   3497  C  CG2   . ILE B  2  28  ? 92.602  64.990  63.400  1.00 138.38 ? 26   ILE B CG2   1 
ATOM   3498  C  CD1   . ILE B  2  28  ? 90.440  64.747  65.454  1.00 136.25 ? 26   ILE B CD1   1 
ATOM   3499  N  N     . THR B  2  29  ? 94.367  68.479  65.540  1.00 138.01 ? 27   THR B N     1 
ATOM   3500  C  CA    . THR B  2  29  ? 95.373  68.524  66.601  1.00 138.39 ? 27   THR B CA    1 
ATOM   3501  C  C     . THR B  2  29  ? 94.758  68.017  67.913  1.00 138.94 ? 27   THR B C     1 
ATOM   3502  O  O     . THR B  2  29  ? 93.560  67.749  67.964  1.00 139.15 ? 27   THR B O     1 
ATOM   3503  C  CB    . THR B  2  29  ? 95.899  69.965  66.783  1.00 138.31 ? 27   THR B CB    1 
ATOM   3504  O  OG1   . THR B  2  29  ? 96.212  70.515  65.499  1.00 137.66 ? 27   THR B OG1   1 
ATOM   3505  C  CG2   . THR B  2  29  ? 97.163  69.981  67.639  1.00 138.31 ? 27   THR B CG2   1 
ATOM   3506  N  N     . LYS B  2  30  ? 95.560  67.879  68.970  1.00 139.47 ? 28   LYS B N     1 
ATOM   3507  C  CA    . LYS B  2  30  ? 95.023  67.370  70.235  1.00 139.65 ? 28   LYS B CA    1 
ATOM   3508  C  C     . LYS B  2  30  ? 95.694  67.848  71.537  1.00 139.95 ? 28   LYS B C     1 
ATOM   3509  O  O     . LYS B  2  30  ? 95.863  67.064  72.472  1.00 139.88 ? 28   LYS B O     1 
ATOM   3510  C  CB    . LYS B  2  30  ? 95.031  65.841  70.194  1.00 139.46 ? 28   LYS B CB    1 
ATOM   3511  C  CG    . LYS B  2  30  ? 94.206  65.213  71.282  1.00 140.04 ? 28   LYS B CG    1 
ATOM   3512  C  CD    . LYS B  2  30  ? 94.101  63.718  71.110  1.00 141.09 ? 28   LYS B CD    1 
ATOM   3513  C  CE    . LYS B  2  30  ? 93.182  63.150  72.172  1.00 141.90 ? 28   LYS B CE    1 
ATOM   3514  N  NZ    . LYS B  2  30  ? 93.581  63.651  73.520  1.00 142.79 ? 28   LYS B NZ    1 
ATOM   3515  N  N     . LEU B  2  31  ? 96.040  69.137  71.583  1.00 140.27 ? 29   LEU B N     1 
ATOM   3516  C  CA    . LEU B  2  31  ? 96.695  69.818  72.719  1.00 140.18 ? 29   LEU B CA    1 
ATOM   3517  C  C     . LEU B  2  31  ? 96.909  69.115  74.077  1.00 139.43 ? 29   LEU B C     1 
ATOM   3518  O  O     . LEU B  2  31  ? 96.207  68.164  74.424  1.00 139.30 ? 29   LEU B O     1 
ATOM   3519  C  CB    . LEU B  2  31  ? 95.993  71.157  72.966  1.00 140.94 ? 29   LEU B CB    1 
ATOM   3520  C  CG    . LEU B  2  31  ? 96.211  72.224  71.886  1.00 141.45 ? 29   LEU B CG    1 
ATOM   3521  C  CD1   . LEU B  2  31  ? 95.485  73.502  72.298  1.00 141.88 ? 29   LEU B CD1   1 
ATOM   3522  C  CD2   . LEU B  2  31  ? 97.709  72.489  71.688  1.00 141.09 ? 29   LEU B CD2   1 
ATOM   3523  N  N     . PRO B  2  32  ? 97.876  69.616  74.877  1.00 138.62 ? 30   PRO B N     1 
ATOM   3524  C  CA    . PRO B  2  32  ? 98.236  69.087  76.199  1.00 138.44 ? 30   PRO B CA    1 
ATOM   3525  C  C     . PRO B  2  32  ? 97.115  68.780  77.191  1.00 138.64 ? 30   PRO B C     1 
ATOM   3526  O  O     . PRO B  2  32  ? 97.036  67.664  77.710  1.00 138.82 ? 30   PRO B O     1 
ATOM   3527  C  CB    . PRO B  2  32  ? 99.213  70.136  76.741  1.00 138.08 ? 30   PRO B CB    1 
ATOM   3528  C  CG    . PRO B  2  32  ? 98.833  71.384  76.014  1.00 137.67 ? 30   PRO B CG    1 
ATOM   3529  C  CD    . PRO B  2  32  ? 98.619  70.863  74.622  1.00 138.21 ? 30   PRO B CD    1 
ATOM   3530  N  N     . ASN B  2  33  ? 96.253  69.757  77.460  1.00 138.78 ? 31   ASN B N     1 
ATOM   3531  C  CA    . ASN B  2  33  ? 95.158  69.576  78.424  1.00 138.33 ? 31   ASN B CA    1 
ATOM   3532  C  C     . ASN B  2  33  ? 94.172  68.411  78.186  1.00 137.58 ? 31   ASN B C     1 
ATOM   3533  O  O     . ASN B  2  33  ? 93.992  67.538  79.049  1.00 136.53 ? 31   ASN B O     1 
ATOM   3534  C  CB    . ASN B  2  33  ? 94.387  70.911  78.605  1.00 138.01 ? 31   ASN B CB    1 
ATOM   3535  C  CG    . ASN B  2  33  ? 94.088  71.635  77.285  1.00 137.12 ? 31   ASN B CG    1 
ATOM   3536  O  OD1   . ASN B  2  33  ? 93.625  72.778  77.296  1.00 136.14 ? 31   ASN B OD1   1 
ATOM   3537  N  ND2   . ASN B  2  33  ? 94.341  70.976  76.158  1.00 136.67 ? 31   ASN B ND2   1 
ATOM   3538  N  N     . GLY B  2  34  ? 93.552  68.399  77.010  1.00 137.10 ? 32   GLY B N     1 
ATOM   3539  C  CA    . GLY B  2  34  ? 92.582  67.374  76.665  1.00 136.20 ? 32   GLY B CA    1 
ATOM   3540  C  C     . GLY B  2  34  ? 91.574  67.943  75.679  1.00 135.36 ? 32   GLY B C     1 
ATOM   3541  O  O     . GLY B  2  34  ? 90.597  67.286  75.297  1.00 134.97 ? 32   GLY B O     1 
ATOM   3542  N  N     . LEU B  2  35  ? 91.827  69.186  75.275  1.00 134.48 ? 33   LEU B N     1 
ATOM   3543  C  CA    . LEU B  2  35  ? 90.977  69.895  74.327  1.00 133.25 ? 33   LEU B CA    1 
ATOM   3544  C  C     . LEU B  2  35  ? 91.276  69.439  72.906  1.00 131.52 ? 33   LEU B C     1 
ATOM   3545  O  O     . LEU B  2  35  ? 92.436  69.321  72.511  1.00 132.00 ? 33   LEU B O     1 
ATOM   3546  C  CB    . LEU B  2  35  ? 91.212  71.404  74.435  1.00 134.31 ? 33   LEU B CB    1 
ATOM   3547  C  CG    . LEU B  2  35  ? 90.456  72.311  73.458  1.00 134.82 ? 33   LEU B CG    1 
ATOM   3548  C  CD1   . LEU B  2  35  ? 88.951  72.209  73.685  1.00 135.09 ? 33   LEU B CD1   1 
ATOM   3549  C  CD2   . LEU B  2  35  ? 90.932  73.738  73.655  1.00 135.39 ? 33   LEU B CD2   1 
ATOM   3550  N  N     . ILE B  2  36  ? 90.221  69.194  72.139  1.00 128.94 ? 34   ILE B N     1 
ATOM   3551  C  CA    . ILE B  2  36  ? 90.351  68.743  70.760  1.00 126.12 ? 34   ILE B CA    1 
ATOM   3552  C  C     . ILE B  2  36  ? 89.971  69.872  69.808  1.00 124.66 ? 34   ILE B C     1 
ATOM   3553  O  O     . ILE B  2  36  ? 89.186  70.743  70.168  1.00 125.32 ? 34   ILE B O     1 
ATOM   3554  C  CB    . ILE B  2  36  ? 89.451  67.513  70.538  1.00 125.40 ? 34   ILE B CB    1 
ATOM   3555  C  CG1   . ILE B  2  36  ? 89.911  66.401  71.491  1.00 124.39 ? 34   ILE B CG1   1 
ATOM   3556  C  CG2   . ILE B  2  36  ? 89.474  67.086  69.069  1.00 124.39 ? 34   ILE B CG2   1 
ATOM   3557  C  CD1   . ILE B  2  36  ? 88.954  65.251  71.641  1.00 124.23 ? 34   ILE B CD1   1 
ATOM   3558  N  N     . ILE B  2  37  ? 90.538  69.866  68.604  1.00 122.45 ? 35   ILE B N     1 
ATOM   3559  C  CA    . ILE B  2  37  ? 90.254  70.903  67.610  1.00 120.57 ? 35   ILE B CA    1 
ATOM   3560  C  C     . ILE B  2  37  ? 90.096  70.265  66.232  1.00 120.26 ? 35   ILE B C     1 
ATOM   3561  O  O     . ILE B  2  37  ? 91.069  69.781  65.671  1.00 121.02 ? 35   ILE B O     1 
ATOM   3562  C  CB    . ILE B  2  37  ? 91.407  71.922  67.531  1.00 119.16 ? 35   ILE B CB    1 
ATOM   3563  C  CG1   . ILE B  2  37  ? 91.818  72.352  68.936  1.00 117.67 ? 35   ILE B CG1   1 
ATOM   3564  C  CG2   . ILE B  2  37  ? 90.979  73.127  66.712  1.00 118.93 ? 35   ILE B CG2   1 
ATOM   3565  C  CD1   . ILE B  2  37  ? 93.009  73.267  68.954  1.00 116.56 ? 35   ILE B CD1   1 
ATOM   3566  N  N     . ALA B  2  38  ? 88.887  70.275  65.677  1.00 119.68 ? 36   ALA B N     1 
ATOM   3567  C  CA    . ALA B  2  38  ? 88.652  69.664  64.367  1.00 119.32 ? 36   ALA B CA    1 
ATOM   3568  C  C     . ALA B  2  38  ? 88.192  70.640  63.287  1.00 119.24 ? 36   ALA B C     1 
ATOM   3569  O  O     . ALA B  2  38  ? 87.000  70.741  63.005  1.00 119.30 ? 36   ALA B O     1 
ATOM   3570  C  CB    . ALA B  2  38  ? 87.637  68.534  64.502  1.00 119.01 ? 36   ALA B CB    1 
ATOM   3571  N  N     . SER B  2  39  ? 89.141  71.342  62.671  1.00 119.47 ? 37   SER B N     1 
ATOM   3572  C  CA    . SER B  2  39  ? 88.824  72.308  61.619  1.00 119.51 ? 37   SER B CA    1 
ATOM   3573  C  C     . SER B  2  39  ? 88.886  71.669  60.242  1.00 119.76 ? 37   SER B C     1 
ATOM   3574  O  O     . SER B  2  39  ? 89.605  70.697  60.024  1.00 119.97 ? 37   SER B O     1 
ATOM   3575  C  CB    . SER B  2  39  ? 89.801  73.489  61.640  1.00 119.37 ? 37   SER B CB    1 
ATOM   3576  O  OG    . SER B  2  39  ? 90.886  73.276  60.746  1.00 118.62 ? 37   SER B OG    1 
ATOM   3577  N  N     . LEU B  2  40  ? 88.137  72.239  59.310  1.00 119.94 ? 38   LEU B N     1 
ATOM   3578  C  CA    . LEU B  2  40  ? 88.104  71.749  57.944  1.00 120.17 ? 38   LEU B CA    1 
ATOM   3579  C  C     . LEU B  2  40  ? 87.674  72.871  57.038  1.00 121.55 ? 38   LEU B C     1 
ATOM   3580  O  O     . LEU B  2  40  ? 86.524  73.283  57.068  1.00 121.84 ? 38   LEU B O     1 
ATOM   3581  C  CB    . LEU B  2  40  ? 87.114  70.598  57.801  1.00 118.21 ? 38   LEU B CB    1 
ATOM   3582  C  CG    . LEU B  2  40  ? 86.471  70.441  56.419  1.00 116.24 ? 38   LEU B CG    1 
ATOM   3583  C  CD1   . LEU B  2  40  ? 87.524  70.313  55.341  1.00 115.38 ? 38   LEU B CD1   1 
ATOM   3584  C  CD2   . LEU B  2  40  ? 85.574  69.231  56.432  1.00 115.79 ? 38   LEU B CD2   1 
ATOM   3585  N  N     . GLU B  2  41  ? 88.600  73.373  56.239  1.00 123.65 ? 39   GLU B N     1 
ATOM   3586  C  CA    . GLU B  2  41  ? 88.283  74.443  55.306  1.00 125.94 ? 39   GLU B CA    1 
ATOM   3587  C  C     . GLU B  2  41  ? 87.561  73.818  54.097  1.00 127.21 ? 39   GLU B C     1 
ATOM   3588  O  O     . GLU B  2  41  ? 88.022  72.817  53.545  1.00 128.74 ? 39   GLU B O     1 
ATOM   3589  C  CB    . GLU B  2  41  ? 89.586  75.139  54.882  1.00 125.80 ? 39   GLU B CB    1 
ATOM   3590  C  CG    . GLU B  2  41  ? 89.448  76.138  53.747  1.00 125.95 ? 39   GLU B CG    1 
ATOM   3591  C  CD    . GLU B  2  41  ? 88.546  77.298  54.085  1.00 126.04 ? 39   GLU B CD    1 
ATOM   3592  O  OE1   . GLU B  2  41  ? 87.313  77.095  54.194  1.00 125.62 ? 39   GLU B OE1   1 
ATOM   3593  O  OE2   . GLU B  2  41  ? 89.083  78.416  54.241  1.00 126.68 ? 39   GLU B OE2   1 
ATOM   3594  N  N     . ASN B  2  42  ? 86.414  74.371  53.706  1.00 127.34 ? 40   ASN B N     1 
ATOM   3595  C  CA    . ASN B  2  42  ? 85.686  73.842  52.552  1.00 127.29 ? 40   ASN B CA    1 
ATOM   3596  C  C     . ASN B  2  42  ? 85.335  75.037  51.688  1.00 127.09 ? 40   ASN B C     1 
ATOM   3597  O  O     . ASN B  2  42  ? 84.504  74.969  50.780  1.00 126.46 ? 40   ASN B O     1 
ATOM   3598  C  CB    . ASN B  2  42  ? 84.425  73.083  52.994  1.00 127.87 ? 40   ASN B CB    1 
ATOM   3599  C  CG    . ASN B  2  42  ? 83.342  74.000  53.530  1.00 128.35 ? 40   ASN B CG    1 
ATOM   3600  O  OD1   . ASN B  2  42  ? 83.622  74.946  54.268  1.00 128.65 ? 40   ASN B OD1   1 
ATOM   3601  N  ND2   . ASN B  2  42  ? 82.093  73.713  53.173  1.00 128.21 ? 40   ASN B ND2   1 
ATOM   3602  N  N     . PHE B  2  43  ? 86.000  76.140  52.009  1.00 127.15 ? 41   PHE B N     1 
ATOM   3603  C  CA    . PHE B  2  43  ? 85.843  77.397  51.307  1.00 127.91 ? 41   PHE B CA    1 
ATOM   3604  C  C     . PHE B  2  43  ? 84.415  77.857  51.062  1.00 127.44 ? 41   PHE B C     1 
ATOM   3605  O  O     . PHE B  2  43  ? 84.127  78.479  50.037  1.00 127.75 ? 41   PHE B O     1 
ATOM   3606  C  CB    . PHE B  2  43  ? 86.592  77.343  49.977  1.00 129.74 ? 41   PHE B CB    1 
ATOM   3607  C  CG    . PHE B  2  43  ? 88.085  77.259  50.128  1.00 131.61 ? 41   PHE B CG    1 
ATOM   3608  C  CD1   . PHE B  2  43  ? 88.738  76.031  50.075  1.00 132.56 ? 41   PHE B CD1   1 
ATOM   3609  C  CD2   . PHE B  2  43  ? 88.840  78.412  50.340  1.00 132.53 ? 41   PHE B CD2   1 
ATOM   3610  C  CE1   . PHE B  2  43  ? 90.126  75.950  50.232  1.00 133.25 ? 41   PHE B CE1   1 
ATOM   3611  C  CE2   . PHE B  2  43  ? 90.227  78.347  50.500  1.00 133.20 ? 41   PHE B CE2   1 
ATOM   3612  C  CZ    . PHE B  2  43  ? 90.872  77.113  50.445  1.00 133.54 ? 41   PHE B CZ    1 
ATOM   3613  N  N     . SER B  2  44  ? 83.516  77.555  51.993  1.00 126.49 ? 42   SER B N     1 
ATOM   3614  C  CA    . SER B  2  44  ? 82.131  77.996  51.846  1.00 124.88 ? 42   SER B CA    1 
ATOM   3615  C  C     . SER B  2  44  ? 82.073  79.395  52.452  1.00 123.48 ? 42   SER B C     1 
ATOM   3616  O  O     . SER B  2  44  ? 82.835  79.713  53.369  1.00 123.76 ? 42   SER B O     1 
ATOM   3617  C  CB    . SER B  2  44  ? 81.165  77.059  52.584  1.00 124.81 ? 42   SER B CB    1 
ATOM   3618  O  OG    . SER B  2  44  ? 79.812  77.415  52.341  1.00 123.73 ? 42   SER B OG    1 
ATOM   3619  N  N     . PRO B  2  45  ? 81.178  80.252  51.939  1.00 121.59 ? 43   PRO B N     1 
ATOM   3620  C  CA    . PRO B  2  45  ? 81.064  81.614  52.466  1.00 120.01 ? 43   PRO B CA    1 
ATOM   3621  C  C     . PRO B  2  45  ? 80.647  81.643  53.936  1.00 118.68 ? 43   PRO B C     1 
ATOM   3622  O  O     . PRO B  2  45  ? 80.859  82.632  54.644  1.00 118.14 ? 43   PRO B O     1 
ATOM   3623  C  CB    . PRO B  2  45  ? 80.018  82.245  51.545  1.00 120.00 ? 43   PRO B CB    1 
ATOM   3624  C  CG    . PRO B  2  45  ? 79.144  81.083  51.190  1.00 120.45 ? 43   PRO B CG    1 
ATOM   3625  C  CD    . PRO B  2  45  ? 80.151  79.994  50.914  1.00 120.95 ? 43   PRO B CD    1 
ATOM   3626  N  N     . ALA B  2  46  ? 80.074  80.539  54.399  1.00 117.40 ? 44   ALA B N     1 
ATOM   3627  C  CA    . ALA B  2  46  ? 79.598  80.460  55.768  1.00 115.99 ? 44   ALA B CA    1 
ATOM   3628  C  C     . ALA B  2  46  ? 80.387  79.537  56.675  1.00 114.60 ? 44   ALA B C     1 
ATOM   3629  O  O     . ALA B  2  46  ? 80.418  78.324  56.488  1.00 114.30 ? 44   ALA B O     1 
ATOM   3630  C  CB    . ALA B  2  46  ? 78.128  80.054  55.775  1.00 116.92 ? 44   ALA B CB    1 
ATOM   3631  N  N     . SER B  2  47  ? 81.018  80.132  57.672  1.00 113.14 ? 45   SER B N     1 
ATOM   3632  C  CA    . SER B  2  47  ? 81.781  79.379  58.646  1.00 112.02 ? 45   SER B CA    1 
ATOM   3633  C  C     . SER B  2  47  ? 80.764  78.940  59.689  1.00 110.76 ? 45   SER B C     1 
ATOM   3634  O  O     . SER B  2  47  ? 79.632  79.405  59.678  1.00 110.63 ? 45   SER B O     1 
ATOM   3635  C  CB    . SER B  2  47  ? 82.826  80.283  59.296  1.00 112.82 ? 45   SER B CB    1 
ATOM   3636  O  OG    . SER B  2  47  ? 83.490  81.064  58.318  1.00 113.82 ? 45   SER B OG    1 
ATOM   3637  N  N     . ARG B  2  48  ? 81.160  78.049  60.584  1.00 109.80 ? 46   ARG B N     1 
ATOM   3638  C  CA    . ARG B  2  48  ? 80.256  77.588  61.633  1.00 109.26 ? 46   ARG B CA    1 
ATOM   3639  C  C     . ARG B  2  48  ? 81.029  76.846  62.717  1.00 108.18 ? 46   ARG B C     1 
ATOM   3640  O  O     . ARG B  2  48  ? 81.207  75.626  62.664  1.00 108.82 ? 46   ARG B O     1 
ATOM   3641  C  CB    . ARG B  2  48  ? 79.158  76.687  61.052  1.00 110.16 ? 46   ARG B CB    1 
ATOM   3642  C  CG    . ARG B  2  48  ? 78.128  76.189  62.078  1.00 110.77 ? 46   ARG B CG    1 
ATOM   3643  C  CD    . ARG B  2  48  ? 77.112  75.265  61.410  1.00 112.45 ? 46   ARG B CD    1 
ATOM   3644  N  NE    . ARG B  2  48  ? 76.413  74.395  62.355  1.00 113.69 ? 46   ARG B NE    1 
ATOM   3645  C  CZ    . ARG B  2  48  ? 75.312  74.727  63.018  1.00 114.41 ? 46   ARG B CZ    1 
ATOM   3646  N  NH1   . ARG B  2  48  ? 74.767  75.922  62.842  1.00 115.43 ? 46   ARG B NH1   1 
ATOM   3647  N  NH2   . ARG B  2  48  ? 74.759  73.861  63.857  1.00 114.43 ? 46   ARG B NH2   1 
ATOM   3648  N  N     . ILE B  2  49  ? 81.484  77.610  63.702  1.00 106.05 ? 47   ILE B N     1 
ATOM   3649  C  CA    . ILE B  2  49  ? 82.252  77.092  64.825  1.00 103.32 ? 47   ILE B CA    1 
ATOM   3650  C  C     . ILE B  2  49  ? 81.347  76.357  65.814  1.00 102.34 ? 47   ILE B C     1 
ATOM   3651  O  O     . ILE B  2  49  ? 80.129  76.536  65.798  1.00 102.64 ? 47   ILE B O     1 
ATOM   3652  C  CB    . ILE B  2  49  ? 82.988  78.258  65.513  1.00 101.47 ? 47   ILE B CB    1 
ATOM   3653  C  CG1   . ILE B  2  49  ? 84.073  78.784  64.573  1.00 100.28 ? 47   ILE B CG1   1 
ATOM   3654  C  CG2   . ILE B  2  49  ? 83.578  77.816  66.830  1.00 100.30 ? 47   ILE B CG2   1 
ATOM   3655  C  CD1   . ILE B  2  49  ? 83.570  79.252  63.214  1.00 99.40  ? 47   ILE B CD1   1 
ATOM   3656  N  N     . GLY B  2  50  ? 81.939  75.516  66.658  1.00 100.66 ? 48   GLY B N     1 
ATOM   3657  C  CA    . GLY B  2  50  ? 81.144  74.780  67.621  1.00 98.80  ? 48   GLY B CA    1 
ATOM   3658  C  C     . GLY B  2  50  ? 81.902  74.101  68.751  1.00 97.36  ? 48   GLY B C     1 
ATOM   3659  O  O     . GLY B  2  50  ? 82.878  73.389  68.518  1.00 98.06  ? 48   GLY B O     1 
ATOM   3660  N  N     . VAL B  2  51  ? 81.435  74.323  69.979  1.00 94.98  ? 49   VAL B N     1 
ATOM   3661  C  CA    . VAL B  2  51  ? 82.023  73.731  71.173  1.00 91.49  ? 49   VAL B CA    1 
ATOM   3662  C  C     . VAL B  2  51  ? 81.153  72.571  71.669  1.00 91.42  ? 49   VAL B C     1 
ATOM   3663  O  O     . VAL B  2  51  ? 80.176  72.773  72.390  1.00 91.76  ? 49   VAL B O     1 
ATOM   3664  C  CB    . VAL B  2  51  ? 82.142  74.772  72.290  1.00 89.41  ? 49   VAL B CB    1 
ATOM   3665  C  CG1   . VAL B  2  51  ? 82.664  74.120  73.557  1.00 87.94  ? 49   VAL B CG1   1 
ATOM   3666  C  CG2   . VAL B  2  51  ? 83.044  75.893  71.840  1.00 87.09  ? 49   VAL B CG2   1 
ATOM   3667  N  N     . PHE B  2  52  ? 81.499  71.356  71.263  1.00 90.83  ? 50   PHE B N     1 
ATOM   3668  C  CA    . PHE B  2  52  ? 80.757  70.177  71.686  1.00 90.63  ? 50   PHE B CA    1 
ATOM   3669  C  C     . PHE B  2  52  ? 81.270  69.822  73.057  1.00 90.58  ? 50   PHE B C     1 
ATOM   3670  O  O     . PHE B  2  52  ? 82.469  69.833  73.294  1.00 91.00  ? 50   PHE B O     1 
ATOM   3671  C  CB    . PHE B  2  52  ? 81.006  69.023  70.731  1.00 90.79  ? 50   PHE B CB    1 
ATOM   3672  C  CG    . PHE B  2  52  ? 80.675  69.346  69.319  1.00 92.53  ? 50   PHE B CG    1 
ATOM   3673  C  CD1   . PHE B  2  52  ? 81.327  70.390  68.658  1.00 93.31  ? 50   PHE B CD1   1 
ATOM   3674  C  CD2   . PHE B  2  52  ? 79.685  68.634  68.652  1.00 93.70  ? 50   PHE B CD2   1 
ATOM   3675  C  CE1   . PHE B  2  52  ? 80.998  70.731  67.349  1.00 94.99  ? 50   PHE B CE1   1 
ATOM   3676  C  CE2   . PHE B  2  52  ? 79.339  68.957  67.341  1.00 95.56  ? 50   PHE B CE2   1 
ATOM   3677  C  CZ    . PHE B  2  52  ? 80.000  70.014  66.684  1.00 96.26  ? 50   PHE B CZ    1 
ATOM   3678  N  N     . ILE B  2  53  ? 80.370  69.507  73.969  1.00 90.81  ? 51   ILE B N     1 
ATOM   3679  C  CA    . ILE B  2  53  ? 80.800  69.184  75.310  1.00 91.82  ? 51   ILE B CA    1 
ATOM   3680  C  C     . ILE B  2  53  ? 80.181  67.889  75.779  1.00 93.34  ? 51   ILE B C     1 
ATOM   3681  O  O     . ILE B  2  53  ? 79.105  67.508  75.324  1.00 93.58  ? 51   ILE B O     1 
ATOM   3682  C  CB    . ILE B  2  53  ? 80.446  70.342  76.266  1.00 91.04  ? 51   ILE B CB    1 
ATOM   3683  C  CG1   . ILE B  2  53  ? 81.214  71.586  75.822  1.00 90.73  ? 51   ILE B CG1   1 
ATOM   3684  C  CG2   . ILE B  2  53  ? 80.776  69.983  77.710  1.00 89.75  ? 51   ILE B CG2   1 
ATOM   3685  C  CD1   . ILE B  2  53  ? 80.880  72.820  76.590  1.00 91.01  ? 51   ILE B CD1   1 
ATOM   3686  N  N     . LYS B  2  54  ? 80.890  67.198  76.665  1.00 95.33  ? 52   LYS B N     1 
ATOM   3687  C  CA    . LYS B  2  54  ? 80.412  65.943  77.222  1.00 97.07  ? 52   LYS B CA    1 
ATOM   3688  C  C     . LYS B  2  54  ? 79.515  66.212  78.435  1.00 96.67  ? 52   LYS B C     1 
ATOM   3689  O  O     . LYS B  2  54  ? 79.528  65.456  79.405  1.00 97.27  ? 52   LYS B O     1 
ATOM   3690  C  CB    . LYS B  2  54  ? 81.590  65.038  77.629  1.00 99.01  ? 52   LYS B CB    1 
ATOM   3691  C  CG    . LYS B  2  54  ? 82.169  64.158  76.500  1.00 101.70 ? 52   LYS B CG    1 
ATOM   3692  C  CD    . LYS B  2  54  ? 83.393  63.320  76.981  1.00 103.86 ? 52   LYS B CD    1 
ATOM   3693  C  CE    . LYS B  2  54  ? 84.009  62.428  75.865  1.00 104.40 ? 52   LYS B CE    1 
ATOM   3694  N  NZ    . LYS B  2  54  ? 85.348  61.834  76.204  1.00 104.34 ? 52   LYS B NZ    1 
ATOM   3695  N  N     . ALA B  2  55  ? 78.751  67.301  78.383  1.00 95.49  ? 53   ALA B N     1 
ATOM   3696  C  CA    . ALA B  2  55  ? 77.821  67.643  79.456  1.00 94.01  ? 53   ALA B CA    1 
ATOM   3697  C  C     . ALA B  2  55  ? 76.463  67.030  79.082  1.00 93.14  ? 53   ALA B C     1 
ATOM   3698  O  O     . ALA B  2  55  ? 76.333  66.401  78.032  1.00 92.58  ? 53   ALA B O     1 
ATOM   3699  C  CB    . ALA B  2  55  ? 77.706  69.152  79.586  1.00 93.88  ? 53   ALA B CB    1 
ATOM   3700  N  N     . GLY B  2  56  ? 75.452  67.199  79.927  1.00 92.38  ? 54   GLY B N     1 
ATOM   3701  C  CA    . GLY B  2  56  ? 74.158  66.627  79.600  1.00 91.88  ? 54   GLY B CA    1 
ATOM   3702  C  C     . GLY B  2  56  ? 73.253  66.444  80.794  1.00 91.73  ? 54   GLY B C     1 
ATOM   3703  O  O     . GLY B  2  56  ? 73.586  66.862  81.897  1.00 90.83  ? 54   GLY B O     1 
ATOM   3704  N  N     . SER B  2  57  ? 72.114  65.795  80.577  1.00 92.71  ? 55   SER B N     1 
ATOM   3705  C  CA    . SER B  2  57  ? 71.136  65.582  81.640  1.00 94.40  ? 55   SER B CA    1 
ATOM   3706  C  C     . SER B  2  57  ? 71.267  64.255  82.375  1.00 95.02  ? 55   SER B C     1 
ATOM   3707  O  O     . SER B  2  57  ? 70.313  63.791  83.012  1.00 93.68  ? 55   SER B O     1 
ATOM   3708  C  CB    . SER B  2  57  ? 69.724  65.686  81.077  1.00 95.02  ? 55   SER B CB    1 
ATOM   3709  O  OG    . SER B  2  57  ? 69.456  64.563  80.258  1.00 96.81  ? 55   SER B OG    1 
ATOM   3710  N  N     . ARG B  2  58  ? 72.442  63.642  82.283  1.00 96.62  ? 56   ARG B N     1 
ATOM   3711  C  CA    . ARG B  2  58  ? 72.681  62.378  82.970  1.00 98.40  ? 56   ARG B CA    1 
ATOM   3712  C  C     . ARG B  2  58  ? 73.578  62.624  84.195  1.00 99.21  ? 56   ARG B C     1 
ATOM   3713  O  O     . ARG B  2  58  ? 73.588  61.841  85.155  1.00 99.26  ? 56   ARG B O     1 
ATOM   3714  C  CB    . ARG B  2  58  ? 73.335  61.373  82.022  1.00 98.04  ? 56   ARG B CB    1 
ATOM   3715  C  CG    . ARG B  2  58  ? 74.760  61.713  81.647  1.00 97.79  ? 56   ARG B CG    1 
ATOM   3716  C  CD    . ARG B  2  58  ? 75.339  60.620  80.787  1.00 97.83  ? 56   ARG B CD    1 
ATOM   3717  N  NE    . ARG B  2  58  ? 75.165  59.331  81.437  1.00 97.51  ? 56   ARG B NE    1 
ATOM   3718  C  CZ    . ARG B  2  58  ? 75.167  58.171  80.801  1.00 97.33  ? 56   ARG B CZ    1 
ATOM   3719  N  NH1   . ARG B  2  58  ? 75.336  58.140  79.486  1.00 97.25  ? 56   ARG B NH1   1 
ATOM   3720  N  NH2   . ARG B  2  58  ? 74.987  57.049  81.483  1.00 97.77  ? 56   ARG B NH2   1 
ATOM   3721  N  N     . TYR B  2  59  ? 74.323  63.725  84.155  1.00 99.76  ? 57   TYR B N     1 
ATOM   3722  C  CA    . TYR B  2  59  ? 75.205  64.105  85.255  1.00 100.29 ? 57   TYR B CA    1 
ATOM   3723  C  C     . TYR B  2  59  ? 74.377  64.791  86.343  1.00 99.89  ? 57   TYR B C     1 
ATOM   3724  O  O     . TYR B  2  59  ? 74.908  65.362  87.299  1.00 98.52  ? 57   TYR B O     1 
ATOM   3725  C  CB    . TYR B  2  59  ? 76.283  65.054  84.739  1.00 101.70 ? 57   TYR B CB    1 
ATOM   3726  C  CG    . TYR B  2  59  ? 77.033  64.503  83.551  1.00 103.80 ? 57   TYR B CG    1 
ATOM   3727  C  CD1   . TYR B  2  59  ? 76.405  64.344  82.323  1.00 104.81 ? 57   TYR B CD1   1 
ATOM   3728  C  CD2   . TYR B  2  59  ? 78.364  64.104  83.665  1.00 105.18 ? 57   TYR B CD2   1 
ATOM   3729  C  CE1   . TYR B  2  59  ? 77.081  63.798  81.231  1.00 106.15 ? 57   TYR B CE1   1 
ATOM   3730  C  CE2   . TYR B  2  59  ? 79.051  63.553  82.581  1.00 106.17 ? 57   TYR B CE2   1 
ATOM   3731  C  CZ    . TYR B  2  59  ? 78.402  63.403  81.366  1.00 106.47 ? 57   TYR B CZ    1 
ATOM   3732  O  OH    . TYR B  2  59  ? 79.065  62.861  80.284  1.00 107.40 ? 57   TYR B OH    1 
ATOM   3733  N  N     . GLU B  2  60  ? 73.062  64.722  86.173  1.00 100.21 ? 58   GLU B N     1 
ATOM   3734  C  CA    . GLU B  2  60  ? 72.118  65.323  87.099  1.00 100.30 ? 58   GLU B CA    1 
ATOM   3735  C  C     . GLU B  2  60  ? 71.720  64.346  88.194  1.00 99.23  ? 58   GLU B C     1 
ATOM   3736  O  O     . GLU B  2  60  ? 71.416  63.180  87.927  1.00 98.10  ? 58   GLU B O     1 
ATOM   3737  C  CB    . GLU B  2  60  ? 70.851  65.789  86.348  1.00 102.66 ? 58   GLU B CB    1 
ATOM   3738  C  CG    . GLU B  2  60  ? 70.845  67.265  85.857  1.00 105.06 ? 58   GLU B CG    1 
ATOM   3739  C  CD    . GLU B  2  60  ? 69.591  67.632  85.040  1.00 106.10 ? 58   GLU B CD    1 
ATOM   3740  O  OE1   . GLU B  2  60  ? 68.488  67.168  85.405  1.00 107.11 ? 58   GLU B OE1   1 
ATOM   3741  O  OE2   . GLU B  2  60  ? 69.706  68.390  84.044  1.00 105.67 ? 58   GLU B OE2   1 
ATOM   3742  N  N     . THR B  2  61  ? 71.735  64.839  89.429  1.00 99.00  ? 59   THR B N     1 
ATOM   3743  C  CA    . THR B  2  61  ? 71.347  64.055  90.603  1.00 98.50  ? 59   THR B CA    1 
ATOM   3744  C  C     . THR B  2  61  ? 69.936  64.507  90.963  1.00 97.65  ? 59   THR B C     1 
ATOM   3745  O  O     . THR B  2  61  ? 69.476  65.561  90.514  1.00 97.60  ? 59   THR B O     1 
ATOM   3746  C  CB    . THR B  2  61  ? 72.236  64.353  91.845  1.00 98.79  ? 59   THR B CB    1 
ATOM   3747  O  OG1   . THR B  2  61  ? 73.617  64.309  91.480  1.00 99.31  ? 59   THR B OG1   1 
ATOM   3748  C  CG2   . THR B  2  61  ? 71.973  63.328  92.955  1.00 97.74  ? 59   THR B CG2   1 
ATOM   3749  N  N     . THR B  2  62  ? 69.259  63.724  91.791  1.00 96.36  ? 60   THR B N     1 
ATOM   3750  C  CA    . THR B  2  62  ? 67.909  64.073  92.209  1.00 94.88  ? 60   THR B CA    1 
ATOM   3751  C  C     . THR B  2  62  ? 67.942  65.395  92.957  1.00 93.38  ? 60   THR B C     1 
ATOM   3752  O  O     . THR B  2  62  ? 66.907  65.961  93.290  1.00 93.30  ? 60   THR B O     1 
ATOM   3753  C  CB    . THR B  2  62  ? 67.334  63.025  93.160  1.00 95.25  ? 60   THR B CB    1 
ATOM   3754  O  OG1   . THR B  2  62  ? 65.933  63.259  93.329  1.00 96.10  ? 60   THR B OG1   1 
ATOM   3755  C  CG2   . THR B  2  62  ? 68.011  63.121  94.522  1.00 94.66  ? 60   THR B CG2   1 
ATOM   3756  N  N     . ALA B  2  63  ? 69.146  65.874  93.223  1.00 91.78  ? 61   ALA B N     1 
ATOM   3757  C  CA    . ALA B  2  63  ? 69.327  67.111  93.950  1.00 90.16  ? 61   ALA B CA    1 
ATOM   3758  C  C     . ALA B  2  63  ? 69.445  68.337  93.053  1.00 89.38  ? 61   ALA B C     1 
ATOM   3759  O  O     . ALA B  2  63  ? 69.071  69.436  93.466  1.00 88.90  ? 61   ALA B O     1 
ATOM   3760  C  CB    . ALA B  2  63  ? 70.546  66.992  94.833  1.00 90.84  ? 61   ALA B CB    1 
ATOM   3761  N  N     . ASN B  2  64  ? 69.969  68.161  91.838  1.00 88.39  ? 62   ASN B N     1 
ATOM   3762  C  CA    . ASN B  2  64  ? 70.118  69.288  90.911  1.00 87.68  ? 62   ASN B CA    1 
ATOM   3763  C  C     . ASN B  2  64  ? 69.523  69.006  89.526  1.00 87.86  ? 62   ASN B C     1 
ATOM   3764  O  O     . ASN B  2  64  ? 70.048  69.443  88.503  1.00 87.26  ? 62   ASN B O     1 
ATOM   3765  C  CB    . ASN B  2  64  ? 71.594  69.691  90.785  1.00 85.96  ? 62   ASN B CB    1 
ATOM   3766  C  CG    . ASN B  2  64  ? 72.341  68.874  89.761  1.00 85.20  ? 62   ASN B CG    1 
ATOM   3767  O  OD1   . ASN B  2  64  ? 72.204  67.656  89.701  1.00 85.35  ? 62   ASN B OD1   1 
ATOM   3768  N  ND2   . ASN B  2  64  ? 73.152  69.543  88.954  1.00 84.81  ? 62   ASN B ND2   1 
ATOM   3769  N  N     . LEU B  2  65  ? 68.405  68.286  89.515  1.00 88.04  ? 63   LEU B N     1 
ATOM   3770  C  CA    . LEU B  2  65  ? 67.709  67.944  88.281  1.00 88.18  ? 63   LEU B CA    1 
ATOM   3771  C  C     . LEU B  2  65  ? 67.498  69.164  87.399  1.00 89.45  ? 63   LEU B C     1 
ATOM   3772  O  O     . LEU B  2  65  ? 67.665  70.300  87.838  1.00 88.84  ? 63   LEU B O     1 
ATOM   3773  C  CB    . LEU B  2  65  ? 66.344  67.323  88.599  1.00 86.57  ? 63   LEU B CB    1 
ATOM   3774  C  CG    . LEU B  2  65  ? 66.275  65.905  89.169  1.00 84.75  ? 63   LEU B CG    1 
ATOM   3775  C  CD1   . LEU B  2  65  ? 64.931  65.637  89.810  1.00 82.92  ? 63   LEU B CD1   1 
ATOM   3776  C  CD2   . LEU B  2  65  ? 66.518  64.925  88.046  1.00 84.21  ? 63   LEU B CD2   1 
ATOM   3777  N  N     . GLY B  2  66  ? 67.119  68.900  86.153  1.00 91.80  ? 64   GLY B N     1 
ATOM   3778  C  CA    . GLY B  2  66  ? 66.852  69.939  85.171  1.00 94.21  ? 64   GLY B CA    1 
ATOM   3779  C  C     . GLY B  2  66  ? 67.876  71.041  84.941  1.00 95.27  ? 64   GLY B C     1 
ATOM   3780  O  O     . GLY B  2  66  ? 67.849  71.682  83.885  1.00 95.80  ? 64   GLY B O     1 
ATOM   3781  N  N     . THR B  2  67  ? 68.774  71.266  85.902  1.00 95.14  ? 65   THR B N     1 
ATOM   3782  C  CA    . THR B  2  67  ? 69.776  72.327  85.786  1.00 94.60  ? 65   THR B CA    1 
ATOM   3783  C  C     . THR B  2  67  ? 70.500  72.349  84.437  1.00 94.29  ? 65   THR B C     1 
ATOM   3784  O  O     . THR B  2  67  ? 71.069  73.380  84.039  1.00 93.13  ? 65   THR B O     1 
ATOM   3785  C  CB    . THR B  2  67  ? 70.806  72.231  86.915  1.00 94.54  ? 65   THR B CB    1 
ATOM   3786  O  OG1   . THR B  2  67  ? 71.737  73.314  86.800  1.00 94.88  ? 65   THR B OG1   1 
ATOM   3787  C  CG2   . THR B  2  67  ? 71.543  70.918  86.840  1.00 95.71  ? 65   THR B CG2   1 
ATOM   3788  N  N     . ALA B  2  68  ? 70.480  71.208  83.743  1.00 94.30  ? 66   ALA B N     1 
ATOM   3789  C  CA    . ALA B  2  68  ? 71.097  71.093  82.420  1.00 94.37  ? 66   ALA B CA    1 
ATOM   3790  C  C     . ALA B  2  68  ? 70.294  72.026  81.536  1.00 93.92  ? 66   ALA B C     1 
ATOM   3791  O  O     . ALA B  2  68  ? 70.770  73.074  81.075  1.00 93.98  ? 66   ALA B O     1 
ATOM   3792  C  CB    . ALA B  2  68  ? 70.971  69.659  81.895  1.00 94.27  ? 66   ALA B CB    1 
ATOM   3793  N  N     . HIS B  2  69  ? 69.056  71.595  81.323  1.00 92.69  ? 67   HIS B N     1 
ATOM   3794  C  CA    . HIS B  2  69  ? 68.040  72.291  80.546  1.00 90.55  ? 67   HIS B CA    1 
ATOM   3795  C  C     . HIS B  2  69  ? 68.152  73.816  80.683  1.00 88.27  ? 67   HIS B C     1 
ATOM   3796  O  O     . HIS B  2  69  ? 68.289  74.549  79.698  1.00 86.17  ? 67   HIS B O     1 
ATOM   3797  C  CB    . HIS B  2  69  ? 66.682  71.799  81.053  1.00 91.03  ? 67   HIS B CB    1 
ATOM   3798  C  CG    . HIS B  2  69  ? 65.512  72.326  80.294  1.00 90.45  ? 67   HIS B CG    1 
ATOM   3799  N  ND1   . HIS B  2  69  ? 64.229  71.879  80.518  1.00 89.74  ? 67   HIS B ND1   1 
ATOM   3800  C  CD2   . HIS B  2  69  ? 65.425  73.267  79.328  1.00 90.31  ? 67   HIS B CD2   1 
ATOM   3801  C  CE1   . HIS B  2  69  ? 63.399  72.524  79.721  1.00 90.52  ? 67   HIS B CE1   1 
ATOM   3802  N  NE2   . HIS B  2  69  ? 64.100  73.372  78.989  1.00 91.25  ? 67   HIS B NE2   1 
ATOM   3803  N  N     . LEU B  2  70  ? 68.089  74.273  81.927  1.00 86.64  ? 68   LEU B N     1 
ATOM   3804  C  CA    . LEU B  2  70  ? 68.175  75.687  82.232  1.00 85.08  ? 68   LEU B CA    1 
ATOM   3805  C  C     . LEU B  2  70  ? 69.449  76.241  81.663  1.00 84.00  ? 68   LEU B C     1 
ATOM   3806  O  O     . LEU B  2  70  ? 69.433  77.207  80.908  1.00 84.29  ? 68   LEU B O     1 
ATOM   3807  C  CB    . LEU B  2  70  ? 68.163  75.905  83.736  1.00 84.41  ? 68   LEU B CB    1 
ATOM   3808  C  CG    . LEU B  2  70  ? 68.163  77.374  84.126  1.00 84.25  ? 68   LEU B CG    1 
ATOM   3809  C  CD1   . LEU B  2  70  ? 67.027  78.108  83.433  1.00 83.24  ? 68   LEU B CD1   1 
ATOM   3810  C  CD2   . LEU B  2  70  ? 68.018  77.466  85.626  1.00 85.56  ? 68   LEU B CD2   1 
ATOM   3811  N  N     . LEU B  2  71  ? 70.560  75.623  82.040  1.00 82.92  ? 69   LEU B N     1 
ATOM   3812  C  CA    . LEU B  2  71  ? 71.857  76.051  81.556  1.00 81.52  ? 69   LEU B CA    1 
ATOM   3813  C  C     . LEU B  2  71  ? 71.793  76.288  80.057  1.00 80.12  ? 69   LEU B C     1 
ATOM   3814  O  O     . LEU B  2  71  ? 72.424  77.209  79.522  1.00 78.74  ? 69   LEU B O     1 
ATOM   3815  C  CB    . LEU B  2  71  ? 72.905  74.985  81.852  1.00 81.02  ? 69   LEU B CB    1 
ATOM   3816  C  CG    . LEU B  2  71  ? 74.199  75.251  81.086  1.00 81.19  ? 69   LEU B CG    1 
ATOM   3817  C  CD1   . LEU B  2  71  ? 74.763  76.617  81.450  1.00 80.22  ? 69   LEU B CD1   1 
ATOM   3818  C  CD2   . LEU B  2  71  ? 75.188  74.156  81.397  1.00 83.26  ? 69   LEU B CD2   1 
ATOM   3819  N  N     . ARG B  2  72  ? 71.011  75.448  79.390  1.00 78.95  ? 70   ARG B N     1 
ATOM   3820  C  CA    . ARG B  2  72  ? 70.859  75.533  77.951  1.00 78.52  ? 70   ARG B CA    1 
ATOM   3821  C  C     . ARG B  2  72  ? 70.253  76.849  77.537  1.00 78.46  ? 70   ARG B C     1 
ATOM   3822  O  O     . ARG B  2  72  ? 70.707  77.476  76.582  1.00 78.18  ? 70   ARG B O     1 
ATOM   3823  C  CB    . ARG B  2  72  ? 69.989  74.388  77.444  1.00 78.16  ? 70   ARG B CB    1 
ATOM   3824  C  CG    . ARG B  2  72  ? 69.864  74.351  75.941  1.00 76.95  ? 70   ARG B CG    1 
ATOM   3825  C  CD    . ARG B  2  72  ? 69.361  72.999  75.448  1.00 77.02  ? 70   ARG B CD    1 
ATOM   3826  N  NE    . ARG B  2  72  ? 67.962  72.719  75.765  1.00 76.59  ? 70   ARG B NE    1 
ATOM   3827  C  CZ    . ARG B  2  72  ? 67.563  71.830  76.667  1.00 77.58  ? 70   ARG B CZ    1 
ATOM   3828  N  NH1   . ARG B  2  72  ? 68.456  71.128  77.358  1.00 77.96  ? 70   ARG B NH1   1 
ATOM   3829  N  NH2   . ARG B  2  72  ? 66.269  71.628  76.866  1.00 78.13  ? 70   ARG B NH2   1 
ATOM   3830  N  N     . LEU B  2  73  ? 69.222  77.264  78.263  1.00 78.47  ? 71   LEU B N     1 
ATOM   3831  C  CA    . LEU B  2  73  ? 68.539  78.515  77.962  1.00 78.25  ? 71   LEU B CA    1 
ATOM   3832  C  C     . LEU B  2  73  ? 69.343  79.715  78.451  1.00 77.68  ? 71   LEU B C     1 
ATOM   3833  O  O     . LEU B  2  73  ? 69.292  80.790  77.855  1.00 78.04  ? 71   LEU B O     1 
ATOM   3834  C  CB    . LEU B  2  73  ? 67.160  78.536  78.626  1.00 78.45  ? 71   LEU B CB    1 
ATOM   3835  C  CG    . LEU B  2  73  ? 66.316  77.257  78.616  1.00 78.53  ? 71   LEU B CG    1 
ATOM   3836  C  CD1   . LEU B  2  73  ? 64.887  77.603  79.022  1.00 79.04  ? 71   LEU B CD1   1 
ATOM   3837  C  CD2   . LEU B  2  73  ? 66.316  76.632  77.242  1.00 78.21  ? 71   LEU B CD2   1 
ATOM   3838  N  N     . ALA B  2  74  ? 70.080  79.515  79.538  1.00 76.18  ? 72   ALA B N     1 
ATOM   3839  C  CA    . ALA B  2  74  ? 70.880  80.562  80.141  1.00 74.38  ? 72   ALA B CA    1 
ATOM   3840  C  C     . ALA B  2  74  ? 72.004  81.042  79.235  1.00 74.30  ? 72   ALA B C     1 
ATOM   3841  O  O     . ALA B  2  74  ? 72.749  81.947  79.594  1.00 74.04  ? 72   ALA B O     1 
ATOM   3842  C  CB    . ALA B  2  74  ? 71.434  80.065  81.447  1.00 73.18  ? 72   ALA B CB    1 
ATOM   3843  N  N     . SER B  2  75  ? 72.119  80.443  78.056  1.00 74.59  ? 73   SER B N     1 
ATOM   3844  C  CA    . SER B  2  75  ? 73.155  80.817  77.099  1.00 75.71  ? 73   SER B CA    1 
ATOM   3845  C  C     . SER B  2  75  ? 73.371  82.322  76.904  1.00 77.33  ? 73   SER B C     1 
ATOM   3846  O  O     . SER B  2  75  ? 74.473  82.821  77.094  1.00 77.80  ? 73   SER B O     1 
ATOM   3847  C  CB    . SER B  2  75  ? 72.853  80.168  75.760  1.00 74.50  ? 73   SER B CB    1 
ATOM   3848  O  OG    . SER B  2  75  ? 71.478  79.863  75.692  1.00 74.87  ? 73   SER B OG    1 
ATOM   3849  N  N     . PRO B  2  76  ? 72.322  83.068  76.538  1.00 79.27  ? 74   PRO B N     1 
ATOM   3850  C  CA    . PRO B  2  76  ? 72.428  84.519  76.320  1.00 80.40  ? 74   PRO B CA    1 
ATOM   3851  C  C     . PRO B  2  76  ? 72.804  85.342  77.543  1.00 81.42  ? 74   PRO B C     1 
ATOM   3852  O  O     . PRO B  2  76  ? 72.993  86.552  77.437  1.00 80.70  ? 74   PRO B O     1 
ATOM   3853  C  CB    . PRO B  2  76  ? 71.043  84.888  75.811  1.00 80.40  ? 74   PRO B CB    1 
ATOM   3854  C  CG    . PRO B  2  76  ? 70.167  83.936  76.570  1.00 80.74  ? 74   PRO B CG    1 
ATOM   3855  C  CD    . PRO B  2  76  ? 70.918  82.631  76.448  1.00 80.08  ? 74   PRO B CD    1 
ATOM   3856  N  N     . LEU B  2  77  ? 72.906  84.680  78.693  1.00 83.37  ? 75   LEU B N     1 
ATOM   3857  C  CA    . LEU B  2  77  ? 73.233  85.342  79.952  1.00 85.68  ? 75   LEU B CA    1 
ATOM   3858  C  C     . LEU B  2  77  ? 74.646  85.890  80.054  1.00 87.92  ? 75   LEU B C     1 
ATOM   3859  O  O     . LEU B  2  77  ? 75.608  85.248  79.628  1.00 88.11  ? 75   LEU B O     1 
ATOM   3860  C  CB    . LEU B  2  77  ? 72.945  84.400  81.118  1.00 84.34  ? 75   LEU B CB    1 
ATOM   3861  C  CG    . LEU B  2  77  ? 71.440  84.328  81.382  1.00 83.30  ? 75   LEU B CG    1 
ATOM   3862  C  CD1   . LEU B  2  77  ? 71.088  83.143  82.230  1.00 83.17  ? 75   LEU B CD1   1 
ATOM   3863  C  CD2   . LEU B  2  77  ? 71.009  85.605  82.061  1.00 83.29  ? 75   LEU B CD2   1 
ATOM   3864  N  N     . THR B  2  78  ? 74.741  87.087  80.636  1.00 90.72  ? 76   THR B N     1 
ATOM   3865  C  CA    . THR B  2  78  ? 75.996  87.817  80.816  1.00 93.49  ? 76   THR B CA    1 
ATOM   3866  C  C     . THR B  2  78  ? 77.215  86.975  81.184  1.00 95.54  ? 76   THR B C     1 
ATOM   3867  O  O     . THR B  2  78  ? 77.106  85.970  81.892  1.00 95.98  ? 76   THR B O     1 
ATOM   3868  C  CB    . THR B  2  78  ? 75.839  88.947  81.866  1.00 92.99  ? 76   THR B CB    1 
ATOM   3869  O  OG1   . THR B  2  78  ? 75.090  88.462  82.986  1.00 92.94  ? 76   THR B OG1   1 
ATOM   3870  C  CG2   . THR B  2  78  ? 75.129  90.148  81.261  1.00 92.69  ? 76   THR B CG2   1 
ATOM   3871  N  N     . THR B  2  79  ? 78.372  87.409  80.682  1.00 97.45  ? 77   THR B N     1 
ATOM   3872  C  CA    . THR B  2  79  ? 79.646  86.742  80.915  1.00 98.67  ? 77   THR B CA    1 
ATOM   3873  C  C     . THR B  2  79  ? 80.602  87.731  81.571  1.00 100.69 ? 77   THR B C     1 
ATOM   3874  O  O     . THR B  2  79  ? 80.219  88.853  81.911  1.00 100.02 ? 77   THR B O     1 
ATOM   3875  C  CB    . THR B  2  79  ? 80.283  86.257  79.590  1.00 97.72  ? 77   THR B CB    1 
ATOM   3876  O  OG1   . THR B  2  79  ? 80.735  87.388  78.839  1.00 95.25  ? 77   THR B OG1   1 
ATOM   3877  C  CG2   . THR B  2  79  ? 79.265  85.472  78.755  1.00 97.70  ? 77   THR B CG2   1 
ATOM   3878  N  N     . LYS B  2  80  ? 81.850  87.310  81.745  1.00 103.79 ? 78   LYS B N     1 
ATOM   3879  C  CA    . LYS B  2  80  ? 82.867  88.162  82.363  1.00 106.45 ? 78   LYS B CA    1 
ATOM   3880  C  C     . LYS B  2  80  ? 83.378  89.193  81.353  1.00 106.29 ? 78   LYS B C     1 
ATOM   3881  O  O     . LYS B  2  80  ? 84.028  90.175  81.733  1.00 106.32 ? 78   LYS B O     1 
ATOM   3882  C  CB    . LYS B  2  80  ? 84.062  87.319  82.878  1.00 109.08 ? 78   LYS B CB    1 
ATOM   3883  C  CG    . LYS B  2  80  ? 83.822  86.437  84.139  1.00 111.93 ? 78   LYS B CG    1 
ATOM   3884  C  CD    . LYS B  2  80  ? 85.139  85.756  84.624  1.00 113.91 ? 78   LYS B CD    1 
ATOM   3885  C  CE    . LYS B  2  80  ? 84.993  84.912  85.923  1.00 114.91 ? 78   LYS B CE    1 
ATOM   3886  N  NZ    . LYS B  2  80  ? 84.435  83.527  85.744  1.00 114.82 ? 78   LYS B NZ    1 
ATOM   3887  N  N     . GLY B  2  81  ? 83.083  88.967  80.070  1.00 105.62 ? 79   GLY B N     1 
ATOM   3888  C  CA    . GLY B  2  81  ? 83.545  89.879  79.035  1.00 104.25 ? 79   GLY B CA    1 
ATOM   3889  C  C     . GLY B  2  81  ? 82.485  90.368  78.068  1.00 103.27 ? 79   GLY B C     1 
ATOM   3890  O  O     . GLY B  2  81  ? 82.753  91.221  77.220  1.00 101.67 ? 79   GLY B O     1 
ATOM   3891  N  N     . ALA B  2  82  ? 81.278  89.832  78.189  1.00 103.57 ? 80   ALA B N     1 
ATOM   3892  C  CA    . ALA B  2  82  ? 80.193  90.239  77.305  1.00 103.91 ? 80   ALA B CA    1 
ATOM   3893  C  C     . ALA B  2  82  ? 78.843  90.383  78.008  1.00 103.81 ? 80   ALA B C     1 
ATOM   3894  O  O     . ALA B  2  82  ? 78.356  89.447  78.645  1.00 103.73 ? 80   ALA B O     1 
ATOM   3895  C  CB    . ALA B  2  82  ? 80.071  89.260  76.159  1.00 104.52 ? 80   ALA B CB    1 
ATOM   3896  N  N     . SER B  2  83  ? 78.248  91.567  77.869  1.00 103.26 ? 81   SER B N     1 
ATOM   3897  C  CA    . SER B  2  83  ? 76.954  91.891  78.463  1.00 102.04 ? 81   SER B CA    1 
ATOM   3898  C  C     . SER B  2  83  ? 75.826  91.201  77.703  1.00 101.58 ? 81   SER B C     1 
ATOM   3899  O  O     . SER B  2  83  ? 75.802  91.222  76.468  1.00 101.69 ? 81   SER B O     1 
ATOM   3900  C  CB    . SER B  2  83  ? 76.742  93.405  78.423  1.00 101.96 ? 81   SER B CB    1 
ATOM   3901  O  OG    . SER B  2  83  ? 76.928  93.910  77.107  1.00 100.87 ? 81   SER B OG    1 
ATOM   3902  N  N     . SER B  2  84  ? 74.892  90.597  78.438  1.00 100.39 ? 82   SER B N     1 
ATOM   3903  C  CA    . SER B  2  84  ? 73.755  89.906  77.824  1.00 98.86  ? 82   SER B CA    1 
ATOM   3904  C  C     . SER B  2  84  ? 73.291  90.705  76.622  1.00 97.11  ? 82   SER B C     1 
ATOM   3905  O  O     . SER B  2  84  ? 72.761  90.160  75.650  1.00 96.20  ? 82   SER B O     1 
ATOM   3906  C  CB    . SER B  2  84  ? 72.597  89.782  78.813  1.00 99.45  ? 82   SER B CB    1 
ATOM   3907  O  OG    . SER B  2  84  ? 71.434  89.304  78.153  1.00 100.24 ? 82   SER B OG    1 
ATOM   3908  N  N     . PHE B  2  85  ? 73.498  92.013  76.722  1.00 95.30  ? 83   PHE B N     1 
ATOM   3909  C  CA    . PHE B  2  85  ? 73.149  92.947  75.676  1.00 93.52  ? 83   PHE B CA    1 
ATOM   3910  C  C     . PHE B  2  85  ? 74.117  92.757  74.515  1.00 93.45  ? 83   PHE B C     1 
ATOM   3911  O  O     . PHE B  2  85  ? 73.776  92.175  73.480  1.00 93.88  ? 83   PHE B O     1 
ATOM   3912  C  CB    . PHE B  2  85  ? 73.254  94.382  76.204  1.00 91.66  ? 83   PHE B CB    1 
ATOM   3913  C  CG    . PHE B  2  85  ? 72.947  95.434  75.170  1.00 90.43  ? 83   PHE B CG    1 
ATOM   3914  C  CD1   . PHE B  2  85  ? 71.665  95.589  74.671  1.00 90.20  ? 83   PHE B CD1   1 
ATOM   3915  C  CD2   . PHE B  2  85  ? 73.947  96.267  74.689  1.00 89.89  ? 83   PHE B CD2   1 
ATOM   3916  C  CE1   . PHE B  2  85  ? 71.391  96.555  73.712  1.00 89.22  ? 83   PHE B CE1   1 
ATOM   3917  C  CE2   . PHE B  2  85  ? 73.676  97.236  73.728  1.00 87.92  ? 83   PHE B CE2   1 
ATOM   3918  C  CZ    . PHE B  2  85  ? 72.403  97.379  73.243  1.00 88.22  ? 83   PHE B CZ    1 
ATOM   3919  N  N     . ARG B  2  86  ? 75.340  93.235  74.704  1.00 92.84  ? 84   ARG B N     1 
ATOM   3920  C  CA    . ARG B  2  86  ? 76.344  93.148  73.659  1.00 91.70  ? 84   ARG B CA    1 
ATOM   3921  C  C     . ARG B  2  86  ? 76.350  91.809  72.957  1.00 90.06  ? 84   ARG B C     1 
ATOM   3922  O  O     . ARG B  2  86  ? 76.595  91.755  71.763  1.00 88.59  ? 84   ARG B O     1 
ATOM   3923  C  CB    . ARG B  2  86  ? 77.730  93.464  74.222  1.00 93.17  ? 84   ARG B CB    1 
ATOM   3924  C  CG    . ARG B  2  86  ? 78.843  93.411  73.190  1.00 95.66  ? 84   ARG B CG    1 
ATOM   3925  C  CD    . ARG B  2  86  ? 79.900  94.461  73.489  1.00 98.72  ? 84   ARG B CD    1 
ATOM   3926  N  NE    . ARG B  2  86  ? 81.254  94.000  73.192  1.00 101.41 ? 84   ARG B NE    1 
ATOM   3927  C  CZ    . ARG B  2  86  ? 81.879  93.026  73.855  1.00 102.60 ? 84   ARG B CZ    1 
ATOM   3928  N  NH1   . ARG B  2  86  ? 81.279  92.393  74.861  1.00 102.28 ? 84   ARG B NH1   1 
ATOM   3929  N  NH2   . ARG B  2  86  ? 83.119  92.694  73.521  1.00 103.29 ? 84   ARG B NH2   1 
ATOM   3930  N  N     . ILE B  2  87  ? 76.064  90.732  73.680  1.00 89.24  ? 85   ILE B N     1 
ATOM   3931  C  CA    . ILE B  2  87  ? 76.066  89.428  73.041  1.00 89.34  ? 85   ILE B CA    1 
ATOM   3932  C  C     . ILE B  2  87  ? 75.042  89.440  71.937  1.00 89.50  ? 85   ILE B C     1 
ATOM   3933  O  O     . ILE B  2  87  ? 75.383  89.478  70.763  1.00 90.06  ? 85   ILE B O     1 
ATOM   3934  C  CB    . ILE B  2  87  ? 75.707  88.291  73.998  1.00 89.21  ? 85   ILE B CB    1 
ATOM   3935  C  CG1   . ILE B  2  87  ? 76.724  88.233  75.139  1.00 89.86  ? 85   ILE B CG1   1 
ATOM   3936  C  CG2   . ILE B  2  87  ? 75.683  86.969  73.228  1.00 88.28  ? 85   ILE B CG2   1 
ATOM   3937  C  CD1   . ILE B  2  87  ? 76.403  87.196  76.217  1.00 90.50  ? 85   ILE B CD1   1 
ATOM   3938  N  N     . THR B  2  88  ? 73.776  89.426  72.316  1.00 89.45  ? 86   THR B N     1 
ATOM   3939  C  CA    . THR B  2  88  ? 72.726  89.418  71.322  1.00 89.00  ? 86   THR B CA    1 
ATOM   3940  C  C     . THR B  2  88  ? 72.920  90.533  70.297  1.00 88.14  ? 86   THR B C     1 
ATOM   3941  O  O     . THR B  2  88  ? 72.793  90.301  69.104  1.00 87.95  ? 86   THR B O     1 
ATOM   3942  C  CB    . THR B  2  88  ? 71.337  89.548  71.977  1.00 89.47  ? 86   THR B CB    1 
ATOM   3943  O  OG1   . THR B  2  88  ? 71.175  88.528  72.978  1.00 89.15  ? 86   THR B OG1   1 
ATOM   3944  C  CG2   . THR B  2  88  ? 70.245  89.401  70.924  1.00 89.49  ? 86   THR B CG2   1 
ATOM   3945  N  N     . ARG B  2  89  ? 73.249  91.736  70.741  1.00 87.48  ? 87   ARG B N     1 
ATOM   3946  C  CA    . ARG B  2  89  ? 73.425  92.814  69.781  1.00 88.73  ? 87   ARG B CA    1 
ATOM   3947  C  C     . ARG B  2  89  ? 74.656  92.622  68.921  1.00 90.06  ? 87   ARG B C     1 
ATOM   3948  O  O     . ARG B  2  89  ? 74.707  93.068  67.769  1.00 89.77  ? 87   ARG B O     1 
ATOM   3949  C  CB    . ARG B  2  89  ? 73.523  94.162  70.486  1.00 88.60  ? 87   ARG B CB    1 
ATOM   3950  C  CG    . ARG B  2  89  ? 72.204  94.729  70.935  1.00 87.86  ? 87   ARG B CG    1 
ATOM   3951  C  CD    . ARG B  2  89  ? 71.238  94.864  69.781  1.00 87.31  ? 87   ARG B CD    1 
ATOM   3952  N  NE    . ARG B  2  89  ? 69.938  95.281  70.279  1.00 87.64  ? 87   ARG B NE    1 
ATOM   3953  C  CZ    . ARG B  2  89  ? 69.693  96.482  70.784  1.00 88.14  ? 87   ARG B CZ    1 
ATOM   3954  N  NH1   . ARG B  2  89  ? 70.665  97.382  70.841  1.00 87.50  ? 87   ARG B NH1   1 
ATOM   3955  N  NH2   . ARG B  2  89  ? 68.487  96.776  71.256  1.00 89.22  ? 87   ARG B NH2   1 
ATOM   3956  N  N     . GLY B  2  90  ? 75.656  91.962  69.490  1.00 91.36  ? 88   GLY B N     1 
ATOM   3957  C  CA    . GLY B  2  90  ? 76.891  91.731  68.762  1.00 93.27  ? 88   GLY B CA    1 
ATOM   3958  C  C     . GLY B  2  90  ? 76.754  90.725  67.637  1.00 93.91  ? 88   GLY B C     1 
ATOM   3959  O  O     . GLY B  2  90  ? 77.161  90.989  66.505  1.00 94.06  ? 88   GLY B O     1 
ATOM   3960  N  N     . ILE B  2  91  ? 76.183  89.567  67.956  1.00 94.61  ? 89   ILE B N     1 
ATOM   3961  C  CA    . ILE B  2  91  ? 75.982  88.510  66.976  1.00 95.33  ? 89   ILE B CA    1 
ATOM   3962  C  C     . ILE B  2  91  ? 74.949  88.947  65.936  1.00 97.01  ? 89   ILE B C     1 
ATOM   3963  O  O     . ILE B  2  91  ? 75.064  88.602  64.756  1.00 97.38  ? 89   ILE B O     1 
ATOM   3964  C  CB    . ILE B  2  91  ? 75.503  87.208  67.655  1.00 94.12  ? 89   ILE B CB    1 
ATOM   3965  C  CG1   . ILE B  2  91  ? 76.508  86.782  68.726  1.00 93.66  ? 89   ILE B CG1   1 
ATOM   3966  C  CG2   . ILE B  2  91  ? 75.346  86.109  66.619  1.00 93.43  ? 89   ILE B CG2   1 
ATOM   3967  C  CD1   . ILE B  2  91  ? 76.094  85.557  69.529  1.00 92.66  ? 89   ILE B CD1   1 
ATOM   3968  N  N     . GLU B  2  92  ? 73.948  89.712  66.373  1.00 98.42  ? 90   GLU B N     1 
ATOM   3969  C  CA    . GLU B  2  92  ? 72.904  90.190  65.465  1.00 99.27  ? 90   GLU B CA    1 
ATOM   3970  C  C     . GLU B  2  92  ? 73.466  91.230  64.502  1.00 98.32  ? 90   GLU B C     1 
ATOM   3971  O  O     . GLU B  2  92  ? 73.048  91.301  63.346  1.00 98.05  ? 90   GLU B O     1 
ATOM   3972  C  CB    . GLU B  2  92  ? 71.712  90.788  66.247  1.00 101.19 ? 90   GLU B CB    1 
ATOM   3973  C  CG    . GLU B  2  92  ? 70.912  89.758  67.071  1.00 104.57 ? 90   GLU B CG    1 
ATOM   3974  C  CD    . GLU B  2  92  ? 69.392  89.819  66.859  1.00 106.21 ? 90   GLU B CD    1 
ATOM   3975  O  OE1   . GLU B  2  92  ? 68.752  90.798  67.312  1.00 107.02 ? 90   GLU B OE1   1 
ATOM   3976  O  OE2   . GLU B  2  92  ? 68.839  88.875  66.239  1.00 107.24 ? 90   GLU B OE2   1 
ATOM   3977  N  N     . ALA B  2  93  ? 74.426  92.016  64.984  1.00 97.18  ? 91   ALA B N     1 
ATOM   3978  C  CA    . ALA B  2  93  ? 75.055  93.069  64.194  1.00 96.59  ? 91   ALA B CA    1 
ATOM   3979  C  C     . ALA B  2  93  ? 75.801  92.592  62.946  1.00 96.42  ? 91   ALA B C     1 
ATOM   3980  O  O     . ALA B  2  93  ? 76.243  93.406  62.141  1.00 95.80  ? 91   ALA B O     1 
ATOM   3981  C  CB    . ALA B  2  93  ? 75.996  93.858  65.076  1.00 96.35  ? 91   ALA B CB    1 
ATOM   3982  N  N     . VAL B  2  94  ? 75.937  91.281  62.778  1.00 96.67  ? 92   VAL B N     1 
ATOM   3983  C  CA    . VAL B  2  94  ? 76.652  90.733  61.626  1.00 96.76  ? 92   VAL B CA    1 
ATOM   3984  C  C     . VAL B  2  94  ? 75.886  89.585  60.986  1.00 97.12  ? 92   VAL B C     1 
ATOM   3985  O  O     . VAL B  2  94  ? 76.448  88.773  60.251  1.00 96.61  ? 92   VAL B O     1 
ATOM   3986  C  CB    . VAL B  2  94  ? 78.016  90.194  62.045  1.00 97.02  ? 92   VAL B CB    1 
ATOM   3987  C  CG1   . VAL B  2  94  ? 78.765  91.244  62.870  1.00 97.11  ? 92   VAL B CG1   1 
ATOM   3988  C  CG2   . VAL B  2  94  ? 77.827  88.903  62.835  1.00 96.89  ? 92   VAL B CG2   1 
ATOM   3989  N  N     . GLY B  2  95  ? 74.597  89.511  61.278  1.00 97.95  ? 93   GLY B N     1 
ATOM   3990  C  CA    . GLY B  2  95  ? 73.797  88.444  60.717  1.00 97.85  ? 93   GLY B CA    1 
ATOM   3991  C  C     . GLY B  2  95  ? 74.256  87.118  61.277  1.00 97.06  ? 93   GLY B C     1 
ATOM   3992  O  O     . GLY B  2  95  ? 74.222  86.097  60.595  1.00 96.67  ? 93   GLY B O     1 
ATOM   3993  N  N     . GLY B  2  96  ? 74.699  87.146  62.528  1.00 96.50  ? 94   GLY B N     1 
ATOM   3994  C  CA    . GLY B  2  96  ? 75.148  85.932  63.172  1.00 96.60  ? 94   GLY B CA    1 
ATOM   3995  C  C     . GLY B  2  96  ? 73.981  85.165  63.764  1.00 96.63  ? 94   GLY B C     1 
ATOM   3996  O  O     . GLY B  2  96  ? 72.821  85.519  63.548  1.00 96.53  ? 94   GLY B O     1 
ATOM   3997  N  N     . SER B  2  97  ? 74.294  84.105  64.502  1.00 96.74  ? 95   SER B N     1 
ATOM   3998  C  CA    . SER B  2  97  ? 73.288  83.270  65.145  1.00 97.03  ? 95   SER B CA    1 
ATOM   3999  C  C     . SER B  2  97  ? 74.012  82.471  66.194  1.00 97.22  ? 95   SER B C     1 
ATOM   4000  O  O     . SER B  2  97  ? 75.178  82.146  66.034  1.00 97.72  ? 95   SER B O     1 
ATOM   4001  C  CB    . SER B  2  97  ? 72.648  82.293  64.156  1.00 97.78  ? 95   SER B CB    1 
ATOM   4002  O  OG    . SER B  2  97  ? 73.397  81.088  64.053  1.00 98.23  ? 95   SER B OG    1 
ATOM   4003  N  N     . LEU B  2  98  ? 73.326  82.150  67.272  1.00 97.73  ? 96   LEU B N     1 
ATOM   4004  C  CA    . LEU B  2  98  ? 73.944  81.367  68.322  1.00 98.43  ? 96   LEU B CA    1 
ATOM   4005  C  C     . LEU B  2  98  ? 72.909  80.377  68.784  1.00 99.57  ? 96   LEU B C     1 
ATOM   4006  O  O     . LEU B  2  98  ? 71.783  80.750  69.109  1.00 101.43 ? 96   LEU B O     1 
ATOM   4007  C  CB    . LEU B  2  98  ? 74.362  82.253  69.488  1.00 96.92  ? 96   LEU B CB    1 
ATOM   4008  C  CG    . LEU B  2  98  ? 74.878  81.397  70.628  1.00 95.64  ? 96   LEU B CG    1 
ATOM   4009  C  CD1   . LEU B  2  98  ? 76.105  80.677  70.139  1.00 95.22  ? 96   LEU B CD1   1 
ATOM   4010  C  CD2   . LEU B  2  98  ? 75.177  82.248  71.839  1.00 95.86  ? 96   LEU B CD2   1 
ATOM   4011  N  N     . SER B  2  99  ? 73.275  79.110  68.814  1.00 99.88  ? 97   SER B N     1 
ATOM   4012  C  CA    . SER B  2  99  ? 72.316  78.108  69.229  1.00 100.36 ? 97   SER B CA    1 
ATOM   4013  C  C     . SER B  2  99  ? 72.950  77.137  70.213  1.00 100.34 ? 97   SER B C     1 
ATOM   4014  O  O     . SER B  2  99  ? 74.167  77.073  70.338  1.00 101.36 ? 97   SER B O     1 
ATOM   4015  C  CB    . SER B  2  99  ? 71.806  77.360  67.988  1.00 100.37 ? 97   SER B CB    1 
ATOM   4016  O  OG    . SER B  2  99  ? 71.505  78.260  66.930  1.00 100.37 ? 97   SER B OG    1 
ATOM   4017  N  N     . VAL B  2  100 ? 72.123  76.398  70.934  1.00 99.74  ? 98   VAL B N     1 
ATOM   4018  C  CA    . VAL B  2  100 ? 72.634  75.409  71.860  1.00 99.76  ? 98   VAL B CA    1 
ATOM   4019  C  C     . VAL B  2  100 ? 71.788  74.167  71.667  1.00 101.04 ? 98   VAL B C     1 
ATOM   4020  O  O     . VAL B  2  100 ? 70.569  74.234  71.771  1.00 102.29 ? 98   VAL B O     1 
ATOM   4021  C  CB    . VAL B  2  100 ? 72.525  75.886  73.304  1.00 98.58  ? 98   VAL B CB    1 
ATOM   4022  C  CG1   . VAL B  2  100 ? 72.929  74.774  74.251  1.00 97.72  ? 98   VAL B CG1   1 
ATOM   4023  C  CG2   . VAL B  2  100 ? 73.407  77.093  73.497  1.00 98.21  ? 98   VAL B CG2   1 
ATOM   4024  N  N     . TYR B  2  101 ? 72.426  73.046  71.341  1.00 101.87 ? 99   TYR B N     1 
ATOM   4025  C  CA    . TYR B  2  101 ? 71.712  71.784  71.141  1.00 102.57 ? 99   TYR B CA    1 
ATOM   4026  C  C     . TYR B  2  101 ? 72.319  70.774  72.104  1.00 102.31 ? 99   TYR B C     1 
ATOM   4027  O  O     . TYR B  2  101 ? 73.531  70.783  72.325  1.00 103.10 ? 99   TYR B O     1 
ATOM   4028  C  CB    . TYR B  2  101 ? 71.884  71.254  69.707  1.00 104.09 ? 99   TYR B CB    1 
ATOM   4029  C  CG    . TYR B  2  101 ? 71.660  72.253  68.586  1.00 105.71 ? 99   TYR B CG    1 
ATOM   4030  C  CD1   . TYR B  2  101 ? 72.654  73.171  68.233  1.00 106.08 ? 99   TYR B CD1   1 
ATOM   4031  C  CD2   . TYR B  2  101 ? 70.461  72.265  67.860  1.00 106.50 ? 99   TYR B CD2   1 
ATOM   4032  C  CE1   . TYR B  2  101 ? 72.462  74.078  67.181  1.00 107.18 ? 99   TYR B CE1   1 
ATOM   4033  C  CE2   . TYR B  2  101 ? 70.257  73.168  66.806  1.00 107.29 ? 99   TYR B CE2   1 
ATOM   4034  C  CZ    . TYR B  2  101 ? 71.264  74.072  66.471  1.00 107.43 ? 99   TYR B CZ    1 
ATOM   4035  O  OH    . TYR B  2  101 ? 71.079  74.966  65.432  1.00 107.26 ? 99   TYR B OH    1 
ATOM   4036  N  N     . SER B  2  102 ? 71.504  69.898  72.676  1.00 101.28 ? 100  SER B N     1 
ATOM   4037  C  CA    . SER B  2  102 ? 72.062  68.921  73.596  1.00 100.65 ? 100  SER B CA    1 
ATOM   4038  C  C     . SER B  2  102 ? 71.234  67.668  73.781  1.00 99.60  ? 100  SER B C     1 
ATOM   4039  O  O     . SER B  2  102 ? 70.018  67.700  73.681  1.00 99.68  ? 100  SER B O     1 
ATOM   4040  C  CB    . SER B  2  102 ? 72.318  69.565  74.963  1.00 101.16 ? 100  SER B CB    1 
ATOM   4041  O  OG    . SER B  2  102 ? 71.109  69.894  75.616  1.00 101.79 ? 100  SER B OG    1 
ATOM   4042  N  N     . THR B  2  103 ? 71.923  66.562  74.041  1.00 99.05  ? 101  THR B N     1 
ATOM   4043  C  CA    . THR B  2  103 ? 71.305  65.260  74.278  1.00 98.56  ? 101  THR B CA    1 
ATOM   4044  C  C     . THR B  2  103 ? 71.483  64.942  75.765  1.00 98.04  ? 101  THR B C     1 
ATOM   4045  O  O     . THR B  2  103 ? 72.204  65.660  76.471  1.00 98.47  ? 101  THR B O     1 
ATOM   4046  C  CB    . THR B  2  103 ? 72.006  64.146  73.455  1.00 98.49  ? 101  THR B CB    1 
ATOM   4047  O  OG1   . THR B  2  103 ? 73.344  64.561  73.139  1.00 97.70  ? 101  THR B OG1   1 
ATOM   4048  C  CG2   . THR B  2  103 ? 71.237  63.838  72.178  1.00 97.97  ? 101  THR B CG2   1 
ATOM   4049  N  N     . ARG B  2  104 ? 70.845  63.876  76.245  1.00 96.06  ? 102  ARG B N     1 
ATOM   4050  C  CA    . ARG B  2  104 ? 70.987  63.518  77.648  1.00 94.45  ? 102  ARG B CA    1 
ATOM   4051  C  C     . ARG B  2  104 ? 72.448  63.498  78.098  1.00 94.79  ? 102  ARG B C     1 
ATOM   4052  O  O     . ARG B  2  104 ? 72.724  63.628  79.292  1.00 94.27  ? 102  ARG B O     1 
ATOM   4053  C  CB    . ARG B  2  104 ? 70.361  62.155  77.910  1.00 92.65  ? 102  ARG B CB    1 
ATOM   4054  C  CG    . ARG B  2  104 ? 68.878  62.198  78.017  1.00 92.08  ? 102  ARG B CG    1 
ATOM   4055  C  CD    . ARG B  2  104 ? 68.210  61.399  76.934  1.00 93.09  ? 102  ARG B CD    1 
ATOM   4056  N  NE    . ARG B  2  104 ? 66.759  61.421  77.106  1.00 96.37  ? 102  ARG B NE    1 
ATOM   4057  C  CZ    . ARG B  2  104 ? 66.120  61.057  78.221  1.00 97.21  ? 102  ARG B CZ    1 
ATOM   4058  N  NH1   . ARG B  2  104 ? 66.801  60.634  79.274  1.00 96.54  ? 102  ARG B NH1   1 
ATOM   4059  N  NH2   . ARG B  2  104 ? 64.792  61.113  78.290  1.00 99.08  ? 102  ARG B NH2   1 
ATOM   4060  N  N     . GLU B  2  105 ? 73.373  63.363  77.140  1.00 95.81  ? 103  GLU B N     1 
ATOM   4061  C  CA    . GLU B  2  105 ? 74.821  63.283  77.416  1.00 96.29  ? 103  GLU B CA    1 
ATOM   4062  C  C     . GLU B  2  105 ? 75.736  64.146  76.534  1.00 96.06  ? 103  GLU B C     1 
ATOM   4063  O  O     . GLU B  2  105 ? 76.936  63.875  76.455  1.00 96.22  ? 103  GLU B O     1 
ATOM   4064  C  CB    . GLU B  2  105 ? 75.297  61.818  77.287  1.00 96.45  ? 103  GLU B CB    1 
ATOM   4065  C  CG    . GLU B  2  105 ? 75.673  61.406  75.856  1.00 95.87  ? 103  GLU B CG    1 
ATOM   4066  C  CD    . GLU B  2  105 ? 75.615  59.911  75.621  1.00 96.18  ? 103  GLU B CD    1 
ATOM   4067  O  OE1   . GLU B  2  105 ? 76.050  59.475  74.527  1.00 96.35  ? 103  GLU B OE1   1 
ATOM   4068  O  OE2   . GLU B  2  105 ? 75.129  59.182  76.519  1.00 95.64  ? 103  GLU B OE2   1 
ATOM   4069  N  N     . LYS B  2  106 ? 75.201  65.171  75.877  1.00 95.65  ? 104  LYS B N     1 
ATOM   4070  C  CA    . LYS B  2  106 ? 76.033  66.006  75.008  1.00 96.18  ? 104  LYS B CA    1 
ATOM   4071  C  C     . LYS B  2  106 ? 75.454  67.382  74.702  1.00 95.51  ? 104  LYS B C     1 
ATOM   4072  O  O     . LYS B  2  106 ? 74.380  67.476  74.123  1.00 96.30  ? 104  LYS B O     1 
ATOM   4073  C  CB    . LYS B  2  106 ? 76.294  65.280  73.681  1.00 97.65  ? 104  LYS B CB    1 
ATOM   4074  C  CG    . LYS B  2  106 ? 76.853  66.170  72.559  1.00 100.57 ? 104  LYS B CG    1 
ATOM   4075  C  CD    . LYS B  2  106 ? 76.962  65.400  71.225  1.00 103.71 ? 104  LYS B CD    1 
ATOM   4076  C  CE    . LYS B  2  106 ? 77.340  66.290  70.008  1.00 105.34 ? 104  LYS B CE    1 
ATOM   4077  N  NZ    . LYS B  2  106 ? 76.213  67.072  69.379  1.00 105.55 ? 104  LYS B NZ    1 
ATOM   4078  N  N     . MET B  2  107 ? 76.173  68.442  75.077  1.00 93.87  ? 105  MET B N     1 
ATOM   4079  C  CA    . MET B  2  107 ? 75.741  69.818  74.814  1.00 91.64  ? 105  MET B CA    1 
ATOM   4080  C  C     . MET B  2  107 ? 76.598  70.372  73.689  1.00 90.21  ? 105  MET B C     1 
ATOM   4081  O  O     . MET B  2  107 ? 77.792  70.100  73.632  1.00 91.14  ? 105  MET B O     1 
ATOM   4082  C  CB    . MET B  2  107 ? 75.905  70.698  76.052  1.00 92.07  ? 105  MET B CB    1 
ATOM   4083  C  CG    . MET B  2  107 ? 75.002  70.336  77.211  1.00 93.35  ? 105  MET B CG    1 
ATOM   4084  S  SD    . MET B  2  107 ? 74.917  71.676  78.426  1.00 95.54  ? 105  MET B SD    1 
ATOM   4085  C  CE    . MET B  2  107 ? 73.122  71.741  78.741  1.00 94.34  ? 105  MET B CE    1 
ATOM   4086  N  N     . THR B  2  108 ? 76.007  71.176  72.817  1.00 88.42  ? 106  THR B N     1 
ATOM   4087  C  CA    . THR B  2  108 ? 76.738  71.695  71.673  1.00 87.05  ? 106  THR B CA    1 
ATOM   4088  C  C     . THR B  2  108 ? 76.560  73.186  71.413  1.00 85.52  ? 106  THR B C     1 
ATOM   4089  O  O     . THR B  2  108 ? 75.723  73.580  70.616  1.00 85.46  ? 106  THR B O     1 
ATOM   4090  C  CB    . THR B  2  108 ? 76.301  70.937  70.395  1.00 88.17  ? 106  THR B CB    1 
ATOM   4091  O  OG1   . THR B  2  108 ? 75.870  69.606  70.737  1.00 87.60  ? 106  THR B OG1   1 
ATOM   4092  C  CG2   . THR B  2  108 ? 77.444  70.861  69.409  1.00 88.64  ? 106  THR B CG2   1 
ATOM   4093  N  N     . TYR B  2  109 ? 77.344  74.023  72.066  1.00 84.84  ? 107  TYR B N     1 
ATOM   4094  C  CA    . TYR B  2  109 ? 77.222  75.458  71.835  1.00 86.43  ? 107  TYR B CA    1 
ATOM   4095  C  C     . TYR B  2  109 ? 77.888  75.875  70.520  1.00 87.83  ? 107  TYR B C     1 
ATOM   4096  O  O     . TYR B  2  109 ? 79.113  75.971  70.463  1.00 88.55  ? 107  TYR B O     1 
ATOM   4097  C  CB    . TYR B  2  109 ? 77.892  76.239  72.957  1.00 85.93  ? 107  TYR B CB    1 
ATOM   4098  C  CG    . TYR B  2  109 ? 77.219  76.154  74.299  1.00 86.35  ? 107  TYR B CG    1 
ATOM   4099  C  CD1   . TYR B  2  109 ? 77.031  74.930  74.942  1.00 87.04  ? 107  TYR B CD1   1 
ATOM   4100  C  CD2   . TYR B  2  109 ? 76.824  77.310  74.963  1.00 87.02  ? 107  TYR B CD2   1 
ATOM   4101  C  CE1   . TYR B  2  109 ? 76.463  74.865  76.234  1.00 86.87  ? 107  TYR B CE1   1 
ATOM   4102  C  CE2   . TYR B  2  109 ? 76.257  77.260  76.247  1.00 87.15  ? 107  TYR B CE2   1 
ATOM   4103  C  CZ    . TYR B  2  109 ? 76.081  76.040  76.875  1.00 86.97  ? 107  TYR B CZ    1 
ATOM   4104  O  OH    . TYR B  2  109 ? 75.527  76.018  78.137  1.00 86.60  ? 107  TYR B OH    1 
ATOM   4105  N  N     . CYS B  2  110 ? 77.110  76.162  69.478  1.00 89.17  ? 108  CYS B N     1 
ATOM   4106  C  CA    . CYS B  2  110 ? 77.713  76.559  68.203  1.00 90.94  ? 108  CYS B CA    1 
ATOM   4107  C  C     . CYS B  2  110 ? 77.202  77.833  67.523  1.00 92.40  ? 108  CYS B C     1 
ATOM   4108  O  O     . CYS B  2  110 ? 76.003  78.000  67.299  1.00 92.20  ? 108  CYS B O     1 
ATOM   4109  C  CB    . CYS B  2  110 ? 77.626  75.399  67.203  1.00 91.30  ? 108  CYS B CB    1 
ATOM   4110  S  SG    . CYS B  2  110 ? 75.972  74.732  66.912  1.00 89.74  ? 108  CYS B SG    1 
ATOM   4111  N  N     . VAL B  2  111 ? 78.133  78.725  67.189  1.00 94.12  ? 109  VAL B N     1 
ATOM   4112  C  CA    . VAL B  2  111 ? 77.793  79.963  66.500  1.00 95.87  ? 109  VAL B CA    1 
ATOM   4113  C  C     . VAL B  2  111 ? 77.675  79.626  65.022  1.00 97.44  ? 109  VAL B C     1 
ATOM   4114  O  O     . VAL B  2  111 ? 77.659  78.444  64.662  1.00 97.41  ? 109  VAL B O     1 
ATOM   4115  C  CB    . VAL B  2  111 ? 78.877  81.050  66.689  1.00 95.61  ? 109  VAL B CB    1 
ATOM   4116  C  CG1   . VAL B  2  111 ? 78.992  81.408  68.158  1.00 96.09  ? 109  VAL B CG1   1 
ATOM   4117  C  CG2   . VAL B  2  111 ? 80.208  80.565  66.157  1.00 95.48  ? 109  VAL B CG2   1 
ATOM   4118  N  N     . GLU B  2  112 ? 77.605  80.655  64.173  1.00 99.81  ? 110  GLU B N     1 
ATOM   4119  C  CA    . GLU B  2  112 ? 77.468  80.471  62.717  1.00 102.00 ? 110  GLU B CA    1 
ATOM   4120  C  C     . GLU B  2  112 ? 77.303  81.805  61.987  1.00 102.07 ? 110  GLU B C     1 
ATOM   4121  O  O     . GLU B  2  112 ? 76.201  82.337  61.917  1.00 102.27 ? 110  GLU B O     1 
ATOM   4122  C  CB    . GLU B  2  112 ? 76.250  79.586  62.423  1.00 103.24 ? 110  GLU B CB    1 
ATOM   4123  C  CG    . GLU B  2  112 ? 75.879  79.440  60.960  1.00 104.15 ? 110  GLU B CG    1 
ATOM   4124  C  CD    . GLU B  2  112 ? 74.621  78.618  60.786  1.00 105.21 ? 110  GLU B CD    1 
ATOM   4125  O  OE1   . GLU B  2  112 ? 73.560  79.052  61.296  1.00 105.07 ? 110  GLU B OE1   1 
ATOM   4126  O  OE2   . GLU B  2  112 ? 74.695  77.539  60.152  1.00 105.77 ? 110  GLU B OE2   1 
ATOM   4127  N  N     . CYS B  2  113 ? 78.381  82.329  61.415  1.00 102.36 ? 111  CYS B N     1 
ATOM   4128  C  CA    . CYS B  2  113 ? 78.292  83.610  60.730  1.00 103.33 ? 111  CYS B CA    1 
ATOM   4129  C  C     . CYS B  2  113 ? 78.870  83.629  59.323  1.00 104.46 ? 111  CYS B C     1 
ATOM   4130  O  O     . CYS B  2  113 ? 79.070  82.588  58.701  1.00 104.38 ? 111  CYS B O     1 
ATOM   4131  C  CB    . CYS B  2  113 ? 78.998  84.678  61.560  1.00 103.03 ? 111  CYS B CB    1 
ATOM   4132  S  SG    . CYS B  2  113 ? 80.787  84.557  61.537  1.00 101.63 ? 111  CYS B SG    1 
ATOM   4133  N  N     . LEU B  2  114 ? 79.122  84.838  58.831  1.00 105.95 ? 112  LEU B N     1 
ATOM   4134  C  CA    . LEU B  2  114 ? 79.707  85.038  57.515  1.00 107.89 ? 112  LEU B CA    1 
ATOM   4135  C  C     . LEU B  2  114 ? 81.210  85.024  57.732  1.00 109.30 ? 112  LEU B C     1 
ATOM   4136  O  O     . LEU B  2  114 ? 81.697  85.543  58.736  1.00 109.16 ? 112  LEU B O     1 
ATOM   4137  C  CB    . LEU B  2  114 ? 79.280  86.388  56.936  1.00 108.29 ? 112  LEU B CB    1 
ATOM   4138  C  CG    . LEU B  2  114 ? 77.787  86.643  56.691  1.00 109.09 ? 112  LEU B CG    1 
ATOM   4139  C  CD1   . LEU B  2  114 ? 77.597  88.091  56.242  1.00 109.02 ? 112  LEU B CD1   1 
ATOM   4140  C  CD2   . LEU B  2  114 ? 77.235  85.672  55.638  1.00 108.96 ? 112  LEU B CD2   1 
ATOM   4141  N  N     . ARG B  2  115 ? 81.939  84.435  56.792  1.00 111.22 ? 113  ARG B N     1 
ATOM   4142  C  CA    . ARG B  2  115 ? 83.390  84.325  56.886  1.00 113.78 ? 113  ARG B CA    1 
ATOM   4143  C  C     . ARG B  2  115 ? 84.155  85.462  57.559  1.00 114.97 ? 113  ARG B C     1 
ATOM   4144  O  O     . ARG B  2  115 ? 84.858  85.241  58.546  1.00 115.29 ? 113  ARG B O     1 
ATOM   4145  C  CB    . ARG B  2  115 ? 83.985  84.102  55.498  1.00 114.29 ? 113  ARG B CB    1 
ATOM   4146  C  CG    . ARG B  2  115 ? 83.661  82.745  54.905  1.00 115.84 ? 113  ARG B CG    1 
ATOM   4147  C  CD    . ARG B  2  115 ? 84.298  82.583  53.529  1.00 116.46 ? 113  ARG B CD    1 
ATOM   4148  N  NE    . ARG B  2  115 ? 85.752  82.457  53.591  1.00 116.00 ? 113  ARG B NE    1 
ATOM   4149  C  CZ    . ARG B  2  115 ? 86.397  81.363  53.986  1.00 115.66 ? 113  ARG B CZ    1 
ATOM   4150  N  NH1   . ARG B  2  115 ? 85.724  80.281  54.359  1.00 115.10 ? 113  ARG B NH1   1 
ATOM   4151  N  NH2   . ARG B  2  115 ? 87.721  81.350  54.007  1.00 115.98 ? 113  ARG B NH2   1 
ATOM   4152  N  N     . ASP B  2  116 ? 84.019  86.674  57.033  1.00 116.11 ? 114  ASP B N     1 
ATOM   4153  C  CA    . ASP B  2  116 ? 84.747  87.823  57.567  1.00 117.34 ? 114  ASP B CA    1 
ATOM   4154  C  C     . ASP B  2  116 ? 84.379  88.296  58.963  1.00 118.10 ? 114  ASP B C     1 
ATOM   4155  O  O     . ASP B  2  116 ? 84.697  89.427  59.333  1.00 118.31 ? 114  ASP B O     1 
ATOM   4156  C  CB    . ASP B  2  116 ? 84.610  88.996  56.612  1.00 117.38 ? 114  ASP B CB    1 
ATOM   4157  C  CG    . ASP B  2  116 ? 84.621  88.560  55.177  1.00 117.81 ? 114  ASP B CG    1 
ATOM   4158  O  OD1   . ASP B  2  116 ? 85.493  87.743  54.816  1.00 118.52 ? 114  ASP B OD1   1 
ATOM   4159  O  OD2   . ASP B  2  116 ? 83.760  89.035  54.412  1.00 118.06 ? 114  ASP B OD2   1 
ATOM   4160  N  N     . HIS B  2  117 ? 83.729  87.448  59.748  1.00 118.92 ? 115  HIS B N     1 
ATOM   4161  C  CA    . HIS B  2  117 ? 83.343  87.866  61.087  1.00 119.61 ? 115  HIS B CA    1 
ATOM   4162  C  C     . HIS B  2  117 ? 83.525  86.782  62.137  1.00 119.70 ? 115  HIS B C     1 
ATOM   4163  O  O     . HIS B  2  117 ? 83.095  86.940  63.284  1.00 120.18 ? 115  HIS B O     1 
ATOM   4164  C  CB    . HIS B  2  117 ? 81.889  88.338  61.075  1.00 120.11 ? 115  HIS B CB    1 
ATOM   4165  C  CG    . HIS B  2  117 ? 81.627  89.444  60.103  1.00 120.02 ? 115  HIS B CG    1 
ATOM   4166  N  ND1   . HIS B  2  117 ? 82.242  90.673  60.195  1.00 119.79 ? 115  HIS B ND1   1 
ATOM   4167  C  CD2   . HIS B  2  117 ? 80.839  89.496  59.002  1.00 120.17 ? 115  HIS B CD2   1 
ATOM   4168  C  CE1   . HIS B  2  117 ? 81.845  91.436  59.191  1.00 120.48 ? 115  HIS B CE1   1 
ATOM   4169  N  NE2   . HIS B  2  117 ? 80.994  90.745  58.452  1.00 120.19 ? 115  HIS B NE2   1 
ATOM   4170  N  N     . VAL B  2  118 ? 84.166  85.687  61.752  1.00 119.08 ? 116  VAL B N     1 
ATOM   4171  C  CA    . VAL B  2  118 ? 84.380  84.599  62.690  1.00 118.87 ? 116  VAL B CA    1 
ATOM   4172  C  C     . VAL B  2  118 ? 85.067  85.114  63.953  1.00 117.96 ? 116  VAL B C     1 
ATOM   4173  O  O     . VAL B  2  118 ? 84.717  84.717  65.065  1.00 117.83 ? 116  VAL B O     1 
ATOM   4174  C  CB    . VAL B  2  118 ? 85.234  83.488  62.063  1.00 119.81 ? 116  VAL B CB    1 
ATOM   4175  C  CG1   . VAL B  2  118 ? 85.328  82.307  63.024  1.00 120.42 ? 116  VAL B CG1   1 
ATOM   4176  C  CG2   . VAL B  2  118 ? 84.625  83.053  60.733  1.00 119.73 ? 116  VAL B CG2   1 
ATOM   4177  N  N     . ASP B  2  119 ? 86.038  86.007  63.764  1.00 117.03 ? 117  ASP B N     1 
ATOM   4178  C  CA    . ASP B  2  119 ? 86.797  86.608  64.868  1.00 115.83 ? 117  ASP B CA    1 
ATOM   4179  C  C     . ASP B  2  119 ? 85.848  87.159  65.928  1.00 114.65 ? 117  ASP B C     1 
ATOM   4180  O  O     . ASP B  2  119 ? 86.022  86.942  67.132  1.00 114.84 ? 117  ASP B O     1 
ATOM   4181  C  CB    . ASP B  2  119 ? 87.660  87.760  64.338  1.00 115.56 ? 117  ASP B CB    1 
ATOM   4182  C  CG    . ASP B  2  119 ? 88.401  87.397  63.063  1.00 115.43 ? 117  ASP B CG    1 
ATOM   4183  O  OD1   . ASP B  2  119 ? 89.338  86.577  63.136  1.00 115.61 ? 117  ASP B OD1   1 
ATOM   4184  O  OD2   . ASP B  2  119 ? 88.041  87.925  61.987  1.00 114.18 ? 117  ASP B OD2   1 
ATOM   4185  N  N     . THR B  2  120 ? 84.840  87.880  65.453  1.00 112.74 ? 118  THR B N     1 
ATOM   4186  C  CA    . THR B  2  120 ? 83.853  88.490  66.318  1.00 109.87 ? 118  THR B CA    1 
ATOM   4187  C  C     . THR B  2  120 ? 82.909  87.448  66.921  1.00 106.67 ? 118  THR B C     1 
ATOM   4188  O  O     . THR B  2  120 ? 82.939  87.231  68.128  1.00 106.51 ? 118  THR B O     1 
ATOM   4189  C  CB    . THR B  2  120 ? 83.058  89.560  65.541  1.00 111.32 ? 118  THR B CB    1 
ATOM   4190  O  OG1   . THR B  2  120 ? 83.965  90.344  64.747  1.00 111.48 ? 118  THR B OG1   1 
ATOM   4191  C  CG2   . THR B  2  120 ? 82.339  90.492  66.509  1.00 112.57 ? 118  THR B CG2   1 
ATOM   4192  N  N     . VAL B  2  121 ? 82.093  86.788  66.100  1.00 103.14 ? 119  VAL B N     1 
ATOM   4193  C  CA    . VAL B  2  121 ? 81.162  85.785  66.624  1.00 101.03 ? 119  VAL B CA    1 
ATOM   4194  C  C     . VAL B  2  121 ? 81.820  84.771  67.552  1.00 100.44 ? 119  VAL B C     1 
ATOM   4195  O  O     . VAL B  2  121 ? 81.135  84.038  68.261  1.00 100.11 ? 119  VAL B O     1 
ATOM   4196  C  CB    . VAL B  2  121 ? 80.458  84.973  65.506  1.00 100.03 ? 119  VAL B CB    1 
ATOM   4197  C  CG1   . VAL B  2  121 ? 79.639  85.873  64.645  1.00 99.68  ? 119  VAL B CG1   1 
ATOM   4198  C  CG2   . VAL B  2  121 ? 81.467  84.230  64.681  1.00 99.56  ? 119  VAL B CG2   1 
ATOM   4199  N  N     . MET B  2  122 ? 83.145  84.718  67.544  1.00 99.80  ? 120  MET B N     1 
ATOM   4200  C  CA    . MET B  2  122 ? 83.859  83.765  68.385  1.00 98.65  ? 120  MET B CA    1 
ATOM   4201  C  C     . MET B  2  122 ? 83.827  84.206  69.827  1.00 96.53  ? 120  MET B C     1 
ATOM   4202  O  O     . MET B  2  122 ? 83.430  83.457  70.715  1.00 95.39  ? 120  MET B O     1 
ATOM   4203  C  CB    . MET B  2  122 ? 85.314  83.645  67.942  1.00 101.05 ? 120  MET B CB    1 
ATOM   4204  C  CG    . MET B  2  122 ? 86.024  82.438  68.528  1.00 103.48 ? 120  MET B CG    1 
ATOM   4205  S  SD    . MET B  2  122 ? 85.167  80.912  68.062  1.00 106.54 ? 120  MET B SD    1 
ATOM   4206  C  CE    . MET B  2  122 ? 85.273  81.008  66.258  1.00 104.98 ? 120  MET B CE    1 
ATOM   4207  N  N     . GLU B  2  123 ? 84.269  85.436  70.037  1.00 95.00  ? 121  GLU B N     1 
ATOM   4208  C  CA    . GLU B  2  123 ? 84.321  86.038  71.352  1.00 94.05  ? 121  GLU B CA    1 
ATOM   4209  C  C     . GLU B  2  123 ? 83.156  85.652  72.248  1.00 93.51  ? 121  GLU B C     1 
ATOM   4210  O  O     . GLU B  2  123 ? 83.343  85.209  73.383  1.00 92.90  ? 121  GLU B O     1 
ATOM   4211  C  CB    . GLU B  2  123 ? 84.377  87.553  71.204  1.00 93.94  ? 121  GLU B CB    1 
ATOM   4212  C  CG    . GLU B  2  123 ? 84.079  88.283  72.480  1.00 95.38  ? 121  GLU B CG    1 
ATOM   4213  C  CD    . GLU B  2  123 ? 84.641  89.678  72.479  1.00 96.31  ? 121  GLU B CD    1 
ATOM   4214  O  OE1   . GLU B  2  123 ? 84.424  90.408  71.484  1.00 95.99  ? 121  GLU B OE1   1 
ATOM   4215  O  OE2   . GLU B  2  123 ? 85.299  90.037  73.480  1.00 97.37  ? 121  GLU B OE2   1 
ATOM   4216  N  N     . TYR B  2  124 ? 81.945  85.822  71.740  1.00 93.49  ? 122  TYR B N     1 
ATOM   4217  C  CA    . TYR B  2  124 ? 80.772  85.497  72.526  1.00 93.26  ? 122  TYR B CA    1 
ATOM   4218  C  C     . TYR B  2  124 ? 80.670  83.999  72.778  1.00 93.92  ? 122  TYR B C     1 
ATOM   4219  O  O     . TYR B  2  124 ? 80.451  83.589  73.916  1.00 93.50  ? 122  TYR B O     1 
ATOM   4220  C  CB    . TYR B  2  124 ? 79.518  86.047  71.839  1.00 92.07  ? 122  TYR B CB    1 
ATOM   4221  C  CG    . TYR B  2  124 ? 79.643  87.525  71.535  1.00 90.97  ? 122  TYR B CG    1 
ATOM   4222  C  CD1   . TYR B  2  124 ? 79.949  87.970  70.250  1.00 91.17  ? 122  TYR B CD1   1 
ATOM   4223  C  CD2   . TYR B  2  124 ? 79.534  88.476  72.549  1.00 90.19  ? 122  TYR B CD2   1 
ATOM   4224  C  CE1   . TYR B  2  124 ? 80.147  89.329  69.980  1.00 91.37  ? 122  TYR B CE1   1 
ATOM   4225  C  CE2   . TYR B  2  124 ? 79.734  89.837  72.293  1.00 90.58  ? 122  TYR B CE2   1 
ATOM   4226  C  CZ    . TYR B  2  124 ? 80.041  90.257  71.006  1.00 91.27  ? 122  TYR B CZ    1 
ATOM   4227  O  OH    . TYR B  2  124 ? 80.248  91.599  70.747  1.00 91.12  ? 122  TYR B OH    1 
ATOM   4228  N  N     . LEU B  2  125 ? 80.853  83.183  71.736  1.00 95.16  ? 123  LEU B N     1 
ATOM   4229  C  CA    . LEU B  2  125 ? 80.784  81.726  71.892  1.00 96.26  ? 123  LEU B CA    1 
ATOM   4230  C  C     . LEU B  2  125 ? 81.754  81.296  72.975  1.00 97.63  ? 123  LEU B C     1 
ATOM   4231  O  O     . LEU B  2  125 ? 81.469  80.401  73.776  1.00 97.47  ? 123  LEU B O     1 
ATOM   4232  C  CB    . LEU B  2  125 ? 81.132  81.010  70.587  1.00 94.82  ? 123  LEU B CB    1 
ATOM   4233  C  CG    . LEU B  2  125 ? 81.328  79.493  70.699  1.00 94.58  ? 123  LEU B CG    1 
ATOM   4234  C  CD1   . LEU B  2  125 ? 80.163  78.833  71.412  1.00 93.51  ? 123  LEU B CD1   1 
ATOM   4235  C  CD2   . LEU B  2  125 ? 81.486  78.913  69.309  1.00 95.69  ? 123  LEU B CD2   1 
ATOM   4236  N  N     . LEU B  2  126 ? 82.911  81.944  72.985  1.00 99.58  ? 124  LEU B N     1 
ATOM   4237  C  CA    . LEU B  2  126 ? 83.927  81.667  73.985  1.00 101.28 ? 124  LEU B CA    1 
ATOM   4238  C  C     . LEU B  2  126 ? 83.369  82.071  75.348  1.00 101.11 ? 124  LEU B C     1 
ATOM   4239  O  O     . LEU B  2  126 ? 83.143  81.219  76.209  1.00 100.93 ? 124  LEU B O     1 
ATOM   4240  C  CB    . LEU B  2  126 ? 85.202  82.466  73.669  1.00 103.46 ? 124  LEU B CB    1 
ATOM   4241  C  CG    . LEU B  2  126 ? 86.033  83.040  74.832  1.00 105.06 ? 124  LEU B CG    1 
ATOM   4242  C  CD1   . LEU B  2  126 ? 86.520  81.924  75.745  1.00 105.15 ? 124  LEU B CD1   1 
ATOM   4243  C  CD2   . LEU B  2  126 ? 87.211  83.832  74.276  1.00 105.82 ? 124  LEU B CD2   1 
ATOM   4244  N  N     . ASN B  2  127 ? 83.132  83.375  75.514  1.00 100.62 ? 125  ASN B N     1 
ATOM   4245  C  CA    . ASN B  2  127 ? 82.619  83.953  76.756  1.00 100.21 ? 125  ASN B CA    1 
ATOM   4246  C  C     . ASN B  2  127 ? 81.369  83.278  77.323  1.00 100.03 ? 125  ASN B C     1 
ATOM   4247  O  O     . ASN B  2  127 ? 81.158  83.244  78.533  1.00 99.32  ? 125  ASN B O     1 
ATOM   4248  C  CB    . ASN B  2  127 ? 82.356  85.452  76.552  1.00 99.77  ? 125  ASN B CB    1 
ATOM   4249  C  CG    . ASN B  2  127 ? 83.543  86.323  76.959  1.00 99.79  ? 125  ASN B CG    1 
ATOM   4250  O  OD1   . ASN B  2  127 ? 83.809  86.509  78.151  1.00 100.12 ? 125  ASN B OD1   1 
ATOM   4251  N  ND2   . ASN B  2  127 ? 84.259  86.859  75.970  1.00 98.11  ? 125  ASN B ND2   1 
ATOM   4252  N  N     . VAL B  2  128 ? 80.540  82.729  76.456  1.00 100.32 ? 126  VAL B N     1 
ATOM   4253  C  CA    . VAL B  2  128 ? 79.334  82.083  76.923  1.00 100.97 ? 126  VAL B CA    1 
ATOM   4254  C  C     . VAL B  2  128 ? 79.569  80.700  77.507  1.00 101.09 ? 126  VAL B C     1 
ATOM   4255  O  O     . VAL B  2  128 ? 78.927  80.323  78.485  1.00 101.13 ? 126  VAL B O     1 
ATOM   4256  C  CB    . VAL B  2  128 ? 78.331  81.946  75.792  1.00 101.60 ? 126  VAL B CB    1 
ATOM   4257  C  CG1   . VAL B  2  128 ? 77.129  81.157  76.262  1.00 103.17 ? 126  VAL B CG1   1 
ATOM   4258  C  CG2   . VAL B  2  128 ? 77.914  83.316  75.322  1.00 102.66 ? 126  VAL B CG2   1 
ATOM   4259  N  N     . THR B  2  129 ? 80.488  79.952  76.901  1.00 101.47 ? 127  THR B N     1 
ATOM   4260  C  CA    . THR B  2  129 ? 80.802  78.580  77.314  1.00 101.48 ? 127  THR B CA    1 
ATOM   4261  C  C     . THR B  2  129 ? 81.888  78.429  78.378  1.00 102.12 ? 127  THR B C     1 
ATOM   4262  O  O     . THR B  2  129 ? 82.016  77.366  78.998  1.00 101.23 ? 127  THR B O     1 
ATOM   4263  C  CB    . THR B  2  129 ? 81.258  77.765  76.110  1.00 100.70 ? 127  THR B CB    1 
ATOM   4264  O  OG1   . THR B  2  129 ? 82.345  78.451  75.478  1.00 100.42 ? 127  THR B OG1   1 
ATOM   4265  C  CG2   . THR B  2  129 ? 80.130  77.601  75.115  1.00 100.04 ? 127  THR B CG2   1 
ATOM   4266  N  N     . THR B  2  130 ? 82.666  79.487  78.586  1.00 103.04 ? 128  THR B N     1 
ATOM   4267  C  CA    . THR B  2  130 ? 83.763  79.434  79.540  1.00 103.49 ? 128  THR B CA    1 
ATOM   4268  C  C     . THR B  2  130 ? 83.780  80.542  80.577  1.00 104.32 ? 128  THR B C     1 
ATOM   4269  O  O     . THR B  2  130 ? 84.584  80.487  81.504  1.00 104.81 ? 128  THR B O     1 
ATOM   4270  C  CB    . THR B  2  130 ? 85.106  79.493  78.816  1.00 103.27 ? 128  THR B CB    1 
ATOM   4271  O  OG1   . THR B  2  130 ? 85.406  80.856  78.481  1.00 102.80 ? 128  THR B OG1   1 
ATOM   4272  C  CG2   . THR B  2  130 ? 85.051  78.664  77.537  1.00 102.93 ? 128  THR B CG2   1 
ATOM   4273  N  N     . ALA B  2  131 ? 82.918  81.545  80.431  1.00 105.21 ? 129  ALA B N     1 
ATOM   4274  C  CA    . ALA B  2  131 ? 82.899  82.655  81.387  1.00 106.08 ? 129  ALA B CA    1 
ATOM   4275  C  C     . ALA B  2  131 ? 81.504  83.112  81.822  1.00 105.93 ? 129  ALA B C     1 
ATOM   4276  O  O     . ALA B  2  131 ? 81.250  84.302  81.995  1.00 105.78 ? 129  ALA B O     1 
ATOM   4277  C  CB    . ALA B  2  131 ? 83.685  83.846  80.811  1.00 106.61 ? 129  ALA B CB    1 
ATOM   4278  N  N     . PRO B  2  132 ? 80.585  82.168  82.023  1.00 106.15 ? 130  PRO B N     1 
ATOM   4279  C  CA    . PRO B  2  132 ? 79.249  82.593  82.438  1.00 106.19 ? 130  PRO B CA    1 
ATOM   4280  C  C     . PRO B  2  132 ? 79.280  83.147  83.863  1.00 105.51 ? 130  PRO B C     1 
ATOM   4281  O  O     . PRO B  2  132 ? 79.988  82.610  84.711  1.00 105.69 ? 130  PRO B O     1 
ATOM   4282  C  CB    . PRO B  2  132 ? 78.447  81.304  82.319  1.00 106.79 ? 130  PRO B CB    1 
ATOM   4283  C  CG    . PRO B  2  132 ? 79.447  80.266  82.741  1.00 106.90 ? 130  PRO B CG    1 
ATOM   4284  C  CD    . PRO B  2  132 ? 80.690  80.697  81.993  1.00 106.73 ? 130  PRO B CD    1 
ATOM   4285  N  N     . GLU B  2  133 ? 78.534  84.223  84.118  1.00 104.38 ? 131  GLU B N     1 
ATOM   4286  C  CA    . GLU B  2  133 ? 78.483  84.819  85.452  1.00 102.49 ? 131  GLU B CA    1 
ATOM   4287  C  C     . GLU B  2  133 ? 77.197  84.459  86.175  1.00 101.80 ? 131  GLU B C     1 
ATOM   4288  O  O     . GLU B  2  133 ? 77.072  84.693  87.378  1.00 101.25 ? 131  GLU B O     1 
ATOM   4289  C  CB    . GLU B  2  133 ? 78.612  86.340  85.382  1.00 101.49 ? 131  GLU B CB    1 
ATOM   4290  C  CG    . GLU B  2  133 ? 80.018  86.816  85.114  1.00 101.02 ? 131  GLU B CG    1 
ATOM   4291  C  CD    . GLU B  2  133 ? 80.214  88.272  85.478  1.00 101.55 ? 131  GLU B CD    1 
ATOM   4292  O  OE1   . GLU B  2  133 ? 79.667  89.151  84.783  1.00 102.80 ? 131  GLU B OE1   1 
ATOM   4293  O  OE2   . GLU B  2  133 ? 80.913  88.545  86.471  1.00 101.83 ? 131  GLU B OE2   1 
ATOM   4294  N  N     . PHE B  2  134 ? 76.256  83.882  85.431  1.00 101.62 ? 132  PHE B N     1 
ATOM   4295  C  CA    . PHE B  2  134 ? 74.963  83.469  85.968  1.00 102.17 ? 132  PHE B CA    1 
ATOM   4296  C  C     . PHE B  2  134 ? 74.495  84.381  87.091  1.00 102.67 ? 132  PHE B C     1 
ATOM   4297  O  O     . PHE B  2  134 ? 74.220  83.923  88.207  1.00 102.69 ? 132  PHE B O     1 
ATOM   4298  C  CB    . PHE B  2  134 ? 75.032  82.033  86.488  1.00 101.78 ? 132  PHE B CB    1 
ATOM   4299  C  CG    . PHE B  2  134 ? 75.356  81.018  85.433  1.00 101.46 ? 132  PHE B CG    1 
ATOM   4300  C  CD1   . PHE B  2  134 ? 75.610  79.704  85.785  1.00 101.13 ? 132  PHE B CD1   1 
ATOM   4301  C  CD2   . PHE B  2  134 ? 75.404  81.370  84.091  1.00 101.98 ? 132  PHE B CD2   1 
ATOM   4302  C  CE1   . PHE B  2  134 ? 75.908  78.752  84.822  1.00 101.40 ? 132  PHE B CE1   1 
ATOM   4303  C  CE2   . PHE B  2  134 ? 75.700  80.420  83.116  1.00 102.27 ? 132  PHE B CE2   1 
ATOM   4304  C  CZ    . PHE B  2  134 ? 75.953  79.109  83.484  1.00 102.11 ? 132  PHE B CZ    1 
ATOM   4305  N  N     . ARG B  2  135 ? 74.416  85.673  86.790  1.00 102.71 ? 133  ARG B N     1 
ATOM   4306  C  CA    . ARG B  2  135 ? 73.983  86.662  87.765  1.00 102.19 ? 133  ARG B CA    1 
ATOM   4307  C  C     . ARG B  2  135 ? 72.637  86.247  88.364  1.00 101.38 ? 133  ARG B C     1 
ATOM   4308  O  O     . ARG B  2  135 ? 71.659  86.053  87.643  1.00 101.55 ? 133  ARG B O     1 
ATOM   4309  C  CB    . ARG B  2  135 ? 73.915  88.033  87.091  1.00 103.04 ? 133  ARG B CB    1 
ATOM   4310  C  CG    . ARG B  2  135 ? 75.274  88.518  86.581  1.00 104.23 ? 133  ARG B CG    1 
ATOM   4311  C  CD    . ARG B  2  135 ? 75.180  89.897  85.949  1.00 106.57 ? 133  ARG B CD    1 
ATOM   4312  N  NE    . ARG B  2  135 ? 76.492  90.470  85.647  1.00 109.20 ? 133  ARG B NE    1 
ATOM   4313  C  CZ    . ARG B  2  135 ? 76.675  91.630  85.017  1.00 110.51 ? 133  ARG B CZ    1 
ATOM   4314  N  NH1   . ARG B  2  135 ? 75.628  92.344  84.620  1.00 110.83 ? 133  ARG B NH1   1 
ATOM   4315  N  NH2   . ARG B  2  135 ? 77.904  92.079  84.778  1.00 111.58 ? 133  ARG B NH2   1 
ATOM   4316  N  N     . PRO B  2  136 ? 72.582  86.108  89.702  1.00 100.79 ? 134  PRO B N     1 
ATOM   4317  C  CA    . PRO B  2  136 ? 71.448  85.712  90.556  1.00 100.51 ? 134  PRO B CA    1 
ATOM   4318  C  C     . PRO B  2  136 ? 70.045  86.125  90.116  1.00 100.12 ? 134  PRO B C     1 
ATOM   4319  O  O     . PRO B  2  136 ? 69.087  85.357  90.265  1.00 100.96 ? 134  PRO B O     1 
ATOM   4320  C  CB    . PRO B  2  136 ? 71.814  86.304  91.909  1.00 100.39 ? 134  PRO B CB    1 
ATOM   4321  C  CG    . PRO B  2  136 ? 73.296  86.179  91.914  1.00 101.02 ? 134  PRO B CG    1 
ATOM   4322  C  CD    . PRO B  2  136 ? 73.677  86.645  90.531  1.00 100.69 ? 134  PRO B CD    1 
ATOM   4323  N  N     . TRP B  2  137 ? 69.925  87.343  89.596  1.00 98.62  ? 135  TRP B N     1 
ATOM   4324  C  CA    . TRP B  2  137 ? 68.644  87.849  89.143  1.00 95.96  ? 135  TRP B CA    1 
ATOM   4325  C  C     . TRP B  2  137 ? 68.370  87.404  87.705  1.00 94.54  ? 135  TRP B C     1 
ATOM   4326  O  O     . TRP B  2  137 ? 67.396  86.691  87.460  1.00 93.14  ? 135  TRP B O     1 
ATOM   4327  C  CB    . TRP B  2  137 ? 68.615  89.377  89.289  1.00 95.82  ? 135  TRP B CB    1 
ATOM   4328  C  CG    . TRP B  2  137 ? 69.756  90.095  88.642  1.00 95.90  ? 135  TRP B CG    1 
ATOM   4329  C  CD1   . TRP B  2  137 ? 69.772  90.652  87.403  1.00 96.53  ? 135  TRP B CD1   1 
ATOM   4330  C  CD2   . TRP B  2  137 ? 71.047  90.333  89.204  1.00 96.60  ? 135  TRP B CD2   1 
ATOM   4331  N  NE1   . TRP B  2  137 ? 70.995  91.228  87.152  1.00 96.58  ? 135  TRP B NE1   1 
ATOM   4332  C  CE2   . TRP B  2  137 ? 71.798  91.046  88.244  1.00 97.12  ? 135  TRP B CE2   1 
ATOM   4333  C  CE3   . TRP B  2  137 ? 71.648  90.009  90.427  1.00 97.51  ? 135  TRP B CE3   1 
ATOM   4334  C  CZ2   . TRP B  2  137 ? 73.123  91.445  88.468  1.00 98.29  ? 135  TRP B CZ2   1 
ATOM   4335  C  CZ3   . TRP B  2  137 ? 72.971  90.404  90.654  1.00 98.16  ? 135  TRP B CZ3   1 
ATOM   4336  C  CH2   . TRP B  2  137 ? 73.691  91.115  89.676  1.00 98.77  ? 135  TRP B CH2   1 
ATOM   4337  N  N     . GLU B  2  138 ? 69.232  87.801  86.767  1.00 93.37  ? 136  GLU B N     1 
ATOM   4338  C  CA    . GLU B  2  138 ? 69.060  87.422  85.367  1.00 92.20  ? 136  GLU B CA    1 
ATOM   4339  C  C     . GLU B  2  138 ? 68.554  85.999  85.338  1.00 92.22  ? 136  GLU B C     1 
ATOM   4340  O  O     . GLU B  2  138 ? 67.631  85.671  84.596  1.00 93.11  ? 136  GLU B O     1 
ATOM   4341  C  CB    . GLU B  2  138 ? 70.385  87.505  84.603  1.00 91.00  ? 136  GLU B CB    1 
ATOM   4342  C  CG    . GLU B  2  138 ? 70.869  88.922  84.317  1.00 89.07  ? 136  GLU B CG    1 
ATOM   4343  C  CD    . GLU B  2  138 ? 72.161  88.958  83.519  1.00 88.09  ? 136  GLU B CD    1 
ATOM   4344  O  OE1   . GLU B  2  138 ? 72.685  90.067  83.299  1.00 86.25  ? 136  GLU B OE1   1 
ATOM   4345  O  OE2   . GLU B  2  138 ? 72.654  87.884  83.112  1.00 88.26  ? 136  GLU B OE2   1 
ATOM   4346  N  N     . VAL B  2  139 ? 69.159  85.165  86.176  1.00 92.10  ? 137  VAL B N     1 
ATOM   4347  C  CA    . VAL B  2  139 ? 68.784  83.765  86.268  1.00 92.44  ? 137  VAL B CA    1 
ATOM   4348  C  C     . VAL B  2  139 ? 67.348  83.596  86.731  1.00 92.16  ? 137  VAL B C     1 
ATOM   4349  O  O     . VAL B  2  139 ? 66.559  82.891  86.091  1.00 92.18  ? 137  VAL B O     1 
ATOM   4350  C  CB    . VAL B  2  139 ? 69.688  83.009  87.245  1.00 92.68  ? 137  VAL B CB    1 
ATOM   4351  C  CG1   . VAL B  2  139 ? 69.148  81.601  87.455  1.00 92.73  ? 137  VAL B CG1   1 
ATOM   4352  C  CG2   . VAL B  2  139 ? 71.111  82.968  86.708  1.00 93.04  ? 137  VAL B CG2   1 
ATOM   4353  N  N     . THR B  2  140 ? 67.008  84.238  87.845  1.00 91.64  ? 138  THR B N     1 
ATOM   4354  C  CA    . THR B  2  140 ? 65.657  84.125  88.370  1.00 90.99  ? 138  THR B CA    1 
ATOM   4355  C  C     . THR B  2  140 ? 64.604  84.787  87.459  1.00 90.51  ? 138  THR B C     1 
ATOM   4356  O  O     . THR B  2  140 ? 63.430  84.412  87.500  1.00 91.88  ? 138  THR B O     1 
ATOM   4357  C  CB    . THR B  2  140 ? 65.564  84.660  89.851  1.00 90.28  ? 138  THR B CB    1 
ATOM   4358  O  OG1   . THR B  2  140 ? 66.445  85.779  90.028  1.00 88.63  ? 138  THR B OG1   1 
ATOM   4359  C  CG2   . THR B  2  140 ? 65.927  83.543  90.856  1.00 89.18  ? 138  THR B CG2   1 
ATOM   4360  N  N     . ASP B  2  141 ? 65.011  85.745  86.626  1.00 88.57  ? 139  ASP B N     1 
ATOM   4361  C  CA    . ASP B  2  141 ? 64.060  86.389  85.717  1.00 85.85  ? 139  ASP B CA    1 
ATOM   4362  C  C     . ASP B  2  141 ? 63.809  85.434  84.581  1.00 82.73  ? 139  ASP B C     1 
ATOM   4363  O  O     . ASP B  2  141 ? 62.762  85.462  83.958  1.00 82.33  ? 139  ASP B O     1 
ATOM   4364  C  CB    . ASP B  2  141 ? 64.621  87.683  85.113  1.00 88.74  ? 139  ASP B CB    1 
ATOM   4365  C  CG    . ASP B  2  141 ? 64.694  88.828  86.118  1.00 92.52  ? 139  ASP B CG    1 
ATOM   4366  O  OD1   . ASP B  2  141 ? 63.806  88.909  87.004  1.00 94.14  ? 139  ASP B OD1   1 
ATOM   4367  O  OD2   . ASP B  2  141 ? 65.628  89.664  86.008  1.00 94.10  ? 139  ASP B OD2   1 
ATOM   4368  N  N     . LEU B  2  142 ? 64.791  84.579  84.341  1.00 79.69  ? 140  LEU B N     1 
ATOM   4369  C  CA    . LEU B  2  142 ? 64.764  83.631  83.254  1.00 77.42  ? 140  LEU B CA    1 
ATOM   4370  C  C     . LEU B  2  142 ? 64.115  82.294  83.495  1.00 76.96  ? 140  LEU B C     1 
ATOM   4371  O  O     . LEU B  2  142 ? 63.513  81.729  82.597  1.00 76.23  ? 140  LEU B O     1 
ATOM   4372  C  CB    . LEU B  2  142 ? 66.189  83.410  82.777  1.00 76.81  ? 140  LEU B CB    1 
ATOM   4373  C  CG    . LEU B  2  142 ? 66.501  82.097  82.074  1.00 77.59  ? 140  LEU B CG    1 
ATOM   4374  C  CD1   . LEU B  2  142 ? 65.694  81.987  80.806  1.00 77.82  ? 140  LEU B CD1   1 
ATOM   4375  C  CD2   . LEU B  2  142 ? 67.993  82.032  81.764  1.00 78.90  ? 140  LEU B CD2   1 
ATOM   4376  N  N     . GLN B  2  143 ? 64.228  81.772  84.697  1.00 78.18  ? 141  GLN B N     1 
ATOM   4377  C  CA    . GLN B  2  143 ? 63.661  80.459  84.954  1.00 80.77  ? 141  GLN B CA    1 
ATOM   4378  C  C     . GLN B  2  143 ? 62.250  80.210  84.425  1.00 80.71  ? 141  GLN B C     1 
ATOM   4379  O  O     . GLN B  2  143 ? 61.963  79.130  83.913  1.00 81.23  ? 141  GLN B O     1 
ATOM   4380  C  CB    . GLN B  2  143 ? 63.751  80.137  86.447  1.00 83.36  ? 141  GLN B CB    1 
ATOM   4381  C  CG    . GLN B  2  143 ? 65.209  80.097  86.945  1.00 86.81  ? 141  GLN B CG    1 
ATOM   4382  C  CD    . GLN B  2  143 ? 65.400  79.292  88.229  1.00 88.66  ? 141  GLN B CD    1 
ATOM   4383  O  OE1   . GLN B  2  143 ? 65.124  78.086  88.265  1.00 89.96  ? 141  GLN B OE1   1 
ATOM   4384  N  NE2   . GLN B  2  143 ? 65.883  79.955  89.288  1.00 88.74  ? 141  GLN B NE2   1 
ATOM   4385  N  N     . PRO B  2  144 ? 61.349  81.199  84.526  1.00 80.93  ? 142  PRO B N     1 
ATOM   4386  C  CA    . PRO B  2  144 ? 59.976  81.007  84.027  1.00 80.56  ? 142  PRO B CA    1 
ATOM   4387  C  C     . PRO B  2  144 ? 59.876  80.642  82.530  1.00 78.42  ? 142  PRO B C     1 
ATOM   4388  O  O     . PRO B  2  144 ? 58.796  80.336  82.019  1.00 78.12  ? 142  PRO B O     1 
ATOM   4389  C  CB    . PRO B  2  144 ? 59.303  82.348  84.349  1.00 81.60  ? 142  PRO B CB    1 
ATOM   4390  C  CG    . PRO B  2  144 ? 59.981  82.745  85.625  1.00 82.16  ? 142  PRO B CG    1 
ATOM   4391  C  CD    . PRO B  2  144 ? 61.448  82.447  85.304  1.00 81.77  ? 142  PRO B CD    1 
ATOM   4392  N  N     . GLN B  2  145 ? 61.006  80.675  81.837  1.00 75.74  ? 143  GLN B N     1 
ATOM   4393  C  CA    . GLN B  2  145 ? 61.035  80.356  80.425  1.00 72.72  ? 143  GLN B CA    1 
ATOM   4394  C  C     . GLN B  2  145 ? 60.974  78.857  80.315  1.00 71.93  ? 143  GLN B C     1 
ATOM   4395  O  O     . GLN B  2  145 ? 60.419  78.318  79.375  1.00 71.68  ? 143  GLN B O     1 
ATOM   4396  C  CB    . GLN B  2  145 ? 62.325  80.868  79.807  1.00 70.68  ? 143  GLN B CB    1 
ATOM   4397  C  CG    . GLN B  2  145 ? 62.425  80.693  78.310  1.00 69.04  ? 143  GLN B CG    1 
ATOM   4398  C  CD    . GLN B  2  145 ? 61.592  81.690  77.539  1.00 68.07  ? 143  GLN B CD    1 
ATOM   4399  O  OE1   . GLN B  2  145 ? 60.541  81.341  77.006  1.00 66.79  ? 143  GLN B OE1   1 
ATOM   4400  N  NE2   . GLN B  2  145 ? 62.059  82.943  77.474  1.00 66.98  ? 143  GLN B NE2   1 
ATOM   4401  N  N     . LEU B  2  146 ? 61.555  78.185  81.295  1.00 72.10  ? 144  LEU B N     1 
ATOM   4402  C  CA    . LEU B  2  146 ? 61.568  76.734  81.310  1.00 72.97  ? 144  LEU B CA    1 
ATOM   4403  C  C     . LEU B  2  146 ? 60.152  76.234  81.224  1.00 73.30  ? 144  LEU B C     1 
ATOM   4404  O  O     . LEU B  2  146 ? 59.879  75.224  80.582  1.00 73.69  ? 144  LEU B O     1 
ATOM   4405  C  CB    . LEU B  2  146 ? 62.183  76.207  82.606  1.00 73.09  ? 144  LEU B CB    1 
ATOM   4406  C  CG    . LEU B  2  146 ? 63.690  76.249  82.835  1.00 73.07  ? 144  LEU B CG    1 
ATOM   4407  C  CD1   . LEU B  2  146 ? 64.020  75.745  84.236  1.00 72.89  ? 144  LEU B CD1   1 
ATOM   4408  C  CD2   . LEU B  2  146 ? 64.363  75.390  81.790  1.00 72.94  ? 144  LEU B CD2   1 
ATOM   4409  N  N     . LYS B  2  147 ? 59.252  76.949  81.885  1.00 73.71  ? 145  LYS B N     1 
ATOM   4410  C  CA    . LYS B  2  147 ? 57.849  76.561  81.906  1.00 75.23  ? 145  LYS B CA    1 
ATOM   4411  C  C     . LYS B  2  147 ? 57.268  76.641  80.499  1.00 74.32  ? 145  LYS B C     1 
ATOM   4412  O  O     . LYS B  2  147 ? 56.301  75.940  80.176  1.00 74.52  ? 145  LYS B O     1 
ATOM   4413  C  CB    . LYS B  2  147 ? 57.065  77.486  82.849  1.00 77.60  ? 145  LYS B CB    1 
ATOM   4414  C  CG    . LYS B  2  147 ? 55.765  76.898  83.426  1.00 80.33  ? 145  LYS B CG    1 
ATOM   4415  C  CD    . LYS B  2  147 ? 56.030  76.013  84.649  1.00 82.99  ? 145  LYS B CD    1 
ATOM   4416  C  CE    . LYS B  2  147 ? 54.732  75.588  85.346  1.00 84.08  ? 145  LYS B CE    1 
ATOM   4417  N  NZ    . LYS B  2  147 ? 54.962  74.856  86.634  1.00 84.86  ? 145  LYS B NZ    1 
ATOM   4418  N  N     . VAL B  2  148 ? 57.870  77.494  79.671  1.00 72.80  ? 146  VAL B N     1 
ATOM   4419  C  CA    . VAL B  2  148 ? 57.433  77.707  78.288  1.00 71.05  ? 146  VAL B CA    1 
ATOM   4420  C  C     . VAL B  2  148 ? 58.191  76.843  77.274  1.00 71.79  ? 146  VAL B C     1 
ATOM   4421  O  O     . VAL B  2  148 ? 57.586  76.070  76.523  1.00 70.18  ? 146  VAL B O     1 
ATOM   4422  C  CB    . VAL B  2  148 ? 57.568  79.207  77.922  1.00 68.83  ? 146  VAL B CB    1 
ATOM   4423  C  CG1   . VAL B  2  148 ? 58.104  79.381  76.521  1.00 67.45  ? 146  VAL B CG1   1 
ATOM   4424  C  CG2   . VAL B  2  148 ? 56.221  79.880  78.063  1.00 67.35  ? 146  VAL B CG2   1 
ATOM   4425  N  N     . ASP B  2  149 ? 59.516  76.974  77.260  1.00 73.30  ? 147  ASP B N     1 
ATOM   4426  C  CA    . ASP B  2  149 ? 60.348  76.207  76.347  1.00 74.18  ? 147  ASP B CA    1 
ATOM   4427  C  C     . ASP B  2  149 ? 59.913  74.757  76.395  1.00 73.54  ? 147  ASP B C     1 
ATOM   4428  O  O     . ASP B  2  149 ? 59.878  74.069  75.380  1.00 73.62  ? 147  ASP B O     1 
ATOM   4429  C  CB    . ASP B  2  149 ? 61.822  76.335  76.735  1.00 76.29  ? 147  ASP B CB    1 
ATOM   4430  C  CG    . ASP B  2  149 ? 62.728  75.534  75.824  1.00 79.27  ? 147  ASP B CG    1 
ATOM   4431  O  OD1   . ASP B  2  149 ? 62.471  75.503  74.598  1.00 81.49  ? 147  ASP B OD1   1 
ATOM   4432  O  OD2   . ASP B  2  149 ? 63.705  74.938  76.326  1.00 81.33  ? 147  ASP B OD2   1 
ATOM   4433  N  N     . LYS B  2  150 ? 59.567  74.301  77.589  1.00 73.45  ? 148  LYS B N     1 
ATOM   4434  C  CA    . LYS B  2  150 ? 59.118  72.933  77.767  1.00 73.91  ? 148  LYS B CA    1 
ATOM   4435  C  C     . LYS B  2  150 ? 57.766  72.777  77.068  1.00 74.56  ? 148  LYS B C     1 
ATOM   4436  O  O     . LYS B  2  150 ? 57.635  71.990  76.125  1.00 74.68  ? 148  LYS B O     1 
ATOM   4437  C  CB    . LYS B  2  150 ? 58.976  72.609  79.262  1.00 73.32  ? 148  LYS B CB    1 
ATOM   4438  C  CG    . LYS B  2  150 ? 58.804  71.132  79.568  1.00 72.52  ? 148  LYS B CG    1 
ATOM   4439  C  CD    . LYS B  2  150 ? 58.466  70.878  81.037  1.00 73.20  ? 148  LYS B CD    1 
ATOM   4440  C  CE    . LYS B  2  150 ? 58.609  69.384  81.368  1.00 74.25  ? 148  LYS B CE    1 
ATOM   4441  N  NZ    . LYS B  2  150 ? 58.213  68.988  82.752  1.00 73.81  ? 148  LYS B NZ    1 
ATOM   4442  N  N     . ALA B  2  151 ? 56.781  73.557  77.525  1.00 74.79  ? 149  ALA B N     1 
ATOM   4443  C  CA    . ALA B  2  151 ? 55.410  73.522  77.006  1.00 74.28  ? 149  ALA B CA    1 
ATOM   4444  C  C     . ALA B  2  151 ? 55.267  73.507  75.485  1.00 74.14  ? 149  ALA B C     1 
ATOM   4445  O  O     . ALA B  2  151 ? 54.313  72.923  74.970  1.00 73.64  ? 149  ALA B O     1 
ATOM   4446  C  CB    . ALA B  2  151 ? 54.597  74.675  77.595  1.00 73.66  ? 149  ALA B CB    1 
ATOM   4447  N  N     . VAL B  2  152 ? 56.190  74.146  74.766  1.00 74.00  ? 150  VAL B N     1 
ATOM   4448  C  CA    . VAL B  2  152 ? 56.110  74.147  73.307  1.00 73.87  ? 150  VAL B CA    1 
ATOM   4449  C  C     . VAL B  2  152 ? 56.531  72.783  72.805  1.00 74.55  ? 150  VAL B C     1 
ATOM   4450  O  O     . VAL B  2  152 ? 55.734  72.070  72.210  1.00 75.26  ? 150  VAL B O     1 
ATOM   4451  C  CB    . VAL B  2  152 ? 57.016  75.223  72.646  1.00 73.25  ? 150  VAL B CB    1 
ATOM   4452  C  CG1   . VAL B  2  152 ? 56.644  76.583  73.159  1.00 73.61  ? 150  VAL B CG1   1 
ATOM   4453  C  CG2   . VAL B  2  152 ? 58.490  74.945  72.914  1.00 74.03  ? 150  VAL B CG2   1 
ATOM   4454  N  N     . ALA B  2  153 ? 57.782  72.416  73.070  1.00 75.31  ? 151  ALA B N     1 
ATOM   4455  C  CA    . ALA B  2  153 ? 58.321  71.136  72.637  1.00 75.84  ? 151  ALA B CA    1 
ATOM   4456  C  C     . ALA B  2  153 ? 57.335  70.024  72.951  1.00 76.27  ? 151  ALA B C     1 
ATOM   4457  O  O     . ALA B  2  153 ? 57.043  69.180  72.098  1.00 75.17  ? 151  ALA B O     1 
ATOM   4458  C  CB    . ALA B  2  153 ? 59.658  70.878  73.323  1.00 74.88  ? 151  ALA B CB    1 
ATOM   4459  N  N     . PHE B  2  154 ? 56.805  70.049  74.169  1.00 77.60  ? 152  PHE B N     1 
ATOM   4460  C  CA    . PHE B  2  154 ? 55.850  69.043  74.611  1.00 80.44  ? 152  PHE B CA    1 
ATOM   4461  C  C     . PHE B  2  154 ? 54.543  69.012  73.816  1.00 81.97  ? 152  PHE B C     1 
ATOM   4462  O  O     . PHE B  2  154 ? 53.600  68.277  74.167  1.00 82.49  ? 152  PHE B O     1 
ATOM   4463  C  CB    . PHE B  2  154 ? 55.531  69.232  76.090  1.00 81.15  ? 152  PHE B CB    1 
ATOM   4464  C  CG    . PHE B  2  154 ? 56.136  68.187  76.978  1.00 81.76  ? 152  PHE B CG    1 
ATOM   4465  C  CD1   . PHE B  2  154 ? 57.489  68.225  77.282  1.00 82.03  ? 152  PHE B CD1   1 
ATOM   4466  C  CD2   . PHE B  2  154 ? 55.348  67.164  77.515  1.00 81.92  ? 152  PHE B CD2   1 
ATOM   4467  C  CE1   . PHE B  2  154 ? 58.058  67.259  78.113  1.00 82.69  ? 152  PHE B CE1   1 
ATOM   4468  C  CE2   . PHE B  2  154 ? 55.903  66.193  78.347  1.00 82.22  ? 152  PHE B CE2   1 
ATOM   4469  C  CZ    . PHE B  2  154 ? 57.263  66.239  78.649  1.00 82.33  ? 152  PHE B CZ    1 
ATOM   4470  N  N     . GLN B  2  155 ? 54.480  69.809  72.753  1.00 82.92  ? 153  GLN B N     1 
ATOM   4471  C  CA    . GLN B  2  155 ? 53.289  69.838  71.914  1.00 83.59  ? 153  GLN B CA    1 
ATOM   4472  C  C     . GLN B  2  155 ? 53.303  68.638  70.989  1.00 83.24  ? 153  GLN B C     1 
ATOM   4473  O  O     . GLN B  2  155 ? 52.261  68.241  70.463  1.00 83.67  ? 153  GLN B O     1 
ATOM   4474  C  CB    . GLN B  2  155 ? 53.221  71.132  71.106  1.00 84.59  ? 153  GLN B CB    1 
ATOM   4475  C  CG    . GLN B  2  155 ? 52.584  72.276  71.872  1.00 85.54  ? 153  GLN B CG    1 
ATOM   4476  C  CD    . GLN B  2  155 ? 52.430  73.529  71.041  1.00 85.64  ? 153  GLN B CD    1 
ATOM   4477  O  OE1   . GLN B  2  155 ? 51.627  74.402  71.379  1.00 85.84  ? 153  GLN B OE1   1 
ATOM   4478  N  NE2   . GLN B  2  155 ? 53.204  73.635  69.956  1.00 84.96  ? 153  GLN B NE2   1 
ATOM   4479  N  N     . SER B  2  156 ? 54.496  68.070  70.803  1.00 82.36  ? 154  SER B N     1 
ATOM   4480  C  CA    . SER B  2  156 ? 54.692  66.877  69.979  1.00 81.23  ? 154  SER B CA    1 
ATOM   4481  C  C     . SER B  2  156 ? 54.661  65.683  70.958  1.00 80.77  ? 154  SER B C     1 
ATOM   4482  O  O     . SER B  2  156 ? 55.656  65.392  71.619  1.00 80.53  ? 154  SER B O     1 
ATOM   4483  C  CB    . SER B  2  156 ? 56.050  66.961  69.283  1.00 80.33  ? 154  SER B CB    1 
ATOM   4484  O  OG    . SER B  2  156 ? 56.345  68.297  68.907  1.00 79.01  ? 154  SER B OG    1 
ATOM   4485  N  N     . PRO B  2  157 ? 53.514  64.980  71.064  1.00 80.69  ? 155  PRO B N     1 
ATOM   4486  C  CA    . PRO B  2  157 ? 53.413  63.840  71.987  1.00 79.52  ? 155  PRO B CA    1 
ATOM   4487  C  C     . PRO B  2  157 ? 54.620  62.968  71.824  1.00 78.08  ? 155  PRO B C     1 
ATOM   4488  O  O     . PRO B  2  157 ? 55.080  62.334  72.764  1.00 77.41  ? 155  PRO B O     1 
ATOM   4489  C  CB    . PRO B  2  157 ? 52.136  63.137  71.535  1.00 80.75  ? 155  PRO B CB    1 
ATOM   4490  C  CG    . PRO B  2  157 ? 51.306  64.259  70.946  1.00 80.89  ? 155  PRO B CG    1 
ATOM   4491  C  CD    . PRO B  2  157 ? 52.347  65.026  70.163  1.00 81.01  ? 155  PRO B CD    1 
ATOM   4492  N  N     . GLN B  2  158 ? 55.108  62.958  70.591  1.00 77.31  ? 156  GLN B N     1 
ATOM   4493  C  CA    . GLN B  2  158 ? 56.282  62.207  70.182  1.00 76.74  ? 156  GLN B CA    1 
ATOM   4494  C  C     . GLN B  2  158 ? 57.456  62.381  71.181  1.00 75.17  ? 156  GLN B C     1 
ATOM   4495  O  O     . GLN B  2  158 ? 58.249  61.456  71.357  1.00 74.58  ? 156  GLN B O     1 
ATOM   4496  C  CB    . GLN B  2  158 ? 56.660  62.667  68.759  1.00 78.10  ? 156  GLN B CB    1 
ATOM   4497  C  CG    . GLN B  2  158 ? 58.060  62.309  68.280  1.00 80.81  ? 156  GLN B CG    1 
ATOM   4498  C  CD    . GLN B  2  158 ? 58.697  63.424  67.425  1.00 82.58  ? 156  GLN B CD    1 
ATOM   4499  O  OE1   . GLN B  2  158 ? 58.058  63.960  66.508  1.00 82.69  ? 156  GLN B OE1   1 
ATOM   4500  N  NE2   . GLN B  2  158 ? 59.964  63.770  67.723  1.00 82.40  ? 156  GLN B NE2   1 
ATOM   4501  N  N     . VAL B  2  159 ? 57.543  63.546  71.839  1.00 73.14  ? 157  VAL B N     1 
ATOM   4502  C  CA    . VAL B  2  159 ? 58.611  63.847  72.812  1.00 70.39  ? 157  VAL B CA    1 
ATOM   4503  C  C     . VAL B  2  159 ? 58.213  63.425  74.208  1.00 70.60  ? 157  VAL B C     1 
ATOM   4504  O  O     . VAL B  2  159 ? 59.058  63.220  75.074  1.00 69.10  ? 157  VAL B O     1 
ATOM   4505  C  CB    . VAL B  2  159 ? 58.935  65.350  72.887  1.00 68.42  ? 157  VAL B CB    1 
ATOM   4506  C  CG1   . VAL B  2  159 ? 57.764  66.091  73.461  1.00 68.07  ? 157  VAL B CG1   1 
ATOM   4507  C  CG2   . VAL B  2  159 ? 60.148  65.585  73.756  1.00 66.18  ? 157  VAL B CG2   1 
ATOM   4508  N  N     . GLY B  2  160 ? 56.910  63.330  74.426  1.00 72.58  ? 158  GLY B N     1 
ATOM   4509  C  CA    . GLY B  2  160 ? 56.422  62.911  75.720  1.00 75.11  ? 158  GLY B CA    1 
ATOM   4510  C  C     . GLY B  2  160 ? 56.906  61.498  75.999  1.00 76.12  ? 158  GLY B C     1 
ATOM   4511  O  O     . GLY B  2  160 ? 57.817  61.300  76.795  1.00 76.55  ? 158  GLY B O     1 
ATOM   4512  N  N     . VAL B  2  161 ? 56.310  60.521  75.318  1.00 76.92  ? 159  VAL B N     1 
ATOM   4513  C  CA    . VAL B  2  161 ? 56.657  59.116  75.494  1.00 76.46  ? 159  VAL B CA    1 
ATOM   4514  C  C     . VAL B  2  161 ? 58.144  58.829  75.633  1.00 77.03  ? 159  VAL B C     1 
ATOM   4515  O  O     . VAL B  2  161 ? 58.518  57.919  76.364  1.00 77.22  ? 159  VAL B O     1 
ATOM   4516  C  CB    . VAL B  2  161 ? 56.118  58.268  74.343  1.00 75.51  ? 159  VAL B CB    1 
ATOM   4517  C  CG1   . VAL B  2  161 ? 54.601  58.345  74.318  1.00 74.85  ? 159  VAL B CG1   1 
ATOM   4518  C  CG2   . VAL B  2  161 ? 56.713  58.744  73.035  1.00 73.94  ? 159  VAL B CG2   1 
ATOM   4519  N  N     . LEU B  2  162 ? 58.994  59.586  74.943  1.00 77.88  ? 160  LEU B N     1 
ATOM   4520  C  CA    . LEU B  2  162 ? 60.440  59.349  75.043  1.00 78.86  ? 160  LEU B CA    1 
ATOM   4521  C  C     . LEU B  2  162 ? 60.998  59.754  76.402  1.00 79.19  ? 160  LEU B C     1 
ATOM   4522  O  O     . LEU B  2  162 ? 61.885  59.090  76.931  1.00 79.44  ? 160  LEU B O     1 
ATOM   4523  C  CB    . LEU B  2  162 ? 61.216  60.077  73.934  1.00 79.03  ? 160  LEU B CB    1 
ATOM   4524  C  CG    . LEU B  2  162 ? 60.955  59.711  72.460  1.00 78.94  ? 160  LEU B CG    1 
ATOM   4525  C  CD1   . LEU B  2  162 ? 62.121  60.211  71.615  1.00 77.33  ? 160  LEU B CD1   1 
ATOM   4526  C  CD2   . LEU B  2  162 ? 60.789  58.202  72.287  1.00 78.50  ? 160  LEU B CD2   1 
ATOM   4527  N  N     . GLU B  2  163 ? 60.496  60.851  76.958  1.00 79.75  ? 161  GLU B N     1 
ATOM   4528  C  CA    . GLU B  2  163 ? 60.940  61.283  78.278  1.00 80.01  ? 161  GLU B CA    1 
ATOM   4529  C  C     . GLU B  2  163 ? 60.597  60.186  79.284  1.00 79.18  ? 161  GLU B C     1 
ATOM   4530  O  O     . GLU B  2  163 ? 61.395  59.875  80.158  1.00 78.18  ? 161  GLU B O     1 
ATOM   4531  C  CB    . GLU B  2  163 ? 60.234  62.576  78.691  1.00 81.60  ? 161  GLU B CB    1 
ATOM   4532  C  CG    . GLU B  2  163 ? 60.820  63.846  78.109  1.00 83.47  ? 161  GLU B CG    1 
ATOM   4533  C  CD    . GLU B  2  163 ? 62.219  64.132  78.622  1.00 84.97  ? 161  GLU B CD    1 
ATOM   4534  O  OE1   . GLU B  2  163 ? 63.194  63.670  77.991  1.00 85.54  ? 161  GLU B OE1   1 
ATOM   4535  O  OE2   . GLU B  2  163 ? 62.340  64.816  79.661  1.00 85.22  ? 161  GLU B OE2   1 
ATOM   4536  N  N     . ASN B  2  164 ? 59.399  59.612  79.139  1.00 79.12  ? 162  ASN B N     1 
ATOM   4537  C  CA    . ASN B  2  164 ? 58.901  58.546  80.012  1.00 79.66  ? 162  ASN B CA    1 
ATOM   4538  C  C     . ASN B  2  164 ? 59.585  57.215  79.739  1.00 80.39  ? 162  ASN B C     1 
ATOM   4539  O  O     . ASN B  2  164 ? 59.829  56.430  80.667  1.00 81.21  ? 162  ASN B O     1 
ATOM   4540  C  CB    . ASN B  2  164 ? 57.395  58.349  79.827  1.00 79.28  ? 162  ASN B CB    1 
ATOM   4541  C  CG    . ASN B  2  164 ? 56.617  59.597  80.096  1.00 80.32  ? 162  ASN B CG    1 
ATOM   4542  O  OD1   . ASN B  2  164 ? 56.845  60.268  81.102  1.00 80.53  ? 162  ASN B OD1   1 
ATOM   4543  N  ND2   . ASN B  2  164 ? 55.681  59.925  79.203  1.00 81.33  ? 162  ASN B ND2   1 
ATOM   4544  N  N     . LEU B  2  165 ? 59.864  56.945  78.463  1.00 79.88  ? 163  LEU B N     1 
ATOM   4545  C  CA    . LEU B  2  165 ? 60.528  55.703  78.087  1.00 78.23  ? 163  LEU B CA    1 
ATOM   4546  C  C     . LEU B  2  165 ? 61.880  55.688  78.790  1.00 77.91  ? 163  LEU B C     1 
ATOM   4547  O  O     . LEU B  2  165 ? 62.136  54.812  79.613  1.00 79.07  ? 163  LEU B O     1 
ATOM   4548  C  CB    . LEU B  2  165 ? 60.733  55.621  76.578  1.00 77.14  ? 163  LEU B CB    1 
ATOM   4549  C  CG    . LEU B  2  165 ? 61.059  54.194  76.157  1.00 75.95  ? 163  LEU B CG    1 
ATOM   4550  C  CD1   . LEU B  2  165 ? 59.850  53.336  76.467  1.00 74.82  ? 163  LEU B CD1   1 
ATOM   4551  C  CD2   . LEU B  2  165 ? 61.420  54.124  74.684  1.00 75.59  ? 163  LEU B CD2   1 
ATOM   4552  N  N     . HIS B  2  166 ? 62.737  56.662  78.478  1.00 75.98  ? 164  HIS B N     1 
ATOM   4553  C  CA    . HIS B  2  166 ? 64.047  56.760  79.116  1.00 73.47  ? 164  HIS B CA    1 
ATOM   4554  C  C     . HIS B  2  166 ? 63.981  56.570  80.631  1.00 73.04  ? 164  HIS B C     1 
ATOM   4555  O  O     . HIS B  2  166 ? 64.869  55.971  81.226  1.00 73.39  ? 164  HIS B O     1 
ATOM   4556  C  CB    . HIS B  2  166 ? 64.687  58.097  78.784  1.00 71.37  ? 164  HIS B CB    1 
ATOM   4557  C  CG    . HIS B  2  166 ? 65.361  58.103  77.457  1.00 70.45  ? 164  HIS B CG    1 
ATOM   4558  N  ND1   . HIS B  2  166 ? 64.739  57.661  76.311  1.00 69.66  ? 164  HIS B ND1   1 
ATOM   4559  C  CD2   . HIS B  2  166 ? 66.613  58.466  77.094  1.00 71.20  ? 164  HIS B CD2   1 
ATOM   4560  C  CE1   . HIS B  2  166 ? 65.581  57.753  75.297  1.00 71.14  ? 164  HIS B CE1   1 
ATOM   4561  N  NE2   . HIS B  2  166 ? 66.725  58.240  75.745  1.00 71.99  ? 164  HIS B NE2   1 
ATOM   4562  N  N     . ALA B  2  167 ? 62.927  57.077  81.256  1.00 72.53  ? 165  ALA B N     1 
ATOM   4563  C  CA    . ALA B  2  167 ? 62.763  56.917  82.689  1.00 71.77  ? 165  ALA B CA    1 
ATOM   4564  C  C     . ALA B  2  167 ? 62.374  55.476  82.951  1.00 72.15  ? 165  ALA B C     1 
ATOM   4565  O  O     . ALA B  2  167 ? 62.854  54.880  83.903  1.00 72.92  ? 165  ALA B O     1 
ATOM   4566  C  CB    . ALA B  2  167 ? 61.690  57.830  83.196  1.00 71.83  ? 165  ALA B CB    1 
ATOM   4567  N  N     . ALA B  2  168 ? 61.505  54.925  82.101  1.00 72.31  ? 166  ALA B N     1 
ATOM   4568  C  CA    . ALA B  2  168 ? 61.035  53.536  82.215  1.00 72.82  ? 166  ALA B CA    1 
ATOM   4569  C  C     . ALA B  2  168 ? 62.048  52.497  81.719  1.00 73.63  ? 166  ALA B C     1 
ATOM   4570  O  O     . ALA B  2  168 ? 61.889  51.305  81.957  1.00 72.72  ? 166  ALA B O     1 
ATOM   4571  C  CB    . ALA B  2  168 ? 59.736  53.366  81.447  1.00 72.38  ? 166  ALA B CB    1 
ATOM   4572  N  N     . ALA B  2  169 ? 63.078  52.947  81.013  1.00 74.80  ? 167  ALA B N     1 
ATOM   4573  C  CA    . ALA B  2  169 ? 64.084  52.032  80.504  1.00 76.11  ? 167  ALA B CA    1 
ATOM   4574  C  C     . ALA B  2  169 ? 65.339  52.111  81.340  1.00 77.50  ? 167  ALA B C     1 
ATOM   4575  O  O     . ALA B  2  169 ? 66.290  51.384  81.088  1.00 78.84  ? 167  ALA B O     1 
ATOM   4576  C  CB    . ALA B  2  169 ? 64.411  52.351  79.065  1.00 75.82  ? 167  ALA B CB    1 
ATOM   4577  N  N     . TYR B  2  170 ? 65.363  52.998  82.327  1.00 78.51  ? 168  TYR B N     1 
ATOM   4578  C  CA    . TYR B  2  170 ? 66.546  53.113  83.168  1.00 79.82  ? 168  TYR B CA    1 
ATOM   4579  C  C     . TYR B  2  170 ? 66.270  53.278  84.663  1.00 81.43  ? 168  TYR B C     1 
ATOM   4580  O  O     . TYR B  2  170 ? 65.118  53.221  85.120  1.00 81.07  ? 168  TYR B O     1 
ATOM   4581  C  CB    . TYR B  2  170 ? 67.431  54.258  82.681  1.00 78.71  ? 168  TYR B CB    1 
ATOM   4582  C  CG    . TYR B  2  170 ? 68.051  54.022  81.326  1.00 78.57  ? 168  TYR B CG    1 
ATOM   4583  C  CD1   . TYR B  2  170 ? 67.265  53.903  80.187  1.00 78.63  ? 168  TYR B CD1   1 
ATOM   4584  C  CD2   . TYR B  2  170 ? 69.430  53.956  81.174  1.00 79.12  ? 168  TYR B CD2   1 
ATOM   4585  C  CE1   . TYR B  2  170 ? 67.840  53.729  78.923  1.00 79.27  ? 168  TYR B CE1   1 
ATOM   4586  C  CE2   . TYR B  2  170 ? 70.015  53.784  79.918  1.00 78.86  ? 168  TYR B CE2   1 
ATOM   4587  C  CZ    . TYR B  2  170 ? 69.219  53.676  78.795  1.00 78.76  ? 168  TYR B CZ    1 
ATOM   4588  O  OH    . TYR B  2  170 ? 69.799  53.555  77.550  1.00 77.71  ? 168  TYR B OH    1 
ATOM   4589  N  N     . LYS B  2  171 ? 67.358  53.458  85.415  1.00 83.03  ? 169  LYS B N     1 
ATOM   4590  C  CA    . LYS B  2  171 ? 67.313  53.641  86.867  1.00 83.43  ? 169  LYS B CA    1 
ATOM   4591  C  C     . LYS B  2  171 ? 68.011  54.936  87.239  1.00 81.86  ? 169  LYS B C     1 
ATOM   4592  O  O     . LYS B  2  171 ? 67.815  55.451  88.334  1.00 80.72  ? 169  LYS B O     1 
ATOM   4593  C  CB    . LYS B  2  171 ? 68.004  52.476  87.598  1.00 85.46  ? 169  LYS B CB    1 
ATOM   4594  C  CG    . LYS B  2  171 ? 67.211  51.157  87.630  1.00 87.81  ? 169  LYS B CG    1 
ATOM   4595  C  CD    . LYS B  2  171 ? 67.889  50.084  88.510  1.00 88.72  ? 169  LYS B CD    1 
ATOM   4596  C  CE    . LYS B  2  171 ? 67.032  48.812  88.625  1.00 89.05  ? 169  LYS B CE    1 
ATOM   4597  N  NZ    . LYS B  2  171 ? 67.605  47.769  89.529  1.00 88.97  ? 169  LYS B NZ    1 
ATOM   4598  N  N     . THR B  2  172 ? 68.822  55.454  86.321  1.00 81.16  ? 170  THR B N     1 
ATOM   4599  C  CA    . THR B  2  172 ? 69.552  56.691  86.564  1.00 81.19  ? 170  THR B CA    1 
ATOM   4600  C  C     . THR B  2  172 ? 70.154  57.344  85.321  1.00 80.86  ? 170  THR B C     1 
ATOM   4601  O  O     . THR B  2  172 ? 69.930  56.903  84.191  1.00 80.34  ? 170  THR B O     1 
ATOM   4602  C  CB    . THR B  2  172 ? 70.682  56.450  87.538  1.00 81.18  ? 170  THR B CB    1 
ATOM   4603  O  OG1   . THR B  2  172 ? 71.272  55.180  87.242  1.00 82.14  ? 170  THR B OG1   1 
ATOM   4604  C  CG2   . THR B  2  172 ? 70.178  56.470  88.963  1.00 81.18  ? 170  THR B CG2   1 
ATOM   4605  N  N     . ALA B  2  173 ? 70.920  58.406  85.559  1.00 80.47  ? 171  ALA B N     1 
ATOM   4606  C  CA    . ALA B  2  173 ? 71.586  59.154  84.502  1.00 80.21  ? 171  ALA B CA    1 
ATOM   4607  C  C     . ALA B  2  173 ? 70.751  59.288  83.228  1.00 79.27  ? 171  ALA B C     1 
ATOM   4608  O  O     . ALA B  2  173 ? 70.101  60.307  82.990  1.00 78.23  ? 171  ALA B O     1 
ATOM   4609  C  CB    . ALA B  2  173 ? 72.929  58.498  84.186  1.00 81.04  ? 171  ALA B CB    1 
ATOM   4610  N  N     . LEU B  2  174 ? 70.780  58.260  82.399  1.00 79.16  ? 172  LEU B N     1 
ATOM   4611  C  CA    . LEU B  2  174 ? 70.015  58.310  81.177  1.00 80.12  ? 172  LEU B CA    1 
ATOM   4612  C  C     . LEU B  2  174 ? 68.529  58.367  81.498  1.00 80.58  ? 172  LEU B C     1 
ATOM   4613  O  O     . LEU B  2  174 ? 67.742  58.935  80.746  1.00 80.75  ? 172  LEU B O     1 
ATOM   4614  C  CB    . LEU B  2  174 ? 70.330  57.098  80.295  1.00 80.05  ? 172  LEU B CB    1 
ATOM   4615  C  CG    . LEU B  2  174 ? 71.752  57.002  79.723  1.00 80.40  ? 172  LEU B CG    1 
ATOM   4616  C  CD1   . LEU B  2  174 ? 71.751  55.963  78.635  1.00 79.75  ? 172  LEU B CD1   1 
ATOM   4617  C  CD2   . LEU B  2  174 ? 72.217  58.333  79.132  1.00 80.66  ? 172  LEU B CD2   1 
ATOM   4618  N  N     . ALA B  2  175 ? 68.134  57.789  82.620  1.00 81.34  ? 173  ALA B N     1 
ATOM   4619  C  CA    . ALA B  2  175 ? 66.725  57.815  82.970  1.00 82.88  ? 173  ALA B CA    1 
ATOM   4620  C  C     . ALA B  2  175 ? 66.291  59.236  83.280  1.00 84.39  ? 173  ALA B C     1 
ATOM   4621  O  O     . ALA B  2  175 ? 65.092  59.505  83.351  1.00 84.98  ? 173  ALA B O     1 
ATOM   4622  C  CB    . ALA B  2  175 ? 66.456  56.919  84.166  1.00 82.32  ? 173  ALA B CB    1 
ATOM   4623  N  N     . ASN B  2  176 ? 67.261  60.138  83.466  1.00 85.94  ? 174  ASN B N     1 
ATOM   4624  C  CA    . ASN B  2  176 ? 66.972  61.541  83.793  1.00 87.50  ? 174  ASN B CA    1 
ATOM   4625  C  C     . ASN B  2  176 ? 66.433  62.335  82.614  1.00 87.79  ? 174  ASN B C     1 
ATOM   4626  O  O     . ASN B  2  176 ? 67.058  62.375  81.557  1.00 88.34  ? 174  ASN B O     1 
ATOM   4627  C  CB    . ASN B  2  176 ? 68.213  62.242  84.364  1.00 88.11  ? 174  ASN B CB    1 
ATOM   4628  C  CG    . ASN B  2  176 ? 68.409  61.954  85.848  1.00 89.52  ? 174  ASN B CG    1 
ATOM   4629  O  OD1   . ASN B  2  176 ? 67.434  61.865  86.604  1.00 88.83  ? 174  ASN B OD1   1 
ATOM   4630  N  ND2   . ASN B  2  176 ? 69.667  61.821  86.277  1.00 89.99  ? 174  ASN B ND2   1 
ATOM   4631  N  N     . PRO B  2  177 ? 65.265  62.990  82.792  1.00 87.81  ? 175  PRO B N     1 
ATOM   4632  C  CA    . PRO B  2  177 ? 64.579  63.802  81.776  1.00 87.15  ? 175  PRO B CA    1 
ATOM   4633  C  C     . PRO B  2  177 ? 65.401  64.921  81.143  1.00 86.47  ? 175  PRO B C     1 
ATOM   4634  O  O     . PRO B  2  177 ? 66.248  65.554  81.802  1.00 86.87  ? 175  PRO B O     1 
ATOM   4635  C  CB    . PRO B  2  177 ? 63.351  64.322  82.521  1.00 87.44  ? 175  PRO B CB    1 
ATOM   4636  C  CG    . PRO B  2  177 ? 63.818  64.388  83.928  1.00 87.24  ? 175  PRO B CG    1 
ATOM   4637  C  CD    . PRO B  2  177 ? 64.556  63.088  84.080  1.00 87.45  ? 175  PRO B CD    1 
ATOM   4638  N  N     . LEU B  2  178 ? 65.112  65.155  79.861  1.00 84.23  ? 176  LEU B N     1 
ATOM   4639  C  CA    . LEU B  2  178 ? 65.801  66.144  79.047  1.00 82.62  ? 176  LEU B CA    1 
ATOM   4640  C  C     . LEU B  2  178 ? 65.325  67.573  79.242  1.00 82.79  ? 176  LEU B C     1 
ATOM   4641  O  O     . LEU B  2  178 ? 66.058  68.530  78.969  1.00 83.02  ? 176  LEU B O     1 
ATOM   4642  C  CB    . LEU B  2  178 ? 65.669  65.751  77.585  1.00 80.44  ? 176  LEU B CB    1 
ATOM   4643  C  CG    . LEU B  2  178 ? 66.485  66.619  76.641  1.00 80.98  ? 176  LEU B CG    1 
ATOM   4644  C  CD1   . LEU B  2  178 ? 67.847  66.991  77.256  1.00 81.36  ? 176  LEU B CD1   1 
ATOM   4645  C  CD2   . LEU B  2  178 ? 66.646  65.854  75.350  1.00 81.25  ? 176  LEU B CD2   1 
ATOM   4646  N  N     . TYR B  2  179 ? 64.091  67.705  79.719  1.00 82.92  ? 177  TYR B N     1 
ATOM   4647  C  CA    . TYR B  2  179 ? 63.461  69.000  79.974  1.00 81.72  ? 177  TYR B CA    1 
ATOM   4648  C  C     . TYR B  2  179 ? 63.089  69.106  81.465  1.00 80.82  ? 177  TYR B C     1 
ATOM   4649  O  O     . TYR B  2  179 ? 62.109  68.501  81.921  1.00 79.70  ? 177  TYR B O     1 
ATOM   4650  C  CB    . TYR B  2  179 ? 62.197  69.139  79.110  1.00 81.84  ? 177  TYR B CB    1 
ATOM   4651  C  CG    . TYR B  2  179 ? 62.422  69.247  77.609  1.00 80.33  ? 177  TYR B CG    1 
ATOM   4652  C  CD1   . TYR B  2  179 ? 61.573  68.589  76.718  1.00 79.39  ? 177  TYR B CD1   1 
ATOM   4653  C  CD2   . TYR B  2  179 ? 63.426  70.065  77.081  1.00 79.77  ? 177  TYR B CD2   1 
ATOM   4654  C  CE1   . TYR B  2  179 ? 61.705  68.743  75.340  1.00 79.78  ? 177  TYR B CE1   1 
ATOM   4655  C  CE2   . TYR B  2  179 ? 63.567  70.230  75.698  1.00 80.10  ? 177  TYR B CE2   1 
ATOM   4656  C  CZ    . TYR B  2  179 ? 62.694  69.566  74.833  1.00 80.33  ? 177  TYR B CZ    1 
ATOM   4657  O  OH    . TYR B  2  179 ? 62.769  69.746  73.465  1.00 80.37  ? 177  TYR B OH    1 
ATOM   4658  N  N     . CYS B  2  180 ? 63.891  69.864  82.211  1.00 80.10  ? 178  CYS B N     1 
ATOM   4659  C  CA    . CYS B  2  180 ? 63.688  70.073  83.643  1.00 79.95  ? 178  CYS B CA    1 
ATOM   4660  C  C     . CYS B  2  180 ? 62.264  69.758  84.066  1.00 81.35  ? 178  CYS B C     1 
ATOM   4661  O  O     . CYS B  2  180 ? 61.332  70.330  83.543  1.00 82.30  ? 178  CYS B O     1 
ATOM   4662  C  CB    . CYS B  2  180 ? 64.013  71.524  83.995  1.00 78.09  ? 178  CYS B CB    1 
ATOM   4663  S  SG    . CYS B  2  180 ? 63.339  72.075  85.569  1.00 73.57  ? 178  CYS B SG    1 
ATOM   4664  N  N     . PRO B  2  181 ? 62.074  68.840  85.017  1.00 82.79  ? 179  PRO B N     1 
ATOM   4665  C  CA    . PRO B  2  181 ? 60.702  68.531  85.431  1.00 84.35  ? 179  PRO B CA    1 
ATOM   4666  C  C     . PRO B  2  181 ? 60.014  69.743  86.049  1.00 85.81  ? 179  PRO B C     1 
ATOM   4667  O  O     . PRO B  2  181 ? 60.670  70.719  86.431  1.00 84.98  ? 179  PRO B O     1 
ATOM   4668  C  CB    . PRO B  2  181 ? 60.887  67.393  86.425  1.00 84.02  ? 179  PRO B CB    1 
ATOM   4669  C  CG    . PRO B  2  181 ? 62.211  67.733  87.046  1.00 84.07  ? 179  PRO B CG    1 
ATOM   4670  C  CD    . PRO B  2  181 ? 63.055  68.144  85.862  1.00 83.01  ? 179  PRO B CD    1 
ATOM   4671  N  N     . ASP B  2  182 ? 58.691  69.668  86.145  1.00 88.23  ? 180  ASP B N     1 
ATOM   4672  C  CA    . ASP B  2  182 ? 57.889  70.761  86.686  1.00 90.83  ? 180  ASP B CA    1 
ATOM   4673  C  C     . ASP B  2  182 ? 58.387  71.279  88.035  1.00 91.20  ? 180  ASP B C     1 
ATOM   4674  O  O     . ASP B  2  182 ? 59.009  72.342  88.117  1.00 91.41  ? 180  ASP B O     1 
ATOM   4675  C  CB    . ASP B  2  182 ? 56.415  70.336  86.833  1.00 92.54  ? 180  ASP B CB    1 
ATOM   4676  C  CG    . ASP B  2  182 ? 55.760  69.982  85.502  1.00 93.96  ? 180  ASP B CG    1 
ATOM   4677  O  OD1   . ASP B  2  182 ? 55.877  70.782  84.540  1.00 94.98  ? 180  ASP B OD1   1 
ATOM   4678  O  OD2   . ASP B  2  182 ? 55.118  68.907  85.427  1.00 93.95  ? 180  ASP B OD2   1 
ATOM   4679  N  N     . TYR B  2  183 ? 58.102  70.514  89.085  1.00 91.22  ? 181  TYR B N     1 
ATOM   4680  C  CA    . TYR B  2  183 ? 58.468  70.875  90.449  1.00 90.69  ? 181  TYR B CA    1 
ATOM   4681  C  C     . TYR B  2  183 ? 59.763  71.682  90.600  1.00 88.56  ? 181  TYR B C     1 
ATOM   4682  O  O     . TYR B  2  183 ? 59.817  72.633  91.381  1.00 88.38  ? 181  TYR B O     1 
ATOM   4683  C  CB    . TYR B  2  183 ? 58.495  69.605  91.328  1.00 93.27  ? 181  TYR B CB    1 
ATOM   4684  C  CG    . TYR B  2  183 ? 59.859  69.000  91.651  1.00 95.52  ? 181  TYR B CG    1 
ATOM   4685  C  CD1   . TYR B  2  183 ? 60.754  69.648  92.506  1.00 97.02  ? 181  TYR B CD1   1 
ATOM   4686  C  CD2   . TYR B  2  183 ? 60.217  67.742  91.167  1.00 96.15  ? 181  TYR B CD2   1 
ATOM   4687  C  CE1   . TYR B  2  183 ? 61.962  69.055  92.876  1.00 97.85  ? 181  TYR B CE1   1 
ATOM   4688  C  CE2   . TYR B  2  183 ? 61.425  67.142  91.531  1.00 96.94  ? 181  TYR B CE2   1 
ATOM   4689  C  CZ    . TYR B  2  183 ? 62.289  67.804  92.387  1.00 97.77  ? 181  TYR B CZ    1 
ATOM   4690  O  OH    . TYR B  2  183 ? 63.473  67.219  92.779  1.00 98.75  ? 181  TYR B OH    1 
ATOM   4691  N  N     . ARG B  2  184 ? 60.797  71.327  89.850  1.00 85.70  ? 182  ARG B N     1 
ATOM   4692  C  CA    . ARG B  2  184 ? 62.055  72.044  89.973  1.00 83.15  ? 182  ARG B CA    1 
ATOM   4693  C  C     . ARG B  2  184 ? 62.136  73.393  89.268  1.00 82.88  ? 182  ARG B C     1 
ATOM   4694  O  O     . ARG B  2  184 ? 63.168  74.067  89.322  1.00 82.29  ? 182  ARG B O     1 
ATOM   4695  C  CB    . ARG B  2  184 ? 63.214  71.157  89.520  1.00 81.10  ? 182  ARG B CB    1 
ATOM   4696  C  CG    . ARG B  2  184 ? 63.693  70.197  90.588  1.00 76.35  ? 182  ARG B CG    1 
ATOM   4697  C  CD    . ARG B  2  184 ? 65.075  69.656  90.281  1.00 73.34  ? 182  ARG B CD    1 
ATOM   4698  N  NE    . ARG B  2  184 ? 66.097  70.702  90.208  1.00 69.75  ? 182  ARG B NE    1 
ATOM   4699  C  CZ    . ARG B  2  184 ? 66.484  71.459  91.233  1.00 67.56  ? 182  ARG B CZ    1 
ATOM   4700  N  NH1   . ARG B  2  184 ? 65.937  71.295  92.431  1.00 66.07  ? 182  ARG B NH1   1 
ATOM   4701  N  NH2   . ARG B  2  184 ? 67.421  72.383  91.060  1.00 65.07  ? 182  ARG B NH2   1 
ATOM   4702  N  N     . ILE B  2  185 ? 61.062  73.803  88.608  1.00 82.80  ? 183  ILE B N     1 
ATOM   4703  C  CA    . ILE B  2  185 ? 61.097  75.090  87.931  1.00 82.76  ? 183  ILE B CA    1 
ATOM   4704  C  C     . ILE B  2  185 ? 61.273  76.223  88.922  1.00 83.03  ? 183  ILE B C     1 
ATOM   4705  O  O     . ILE B  2  185 ? 60.386  76.490  89.745  1.00 82.10  ? 183  ILE B O     1 
ATOM   4706  C  CB    . ILE B  2  185 ? 59.817  75.370  87.116  1.00 81.95  ? 183  ILE B CB    1 
ATOM   4707  C  CG1   . ILE B  2  185 ? 59.817  74.526  85.853  1.00 80.91  ? 183  ILE B CG1   1 
ATOM   4708  C  CG2   . ILE B  2  185 ? 59.767  76.836  86.704  1.00 81.78  ? 183  ILE B CG2   1 
ATOM   4709  C  CD1   . ILE B  2  185 ? 61.003  74.786  84.998  1.00 80.19  ? 183  ILE B CD1   1 
ATOM   4710  N  N     . GLY B  2  186 ? 62.431  76.873  88.836  1.00 83.31  ? 184  GLY B N     1 
ATOM   4711  C  CA    . GLY B  2  186 ? 62.720  78.006  89.693  1.00 84.06  ? 184  GLY B CA    1 
ATOM   4712  C  C     . GLY B  2  186 ? 63.539  77.753  90.940  1.00 84.13  ? 184  GLY B C     1 
ATOM   4713  O  O     . GLY B  2  186 ? 64.093  78.697  91.514  1.00 84.10  ? 184  GLY B O     1 
ATOM   4714  N  N     . LYS B  2  187 ? 63.621  76.498  91.368  1.00 84.27  ? 185  LYS B N     1 
ATOM   4715  C  CA    . LYS B  2  187 ? 64.370  76.174  92.576  1.00 84.73  ? 185  LYS B CA    1 
ATOM   4716  C  C     . LYS B  2  187 ? 65.847  75.917  92.296  1.00 84.99  ? 185  LYS B C     1 
ATOM   4717  O  O     . LYS B  2  187 ? 66.627  75.628  93.211  1.00 84.44  ? 185  LYS B O     1 
ATOM   4718  C  CB    . LYS B  2  187 ? 63.722  74.979  93.295  1.00 84.94  ? 185  LYS B CB    1 
ATOM   4719  C  CG    . LYS B  2  187 ? 62.294  75.280  93.769  1.00 85.65  ? 185  LYS B CG    1 
ATOM   4720  C  CD    . LYS B  2  187 ? 61.665  74.146  94.584  1.00 85.79  ? 185  LYS B CD    1 
ATOM   4721  C  CE    . LYS B  2  187 ? 60.247  74.510  95.080  1.00 85.35  ? 185  LYS B CE    1 
ATOM   4722  N  NZ    . LYS B  2  187 ? 60.180  75.739  95.948  1.00 82.83  ? 185  LYS B NZ    1 
ATOM   4723  N  N     . ILE B  2  188 ? 66.225  76.044  91.026  1.00 85.04  ? 186  ILE B N     1 
ATOM   4724  C  CA    . ILE B  2  188 ? 67.607  75.858  90.613  1.00 85.58  ? 186  ILE B CA    1 
ATOM   4725  C  C     . ILE B  2  188 ? 68.357  77.113  91.037  1.00 86.79  ? 186  ILE B C     1 
ATOM   4726  O  O     . ILE B  2  188 ? 67.834  78.221  90.937  1.00 87.24  ? 186  ILE B O     1 
ATOM   4727  C  CB    . ILE B  2  188 ? 67.705  75.707  89.109  1.00 85.11  ? 186  ILE B CB    1 
ATOM   4728  C  CG1   . ILE B  2  188 ? 66.711  74.646  88.641  1.00 85.65  ? 186  ILE B CG1   1 
ATOM   4729  C  CG2   . ILE B  2  188 ? 69.117  75.335  88.725  1.00 84.88  ? 186  ILE B CG2   1 
ATOM   4730  C  CD1   . ILE B  2  188 ? 66.517  74.600  87.131  1.00 86.43  ? 186  ILE B CD1   1 
ATOM   4731  N  N     . THR B  2  189 ? 69.586  76.943  91.501  1.00 87.92  ? 187  THR B N     1 
ATOM   4732  C  CA    . THR B  2  189 ? 70.372  78.068  91.981  1.00 88.66  ? 187  THR B CA    1 
ATOM   4733  C  C     . THR B  2  189 ? 71.417  78.532  90.995  1.00 89.31  ? 187  THR B C     1 
ATOM   4734  O  O     . THR B  2  189 ? 71.665  77.879  89.984  1.00 89.11  ? 187  THR B O     1 
ATOM   4735  C  CB    . THR B  2  189 ? 71.098  77.699  93.275  1.00 89.23  ? 187  THR B CB    1 
ATOM   4736  O  OG1   . THR B  2  189 ? 72.140  76.760  92.977  1.00 89.78  ? 187  THR B OG1   1 
ATOM   4737  C  CG2   . THR B  2  189 ? 70.126  77.060  94.273  1.00 89.20  ? 187  THR B CG2   1 
ATOM   4738  N  N     . SER B  2  190 ? 72.033  79.667  91.306  1.00 90.40  ? 188  SER B N     1 
ATOM   4739  C  CA    . SER B  2  190 ? 73.083  80.215  90.472  1.00 92.63  ? 188  SER B CA    1 
ATOM   4740  C  C     . SER B  2  190 ? 74.318  79.355  90.688  1.00 94.84  ? 188  SER B C     1 
ATOM   4741  O  O     . SER B  2  190 ? 75.295  79.451  89.951  1.00 95.26  ? 188  SER B O     1 
ATOM   4742  C  CB    . SER B  2  190 ? 73.361  81.651  90.872  1.00 91.73  ? 188  SER B CB    1 
ATOM   4743  O  OG    . SER B  2  190 ? 72.132  82.339  91.003  1.00 91.62  ? 188  SER B OG    1 
ATOM   4744  N  N     . GLU B  2  191 ? 74.275  78.518  91.719  1.00 97.54  ? 189  GLU B N     1 
ATOM   4745  C  CA    . GLU B  2  191 ? 75.382  77.608  91.993  1.00 99.86  ? 189  GLU B CA    1 
ATOM   4746  C  C     . GLU B  2  191 ? 75.181  76.375  91.121  1.00 99.82  ? 189  GLU B C     1 
ATOM   4747  O  O     . GLU B  2  191 ? 75.952  76.139  90.189  1.00 98.71  ? 189  GLU B O     1 
ATOM   4748  C  CB    . GLU B  2  191 ? 75.424  77.167  93.470  1.00 102.46 ? 189  GLU B CB    1 
ATOM   4749  C  CG    . GLU B  2  191 ? 75.930  78.212  94.462  1.00 106.49 ? 189  GLU B CG    1 
ATOM   4750  C  CD    . GLU B  2  191 ? 74.805  78.872  95.253  1.00 109.15 ? 189  GLU B CD    1 
ATOM   4751  O  OE1   . GLU B  2  191 ? 74.173  78.188  96.094  1.00 110.14 ? 189  GLU B OE1   1 
ATOM   4752  O  OE2   . GLU B  2  191 ? 74.551  80.076  95.029  1.00 110.93 ? 189  GLU B OE2   1 
ATOM   4753  N  N     . GLN B  2  192 ? 74.129  75.609  91.428  1.00 100.25 ? 190  GLN B N     1 
ATOM   4754  C  CA    . GLN B  2  192 ? 73.816  74.385  90.698  1.00 100.64 ? 190  GLN B CA    1 
ATOM   4755  C  C     . GLN B  2  192 ? 74.200  74.546  89.245  1.00 101.51 ? 190  GLN B C     1 
ATOM   4756  O  O     . GLN B  2  192 ? 74.567  73.581  88.583  1.00 101.03 ? 190  GLN B O     1 
ATOM   4757  C  CB    . GLN B  2  192 ? 72.330  74.031  90.826  1.00 99.62  ? 190  GLN B CB    1 
ATOM   4758  C  CG    . GLN B  2  192 ? 71.881  73.757  92.258  1.00 98.20  ? 190  GLN B CG    1 
ATOM   4759  C  CD    . GLN B  2  192 ? 70.609  72.928  92.331  1.00 97.63  ? 190  GLN B CD    1 
ATOM   4760  O  OE1   . GLN B  2  192 ? 69.617  73.228  91.667  1.00 96.60  ? 190  GLN B OE1   1 
ATOM   4761  N  NE2   . GLN B  2  192 ? 70.633  71.882  93.148  1.00 97.16  ? 190  GLN B NE2   1 
ATOM   4762  N  N     . LEU B  2  193 ? 74.110  75.774  88.753  1.00 103.37 ? 191  LEU B N     1 
ATOM   4763  C  CA    . LEU B  2  193 ? 74.499  76.060  87.387  1.00 106.09 ? 191  LEU B CA    1 
ATOM   4764  C  C     . LEU B  2  193 ? 76.021  76.108  87.386  1.00 107.49 ? 191  LEU B C     1 
ATOM   4765  O  O     . LEU B  2  193 ? 76.681  75.285  86.755  1.00 108.73 ? 191  LEU B O     1 
ATOM   4766  C  CB    . LEU B  2  193 ? 73.946  77.408  86.930  1.00 106.38 ? 191  LEU B CB    1 
ATOM   4767  C  CG    . LEU B  2  193 ? 72.468  77.557  86.584  1.00 106.51 ? 191  LEU B CG    1 
ATOM   4768  C  CD1   . LEU B  2  193 ? 72.257  78.947  86.012  1.00 106.32 ? 191  LEU B CD1   1 
ATOM   4769  C  CD2   . LEU B  2  193 ? 72.048  76.491  85.573  1.00 106.79 ? 191  LEU B CD2   1 
ATOM   4770  N  N     . HIS B  2  194 ? 76.577  77.074  88.104  1.00 108.31 ? 192  HIS B N     1 
ATOM   4771  C  CA    . HIS B  2  194 ? 78.018  77.209  88.186  1.00 109.56 ? 192  HIS B CA    1 
ATOM   4772  C  C     . HIS B  2  194 ? 78.712  75.867  88.341  1.00 110.30 ? 192  HIS B C     1 
ATOM   4773  O  O     . HIS B  2  194 ? 79.443  75.431  87.453  1.00 109.75 ? 192  HIS B O     1 
ATOM   4774  C  CB    . HIS B  2  194 ? 78.382  78.096  89.361  1.00 110.63 ? 192  HIS B CB    1 
ATOM   4775  C  CG    . HIS B  2  194 ? 78.774  79.480  88.965  1.00 112.12 ? 192  HIS B CG    1 
ATOM   4776  N  ND1   . HIS B  2  194 ? 78.159  80.603  89.476  1.00 112.76 ? 192  HIS B ND1   1 
ATOM   4777  C  CD2   . HIS B  2  194 ? 79.731  79.924  88.117  1.00 112.65 ? 192  HIS B CD2   1 
ATOM   4778  C  CE1   . HIS B  2  194 ? 78.720  81.681  88.960  1.00 113.50 ? 192  HIS B CE1   1 
ATOM   4779  N  NE2   . HIS B  2  194 ? 79.676  81.296  88.132  1.00 113.87 ? 192  HIS B NE2   1 
ATOM   4780  N  N     . HIS B  2  195 ? 78.477  75.213  89.475  1.00 111.54 ? 193  HIS B N     1 
ATOM   4781  C  CA    . HIS B  2  195 ? 79.095  73.924  89.747  1.00 113.20 ? 193  HIS B CA    1 
ATOM   4782  C  C     . HIS B  2  195 ? 78.877  72.927  88.616  1.00 113.33 ? 193  HIS B C     1 
ATOM   4783  O  O     . HIS B  2  195 ? 79.702  72.045  88.402  1.00 114.24 ? 193  HIS B O     1 
ATOM   4784  C  CB    . HIS B  2  195 ? 78.583  73.337  91.075  1.00 115.26 ? 193  HIS B CB    1 
ATOM   4785  C  CG    . HIS B  2  195 ? 78.986  74.132  92.283  1.00 118.23 ? 193  HIS B CG    1 
ATOM   4786  N  ND1   . HIS B  2  195 ? 80.266  74.617  92.464  1.00 119.22 ? 193  HIS B ND1   1 
ATOM   4787  C  CD2   . HIS B  2  195 ? 78.277  74.533  93.367  1.00 119.00 ? 193  HIS B CD2   1 
ATOM   4788  C  CE1   . HIS B  2  195 ? 80.327  75.285  93.604  1.00 119.34 ? 193  HIS B CE1   1 
ATOM   4789  N  NE2   . HIS B  2  195 ? 79.134  75.249  94.171  1.00 119.75 ? 193  HIS B NE2   1 
ATOM   4790  N  N     . PHE B  2  196 ? 77.780  73.062  87.879  1.00 113.02 ? 194  PHE B N     1 
ATOM   4791  C  CA    . PHE B  2  196 ? 77.520  72.137  86.780  1.00 112.15 ? 194  PHE B CA    1 
ATOM   4792  C  C     . PHE B  2  196 ? 78.426  72.424  85.587  1.00 113.61 ? 194  PHE B C     1 
ATOM   4793  O  O     . PHE B  2  196 ? 78.573  71.589  84.702  1.00 114.16 ? 194  PHE B O     1 
ATOM   4794  C  CB    . PHE B  2  196 ? 76.063  72.214  86.328  1.00 108.42 ? 194  PHE B CB    1 
ATOM   4795  C  CG    . PHE B  2  196 ? 75.694  71.164  85.329  1.00 104.04 ? 194  PHE B CG    1 
ATOM   4796  C  CD1   . PHE B  2  196 ? 75.162  69.955  85.744  1.00 102.17 ? 194  PHE B CD1   1 
ATOM   4797  C  CD2   . PHE B  2  196 ? 75.915  71.370  83.971  1.00 102.54 ? 194  PHE B CD2   1 
ATOM   4798  C  CE1   . PHE B  2  196 ? 74.856  68.961  84.825  1.00 101.34 ? 194  PHE B CE1   1 
ATOM   4799  C  CE2   . PHE B  2  196 ? 75.614  70.384  83.046  1.00 101.28 ? 194  PHE B CE2   1 
ATOM   4800  C  CZ    . PHE B  2  196 ? 75.083  69.175  83.473  1.00 101.11 ? 194  PHE B CZ    1 
ATOM   4801  N  N     . VAL B  2  197 ? 79.029  73.605  85.555  1.00 115.21 ? 195  VAL B N     1 
ATOM   4802  C  CA    . VAL B  2  197 ? 79.925  73.950  84.458  1.00 117.57 ? 195  VAL B CA    1 
ATOM   4803  C  C     . VAL B  2  197 ? 81.382  73.660  84.811  1.00 119.08 ? 195  VAL B C     1 
ATOM   4804  O  O     . VAL B  2  197 ? 82.128  73.074  84.017  1.00 119.58 ? 195  VAL B O     1 
ATOM   4805  C  CB    . VAL B  2  197 ? 79.784  75.433  84.074  1.00 117.80 ? 195  VAL B CB    1 
ATOM   4806  C  CG1   . VAL B  2  197 ? 81.014  75.911  83.283  1.00 117.66 ? 195  VAL B CG1   1 
ATOM   4807  C  CG2   . VAL B  2  197 ? 78.528  75.607  83.249  1.00 117.92 ? 195  VAL B CG2   1 
ATOM   4808  N  N     . GLN B  2  198 ? 81.784  74.076  86.007  1.00 120.05 ? 196  GLN B N     1 
ATOM   4809  C  CA    . GLN B  2  198 ? 83.151  73.859  86.468  1.00 120.43 ? 196  GLN B CA    1 
ATOM   4810  C  C     . GLN B  2  198 ? 83.437  72.352  86.542  1.00 119.66 ? 196  GLN B C     1 
ATOM   4811  O  O     . GLN B  2  198 ? 84.578  71.917  86.359  1.00 119.91 ? 196  GLN B O     1 
ATOM   4812  C  CB    . GLN B  2  198 ? 83.343  74.509  87.850  1.00 121.47 ? 196  GLN B CB    1 
ATOM   4813  C  CG    . GLN B  2  198 ? 82.831  75.959  87.941  1.00 122.34 ? 196  GLN B CG    1 
ATOM   4814  C  CD    . GLN B  2  198 ? 82.943  76.562  89.343  1.00 122.69 ? 196  GLN B CD    1 
ATOM   4815  O  OE1   . GLN B  2  198 ? 82.366  76.052  90.310  1.00 122.28 ? 196  GLN B OE1   1 
ATOM   4816  N  NE2   . GLN B  2  198 ? 83.684  77.660  89.452  1.00 122.36 ? 196  GLN B NE2   1 
ATOM   4817  N  N     . ASN B  2  199 ? 82.389  71.566  86.794  1.00 118.31 ? 197  ASN B N     1 
ATOM   4818  C  CA    . ASN B  2  199 ? 82.508  70.113  86.908  1.00 117.03 ? 197  ASN B CA    1 
ATOM   4819  C  C     . ASN B  2  199 ? 82.227  69.325  85.625  1.00 115.74 ? 197  ASN B C     1 
ATOM   4820  O  O     . ASN B  2  199 ? 82.380  68.104  85.609  1.00 116.43 ? 197  ASN B O     1 
ATOM   4821  C  CB    . ASN B  2  199 ? 81.591  69.570  88.027  1.00 117.32 ? 197  ASN B CB    1 
ATOM   4822  C  CG    . ASN B  2  199 ? 82.127  69.855  89.439  1.00 117.42 ? 197  ASN B CG    1 
ATOM   4823  O  OD1   . ASN B  2  199 ? 83.312  69.663  89.724  1.00 116.83 ? 197  ASN B OD1   1 
ATOM   4824  N  ND2   . ASN B  2  199 ? 81.240  70.292  90.330  1.00 117.56 ? 197  ASN B ND2   1 
ATOM   4825  N  N     . ASN B  2  200 ? 81.832  69.996  84.549  1.00 113.41 ? 198  ASN B N     1 
ATOM   4826  C  CA    . ASN B  2  200 ? 81.543  69.271  83.322  1.00 111.56 ? 198  ASN B CA    1 
ATOM   4827  C  C     . ASN B  2  200 ? 82.139  69.904  82.099  1.00 111.15 ? 198  ASN B C     1 
ATOM   4828  O  O     . ASN B  2  200 ? 82.497  69.211  81.160  1.00 111.12 ? 198  ASN B O     1 
ATOM   4829  C  CB    . ASN B  2  200 ? 80.040  69.131  83.145  1.00 110.93 ? 198  ASN B CB    1 
ATOM   4830  C  CG    . ASN B  2  200 ? 79.430  68.201  84.163  1.00 110.75 ? 198  ASN B CG    1 
ATOM   4831  O  OD1   . ASN B  2  200 ? 79.366  66.992  83.949  1.00 109.98 ? 198  ASN B OD1   1 
ATOM   4832  N  ND2   . ASN B  2  200 ? 78.995  68.757  85.294  1.00 111.17 ? 198  ASN B ND2   1 
ATOM   4833  N  N     . PHE B  2  201 ? 82.234  71.223  82.101  1.00 111.60 ? 199  PHE B N     1 
ATOM   4834  C  CA    . PHE B  2  201 ? 82.810  71.932  80.970  1.00 112.76 ? 199  PHE B CA    1 
ATOM   4835  C  C     . PHE B  2  201 ? 84.303  72.032  81.219  1.00 112.42 ? 199  PHE B C     1 
ATOM   4836  O  O     . PHE B  2  201 ? 84.829  73.119  81.448  1.00 112.77 ? 199  PHE B O     1 
ATOM   4837  C  CB    . PHE B  2  201 ? 82.193  73.329  80.839  1.00 114.70 ? 199  PHE B CB    1 
ATOM   4838  C  CG    . PHE B  2  201 ? 80.790  73.328  80.277  1.00 117.04 ? 199  PHE B CG    1 
ATOM   4839  C  CD1   . PHE B  2  201 ? 79.886  72.312  80.606  1.00 118.13 ? 199  PHE B CD1   1 
ATOM   4840  C  CD2   . PHE B  2  201 ? 80.363  74.356  79.441  1.00 117.57 ? 199  PHE B CD2   1 
ATOM   4841  C  CE1   . PHE B  2  201 ? 78.576  72.317  80.113  1.00 117.99 ? 199  PHE B CE1   1 
ATOM   4842  C  CE2   . PHE B  2  201 ? 79.055  74.371  78.942  1.00 118.48 ? 199  PHE B CE2   1 
ATOM   4843  C  CZ    . PHE B  2  201 ? 78.160  73.346  79.281  1.00 118.26 ? 199  PHE B CZ    1 
ATOM   4844  N  N     . THR B  2  202 ? 84.968  70.878  81.179  1.00 111.81 ? 200  THR B N     1 
ATOM   4845  C  CA    . THR B  2  202 ? 86.413  70.759  81.401  1.00 110.53 ? 200  THR B CA    1 
ATOM   4846  C  C     . THR B  2  202 ? 87.148  70.406  80.102  1.00 109.18 ? 200  THR B C     1 
ATOM   4847  O  O     . THR B  2  202 ? 86.836  69.407  79.464  1.00 108.78 ? 200  THR B O     1 
ATOM   4848  C  CB    . THR B  2  202 ? 86.701  69.658  82.420  1.00 111.19 ? 200  THR B CB    1 
ATOM   4849  O  OG1   . THR B  2  202 ? 86.398  68.388  81.831  1.00 111.29 ? 200  THR B OG1   1 
ATOM   4850  C  CG2   . THR B  2  202 ? 85.840  69.848  83.669  1.00 111.16 ? 200  THR B CG2   1 
ATOM   4851  N  N     . SER B  2  203 ? 88.137  71.215  79.737  1.00 107.81 ? 201  SER B N     1 
ATOM   4852  C  CA    . SER B  2  203 ? 88.906  71.028  78.508  1.00 107.58 ? 201  SER B CA    1 
ATOM   4853  C  C     . SER B  2  203 ? 89.028  69.606  77.951  1.00 107.58 ? 201  SER B C     1 
ATOM   4854  O  O     . SER B  2  203 ? 89.129  69.427  76.737  1.00 107.39 ? 201  SER B O     1 
ATOM   4855  C  CB    . SER B  2  203 ? 90.307  71.603  78.680  1.00 107.36 ? 201  SER B CB    1 
ATOM   4856  O  OG    . SER B  2  203 ? 91.094  70.752  79.486  1.00 107.91 ? 201  SER B OG    1 
ATOM   4857  N  N     . ALA B  2  204 ? 89.028  68.598  78.818  1.00 107.81 ? 202  ALA B N     1 
ATOM   4858  C  CA    . ALA B  2  204 ? 89.155  67.208  78.372  1.00 108.36 ? 202  ALA B CA    1 
ATOM   4859  C  C     . ALA B  2  204 ? 87.891  66.670  77.710  1.00 108.91 ? 202  ALA B C     1 
ATOM   4860  O  O     . ALA B  2  204 ? 87.956  65.780  76.845  1.00 108.68 ? 202  ALA B O     1 
ATOM   4861  C  CB    . ALA B  2  204 ? 89.525  66.325  79.548  1.00 108.08 ? 202  ALA B CB    1 
ATOM   4862  N  N     . ARG B  2  205 ? 86.750  67.217  78.140  1.00 109.42 ? 203  ARG B N     1 
ATOM   4863  C  CA    . ARG B  2  205 ? 85.418  66.835  77.649  1.00 108.82 ? 203  ARG B CA    1 
ATOM   4864  C  C     . ARG B  2  205 ? 84.921  67.757  76.537  1.00 108.15 ? 203  ARG B C     1 
ATOM   4865  O  O     . ARG B  2  205 ? 83.874  67.504  75.941  1.00 108.57 ? 203  ARG B O     1 
ATOM   4866  C  CB    . ARG B  2  205 ? 84.401  66.862  78.800  1.00 108.08 ? 203  ARG B CB    1 
ATOM   4867  C  CG    . ARG B  2  205 ? 84.771  66.000  79.987  1.00 108.24 ? 203  ARG B CG    1 
ATOM   4868  C  CD    . ARG B  2  205 ? 84.245  66.614  81.260  1.00 109.09 ? 203  ARG B CD    1 
ATOM   4869  N  NE    . ARG B  2  205 ? 82.790  66.599  81.337  1.00 109.85 ? 203  ARG B NE    1 
ATOM   4870  C  CZ    . ARG B  2  205 ? 82.076  65.570  81.783  1.00 110.00 ? 203  ARG B CZ    1 
ATOM   4871  N  NH1   . ARG B  2  205 ? 82.680  64.459  82.195  1.00 109.65 ? 203  ARG B NH1   1 
ATOM   4872  N  NH2   . ARG B  2  205 ? 80.756  65.665  81.830  1.00 109.77 ? 203  ARG B NH2   1 
ATOM   4873  N  N     . MET B  2  206 ? 85.669  68.822  76.263  1.00 107.18 ? 204  MET B N     1 
ATOM   4874  C  CA    . MET B  2  206 ? 85.287  69.778  75.229  1.00 106.16 ? 204  MET B CA    1 
ATOM   4875  C  C     . MET B  2  206 ? 86.019  69.578  73.910  1.00 105.85 ? 204  MET B C     1 
ATOM   4876  O  O     . MET B  2  206 ? 87.178  69.167  73.879  1.00 105.98 ? 204  MET B O     1 
ATOM   4877  C  CB    . MET B  2  206 ? 85.523  71.201  75.723  1.00 105.45 ? 204  MET B CB    1 
ATOM   4878  C  CG    . MET B  2  206 ? 84.534  71.666  76.764  1.00 104.76 ? 204  MET B CG    1 
ATOM   4879  S  SD    . MET B  2  206 ? 85.175  73.079  77.667  1.00 104.72 ? 204  MET B SD    1 
ATOM   4880  C  CE    . MET B  2  206 ? 85.058  74.349  76.446  1.00 105.17 ? 204  MET B CE    1 
ATOM   4881  N  N     . ALA B  2  207 ? 85.327  69.886  72.820  1.00 105.21 ? 205  ALA B N     1 
ATOM   4882  C  CA    . ALA B  2  207 ? 85.882  69.746  71.484  1.00 104.74 ? 205  ALA B CA    1 
ATOM   4883  C  C     . ALA B  2  207 ? 85.479  70.946  70.628  1.00 104.66 ? 205  ALA B C     1 
ATOM   4884  O  O     . ALA B  2  207 ? 84.359  71.009  70.117  1.00 105.44 ? 205  ALA B O     1 
ATOM   4885  C  CB    . ALA B  2  207 ? 85.386  68.446  70.847  1.00 103.97 ? 205  ALA B CB    1 
ATOM   4886  N  N     . LEU B  2  208 ? 86.399  71.892  70.473  1.00 104.05 ? 206  LEU B N     1 
ATOM   4887  C  CA    . LEU B  2  208 ? 86.155  73.097  69.685  1.00 103.87 ? 206  LEU B CA    1 
ATOM   4888  C  C     . LEU B  2  208 ? 86.217  72.878  68.159  1.00 104.18 ? 206  LEU B C     1 
ATOM   4889  O  O     . LEU B  2  208 ? 87.147  73.346  67.490  1.00 103.95 ? 206  LEU B O     1 
ATOM   4890  C  CB    . LEU B  2  208 ? 87.162  74.164  70.097  1.00 103.21 ? 206  LEU B CB    1 
ATOM   4891  C  CG    . LEU B  2  208 ? 87.080  75.448  69.284  1.00 103.50 ? 206  LEU B CG    1 
ATOM   4892  C  CD1   . LEU B  2  208 ? 85.664  76.002  69.358  1.00 103.73 ? 206  LEU B CD1   1 
ATOM   4893  C  CD2   . LEU B  2  208 ? 88.093  76.444  69.805  1.00 103.92 ? 206  LEU B CD2   1 
ATOM   4894  N  N     . VAL B  2  209 ? 85.205  72.195  67.619  1.00 104.73 ? 207  VAL B N     1 
ATOM   4895  C  CA    . VAL B  2  209 ? 85.126  71.870  66.189  1.00 105.11 ? 207  VAL B CA    1 
ATOM   4896  C  C     . VAL B  2  209 ? 84.970  73.095  65.284  1.00 106.14 ? 207  VAL B C     1 
ATOM   4897  O  O     . VAL B  2  209 ? 85.109  74.223  65.741  1.00 105.99 ? 207  VAL B O     1 
ATOM   4898  C  CB    . VAL B  2  209 ? 83.967  70.877  65.936  1.00 104.07 ? 207  VAL B CB    1 
ATOM   4899  C  CG1   . VAL B  2  209 ? 84.087  70.263  64.561  1.00 103.80 ? 207  VAL B CG1   1 
ATOM   4900  C  CG2   . VAL B  2  209 ? 83.995  69.782  66.985  1.00 102.97 ? 207  VAL B CG2   1 
ATOM   4901  N  N     . GLY B  2  210 ? 84.703  72.874  64.001  1.00 107.62 ? 208  GLY B N     1 
ATOM   4902  C  CA    . GLY B  2  210 ? 84.549  73.996  63.091  1.00 110.69 ? 208  GLY B CA    1 
ATOM   4903  C  C     . GLY B  2  210 ? 84.635  73.686  61.604  1.00 112.94 ? 208  GLY B C     1 
ATOM   4904  O  O     . GLY B  2  210 ? 85.320  72.752  61.181  1.00 113.80 ? 208  GLY B O     1 
ATOM   4905  N  N     . ILE B  2  211 ? 83.930  74.491  60.811  1.00 114.42 ? 209  ILE B N     1 
ATOM   4906  C  CA    . ILE B  2  211 ? 83.889  74.365  59.354  1.00 115.64 ? 209  ILE B CA    1 
ATOM   4907  C  C     . ILE B  2  211 ? 84.190  75.756  58.777  1.00 117.76 ? 209  ILE B C     1 
ATOM   4908  O  O     . ILE B  2  211 ? 84.237  76.733  59.526  1.00 118.47 ? 209  ILE B O     1 
ATOM   4909  C  CB    . ILE B  2  211 ? 82.488  73.854  58.892  1.00 113.96 ? 209  ILE B CB    1 
ATOM   4910  C  CG1   . ILE B  2  211 ? 82.301  72.412  59.368  1.00 112.93 ? 209  ILE B CG1   1 
ATOM   4911  C  CG2   . ILE B  2  211 ? 82.342  73.936  57.377  1.00 113.39 ? 209  ILE B CG2   1 
ATOM   4912  C  CD1   . ILE B  2  211 ? 80.987  71.807  58.993  1.00 112.28 ? 209  ILE B CD1   1 
ATOM   4913  N  N     . GLY B  2  212 ? 84.419  75.846  57.467  1.00 119.66 ? 210  GLY B N     1 
ATOM   4914  C  CA    . GLY B  2  212 ? 84.715  77.128  56.845  1.00 121.35 ? 210  GLY B CA    1 
ATOM   4915  C  C     . GLY B  2  212 ? 85.880  77.877  57.475  1.00 122.85 ? 210  GLY B C     1 
ATOM   4916  O  O     . GLY B  2  212 ? 85.897  79.108  57.482  1.00 122.69 ? 210  GLY B O     1 
ATOM   4917  N  N     . VAL B  2  213 ? 86.851  77.139  58.010  1.00 124.56 ? 211  VAL B N     1 
ATOM   4918  C  CA    . VAL B  2  213 ? 88.029  77.740  58.636  1.00 125.96 ? 211  VAL B CA    1 
ATOM   4919  C  C     . VAL B  2  213 ? 89.324  76.942  58.448  1.00 127.93 ? 211  VAL B C     1 
ATOM   4920  O  O     . VAL B  2  213 ? 89.311  75.754  58.105  1.00 128.20 ? 211  VAL B O     1 
ATOM   4921  C  CB    . VAL B  2  213 ? 87.813  77.958  60.148  1.00 124.67 ? 211  VAL B CB    1 
ATOM   4922  C  CG1   . VAL B  2  213 ? 86.984  79.200  60.371  1.00 124.09 ? 211  VAL B CG1   1 
ATOM   4923  C  CG2   . VAL B  2  213 ? 87.131  76.744  60.759  1.00 123.36 ? 211  VAL B CG2   1 
ATOM   4924  N  N     . LYS B  2  214 ? 90.444  77.621  58.672  1.00 129.84 ? 212  LYS B N     1 
ATOM   4925  C  CA    . LYS B  2  214 ? 91.772  77.022  58.552  1.00 131.47 ? 212  LYS B CA    1 
ATOM   4926  C  C     . LYS B  2  214 ? 92.170  76.576  59.962  1.00 132.14 ? 212  LYS B C     1 
ATOM   4927  O  O     . LYS B  2  214 ? 92.019  77.334  60.920  1.00 132.46 ? 212  LYS B O     1 
ATOM   4928  C  CB    . LYS B  2  214 ? 92.765  78.076  58.021  1.00 131.85 ? 212  LYS B CB    1 
ATOM   4929  C  CG    . LYS B  2  214 ? 94.008  77.546  57.280  1.00 131.63 ? 212  LYS B CG    1 
ATOM   4930  C  CD    . LYS B  2  214 ? 95.052  76.914  58.200  1.00 130.95 ? 212  LYS B CD    1 
ATOM   4931  C  CE    . LYS B  2  214 ? 96.317  76.560  57.422  1.00 130.02 ? 212  LYS B CE    1 
ATOM   4932  N  NZ    . LYS B  2  214 ? 97.315  75.830  58.245  1.00 129.45 ? 212  LYS B NZ    1 
ATOM   4933  N  N     . HIS B  2  215 ? 92.668  75.350  60.090  1.00 132.49 ? 213  HIS B N     1 
ATOM   4934  C  CA    . HIS B  2  215 ? 93.075  74.823  61.387  1.00 132.83 ? 213  HIS B CA    1 
ATOM   4935  C  C     . HIS B  2  215 ? 93.960  75.783  62.198  1.00 132.79 ? 213  HIS B C     1 
ATOM   4936  O  O     . HIS B  2  215 ? 93.877  75.819  63.429  1.00 131.79 ? 213  HIS B O     1 
ATOM   4937  C  CB    . HIS B  2  215 ? 93.800  73.494  61.180  1.00 134.28 ? 213  HIS B CB    1 
ATOM   4938  C  CG    . HIS B  2  215 ? 93.782  72.601  62.381  1.00 136.22 ? 213  HIS B CG    1 
ATOM   4939  N  ND1   . HIS B  2  215 ? 92.612  72.187  62.980  1.00 137.02 ? 213  HIS B ND1   1 
ATOM   4940  C  CD2   . HIS B  2  215 ? 94.786  72.020  63.081  1.00 137.26 ? 213  HIS B CD2   1 
ATOM   4941  C  CE1   . HIS B  2  215 ? 92.895  71.390  63.995  1.00 137.25 ? 213  HIS B CE1   1 
ATOM   4942  N  NE2   . HIS B  2  215 ? 94.207  71.272  64.078  1.00 137.23 ? 213  HIS B NE2   1 
ATOM   4943  N  N     . SER B  2  216 ? 94.790  76.562  61.502  1.00 133.22 ? 214  SER B N     1 
ATOM   4944  C  CA    . SER B  2  216 ? 95.707  77.518  62.138  1.00 133.77 ? 214  SER B CA    1 
ATOM   4945  C  C     . SER B  2  216 ? 95.021  78.612  62.953  1.00 134.37 ? 214  SER B C     1 
ATOM   4946  O  O     . SER B  2  216 ? 95.607  79.177  63.881  1.00 133.41 ? 214  SER B O     1 
ATOM   4947  C  CB    . SER B  2  216 ? 96.610  78.170  61.080  1.00 133.32 ? 214  SER B CB    1 
ATOM   4948  O  OG    . SER B  2  216 ? 95.865  78.920  60.139  1.00 132.51 ? 214  SER B OG    1 
ATOM   4949  N  N     . ASP B  2  217 ? 93.784  78.920  62.588  1.00 135.78 ? 215  ASP B N     1 
ATOM   4950  C  CA    . ASP B  2  217 ? 93.018  79.936  63.292  1.00 136.97 ? 215  ASP B CA    1 
ATOM   4951  C  C     . ASP B  2  217 ? 92.360  79.260  64.497  1.00 138.42 ? 215  ASP B C     1 
ATOM   4952  O  O     . ASP B  2  217 ? 92.822  79.414  65.627  1.00 138.46 ? 215  ASP B O     1 
ATOM   4953  C  CB    . ASP B  2  217 ? 91.939  80.543  62.373  1.00 135.86 ? 215  ASP B CB    1 
ATOM   4954  C  CG    . ASP B  2  217 ? 92.504  81.079  61.058  1.00 134.93 ? 215  ASP B CG    1 
ATOM   4955  O  OD1   . ASP B  2  217 ? 93.425  81.919  61.097  1.00 134.29 ? 215  ASP B OD1   1 
ATOM   4956  O  OD2   . ASP B  2  217 ? 92.017  80.666  59.981  1.00 133.71 ? 215  ASP B OD2   1 
ATOM   4957  N  N     . LEU B  2  218 ? 91.297  78.493  64.239  1.00 140.29 ? 216  LEU B N     1 
ATOM   4958  C  CA    . LEU B  2  218 ? 90.550  77.789  65.285  1.00 141.67 ? 216  LEU B CA    1 
ATOM   4959  C  C     . LEU B  2  218 ? 91.454  77.194  66.353  1.00 143.62 ? 216  LEU B C     1 
ATOM   4960  O  O     . LEU B  2  218 ? 91.048  77.065  67.508  1.00 143.75 ? 216  LEU B O     1 
ATOM   4961  C  CB    . LEU B  2  218 ? 89.672  76.685  64.676  1.00 140.12 ? 216  LEU B CB    1 
ATOM   4962  C  CG    . LEU B  2  218 ? 88.852  75.867  65.675  1.00 138.44 ? 216  LEU B CG    1 
ATOM   4963  C  CD1   . LEU B  2  218 ? 88.177  76.806  66.638  1.00 137.85 ? 216  LEU B CD1   1 
ATOM   4964  C  CD2   . LEU B  2  218 ? 87.833  75.014  64.946  1.00 137.64 ? 216  LEU B CD2   1 
ATOM   4965  N  N     . LYS B  2  219 ? 92.670  76.824  65.960  1.00 145.78 ? 217  LYS B N     1 
ATOM   4966  C  CA    . LYS B  2  219 ? 93.635  76.278  66.905  1.00 148.24 ? 217  LYS B CA    1 
ATOM   4967  C  C     . LYS B  2  219 ? 94.133  77.450  67.740  1.00 149.74 ? 217  LYS B C     1 
ATOM   4968  O  O     . LYS B  2  219 ? 93.987  77.478  68.965  1.00 149.44 ? 217  LYS B O     1 
ATOM   4969  C  CB    . LYS B  2  219 ? 94.822  75.652  66.170  1.00 148.49 ? 217  LYS B CB    1 
ATOM   4970  C  CG    . LYS B  2  219 ? 95.975  75.257  67.104  1.00 149.06 ? 217  LYS B CG    1 
ATOM   4971  C  CD    . LYS B  2  219 ? 97.278  74.965  66.361  1.00 148.36 ? 217  LYS B CD    1 
ATOM   4972  C  CE    . LYS B  2  219 ? 98.422  74.729  67.339  1.00 147.79 ? 217  LYS B CE    1 
ATOM   4973  N  NZ    . LYS B  2  219 ? 99.742  74.645  66.658  1.00 147.77 ? 217  LYS B NZ    1 
ATOM   4974  N  N     . GLN B  2  220 ? 94.725  78.413  67.041  1.00 151.59 ? 218  GLN B N     1 
ATOM   4975  C  CA    . GLN B  2  220 ? 95.269  79.626  67.639  1.00 153.78 ? 218  GLN B CA    1 
ATOM   4976  C  C     . GLN B  2  220 ? 94.383  80.157  68.776  1.00 155.04 ? 218  GLN B C     1 
ATOM   4977  O  O     . GLN B  2  220 ? 94.871  80.502  69.854  1.00 154.59 ? 218  GLN B O     1 
ATOM   4978  C  CB    . GLN B  2  220 ? 95.433  80.679  66.535  1.00 154.09 ? 218  GLN B CB    1 
ATOM   4979  C  CG    . GLN B  2  220 ? 96.050  81.994  66.974  1.00 154.83 ? 218  GLN B CG    1 
ATOM   4980  C  CD    . GLN B  2  220 ? 96.329  82.916  65.801  1.00 155.01 ? 218  GLN B CD    1 
ATOM   4981  O  OE1   . GLN B  2  220 ? 95.430  83.236  65.020  1.00 155.06 ? 218  GLN B OE1   1 
ATOM   4982  N  NE2   . GLN B  2  220 ? 97.579  83.348  65.671  1.00 154.97 ? 218  GLN B NE2   1 
ATOM   4983  N  N     . VAL B  2  221 ? 93.079  80.215  68.528  1.00 156.90 ? 219  VAL B N     1 
ATOM   4984  C  CA    . VAL B  2  221 ? 92.130  80.693  69.525  1.00 158.73 ? 219  VAL B CA    1 
ATOM   4985  C  C     . VAL B  2  221 ? 92.058  79.713  70.683  1.00 160.33 ? 219  VAL B C     1 
ATOM   4986  O  O     . VAL B  2  221 ? 92.208  80.095  71.839  1.00 160.73 ? 219  VAL B O     1 
ATOM   4987  C  CB    . VAL B  2  221 ? 90.716  80.848  68.924  1.00 158.46 ? 219  VAL B CB    1 
ATOM   4988  C  CG1   . VAL B  2  221 ? 89.713  81.179  70.017  1.00 158.42 ? 219  VAL B CG1   1 
ATOM   4989  C  CG2   . VAL B  2  221 ? 90.718  81.943  67.876  1.00 158.46 ? 219  VAL B CG2   1 
ATOM   4990  N  N     . ALA B  2  222 ? 91.829  78.445  70.358  1.00 162.27 ? 220  ALA B N     1 
ATOM   4991  C  CA    . ALA B  2  222 ? 91.720  77.382  71.353  1.00 164.52 ? 220  ALA B CA    1 
ATOM   4992  C  C     . ALA B  2  222 ? 92.703  77.492  72.517  1.00 166.06 ? 220  ALA B C     1 
ATOM   4993  O  O     . ALA B  2  222 ? 92.305  77.478  73.685  1.00 166.11 ? 220  ALA B O     1 
ATOM   4994  C  CB    . ALA B  2  222 ? 91.887  76.030  70.674  1.00 164.46 ? 220  ALA B CB    1 
ATOM   4995  N  N     . GLU B  2  223 ? 93.988  77.594  72.192  1.00 167.92 ? 221  GLU B N     1 
ATOM   4996  C  CA    . GLU B  2  223 ? 95.037  77.683  73.206  1.00 169.82 ? 221  GLU B CA    1 
ATOM   4997  C  C     . GLU B  2  223 ? 95.080  79.004  73.989  1.00 170.51 ? 221  GLU B C     1 
ATOM   4998  O  O     . GLU B  2  223 ? 95.032  79.006  75.225  1.00 170.67 ? 221  GLU B O     1 
ATOM   4999  C  CB    . GLU B  2  223 ? 96.409  77.414  72.557  1.00 170.95 ? 221  GLU B CB    1 
ATOM   5000  C  CG    . GLU B  2  223 ? 96.757  78.314  71.355  1.00 172.24 ? 221  GLU B CG    1 
ATOM   5001  C  CD    . GLU B  2  223 ? 98.124  78.000  70.736  1.00 172.60 ? 221  GLU B CD    1 
ATOM   5002  O  OE1   . GLU B  2  223 ? 98.318  76.868  70.236  1.00 172.94 ? 221  GLU B OE1   1 
ATOM   5003  O  OE2   . GLU B  2  223 ? 99.004  78.890  70.745  1.00 172.33 ? 221  GLU B OE2   1 
ATOM   5004  N  N     . GLN B  2  224 ? 95.168  80.119  73.266  1.00 171.07 ? 222  GLN B N     1 
ATOM   5005  C  CA    . GLN B  2  224 ? 95.246  81.450  73.870  1.00 171.33 ? 222  GLN B CA    1 
ATOM   5006  C  C     . GLN B  2  224 ? 94.030  81.881  74.697  1.00 171.40 ? 222  GLN B C     1 
ATOM   5007  O  O     . GLN B  2  224 ? 94.187  82.457  75.781  1.00 170.68 ? 222  GLN B O     1 
ATOM   5008  C  CB    . GLN B  2  224 ? 95.505  82.489  72.769  1.00 171.68 ? 222  GLN B CB    1 
ATOM   5009  C  CG    . GLN B  2  224 ? 96.862  82.348  72.085  1.00 171.95 ? 222  GLN B CG    1 
ATOM   5010  C  CD    . GLN B  2  224 ? 97.010  83.253  70.876  1.00 172.11 ? 222  GLN B CD    1 
ATOM   5011  O  OE1   . GLN B  2  224 ? 96.732  84.450  70.945  1.00 171.84 ? 222  GLN B OE1   1 
ATOM   5012  N  NE2   . GLN B  2  224 ? 97.459  82.684  69.761  1.00 172.25 ? 222  GLN B NE2   1 
ATOM   5013  N  N     . PHE B  2  225 ? 92.832  81.593  74.182  1.00 171.84 ? 223  PHE B N     1 
ATOM   5014  C  CA    . PHE B  2  225 ? 91.571  81.973  74.826  1.00 171.93 ? 223  PHE B CA    1 
ATOM   5015  C  C     . PHE B  2  225 ? 90.907  80.962  75.771  1.00 171.52 ? 223  PHE B C     1 
ATOM   5016  O  O     . PHE B  2  225 ? 90.057  81.354  76.569  1.00 171.58 ? 223  PHE B O     1 
ATOM   5017  C  CB    . PHE B  2  225 ? 90.529  82.383  73.766  1.00 172.59 ? 223  PHE B CB    1 
ATOM   5018  C  CG    . PHE B  2  225 ? 90.854  83.664  73.028  1.00 173.47 ? 223  PHE B CG    1 
ATOM   5019  C  CD1   . PHE B  2  225 ? 91.882  83.709  72.087  1.00 173.81 ? 223  PHE B CD1   1 
ATOM   5020  C  CD2   . PHE B  2  225 ? 90.104  84.821  73.252  1.00 173.80 ? 223  PHE B CD2   1 
ATOM   5021  C  CE1   . PHE B  2  225 ? 92.155  84.887  71.378  1.00 174.10 ? 223  PHE B CE1   1 
ATOM   5022  C  CE2   . PHE B  2  225 ? 90.366  86.003  72.550  1.00 174.06 ? 223  PHE B CE2   1 
ATOM   5023  C  CZ    . PHE B  2  225 ? 91.393  86.036  71.611  1.00 174.11 ? 223  PHE B CZ    1 
ATOM   5024  N  N     . LEU B  2  226 ? 91.263  79.680  75.693  1.00 171.04 ? 224  LEU B N     1 
ATOM   5025  C  CA    . LEU B  2  226 ? 90.638  78.684  76.573  1.00 170.88 ? 224  LEU B CA    1 
ATOM   5026  C  C     . LEU B  2  226 ? 91.404  78.384  77.871  1.00 171.25 ? 224  LEU B C     1 
ATOM   5027  O  O     . LEU B  2  226 ? 92.563  77.958  77.844  1.00 171.06 ? 224  LEU B O     1 
ATOM   5028  C  CB    . LEU B  2  226 ? 90.360  77.383  75.800  1.00 169.84 ? 224  LEU B CB    1 
ATOM   5029  C  CG    . LEU B  2  226 ? 89.115  77.404  74.896  1.00 168.85 ? 224  LEU B CG    1 
ATOM   5030  C  CD1   . LEU B  2  226 ? 89.035  76.148  74.067  1.00 168.04 ? 224  LEU B CD1   1 
ATOM   5031  C  CD2   . LEU B  2  226 ? 87.865  77.529  75.746  1.00 168.40 ? 224  LEU B CD2   1 
ATOM   5032  N  N     . ASN B  2  227 ? 90.724  78.606  79.000  1.00 171.77 ? 225  ASN B N     1 
ATOM   5033  C  CA    . ASN B  2  227 ? 91.276  78.402  80.346  1.00 172.19 ? 225  ASN B CA    1 
ATOM   5034  C  C     . ASN B  2  227 ? 90.952  77.042  80.976  1.00 172.57 ? 225  ASN B C     1 
ATOM   5035  O  O     . ASN B  2  227 ? 91.806  76.155  81.034  1.00 172.98 ? 225  ASN B O     1 
ATOM   5036  C  CB    . ASN B  2  227 ? 90.769  79.493  81.305  1.00 171.81 ? 225  ASN B CB    1 
ATOM   5037  C  CG    . ASN B  2  227 ? 91.337  80.867  80.999  1.00 171.69 ? 225  ASN B CG    1 
ATOM   5038  O  OD1   . ASN B  2  227 ? 91.112  81.423  79.926  1.00 171.93 ? 225  ASN B OD1   1 
ATOM   5039  N  ND2   . ASN B  2  227 ? 92.074  81.425  81.953  1.00 171.16 ? 225  ASN B ND2   1 
ATOM   5040  N  N     . ILE B  2  228 ? 89.713  76.912  81.453  1.00 172.53 ? 226  ILE B N     1 
ATOM   5041  C  CA    . ILE B  2  228 ? 89.187  75.715  82.128  1.00 172.32 ? 226  ILE B CA    1 
ATOM   5042  C  C     . ILE B  2  228 ? 90.032  74.429  82.127  1.00 171.76 ? 226  ILE B C     1 
ATOM   5043  O  O     . ILE B  2  228 ? 90.569  74.006  81.096  1.00 171.56 ? 226  ILE B O     1 
ATOM   5044  C  CB    . ILE B  2  228 ? 87.767  75.364  81.607  1.00 172.66 ? 226  ILE B CB    1 
ATOM   5045  C  CG1   . ILE B  2  228 ? 87.075  74.405  82.587  1.00 173.00 ? 226  ILE B CG1   1 
ATOM   5046  C  CG2   . ILE B  2  228 ? 87.854  74.744  80.211  1.00 172.52 ? 226  ILE B CG2   1 
ATOM   5047  C  CD1   . ILE B  2  228 ? 86.773  75.003  83.959  1.00 172.17 ? 226  ILE B CD1   1 
ATOM   5048  N  N     . ARG B  2  229 ? 90.111  73.807  83.305  1.00 170.92 ? 227  ARG B N     1 
ATOM   5049  C  CA    . ARG B  2  229 ? 90.876  72.579  83.514  1.00 169.72 ? 227  ARG B CA    1 
ATOM   5050  C  C     . ARG B  2  229 ? 90.413  71.373  82.701  1.00 168.63 ? 227  ARG B C     1 
ATOM   5051  O  O     . ARG B  2  229 ? 89.569  71.489  81.809  1.00 168.58 ? 227  ARG B O     1 
ATOM   5052  C  CB    . ARG B  2  229 ? 90.889  72.211  85.006  1.00 169.80 ? 227  ARG B CB    1 
ATOM   5053  C  CG    . ARG B  2  229 ? 92.149  72.657  85.749  1.00 170.17 ? 227  ARG B CG    1 
ATOM   5054  C  CD    . ARG B  2  229 ? 93.406  71.985  85.175  1.00 170.93 ? 227  ARG B CD    1 
ATOM   5055  N  NE    . ARG B  2  229 ? 93.691  72.396  83.796  1.00 171.11 ? 227  ARG B NE    1 
ATOM   5056  C  CZ    . ARG B  2  229 ? 94.633  71.862  83.017  1.00 170.65 ? 227  ARG B CZ    1 
ATOM   5057  N  NH1   . ARG B  2  229 ? 95.404  70.878  83.467  1.00 170.24 ? 227  ARG B NH1   1 
ATOM   5058  N  NH2   . ARG B  2  229 ? 94.804  72.311  81.779  1.00 170.11 ? 227  ARG B NH2   1 
ATOM   5059  N  N     . SER B  2  230 ? 90.998  70.217  83.012  1.00 167.13 ? 228  SER B N     1 
ATOM   5060  C  CA    . SER B  2  230 ? 90.666  68.968  82.337  1.00 165.44 ? 228  SER B CA    1 
ATOM   5061  C  C     . SER B  2  230 ? 90.179  67.971  83.378  1.00 164.24 ? 228  SER B C     1 
ATOM   5062  O  O     . SER B  2  230 ? 89.794  68.362  84.484  1.00 164.15 ? 228  SER B O     1 
ATOM   5063  C  CB    . SER B  2  230 ? 91.887  68.397  81.603  1.00 165.26 ? 228  SER B CB    1 
ATOM   5064  O  OG    . SER B  2  230 ? 92.854  67.897  82.509  1.00 164.92 ? 228  SER B OG    1 
ATOM   5065  N  N     . GLY B  2  231 ? 90.212  66.688  83.028  1.00 162.84 ? 229  GLY B N     1 
ATOM   5066  C  CA    . GLY B  2  231 ? 89.746  65.663  83.943  1.00 160.82 ? 229  GLY B CA    1 
ATOM   5067  C  C     . GLY B  2  231 ? 88.239  65.775  84.033  1.00 159.32 ? 229  GLY B C     1 
ATOM   5068  O  O     . GLY B  2  231 ? 87.714  66.840  84.364  1.00 159.46 ? 229  GLY B O     1 
ATOM   5069  N  N     . ALA B  2  232 ? 87.539  64.684  83.742  1.00 157.65 ? 230  ALA B N     1 
ATOM   5070  C  CA    . ALA B  2  232 ? 86.078  64.679  83.766  1.00 155.82 ? 230  ALA B CA    1 
ATOM   5071  C  C     . ALA B  2  232 ? 85.450  65.191  85.065  1.00 154.32 ? 230  ALA B C     1 
ATOM   5072  O  O     . ALA B  2  232 ? 84.241  65.041  85.254  1.00 154.18 ? 230  ALA B O     1 
ATOM   5073  C  CB    . ALA B  2  232 ? 85.556  63.271  83.457  1.00 155.67 ? 230  ALA B CB    1 
ATOM   5074  N  N     . GLY B  2  233 ? 86.253  65.804  85.941  1.00 152.45 ? 231  GLY B N     1 
ATOM   5075  C  CA    . GLY B  2  233 ? 85.728  66.303  87.204  1.00 149.60 ? 231  GLY B CA    1 
ATOM   5076  C  C     . GLY B  2  233 ? 84.808  65.264  87.818  1.00 147.73 ? 231  GLY B C     1 
ATOM   5077  O  O     . GLY B  2  233 ? 85.249  64.403  88.582  1.00 147.40 ? 231  GLY B O     1 
ATOM   5078  N  N     . THR B  2  234 ? 83.525  65.348  87.476  1.00 145.94 ? 232  THR B N     1 
ATOM   5079  C  CA    . THR B  2  234 ? 82.525  64.398  87.954  1.00 144.19 ? 232  THR B CA    1 
ATOM   5080  C  C     . THR B  2  234 ? 82.133  63.455  86.815  1.00 142.51 ? 232  THR B C     1 
ATOM   5081  O  O     . THR B  2  234 ? 81.782  63.896  85.719  1.00 142.16 ? 232  THR B O     1 
ATOM   5082  C  CB    . THR B  2  234 ? 81.257  65.110  88.447  1.00 144.62 ? 232  THR B CB    1 
ATOM   5083  O  OG1   . THR B  2  234 ? 81.605  66.030  89.491  1.00 144.80 ? 232  THR B OG1   1 
ATOM   5084  C  CG2   . THR B  2  234 ? 80.246  64.090  88.974  1.00 144.27 ? 232  THR B CG2   1 
ATOM   5085  N  N     . SER B  2  235 ? 82.198  62.155  87.077  1.00 140.51 ? 233  SER B N     1 
ATOM   5086  C  CA    . SER B  2  235 ? 81.856  61.167  86.065  1.00 138.14 ? 233  SER B CA    1 
ATOM   5087  C  C     . SER B  2  235 ? 80.391  60.788  86.193  1.00 136.13 ? 233  SER B C     1 
ATOM   5088  O  O     . SER B  2  235 ? 79.769  61.023  87.232  1.00 135.64 ? 233  SER B O     1 
ATOM   5089  C  CB    . SER B  2  235 ? 82.729  59.915  86.221  1.00 138.74 ? 233  SER B CB    1 
ATOM   5090  O  OG    . SER B  2  235 ? 84.107  60.221  86.089  1.00 138.78 ? 233  SER B OG    1 
ATOM   5091  N  N     . SER B  2  236 ? 79.850  60.201  85.130  1.00 133.66 ? 234  SER B N     1 
ATOM   5092  C  CA    . SER B  2  236 ? 78.459  59.778  85.113  1.00 131.91 ? 234  SER B CA    1 
ATOM   5093  C  C     . SER B  2  236 ? 78.284  58.353  85.643  1.00 130.93 ? 234  SER B C     1 
ATOM   5094  O  O     . SER B  2  236 ? 78.893  57.413  85.127  1.00 130.84 ? 234  SER B O     1 
ATOM   5095  C  CB    . SER B  2  236 ? 77.906  59.863  83.692  1.00 131.43 ? 234  SER B CB    1 
ATOM   5096  O  OG    . SER B  2  236 ? 76.580  59.371  83.639  1.00 131.86 ? 234  SER B OG    1 
ATOM   5097  N  N     . ALA B  2  237 ? 77.446  58.199  86.669  1.00 129.69 ? 235  ALA B N     1 
ATOM   5098  C  CA    . ALA B  2  237 ? 77.175  56.892  87.269  1.00 127.74 ? 235  ALA B CA    1 
ATOM   5099  C  C     . ALA B  2  237 ? 76.519  55.970  86.240  1.00 126.41 ? 235  ALA B C     1 
ATOM   5100  O  O     . ALA B  2  237 ? 75.291  55.936  86.117  1.00 126.56 ? 235  ALA B O     1 
ATOM   5101  C  CB    . ALA B  2  237 ? 76.263  57.054  88.488  1.00 127.83 ? 235  ALA B CB    1 
ATOM   5102  N  N     . LYS B  2  238 ? 77.353  55.234  85.506  1.00 124.11 ? 236  LYS B N     1 
ATOM   5103  C  CA    . LYS B  2  238 ? 76.903  54.307  84.469  1.00 121.33 ? 236  LYS B CA    1 
ATOM   5104  C  C     . LYS B  2  238 ? 75.433  53.906  84.590  1.00 119.28 ? 236  LYS B C     1 
ATOM   5105  O  O     . LYS B  2  238 ? 74.927  53.624  85.679  1.00 118.45 ? 236  LYS B O     1 
ATOM   5106  C  CB    . LYS B  2  238 ? 77.782  53.056  84.473  1.00 121.95 ? 236  LYS B CB    1 
ATOM   5107  C  CG    . LYS B  2  238 ? 79.275  53.322  84.276  1.00 121.31 ? 236  LYS B CG    1 
ATOM   5108  C  CD    . LYS B  2  238 ? 80.061  52.009  84.231  1.00 120.68 ? 236  LYS B CD    1 
ATOM   5109  C  CE    . LYS B  2  238 ? 79.868  51.194  85.504  1.00 119.47 ? 236  LYS B CE    1 
ATOM   5110  N  NZ    . LYS B  2  238 ? 80.418  49.825  85.374  1.00 119.43 ? 236  LYS B NZ    1 
ATOM   5111  N  N     . ALA B  2  239 ? 74.762  53.861  83.450  1.00 117.24 ? 237  ALA B N     1 
ATOM   5112  C  CA    . ALA B  2  239 ? 73.350  53.539  83.404  1.00 116.08 ? 237  ALA B CA    1 
ATOM   5113  C  C     . ALA B  2  239 ? 72.951  52.098  83.691  1.00 114.95 ? 237  ALA B C     1 
ATOM   5114  O  O     . ALA B  2  239 ? 73.361  51.166  83.002  1.00 114.06 ? 237  ALA B O     1 
ATOM   5115  C  CB    . ALA B  2  239 ? 72.792  53.962  82.070  1.00 116.76 ? 237  ALA B CB    1 
ATOM   5116  N  N     . THR B  2  240 ? 72.128  51.932  84.717  1.00 114.29 ? 238  THR B N     1 
ATOM   5117  C  CA    . THR B  2  240 ? 71.624  50.621  85.088  1.00 114.21 ? 238  THR B CA    1 
ATOM   5118  C  C     . THR B  2  240 ? 70.381  50.491  84.228  1.00 113.79 ? 238  THR B C     1 
ATOM   5119  O  O     . THR B  2  240 ? 69.758  51.500  83.914  1.00 113.85 ? 238  THR B O     1 
ATOM   5120  C  CB    . THR B  2  240 ? 71.194  50.581  86.574  1.00 114.41 ? 238  THR B CB    1 
ATOM   5121  O  OG1   . THR B  2  240 ? 72.244  51.115  87.393  1.00 114.26 ? 238  THR B OG1   1 
ATOM   5122  C  CG2   . THR B  2  240 ? 70.878  49.144  87.008  1.00 113.96 ? 238  THR B CG2   1 
ATOM   5123  N  N     . TYR B  2  241 ? 70.020  49.275  83.833  1.00 113.45 ? 239  TYR B N     1 
ATOM   5124  C  CA    . TYR B  2  241 ? 68.819  49.088  83.021  1.00 113.13 ? 239  TYR B CA    1 
ATOM   5125  C  C     . TYR B  2  241 ? 67.659  48.711  83.926  1.00 113.53 ? 239  TYR B C     1 
ATOM   5126  O  O     . TYR B  2  241 ? 67.811  47.888  84.825  1.00 113.44 ? 239  TYR B O     1 
ATOM   5127  C  CB    . TYR B  2  241 ? 69.029  47.992  81.972  1.00 112.06 ? 239  TYR B CB    1 
ATOM   5128  C  CG    . TYR B  2  241 ? 67.868  47.812  81.009  1.00 111.07 ? 239  TYR B CG    1 
ATOM   5129  C  CD1   . TYR B  2  241 ? 68.077  47.789  79.631  1.00 110.51 ? 239  TYR B CD1   1 
ATOM   5130  C  CD2   . TYR B  2  241 ? 66.564  47.642  81.472  1.00 110.77 ? 239  TYR B CD2   1 
ATOM   5131  C  CE1   . TYR B  2  241 ? 67.015  47.599  78.740  1.00 109.92 ? 239  TYR B CE1   1 
ATOM   5132  C  CE2   . TYR B  2  241 ? 65.499  47.454  80.591  1.00 110.24 ? 239  TYR B CE2   1 
ATOM   5133  C  CZ    . TYR B  2  241 ? 65.732  47.431  79.227  1.00 109.78 ? 239  TYR B CZ    1 
ATOM   5134  O  OH    . TYR B  2  241 ? 64.685  47.226  78.358  1.00 108.69 ? 239  TYR B OH    1 
ATOM   5135  N  N     . TRP B  2  242 ? 66.501  49.319  83.688  1.00 114.37 ? 240  TRP B N     1 
ATOM   5136  C  CA    . TRP B  2  242 ? 65.332  49.022  84.493  1.00 115.49 ? 240  TRP B CA    1 
ATOM   5137  C  C     . TRP B  2  242 ? 64.409  48.028  83.807  1.00 114.94 ? 240  TRP B C     1 
ATOM   5138  O  O     . TRP B  2  242 ? 64.388  46.850  84.158  1.00 114.95 ? 240  TRP B O     1 
ATOM   5139  C  CB    . TRP B  2  242 ? 64.551  50.304  84.841  1.00 117.39 ? 240  TRP B CB    1 
ATOM   5140  C  CG    . TRP B  2  242 ? 63.321  50.037  85.698  1.00 120.95 ? 240  TRP B CG    1 
ATOM   5141  C  CD1   . TRP B  2  242 ? 63.028  48.884  86.381  1.00 121.87 ? 240  TRP B CD1   1 
ATOM   5142  C  CD2   . TRP B  2  242 ? 62.221  50.928  85.942  1.00 123.08 ? 240  TRP B CD2   1 
ATOM   5143  N  NE1   . TRP B  2  242 ? 61.818  48.999  87.026  1.00 122.77 ? 240  TRP B NE1   1 
ATOM   5144  C  CE2   . TRP B  2  242 ? 61.299  50.241  86.777  1.00 123.60 ? 240  TRP B CE2   1 
ATOM   5145  C  CE3   . TRP B  2  242 ? 61.919  52.236  85.538  1.00 124.57 ? 240  TRP B CE3   1 
ATOM   5146  C  CZ2   . TRP B  2  242 ? 60.094  50.821  87.214  1.00 124.05 ? 240  TRP B CZ2   1 
ATOM   5147  C  CZ3   . TRP B  2  242 ? 60.711  52.815  85.975  1.00 125.42 ? 240  TRP B CZ3   1 
ATOM   5148  C  CH2   . TRP B  2  242 ? 59.817  52.102  86.804  1.00 124.52 ? 240  TRP B CH2   1 
ATOM   5149  N  N     . GLY B  2  243 ? 63.662  48.494  82.816  1.00 114.51 ? 241  GLY B N     1 
ATOM   5150  C  CA    . GLY B  2  243 ? 62.719  47.617  82.143  1.00 114.34 ? 241  GLY B CA    1 
ATOM   5151  C  C     . GLY B  2  243 ? 61.358  47.932  82.737  1.00 114.10 ? 241  GLY B C     1 
ATOM   5152  O  O     . GLY B  2  243 ? 60.608  47.049  83.190  1.00 113.83 ? 241  GLY B O     1 
ATOM   5153  N  N     . GLY B  2  244 ? 61.056  49.227  82.734  1.00 113.27 ? 242  GLY B N     1 
ATOM   5154  C  CA    . GLY B  2  244 ? 59.813  49.715  83.284  1.00 110.94 ? 242  GLY B CA    1 
ATOM   5155  C  C     . GLY B  2  244 ? 58.752  50.023  82.261  1.00 109.37 ? 242  GLY B C     1 
ATOM   5156  O  O     . GLY B  2  244 ? 59.025  50.293  81.093  1.00 108.78 ? 242  GLY B O     1 
ATOM   5157  N  N     . GLU B  2  245 ? 57.522  49.984  82.744  1.00 108.36 ? 243  GLU B N     1 
ATOM   5158  C  CA    . GLU B  2  245 ? 56.342  50.242  81.953  1.00 107.66 ? 243  GLU B CA    1 
ATOM   5159  C  C     . GLU B  2  245 ? 55.743  51.544  82.507  1.00 106.89 ? 243  GLU B C     1 
ATOM   5160  O  O     . GLU B  2  245 ? 55.456  51.623  83.708  1.00 107.00 ? 243  GLU B O     1 
ATOM   5161  C  CB    . GLU B  2  245 ? 55.371  49.077  82.159  1.00 108.87 ? 243  GLU B CB    1 
ATOM   5162  C  CG    . GLU B  2  245 ? 54.667  48.558  80.907  1.00 111.90 ? 243  GLU B CG    1 
ATOM   5163  C  CD    . GLU B  2  245 ? 53.640  47.461  81.215  1.00 113.10 ? 243  GLU B CD    1 
ATOM   5164  O  OE1   . GLU B  2  245 ? 54.018  46.436  81.831  1.00 114.21 ? 243  GLU B OE1   1 
ATOM   5165  O  OE2   . GLU B  2  245 ? 52.456  47.625  80.839  1.00 113.23 ? 243  GLU B OE2   1 
ATOM   5166  N  N     . ILE B  2  246 ? 55.579  52.560  81.653  1.00 105.39 ? 244  ILE B N     1 
ATOM   5167  C  CA    . ILE B  2  246 ? 54.995  53.846  82.067  1.00 103.74 ? 244  ILE B CA    1 
ATOM   5168  C  C     . ILE B  2  246 ? 53.819  54.231  81.165  1.00 103.68 ? 244  ILE B C     1 
ATOM   5169  O  O     . ILE B  2  246 ? 54.003  54.491  79.978  1.00 103.26 ? 244  ILE B O     1 
ATOM   5170  C  CB    . ILE B  2  246 ? 56.019  54.996  82.005  1.00 102.40 ? 244  ILE B CB    1 
ATOM   5171  C  CG1   . ILE B  2  246 ? 57.190  54.713  82.943  1.00 101.23 ? 244  ILE B CG1   1 
ATOM   5172  C  CG2   . ILE B  2  246 ? 55.347  56.296  82.390  1.00 101.77 ? 244  ILE B CG2   1 
ATOM   5173  C  CD1   . ILE B  2  246 ? 58.264  55.770  82.905  1.00 100.11 ? 244  ILE B CD1   1 
ATOM   5174  N  N     . ARG B  2  247 ? 52.615  54.277  81.732  1.00 103.72 ? 245  ARG B N     1 
ATOM   5175  C  CA    . ARG B  2  247 ? 51.418  54.616  80.960  1.00 103.86 ? 245  ARG B CA    1 
ATOM   5176  C  C     . ARG B  2  247 ? 50.731  55.906  81.436  1.00 104.63 ? 245  ARG B C     1 
ATOM   5177  O  O     . ARG B  2  247 ? 50.359  56.042  82.613  1.00 105.30 ? 245  ARG B O     1 
ATOM   5178  C  CB    . ARG B  2  247 ? 50.438  53.441  80.994  1.00 102.51 ? 245  ARG B CB    1 
ATOM   5179  C  CG    . ARG B  2  247 ? 50.943  52.207  80.258  1.00 100.76 ? 245  ARG B CG    1 
ATOM   5180  C  CD    . ARG B  2  247 ? 50.345  50.944  80.842  1.00 99.95  ? 245  ARG B CD    1 
ATOM   5181  N  NE    . ARG B  2  247 ? 48.894  50.893  80.702  1.00 99.33  ? 245  ARG B NE    1 
ATOM   5182  C  CZ    . ARG B  2  247 ? 48.272  50.518  79.594  1.00 99.07  ? 245  ARG B CZ    1 
ATOM   5183  N  NH1   . ARG B  2  247 ? 48.982  50.160  78.528  1.00 98.96  ? 245  ARG B NH1   1 
ATOM   5184  N  NH2   . ARG B  2  247 ? 46.945  50.504  79.557  1.00 98.40  ? 245  ARG B NH2   1 
ATOM   5185  N  N     . GLU B  2  248 ? 50.558  56.838  80.494  1.00 104.47 ? 246  GLU B N     1 
ATOM   5186  C  CA    . GLU B  2  248 ? 49.957  58.149  80.745  1.00 103.71 ? 246  GLU B CA    1 
ATOM   5187  C  C     . GLU B  2  248 ? 48.622  58.370  80.019  1.00 102.79 ? 246  GLU B C     1 
ATOM   5188  O  O     . GLU B  2  248 ? 48.565  59.099  79.027  1.00 102.47 ? 246  GLU B O     1 
ATOM   5189  C  CB    . GLU B  2  248 ? 50.943  59.238  80.314  1.00 104.61 ? 246  GLU B CB    1 
ATOM   5190  C  CG    . GLU B  2  248 ? 50.562  60.646  80.729  1.00 107.12 ? 246  GLU B CG    1 
ATOM   5191  C  CD    . GLU B  2  248 ? 51.211  61.715  79.856  1.00 108.42 ? 246  GLU B CD    1 
ATOM   5192  O  OE1   . GLU B  2  248 ? 52.461  61.709  79.701  1.00 108.39 ? 246  GLU B OE1   1 
ATOM   5193  O  OE2   . GLU B  2  248 ? 50.455  62.565  79.327  1.00 108.41 ? 246  GLU B OE2   1 
ATOM   5194  N  N     . GLN B  2  249 ? 47.558  57.744  80.518  1.00 101.82 ? 247  GLN B N     1 
ATOM   5195  C  CA    . GLN B  2  249 ? 46.221  57.880  79.939  1.00 100.63 ? 247  GLN B CA    1 
ATOM   5196  C  C     . GLN B  2  249 ? 45.929  59.373  79.754  1.00 100.17 ? 247  GLN B C     1 
ATOM   5197  O  O     . GLN B  2  249 ? 46.104  60.153  80.685  1.00 99.53  ? 247  GLN B O     1 
ATOM   5198  C  CB    . GLN B  2  249 ? 45.200  57.242  80.889  1.00 100.45 ? 247  GLN B CB    1 
ATOM   5199  C  CG    . GLN B  2  249 ? 43.755  57.405  80.483  1.00 100.98 ? 247  GLN B CG    1 
ATOM   5200  C  CD    . GLN B  2  249 ? 43.484  56.859  79.108  1.00 101.19 ? 247  GLN B CD    1 
ATOM   5201  O  OE1   . GLN B  2  249 ? 43.676  55.674  78.853  1.00 101.00 ? 247  GLN B OE1   1 
ATOM   5202  N  NE2   . GLN B  2  249 ? 43.036  57.724  78.206  1.00 101.92 ? 247  GLN B NE2   1 
ATOM   5203  N  N     . ASN B  2  250 ? 45.489  59.780  78.564  1.00 99.99  ? 248  ASN B N     1 
ATOM   5204  C  CA    . ASN B  2  250 ? 45.230  61.199  78.347  1.00 100.03 ? 248  ASN B CA    1 
ATOM   5205  C  C     . ASN B  2  250 ? 44.169  61.611  77.320  1.00 100.31 ? 248  ASN B C     1 
ATOM   5206  O  O     . ASN B  2  250 ? 44.224  62.713  76.783  1.00 99.88  ? 248  ASN B O     1 
ATOM   5207  C  CB    . ASN B  2  250 ? 46.553  61.914  78.029  1.00 100.07 ? 248  ASN B CB    1 
ATOM   5208  C  CG    . ASN B  2  250 ? 46.980  61.761  76.580  1.00 99.70  ? 248  ASN B CG    1 
ATOM   5209  O  OD1   . ASN B  2  250 ? 48.052  62.226  76.190  1.00 99.32  ? 248  ASN B OD1   1 
ATOM   5210  N  ND2   . ASN B  2  250 ? 46.145  61.118  75.777  1.00 99.32  ? 248  ASN B ND2   1 
ATOM   5211  N  N     . GLY B  2  251 ? 43.215  60.735  77.037  1.00 101.45 ? 249  GLY B N     1 
ATOM   5212  C  CA    . GLY B  2  251 ? 42.146  61.071  76.102  1.00 103.09 ? 249  GLY B CA    1 
ATOM   5213  C  C     . GLY B  2  251 ? 42.471  61.550  74.693  1.00 103.53 ? 249  GLY B C     1 
ATOM   5214  O  O     . GLY B  2  251 ? 41.557  61.750  73.891  1.00 103.41 ? 249  GLY B O     1 
ATOM   5215  N  N     . HIS B  2  252 ? 43.753  61.747  74.395  1.00 104.04 ? 250  HIS B N     1 
ATOM   5216  C  CA    . HIS B  2  252 ? 44.206  62.187  73.071  1.00 104.25 ? 250  HIS B CA    1 
ATOM   5217  C  C     . HIS B  2  252 ? 43.932  61.021  72.101  1.00 103.46 ? 250  HIS B C     1 
ATOM   5218  O  O     . HIS B  2  252 ? 44.434  59.922  72.305  1.00 104.66 ? 250  HIS B O     1 
ATOM   5219  C  CB    . HIS B  2  252 ? 45.705  62.513  73.158  1.00 105.89 ? 250  HIS B CB    1 
ATOM   5220  C  CG    . HIS B  2  252 ? 46.314  62.993  71.879  1.00 108.00 ? 250  HIS B CG    1 
ATOM   5221  N  ND1   . HIS B  2  252 ? 46.209  62.298  70.691  1.00 108.52 ? 250  HIS B ND1   1 
ATOM   5222  C  CD2   . HIS B  2  252 ? 47.099  64.066  71.617  1.00 108.92 ? 250  HIS B CD2   1 
ATOM   5223  C  CE1   . HIS B  2  252 ? 46.905  62.920  69.755  1.00 109.00 ? 250  HIS B CE1   1 
ATOM   5224  N  NE2   . HIS B  2  252 ? 47.455  63.996  70.290  1.00 109.38 ? 250  HIS B NE2   1 
ATOM   5225  N  N     . SER B  2  253 ? 43.139  61.260  71.058  1.00 102.11 ? 251  SER B N     1 
ATOM   5226  C  CA    . SER B  2  253 ? 42.743  60.227  70.076  1.00 100.94 ? 251  SER B CA    1 
ATOM   5227  C  C     . SER B  2  253 ? 43.778  59.230  69.512  1.00 99.59  ? 251  SER B C     1 
ATOM   5228  O  O     . SER B  2  253 ? 43.436  58.077  69.217  1.00 99.59  ? 251  SER B O     1 
ATOM   5229  C  CB    . SER B  2  253 ? 42.014  60.888  68.893  1.00 101.34 ? 251  SER B CB    1 
ATOM   5230  O  OG    . SER B  2  253 ? 42.853  61.809  68.208  1.00 101.57 ? 251  SER B OG    1 
ATOM   5231  N  N     . LEU B  2  254 ? 45.027  59.652  69.350  1.00 97.21  ? 252  LEU B N     1 
ATOM   5232  C  CA    . LEU B  2  254 ? 46.044  58.757  68.807  1.00 94.70  ? 252  LEU B CA    1 
ATOM   5233  C  C     . LEU B  2  254 ? 46.984  58.215  69.870  1.00 93.11  ? 252  LEU B C     1 
ATOM   5234  O  O     . LEU B  2  254 ? 47.716  58.978  70.504  1.00 93.65  ? 252  LEU B O     1 
ATOM   5235  C  CB    . LEU B  2  254 ? 46.870  59.487  67.764  1.00 95.47  ? 252  LEU B CB    1 
ATOM   5236  C  CG    . LEU B  2  254 ? 46.082  60.202  66.675  1.00 96.03  ? 252  LEU B CG    1 
ATOM   5237  C  CD1   . LEU B  2  254 ? 47.068  60.886  65.742  1.00 96.68  ? 252  LEU B CD1   1 
ATOM   5238  C  CD2   . LEU B  2  254 ? 45.201  59.212  65.926  1.00 95.81  ? 252  LEU B CD2   1 
ATOM   5239  N  N     . VAL B  2  255 ? 46.978  56.899  70.048  1.00 90.29  ? 253  VAL B N     1 
ATOM   5240  C  CA    . VAL B  2  255 ? 47.836  56.263  71.031  1.00 87.56  ? 253  VAL B CA    1 
ATOM   5241  C  C     . VAL B  2  255 ? 49.258  56.127  70.511  1.00 87.97  ? 253  VAL B C     1 
ATOM   5242  O  O     . VAL B  2  255 ? 49.499  55.453  69.515  1.00 88.27  ? 253  VAL B O     1 
ATOM   5243  C  CB    . VAL B  2  255 ? 47.321  54.872  71.370  1.00 85.39  ? 253  VAL B CB    1 
ATOM   5244  C  CG1   . VAL B  2  255 ? 48.288  54.181  72.274  1.00 85.12  ? 253  VAL B CG1   1 
ATOM   5245  C  CG2   . VAL B  2  255 ? 45.978  54.969  72.020  1.00 84.40  ? 253  VAL B CG2   1 
ATOM   5246  N  N     . HIS B  2  256 ? 50.204  56.789  71.159  1.00 88.29  ? 254  HIS B N     1 
ATOM   5247  C  CA    . HIS B  2  256 ? 51.585  56.659  70.738  1.00 89.49  ? 254  HIS B CA    1 
ATOM   5248  C  C     . HIS B  2  256 ? 52.121  55.525  71.561  1.00 90.63  ? 254  HIS B C     1 
ATOM   5249  O  O     . HIS B  2  256 ? 51.527  55.160  72.568  1.00 90.30  ? 254  HIS B O     1 
ATOM   5250  C  CB    . HIS B  2  256 ? 52.376  57.921  71.018  1.00 89.96  ? 254  HIS B CB    1 
ATOM   5251  C  CG    . HIS B  2  256 ? 52.206  58.970  69.970  1.00 92.28  ? 254  HIS B CG    1 
ATOM   5252  N  ND1   . HIS B  2  256 ? 53.249  59.416  69.187  1.00 93.40  ? 254  HIS B ND1   1 
ATOM   5253  C  CD2   . HIS B  2  256 ? 51.106  59.639  69.551  1.00 93.56  ? 254  HIS B CD2   1 
ATOM   5254  C  CE1   . HIS B  2  256 ? 52.799  60.314  68.329  1.00 94.80  ? 254  HIS B CE1   1 
ATOM   5255  N  NE2   . HIS B  2  256 ? 51.501  60.468  68.528  1.00 94.92  ? 254  HIS B NE2   1 
ATOM   5256  N  N     . ALA B  2  257 ? 53.240  54.956  71.138  1.00 92.74  ? 255  ALA B N     1 
ATOM   5257  C  CA    . ALA B  2  257 ? 53.826  53.839  71.866  1.00 94.28  ? 255  ALA B CA    1 
ATOM   5258  C  C     . ALA B  2  257 ? 55.217  53.468  71.363  1.00 94.94  ? 255  ALA B C     1 
ATOM   5259  O  O     . ALA B  2  257 ? 55.546  53.618  70.182  1.00 94.99  ? 255  ALA B O     1 
ATOM   5260  C  CB    . ALA B  2  257 ? 52.893  52.612  71.794  1.00 94.01  ? 255  ALA B CB    1 
ATOM   5261  N  N     . ALA B  2  258 ? 56.026  52.977  72.290  1.00 95.67  ? 256  ALA B N     1 
ATOM   5262  C  CA    . ALA B  2  258 ? 57.382  52.564  71.994  1.00 96.76  ? 256  ALA B CA    1 
ATOM   5263  C  C     . ALA B  2  258 ? 57.747  51.412  72.927  1.00 97.52  ? 256  ALA B C     1 
ATOM   5264  O  O     . ALA B  2  258 ? 57.563  51.500  74.142  1.00 98.33  ? 256  ALA B O     1 
ATOM   5265  C  CB    . ALA B  2  258 ? 58.341  53.737  72.190  1.00 96.67  ? 256  ALA B CB    1 
ATOM   5266  N  N     . VAL B  2  259 ? 58.241  50.326  72.342  1.00 97.79  ? 257  VAL B N     1 
ATOM   5267  C  CA    . VAL B  2  259 ? 58.647  49.145  73.092  1.00 97.37  ? 257  VAL B CA    1 
ATOM   5268  C  C     . VAL B  2  259 ? 60.076  48.848  72.683  1.00 97.23  ? 257  VAL B C     1 
ATOM   5269  O  O     . VAL B  2  259 ? 60.335  48.545  71.529  1.00 97.04  ? 257  VAL B O     1 
ATOM   5270  C  CB    . VAL B  2  259 ? 57.750  47.933  72.751  1.00 96.94  ? 257  VAL B CB    1 
ATOM   5271  C  CG1   . VAL B  2  259 ? 58.283  46.679  73.415  1.00 96.82  ? 257  VAL B CG1   1 
ATOM   5272  C  CG2   . VAL B  2  259 ? 56.330  48.199  73.211  1.00 96.64  ? 257  VAL B CG2   1 
ATOM   5273  N  N     . VAL B  2  260 ? 61.009  48.948  73.617  1.00 97.78  ? 258  VAL B N     1 
ATOM   5274  C  CA    . VAL B  2  260 ? 62.394  48.691  73.276  1.00 99.65  ? 258  VAL B CA    1 
ATOM   5275  C  C     . VAL B  2  260 ? 63.092  47.806  74.302  1.00 101.20 ? 258  VAL B C     1 
ATOM   5276  O  O     . VAL B  2  260 ? 62.497  47.395  75.301  1.00 101.22 ? 258  VAL B O     1 
ATOM   5277  C  CB    . VAL B  2  260 ? 63.176  50.022  73.132  1.00 99.75  ? 258  VAL B CB    1 
ATOM   5278  C  CG1   . VAL B  2  260 ? 62.268  51.081  72.537  1.00 100.10 ? 258  VAL B CG1   1 
ATOM   5279  C  CG2   . VAL B  2  260 ? 63.723  50.480  74.475  1.00 99.97  ? 258  VAL B CG2   1 
ATOM   5280  N  N     . THR B  2  261 ? 64.356  47.502  74.028  1.00 102.60 ? 259  THR B N     1 
ATOM   5281  C  CA    . THR B  2  261 ? 65.179  46.693  74.916  1.00 103.53 ? 259  THR B CA    1 
ATOM   5282  C  C     . THR B  2  261 ? 66.563  47.280  74.823  1.00 104.79 ? 259  THR B C     1 
ATOM   5283  O  O     . THR B  2  261 ? 66.891  47.923  73.830  1.00 104.05 ? 259  THR B O     1 
ATOM   5284  C  CB    . THR B  2  261 ? 65.231  45.231  74.475  1.00 103.07 ? 259  THR B CB    1 
ATOM   5285  O  OG1   . THR B  2  261 ? 63.958  44.623  74.712  1.00 103.42 ? 259  THR B OG1   1 
ATOM   5286  C  CG2   . THR B  2  261 ? 66.304  44.476  75.246  1.00 102.87 ? 259  THR B CG2   1 
ATOM   5287  N  N     . GLU B  2  262 ? 67.368  47.082  75.860  1.00 107.17 ? 260  GLU B N     1 
ATOM   5288  C  CA    . GLU B  2  262 ? 68.719  47.612  75.844  1.00 109.96 ? 260  GLU B CA    1 
ATOM   5289  C  C     . GLU B  2  262 ? 69.278  47.276  74.473  1.00 110.95 ? 260  GLU B C     1 
ATOM   5290  O  O     . GLU B  2  262 ? 69.140  46.145  73.995  1.00 110.54 ? 260  GLU B O     1 
ATOM   5291  C  CB    . GLU B  2  262 ? 69.574  46.974  76.948  1.00 111.92 ? 260  GLU B CB    1 
ATOM   5292  C  CG    . GLU B  2  262 ? 70.946  47.625  77.137  1.00 114.84 ? 260  GLU B CG    1 
ATOM   5293  C  CD    . GLU B  2  262 ? 71.645  47.189  78.421  1.00 116.58 ? 260  GLU B CD    1 
ATOM   5294  O  OE1   . GLU B  2  262 ? 71.827  45.966  78.622  1.00 117.24 ? 260  GLU B OE1   1 
ATOM   5295  O  OE2   . GLU B  2  262 ? 72.015  48.077  79.228  1.00 117.70 ? 260  GLU B OE2   1 
ATOM   5296  N  N     . GLY B  2  263 ? 69.879  48.275  73.835  1.00 112.39 ? 261  GLY B N     1 
ATOM   5297  C  CA    . GLY B  2  263 ? 70.437  48.083  72.511  1.00 113.59 ? 261  GLY B CA    1 
ATOM   5298  C  C     . GLY B  2  263 ? 71.946  48.036  72.488  1.00 114.19 ? 261  GLY B C     1 
ATOM   5299  O  O     . GLY B  2  263 ? 72.569  47.186  73.120  1.00 114.48 ? 261  GLY B O     1 
ATOM   5300  N  N     . ALA B  2  264 ? 72.546  48.957  71.755  1.00 114.90 ? 262  ALA B N     1 
ATOM   5301  C  CA    . ALA B  2  264 ? 73.986  48.973  71.661  1.00 116.36 ? 262  ALA B CA    1 
ATOM   5302  C  C     . ALA B  2  264 ? 74.527  50.283  72.153  1.00 117.55 ? 262  ALA B C     1 
ATOM   5303  O  O     . ALA B  2  264 ? 73.771  51.145  72.597  1.00 117.38 ? 262  ALA B O     1 
ATOM   5304  C  CB    . ALA B  2  264 ? 74.410  48.748  70.240  1.00 117.29 ? 262  ALA B CB    1 
ATOM   5305  N  N     . ALA B  2  265 ? 75.844  50.427  72.059  1.00 119.35 ? 263  ALA B N     1 
ATOM   5306  C  CA    . ALA B  2  265 ? 76.520  51.632  72.506  1.00 121.41 ? 263  ALA B CA    1 
ATOM   5307  C  C     . ALA B  2  265 ? 77.342  52.234  71.391  1.00 122.82 ? 263  ALA B C     1 
ATOM   5308  O  O     . ALA B  2  265 ? 77.377  51.714  70.279  1.00 122.15 ? 263  ALA B O     1 
ATOM   5309  C  CB    . ALA B  2  265 ? 77.416  51.314  73.695  1.00 121.46 ? 263  ALA B CB    1 
ATOM   5310  N  N     . VAL B  2  266 ? 78.006  53.337  71.710  1.00 125.50 ? 264  VAL B N     1 
ATOM   5311  C  CA    . VAL B  2  266 ? 78.853  54.044  70.758  1.00 128.89 ? 264  VAL B CA    1 
ATOM   5312  C  C     . VAL B  2  266 ? 79.973  53.110  70.281  1.00 130.47 ? 264  VAL B C     1 
ATOM   5313  O  O     . VAL B  2  266 ? 80.328  52.160  70.983  1.00 131.25 ? 264  VAL B O     1 
ATOM   5314  C  CB    . VAL B  2  266 ? 79.496  55.300  71.418  1.00 129.70 ? 264  VAL B CB    1 
ATOM   5315  C  CG1   . VAL B  2  266 ? 80.196  56.151  70.355  1.00 130.05 ? 264  VAL B CG1   1 
ATOM   5316  C  CG2   . VAL B  2  266 ? 78.435  56.111  72.169  1.00 129.69 ? 264  VAL B CG2   1 
ATOM   5317  N  N     . GLY B  2  267 ? 80.519  53.376  69.094  1.00 131.66 ? 265  GLY B N     1 
ATOM   5318  C  CA    . GLY B  2  267 ? 81.601  52.559  68.560  1.00 132.77 ? 265  GLY B CA    1 
ATOM   5319  C  C     . GLY B  2  267 ? 81.290  51.089  68.304  1.00 133.57 ? 265  GLY B C     1 
ATOM   5320  O  O     . GLY B  2  267 ? 81.212  50.669  67.143  1.00 133.42 ? 265  GLY B O     1 
ATOM   5321  N  N     . SER B  2  268 ? 81.126  50.315  69.384  1.00 133.86 ? 266  SER B N     1 
ATOM   5322  C  CA    . SER B  2  268 ? 80.828  48.880  69.322  1.00 133.81 ? 266  SER B CA    1 
ATOM   5323  C  C     . SER B  2  268 ? 80.165  48.459  68.019  1.00 134.32 ? 266  SER B C     1 
ATOM   5324  O  O     . SER B  2  268 ? 79.085  48.941  67.675  1.00 134.26 ? 266  SER B O     1 
ATOM   5325  C  CB    . SER B  2  268 ? 79.925  48.469  70.491  1.00 133.24 ? 266  SER B CB    1 
ATOM   5326  O  OG    . SER B  2  268 ? 79.544  47.107  70.383  1.00 132.34 ? 266  SER B OG    1 
ATOM   5327  N  N     . ALA B  2  269 ? 80.821  47.553  67.298  1.00 134.94 ? 267  ALA B N     1 
ATOM   5328  C  CA    . ALA B  2  269 ? 80.297  47.058  66.025  1.00 135.11 ? 267  ALA B CA    1 
ATOM   5329  C  C     . ALA B  2  269 ? 78.986  46.305  66.250  1.00 134.76 ? 267  ALA B C     1 
ATOM   5330  O  O     . ALA B  2  269 ? 78.319  45.897  65.298  1.00 135.09 ? 267  ALA B O     1 
ATOM   5331  C  CB    . ALA B  2  269 ? 81.330  46.142  65.343  1.00 135.46 ? 267  ALA B CB    1 
ATOM   5332  N  N     . GLU B  2  270 ? 78.633  46.117  67.519  1.00 133.81 ? 268  GLU B N     1 
ATOM   5333  C  CA    . GLU B  2  270 ? 77.401  45.434  67.888  1.00 132.47 ? 268  GLU B CA    1 
ATOM   5334  C  C     . GLU B  2  270 ? 76.237  46.375  67.562  1.00 130.91 ? 268  GLU B C     1 
ATOM   5335  O  O     . GLU B  2  270 ? 75.092  45.941  67.392  1.00 130.35 ? 268  GLU B O     1 
ATOM   5336  C  CB    . GLU B  2  270 ? 77.434  45.107  69.387  1.00 133.62 ? 268  GLU B CB    1 
ATOM   5337  C  CG    . GLU B  2  270 ? 76.118  44.604  69.964  1.00 136.16 ? 268  GLU B CG    1 
ATOM   5338  C  CD    . GLU B  2  270 ? 76.205  44.274  71.456  1.00 137.68 ? 268  GLU B CD    1 
ATOM   5339  O  OE1   . GLU B  2  270 ? 76.699  45.120  72.242  1.00 137.21 ? 268  GLU B OE1   1 
ATOM   5340  O  OE2   . GLU B  2  270 ? 75.765  43.167  71.842  1.00 138.94 ? 268  GLU B OE2   1 
ATOM   5341  N  N     . ALA B  2  271 ? 76.562  47.665  67.451  1.00 128.92 ? 269  ALA B N     1 
ATOM   5342  C  CA    . ALA B  2  271 ? 75.595  48.726  67.159  1.00 126.26 ? 269  ALA B CA    1 
ATOM   5343  C  C     . ALA B  2  271 ? 75.227  48.839  65.686  1.00 124.18 ? 269  ALA B C     1 
ATOM   5344  O  O     . ALA B  2  271 ? 74.059  49.011  65.346  1.00 123.98 ? 269  ALA B O     1 
ATOM   5345  C  CB    . ALA B  2  271 ? 76.135  50.066  67.654  1.00 126.55 ? 269  ALA B CB    1 
ATOM   5346  N  N     . ASN B  2  272 ? 76.228  48.770  64.818  1.00 121.61 ? 270  ASN B N     1 
ATOM   5347  C  CA    . ASN B  2  272 ? 75.995  48.854  63.389  1.00 119.21 ? 270  ASN B CA    1 
ATOM   5348  C  C     . ASN B  2  272 ? 74.959  47.813  62.994  1.00 118.67 ? 270  ASN B C     1 
ATOM   5349  O  O     . ASN B  2  272 ? 74.058  48.092  62.208  1.00 118.69 ? 270  ASN B O     1 
ATOM   5350  C  CB    . ASN B  2  272 ? 77.298  48.609  62.637  1.00 117.97 ? 270  ASN B CB    1 
ATOM   5351  C  CG    . ASN B  2  272 ? 78.341  49.656  62.939  1.00 117.29 ? 270  ASN B CG    1 
ATOM   5352  O  OD1   . ASN B  2  272 ? 78.155  50.825  62.629  1.00 116.57 ? 270  ASN B OD1   1 
ATOM   5353  N  ND2   . ASN B  2  272 ? 79.442  49.245  63.552  1.00 117.05 ? 270  ASN B ND2   1 
ATOM   5354  N  N     . ALA B  2  273 ? 75.088  46.613  63.551  1.00 118.24 ? 271  ALA B N     1 
ATOM   5355  C  CA    . ALA B  2  273 ? 74.164  45.520  63.268  1.00 118.42 ? 271  ALA B CA    1 
ATOM   5356  C  C     . ALA B  2  273 ? 72.705  45.985  63.354  1.00 118.76 ? 271  ALA B C     1 
ATOM   5357  O  O     . ALA B  2  273 ? 71.936  45.842  62.399  1.00 118.81 ? 271  ALA B O     1 
ATOM   5358  C  CB    . ALA B  2  273 ? 74.414  44.364  64.243  1.00 117.95 ? 271  ALA B CB    1 
ATOM   5359  N  N     . PHE B  2  274 ? 72.326  46.543  64.501  1.00 118.96 ? 272  PHE B N     1 
ATOM   5360  C  CA    . PHE B  2  274 ? 70.959  47.026  64.686  1.00 118.31 ? 272  PHE B CA    1 
ATOM   5361  C  C     . PHE B  2  274 ? 70.597  48.015  63.588  1.00 117.49 ? 272  PHE B C     1 
ATOM   5362  O  O     . PHE B  2  274 ? 69.593  47.845  62.907  1.00 116.81 ? 272  PHE B O     1 
ATOM   5363  C  CB    . PHE B  2  274 ? 70.800  47.715  66.048  1.00 118.84 ? 272  PHE B CB    1 
ATOM   5364  C  CG    . PHE B  2  274 ? 70.869  46.780  67.213  1.00 118.58 ? 272  PHE B CG    1 
ATOM   5365  C  CD1   . PHE B  2  274 ? 72.018  46.697  67.989  1.00 118.25 ? 272  PHE B CD1   1 
ATOM   5366  C  CD2   . PHE B  2  274 ? 69.780  45.968  67.527  1.00 118.50 ? 272  PHE B CD2   1 
ATOM   5367  C  CE1   . PHE B  2  274 ? 72.082  45.817  69.062  1.00 119.05 ? 272  PHE B CE1   1 
ATOM   5368  C  CE2   . PHE B  2  274 ? 69.829  45.084  68.595  1.00 118.47 ? 272  PHE B CE2   1 
ATOM   5369  C  CZ    . PHE B  2  274 ? 70.980  45.005  69.367  1.00 119.28 ? 272  PHE B CZ    1 
ATOM   5370  N  N     . SER B  2  275 ? 71.426  49.047  63.435  1.00 116.73 ? 273  SER B N     1 
ATOM   5371  C  CA    . SER B  2  275 ? 71.223  50.087  62.434  1.00 115.50 ? 273  SER B CA    1 
ATOM   5372  C  C     . SER B  2  275 ? 70.717  49.465  61.153  1.00 114.58 ? 273  SER B C     1 
ATOM   5373  O  O     . SER B  2  275 ? 69.832  50.009  60.495  1.00 114.18 ? 273  SER B O     1 
ATOM   5374  C  CB    . SER B  2  275 ? 72.534  50.830  62.163  1.00 115.76 ? 273  SER B CB    1 
ATOM   5375  O  OG    . SER B  2  275 ? 73.043  51.414  63.351  1.00 115.87 ? 273  SER B OG    1 
ATOM   5376  N  N     . VAL B  2  276 ? 71.287  48.320  60.800  1.00 113.71 ? 274  VAL B N     1 
ATOM   5377  C  CA    . VAL B  2  276 ? 70.868  47.621  59.601  1.00 113.42 ? 274  VAL B CA    1 
ATOM   5378  C  C     . VAL B  2  276 ? 69.524  46.969  59.894  1.00 113.17 ? 274  VAL B C     1 
ATOM   5379  O  O     . VAL B  2  276 ? 68.602  47.044  59.082  1.00 112.84 ? 274  VAL B O     1 
ATOM   5380  C  CB    . VAL B  2  276 ? 71.903  46.557  59.176  1.00 113.45 ? 274  VAL B CB    1 
ATOM   5381  C  CG1   . VAL B  2  276 ? 71.329  45.677  58.077  1.00 113.19 ? 274  VAL B CG1   1 
ATOM   5382  C  CG2   . VAL B  2  276 ? 73.172  47.246  58.675  1.00 112.92 ? 274  VAL B CG2   1 
ATOM   5383  N  N     . LEU B  2  277 ? 69.408  46.345  61.063  1.00 112.99 ? 275  LEU B N     1 
ATOM   5384  C  CA    . LEU B  2  277 ? 68.152  45.710  61.456  1.00 113.08 ? 275  LEU B CA    1 
ATOM   5385  C  C     . LEU B  2  277 ? 67.065  46.774  61.571  1.00 112.56 ? 275  LEU B C     1 
ATOM   5386  O  O     . LEU B  2  277 ? 65.869  46.490  61.489  1.00 112.29 ? 275  LEU B O     1 
ATOM   5387  C  CB    . LEU B  2  277 ? 68.306  44.996  62.794  1.00 113.54 ? 275  LEU B CB    1 
ATOM   5388  C  CG    . LEU B  2  277 ? 66.992  44.463  63.372  1.00 114.25 ? 275  LEU B CG    1 
ATOM   5389  C  CD1   . LEU B  2  277 ? 66.171  43.725  62.318  1.00 113.83 ? 275  LEU B CD1   1 
ATOM   5390  C  CD2   . LEU B  2  277 ? 67.327  43.538  64.517  1.00 115.41 ? 275  LEU B CD2   1 
ATOM   5391  N  N     . GLN B  2  278 ? 67.508  48.004  61.782  1.00 111.94 ? 276  GLN B N     1 
ATOM   5392  C  CA    . GLN B  2  278 ? 66.631  49.157  61.884  1.00 110.84 ? 276  GLN B CA    1 
ATOM   5393  C  C     . GLN B  2  278 ? 65.991  49.299  60.506  1.00 110.67 ? 276  GLN B C     1 
ATOM   5394  O  O     . GLN B  2  278 ? 64.804  49.028  60.321  1.00 110.21 ? 276  GLN B O     1 
ATOM   5395  C  CB    . GLN B  2  278 ? 67.481  50.395  62.198  1.00 110.25 ? 276  GLN B CB    1 
ATOM   5396  C  CG    . GLN B  2  278 ? 66.731  51.678  62.514  1.00 108.23 ? 276  GLN B CG    1 
ATOM   5397  C  CD    . GLN B  2  278 ? 67.682  52.842  62.758  1.00 106.95 ? 276  GLN B CD    1 
ATOM   5398  O  OE1   . GLN B  2  278 ? 67.371  53.769  63.508  1.00 106.51 ? 276  GLN B OE1   1 
ATOM   5399  N  NE2   . GLN B  2  278 ? 68.846  52.800  62.115  1.00 105.27 ? 276  GLN B NE2   1 
ATOM   5400  N  N     . HIS B  2  279 ? 66.815  49.705  59.543  1.00 110.31 ? 277  HIS B N     1 
ATOM   5401  C  CA    . HIS B  2  279 ? 66.393  49.904  58.166  1.00 109.65 ? 277  HIS B CA    1 
ATOM   5402  C  C     . HIS B  2  279 ? 65.665  48.707  57.597  1.00 109.79 ? 277  HIS B C     1 
ATOM   5403  O  O     . HIS B  2  279 ? 64.789  48.852  56.755  1.00 110.36 ? 277  HIS B O     1 
ATOM   5404  C  CB    . HIS B  2  279 ? 67.601  50.221  57.296  1.00 108.61 ? 277  HIS B CB    1 
ATOM   5405  C  CG    . HIS B  2  279 ? 68.261  51.515  57.642  1.00 108.26 ? 277  HIS B CG    1 
ATOM   5406  N  ND1   . HIS B  2  279 ? 67.615  52.728  57.549  1.00 107.90 ? 277  HIS B ND1   1 
ATOM   5407  C  CD2   . HIS B  2  279 ? 69.511  51.785  58.082  1.00 108.54 ? 277  HIS B CD2   1 
ATOM   5408  C  CE1   . HIS B  2  279 ? 68.440  53.692  57.916  1.00 107.82 ? 277  HIS B CE1   1 
ATOM   5409  N  NE2   . HIS B  2  279 ? 69.596  53.146  58.244  1.00 108.85 ? 277  HIS B NE2   1 
ATOM   5410  N  N     . VAL B  2  280 ? 66.028  47.520  58.051  1.00 110.17 ? 278  VAL B N     1 
ATOM   5411  C  CA    . VAL B  2  280 ? 65.379  46.319  57.560  1.00 111.49 ? 278  VAL B CA    1 
ATOM   5412  C  C     . VAL B  2  280 ? 63.920  46.246  57.995  1.00 112.53 ? 278  VAL B C     1 
ATOM   5413  O  O     . VAL B  2  280 ? 63.100  45.602  57.342  1.00 112.54 ? 278  VAL B O     1 
ATOM   5414  C  CB    . VAL B  2  280 ? 66.081  45.073  58.071  1.00 111.37 ? 278  VAL B CB    1 
ATOM   5415  C  CG1   . VAL B  2  280 ? 65.343  43.840  57.596  1.00 111.61 ? 278  VAL B CG1   1 
ATOM   5416  C  CG2   . VAL B  2  280 ? 67.508  45.061  57.589  1.00 111.40 ? 278  VAL B CG2   1 
ATOM   5417  N  N     . LEU B  2  281 ? 63.603  46.901  59.104  1.00 113.74 ? 279  LEU B N     1 
ATOM   5418  C  CA    . LEU B  2  281 ? 62.243  46.900  59.624  1.00 114.80 ? 279  LEU B CA    1 
ATOM   5419  C  C     . LEU B  2  281 ? 61.479  48.130  59.143  1.00 115.53 ? 279  LEU B C     1 
ATOM   5420  O  O     . LEU B  2  281 ? 60.260  48.211  59.284  1.00 115.24 ? 279  LEU B O     1 
ATOM   5421  C  CB    . LEU B  2  281 ? 62.284  46.847  61.153  1.00 115.02 ? 279  LEU B CB    1 
ATOM   5422  C  CG    . LEU B  2  281 ? 62.826  45.527  61.719  1.00 114.94 ? 279  LEU B CG    1 
ATOM   5423  C  CD1   . LEU B  2  281 ? 63.555  45.759  63.043  1.00 115.18 ? 279  LEU B CD1   1 
ATOM   5424  C  CD2   . LEU B  2  281 ? 61.669  44.548  61.875  1.00 114.23 ? 279  LEU B CD2   1 
ATOM   5425  N  N     . GLY B  2  282 ? 62.210  49.077  58.561  1.00 116.64 ? 280  GLY B N     1 
ATOM   5426  C  CA    . GLY B  2  282 ? 61.600  50.296  58.051  1.00 118.04 ? 280  GLY B CA    1 
ATOM   5427  C  C     . GLY B  2  282 ? 61.882  51.493  58.937  1.00 118.65 ? 280  GLY B C     1 
ATOM   5428  O  O     . GLY B  2  282 ? 61.475  51.506  60.099  1.00 118.62 ? 280  GLY B O     1 
ATOM   5429  N  N     . ALA B  2  283 ? 62.561  52.505  58.401  1.00 119.36 ? 281  ALA B N     1 
ATOM   5430  C  CA    . ALA B  2  283 ? 62.894  53.683  59.200  1.00 120.42 ? 281  ALA B CA    1 
ATOM   5431  C  C     . ALA B  2  283 ? 62.565  55.044  58.579  1.00 121.22 ? 281  ALA B C     1 
ATOM   5432  O  O     . ALA B  2  283 ? 63.451  55.730  58.057  1.00 121.46 ? 281  ALA B O     1 
ATOM   5433  C  CB    . ALA B  2  283 ? 64.374  53.641  59.579  1.00 120.28 ? 281  ALA B CB    1 
ATOM   5434  N  N     . GLY B  2  284 ? 61.295  55.438  58.657  1.00 121.74 ? 282  GLY B N     1 
ATOM   5435  C  CA    . GLY B  2  284 ? 60.863  56.722  58.118  1.00 121.80 ? 282  GLY B CA    1 
ATOM   5436  C  C     . GLY B  2  284 ? 60.848  56.859  56.599  1.00 121.43 ? 282  GLY B C     1 
ATOM   5437  O  O     . GLY B  2  284 ? 61.841  57.305  56.019  1.00 121.55 ? 282  GLY B O     1 
ATOM   5438  N  N     . PRO B  2  285 ? 59.726  56.512  55.932  1.00 120.92 ? 283  PRO B N     1 
ATOM   5439  C  CA    . PRO B  2  285 ? 59.507  56.565  54.480  1.00 120.12 ? 283  PRO B CA    1 
ATOM   5440  C  C     . PRO B  2  285 ? 60.404  57.497  53.645  1.00 119.05 ? 283  PRO B C     1 
ATOM   5441  O  O     . PRO B  2  285 ? 60.909  58.519  54.135  1.00 119.12 ? 283  PRO B O     1 
ATOM   5442  C  CB    . PRO B  2  285 ? 58.009  56.909  54.360  1.00 120.72 ? 283  PRO B CB    1 
ATOM   5443  C  CG    . PRO B  2  285 ? 57.490  57.013  55.814  1.00 120.98 ? 283  PRO B CG    1 
ATOM   5444  C  CD    . PRO B  2  285 ? 58.460  56.193  56.608  1.00 121.30 ? 283  PRO B CD    1 
ATOM   5445  N  N     . LEU B  2  286 ? 60.588  57.125  52.377  1.00 117.06 ? 284  LEU B N     1 
ATOM   5446  C  CA    . LEU B  2  286 ? 61.424  57.886  51.453  1.00 114.90 ? 284  LEU B CA    1 
ATOM   5447  C  C     . LEU B  2  286 ? 60.605  58.518  50.348  1.00 112.73 ? 284  LEU B C     1 
ATOM   5448  O  O     . LEU B  2  286 ? 61.150  59.202  49.483  1.00 112.45 ? 284  LEU B O     1 
ATOM   5449  C  CB    . LEU B  2  286 ? 62.455  56.977  50.799  1.00 116.56 ? 284  LEU B CB    1 
ATOM   5450  C  CG    . LEU B  2  286 ? 63.074  55.868  51.645  1.00 118.55 ? 284  LEU B CG    1 
ATOM   5451  C  CD1   . LEU B  2  286 ? 64.168  55.195  50.823  1.00 119.16 ? 284  LEU B CD1   1 
ATOM   5452  C  CD2   . LEU B  2  286 ? 63.647  56.436  52.948  1.00 120.32 ? 284  LEU B CD2   1 
ATOM   5453  N  N     . ILE B  2  287 ? 59.300  58.269  50.370  1.00 109.97 ? 285  ILE B N     1 
ATOM   5454  C  CA    . ILE B  2  287 ? 58.397  58.804  49.361  1.00 106.97 ? 285  ILE B CA    1 
ATOM   5455  C  C     . ILE B  2  287 ? 57.173  59.462  49.980  1.00 105.47 ? 285  ILE B C     1 
ATOM   5456  O  O     . ILE B  2  287 ? 56.392  58.814  50.671  1.00 104.47 ? 285  ILE B O     1 
ATOM   5457  C  CB    . ILE B  2  287 ? 57.944  57.696  48.411  1.00 106.33 ? 285  ILE B CB    1 
ATOM   5458  C  CG1   . ILE B  2  287 ? 57.653  56.425  49.215  1.00 105.47 ? 285  ILE B CG1   1 
ATOM   5459  C  CG2   . ILE B  2  287 ? 59.003  57.466  47.343  1.00 105.74 ? 285  ILE B CG2   1 
ATOM   5460  C  CD1   . ILE B  2  287 ? 57.288  55.227  48.362  1.00 105.14 ? 285  ILE B CD1   1 
ATOM   5461  N  N     . LYS B  2  288 ? 57.021  60.756  49.719  1.00 104.35 ? 286  LYS B N     1 
ATOM   5462  C  CA    . LYS B  2  288 ? 55.909  61.547  50.237  1.00 103.71 ? 286  LYS B CA    1 
ATOM   5463  C  C     . LYS B  2  288 ? 54.557  60.850  50.012  1.00 103.87 ? 286  LYS B C     1 
ATOM   5464  O  O     . LYS B  2  288 ? 54.159  60.608  48.874  1.00 103.99 ? 286  LYS B O     1 
ATOM   5465  C  CB    . LYS B  2  288 ? 55.925  62.922  49.559  1.00 102.67 ? 286  LYS B CB    1 
ATOM   5466  C  CG    . LYS B  2  288 ? 55.038  63.981  50.196  1.00 101.94 ? 286  LYS B CG    1 
ATOM   5467  C  CD    . LYS B  2  288 ? 55.081  65.272  49.385  1.00 101.82 ? 286  LYS B CD    1 
ATOM   5468  C  CE    . LYS B  2  288 ? 54.099  66.315  49.896  1.00 101.00 ? 286  LYS B CE    1 
ATOM   5469  N  NZ    . LYS B  2  288 ? 53.982  67.451  48.940  1.00 100.59 ? 286  LYS B NZ    1 
ATOM   5470  N  N     . ARG B  2  289 ? 53.853  60.536  51.100  1.00 104.12 ? 287  ARG B N     1 
ATOM   5471  C  CA    . ARG B  2  289 ? 52.551  59.860  51.028  1.00 104.41 ? 287  ARG B CA    1 
ATOM   5472  C  C     . ARG B  2  289 ? 52.711  58.437  50.528  1.00 105.53 ? 287  ARG B C     1 
ATOM   5473  O  O     . ARG B  2  289 ? 51.754  57.816  50.060  1.00 104.48 ? 287  ARG B O     1 
ATOM   5474  C  CB    . ARG B  2  289 ? 51.592  60.596  50.087  1.00 103.10 ? 287  ARG B CB    1 
ATOM   5475  C  CG    . ARG B  2  289 ? 51.352  62.036  50.466  1.00 101.76 ? 287  ARG B CG    1 
ATOM   5476  C  CD    . ARG B  2  289 ? 50.123  62.612  49.788  1.00 99.33  ? 287  ARG B CD    1 
ATOM   5477  N  NE    . ARG B  2  289 ? 49.830  63.939  50.318  1.00 97.62  ? 287  ARG B NE    1 
ATOM   5478  C  CZ    . ARG B  2  289 ? 50.507  65.037  50.003  1.00 96.98  ? 287  ARG B CZ    1 
ATOM   5479  N  NH1   . ARG B  2  289 ? 51.512  64.981  49.143  1.00 96.56  ? 287  ARG B NH1   1 
ATOM   5480  N  NH2   . ARG B  2  289 ? 50.201  66.187  50.580  1.00 97.61  ? 287  ARG B NH2   1 
ATOM   5481  N  N     . GLY B  2  290 ? 53.929  57.926  50.644  1.00 107.45 ? 288  GLY B N     1 
ATOM   5482  C  CA    . GLY B  2  290 ? 54.223  56.585  50.179  1.00 110.24 ? 288  GLY B CA    1 
ATOM   5483  C  C     . GLY B  2  290 ? 53.531  55.442  50.893  1.00 111.83 ? 288  GLY B C     1 
ATOM   5484  O  O     . GLY B  2  290 ? 52.462  55.615  51.489  1.00 111.99 ? 288  GLY B O     1 
ATOM   5485  N  N     . SER B  2  291 ? 54.155  54.266  50.801  1.00 113.18 ? 289  SER B N     1 
ATOM   5486  C  CA    . SER B  2  291 ? 53.665  53.030  51.420  1.00 114.10 ? 289  SER B CA    1 
ATOM   5487  C  C     . SER B  2  291 ? 54.846  52.208  51.930  1.00 114.13 ? 289  SER B C     1 
ATOM   5488  O  O     . SER B  2  291 ? 54.659  51.157  52.546  1.00 113.64 ? 289  SER B O     1 
ATOM   5489  C  CB    . SER B  2  291 ? 52.865  52.193  50.409  1.00 114.13 ? 289  SER B CB    1 
ATOM   5490  O  OG    . SER B  2  291 ? 52.457  50.951  50.970  1.00 114.16 ? 289  SER B OG    1 
ATOM   5491  N  N     . SER B  2  292 ? 56.055  52.700  51.666  1.00 114.34 ? 290  SER B N     1 
ATOM   5492  C  CA    . SER B  2  292 ? 57.280  52.028  52.082  1.00 115.03 ? 290  SER B CA    1 
ATOM   5493  C  C     . SER B  2  292 ? 57.113  50.514  52.084  1.00 115.51 ? 290  SER B C     1 
ATOM   5494  O  O     . SER B  2  292 ? 56.665  49.938  53.073  1.00 116.18 ? 290  SER B O     1 
ATOM   5495  C  CB    . SER B  2  292 ? 57.693  52.489  53.481  1.00 114.82 ? 290  SER B CB    1 
ATOM   5496  O  OG    . SER B  2  292 ? 57.944  53.879  53.507  1.00 115.54 ? 290  SER B OG    1 
ATOM   5497  N  N     . VAL B  2  293 ? 57.463  49.862  50.981  1.00 115.74 ? 291  VAL B N     1 
ATOM   5498  C  CA    . VAL B  2  293 ? 57.346  48.411  50.920  1.00 115.50 ? 291  VAL B CA    1 
ATOM   5499  C  C     . VAL B  2  293 ? 58.624  47.789  51.491  1.00 115.49 ? 291  VAL B C     1 
ATOM   5500  O  O     . VAL B  2  293 ? 58.611  46.645  51.952  1.00 115.36 ? 291  VAL B O     1 
ATOM   5501  C  CB    . VAL B  2  293 ? 57.124  47.923  49.470  1.00 115.53 ? 291  VAL B CB    1 
ATOM   5502  C  CG1   . VAL B  2  293 ? 56.724  46.455  49.466  1.00 114.55 ? 291  VAL B CG1   1 
ATOM   5503  C  CG2   . VAL B  2  293 ? 56.049  48.764  48.803  1.00 115.46 ? 291  VAL B CG2   1 
ATOM   5504  N  N     . THR B  2  294 ? 59.716  48.559  51.469  1.00 115.34 ? 292  THR B N     1 
ATOM   5505  C  CA    . THR B  2  294 ? 61.016  48.124  51.995  1.00 114.98 ? 292  THR B CA    1 
ATOM   5506  C  C     . THR B  2  294 ? 60.953  48.031  53.515  1.00 115.11 ? 292  THR B C     1 
ATOM   5507  O  O     . THR B  2  294 ? 61.924  47.636  54.168  1.00 115.19 ? 292  THR B O     1 
ATOM   5508  C  CB    . THR B  2  294 ? 62.135  49.130  51.658  1.00 114.79 ? 292  THR B CB    1 
ATOM   5509  O  OG1   . THR B  2  294 ? 62.163  49.361  50.248  1.00 114.86 ? 292  THR B OG1   1 
ATOM   5510  C  CG2   . THR B  2  294 ? 63.490  48.601  52.126  1.00 114.30 ? 292  THR B CG2   1 
ATOM   5511  N  N     . SER B  2  295 ? 59.805  48.416  54.068  1.00 114.70 ? 293  SER B N     1 
ATOM   5512  C  CA    . SER B  2  295 ? 59.583  48.396  55.506  1.00 113.42 ? 293  SER B CA    1 
ATOM   5513  C  C     . SER B  2  295 ? 58.798  47.160  55.936  1.00 113.02 ? 293  SER B C     1 
ATOM   5514  O  O     . SER B  2  295 ? 57.571  47.120  55.838  1.00 112.34 ? 293  SER B O     1 
ATOM   5515  C  CB    . SER B  2  295 ? 58.838  49.661  55.931  1.00 112.82 ? 293  SER B CB    1 
ATOM   5516  O  OG    . SER B  2  295 ? 58.642  49.677  57.331  1.00 112.15 ? 293  SER B OG    1 
ATOM   5517  N  N     . LYS B  2  296 ? 59.524  46.147  56.398  1.00 113.26 ? 294  LYS B N     1 
ATOM   5518  C  CA    . LYS B  2  296 ? 58.915  44.906  56.860  1.00 113.35 ? 294  LYS B CA    1 
ATOM   5519  C  C     . LYS B  2  296 ? 57.865  45.297  57.886  1.00 113.35 ? 294  LYS B C     1 
ATOM   5520  O  O     . LYS B  2  296 ? 56.680  45.005  57.731  1.00 113.12 ? 294  LYS B O     1 
ATOM   5521  C  CB    . LYS B  2  296 ? 59.965  44.006  57.533  1.00 113.32 ? 294  LYS B CB    1 
ATOM   5522  C  CG    . LYS B  2  296 ? 61.125  43.564  56.642  1.00 112.55 ? 294  LYS B CG    1 
ATOM   5523  C  CD    . LYS B  2  296 ? 60.747  42.396  55.746  1.00 111.77 ? 294  LYS B CD    1 
ATOM   5524  C  CE    . LYS B  2  296 ? 61.917  41.979  54.866  1.00 111.06 ? 294  LYS B CE    1 
ATOM   5525  N  NZ    . LYS B  2  296 ? 61.639  40.721  54.118  1.00 110.34 ? 294  LYS B NZ    1 
ATOM   5526  N  N     . LEU B  2  297 ? 58.326  45.979  58.931  1.00 113.30 ? 295  LEU B N     1 
ATOM   5527  C  CA    . LEU B  2  297 ? 57.468  46.425  60.018  1.00 113.04 ? 295  LEU B CA    1 
ATOM   5528  C  C     . LEU B  2  297 ? 56.227  47.143  59.478  1.00 112.98 ? 295  LEU B C     1 
ATOM   5529  O  O     . LEU B  2  297 ? 55.109  46.645  59.619  1.00 111.53 ? 295  LEU B O     1 
ATOM   5530  C  CB    . LEU B  2  297 ? 58.280  47.336  60.954  1.00 112.66 ? 295  LEU B CB    1 
ATOM   5531  C  CG    . LEU B  2  297 ? 57.810  47.672  62.374  1.00 112.22 ? 295  LEU B CG    1 
ATOM   5532  C  CD1   . LEU B  2  297 ? 57.531  46.409  63.173  1.00 111.89 ? 295  LEU B CD1   1 
ATOM   5533  C  CD2   . LEU B  2  297 ? 58.889  48.494  63.055  1.00 111.52 ? 295  LEU B CD2   1 
ATOM   5534  N  N     . TYR B  2  298 ? 56.433  48.298  58.848  1.00 113.90 ? 296  TYR B N     1 
ATOM   5535  C  CA    . TYR B  2  298 ? 55.332  49.083  58.286  1.00 114.89 ? 296  TYR B CA    1 
ATOM   5536  C  C     . TYR B  2  298 ? 54.360  48.131  57.607  1.00 115.06 ? 296  TYR B C     1 
ATOM   5537  O  O     . TYR B  2  298 ? 53.274  47.863  58.118  1.00 114.42 ? 296  TYR B O     1 
ATOM   5538  C  CB    . TYR B  2  298 ? 55.869  50.081  57.254  1.00 115.76 ? 296  TYR B CB    1 
ATOM   5539  C  CG    . TYR B  2  298 ? 54.985  51.287  56.987  1.00 116.52 ? 296  TYR B CG    1 
ATOM   5540  C  CD1   . TYR B  2  298 ? 53.604  51.151  56.817  1.00 116.64 ? 296  TYR B CD1   1 
ATOM   5541  C  CD2   . TYR B  2  298 ? 55.541  52.567  56.879  1.00 116.75 ? 296  TYR B CD2   1 
ATOM   5542  C  CE1   . TYR B  2  298 ? 52.800  52.261  56.548  1.00 117.39 ? 296  TYR B CE1   1 
ATOM   5543  C  CE2   . TYR B  2  298 ? 54.748  53.681  56.609  1.00 117.33 ? 296  TYR B CE2   1 
ATOM   5544  C  CZ    . TYR B  2  298 ? 53.378  53.524  56.445  1.00 117.85 ? 296  TYR B CZ    1 
ATOM   5545  O  OH    . TYR B  2  298 ? 52.591  54.630  56.178  1.00 118.55 ? 296  TYR B OH    1 
ATOM   5546  N  N     . GLN B  2  299 ? 54.771  47.625  56.450  1.00 115.80 ? 297  GLN B N     1 
ATOM   5547  C  CA    . GLN B  2  299 ? 53.968  46.688  55.682  1.00 116.45 ? 297  GLN B CA    1 
ATOM   5548  C  C     . GLN B  2  299 ? 53.293  45.706  56.632  1.00 117.50 ? 297  GLN B C     1 
ATOM   5549  O  O     . GLN B  2  299 ? 52.079  45.516  56.591  1.00 117.22 ? 297  GLN B O     1 
ATOM   5550  C  CB    . GLN B  2  299 ? 54.859  45.923  54.701  1.00 115.73 ? 297  GLN B CB    1 
ATOM   5551  C  CG    . GLN B  2  299 ? 55.426  46.753  53.558  1.00 114.59 ? 297  GLN B CG    1 
ATOM   5552  C  CD    . GLN B  2  299 ? 54.353  47.255  52.608  1.00 114.04 ? 297  GLN B CD    1 
ATOM   5553  O  OE1   . GLN B  2  299 ? 53.364  46.567  52.351  1.00 113.84 ? 297  GLN B OE1   1 
ATOM   5554  N  NE2   . GLN B  2  299 ? 54.552  48.451  52.069  1.00 113.22 ? 297  GLN B NE2   1 
ATOM   5555  N  N     . GLY B  2  300 ? 54.092  45.096  57.500  1.00 118.69 ? 298  GLY B N     1 
ATOM   5556  C  CA    . GLY B  2  300 ? 53.560  44.133  58.445  1.00 119.94 ? 298  GLY B CA    1 
ATOM   5557  C  C     . GLY B  2  300 ? 52.321  44.618  59.166  1.00 120.81 ? 298  GLY B C     1 
ATOM   5558  O  O     . GLY B  2  300 ? 51.310  43.913  59.233  1.00 120.63 ? 298  GLY B O     1 
ATOM   5559  N  N     . VAL B  2  301 ? 52.397  45.836  59.694  1.00 121.68 ? 299  VAL B N     1 
ATOM   5560  C  CA    . VAL B  2  301 ? 51.291  46.427  60.444  1.00 122.26 ? 299  VAL B CA    1 
ATOM   5561  C  C     . VAL B  2  301 ? 50.030  46.606  59.614  1.00 121.77 ? 299  VAL B C     1 
ATOM   5562  O  O     . VAL B  2  301 ? 48.937  46.231  60.035  1.00 120.87 ? 299  VAL B O     1 
ATOM   5563  C  CB    . VAL B  2  301 ? 51.695  47.808  61.037  1.00 122.98 ? 299  VAL B CB    1 
ATOM   5564  C  CG1   . VAL B  2  301 ? 50.562  48.366  61.894  1.00 123.24 ? 299  VAL B CG1   1 
ATOM   5565  C  CG2   . VAL B  2  301 ? 52.973  47.668  61.869  1.00 123.50 ? 299  VAL B CG2   1 
ATOM   5566  N  N     . ALA B  2  302 ? 50.189  47.181  58.431  1.00 122.19 ? 300  ALA B N     1 
ATOM   5567  C  CA    . ALA B  2  302 ? 49.057  47.424  57.553  1.00 122.68 ? 300  ALA B CA    1 
ATOM   5568  C  C     . ALA B  2  302 ? 48.202  46.176  57.355  1.00 122.88 ? 300  ALA B C     1 
ATOM   5569  O  O     . ALA B  2  302 ? 46.975  46.253  57.355  1.00 122.34 ? 300  ALA B O     1 
ATOM   5570  C  CB    . ALA B  2  302 ? 49.549  47.950  56.201  1.00 122.64 ? 300  ALA B CB    1 
ATOM   5571  N  N     . LYS B  2  303 ? 48.855  45.029  57.201  1.00 123.79 ? 301  LYS B N     1 
ATOM   5572  C  CA    . LYS B  2  303 ? 48.159  43.765  56.974  1.00 124.83 ? 301  LYS B CA    1 
ATOM   5573  C  C     . LYS B  2  303 ? 47.235  43.381  58.121  1.00 124.54 ? 301  LYS B C     1 
ATOM   5574  O  O     . LYS B  2  303 ? 46.413  42.470  57.988  1.00 124.32 ? 301  LYS B O     1 
ATOM   5575  C  CB    . LYS B  2  303 ? 49.173  42.632  56.741  1.00 126.20 ? 301  LYS B CB    1 
ATOM   5576  C  CG    . LYS B  2  303 ? 50.153  42.874  55.580  1.00 128.56 ? 301  LYS B CG    1 
ATOM   5577  C  CD    . LYS B  2  303 ? 51.090  41.679  55.347  1.00 129.62 ? 301  LYS B CD    1 
ATOM   5578  C  CE    . LYS B  2  303 ? 52.190  41.995  54.323  1.00 129.92 ? 301  LYS B CE    1 
ATOM   5579  N  NZ    . LYS B  2  303 ? 51.675  42.325  52.959  1.00 130.29 ? 301  LYS B NZ    1 
ATOM   5580  N  N     . ALA B  2  304 ? 47.363  44.082  59.241  1.00 124.40 ? 302  ALA B N     1 
ATOM   5581  C  CA    . ALA B  2  304 ? 46.549  43.789  60.416  1.00 124.09 ? 302  ALA B CA    1 
ATOM   5582  C  C     . ALA B  2  304 ? 45.501  44.850  60.742  1.00 123.72 ? 302  ALA B C     1 
ATOM   5583  O  O     . ALA B  2  304 ? 44.372  44.522  61.105  1.00 123.04 ? 302  ALA B O     1 
ATOM   5584  C  CB    . ALA B  2  304 ? 47.454  43.573  61.618  1.00 124.60 ? 302  ALA B CB    1 
ATOM   5585  N  N     . THR B  2  305 ? 45.875  46.120  60.626  1.00 123.82 ? 303  THR B N     1 
ATOM   5586  C  CA    . THR B  2  305 ? 44.952  47.215  60.918  1.00 123.92 ? 303  THR B CA    1 
ATOM   5587  C  C     . THR B  2  305 ? 44.358  47.779  59.629  1.00 124.22 ? 303  THR B C     1 
ATOM   5588  O  O     . THR B  2  305 ? 45.044  47.876  58.606  1.00 124.81 ? 303  THR B O     1 
ATOM   5589  C  CB    . THR B  2  305 ? 45.657  48.363  61.663  1.00 123.77 ? 303  THR B CB    1 
ATOM   5590  O  OG1   . THR B  2  305 ? 44.687  49.336  62.075  1.00 123.44 ? 303  THR B OG1   1 
ATOM   5591  C  CG2   . THR B  2  305 ? 46.693  49.030  60.758  1.00 123.31 ? 303  THR B CG2   1 
ATOM   5592  N  N     . THR B  2  306 ? 43.083  48.158  59.687  1.00 123.76 ? 304  THR B N     1 
ATOM   5593  C  CA    . THR B  2  306 ? 42.388  48.706  58.523  1.00 122.32 ? 304  THR B CA    1 
ATOM   5594  C  C     . THR B  2  306 ? 42.558  50.229  58.409  1.00 121.31 ? 304  THR B C     1 
ATOM   5595  O  O     . THR B  2  306 ? 42.783  50.756  57.316  1.00 120.92 ? 304  THR B O     1 
ATOM   5596  C  CB    . THR B  2  306 ? 40.866  48.344  58.561  1.00 122.19 ? 304  THR B CB    1 
ATOM   5597  O  OG1   . THR B  2  306 ? 40.232  48.998  59.668  1.00 122.18 ? 304  THR B OG1   1 
ATOM   5598  C  CG2   . THR B  2  306 ? 40.678  46.839  58.725  1.00 122.01 ? 304  THR B CG2   1 
ATOM   5599  N  N     . GLN B  2  307 ? 42.469  50.920  59.545  1.00 120.11 ? 305  GLN B N     1 
ATOM   5600  C  CA    . GLN B  2  307 ? 42.589  52.379  59.604  1.00 118.69 ? 305  GLN B CA    1 
ATOM   5601  C  C     . GLN B  2  307 ? 44.046  52.862  59.562  1.00 117.73 ? 305  GLN B C     1 
ATOM   5602  O  O     . GLN B  2  307 ? 44.973  52.053  59.541  1.00 117.43 ? 305  GLN B O     1 
ATOM   5603  C  CB    . GLN B  2  307 ? 41.903  52.909  60.879  1.00 118.56 ? 305  GLN B CB    1 
ATOM   5604  C  CG    . GLN B  2  307 ? 40.371  52.764  60.924  1.00 118.12 ? 305  GLN B CG    1 
ATOM   5605  C  CD    . GLN B  2  307 ? 39.644  53.676  59.941  1.00 117.63 ? 305  GLN B CD    1 
ATOM   5606  O  OE1   . GLN B  2  307 ? 39.775  54.899  59.997  1.00 117.18 ? 305  GLN B OE1   1 
ATOM   5607  N  NE2   . GLN B  2  307 ? 38.868  53.080  59.038  1.00 117.09 ? 305  GLN B NE2   1 
ATOM   5608  N  N     . PRO B  2  308 ? 44.254  54.196  59.532  1.00 116.92 ? 306  PRO B N     1 
ATOM   5609  C  CA    . PRO B  2  308 ? 45.564  54.862  59.494  1.00 115.92 ? 306  PRO B CA    1 
ATOM   5610  C  C     . PRO B  2  308 ? 46.483  54.580  60.679  1.00 114.33 ? 306  PRO B C     1 
ATOM   5611  O  O     . PRO B  2  308 ? 46.028  54.207  61.761  1.00 114.26 ? 306  PRO B O     1 
ATOM   5612  C  CB    . PRO B  2  308 ? 45.194  56.338  59.407  1.00 116.37 ? 306  PRO B CB    1 
ATOM   5613  C  CG    . PRO B  2  308 ? 43.971  56.295  58.564  1.00 117.43 ? 306  PRO B CG    1 
ATOM   5614  C  CD    . PRO B  2  308 ? 43.193  55.166  59.208  1.00 117.34 ? 306  PRO B CD    1 
ATOM   5615  N  N     . PHE B  2  309 ? 47.780  54.791  60.463  1.00 112.50 ? 307  PHE B N     1 
ATOM   5616  C  CA    . PHE B  2  309 ? 48.787  54.546  61.491  1.00 110.29 ? 307  PHE B CA    1 
ATOM   5617  C  C     . PHE B  2  309 ? 50.198  54.873  60.988  1.00 107.95 ? 307  PHE B C     1 
ATOM   5618  O  O     . PHE B  2  309 ? 50.381  55.507  59.956  1.00 108.39 ? 307  PHE B O     1 
ATOM   5619  C  CB    . PHE B  2  309 ? 48.742  53.074  61.894  1.00 111.62 ? 307  PHE B CB    1 
ATOM   5620  C  CG    . PHE B  2  309 ? 49.334  52.154  60.865  1.00 112.83 ? 307  PHE B CG    1 
ATOM   5621  C  CD1   . PHE B  2  309 ? 50.688  51.825  60.904  1.00 113.28 ? 307  PHE B CD1   1 
ATOM   5622  C  CD2   . PHE B  2  309 ? 48.553  51.665  59.823  1.00 113.36 ? 307  PHE B CD2   1 
ATOM   5623  C  CE1   . PHE B  2  309 ? 51.259  51.030  59.922  1.00 114.25 ? 307  PHE B CE1   1 
ATOM   5624  C  CE2   . PHE B  2  309 ? 49.111  50.867  58.831  1.00 114.31 ? 307  PHE B CE2   1 
ATOM   5625  C  CZ    . PHE B  2  309 ? 50.470  50.547  58.879  1.00 114.74 ? 307  PHE B CZ    1 
ATOM   5626  N  N     . ASP B  2  310 ? 51.189  54.422  61.741  1.00 104.84 ? 308  ASP B N     1 
ATOM   5627  C  CA    . ASP B  2  310 ? 52.582  54.606  61.393  1.00 102.58 ? 308  ASP B CA    1 
ATOM   5628  C  C     . ASP B  2  310 ? 53.396  53.906  62.467  1.00 102.38 ? 308  ASP B C     1 
ATOM   5629  O  O     . ASP B  2  310 ? 53.063  53.980  63.652  1.00 103.12 ? 308  ASP B O     1 
ATOM   5630  C  CB    . ASP B  2  310 ? 52.954  56.083  61.355  1.00 101.52 ? 308  ASP B CB    1 
ATOM   5631  C  CG    . ASP B  2  310 ? 54.369  56.304  60.865  1.00 101.14 ? 308  ASP B CG    1 
ATOM   5632  O  OD1   . ASP B  2  310 ? 54.653  55.904  59.721  1.00 102.15 ? 308  ASP B OD1   1 
ATOM   5633  O  OD2   . ASP B  2  310 ? 55.203  56.867  61.608  1.00 100.12 ? 308  ASP B OD2   1 
ATOM   5634  N  N     . ALA B  2  311 ? 54.458  53.220  62.055  1.00 101.15 ? 309  ALA B N     1 
ATOM   5635  C  CA    . ALA B  2  311 ? 55.322  52.498  62.988  1.00 98.76  ? 309  ALA B CA    1 
ATOM   5636  C  C     . ALA B  2  311 ? 56.734  52.422  62.424  1.00 96.84  ? 309  ALA B C     1 
ATOM   5637  O  O     . ALA B  2  311 ? 56.916  52.115  61.252  1.00 96.47  ? 309  ALA B O     1 
ATOM   5638  C  CB    . ALA B  2  311 ? 54.772  51.100  63.218  1.00 98.96  ? 309  ALA B CB    1 
ATOM   5639  N  N     . SER B  2  312 ? 57.735  52.691  63.254  1.00 95.15  ? 310  SER B N     1 
ATOM   5640  C  CA    . SER B  2  312 ? 59.107  52.652  62.773  1.00 94.44  ? 310  SER B CA    1 
ATOM   5641  C  C     . SER B  2  312 ? 60.078  51.918  63.686  1.00 93.03  ? 310  SER B C     1 
ATOM   5642  O  O     . SER B  2  312 ? 59.730  51.482  64.773  1.00 92.79  ? 310  SER B O     1 
ATOM   5643  C  CB    . SER B  2  312 ? 59.609  54.077  62.536  1.00 95.31  ? 310  SER B CB    1 
ATOM   5644  O  OG    . SER B  2  312 ? 58.744  54.784  61.659  1.00 96.65  ? 310  SER B OG    1 
ATOM   5645  N  N     . ALA B  2  313 ? 61.311  51.787  63.227  1.00 91.80  ? 311  ALA B N     1 
ATOM   5646  C  CA    . ALA B  2  313 ? 62.323  51.105  64.003  1.00 91.25  ? 311  ALA B CA    1 
ATOM   5647  C  C     . ALA B  2  313 ? 63.050  52.102  64.877  1.00 90.97  ? 311  ALA B C     1 
ATOM   5648  O  O     . ALA B  2  313 ? 63.716  53.002  64.372  1.00 90.47  ? 311  ALA B O     1 
ATOM   5649  C  CB    . ALA B  2  313 ? 63.309  50.412  63.078  1.00 91.71  ? 311  ALA B CB    1 
ATOM   5650  N  N     . PHE B  2  314 ? 62.924  51.935  66.189  1.00 91.03  ? 312  PHE B N     1 
ATOM   5651  C  CA    . PHE B  2  314 ? 63.577  52.821  67.140  1.00 91.42  ? 312  PHE B CA    1 
ATOM   5652  C  C     . PHE B  2  314 ? 64.974  52.330  67.491  1.00 91.73  ? 312  PHE B C     1 
ATOM   5653  O  O     . PHE B  2  314 ? 65.158  51.156  67.798  1.00 90.43  ? 312  PHE B O     1 
ATOM   5654  C  CB    . PHE B  2  314 ? 62.734  52.942  68.417  1.00 91.23  ? 312  PHE B CB    1 
ATOM   5655  C  CG    . PHE B  2  314 ? 63.221  54.010  69.373  1.00 92.13  ? 312  PHE B CG    1 
ATOM   5656  C  CD1   . PHE B  2  314 ? 63.403  55.329  68.948  1.00 92.10  ? 312  PHE B CD1   1 
ATOM   5657  C  CD2   . PHE B  2  314 ? 63.512  53.700  70.694  1.00 92.45  ? 312  PHE B CD2   1 
ATOM   5658  C  CE1   . PHE B  2  314 ? 63.869  56.320  69.824  1.00 91.17  ? 312  PHE B CE1   1 
ATOM   5659  C  CE2   . PHE B  2  314 ? 63.980  54.686  71.577  1.00 92.28  ? 312  PHE B CE2   1 
ATOM   5660  C  CZ    . PHE B  2  314 ? 64.158  55.997  71.134  1.00 91.57  ? 312  PHE B CZ    1 
ATOM   5661  N  N     . ASN B  2  315 ? 65.954  53.232  67.433  1.00 93.31  ? 313  ASN B N     1 
ATOM   5662  C  CA    . ASN B  2  315 ? 67.332  52.891  67.773  1.00 96.20  ? 313  ASN B CA    1 
ATOM   5663  C  C     . ASN B  2  315 ? 68.169  54.071  68.256  1.00 97.99  ? 313  ASN B C     1 
ATOM   5664  O  O     . ASN B  2  315 ? 68.363  55.053  67.536  1.00 97.23  ? 313  ASN B O     1 
ATOM   5665  C  CB    . ASN B  2  315 ? 68.046  52.249  66.595  1.00 96.90  ? 313  ASN B CB    1 
ATOM   5666  C  CG    . ASN B  2  315 ? 69.510  51.964  66.897  1.00 97.52  ? 313  ASN B CG    1 
ATOM   5667  O  OD1   . ASN B  2  315 ? 69.834  51.210  67.819  1.00 97.08  ? 313  ASN B OD1   1 
ATOM   5668  N  ND2   . ASN B  2  315 ? 70.400  52.575  66.126  1.00 98.51  ? 313  ASN B ND2   1 
ATOM   5669  N  N     . VAL B  2  316 ? 68.694  53.937  69.474  1.00 100.68 ? 314  VAL B N     1 
ATOM   5670  C  CA    . VAL B  2  316 ? 69.505  54.972  70.100  1.00 103.11 ? 314  VAL B CA    1 
ATOM   5671  C  C     . VAL B  2  316 ? 70.839  54.455  70.604  1.00 104.60 ? 314  VAL B C     1 
ATOM   5672  O  O     . VAL B  2  316 ? 70.922  53.367  71.179  1.00 104.08 ? 314  VAL B O     1 
ATOM   5673  C  CB    . VAL B  2  316 ? 68.801  55.573  71.316  1.00 103.74 ? 314  VAL B CB    1 
ATOM   5674  C  CG1   . VAL B  2  316 ? 69.595  56.750  71.828  1.00 104.41 ? 314  VAL B CG1   1 
ATOM   5675  C  CG2   . VAL B  2  316 ? 67.396  55.989  70.959  1.00 105.24 ? 314  VAL B CG2   1 
ATOM   5676  N  N     . ASN B  2  317 ? 71.876  55.264  70.417  1.00 106.83 ? 315  ASN B N     1 
ATOM   5677  C  CA    . ASN B  2  317 ? 73.214  54.903  70.866  1.00 109.24 ? 315  ASN B CA    1 
ATOM   5678  C  C     . ASN B  2  317 ? 73.765  55.924  71.873  1.00 110.35 ? 315  ASN B C     1 
ATOM   5679  O  O     . ASN B  2  317 ? 73.980  57.093  71.531  1.00 111.06 ? 315  ASN B O     1 
ATOM   5680  C  CB    . ASN B  2  317 ? 74.168  54.801  69.667  1.00 110.39 ? 315  ASN B CB    1 
ATOM   5681  C  CG    . ASN B  2  317 ? 73.675  53.834  68.601  1.00 111.57 ? 315  ASN B CG    1 
ATOM   5682  O  OD1   . ASN B  2  317 ? 73.280  52.709  68.904  1.00 112.39 ? 315  ASN B OD1   1 
ATOM   5683  N  ND2   . ASN B  2  317 ? 73.707  54.267  67.344  1.00 112.00 ? 315  ASN B ND2   1 
ATOM   5684  N  N     . TYR B  2  318 ? 73.987  55.477  73.111  1.00 111.01 ? 316  TYR B N     1 
ATOM   5685  C  CA    . TYR B  2  318 ? 74.528  56.326  74.184  1.00 110.95 ? 316  TYR B CA    1 
ATOM   5686  C  C     . TYR B  2  318 ? 75.910  55.802  74.639  1.00 110.25 ? 316  TYR B C     1 
ATOM   5687  O  O     . TYR B  2  318 ? 76.266  54.647  74.383  1.00 109.88 ? 316  TYR B O     1 
ATOM   5688  C  CB    . TYR B  2  318 ? 73.551  56.367  75.383  1.00 111.61 ? 316  TYR B CB    1 
ATOM   5689  C  CG    . TYR B  2  318 ? 72.242  57.097  75.123  1.00 111.98 ? 316  TYR B CG    1 
ATOM   5690  C  CD1   . TYR B  2  318 ? 71.026  56.612  75.629  1.00 111.49 ? 316  TYR B CD1   1 
ATOM   5691  C  CD2   . TYR B  2  318 ? 72.221  58.276  74.379  1.00 112.83 ? 316  TYR B CD2   1 
ATOM   5692  C  CE1   . TYR B  2  318 ? 69.818  57.290  75.395  1.00 111.74 ? 316  TYR B CE1   1 
ATOM   5693  C  CE2   . TYR B  2  318 ? 71.022  58.964  74.139  1.00 113.37 ? 316  TYR B CE2   1 
ATOM   5694  C  CZ    . TYR B  2  318 ? 69.825  58.470  74.649  1.00 112.68 ? 316  TYR B CZ    1 
ATOM   5695  O  OH    . TYR B  2  318 ? 68.659  59.174  74.416  1.00 111.60 ? 316  TYR B OH    1 
ATOM   5696  N  N     . SER B  2  319 ? 76.679  56.652  75.319  1.00 109.45 ? 317  SER B N     1 
ATOM   5697  C  CA    . SER B  2  319 ? 78.017  56.278  75.785  1.00 108.11 ? 317  SER B CA    1 
ATOM   5698  C  C     . SER B  2  319 ? 78.068  54.901  76.425  1.00 106.68 ? 317  SER B C     1 
ATOM   5699  O  O     . SER B  2  319 ? 78.776  54.026  75.940  1.00 107.69 ? 317  SER B O     1 
ATOM   5700  C  CB    . SER B  2  319 ? 78.575  57.308  76.785  1.00 108.04 ? 317  SER B CB    1 
ATOM   5701  O  OG    . SER B  2  319 ? 78.391  56.888  78.131  1.00 106.16 ? 317  SER B OG    1 
ATOM   5702  N  N     . ASP B  2  320 ? 77.324  54.696  77.505  1.00 104.01 ? 318  ASP B N     1 
ATOM   5703  C  CA    . ASP B  2  320 ? 77.362  53.404  78.162  1.00 102.51 ? 318  ASP B CA    1 
ATOM   5704  C  C     . ASP B  2  320 ? 76.100  52.565  78.016  1.00 100.39 ? 318  ASP B C     1 
ATOM   5705  O  O     . ASP B  2  320 ? 75.723  51.823  78.920  1.00 100.09 ? 318  ASP B O     1 
ATOM   5706  C  CB    . ASP B  2  320 ? 77.731  53.573  79.643  1.00 104.92 ? 318  ASP B CB    1 
ATOM   5707  C  CG    . ASP B  2  320 ? 76.647  54.255  80.459  1.00 106.88 ? 318  ASP B CG    1 
ATOM   5708  O  OD1   . ASP B  2  320 ? 75.539  53.687  80.617  1.00 106.93 ? 318  ASP B OD1   1 
ATOM   5709  O  OD2   . ASP B  2  320 ? 76.925  55.365  80.958  1.00 108.94 ? 318  ASP B OD2   1 
ATOM   5710  N  N     . SER B  2  321 ? 75.454  52.672  76.866  1.00 97.95  ? 319  SER B N     1 
ATOM   5711  C  CA    . SER B  2  321 ? 74.247  51.895  76.601  1.00 96.44  ? 319  SER B CA    1 
ATOM   5712  C  C     . SER B  2  321 ? 73.581  52.401  75.336  1.00 96.16  ? 319  SER B C     1 
ATOM   5713  O  O     . SER B  2  321 ? 74.202  53.097  74.538  1.00 96.69  ? 319  SER B O     1 
ATOM   5714  C  CB    . SER B  2  321 ? 73.262  51.987  77.770  1.00 95.32  ? 319  SER B CB    1 
ATOM   5715  O  OG    . SER B  2  321 ? 72.146  51.141  77.559  1.00 92.66  ? 319  SER B OG    1 
ATOM   5716  N  N     . GLY B  2  322 ? 72.319  52.043  75.154  1.00 95.30  ? 320  GLY B N     1 
ATOM   5717  C  CA    . GLY B  2  322 ? 71.584  52.470  73.979  1.00 94.26  ? 320  GLY B CA    1 
ATOM   5718  C  C     . GLY B  2  322 ? 70.244  51.779  74.038  1.00 93.36  ? 320  GLY B C     1 
ATOM   5719  O  O     . GLY B  2  322 ? 70.075  50.869  74.850  1.00 94.41  ? 320  GLY B O     1 
ATOM   5720  N  N     . LEU B  2  323 ? 69.290  52.198  73.213  1.00 91.11  ? 321  LEU B N     1 
ATOM   5721  C  CA    . LEU B  2  323 ? 67.978  51.561  73.224  1.00 88.54  ? 321  LEU B CA    1 
ATOM   5722  C  C     . LEU B  2  323 ? 67.641  51.033  71.849  1.00 87.29  ? 321  LEU B C     1 
ATOM   5723  O  O     . LEU B  2  323 ? 68.293  51.392  70.865  1.00 86.97  ? 321  LEU B O     1 
ATOM   5724  C  CB    . LEU B  2  323 ? 66.907  52.544  73.691  1.00 87.29  ? 321  LEU B CB    1 
ATOM   5725  C  CG    . LEU B  2  323 ? 66.941  52.848  75.188  1.00 85.84  ? 321  LEU B CG    1 
ATOM   5726  C  CD1   . LEU B  2  323 ? 66.095  54.067  75.480  1.00 85.76  ? 321  LEU B CD1   1 
ATOM   5727  C  CD2   . LEU B  2  323 ? 66.446  51.644  75.960  1.00 84.23  ? 321  LEU B CD2   1 
ATOM   5728  N  N     . PHE B  2  324 ? 66.637  50.162  71.782  1.00 85.59  ? 322  PHE B N     1 
ATOM   5729  C  CA    . PHE B  2  324 ? 66.236  49.593  70.502  1.00 83.88  ? 322  PHE B CA    1 
ATOM   5730  C  C     . PHE B  2  324 ? 64.856  48.973  70.520  1.00 81.92  ? 322  PHE B C     1 
ATOM   5731  O  O     . PHE B  2  324 ? 64.488  48.240  71.440  1.00 81.03  ? 322  PHE B O     1 
ATOM   5732  C  CB    . PHE B  2  324 ? 67.231  48.532  70.042  1.00 84.68  ? 322  PHE B CB    1 
ATOM   5733  C  CG    . PHE B  2  324 ? 66.989  48.049  68.644  1.00 84.50  ? 322  PHE B CG    1 
ATOM   5734  C  CD1   . PHE B  2  324 ? 67.706  48.594  67.581  1.00 84.47  ? 322  PHE B CD1   1 
ATOM   5735  C  CD2   . PHE B  2  324 ? 66.035  47.065  68.386  1.00 84.10  ? 322  PHE B CD2   1 
ATOM   5736  C  CE1   . PHE B  2  324 ? 67.484  48.170  66.273  1.00 84.43  ? 322  PHE B CE1   1 
ATOM   5737  C  CE2   . PHE B  2  324 ? 65.799  46.632  67.084  1.00 84.66  ? 322  PHE B CE2   1 
ATOM   5738  C  CZ    . PHE B  2  324 ? 66.530  47.188  66.019  1.00 84.62  ? 322  PHE B CZ    1 
ATOM   5739  N  N     . GLY B  2  325 ? 64.112  49.259  69.462  1.00 79.71  ? 323  GLY B N     1 
ATOM   5740  C  CA    . GLY B  2  325 ? 62.773  48.743  69.342  1.00 76.93  ? 323  GLY B CA    1 
ATOM   5741  C  C     . GLY B  2  325 ? 62.010  49.512  68.295  1.00 74.43  ? 323  GLY B C     1 
ATOM   5742  O  O     . GLY B  2  325 ? 62.583  50.109  67.404  1.00 73.75  ? 323  GLY B O     1 
ATOM   5743  N  N     . PHE B  2  326 ? 60.701  49.518  68.428  1.00 72.79  ? 324  PHE B N     1 
ATOM   5744  C  CA    . PHE B  2  326 ? 59.866  50.187  67.470  1.00 72.67  ? 324  PHE B CA    1 
ATOM   5745  C  C     . PHE B  2  326 ? 59.009  51.255  68.149  1.00 74.15  ? 324  PHE B C     1 
ATOM   5746  O  O     . PHE B  2  326 ? 58.955  51.308  69.374  1.00 75.73  ? 324  PHE B O     1 
ATOM   5747  C  CB    . PHE B  2  326 ? 59.000  49.129  66.814  1.00 70.88  ? 324  PHE B CB    1 
ATOM   5748  C  CG    . PHE B  2  326 ? 58.142  48.372  67.781  1.00 69.06  ? 324  PHE B CG    1 
ATOM   5749  C  CD1   . PHE B  2  326 ? 56.856  48.797  68.065  1.00 69.42  ? 324  PHE B CD1   1 
ATOM   5750  C  CD2   . PHE B  2  326 ? 58.610  47.234  68.398  1.00 68.70  ? 324  PHE B CD2   1 
ATOM   5751  C  CE1   . PHE B  2  326 ? 56.046  48.100  68.948  1.00 69.95  ? 324  PHE B CE1   1 
ATOM   5752  C  CE2   . PHE B  2  326 ? 57.810  46.531  69.283  1.00 69.40  ? 324  PHE B CE2   1 
ATOM   5753  C  CZ    . PHE B  2  326 ? 56.523  46.966  69.557  1.00 70.01  ? 324  PHE B CZ    1 
ATOM   5754  N  N     . TYR B  2  327 ? 58.346  52.100  67.353  1.00 74.39  ? 325  TYR B N     1 
ATOM   5755  C  CA    . TYR B  2  327 ? 57.470  53.165  67.855  1.00 72.89  ? 325  TYR B CA    1 
ATOM   5756  C  C     . TYR B  2  327 ? 56.197  53.220  67.004  1.00 70.78  ? 325  TYR B C     1 
ATOM   5757  O  O     . TYR B  2  327 ? 56.268  53.451  65.804  1.00 69.93  ? 325  TYR B O     1 
ATOM   5758  C  CB    . TYR B  2  327 ? 58.202  54.500  67.788  1.00 75.65  ? 325  TYR B CB    1 
ATOM   5759  C  CG    . TYR B  2  327 ? 57.443  55.644  68.410  1.00 80.57  ? 325  TYR B CG    1 
ATOM   5760  C  CD1   . TYR B  2  327 ? 58.084  56.550  69.256  1.00 82.81  ? 325  TYR B CD1   1 
ATOM   5761  C  CD2   . TYR B  2  327 ? 56.091  55.853  68.131  1.00 82.44  ? 325  TYR B CD2   1 
ATOM   5762  C  CE1   . TYR B  2  327 ? 57.405  57.643  69.809  1.00 84.58  ? 325  TYR B CE1   1 
ATOM   5763  C  CE2   . TYR B  2  327 ? 55.397  56.945  68.678  1.00 84.67  ? 325  TYR B CE2   1 
ATOM   5764  C  CZ    . TYR B  2  327 ? 56.064  57.839  69.516  1.00 85.21  ? 325  TYR B CZ    1 
ATOM   5765  O  OH    . TYR B  2  327 ? 55.409  58.935  70.042  1.00 85.99  ? 325  TYR B OH    1 
ATOM   5766  N  N     . THR B  2  328 ? 55.035  53.027  67.621  1.00 69.08  ? 326  THR B N     1 
ATOM   5767  C  CA    . THR B  2  328 ? 53.782  53.030  66.865  1.00 69.03  ? 326  THR B CA    1 
ATOM   5768  C  C     . THR B  2  328 ? 52.774  54.103  67.246  1.00 68.50  ? 326  THR B C     1 
ATOM   5769  O  O     . THR B  2  328 ? 52.494  54.321  68.418  1.00 69.51  ? 326  THR B O     1 
ATOM   5770  C  CB    . THR B  2  328 ? 53.040  51.694  66.993  1.00 69.46  ? 326  THR B CB    1 
ATOM   5771  O  OG1   . THR B  2  328 ? 52.410  51.618  68.276  1.00 69.90  ? 326  THR B OG1   1 
ATOM   5772  C  CG2   . THR B  2  328 ? 53.999  50.549  66.866  1.00 70.85  ? 326  THR B CG2   1 
ATOM   5773  N  N     . ILE B  2  329 ? 52.205  54.747  66.238  1.00 67.00  ? 327  ILE B N     1 
ATOM   5774  C  CA    . ILE B  2  329 ? 51.207  55.786  66.430  1.00 64.75  ? 327  ILE B CA    1 
ATOM   5775  C  C     . ILE B  2  329 ? 49.968  55.203  65.802  1.00 66.23  ? 327  ILE B C     1 
ATOM   5776  O  O     . ILE B  2  329 ? 49.997  54.897  64.623  1.00 67.51  ? 327  ILE B O     1 
ATOM   5777  C  CB    . ILE B  2  329 ? 51.583  57.027  65.642  1.00 61.40  ? 327  ILE B CB    1 
ATOM   5778  C  CG1   . ILE B  2  329 ? 53.014  57.419  65.968  1.00 60.13  ? 327  ILE B CG1   1 
ATOM   5779  C  CG2   . ILE B  2  329 ? 50.648  58.137  65.963  1.00 60.33  ? 327  ILE B CG2   1 
ATOM   5780  C  CD1   . ILE B  2  329 ? 53.533  58.560  65.166  1.00 59.95  ? 327  ILE B CD1   1 
ATOM   5781  N  N     . SER B  2  330 ? 48.887  55.035  66.556  1.00 67.86  ? 328  SER B N     1 
ATOM   5782  C  CA    . SER B  2  330 ? 47.667  54.470  65.973  1.00 70.89  ? 328  SER B CA    1 
ATOM   5783  C  C     . SER B  2  330 ? 46.393  55.039  66.578  1.00 73.17  ? 328  SER B C     1 
ATOM   5784  O  O     . SER B  2  330 ? 46.442  55.908  67.451  1.00 73.88  ? 328  SER B O     1 
ATOM   5785  C  CB    . SER B  2  330 ? 47.660  52.957  66.145  1.00 71.15  ? 328  SER B CB    1 
ATOM   5786  O  OG    . SER B  2  330 ? 47.771  52.618  67.513  1.00 72.28  ? 328  SER B OG    1 
ATOM   5787  N  N     . GLN B  2  331 ? 45.243  54.561  66.108  1.00 75.75  ? 329  GLN B N     1 
ATOM   5788  C  CA    . GLN B  2  331 ? 43.986  55.047  66.660  1.00 77.82  ? 329  GLN B CA    1 
ATOM   5789  C  C     . GLN B  2  331 ? 43.732  54.310  67.951  1.00 78.39  ? 329  GLN B C     1 
ATOM   5790  O  O     . GLN B  2  331 ? 44.257  53.221  68.179  1.00 76.90  ? 329  GLN B O     1 
ATOM   5791  C  CB    . GLN B  2  331 ? 42.809  54.814  65.717  1.00 78.88  ? 329  GLN B CB    1 
ATOM   5792  C  CG    . GLN B  2  331 ? 42.859  55.611  64.438  1.00 81.49  ? 329  GLN B CG    1 
ATOM   5793  C  CD    . GLN B  2  331 ? 41.551  55.549  63.670  1.00 83.28  ? 329  GLN B CD    1 
ATOM   5794  O  OE1   . GLN B  2  331 ? 41.506  55.875  62.485  1.00 84.97  ? 329  GLN B OE1   1 
ATOM   5795  N  NE2   . GLN B  2  331 ? 40.474  55.140  64.346  1.00 83.44  ? 329  GLN B NE2   1 
ATOM   5796  N  N     . ALA B  2  332 ? 42.909  54.920  68.789  1.00 80.48  ? 330  ALA B N     1 
ATOM   5797  C  CA    . ALA B  2  332 ? 42.565  54.369  70.090  1.00 83.25  ? 330  ALA B CA    1 
ATOM   5798  C  C     . ALA B  2  332 ? 42.199  52.890  70.095  1.00 84.90  ? 330  ALA B C     1 
ATOM   5799  O  O     . ALA B  2  332 ? 42.740  52.116  70.886  1.00 84.87  ? 330  ALA B O     1 
ATOM   5800  C  CB    . ALA B  2  332 ? 41.426  55.182  70.702  1.00 83.41  ? 330  ALA B CB    1 
ATOM   5801  N  N     . ALA B  2  333 ? 41.272  52.500  69.225  1.00 86.95  ? 331  ALA B N     1 
ATOM   5802  C  CA    . ALA B  2  333 ? 40.824  51.113  69.164  1.00 89.23  ? 331  ALA B CA    1 
ATOM   5803  C  C     . ALA B  2  333 ? 41.785  50.179  68.428  1.00 90.95  ? 331  ALA B C     1 
ATOM   5804  O  O     . ALA B  2  333 ? 41.895  48.998  68.772  1.00 91.38  ? 331  ALA B O     1 
ATOM   5805  C  CB    . ALA B  2  333 ? 39.426  51.042  68.527  1.00 88.23  ? 331  ALA B CB    1 
ATOM   5806  N  N     . HIS B  2  334 ? 42.485  50.701  67.422  1.00 92.62  ? 332  HIS B N     1 
ATOM   5807  C  CA    . HIS B  2  334 ? 43.407  49.877  66.655  1.00 94.22  ? 332  HIS B CA    1 
ATOM   5808  C  C     . HIS B  2  334 ? 44.811  49.906  67.222  1.00 94.68  ? 332  HIS B C     1 
ATOM   5809  O  O     . HIS B  2  334 ? 45.747  49.468  66.562  1.00 95.70  ? 332  HIS B O     1 
ATOM   5810  C  CB    . HIS B  2  334 ? 43.439  50.303  65.180  1.00 95.57  ? 332  HIS B CB    1 
ATOM   5811  C  CG    . HIS B  2  334 ? 42.108  50.213  64.496  1.00 97.72  ? 332  HIS B CG    1 
ATOM   5812  N  ND1   . HIS B  2  334 ? 41.298  49.101  64.582  1.00 98.54  ? 332  HIS B ND1   1 
ATOM   5813  C  CD2   . HIS B  2  334 ? 41.434  51.110  63.736  1.00 98.52  ? 332  HIS B CD2   1 
ATOM   5814  C  CE1   . HIS B  2  334 ? 40.181  49.318  63.909  1.00 99.28  ? 332  HIS B CE1   1 
ATOM   5815  N  NE2   . HIS B  2  334 ? 40.238  50.530  63.387  1.00 99.23  ? 332  HIS B NE2   1 
ATOM   5816  N  N     . ALA B  2  335 ? 44.958  50.419  68.440  1.00 94.58  ? 333  ALA B N     1 
ATOM   5817  C  CA    . ALA B  2  335 ? 46.266  50.472  69.100  1.00 93.89  ? 333  ALA B CA    1 
ATOM   5818  C  C     . ALA B  2  335 ? 46.674  49.066  69.549  1.00 93.39  ? 333  ALA B C     1 
ATOM   5819  O  O     . ALA B  2  335 ? 47.862  48.730  69.597  1.00 91.81  ? 333  ALA B O     1 
ATOM   5820  C  CB    . ALA B  2  335 ? 46.209  51.406  70.299  1.00 94.40  ? 333  ALA B CB    1 
ATOM   5821  N  N     . GLY B  2  336 ? 45.671  48.256  69.885  1.00 93.63  ? 334  GLY B N     1 
ATOM   5822  C  CA    . GLY B  2  336 ? 45.922  46.894  70.306  1.00 93.77  ? 334  GLY B CA    1 
ATOM   5823  C  C     . GLY B  2  336 ? 46.703  46.205  69.210  1.00 93.90  ? 334  GLY B C     1 
ATOM   5824  O  O     . GLY B  2  336 ? 47.935  46.219  69.221  1.00 94.46  ? 334  GLY B O     1 
ATOM   5825  N  N     . GLU B  2  337 ? 45.987  45.634  68.246  1.00 93.36  ? 335  GLU B N     1 
ATOM   5826  C  CA    . GLU B  2  337 ? 46.614  44.930  67.131  1.00 92.72  ? 335  GLU B CA    1 
ATOM   5827  C  C     . GLU B  2  337 ? 47.856  45.592  66.526  1.00 90.75  ? 335  GLU B C     1 
ATOM   5828  O  O     . GLU B  2  337 ? 48.819  44.893  66.206  1.00 91.23  ? 335  GLU B O     1 
ATOM   5829  C  CB    . GLU B  2  337 ? 45.575  44.672  66.046  1.00 94.17  ? 335  GLU B CB    1 
ATOM   5830  C  CG    . GLU B  2  337 ? 44.654  45.839  65.822  1.00 97.91  ? 335  GLU B CG    1 
ATOM   5831  C  CD    . GLU B  2  337 ? 43.281  45.403  65.352  1.00 100.90 ? 335  GLU B CD    1 
ATOM   5832  O  OE1   . GLU B  2  337 ? 42.606  44.662  66.110  1.00 101.86 ? 335  GLU B OE1   1 
ATOM   5833  O  OE2   . GLU B  2  337 ? 42.880  45.800  64.229  1.00 102.61 ? 335  GLU B OE2   1 
ATOM   5834  N  N     . VAL B  2  338 ? 47.849  46.919  66.383  1.00 88.10  ? 336  VAL B N     1 
ATOM   5835  C  CA    . VAL B  2  338 ? 48.998  47.630  65.808  1.00 85.62  ? 336  VAL B CA    1 
ATOM   5836  C  C     . VAL B  2  338 ? 50.317  47.305  66.476  1.00 85.41  ? 336  VAL B C     1 
ATOM   5837  O  O     . VAL B  2  338 ? 51.293  46.986  65.799  1.00 85.45  ? 336  VAL B O     1 
ATOM   5838  C  CB    . VAL B  2  338 ? 48.842  49.163  65.857  1.00 84.15  ? 336  VAL B CB    1 
ATOM   5839  C  CG1   . VAL B  2  338 ? 50.184  49.836  65.584  1.00 82.17  ? 336  VAL B CG1   1 
ATOM   5840  C  CG2   . VAL B  2  338 ? 47.848  49.610  64.818  1.00 83.57  ? 336  VAL B CG2   1 
ATOM   5841  N  N     . ILE B  2  339 ? 50.355  47.405  67.801  1.00 85.06  ? 337  ILE B N     1 
ATOM   5842  C  CA    . ILE B  2  339 ? 51.582  47.120  68.540  1.00 84.43  ? 337  ILE B CA    1 
ATOM   5843  C  C     . ILE B  2  339 ? 51.895  45.621  68.556  1.00 84.57  ? 337  ILE B C     1 
ATOM   5844  O  O     . ILE B  2  339 ? 53.060  45.221  68.406  1.00 83.71  ? 337  ILE B O     1 
ATOM   5845  C  CB    . ILE B  2  339 ? 51.479  47.592  69.991  1.00 83.63  ? 337  ILE B CB    1 
ATOM   5846  C  CG1   . ILE B  2  339 ? 50.727  48.912  70.066  1.00 82.97  ? 337  ILE B CG1   1 
ATOM   5847  C  CG2   . ILE B  2  339 ? 52.867  47.764  70.560  1.00 82.84  ? 337  ILE B CG2   1 
ATOM   5848  C  CD1   . ILE B  2  339 ? 50.396  49.315  71.477  1.00 83.54  ? 337  ILE B CD1   1 
ATOM   5849  N  N     . ARG B  2  340 ? 50.849  44.810  68.751  1.00 84.31  ? 338  ARG B N     1 
ATOM   5850  C  CA    . ARG B  2  340 ? 50.976  43.358  68.793  1.00 84.59  ? 338  ARG B CA    1 
ATOM   5851  C  C     . ARG B  2  340 ? 51.556  42.859  67.495  1.00 85.21  ? 338  ARG B C     1 
ATOM   5852  O  O     . ARG B  2  340 ? 52.508  42.086  67.499  1.00 86.29  ? 338  ARG B O     1 
ATOM   5853  C  CB    . ARG B  2  340 ? 49.622  42.682  69.029  1.00 84.75  ? 338  ARG B CB    1 
ATOM   5854  C  CG    . ARG B  2  340 ? 49.224  42.564  70.500  1.00 86.36  ? 338  ARG B CG    1 
ATOM   5855  C  CD    . ARG B  2  340 ? 48.162  41.481  70.737  1.00 87.19  ? 338  ARG B CD    1 
ATOM   5856  N  NE    . ARG B  2  340 ? 46.858  41.803  70.149  1.00 89.57  ? 338  ARG B NE    1 
ATOM   5857  C  CZ    . ARG B  2  340 ? 45.850  42.399  70.791  1.00 90.19  ? 338  ARG B CZ    1 
ATOM   5858  N  NH1   . ARG B  2  340 ? 45.976  42.749  72.064  1.00 89.66  ? 338  ARG B NH1   1 
ATOM   5859  N  NH2   . ARG B  2  340 ? 44.709  42.652  70.154  1.00 91.13  ? 338  ARG B NH2   1 
ATOM   5860  N  N     . ALA B  2  341 ? 50.974  43.300  66.385  1.00 85.37  ? 339  ALA B N     1 
ATOM   5861  C  CA    . ALA B  2  341 ? 51.448  42.912  65.069  1.00 85.52  ? 339  ALA B CA    1 
ATOM   5862  C  C     . ALA B  2  341 ? 52.813  43.550  64.768  1.00 86.25  ? 339  ALA B C     1 
ATOM   5863  O  O     . ALA B  2  341 ? 53.515  43.110  63.862  1.00 86.31  ? 339  ALA B O     1 
ATOM   5864  C  CB    . ALA B  2  341 ? 50.433  43.313  64.024  1.00 85.03  ? 339  ALA B CB    1 
ATOM   5865  N  N     . ALA B  2  342 ? 53.180  44.585  65.526  1.00 87.47  ? 340  ALA B N     1 
ATOM   5866  C  CA    . ALA B  2  342 ? 54.467  45.260  65.364  1.00 88.83  ? 340  ALA B CA    1 
ATOM   5867  C  C     . ALA B  2  342 ? 55.537  44.369  65.974  1.00 90.98  ? 340  ALA B C     1 
ATOM   5868  O  O     . ALA B  2  342 ? 56.724  44.518  65.680  1.00 91.04  ? 340  ALA B O     1 
ATOM   5869  C  CB    . ALA B  2  342 ? 54.455  46.590  66.074  1.00 87.97  ? 340  ALA B CB    1 
ATOM   5870  N  N     . MET B  2  343 ? 55.096  43.452  66.839  1.00 93.89  ? 341  MET B N     1 
ATOM   5871  C  CA    . MET B  2  343 ? 55.968  42.480  67.513  1.00 96.15  ? 341  MET B CA    1 
ATOM   5872  C  C     . MET B  2  343 ? 56.218  41.223  66.668  1.00 97.38  ? 341  MET B C     1 
ATOM   5873  O  O     . MET B  2  343 ? 57.359  40.955  66.295  1.00 97.22  ? 341  MET B O     1 
ATOM   5874  C  CB    . MET B  2  343 ? 55.372  42.064  68.867  1.00 95.96  ? 341  MET B CB    1 
ATOM   5875  C  CG    . MET B  2  343 ? 55.786  42.949  70.032  1.00 96.69  ? 341  MET B CG    1 
ATOM   5876  S  SD    . MET B  2  343 ? 57.546  42.804  70.458  1.00 97.77  ? 341  MET B SD    1 
ATOM   5877  C  CE    . MET B  2  343 ? 57.469  41.634  71.811  1.00 96.81  ? 341  MET B CE    1 
ATOM   5878  N  N     . ASN B  2  344 ? 55.161  40.457  66.377  1.00 99.00  ? 342  ASN B N     1 
ATOM   5879  C  CA    . ASN B  2  344 ? 55.277  39.235  65.572  1.00 100.57 ? 342  ASN B CA    1 
ATOM   5880  C  C     . ASN B  2  344 ? 56.212  39.503  64.407  1.00 101.76 ? 342  ASN B C     1 
ATOM   5881  O  O     . ASN B  2  344 ? 56.986  38.636  63.999  1.00 102.80 ? 342  ASN B O     1 
ATOM   5882  C  CB    . ASN B  2  344 ? 53.926  38.810  64.993  1.00 100.31 ? 342  ASN B CB    1 
ATOM   5883  C  CG    . ASN B  2  344 ? 52.797  38.951  65.979  1.00 100.68 ? 342  ASN B CG    1 
ATOM   5884  O  OD1   . ASN B  2  344 ? 52.853  38.430  67.097  1.00 100.57 ? 342  ASN B OD1   1 
ATOM   5885  N  ND2   . ASN B  2  344 ? 51.751  39.658  65.567  1.00 101.10 ? 342  ASN B ND2   1 
ATOM   5886  N  N     . GLN B  2  345 ? 56.114  40.715  63.871  1.00 102.52 ? 343  GLN B N     1 
ATOM   5887  C  CA    . GLN B  2  345 ? 56.932  41.143  62.748  1.00 103.32 ? 343  GLN B CA    1 
ATOM   5888  C  C     . GLN B  2  345 ? 58.375  41.331  63.202  1.00 104.11 ? 343  GLN B C     1 
ATOM   5889  O  O     . GLN B  2  345 ? 59.307  41.264  62.403  1.00 104.26 ? 343  GLN B O     1 
ATOM   5890  C  CB    . GLN B  2  345 ? 56.385  42.454  62.180  1.00 103.14 ? 343  GLN B CB    1 
ATOM   5891  C  CG    . GLN B  2  345 ? 57.057  42.924  60.894  1.00 102.38 ? 343  GLN B CG    1 
ATOM   5892  C  CD    . GLN B  2  345 ? 56.662  42.092  59.694  1.00 101.50 ? 343  GLN B CD    1 
ATOM   5893  O  OE1   . GLN B  2  345 ? 55.482  41.815  59.496  1.00 101.04 ? 343  GLN B OE1   1 
ATOM   5894  N  NE2   . GLN B  2  345 ? 57.642  41.698  58.880  1.00 100.48 ? 343  GLN B NE2   1 
ATOM   5895  N  N     . LEU B  2  346 ? 58.562  41.583  64.487  1.00 105.07 ? 344  LEU B N     1 
ATOM   5896  C  CA    . LEU B  2  346 ? 59.903  41.745  64.994  1.00 107.42 ? 344  LEU B CA    1 
ATOM   5897  C  C     . LEU B  2  346 ? 60.393  40.371  65.444  1.00 110.29 ? 344  LEU B C     1 
ATOM   5898  O  O     . LEU B  2  346 ? 61.597  40.138  65.559  1.00 111.61 ? 344  LEU B O     1 
ATOM   5899  C  CB    . LEU B  2  346 ? 59.923  42.736  66.154  1.00 105.54 ? 344  LEU B CB    1 
ATOM   5900  C  CG    . LEU B  2  346 ? 61.326  43.280  66.422  1.00 104.86 ? 344  LEU B CG    1 
ATOM   5901  C  CD1   . LEU B  2  346 ? 61.864  43.975  65.190  1.00 104.18 ? 344  LEU B CD1   1 
ATOM   5902  C  CD2   . LEU B  2  346 ? 61.279  44.237  67.573  1.00 104.86 ? 344  LEU B CD2   1 
ATOM   5903  N  N     . LYS B  2  347 ? 59.455  39.457  65.692  1.00 113.07 ? 345  LYS B N     1 
ATOM   5904  C  CA    . LYS B  2  347 ? 59.803  38.095  66.105  1.00 115.43 ? 345  LYS B CA    1 
ATOM   5905  C  C     . LYS B  2  347 ? 60.122  37.267  64.873  1.00 117.10 ? 345  LYS B C     1 
ATOM   5906  O  O     . LYS B  2  347 ? 61.211  36.708  64.770  1.00 117.76 ? 345  LYS B O     1 
ATOM   5907  C  CB    . LYS B  2  347 ? 58.659  37.421  66.873  1.00 115.72 ? 345  LYS B CB    1 
ATOM   5908  C  CG    . LYS B  2  347 ? 58.488  37.893  68.311  1.00 116.39 ? 345  LYS B CG    1 
ATOM   5909  C  CD    . LYS B  2  347 ? 57.761  36.852  69.168  1.00 116.42 ? 345  LYS B CD    1 
ATOM   5910  C  CE    . LYS B  2  347 ? 56.392  36.488  68.602  1.00 116.82 ? 345  LYS B CE    1 
ATOM   5911  N  NZ    . LYS B  2  347 ? 55.468  37.657  68.545  1.00 117.67 ? 345  LYS B NZ    1 
ATOM   5912  N  N     . ALA B  2  348 ? 59.170  37.184  63.944  1.00 118.85 ? 346  ALA B N     1 
ATOM   5913  C  CA    . ALA B  2  348 ? 59.375  36.436  62.707  1.00 120.71 ? 346  ALA B CA    1 
ATOM   5914  C  C     . ALA B  2  348 ? 60.470  37.151  61.903  1.00 122.01 ? 346  ALA B C     1 
ATOM   5915  O  O     . ALA B  2  348 ? 60.646  36.922  60.701  1.00 122.30 ? 346  ALA B O     1 
ATOM   5916  C  CB    . ALA B  2  348 ? 58.068  36.357  61.910  1.00 119.99 ? 346  ALA B CB    1 
ATOM   5917  N  N     . ALA B  2  349 ? 61.197  38.023  62.599  1.00 123.31 ? 347  ALA B N     1 
ATOM   5918  C  CA    . ALA B  2  349 ? 62.305  38.790  62.045  1.00 125.21 ? 347  ALA B CA    1 
ATOM   5919  C  C     . ALA B  2  349 ? 63.571  38.335  62.776  1.00 126.59 ? 347  ALA B C     1 
ATOM   5920  O  O     . ALA B  2  349 ? 64.699  38.543  62.310  1.00 126.93 ? 347  ALA B O     1 
ATOM   5921  C  CB    . ALA B  2  349 ? 62.074  40.267  62.277  1.00 125.32 ? 347  ALA B CB    1 
ATOM   5922  N  N     . ALA B  2  350 ? 63.362  37.723  63.937  1.00 127.97 ? 348  ALA B N     1 
ATOM   5923  C  CA    . ALA B  2  350 ? 64.442  37.201  64.761  1.00 129.17 ? 348  ALA B CA    1 
ATOM   5924  C  C     . ALA B  2  350 ? 64.579  35.712  64.454  1.00 129.97 ? 348  ALA B C     1 
ATOM   5925  O  O     . ALA B  2  350 ? 65.522  35.056  64.899  1.00 130.02 ? 348  ALA B O     1 
ATOM   5926  C  CB    . ALA B  2  350 ? 64.117  37.410  66.238  1.00 128.92 ? 348  ALA B CB    1 
ATOM   5927  N  N     . GLN B  2  351 ? 63.627  35.193  63.679  1.00 131.09 ? 349  GLN B N     1 
ATOM   5928  C  CA    . GLN B  2  351 ? 63.606  33.783  63.297  1.00 132.31 ? 349  GLN B CA    1 
ATOM   5929  C  C     . GLN B  2  351 ? 63.701  33.538  61.778  1.00 133.08 ? 349  GLN B C     1 
ATOM   5930  O  O     . GLN B  2  351 ? 62.799  32.944  61.170  1.00 132.66 ? 349  GLN B O     1 
ATOM   5931  C  CB    . GLN B  2  351 ? 62.341  33.111  63.858  1.00 132.71 ? 349  GLN B CB    1 
ATOM   5932  C  CG    . GLN B  2  351 ? 62.185  33.231  65.385  1.00 133.06 ? 349  GLN B CG    1 
ATOM   5933  C  CD    . GLN B  2  351 ? 60.946  32.520  65.926  1.00 133.14 ? 349  GLN B CD    1 
ATOM   5934  O  OE1   . GLN B  2  351 ? 59.840  32.717  65.427  1.00 133.78 ? 349  GLN B OE1   1 
ATOM   5935  N  NE2   . GLN B  2  351 ? 61.131  31.698  66.956  1.00 132.30 ? 349  GLN B NE2   1 
ATOM   5936  N  N     . GLY B  2  352 ? 64.794  34.010  61.176  1.00 134.10 ? 350  GLY B N     1 
ATOM   5937  C  CA    . GLY B  2  352 ? 65.027  33.810  59.750  1.00 135.13 ? 350  GLY B CA    1 
ATOM   5938  C  C     . GLY B  2  352 ? 64.404  34.722  58.691  1.00 135.54 ? 350  GLY B C     1 
ATOM   5939  O  O     . GLY B  2  352 ? 64.911  34.775  57.564  1.00 136.53 ? 350  GLY B O     1 
ATOM   5940  N  N     . GLY B  2  353 ? 63.321  35.427  59.024  1.00 134.87 ? 351  GLY B N     1 
ATOM   5941  C  CA    . GLY B  2  353 ? 62.667  36.303  58.058  1.00 132.61 ? 351  GLY B CA    1 
ATOM   5942  C  C     . GLY B  2  353 ? 63.527  37.416  57.483  1.00 131.08 ? 351  GLY B C     1 
ATOM   5943  O  O     . GLY B  2  353 ? 63.031  38.503  57.219  1.00 130.93 ? 351  GLY B O     1 
ATOM   5944  N  N     . VAL B  2  354 ? 64.809  37.140  57.271  1.00 129.89 ? 352  VAL B N     1 
ATOM   5945  C  CA    . VAL B  2  354 ? 65.736  38.125  56.737  1.00 128.97 ? 352  VAL B CA    1 
ATOM   5946  C  C     . VAL B  2  354 ? 66.454  37.625  55.481  1.00 129.29 ? 352  VAL B C     1 
ATOM   5947  O  O     . VAL B  2  354 ? 67.419  36.863  55.567  1.00 129.19 ? 352  VAL B O     1 
ATOM   5948  C  CB    . VAL B  2  354 ? 66.792  38.495  57.793  1.00 128.31 ? 352  VAL B CB    1 
ATOM   5949  C  CG1   . VAL B  2  354 ? 67.686  39.604  57.273  1.00 127.86 ? 352  VAL B CG1   1 
ATOM   5950  C  CG2   . VAL B  2  354 ? 66.110  38.912  59.085  1.00 127.50 ? 352  VAL B CG2   1 
ATOM   5951  N  N     . THR B  2  355 ? 65.978  38.054  54.317  1.00 129.76 ? 353  THR B N     1 
ATOM   5952  C  CA    . THR B  2  355 ? 66.591  37.666  53.049  1.00 130.29 ? 353  THR B CA    1 
ATOM   5953  C  C     . THR B  2  355 ? 67.967  38.316  52.956  1.00 130.81 ? 353  THR B C     1 
ATOM   5954  O  O     . THR B  2  355 ? 68.148  39.467  53.362  1.00 130.82 ? 353  THR B O     1 
ATOM   5955  C  CB    . THR B  2  355 ? 65.751  38.146  51.839  1.00 130.23 ? 353  THR B CB    1 
ATOM   5956  O  OG1   . THR B  2  355 ? 64.453  37.541  51.883  1.00 129.63 ? 353  THR B OG1   1 
ATOM   5957  C  CG2   . THR B  2  355 ? 66.431  37.775  50.525  1.00 129.84 ? 353  THR B CG2   1 
ATOM   5958  N  N     . GLU B  2  356 ? 68.933  37.582  52.413  1.00 131.31 ? 354  GLU B N     1 
ATOM   5959  C  CA    . GLU B  2  356 ? 70.293  38.096  52.264  1.00 131.65 ? 354  GLU B CA    1 
ATOM   5960  C  C     . GLU B  2  356 ? 70.277  39.402  51.462  1.00 130.69 ? 354  GLU B C     1 
ATOM   5961  O  O     . GLU B  2  356 ? 71.282  40.119  51.388  1.00 130.85 ? 354  GLU B O     1 
ATOM   5962  C  CB    . GLU B  2  356 ? 71.173  37.055  51.552  1.00 132.97 ? 354  GLU B CB    1 
ATOM   5963  C  CG    . GLU B  2  356 ? 72.690  37.304  51.627  1.00 134.04 ? 354  GLU B CG    1 
ATOM   5964  C  CD    . GLU B  2  356 ? 73.269  37.041  53.009  1.00 134.47 ? 354  GLU B CD    1 
ATOM   5965  O  OE1   . GLU B  2  356 ? 72.957  35.975  53.592  1.00 134.46 ? 354  GLU B OE1   1 
ATOM   5966  O  OE2   . GLU B  2  356 ? 74.042  37.894  53.501  1.00 134.32 ? 354  GLU B OE2   1 
ATOM   5967  N  N     . GLU B  2  357 ? 69.128  39.705  50.866  1.00 129.08 ? 355  GLU B N     1 
ATOM   5968  C  CA    . GLU B  2  357 ? 68.987  40.909  50.071  1.00 127.37 ? 355  GLU B CA    1 
ATOM   5969  C  C     . GLU B  2  357 ? 68.490  42.061  50.923  1.00 125.21 ? 355  GLU B C     1 
ATOM   5970  O  O     . GLU B  2  357 ? 69.005  43.169  50.825  1.00 124.76 ? 355  GLU B O     1 
ATOM   5971  C  CB    . GLU B  2  357 ? 68.025  40.665  48.910  1.00 129.01 ? 355  GLU B CB    1 
ATOM   5972  C  CG    . GLU B  2  357 ? 68.061  41.755  47.845  1.00 131.25 ? 355  GLU B CG    1 
ATOM   5973  C  CD    . GLU B  2  357 ? 67.218  41.415  46.627  1.00 132.52 ? 355  GLU B CD    1 
ATOM   5974  O  OE1   . GLU B  2  357 ? 65.989  41.223  46.793  1.00 133.63 ? 355  GLU B OE1   1 
ATOM   5975  O  OE2   . GLU B  2  357 ? 67.786  41.340  45.509  1.00 132.52 ? 355  GLU B OE2   1 
ATOM   5976  N  N     . ASP B  2  358 ? 67.494  41.802  51.764  1.00 122.82 ? 356  ASP B N     1 
ATOM   5977  C  CA    . ASP B  2  358 ? 66.965  42.855  52.615  1.00 120.91 ? 356  ASP B CA    1 
ATOM   5978  C  C     . ASP B  2  358 ? 68.141  43.491  53.325  1.00 120.71 ? 356  ASP B C     1 
ATOM   5979  O  O     . ASP B  2  358 ? 68.128  44.685  53.621  1.00 120.88 ? 356  ASP B O     1 
ATOM   5980  C  CB    . ASP B  2  358 ? 65.996  42.291  53.651  1.00 118.84 ? 356  ASP B CB    1 
ATOM   5981  C  CG    . ASP B  2  358 ? 64.988  41.351  53.047  1.00 117.48 ? 356  ASP B CG    1 
ATOM   5982  O  OD1   . ASP B  2  358 ? 64.774  41.424  51.822  1.00 117.50 ? 356  ASP B OD1   1 
ATOM   5983  O  OD2   . ASP B  2  358 ? 64.402  40.544  53.793  1.00 116.16 ? 356  ASP B OD2   1 
ATOM   5984  N  N     . VAL B  2  359 ? 69.165  42.678  53.574  1.00 120.52 ? 357  VAL B N     1 
ATOM   5985  C  CA    . VAL B  2  359 ? 70.371  43.129  54.263  1.00 120.66 ? 357  VAL B CA    1 
ATOM   5986  C  C     . VAL B  2  359 ? 71.222  44.064  53.420  1.00 120.41 ? 357  VAL B C     1 
ATOM   5987  O  O     . VAL B  2  359 ? 71.768  45.042  53.931  1.00 119.67 ? 357  VAL B O     1 
ATOM   5988  C  CB    . VAL B  2  359 ? 71.252  41.934  54.701  1.00 121.05 ? 357  VAL B CB    1 
ATOM   5989  C  CG1   . VAL B  2  359 ? 72.545  42.443  55.329  1.00 121.13 ? 357  VAL B CG1   1 
ATOM   5990  C  CG2   . VAL B  2  359 ? 70.495  41.063  55.694  1.00 121.00 ? 357  VAL B CG2   1 
ATOM   5991  N  N     . THR B  2  360 ? 71.346  43.754  52.133  1.00 120.81 ? 358  THR B N     1 
ATOM   5992  C  CA    . THR B  2  360 ? 72.134  44.587  51.229  1.00 121.01 ? 358  THR B CA    1 
ATOM   5993  C  C     . THR B  2  360 ? 71.398  45.889  50.877  1.00 120.78 ? 358  THR B C     1 
ATOM   5994  O  O     . THR B  2  360 ? 72.036  46.889  50.542  1.00 121.30 ? 358  THR B O     1 
ATOM   5995  C  CB    . THR B  2  360 ? 72.526  43.816  49.922  1.00 121.06 ? 358  THR B CB    1 
ATOM   5996  O  OG1   . THR B  2  360 ? 71.453  42.951  49.519  1.00 121.09 ? 358  THR B OG1   1 
ATOM   5997  C  CG2   . THR B  2  360 ? 73.793  42.992  50.147  1.00 120.44 ? 358  THR B CG2   1 
ATOM   5998  N  N     . LYS B  2  361 ? 70.064  45.878  50.963  1.00 119.66 ? 359  LYS B N     1 
ATOM   5999  C  CA    . LYS B  2  361 ? 69.258  47.067  50.675  1.00 117.64 ? 359  LYS B CA    1 
ATOM   6000  C  C     . LYS B  2  361 ? 69.382  48.015  51.846  1.00 117.25 ? 359  LYS B C     1 
ATOM   6001  O  O     . LYS B  2  361 ? 69.776  49.163  51.685  1.00 116.73 ? 359  LYS B O     1 
ATOM   6002  C  CB    . LYS B  2  361 ? 67.786  46.702  50.478  1.00 116.56 ? 359  LYS B CB    1 
ATOM   6003  C  CG    . LYS B  2  361 ? 67.477  46.091  49.130  1.00 115.63 ? 359  LYS B CG    1 
ATOM   6004  C  CD    . LYS B  2  361 ? 66.000  45.793  48.987  1.00 114.85 ? 359  LYS B CD    1 
ATOM   6005  C  CE    . LYS B  2  361 ? 65.679  45.317  47.583  1.00 114.79 ? 359  LYS B CE    1 
ATOM   6006  N  NZ    . LYS B  2  361 ? 64.237  44.994  47.416  1.00 115.24 ? 359  LYS B NZ    1 
ATOM   6007  N  N     . ALA B  2  362 ? 69.046  47.524  53.031  1.00 117.49 ? 360  ALA B N     1 
ATOM   6008  C  CA    . ALA B  2  362 ? 69.141  48.333  54.234  1.00 118.08 ? 360  ALA B CA    1 
ATOM   6009  C  C     . ALA B  2  362 ? 70.553  48.898  54.343  1.00 118.00 ? 360  ALA B C     1 
ATOM   6010  O  O     . ALA B  2  362 ? 70.760  49.990  54.868  1.00 117.31 ? 360  ALA B O     1 
ATOM   6011  C  CB    . ALA B  2  362 ? 68.809  47.489  55.461  1.00 118.92 ? 360  ALA B CB    1 
ATOM   6012  N  N     . LYS B  2  363 ? 71.523  48.145  53.840  1.00 118.67 ? 361  LYS B N     1 
ATOM   6013  C  CA    . LYS B  2  363 ? 72.911  48.579  53.868  1.00 120.03 ? 361  LYS B CA    1 
ATOM   6014  C  C     . LYS B  2  363 ? 73.077  49.871  53.082  1.00 120.55 ? 361  LYS B C     1 
ATOM   6015  O  O     . LYS B  2  363 ? 73.838  50.752  53.476  1.00 120.76 ? 361  LYS B O     1 
ATOM   6016  C  CB    . LYS B  2  363 ? 73.829  47.513  53.261  1.00 120.38 ? 361  LYS B CB    1 
ATOM   6017  C  CG    . LYS B  2  363 ? 74.180  46.360  54.177  1.00 120.63 ? 361  LYS B CG    1 
ATOM   6018  C  CD    . LYS B  2  363 ? 75.126  45.400  53.472  1.00 120.86 ? 361  LYS B CD    1 
ATOM   6019  C  CE    . LYS B  2  363 ? 75.531  44.253  54.380  1.00 121.58 ? 361  LYS B CE    1 
ATOM   6020  N  NZ    . LYS B  2  363 ? 76.459  43.317  53.691  1.00 121.36 ? 361  LYS B NZ    1 
ATOM   6021  N  N     . ASN B  2  364 ? 72.368  49.977  51.965  1.00 121.26 ? 362  ASN B N     1 
ATOM   6022  C  CA    . ASN B  2  364 ? 72.451  51.163  51.118  1.00 121.95 ? 362  ASN B CA    1 
ATOM   6023  C  C     . ASN B  2  364 ? 71.721  52.331  51.769  1.00 121.57 ? 362  ASN B C     1 
ATOM   6024  O  O     . ASN B  2  364 ? 72.279  53.418  51.922  1.00 121.32 ? 362  ASN B O     1 
ATOM   6025  C  CB    . ASN B  2  364 ? 71.833  50.878  49.749  1.00 123.30 ? 362  ASN B CB    1 
ATOM   6026  C  CG    . ASN B  2  364 ? 72.003  49.435  49.324  1.00 124.44 ? 362  ASN B CG    1 
ATOM   6027  O  OD1   . ASN B  2  364 ? 73.111  48.889  49.363  1.00 125.41 ? 362  ASN B OD1   1 
ATOM   6028  N  ND2   . ASN B  2  364 ? 70.902  48.806  48.911  1.00 124.48 ? 362  ASN B ND2   1 
ATOM   6029  N  N     . GLN B  2  365 ? 70.465  52.099  52.145  1.00 120.95 ? 363  GLN B N     1 
ATOM   6030  C  CA    . GLN B  2  365 ? 69.653  53.124  52.786  1.00 119.87 ? 363  GLN B CA    1 
ATOM   6031  C  C     . GLN B  2  365 ? 70.476  53.782  53.890  1.00 120.10 ? 363  GLN B C     1 
ATOM   6032  O  O     . GLN B  2  365 ? 70.489  55.006  54.026  1.00 119.91 ? 363  GLN B O     1 
ATOM   6033  C  CB    . GLN B  2  365 ? 68.372  52.499  53.359  1.00 118.32 ? 363  GLN B CB    1 
ATOM   6034  C  CG    . GLN B  2  365 ? 67.411  51.960  52.293  1.00 116.63 ? 363  GLN B CG    1 
ATOM   6035  C  CD    . GLN B  2  365 ? 66.186  51.271  52.881  1.00 115.77 ? 363  GLN B CD    1 
ATOM   6036  O  OE1   . GLN B  2  365 ? 65.444  51.862  53.659  1.00 115.91 ? 363  GLN B OE1   1 
ATOM   6037  N  NE2   . GLN B  2  365 ? 65.971  50.016  52.506  1.00 115.18 ? 363  GLN B NE2   1 
ATOM   6038  N  N     . LEU B  2  366 ? 71.177  52.962  54.667  1.00 120.36 ? 364  LEU B N     1 
ATOM   6039  C  CA    . LEU B  2  366 ? 72.018  53.469  55.745  1.00 120.76 ? 364  LEU B CA    1 
ATOM   6040  C  C     . LEU B  2  366 ? 73.218  54.232  55.167  1.00 120.91 ? 364  LEU B C     1 
ATOM   6041  O  O     . LEU B  2  366 ? 73.593  55.295  55.672  1.00 120.64 ? 364  LEU B O     1 
ATOM   6042  C  CB    . LEU B  2  366 ? 72.491  52.310  56.635  1.00 121.14 ? 364  LEU B CB    1 
ATOM   6043  C  CG    . LEU B  2  366 ? 73.360  52.599  57.873  1.00 121.38 ? 364  LEU B CG    1 
ATOM   6044  C  CD1   . LEU B  2  366 ? 72.726  53.673  58.738  1.00 121.50 ? 364  LEU B CD1   1 
ATOM   6045  C  CD2   . LEU B  2  366 ? 73.538  51.317  58.680  1.00 121.65 ? 364  LEU B CD2   1 
ATOM   6046  N  N     . LYS B  2  367 ? 73.824  53.685  54.114  1.00 121.16 ? 365  LYS B N     1 
ATOM   6047  C  CA    . LYS B  2  367 ? 74.953  54.350  53.468  1.00 121.44 ? 365  LYS B CA    1 
ATOM   6048  C  C     . LYS B  2  367 ? 74.392  55.699  53.042  1.00 121.44 ? 365  LYS B C     1 
ATOM   6049  O  O     . LYS B  2  367 ? 74.930  56.761  53.366  1.00 121.28 ? 365  LYS B O     1 
ATOM   6050  C  CB    . LYS B  2  367 ? 75.402  53.603  52.200  1.00 122.06 ? 365  LYS B CB    1 
ATOM   6051  C  CG    . LYS B  2  367 ? 75.944  52.189  52.370  1.00 122.21 ? 365  LYS B CG    1 
ATOM   6052  C  CD    . LYS B  2  367 ? 76.209  51.564  50.989  1.00 122.15 ? 365  LYS B CD    1 
ATOM   6053  C  CE    . LYS B  2  367 ? 76.647  50.105  51.083  1.00 122.59 ? 365  LYS B CE    1 
ATOM   6054  N  NZ    . LYS B  2  367 ? 76.848  49.476  49.740  1.00 121.54 ? 365  LYS B NZ    1 
ATOM   6055  N  N     . ALA B  2  368 ? 73.288  55.620  52.305  1.00 121.23 ? 366  ALA B N     1 
ATOM   6056  C  CA    . ALA B  2  368 ? 72.593  56.783  51.784  1.00 120.48 ? 366  ALA B CA    1 
ATOM   6057  C  C     . ALA B  2  368 ? 72.350  57.800  52.886  1.00 119.68 ? 366  ALA B C     1 
ATOM   6058  O  O     . ALA B  2  368 ? 73.090  58.781  53.015  1.00 119.54 ? 366  ALA B O     1 
ATOM   6059  C  CB    . ALA B  2  368 ? 71.261  56.353  51.157  1.00 120.18 ? 366  ALA B CB    1 
ATOM   6060  N  N     . THR B  2  369 ? 71.313  57.549  53.680  1.00 118.08 ? 367  THR B N     1 
ATOM   6061  C  CA    . THR B  2  369 ? 70.951  58.437  54.763  1.00 116.88 ? 367  THR B CA    1 
ATOM   6062  C  C     . THR B  2  369 ? 72.174  59.031  55.426  1.00 116.59 ? 367  THR B C     1 
ATOM   6063  O  O     . THR B  2  369 ? 72.250  60.246  55.600  1.00 116.89 ? 367  THR B O     1 
ATOM   6064  C  CB    . THR B  2  369 ? 70.113  57.713  55.801  1.00 116.74 ? 367  THR B CB    1 
ATOM   6065  O  OG1   . THR B  2  369 ? 68.869  57.331  55.205  1.00 116.70 ? 367  THR B OG1   1 
ATOM   6066  C  CG2   . THR B  2  369 ? 69.850  58.619  56.999  1.00 117.36 ? 367  THR B CG2   1 
ATOM   6067  N  N     . TYR B  2  370 ? 73.133  58.185  55.796  1.00 116.10 ? 368  TYR B N     1 
ATOM   6068  C  CA    . TYR B  2  370 ? 74.350  58.684  56.420  1.00 115.86 ? 368  TYR B CA    1 
ATOM   6069  C  C     . TYR B  2  370 ? 74.925  59.771  55.510  1.00 115.23 ? 368  TYR B C     1 
ATOM   6070  O  O     . TYR B  2  370 ? 75.085  60.925  55.920  1.00 115.02 ? 368  TYR B O     1 
ATOM   6071  C  CB    . TYR B  2  370 ? 75.384  57.556  56.597  1.00 116.50 ? 368  TYR B CB    1 
ATOM   6072  C  CG    . TYR B  2  370 ? 76.810  58.060  56.801  1.00 117.79 ? 368  TYR B CG    1 
ATOM   6073  C  CD1   . TYR B  2  370 ? 77.257  58.499  58.052  1.00 118.10 ? 368  TYR B CD1   1 
ATOM   6074  C  CD2   . TYR B  2  370 ? 77.692  58.169  55.717  1.00 118.37 ? 368  TYR B CD2   1 
ATOM   6075  C  CE1   . TYR B  2  370 ? 78.556  59.044  58.215  1.00 118.23 ? 368  TYR B CE1   1 
ATOM   6076  C  CE2   . TYR B  2  370 ? 78.987  58.712  55.867  1.00 118.12 ? 368  TYR B CE2   1 
ATOM   6077  C  CZ    . TYR B  2  370 ? 79.413  59.150  57.114  1.00 118.12 ? 368  TYR B CZ    1 
ATOM   6078  O  OH    . TYR B  2  370 ? 80.671  59.719  57.238  1.00 116.83 ? 368  TYR B OH    1 
ATOM   6079  N  N     . LEU B  2  371 ? 75.201  59.392  54.263  1.00 114.22 ? 369  LEU B N     1 
ATOM   6080  C  CA    . LEU B  2  371 ? 75.784  60.291  53.271  1.00 113.34 ? 369  LEU B CA    1 
ATOM   6081  C  C     . LEU B  2  371 ? 75.014  61.562  52.944  1.00 112.83 ? 369  LEU B C     1 
ATOM   6082  O  O     . LEU B  2  371 ? 75.614  62.586  52.590  1.00 112.91 ? 369  LEU B O     1 
ATOM   6083  C  CB    . LEU B  2  371 ? 76.060  59.520  51.984  1.00 112.72 ? 369  LEU B CB    1 
ATOM   6084  C  CG    . LEU B  2  371 ? 77.484  58.975  51.947  1.00 112.46 ? 369  LEU B CG    1 
ATOM   6085  C  CD1   . LEU B  2  371 ? 77.589  57.892  50.896  1.00 112.80 ? 369  LEU B CD1   1 
ATOM   6086  C  CD2   . LEU B  2  371 ? 78.461  60.123  51.682  1.00 111.63 ? 369  LEU B CD2   1 
ATOM   6087  N  N     . MET B  2  372 ? 73.693  61.500  53.056  1.00 111.70 ? 370  MET B N     1 
ATOM   6088  C  CA    . MET B  2  372 ? 72.863  62.658  52.761  1.00 110.29 ? 370  MET B CA    1 
ATOM   6089  C  C     . MET B  2  372 ? 72.871  63.649  53.922  1.00 110.44 ? 370  MET B C     1 
ATOM   6090  O  O     . MET B  2  372 ? 73.032  64.851  53.722  1.00 110.45 ? 370  MET B O     1 
ATOM   6091  C  CB    . MET B  2  372 ? 71.424  62.216  52.455  1.00 107.94 ? 370  MET B CB    1 
ATOM   6092  C  CG    . MET B  2  372 ? 71.294  61.320  51.220  1.00 105.12 ? 370  MET B CG    1 
ATOM   6093  S  SD    . MET B  2  372 ? 69.596  60.974  50.663  1.00 100.78 ? 370  MET B SD    1 
ATOM   6094  C  CE    . MET B  2  372 ? 69.141  59.686  51.765  1.00 103.46 ? 370  MET B CE    1 
ATOM   6095  N  N     . SER B  2  373 ? 72.713  63.134  55.135  1.00 110.69 ? 371  SER B N     1 
ATOM   6096  C  CA    . SER B  2  373 ? 72.680  63.965  56.334  1.00 111.06 ? 371  SER B CA    1 
ATOM   6097  C  C     . SER B  2  373 ? 73.926  64.812  56.568  1.00 111.16 ? 371  SER B C     1 
ATOM   6098  O  O     . SER B  2  373 ? 73.933  65.658  57.457  1.00 111.19 ? 371  SER B O     1 
ATOM   6099  C  CB    . SER B  2  373 ? 72.471  63.088  57.561  1.00 111.11 ? 371  SER B CB    1 
ATOM   6100  O  OG    . SER B  2  373 ? 73.630  62.307  57.788  1.00 111.67 ? 371  SER B OG    1 
ATOM   6101  N  N     . VAL B  2  374 ? 74.976  64.593  55.788  1.00 111.41 ? 372  VAL B N     1 
ATOM   6102  C  CA    . VAL B  2  374 ? 76.204  65.350  55.981  1.00 112.11 ? 372  VAL B CA    1 
ATOM   6103  C  C     . VAL B  2  374 ? 76.435  66.451  54.969  1.00 113.14 ? 372  VAL B C     1 
ATOM   6104  O  O     . VAL B  2  374 ? 77.529  67.017  54.915  1.00 113.45 ? 372  VAL B O     1 
ATOM   6105  C  CB    . VAL B  2  374 ? 77.398  64.442  55.929  1.00 112.28 ? 372  VAL B CB    1 
ATOM   6106  C  CG1   . VAL B  2  374 ? 77.170  63.281  56.868  1.00 113.01 ? 372  VAL B CG1   1 
ATOM   6107  C  CG2   . VAL B  2  374 ? 77.619  63.966  54.498  1.00 112.29 ? 372  VAL B CG2   1 
ATOM   6108  N  N     . GLU B  2  375 ? 75.415  66.741  54.165  1.00 114.10 ? 373  GLU B N     1 
ATOM   6109  C  CA    . GLU B  2  375 ? 75.484  67.798  53.149  1.00 114.31 ? 373  GLU B CA    1 
ATOM   6110  C  C     . GLU B  2  375 ? 75.357  69.170  53.835  1.00 114.87 ? 373  GLU B C     1 
ATOM   6111  O  O     . GLU B  2  375 ? 76.109  70.110  53.529  1.00 114.12 ? 373  GLU B O     1 
ATOM   6112  C  CB    . GLU B  2  375 ? 74.339  67.630  52.134  1.00 113.84 ? 373  GLU B CB    1 
ATOM   6113  C  CG    . GLU B  2  375 ? 74.221  66.230  51.517  1.00 113.12 ? 373  GLU B CG    1 
ATOM   6114  C  CD    . GLU B  2  375 ? 72.894  65.999  50.801  1.00 112.33 ? 373  GLU B CD    1 
ATOM   6115  O  OE1   . GLU B  2  375 ? 72.678  64.879  50.290  1.00 111.47 ? 373  GLU B OE1   1 
ATOM   6116  O  OE2   . GLU B  2  375 ? 72.068  66.935  50.749  1.00 112.46 ? 373  GLU B OE2   1 
ATOM   6117  N  N     . THR B  2  376 ? 74.404  69.251  54.773  1.00 115.73 ? 374  THR B N     1 
ATOM   6118  C  CA    . THR B  2  376 ? 74.101  70.469  55.541  1.00 115.92 ? 374  THR B CA    1 
ATOM   6119  C  C     . THR B  2  376 ? 75.161  70.825  56.585  1.00 115.16 ? 374  THR B C     1 
ATOM   6120  O  O     . THR B  2  376 ? 75.492  70.020  57.453  1.00 114.60 ? 374  THR B O     1 
ATOM   6121  C  CB    . THR B  2  376 ? 72.714  70.364  56.278  1.00 116.52 ? 374  THR B CB    1 
ATOM   6122  O  OG1   . THR B  2  376 ? 72.838  69.545  57.450  1.00 116.18 ? 374  THR B OG1   1 
ATOM   6123  C  CG2   . THR B  2  376 ? 71.647  69.770  55.348  1.00 116.52 ? 374  THR B CG2   1 
ATOM   6124  N  N     . ALA B  2  377 ? 75.672  72.048  56.499  1.00 114.93 ? 375  ALA B N     1 
ATOM   6125  C  CA    . ALA B  2  377 ? 76.690  72.522  57.423  1.00 114.98 ? 375  ALA B CA    1 
ATOM   6126  C  C     . ALA B  2  377 ? 76.441  72.069  58.858  1.00 114.98 ? 375  ALA B C     1 
ATOM   6127  O  O     . ALA B  2  377 ? 77.385  71.922  59.627  1.00 114.83 ? 375  ALA B O     1 
ATOM   6128  C  CB    . ALA B  2  377 ? 76.786  74.045  57.363  1.00 115.28 ? 375  ALA B CB    1 
ATOM   6129  N  N     . GLN B  2  378 ? 75.183  71.846  59.233  1.00 115.58 ? 376  GLN B N     1 
ATOM   6130  C  CA    . GLN B  2  378 ? 74.921  71.401  60.596  1.00 116.58 ? 376  GLN B CA    1 
ATOM   6131  C  C     . GLN B  2  378 ? 75.103  69.895  60.743  1.00 116.74 ? 376  GLN B C     1 
ATOM   6132  O  O     . GLN B  2  378 ? 75.648  69.432  61.744  1.00 117.74 ? 376  GLN B O     1 
ATOM   6133  C  CB    . GLN B  2  378 ? 73.518  71.771  61.074  1.00 116.86 ? 376  GLN B CB    1 
ATOM   6134  C  CG    . GLN B  2  378 ? 73.396  71.575  62.583  1.00 117.06 ? 376  GLN B CG    1 
ATOM   6135  C  CD    . GLN B  2  378 ? 71.984  71.342  63.048  1.00 117.40 ? 376  GLN B CD    1 
ATOM   6136  O  OE1   . GLN B  2  378 ? 71.092  72.150  62.788  1.00 117.52 ? 376  GLN B OE1   1 
ATOM   6137  N  NE2   . GLN B  2  378 ? 71.770  70.232  63.753  1.00 117.51 ? 376  GLN B NE2   1 
ATOM   6138  N  N     . GLY B  2  379 ? 74.633  69.130  59.762  1.00 116.22 ? 377  GLY B N     1 
ATOM   6139  C  CA    . GLY B  2  379 ? 74.797  67.687  59.824  1.00 115.67 ? 377  GLY B CA    1 
ATOM   6140  C  C     . GLY B  2  379 ? 76.275  67.306  59.781  1.00 115.24 ? 377  GLY B C     1 
ATOM   6141  O  O     . GLY B  2  379 ? 76.685  66.295  60.360  1.00 115.61 ? 377  GLY B O     1 
ATOM   6142  N  N     . LEU B  2  380 ? 77.074  68.123  59.093  1.00 114.00 ? 378  LEU B N     1 
ATOM   6143  C  CA    . LEU B  2  380 ? 78.515  67.907  58.966  1.00 112.09 ? 378  LEU B CA    1 
ATOM   6144  C  C     . LEU B  2  380 ? 79.283  68.333  60.216  1.00 111.57 ? 378  LEU B C     1 
ATOM   6145  O  O     . LEU B  2  380 ? 79.944  67.502  60.833  1.00 112.44 ? 378  LEU B O     1 
ATOM   6146  C  CB    . LEU B  2  380 ? 79.068  68.666  57.759  1.00 111.06 ? 378  LEU B CB    1 
ATOM   6147  C  CG    . LEU B  2  380 ? 80.591  68.748  57.686  1.00 109.56 ? 378  LEU B CG    1 
ATOM   6148  C  CD1   . LEU B  2  380 ? 81.154  67.362  57.522  1.00 109.74 ? 378  LEU B CD1   1 
ATOM   6149  C  CD2   . LEU B  2  380 ? 81.000  69.622  56.531  1.00 109.26 ? 378  LEU B CD2   1 
ATOM   6150  N  N     . LEU B  2  381 ? 79.216  69.614  60.591  1.00 109.99 ? 379  LEU B N     1 
ATOM   6151  C  CA    . LEU B  2  381 ? 79.925  70.065  61.782  1.00 108.64 ? 379  LEU B CA    1 
ATOM   6152  C  C     . LEU B  2  381 ? 79.516  69.187  62.935  1.00 108.73 ? 379  LEU B C     1 
ATOM   6153  O  O     . LEU B  2  381 ? 80.190  69.142  63.951  1.00 108.49 ? 379  LEU B O     1 
ATOM   6154  C  CB    . LEU B  2  381 ? 79.599  71.509  62.144  1.00 108.05 ? 379  LEU B CB    1 
ATOM   6155  C  CG    . LEU B  2  381 ? 80.324  71.966  63.424  1.00 107.77 ? 379  LEU B CG    1 
ATOM   6156  C  CD1   . LEU B  2  381 ? 81.795  72.134  63.126  1.00 107.16 ? 379  LEU B CD1   1 
ATOM   6157  C  CD2   . LEU B  2  381 ? 79.752  73.275  63.946  1.00 107.87 ? 379  LEU B CD2   1 
ATOM   6158  N  N     . ASN B  2  382 ? 78.398  68.491  62.781  1.00 109.71 ? 380  ASN B N     1 
ATOM   6159  C  CA    . ASN B  2  382 ? 77.932  67.598  63.827  1.00 111.50 ? 380  ASN B CA    1 
ATOM   6160  C  C     . ASN B  2  382 ? 78.631  66.239  63.749  1.00 112.66 ? 380  ASN B C     1 
ATOM   6161  O  O     . ASN B  2  382 ? 79.011  65.678  64.778  1.00 113.76 ? 380  ASN B O     1 
ATOM   6162  C  CB    . ASN B  2  382 ? 76.426  67.389  63.735  1.00 112.02 ? 380  ASN B CB    1 
ATOM   6163  C  CG    . ASN B  2  382 ? 75.902  66.511  64.850  1.00 112.68 ? 380  ASN B CG    1 
ATOM   6164  O  OD1   . ASN B  2  382 ? 75.946  66.890  66.027  1.00 112.35 ? 380  ASN B OD1   1 
ATOM   6165  N  ND2   . ASN B  2  382 ? 75.418  65.322  64.493  1.00 113.46 ? 380  ASN B ND2   1 
ATOM   6166  N  N     . GLU B  2  383 ? 78.802  65.704  62.539  1.00 112.92 ? 381  GLU B N     1 
ATOM   6167  C  CA    . GLU B  2  383 ? 79.463  64.407  62.387  1.00 112.80 ? 381  GLU B CA    1 
ATOM   6168  C  C     . GLU B  2  383 ? 80.968  64.510  62.649  1.00 111.32 ? 381  GLU B C     1 
ATOM   6169  O  O     . GLU B  2  383 ? 81.630  63.504  62.922  1.00 111.62 ? 381  GLU B O     1 
ATOM   6170  C  CB    . GLU B  2  383 ? 79.213  63.833  60.988  1.00 114.49 ? 381  GLU B CB    1 
ATOM   6171  C  CG    . GLU B  2  383 ? 79.621  62.351  60.810  1.00 117.52 ? 381  GLU B CG    1 
ATOM   6172  C  CD    . GLU B  2  383 ? 78.836  61.378  61.705  1.00 118.97 ? 381  GLU B CD    1 
ATOM   6173  O  OE1   . GLU B  2  383 ? 77.610  61.576  61.886  1.00 119.16 ? 381  GLU B OE1   1 
ATOM   6174  O  OE2   . GLU B  2  383 ? 79.448  60.406  62.214  1.00 119.87 ? 381  GLU B OE2   1 
ATOM   6175  N  N     . ILE B  2  384 ? 81.507  65.722  62.569  1.00 109.17 ? 382  ILE B N     1 
ATOM   6176  C  CA    . ILE B  2  384 ? 82.919  65.927  62.824  1.00 107.39 ? 382  ILE B CA    1 
ATOM   6177  C  C     . ILE B  2  384 ? 83.152  65.951  64.316  1.00 107.71 ? 382  ILE B C     1 
ATOM   6178  O  O     . ILE B  2  384 ? 83.937  65.166  64.837  1.00 108.50 ? 382  ILE B O     1 
ATOM   6179  C  CB    . ILE B  2  384 ? 83.414  67.229  62.218  1.00 105.65 ? 382  ILE B CB    1 
ATOM   6180  C  CG1   . ILE B  2  384 ? 83.475  67.075  60.700  1.00 105.71 ? 382  ILE B CG1   1 
ATOM   6181  C  CG2   . ILE B  2  384 ? 84.770  67.587  62.788  1.00 104.85 ? 382  ILE B CG2   1 
ATOM   6182  C  CD1   . ILE B  2  384 ? 84.005  68.288  59.963  1.00 106.80 ? 382  ILE B CD1   1 
ATOM   6183  N  N     . GLY B  2  385 ? 82.461  66.850  65.003  1.00 107.81 ? 383  GLY B N     1 
ATOM   6184  C  CA    . GLY B  2  385 ? 82.600  66.941  66.442  1.00 108.83 ? 383  GLY B CA    1 
ATOM   6185  C  C     . GLY B  2  385 ? 82.265  65.635  67.137  1.00 110.02 ? 383  GLY B C     1 
ATOM   6186  O  O     . GLY B  2  385 ? 83.060  65.134  67.926  1.00 110.18 ? 383  GLY B O     1 
ATOM   6187  N  N     . SER B  2  386 ? 81.095  65.076  66.842  1.00 111.65 ? 384  SER B N     1 
ATOM   6188  C  CA    . SER B  2  386 ? 80.654  63.817  67.449  1.00 114.20 ? 384  SER B CA    1 
ATOM   6189  C  C     . SER B  2  386 ? 81.801  62.849  67.670  1.00 115.72 ? 384  SER B C     1 
ATOM   6190  O  O     . SER B  2  386 ? 81.938  62.248  68.735  1.00 115.80 ? 384  SER B O     1 
ATOM   6191  C  CB    . SER B  2  386 ? 79.607  63.128  66.566  1.00 114.43 ? 384  SER B CB    1 
ATOM   6192  O  OG    . SER B  2  386 ? 78.346  63.770  66.642  1.00 115.96 ? 384  SER B OG    1 
ATOM   6193  N  N     . GLU B  2  387 ? 82.617  62.699  66.639  1.00 117.94 ? 385  GLU B N     1 
ATOM   6194  C  CA    . GLU B  2  387 ? 83.762  61.807  66.681  1.00 119.65 ? 385  GLU B CA    1 
ATOM   6195  C  C     . GLU B  2  387 ? 84.937  62.495  67.375  1.00 119.28 ? 385  GLU B C     1 
ATOM   6196  O  O     . GLU B  2  387 ? 85.560  61.923  68.267  1.00 118.64 ? 385  GLU B O     1 
ATOM   6197  C  CB    . GLU B  2  387 ? 84.128  61.411  65.248  1.00 121.79 ? 385  GLU B CB    1 
ATOM   6198  C  CG    . GLU B  2  387 ? 85.168  60.314  65.121  1.00 124.95 ? 385  GLU B CG    1 
ATOM   6199  C  CD    . GLU B  2  387 ? 84.811  59.316  64.029  1.00 126.73 ? 385  GLU B CD    1 
ATOM   6200  O  OE1   . GLU B  2  387 ? 84.292  59.750  62.972  1.00 127.84 ? 385  GLU B OE1   1 
ATOM   6201  O  OE2   . GLU B  2  387 ? 85.057  58.102  64.225  1.00 127.36 ? 385  GLU B OE2   1 
ATOM   6202  N  N     . ALA B  2  388 ? 85.223  63.730  66.968  1.00 119.31 ? 386  ALA B N     1 
ATOM   6203  C  CA    . ALA B  2  388 ? 86.321  64.499  67.544  1.00 119.41 ? 386  ALA B CA    1 
ATOM   6204  C  C     . ALA B  2  388 ? 86.145  64.748  69.036  1.00 119.65 ? 386  ALA B C     1 
ATOM   6205  O  O     . ALA B  2  388 ? 86.840  65.582  69.609  1.00 119.61 ? 386  ALA B O     1 
ATOM   6206  C  CB    . ALA B  2  388 ? 86.471  65.830  66.814  1.00 119.27 ? 386  ALA B CB    1 
ATOM   6207  N  N     . LEU B  2  389 ? 85.214  64.033  69.661  1.00 120.34 ? 387  LEU B N     1 
ATOM   6208  C  CA    . LEU B  2  389 ? 84.973  64.181  71.096  1.00 121.79 ? 387  LEU B CA    1 
ATOM   6209  C  C     . LEU B  2  389 ? 85.053  62.823  71.803  1.00 123.59 ? 387  LEU B C     1 
ATOM   6210  O  O     . LEU B  2  389 ? 85.590  62.714  72.915  1.00 123.38 ? 387  LEU B O     1 
ATOM   6211  C  CB    . LEU B  2  389 ? 83.594  64.801  71.354  1.00 120.81 ? 387  LEU B CB    1 
ATOM   6212  C  CG    . LEU B  2  389 ? 83.275  65.174  72.807  1.00 119.57 ? 387  LEU B CG    1 
ATOM   6213  C  CD1   . LEU B  2  389 ? 84.096  66.397  73.172  1.00 118.27 ? 387  LEU B CD1   1 
ATOM   6214  C  CD2   . LEU B  2  389 ? 81.777  65.450  72.996  1.00 118.83 ? 387  LEU B CD2   1 
ATOM   6215  N  N     . LEU B  2  390 ? 84.518  61.791  71.148  1.00 125.67 ? 388  LEU B N     1 
ATOM   6216  C  CA    . LEU B  2  390 ? 84.512  60.433  71.699  1.00 127.19 ? 388  LEU B CA    1 
ATOM   6217  C  C     . LEU B  2  390 ? 85.747  59.610  71.320  1.00 128.00 ? 388  LEU B C     1 
ATOM   6218  O  O     . LEU B  2  390 ? 85.940  58.509  71.839  1.00 127.84 ? 388  LEU B O     1 
ATOM   6219  C  CB    . LEU B  2  390 ? 83.248  59.679  71.255  1.00 127.39 ? 388  LEU B CB    1 
ATOM   6220  C  CG    . LEU B  2  390 ? 81.891  60.170  71.773  1.00 127.60 ? 388  LEU B CG    1 
ATOM   6221  C  CD1   . LEU B  2  390 ? 80.792  59.296  71.202  1.00 127.74 ? 388  LEU B CD1   1 
ATOM   6222  C  CD2   . LEU B  2  390 ? 81.857  60.130  73.294  1.00 127.76 ? 388  LEU B CD2   1 
ATOM   6223  N  N     . SER B  2  391 ? 86.581  60.136  70.423  1.00 128.78 ? 389  SER B N     1 
ATOM   6224  C  CA    . SER B  2  391 ? 87.786  59.421  70.004  1.00 129.30 ? 389  SER B CA    1 
ATOM   6225  C  C     . SER B  2  391 ? 88.967  60.309  69.600  1.00 130.11 ? 389  SER B C     1 
ATOM   6226  O  O     . SER B  2  391 ? 90.104  59.847  69.545  1.00 129.64 ? 389  SER B O     1 
ATOM   6227  C  CB    . SER B  2  391 ? 87.448  58.468  68.855  1.00 129.11 ? 389  SER B CB    1 
ATOM   6228  O  OG    . SER B  2  391 ? 86.957  59.167  67.728  1.00 128.97 ? 389  SER B OG    1 
ATOM   6229  N  N     . GLY B  2  392 ? 88.705  61.579  69.320  1.00 131.74 ? 390  GLY B N     1 
ATOM   6230  C  CA    . GLY B  2  392 ? 89.779  62.472  68.921  1.00 133.82 ? 390  GLY B CA    1 
ATOM   6231  C  C     . GLY B  2  392 ? 90.284  62.098  67.543  1.00 135.42 ? 390  GLY B C     1 
ATOM   6232  O  O     . GLY B  2  392 ? 91.397  62.453  67.149  1.00 135.23 ? 390  GLY B O     1 
ATOM   6233  N  N     . THR B  2  393 ? 89.440  61.378  66.811  1.00 137.35 ? 391  THR B N     1 
ATOM   6234  C  CA    . THR B  2  393 ? 89.759  60.916  65.466  1.00 139.31 ? 391  THR B CA    1 
ATOM   6235  C  C     . THR B  2  393 ? 88.693  61.329  64.445  1.00 140.35 ? 391  THR B C     1 
ATOM   6236  O  O     . THR B  2  393 ? 87.806  62.134  64.735  1.00 140.27 ? 391  THR B O     1 
ATOM   6237  C  CB    . THR B  2  393 ? 89.891  59.367  65.437  1.00 139.61 ? 391  THR B CB    1 
ATOM   6238  O  OG1   . THR B  2  393 ? 88.637  58.765  65.795  1.00 139.34 ? 391  THR B OG1   1 
ATOM   6239  C  CG2   . THR B  2  393 ? 90.970  58.905  66.417  1.00 139.79 ? 391  THR B CG2   1 
ATOM   6240  N  N     . HIS B  2  394 ? 88.800  60.774  63.244  1.00 141.76 ? 392  HIS B N     1 
ATOM   6241  C  CA    . HIS B  2  394 ? 87.851  61.050  62.174  1.00 143.17 ? 392  HIS B CA    1 
ATOM   6242  C  C     . HIS B  2  394 ? 87.803  59.902  61.172  1.00 143.68 ? 392  HIS B C     1 
ATOM   6243  O  O     . HIS B  2  394 ? 88.563  59.884  60.204  1.00 144.21 ? 392  HIS B O     1 
ATOM   6244  C  CB    . HIS B  2  394 ? 88.213  62.345  61.438  1.00 143.92 ? 392  HIS B CB    1 
ATOM   6245  C  CG    . HIS B  2  394 ? 87.507  62.504  60.126  1.00 144.79 ? 392  HIS B CG    1 
ATOM   6246  N  ND1   . HIS B  2  394 ? 88.136  62.308  58.915  1.00 145.50 ? 392  HIS B ND1   1 
ATOM   6247  C  CD2   . HIS B  2  394 ? 86.214  62.787  59.837  1.00 144.84 ? 392  HIS B CD2   1 
ATOM   6248  C  CE1   . HIS B  2  394 ? 87.261  62.462  57.937  1.00 145.82 ? 392  HIS B CE1   1 
ATOM   6249  N  NE2   . HIS B  2  394 ? 86.088  62.754  58.470  1.00 145.47 ? 392  HIS B NE2   1 
ATOM   6250  N  N     . THR B  2  395 ? 86.915  58.942  61.409  1.00 143.93 ? 393  THR B N     1 
ATOM   6251  C  CA    . THR B  2  395 ? 86.774  57.806  60.507  1.00 143.93 ? 393  THR B CA    1 
ATOM   6252  C  C     . THR B  2  395 ? 86.459  58.371  59.124  1.00 143.99 ? 393  THR B C     1 
ATOM   6253  O  O     . THR B  2  395 ? 85.580  59.219  58.988  1.00 144.04 ? 393  THR B O     1 
ATOM   6254  C  CB    . THR B  2  395 ? 85.627  56.873  60.966  1.00 143.72 ? 393  THR B CB    1 
ATOM   6255  O  OG1   . THR B  2  395 ? 85.929  56.338  62.263  1.00 143.52 ? 393  THR B OG1   1 
ATOM   6256  C  CG2   . THR B  2  395 ? 85.441  55.735  59.984  1.00 143.66 ? 393  THR B CG2   1 
ATOM   6257  N  N     . ALA B  2  396 ? 87.192  57.928  58.105  1.00 144.10 ? 394  ALA B N     1 
ATOM   6258  C  CA    . ALA B  2  396 ? 86.964  58.414  56.750  1.00 143.96 ? 394  ALA B CA    1 
ATOM   6259  C  C     . ALA B  2  396 ? 85.614  57.908  56.265  1.00 144.25 ? 394  ALA B C     1 
ATOM   6260  O  O     . ALA B  2  396 ? 85.140  56.866  56.712  1.00 143.97 ? 394  ALA B O     1 
ATOM   6261  C  CB    . ALA B  2  396 ? 88.066  57.930  55.830  1.00 143.77 ? 394  ALA B CB    1 
ATOM   6262  N  N     . PRO B  2  397 ? 84.972  58.643  55.342  1.00 144.86 ? 395  PRO B N     1 
ATOM   6263  C  CA    . PRO B  2  397 ? 83.666  58.226  54.821  1.00 145.58 ? 395  PRO B CA    1 
ATOM   6264  C  C     . PRO B  2  397 ? 83.743  56.856  54.143  1.00 146.20 ? 395  PRO B C     1 
ATOM   6265  O  O     . PRO B  2  397 ? 82.719  56.207  53.880  1.00 146.17 ? 395  PRO B O     1 
ATOM   6266  C  CB    . PRO B  2  397 ? 83.316  59.347  53.845  1.00 145.51 ? 395  PRO B CB    1 
ATOM   6267  C  CG    . PRO B  2  397 ? 84.658  59.793  53.352  1.00 144.95 ? 395  PRO B CG    1 
ATOM   6268  C  CD    . PRO B  2  397 ? 85.465  59.834  54.628  1.00 144.94 ? 395  PRO B CD    1 
ATOM   6269  N  N     . SER B  2  398 ? 84.976  56.435  53.867  1.00 146.48 ? 396  SER B N     1 
ATOM   6270  C  CA    . SER B  2  398 ? 85.255  55.150  53.231  1.00 146.20 ? 396  SER B CA    1 
ATOM   6271  C  C     . SER B  2  398 ? 85.226  54.039  54.289  1.00 145.82 ? 396  SER B C     1 
ATOM   6272  O  O     . SER B  2  398 ? 84.565  53.010  54.107  1.00 145.54 ? 396  SER B O     1 
ATOM   6273  C  CB    . SER B  2  398 ? 86.631  55.198  52.544  1.00 146.02 ? 396  SER B CB    1 
ATOM   6274  O  OG    . SER B  2  398 ? 86.908  54.002  51.834  1.00 145.63 ? 396  SER B OG    1 
ATOM   6275  N  N     . VAL B  2  399 ? 85.936  54.263  55.396  1.00 145.26 ? 397  VAL B N     1 
ATOM   6276  C  CA    . VAL B  2  399 ? 86.002  53.297  56.491  1.00 144.38 ? 397  VAL B CA    1 
ATOM   6277  C  C     . VAL B  2  399 ? 84.589  52.970  56.948  1.00 144.13 ? 397  VAL B C     1 
ATOM   6278  O  O     . VAL B  2  399 ? 84.183  51.807  56.975  1.00 143.24 ? 397  VAL B O     1 
ATOM   6279  C  CB    . VAL B  2  399 ? 86.797  53.855  57.708  1.00 144.09 ? 397  VAL B CB    1 
ATOM   6280  C  CG1   . VAL B  2  399 ? 86.960  52.771  58.761  1.00 143.44 ? 397  VAL B CG1   1 
ATOM   6281  C  CG2   . VAL B  2  399 ? 88.159  54.383  57.265  1.00 143.48 ? 397  VAL B CG2   1 
ATOM   6282  N  N     . VAL B  2  400 ? 83.842  54.012  57.300  1.00 144.62 ? 398  VAL B N     1 
ATOM   6283  C  CA    . VAL B  2  400 ? 82.471  53.847  57.757  1.00 144.98 ? 398  VAL B CA    1 
ATOM   6284  C  C     . VAL B  2  400 ? 81.725  52.952  56.775  1.00 145.50 ? 398  VAL B C     1 
ATOM   6285  O  O     . VAL B  2  400 ? 80.856  52.183  57.170  1.00 145.79 ? 398  VAL B O     1 
ATOM   6286  C  CB    . VAL B  2  400 ? 81.742  55.210  57.876  1.00 144.41 ? 398  VAL B CB    1 
ATOM   6287  C  CG1   . VAL B  2  400 ? 81.522  55.812  56.497  1.00 143.96 ? 398  VAL B CG1   1 
ATOM   6288  C  CG2   . VAL B  2  400 ? 80.424  55.029  58.613  1.00 143.88 ? 398  VAL B CG2   1 
ATOM   6289  N  N     . ALA B  2  401 ? 82.078  53.047  55.497  1.00 145.77 ? 399  ALA B N     1 
ATOM   6290  C  CA    . ALA B  2  401 ? 81.438  52.223  54.484  1.00 146.10 ? 399  ALA B CA    1 
ATOM   6291  C  C     . ALA B  2  401 ? 81.689  50.760  54.817  1.00 146.27 ? 399  ALA B C     1 
ATOM   6292  O  O     . ALA B  2  401 ? 80.762  49.964  54.893  1.00 145.87 ? 399  ALA B O     1 
ATOM   6293  C  CB    . ALA B  2  401 ? 81.994  52.551  53.106  1.00 146.08 ? 399  ALA B CB    1 
ATOM   6294  N  N     . GLN B  2  402 ? 82.952  50.413  55.022  1.00 147.09 ? 400  GLN B N     1 
ATOM   6295  C  CA    . GLN B  2  402 ? 83.312  49.043  55.357  1.00 148.34 ? 400  GLN B CA    1 
ATOM   6296  C  C     . GLN B  2  402 ? 82.436  48.493  56.468  1.00 148.68 ? 400  GLN B C     1 
ATOM   6297  O  O     . GLN B  2  402 ? 81.589  47.639  56.242  1.00 149.23 ? 400  GLN B O     1 
ATOM   6298  C  CB    . GLN B  2  402 ? 84.766  48.953  55.827  1.00 149.13 ? 400  GLN B CB    1 
ATOM   6299  C  CG    . GLN B  2  402 ? 85.829  49.090  54.746  1.00 150.15 ? 400  GLN B CG    1 
ATOM   6300  C  CD    . GLN B  2  402 ? 87.247  48.925  55.302  1.00 150.23 ? 400  GLN B CD    1 
ATOM   6301  O  OE1   . GLN B  2  402 ? 88.234  49.019  54.565  1.00 150.44 ? 400  GLN B OE1   1 
ATOM   6302  N  NE2   . GLN B  2  402 ? 87.349  48.677  56.607  1.00 149.67 ? 400  GLN B NE2   1 
ATOM   6303  N  N     . LYS B  2  403 ? 82.660  48.994  57.676  1.00 149.21 ? 401  LYS B N     1 
ATOM   6304  C  CA    . LYS B  2  403 ? 81.931  48.548  58.858  1.00 149.90 ? 401  LYS B CA    1 
ATOM   6305  C  C     . LYS B  2  403 ? 80.417  48.418  58.656  1.00 149.54 ? 401  LYS B C     1 
ATOM   6306  O  O     . LYS B  2  403 ? 79.737  47.740  59.429  1.00 149.20 ? 401  LYS B O     1 
ATOM   6307  C  CB    . LYS B  2  403 ? 82.210  49.498  60.026  1.00 151.22 ? 401  LYS B CB    1 
ATOM   6308  C  CG    . LYS B  2  403 ? 83.614  50.128  60.034  1.00 152.63 ? 401  LYS B CG    1 
ATOM   6309  C  CD    . LYS B  2  403 ? 84.752  49.118  60.204  1.00 153.18 ? 401  LYS B CD    1 
ATOM   6310  C  CE    . LYS B  2  403 ? 86.108  49.837  60.238  1.00 153.39 ? 401  LYS B CE    1 
ATOM   6311  N  NZ    . LYS B  2  403 ? 87.278  48.917  60.373  1.00 153.22 ? 401  LYS B NZ    1 
ATOM   6312  N  N     . ILE B  2  404 ? 79.887  49.074  57.630  1.00 149.24 ? 402  ILE B N     1 
ATOM   6313  C  CA    . ILE B  2  404 ? 78.456  48.991  57.351  1.00 149.01 ? 402  ILE B CA    1 
ATOM   6314  C  C     . ILE B  2  404 ? 78.132  47.662  56.664  1.00 148.22 ? 402  ILE B C     1 
ATOM   6315  O  O     . ILE B  2  404 ? 77.359  46.853  57.183  1.00 148.17 ? 402  ILE B O     1 
ATOM   6316  C  CB    . ILE B  2  404 ? 77.980  50.134  56.420  1.00 149.82 ? 402  ILE B CB    1 
ATOM   6317  C  CG1   . ILE B  2  404 ? 78.235  51.495  57.069  1.00 150.22 ? 402  ILE B CG1   1 
ATOM   6318  C  CG2   . ILE B  2  404 ? 76.490  49.975  56.127  1.00 149.94 ? 402  ILE B CG2   1 
ATOM   6319  C  CD1   . ILE B  2  404 ? 78.000  52.679  56.131  1.00 150.53 ? 402  ILE B CD1   1 
ATOM   6320  N  N     . ASP B  2  405 ? 78.726  47.447  55.491  1.00 146.90 ? 403  ASP B N     1 
ATOM   6321  C  CA    . ASP B  2  405 ? 78.495  46.228  54.728  1.00 145.23 ? 403  ASP B CA    1 
ATOM   6322  C  C     . ASP B  2  405 ? 79.202  44.999  55.297  1.00 143.92 ? 403  ASP B C     1 
ATOM   6323  O  O     . ASP B  2  405 ? 79.091  43.913  54.732  1.00 144.06 ? 403  ASP B O     1 
ATOM   6324  C  CB    . ASP B  2  405 ? 78.883  46.431  53.249  1.00 145.99 ? 403  ASP B CB    1 
ATOM   6325  C  CG    . ASP B  2  405 ? 80.013  47.446  53.055  1.00 147.06 ? 403  ASP B CG    1 
ATOM   6326  O  OD1   . ASP B  2  405 ? 81.048  47.348  53.746  1.00 148.38 ? 403  ASP B OD1   1 
ATOM   6327  O  OD2   . ASP B  2  405 ? 79.874  48.344  52.193  1.00 147.04 ? 403  ASP B OD2   1 
ATOM   6328  N  N     . SER B  2  406 ? 79.924  45.162  56.408  1.00 142.30 ? 404  SER B N     1 
ATOM   6329  C  CA    . SER B  2  406 ? 80.618  44.034  57.041  1.00 140.39 ? 404  SER B CA    1 
ATOM   6330  C  C     . SER B  2  406 ? 79.670  43.399  58.056  1.00 138.99 ? 404  SER B C     1 
ATOM   6331  O  O     . SER B  2  406 ? 80.080  42.684  58.975  1.00 138.40 ? 404  SER B O     1 
ATOM   6332  C  CB    . SER B  2  406 ? 81.917  44.487  57.730  1.00 140.31 ? 404  SER B CB    1 
ATOM   6333  O  OG    . SER B  2  406 ? 81.669  45.356  58.820  1.00 140.53 ? 404  SER B OG    1 
ATOM   6334  N  N     . VAL B  2  407 ? 78.387  43.678  57.865  1.00 137.38 ? 405  VAL B N     1 
ATOM   6335  C  CA    . VAL B  2  407 ? 77.337  43.150  58.712  1.00 136.06 ? 405  VAL B CA    1 
ATOM   6336  C  C     . VAL B  2  407 ? 76.774  41.899  58.052  1.00 134.87 ? 405  VAL B C     1 
ATOM   6337  O  O     . VAL B  2  407 ? 76.295  41.941  56.920  1.00 133.91 ? 405  VAL B O     1 
ATOM   6338  C  CB    . VAL B  2  407 ? 76.214  44.179  58.882  1.00 136.52 ? 405  VAL B CB    1 
ATOM   6339  C  CG1   . VAL B  2  407 ? 75.064  43.579  59.681  1.00 137.08 ? 405  VAL B CG1   1 
ATOM   6340  C  CG2   . VAL B  2  407 ? 76.760  45.412  59.573  1.00 136.72 ? 405  VAL B CG2   1 
ATOM   6341  N  N     . THR B  2  408 ? 76.830  40.785  58.771  1.00 134.19 ? 406  THR B N     1 
ATOM   6342  C  CA    . THR B  2  408 ? 76.345  39.514  58.247  1.00 133.71 ? 406  THR B CA    1 
ATOM   6343  C  C     . THR B  2  408 ? 74.845  39.341  58.405  1.00 132.56 ? 406  THR B C     1 
ATOM   6344  O  O     . THR B  2  408 ? 74.227  39.934  59.287  1.00 132.10 ? 406  THR B O     1 
ATOM   6345  C  CB    . THR B  2  408 ? 77.015  38.313  58.959  1.00 134.68 ? 406  THR B CB    1 
ATOM   6346  O  OG1   . THR B  2  408 ? 76.472  38.177  60.280  1.00 135.22 ? 406  THR B OG1   1 
ATOM   6347  C  CG2   . THR B  2  408 ? 78.527  38.513  59.060  1.00 135.19 ? 406  THR B CG2   1 
ATOM   6348  N  N     . SER B  2  409 ? 74.272  38.509  57.542  1.00 131.69 ? 407  SER B N     1 
ATOM   6349  C  CA    . SER B  2  409 ? 72.850  38.207  57.591  1.00 131.05 ? 407  SER B CA    1 
ATOM   6350  C  C     . SER B  2  409 ? 72.541  37.799  59.030  1.00 130.52 ? 407  SER B C     1 
ATOM   6351  O  O     . SER B  2  409 ? 71.480  38.105  59.570  1.00 130.31 ? 407  SER B O     1 
ATOM   6352  C  CB    . SER B  2  409 ? 72.532  37.050  56.631  1.00 131.12 ? 407  SER B CB    1 
ATOM   6353  O  OG    . SER B  2  409 ? 71.174  36.647  56.714  1.00 131.42 ? 407  SER B OG    1 
ATOM   6354  N  N     . ALA B  2  410 ? 73.497  37.116  59.648  1.00 130.23 ? 408  ALA B N     1 
ATOM   6355  C  CA    . ALA B  2  410 ? 73.355  36.648  61.019  1.00 129.53 ? 408  ALA B CA    1 
ATOM   6356  C  C     . ALA B  2  410 ? 73.211  37.817  61.972  1.00 128.90 ? 408  ALA B C     1 
ATOM   6357  O  O     . ALA B  2  410 ? 72.152  38.000  62.568  1.00 128.61 ? 408  ALA B O     1 
ATOM   6358  C  CB    . ALA B  2  410 ? 74.561  35.805  61.408  1.00 129.88 ? 408  ALA B CB    1 
ATOM   6359  N  N     . ASP B  2  411 ? 74.279  38.602  62.107  1.00 128.20 ? 409  ASP B N     1 
ATOM   6360  C  CA    . ASP B  2  411 ? 74.299  39.765  62.995  1.00 127.77 ? 409  ASP B CA    1 
ATOM   6361  C  C     . ASP B  2  411 ? 72.923  40.408  63.094  1.00 127.37 ? 409  ASP B C     1 
ATOM   6362  O  O     . ASP B  2  411 ? 72.522  40.912  64.148  1.00 126.80 ? 409  ASP B O     1 
ATOM   6363  C  CB    . ASP B  2  411 ? 75.308  40.796  62.489  1.00 127.80 ? 409  ASP B CB    1 
ATOM   6364  C  CG    . ASP B  2  411 ? 76.736  40.283  62.518  1.00 127.71 ? 409  ASP B CG    1 
ATOM   6365  O  OD1   . ASP B  2  411 ? 77.193  39.860  63.601  1.00 127.13 ? 409  ASP B OD1   1 
ATOM   6366  O  OD2   . ASP B  2  411 ? 77.403  40.311  61.462  1.00 128.06 ? 409  ASP B OD2   1 
ATOM   6367  N  N     . VAL B  2  412 ? 72.208  40.386  61.976  1.00 127.15 ? 410  VAL B N     1 
ATOM   6368  C  CA    . VAL B  2  412 ? 70.866  40.939  61.900  1.00 127.15 ? 410  VAL B CA    1 
ATOM   6369  C  C     . VAL B  2  412 ? 69.872  40.027  62.623  1.00 126.78 ? 410  VAL B C     1 
ATOM   6370  O  O     . VAL B  2  412 ? 69.233  40.449  63.588  1.00 127.23 ? 410  VAL B O     1 
ATOM   6371  C  CB    . VAL B  2  412 ? 70.424  41.110  60.425  1.00 127.55 ? 410  VAL B CB    1 
ATOM   6372  C  CG1   . VAL B  2  412 ? 68.990  41.624  60.353  1.00 127.29 ? 410  VAL B CG1   1 
ATOM   6373  C  CG2   . VAL B  2  412 ? 71.368  42.068  59.717  1.00 128.00 ? 410  VAL B CG2   1 
ATOM   6374  N  N     . VAL B  2  413 ? 69.739  38.784  62.159  1.00 126.01 ? 411  VAL B N     1 
ATOM   6375  C  CA    . VAL B  2  413 ? 68.814  37.845  62.789  1.00 125.19 ? 411  VAL B CA    1 
ATOM   6376  C  C     . VAL B  2  413 ? 69.137  37.776  64.275  1.00 125.55 ? 411  VAL B C     1 
ATOM   6377  O  O     . VAL B  2  413 ? 68.263  37.489  65.098  1.00 124.78 ? 411  VAL B O     1 
ATOM   6378  C  CB    . VAL B  2  413 ? 68.929  36.426  62.198  1.00 124.48 ? 411  VAL B CB    1 
ATOM   6379  C  CG1   . VAL B  2  413 ? 67.883  35.534  62.820  1.00 123.79 ? 411  VAL B CG1   1 
ATOM   6380  C  CG2   . VAL B  2  413 ? 68.745  36.460  60.699  1.00 124.43 ? 411  VAL B CG2   1 
ATOM   6381  N  N     . ASN B  2  414 ? 70.403  38.039  64.607  1.00 126.35 ? 412  ASN B N     1 
ATOM   6382  C  CA    . ASN B  2  414 ? 70.866  38.038  66.000  1.00 126.61 ? 412  ASN B CA    1 
ATOM   6383  C  C     . ASN B  2  414 ? 70.375  39.308  66.699  1.00 125.94 ? 412  ASN B C     1 
ATOM   6384  O  O     . ASN B  2  414 ? 69.653  39.228  67.697  1.00 126.62 ? 412  ASN B O     1 
ATOM   6385  C  CB    . ASN B  2  414 ? 72.407  37.973  66.096  1.00 127.20 ? 412  ASN B CB    1 
ATOM   6386  C  CG    . ASN B  2  414 ? 72.960  36.553  65.947  1.00 127.45 ? 412  ASN B CG    1 
ATOM   6387  O  OD1   . ASN B  2  414 ? 72.411  35.590  66.495  1.00 127.18 ? 412  ASN B OD1   1 
ATOM   6388  N  ND2   . ASN B  2  414 ? 74.067  36.426  65.219  1.00 127.34 ? 412  ASN B ND2   1 
ATOM   6389  N  N     . ALA B  2  415 ? 70.774  40.473  66.183  1.00 123.95 ? 413  ALA B N     1 
ATOM   6390  C  CA    . ALA B  2  415 ? 70.341  41.734  66.767  1.00 121.55 ? 413  ALA B CA    1 
ATOM   6391  C  C     . ALA B  2  415 ? 68.860  41.567  67.042  1.00 120.43 ? 413  ALA B C     1 
ATOM   6392  O  O     . ALA B  2  415 ? 68.360  41.978  68.086  1.00 119.76 ? 413  ALA B O     1 
ATOM   6393  C  CB    . ALA B  2  415 ? 70.567  42.865  65.795  1.00 120.61 ? 413  ALA B CB    1 
ATOM   6394  N  N     . ALA B  2  416 ? 68.183  40.917  66.097  1.00 119.69 ? 414  ALA B N     1 
ATOM   6395  C  CA    . ALA B  2  416 ? 66.752  40.651  66.174  1.00 119.98 ? 414  ALA B CA    1 
ATOM   6396  C  C     . ALA B  2  416 ? 66.373  39.822  67.402  1.00 120.44 ? 414  ALA B C     1 
ATOM   6397  O  O     . ALA B  2  416 ? 65.333  40.053  68.027  1.00 120.52 ? 414  ALA B O     1 
ATOM   6398  C  CB    . ALA B  2  416 ? 66.290  39.949  64.902  1.00 119.53 ? 414  ALA B CB    1 
ATOM   6399  N  N     . LYS B  2  417 ? 67.208  38.847  67.742  1.00 120.83 ? 415  LYS B N     1 
ATOM   6400  C  CA    . LYS B  2  417 ? 66.943  38.011  68.909  1.00 121.09 ? 415  LYS B CA    1 
ATOM   6401  C  C     . LYS B  2  417 ? 67.226  38.777  70.194  1.00 120.54 ? 415  LYS B C     1 
ATOM   6402  O  O     . LYS B  2  417 ? 66.444  38.721  71.140  1.00 120.81 ? 415  LYS B O     1 
ATOM   6403  C  CB    . LYS B  2  417 ? 67.798  36.739  68.887  1.00 121.55 ? 415  LYS B CB    1 
ATOM   6404  C  CG    . LYS B  2  417 ? 67.215  35.581  68.085  1.00 122.01 ? 415  LYS B CG    1 
ATOM   6405  C  CD    . LYS B  2  417 ? 68.050  34.316  68.282  1.00 121.98 ? 415  LYS B CD    1 
ATOM   6406  C  CE    . LYS B  2  417 ? 67.455  33.110  67.567  1.00 121.36 ? 415  LYS B CE    1 
ATOM   6407  N  NZ    . LYS B  2  417 ? 68.274  31.890  67.798  1.00 120.45 ? 415  LYS B NZ    1 
ATOM   6408  N  N     . LYS B  2  418 ? 68.344  39.494  70.224  1.00 119.66 ? 416  LYS B N     1 
ATOM   6409  C  CA    . LYS B  2  418 ? 68.718  40.259  71.405  1.00 118.83 ? 416  LYS B CA    1 
ATOM   6410  C  C     . LYS B  2  418 ? 67.552  41.094  71.900  1.00 118.65 ? 416  LYS B C     1 
ATOM   6411  O  O     . LYS B  2  418 ? 67.514  41.508  73.061  1.00 117.86 ? 416  LYS B O     1 
ATOM   6412  C  CB    . LYS B  2  418 ? 69.909  41.171  71.106  1.00 118.30 ? 416  LYS B CB    1 
ATOM   6413  C  CG    . LYS B  2  418 ? 70.358  41.956  72.325  1.00 117.75 ? 416  LYS B CG    1 
ATOM   6414  C  CD    . LYS B  2  418 ? 71.659  42.701  72.113  1.00 116.43 ? 416  LYS B CD    1 
ATOM   6415  C  CE    . LYS B  2  418 ? 72.070  43.371  73.412  1.00 116.16 ? 416  LYS B CE    1 
ATOM   6416  N  NZ    . LYS B  2  418 ? 73.355  44.103  73.314  1.00 115.59 ? 416  LYS B NZ    1 
ATOM   6417  N  N     . PHE B  2  419 ? 66.600  41.337  71.007  1.00 119.06 ? 417  PHE B N     1 
ATOM   6418  C  CA    . PHE B  2  419 ? 65.422  42.118  71.341  1.00 120.19 ? 417  PHE B CA    1 
ATOM   6419  C  C     . PHE B  2  419 ? 64.328  41.250  71.954  1.00 120.76 ? 417  PHE B C     1 
ATOM   6420  O  O     . PHE B  2  419 ? 63.769  41.588  73.002  1.00 120.77 ? 417  PHE B O     1 
ATOM   6421  C  CB    . PHE B  2  419 ? 64.863  42.807  70.093  1.00 120.70 ? 417  PHE B CB    1 
ATOM   6422  C  CG    . PHE B  2  419 ? 63.594  43.572  70.344  1.00 121.32 ? 417  PHE B CG    1 
ATOM   6423  C  CD1   . PHE B  2  419 ? 63.620  44.944  70.566  1.00 121.33 ? 417  PHE B CD1   1 
ATOM   6424  C  CD2   . PHE B  2  419 ? 62.370  42.901  70.410  1.00 121.75 ? 417  PHE B CD2   1 
ATOM   6425  C  CE1   . PHE B  2  419 ? 62.441  45.632  70.852  1.00 121.94 ? 417  PHE B CE1   1 
ATOM   6426  C  CE2   . PHE B  2  419 ? 61.184  43.575  70.696  1.00 121.43 ? 417  PHE B CE2   1 
ATOM   6427  C  CZ    . PHE B  2  419 ? 61.215  44.938  70.919  1.00 121.84 ? 417  PHE B CZ    1 
ATOM   6428  N  N     . VAL B  2  420 ? 64.018  40.137  71.294  1.00 121.36 ? 418  VAL B N     1 
ATOM   6429  C  CA    . VAL B  2  420 ? 62.967  39.235  71.766  1.00 121.76 ? 418  VAL B CA    1 
ATOM   6430  C  C     . VAL B  2  420 ? 63.310  38.536  73.081  1.00 123.13 ? 418  VAL B C     1 
ATOM   6431  O  O     . VAL B  2  420 ? 62.420  38.019  73.760  1.00 123.10 ? 418  VAL B O     1 
ATOM   6432  C  CB    . VAL B  2  420 ? 62.642  38.154  70.709  1.00 120.57 ? 418  VAL B CB    1 
ATOM   6433  C  CG1   . VAL B  2  420 ? 61.350  37.440  71.079  1.00 119.08 ? 418  VAL B CG1   1 
ATOM   6434  C  CG2   . VAL B  2  420 ? 62.548  38.785  69.323  1.00 119.67 ? 418  VAL B CG2   1 
ATOM   6435  N  N     . SER B  2  421 ? 64.598  38.532  73.435  1.00 124.93 ? 419  SER B N     1 
ATOM   6436  C  CA    . SER B  2  421 ? 65.085  37.885  74.663  1.00 126.09 ? 419  SER B CA    1 
ATOM   6437  C  C     . SER B  2  421 ? 65.120  38.806  75.888  1.00 126.81 ? 419  SER B C     1 
ATOM   6438  O  O     . SER B  2  421 ? 64.308  38.648  76.811  1.00 127.42 ? 419  SER B O     1 
ATOM   6439  C  CB    . SER B  2  421 ? 66.487  37.302  74.438  1.00 125.74 ? 419  SER B CB    1 
ATOM   6440  O  OG    . SER B  2  421 ? 67.438  38.327  74.195  1.00 125.29 ? 419  SER B OG    1 
ATOM   6441  N  N     . GLY B  2  422 ? 66.069  39.747  75.890  1.00 126.67 ? 420  GLY B N     1 
ATOM   6442  C  CA    . GLY B  2  422 ? 66.216  40.689  76.991  1.00 126.07 ? 420  GLY B CA    1 
ATOM   6443  C  C     . GLY B  2  422 ? 64.915  41.245  77.555  1.00 125.65 ? 420  GLY B C     1 
ATOM   6444  O  O     . GLY B  2  422 ? 63.830  41.015  77.013  1.00 126.05 ? 420  GLY B O     1 
ATOM   6445  N  N     . LYS B  2  423 ? 65.020  41.980  78.659  1.00 124.88 ? 421  LYS B N     1 
ATOM   6446  C  CA    . LYS B  2  423 ? 63.845  42.571  79.296  1.00 123.58 ? 421  LYS B CA    1 
ATOM   6447  C  C     . LYS B  2  423 ? 63.418  43.806  78.491  1.00 121.31 ? 421  LYS B C     1 
ATOM   6448  O  O     . LYS B  2  423 ? 64.254  44.625  78.082  1.00 121.14 ? 421  LYS B O     1 
ATOM   6449  C  CB    . LYS B  2  423 ? 64.171  42.943  80.753  1.00 125.58 ? 421  LYS B CB    1 
ATOM   6450  C  CG    . LYS B  2  423 ? 62.956  43.156  81.672  1.00 127.38 ? 421  LYS B CG    1 
ATOM   6451  C  CD    . LYS B  2  423 ? 63.405  43.429  83.118  1.00 128.21 ? 421  LYS B CD    1 
ATOM   6452  C  CE    . LYS B  2  423 ? 62.234  43.761  84.045  1.00 128.62 ? 421  LYS B CE    1 
ATOM   6453  N  NZ    . LYS B  2  423 ? 62.704  44.083  85.426  1.00 128.65 ? 421  LYS B NZ    1 
ATOM   6454  N  N     . LYS B  2  424 ? 62.114  43.934  78.272  1.00 117.87 ? 422  LYS B N     1 
ATOM   6455  C  CA    . LYS B  2  424 ? 61.578  45.030  77.481  1.00 114.08 ? 422  LYS B CA    1 
ATOM   6456  C  C     . LYS B  2  424 ? 60.974  46.159  78.310  1.00 111.90 ? 422  LYS B C     1 
ATOM   6457  O  O     . LYS B  2  424 ? 60.361  45.918  79.350  1.00 111.40 ? 422  LYS B O     1 
ATOM   6458  C  CB    . LYS B  2  424 ? 60.530  44.468  76.516  1.00 113.52 ? 422  LYS B CB    1 
ATOM   6459  C  CG    . LYS B  2  424 ? 61.030  43.277  75.694  1.00 112.10 ? 422  LYS B CG    1 
ATOM   6460  C  CD    . LYS B  2  424 ? 59.914  42.278  75.421  1.00 111.24 ? 422  LYS B CD    1 
ATOM   6461  C  CE    . LYS B  2  424 ? 60.455  40.959  74.885  1.00 110.49 ? 422  LYS B CE    1 
ATOM   6462  N  NZ    . LYS B  2  424 ? 59.404  39.896  74.841  1.00 109.29 ? 422  LYS B NZ    1 
ATOM   6463  N  N     . SER B  2  425 ? 61.173  47.390  77.838  1.00 109.42 ? 423  SER B N     1 
ATOM   6464  C  CA    . SER B  2  425 ? 60.639  48.599  78.479  1.00 106.61 ? 423  SER B CA    1 
ATOM   6465  C  C     . SER B  2  425 ? 59.575  49.160  77.525  1.00 104.23 ? 423  SER B C     1 
ATOM   6466  O  O     . SER B  2  425 ? 59.728  49.051  76.308  1.00 104.75 ? 423  SER B O     1 
ATOM   6467  C  CB    . SER B  2  425 ? 61.746  49.651  78.683  1.00 106.45 ? 423  SER B CB    1 
ATOM   6468  O  OG    . SER B  2  425 ? 62.801  49.170  79.500  1.00 106.41 ? 423  SER B OG    1 
ATOM   6469  N  N     . MET B  2  426 ? 58.506  49.751  78.063  1.00 100.68 ? 424  MET B N     1 
ATOM   6470  C  CA    . MET B  2  426 ? 57.440  50.310  77.225  1.00 96.37  ? 424  MET B CA    1 
ATOM   6471  C  C     . MET B  2  426 ? 56.978  51.692  77.710  1.00 95.19  ? 424  MET B C     1 
ATOM   6472  O  O     . MET B  2  426 ? 57.022  52.003  78.902  1.00 94.53  ? 424  MET B O     1 
ATOM   6473  C  CB    . MET B  2  426 ? 56.248  49.339  77.175  1.00 93.42  ? 424  MET B CB    1 
ATOM   6474  C  CG    . MET B  2  426 ? 55.070  49.783  76.308  1.00 90.43  ? 424  MET B CG    1 
ATOM   6475  S  SD    . MET B  2  426 ? 53.542  48.850  76.697  1.00 89.48  ? 424  MET B SD    1 
ATOM   6476  C  CE    . MET B  2  426 ? 52.641  48.916  75.179  1.00 88.49  ? 424  MET B CE    1 
ATOM   6477  N  N     . ALA B  2  427 ? 56.558  52.522  76.762  1.00 93.97  ? 425  ALA B N     1 
ATOM   6478  C  CA    . ALA B  2  427 ? 56.060  53.866  77.046  1.00 92.90  ? 425  ALA B CA    1 
ATOM   6479  C  C     . ALA B  2  427 ? 54.787  54.041  76.210  1.00 92.01  ? 425  ALA B C     1 
ATOM   6480  O  O     . ALA B  2  427 ? 54.591  53.322  75.235  1.00 92.70  ? 425  ALA B O     1 
ATOM   6481  C  CB    . ALA B  2  427 ? 57.104  54.911  76.655  1.00 92.47  ? 425  ALA B CB    1 
ATOM   6482  N  N     . ALA B  2  428 ? 53.919  54.976  76.582  1.00 90.38  ? 426  ALA B N     1 
ATOM   6483  C  CA    . ALA B  2  428 ? 52.688  55.177  75.822  1.00 89.44  ? 426  ALA B CA    1 
ATOM   6484  C  C     . ALA B  2  428 ? 51.888  56.375  76.319  1.00 89.12  ? 426  ALA B C     1 
ATOM   6485  O  O     . ALA B  2  428 ? 52.015  56.770  77.470  1.00 89.80  ? 426  ALA B O     1 
ATOM   6486  C  CB    . ALA B  2  428 ? 51.834  53.921  75.886  1.00 89.09  ? 426  ALA B CB    1 
ATOM   6487  N  N     . SER B  2  429 ? 51.055  56.945  75.451  1.00 88.33  ? 427  SER B N     1 
ATOM   6488  C  CA    . SER B  2  429 ? 50.243  58.104  75.813  1.00 86.77  ? 427  SER B CA    1 
ATOM   6489  C  C     . SER B  2  429 ? 49.072  58.351  74.863  1.00 86.12  ? 427  SER B C     1 
ATOM   6490  O  O     . SER B  2  429 ? 49.256  58.661  73.689  1.00 85.57  ? 427  SER B O     1 
ATOM   6491  C  CB    . SER B  2  429 ? 51.122  59.345  75.868  1.00 86.87  ? 427  SER B CB    1 
ATOM   6492  O  OG    . SER B  2  429 ? 51.800  59.525  74.641  1.00 87.47  ? 427  SER B OG    1 
ATOM   6493  N  N     . GLY B  2  430 ? 47.864  58.224  75.395  1.00 86.05  ? 428  GLY B N     1 
ATOM   6494  C  CA    . GLY B  2  430 ? 46.660  58.427  74.609  1.00 86.67  ? 428  GLY B CA    1 
ATOM   6495  C  C     . GLY B  2  430 ? 45.501  57.682  75.247  1.00 87.26  ? 428  GLY B C     1 
ATOM   6496  O  O     . GLY B  2  430 ? 45.666  57.102  76.316  1.00 87.77  ? 428  GLY B O     1 
ATOM   6497  N  N     . ASP B  2  431 ? 44.326  57.703  74.629  1.00 87.42  ? 429  ASP B N     1 
ATOM   6498  C  CA    . ASP B  2  431 ? 43.200  56.974  75.188  1.00 88.54  ? 429  ASP B CA    1 
ATOM   6499  C  C     . ASP B  2  431 ? 43.561  55.492  75.066  1.00 89.73  ? 429  ASP B C     1 
ATOM   6500  O  O     . ASP B  2  431 ? 43.070  54.784  74.186  1.00 90.08  ? 429  ASP B O     1 
ATOM   6501  C  CB    . ASP B  2  431 ? 41.930  57.290  74.406  1.00 88.92  ? 429  ASP B CB    1 
ATOM   6502  C  CG    . ASP B  2  431 ? 40.707  56.594  74.971  1.00 90.43  ? 429  ASP B CG    1 
ATOM   6503  O  OD1   . ASP B  2  431 ? 40.639  55.346  74.897  1.00 91.03  ? 429  ASP B OD1   1 
ATOM   6504  O  OD2   . ASP B  2  431 ? 39.810  57.298  75.490  1.00 91.46  ? 429  ASP B OD2   1 
ATOM   6505  N  N     . LEU B  2  432 ? 44.435  55.040  75.963  1.00 90.94  ? 430  LEU B N     1 
ATOM   6506  C  CA    . LEU B  2  432 ? 44.933  53.663  75.978  1.00 92.03  ? 430  LEU B CA    1 
ATOM   6507  C  C     . LEU B  2  432 ? 43.917  52.637  76.461  1.00 92.70  ? 430  LEU B C     1 
ATOM   6508  O  O     . LEU B  2  432 ? 44.255  51.712  77.202  1.00 92.25  ? 430  LEU B O     1 
ATOM   6509  C  CB    . LEU B  2  432 ? 46.177  53.573  76.864  1.00 92.26  ? 430  LEU B CB    1 
ATOM   6510  C  CG    . LEU B  2  432 ? 47.147  54.758  76.892  1.00 92.44  ? 430  LEU B CG    1 
ATOM   6511  C  CD1   . LEU B  2  432 ? 48.343  54.413  77.763  1.00 92.60  ? 430  LEU B CD1   1 
ATOM   6512  C  CD2   . LEU B  2  432 ? 47.604  55.102  75.490  1.00 93.47  ? 430  LEU B CD2   1 
ATOM   6513  N  N     . GLY B  2  433 ? 42.672  52.793  76.038  1.00 93.76  ? 431  GLY B N     1 
ATOM   6514  C  CA    . GLY B  2  433 ? 41.653  51.858  76.464  1.00 95.38  ? 431  GLY B CA    1 
ATOM   6515  C  C     . GLY B  2  433 ? 41.828  50.495  75.834  1.00 96.16  ? 431  GLY B C     1 
ATOM   6516  O  O     . GLY B  2  433 ? 41.503  49.473  76.444  1.00 96.69  ? 431  GLY B O     1 
ATOM   6517  N  N     . SER B  2  434 ? 42.361  50.477  74.616  1.00 96.30  ? 432  SER B N     1 
ATOM   6518  C  CA    . SER B  2  434 ? 42.546  49.228  73.898  1.00 95.68  ? 432  SER B CA    1 
ATOM   6519  C  C     . SER B  2  434 ? 44.005  48.843  73.764  1.00 95.04  ? 432  SER B C     1 
ATOM   6520  O  O     . SER B  2  434 ? 44.323  47.811  73.183  1.00 95.00  ? 432  SER B O     1 
ATOM   6521  C  CB    . SER B  2  434 ? 41.899  49.343  72.521  1.00 96.02  ? 432  SER B CB    1 
ATOM   6522  O  OG    . SER B  2  434 ? 40.577  49.849  72.642  1.00 96.69  ? 432  SER B OG    1 
ATOM   6523  N  N     . THR B  2  435 ? 44.887  49.672  74.311  1.00 94.77  ? 433  THR B N     1 
ATOM   6524  C  CA    . THR B  2  435 ? 46.323  49.417  74.265  1.00 95.02  ? 433  THR B CA    1 
ATOM   6525  C  C     . THR B  2  435 ? 46.717  48.291  75.239  1.00 96.39  ? 433  THR B C     1 
ATOM   6526  O  O     . THR B  2  435 ? 46.066  48.087  76.271  1.00 97.11  ? 433  THR B O     1 
ATOM   6527  C  CB    . THR B  2  435 ? 47.101  50.699  74.614  1.00 93.69  ? 433  THR B CB    1 
ATOM   6528  O  OG1   . THR B  2  435 ? 46.605  51.776  73.813  1.00 92.32  ? 433  THR B OG1   1 
ATOM   6529  C  CG2   . THR B  2  435 ? 48.595  50.521  74.354  1.00 93.21  ? 433  THR B CG2   1 
ATOM   6530  N  N     . PRO B  2  436 ? 47.778  47.529  74.912  1.00 96.95  ? 434  PRO B N     1 
ATOM   6531  C  CA    . PRO B  2  436 ? 48.213  46.436  75.787  1.00 97.16  ? 434  PRO B CA    1 
ATOM   6532  C  C     . PRO B  2  436 ? 49.386  46.744  76.733  1.00 97.73  ? 434  PRO B C     1 
ATOM   6533  O  O     . PRO B  2  436 ? 50.152  47.701  76.527  1.00 97.00  ? 434  PRO B O     1 
ATOM   6534  C  CB    . PRO B  2  436 ? 48.556  45.344  74.791  1.00 96.74  ? 434  PRO B CB    1 
ATOM   6535  C  CG    . PRO B  2  436 ? 49.219  46.133  73.704  1.00 96.47  ? 434  PRO B CG    1 
ATOM   6536  C  CD    . PRO B  2  436 ? 48.309  47.338  73.548  1.00 96.92  ? 434  PRO B CD    1 
ATOM   6537  N  N     . PHE B  2  437 ? 49.507  45.903  77.764  1.00 98.62  ? 435  PHE B N     1 
ATOM   6538  C  CA    . PHE B  2  437 ? 50.560  46.001  78.779  1.00 99.66  ? 435  PHE B CA    1 
ATOM   6539  C  C     . PHE B  2  437 ? 51.773  45.168  78.354  1.00 100.80 ? 435  PHE B C     1 
ATOM   6540  O  O     . PHE B  2  437 ? 51.616  44.120  77.720  1.00 100.22 ? 435  PHE B O     1 
ATOM   6541  C  CB    . PHE B  2  437 ? 50.063  45.466  80.129  1.00 98.24  ? 435  PHE B CB    1 
ATOM   6542  C  CG    . PHE B  2  437 ? 48.946  46.257  80.737  1.00 96.95  ? 435  PHE B CG    1 
ATOM   6543  C  CD1   . PHE B  2  437 ? 47.726  46.373  80.090  1.00 97.16  ? 435  PHE B CD1   1 
ATOM   6544  C  CD2   . PHE B  2  437 ? 49.108  46.870  81.972  1.00 96.65  ? 435  PHE B CD2   1 
ATOM   6545  C  CE1   . PHE B  2  437 ? 46.681  47.088  80.667  1.00 97.68  ? 435  PHE B CE1   1 
ATOM   6546  C  CE2   . PHE B  2  437 ? 48.069  47.588  82.560  1.00 96.96  ? 435  PHE B CE2   1 
ATOM   6547  C  CZ    . PHE B  2  437 ? 46.854  47.699  81.908  1.00 97.23  ? 435  PHE B CZ    1 
ATOM   6548  N  N     . LEU B  2  438 ? 52.972  45.616  78.731  1.00 102.23 ? 436  LEU B N     1 
ATOM   6549  C  CA    . LEU B  2  438 ? 54.197  44.906  78.372  1.00 103.72 ? 436  LEU B CA    1 
ATOM   6550  C  C     . LEU B  2  438 ? 54.079  43.399  78.574  1.00 105.32 ? 436  LEU B C     1 
ATOM   6551  O  O     . LEU B  2  438 ? 54.625  42.625  77.794  1.00 105.59 ? 436  LEU B O     1 
ATOM   6552  C  CB    . LEU B  2  438 ? 55.385  45.421  79.179  1.00 102.45 ? 436  LEU B CB    1 
ATOM   6553  C  CG    . LEU B  2  438 ? 56.724  44.907  78.651  1.00 101.67 ? 436  LEU B CG    1 
ATOM   6554  C  CD1   . LEU B  2  438 ? 57.204  45.830  77.543  1.00 100.87 ? 436  LEU B CD1   1 
ATOM   6555  C  CD2   . LEU B  2  438 ? 57.741  44.848  79.773  1.00 102.20 ? 436  LEU B CD2   1 
ATOM   6556  N  N     . ASP B  2  439 ? 53.375  42.979  79.620  1.00 107.27 ? 437  ASP B N     1 
ATOM   6557  C  CA    . ASP B  2  439 ? 53.211  41.551  79.861  1.00 109.46 ? 437  ASP B CA    1 
ATOM   6558  C  C     . ASP B  2  439 ? 51.971  40.980  79.179  1.00 109.82 ? 437  ASP B C     1 
ATOM   6559  O  O     . ASP B  2  439 ? 51.203  40.221  79.777  1.00 109.40 ? 437  ASP B O     1 
ATOM   6560  C  CB    . ASP B  2  439 ? 53.161  41.235  81.361  1.00 111.75 ? 437  ASP B CB    1 
ATOM   6561  C  CG    . ASP B  2  439 ? 51.947  41.826  82.049  1.00 113.58 ? 437  ASP B CG    1 
ATOM   6562  O  OD1   . ASP B  2  439 ? 51.988  43.035  82.365  1.00 115.23 ? 437  ASP B OD1   1 
ATOM   6563  O  OD2   . ASP B  2  439 ? 50.957  41.082  82.270  1.00 113.64 ? 437  ASP B OD2   1 
ATOM   6564  N  N     . GLU B  2  440 ? 51.782  41.363  77.922  1.00 110.39 ? 438  GLU B N     1 
ATOM   6565  C  CA    . GLU B  2  440 ? 50.674  40.874  77.117  1.00 111.50 ? 438  GLU B CA    1 
ATOM   6566  C  C     . GLU B  2  440 ? 51.241  40.652  75.720  1.00 111.62 ? 438  GLU B C     1 
ATOM   6567  O  O     . GLU B  2  440 ? 50.514  40.408  74.758  1.00 111.52 ? 438  GLU B O     1 
ATOM   6568  C  CB    . GLU B  2  440 ? 49.525  41.890  77.081  1.00 112.63 ? 438  GLU B CB    1 
ATOM   6569  C  CG    . GLU B  2  440 ? 48.791  42.072  78.414  1.00 114.88 ? 438  GLU B CG    1 
ATOM   6570  C  CD    . GLU B  2  440 ? 47.459  42.820  78.278  1.00 116.02 ? 438  GLU B CD    1 
ATOM   6571  O  OE1   . GLU B  2  440 ? 47.456  43.980  77.810  1.00 116.38 ? 438  GLU B OE1   1 
ATOM   6572  O  OE2   . GLU B  2  440 ? 46.408  42.248  78.643  1.00 116.74 ? 438  GLU B OE2   1 
ATOM   6573  N  N     . LEU B  2  441 ? 52.563  40.732  75.634  1.00 111.91 ? 439  LEU B N     1 
ATOM   6574  C  CA    . LEU B  2  441 ? 53.272  40.550  74.378  1.00 112.47 ? 439  LEU B CA    1 
ATOM   6575  C  C     . LEU B  2  441 ? 54.151  39.290  74.423  1.00 113.11 ? 439  LEU B C     1 
ATOM   6576  O  O     . LEU B  2  441 ? 55.400  39.418  74.425  1.00 113.42 ? 439  LEU B O     1 
ATOM   6577  C  CB    . LEU B  2  441 ? 54.131  41.783  74.093  1.00 112.03 ? 439  LEU B CB    1 
ATOM   6578  C  CG    . LEU B  2  441 ? 53.440  43.142  74.219  1.00 111.06 ? 439  LEU B CG    1 
ATOM   6579  C  CD1   . LEU B  2  441 ? 54.384  44.244  73.754  1.00 110.93 ? 439  LEU B CD1   1 
ATOM   6580  C  CD2   . LEU B  2  441 ? 52.174  43.144  73.387  1.00 111.11 ? 439  LEU B CD2   1 
ATOM   6581  O  OXT   . LEU B  2  441 ? 53.575  38.181  74.467  1.00 113.26 ? 439  LEU B OXT   1 
ATOM   6582  N  N     . MET C  3  1   ? 54.927  98.354  80.843  1.00 119.63 ? 1    MET C N     1 
ATOM   6583  C  CA    . MET C  3  1   ? 54.380  99.732  80.634  1.00 119.74 ? 1    MET C CA    1 
ATOM   6584  C  C     . MET C  3  1   ? 53.531  99.808  79.356  1.00 117.79 ? 1    MET C C     1 
ATOM   6585  O  O     . MET C  3  1   ? 53.138  98.773  78.819  1.00 118.07 ? 1    MET C O     1 
ATOM   6586  C  CB    . MET C  3  1   ? 55.534  100.744 80.586  1.00 122.26 ? 1    MET C CB    1 
ATOM   6587  C  CG    . MET C  3  1   ? 56.341  100.818 81.890  1.00 125.13 ? 1    MET C CG    1 
ATOM   6588  S  SD    . MET C  3  1   ? 55.381  101.400 83.348  1.00 128.89 ? 1    MET C SD    1 
ATOM   6589  C  CE    . MET C  3  1   ? 54.838  99.833  84.131  1.00 127.30 ? 1    MET C CE    1 
ATOM   6590  N  N     . ALA C  3  2   ? 53.245  101.018 78.872  1.00 114.98 ? 2    ALA C N     1 
ATOM   6591  C  CA    . ALA C  3  2   ? 52.423  101.175 77.671  1.00 111.93 ? 2    ALA C CA    1 
ATOM   6592  C  C     . ALA C  3  2   ? 53.186  101.707 76.464  1.00 109.81 ? 2    ALA C C     1 
ATOM   6593  O  O     . ALA C  3  2   ? 54.100  102.521 76.603  1.00 109.37 ? 2    ALA C O     1 
ATOM   6594  C  CB    . ALA C  3  2   ? 51.236  102.077 77.966  1.00 112.27 ? 2    ALA C CB    1 
ATOM   6595  N  N     . PRO C  3  3   ? 52.799  101.256 75.255  1.00 107.88 ? 3    PRO C N     1 
ATOM   6596  C  CA    . PRO C  3  3   ? 53.393  101.629 73.965  1.00 106.05 ? 3    PRO C CA    1 
ATOM   6597  C  C     . PRO C  3  3   ? 52.999  103.002 73.405  1.00 104.28 ? 3    PRO C C     1 
ATOM   6598  O  O     . PRO C  3  3   ? 53.842  103.894 73.300  1.00 103.52 ? 3    PRO C O     1 
ATOM   6599  C  CB    . PRO C  3  3   ? 52.955  100.489 73.055  1.00 106.28 ? 3    PRO C CB    1 
ATOM   6600  C  CG    . PRO C  3  3   ? 51.588  100.173 73.579  1.00 106.69 ? 3    PRO C CG    1 
ATOM   6601  C  CD    . PRO C  3  3   ? 51.789  100.194 75.076  1.00 107.21 ? 3    PRO C CD    1 
ATOM   6602  N  N     . ASN C  3  4   ? 51.731  103.164 73.027  1.00 102.54 ? 4    ASN C N     1 
ATOM   6603  C  CA    . ASN C  3  4   ? 51.261  104.435 72.479  1.00 101.12 ? 4    ASN C CA    1 
ATOM   6604  C  C     . ASN C  3  4   ? 50.717  105.350 73.554  1.00 100.34 ? 4    ASN C C     1 
ATOM   6605  O  O     . ASN C  3  4   ? 49.818  104.995 74.317  1.00 100.26 ? 4    ASN C O     1 
ATOM   6606  C  CB    . ASN C  3  4   ? 50.183  104.233 71.406  1.00 100.84 ? 4    ASN C CB    1 
ATOM   6607  C  CG    . ASN C  3  4   ? 49.034  103.378 71.881  1.00 100.89 ? 4    ASN C CG    1 
ATOM   6608  O  OD1   . ASN C  3  4   ? 48.629  103.460 73.038  1.00 100.99 ? 4    ASN C OD1   1 
ATOM   6609  N  ND2   . ASN C  3  4   ? 48.487  102.557 70.983  1.00 101.00 ? 4    ASN C ND2   1 
ATOM   6610  N  N     . ILE C  3  5   ? 51.274  106.548 73.594  1.00 99.31  ? 5    ILE C N     1 
ATOM   6611  C  CA    . ILE C  3  5   ? 50.888  107.546 74.568  1.00 97.60  ? 5    ILE C CA    1 
ATOM   6612  C  C     . ILE C  3  5   ? 49.374  107.631 74.736  1.00 95.43  ? 5    ILE C C     1 
ATOM   6613  O  O     . ILE C  3  5   ? 48.866  107.562 75.846  1.00 94.99  ? 5    ILE C O     1 
ATOM   6614  C  CB    . ILE C  3  5   ? 51.472  108.921 74.161  1.00 98.48  ? 5    ILE C CB    1 
ATOM   6615  C  CG1   . ILE C  3  5   ? 53.011  108.854 74.169  1.00 99.66  ? 5    ILE C CG1   1 
ATOM   6616  C  CG2   . ILE C  3  5   ? 50.970  110.004 75.091  1.00 99.28  ? 5    ILE C CG2   1 
ATOM   6617  C  CD1   . ILE C  3  5   ? 53.651  108.465 75.521  1.00 99.65  ? 5    ILE C CD1   1 
ATOM   6618  N  N     . ARG C  3  6   ? 48.658  107.749 73.627  1.00 93.46  ? 6    ARG C N     1 
ATOM   6619  C  CA    . ARG C  3  6   ? 47.200  107.867 73.639  1.00 91.70  ? 6    ARG C CA    1 
ATOM   6620  C  C     . ARG C  3  6   ? 46.461  107.051 74.712  1.00 89.63  ? 6    ARG C C     1 
ATOM   6621  O  O     . ARG C  3  6   ? 45.380  107.443 75.149  1.00 89.35  ? 6    ARG C O     1 
ATOM   6622  C  CB    . ARG C  3  6   ? 46.655  107.503 72.250  1.00 92.78  ? 6    ARG C CB    1 
ATOM   6623  C  CG    . ARG C  3  6   ? 45.161  107.728 72.033  1.00 93.61  ? 6    ARG C CG    1 
ATOM   6624  C  CD    . ARG C  3  6   ? 44.565  106.627 71.148  1.00 95.44  ? 6    ARG C CD    1 
ATOM   6625  N  NE    . ARG C  3  6   ? 45.272  106.457 69.878  1.00 98.11  ? 6    ARG C NE    1 
ATOM   6626  C  CZ    . ARG C  3  6   ? 45.246  105.345 69.139  1.00 99.51  ? 6    ARG C CZ    1 
ATOM   6627  N  NH1   . ARG C  3  6   ? 44.545  104.278 69.531  1.00 99.35  ? 6    ARG C NH1   1 
ATOM   6628  N  NH2   . ARG C  3  6   ? 45.932  105.296 68.000  1.00 99.50  ? 6    ARG C NH2   1 
ATOM   6629  N  N     . LYS C  3  7   ? 47.032  105.931 75.145  1.00 87.06  ? 7    LYS C N     1 
ATOM   6630  C  CA    . LYS C  3  7   ? 46.362  105.093 76.136  1.00 85.75  ? 7    LYS C CA    1 
ATOM   6631  C  C     . LYS C  3  7   ? 46.850  105.229 77.572  1.00 84.98  ? 7    LYS C C     1 
ATOM   6632  O  O     . LYS C  3  7   ? 46.086  104.997 78.510  1.00 84.80  ? 7    LYS C O     1 
ATOM   6633  C  CB    . LYS C  3  7   ? 46.459  103.621 75.731  1.00 86.28  ? 7    LYS C CB    1 
ATOM   6634  C  CG    . LYS C  3  7   ? 45.585  103.204 74.541  1.00 87.74  ? 7    LYS C CG    1 
ATOM   6635  C  CD    . LYS C  3  7   ? 45.901  101.765 74.064  1.00 87.29  ? 7    LYS C CD    1 
ATOM   6636  C  CE    . LYS C  3  7   ? 45.201  101.414 72.744  1.00 86.98  ? 7    LYS C CE    1 
ATOM   6637  N  NZ    . LYS C  3  7   ? 45.874  100.303 72.011  1.00 85.52  ? 7    LYS C NZ    1 
ATOM   6638  N  N     . SER C  3  8   ? 48.121  105.588 77.743  1.00 84.38  ? 8    SER C N     1 
ATOM   6639  C  CA    . SER C  3  8   ? 48.716  105.742 79.078  1.00 82.96  ? 8    SER C CA    1 
ATOM   6640  C  C     . SER C  3  8   ? 48.463  107.113 79.733  1.00 81.98  ? 8    SER C C     1 
ATOM   6641  O  O     . SER C  3  8   ? 47.899  107.176 80.826  1.00 81.48  ? 8    SER C O     1 
ATOM   6642  C  CB    . SER C  3  8   ? 50.232  105.470 79.025  1.00 82.93  ? 8    SER C CB    1 
ATOM   6643  O  OG    . SER C  3  8   ? 50.933  106.437 78.254  1.00 82.35  ? 8    SER C OG    1 
ATOM   6644  N  N     . HIS C  3  9   ? 48.874  108.196 79.065  1.00 80.51  ? 9    HIS C N     1 
ATOM   6645  C  CA    . HIS C  3  9   ? 48.704  109.559 79.584  1.00 78.11  ? 9    HIS C CA    1 
ATOM   6646  C  C     . HIS C  3  9   ? 47.439  109.716 80.398  1.00 76.13  ? 9    HIS C C     1 
ATOM   6647  O  O     . HIS C  3  9   ? 46.367  109.319 79.974  1.00 76.63  ? 9    HIS C O     1 
ATOM   6648  C  CB    . HIS C  3  9   ? 48.673  110.589 78.456  1.00 78.29  ? 9    HIS C CB    1 
ATOM   6649  C  CG    . HIS C  3  9   ? 49.130  111.946 78.887  1.00 79.17  ? 9    HIS C CG    1 
ATOM   6650  N  ND1   . HIS C  3  9   ? 48.665  112.551 80.033  1.00 78.59  ? 9    HIS C ND1   1 
ATOM   6651  C  CD2   . HIS C  3  9   ? 50.057  112.786 78.366  1.00 79.91  ? 9    HIS C CD2   1 
ATOM   6652  C  CE1   . HIS C  3  9   ? 49.293  113.702 80.204  1.00 79.47  ? 9    HIS C CE1   1 
ATOM   6653  N  NE2   . HIS C  3  9   ? 50.143  113.868 79.206  1.00 79.52  ? 9    HIS C NE2   1 
ATOM   6654  N  N     . PRO C  3  10  ? 47.549  110.308 81.582  1.00 74.67  ? 10   PRO C N     1 
ATOM   6655  C  CA    . PRO C  3  10  ? 46.379  110.495 82.434  1.00 73.76  ? 10   PRO C CA    1 
ATOM   6656  C  C     . PRO C  3  10  ? 45.292  111.305 81.756  1.00 72.41  ? 10   PRO C C     1 
ATOM   6657  O  O     . PRO C  3  10  ? 44.104  111.070 81.983  1.00 73.33  ? 10   PRO C O     1 
ATOM   6658  C  CB    . PRO C  3  10  ? 46.953  111.207 83.653  1.00 74.91  ? 10   PRO C CB    1 
ATOM   6659  C  CG    . PRO C  3  10  ? 48.354  110.668 83.721  1.00 75.64  ? 10   PRO C CG    1 
ATOM   6660  C  CD    . PRO C  3  10  ? 48.773  110.737 82.272  1.00 75.13  ? 10   PRO C CD    1 
ATOM   6661  N  N     . LEU C  3  11  ? 45.688  112.261 80.923  1.00 69.70  ? 11   LEU C N     1 
ATOM   6662  C  CA    . LEU C  3  11  ? 44.700  113.076 80.249  1.00 67.04  ? 11   LEU C CA    1 
ATOM   6663  C  C     . LEU C  3  11  ? 44.272  112.484 78.914  1.00 66.60  ? 11   LEU C C     1 
ATOM   6664  O  O     . LEU C  3  11  ? 43.084  112.286 78.698  1.00 67.44  ? 11   LEU C O     1 
ATOM   6665  C  CB    . LEU C  3  11  ? 45.214  114.500 80.071  1.00 65.63  ? 11   LEU C CB    1 
ATOM   6666  C  CG    . LEU C  3  11  ? 45.481  115.277 81.363  1.00 64.47  ? 11   LEU C CG    1 
ATOM   6667  C  CD1   . LEU C  3  11  ? 45.967  116.669 81.003  1.00 65.08  ? 11   LEU C CD1   1 
ATOM   6668  C  CD2   . LEU C  3  11  ? 44.236  115.357 82.211  1.00 63.59  ? 11   LEU C CD2   1 
ATOM   6669  N  N     . LEU C  3  12  ? 45.212  112.171 78.025  1.00 65.64  ? 12   LEU C N     1 
ATOM   6670  C  CA    . LEU C  3  12  ? 44.829  111.605 76.731  1.00 65.50  ? 12   LEU C CA    1 
ATOM   6671  C  C     . LEU C  3  12  ? 43.956  110.385 76.924  1.00 66.60  ? 12   LEU C C     1 
ATOM   6672  O  O     . LEU C  3  12  ? 42.962  110.200 76.228  1.00 66.28  ? 12   LEU C O     1 
ATOM   6673  C  CB    . LEU C  3  12  ? 46.049  111.200 75.926  1.00 63.58  ? 12   LEU C CB    1 
ATOM   6674  C  CG    . LEU C  3  12  ? 47.099  112.282 75.794  1.00 63.36  ? 12   LEU C CG    1 
ATOM   6675  C  CD1   . LEU C  3  12  ? 47.966  111.926 74.640  1.00 63.93  ? 12   LEU C CD1   1 
ATOM   6676  C  CD2   . LEU C  3  12  ? 46.470  113.628 75.549  1.00 64.20  ? 12   LEU C CD2   1 
ATOM   6677  N  N     . LYS C  3  13  ? 44.349  109.547 77.872  1.00 68.47  ? 13   LYS C N     1 
ATOM   6678  C  CA    . LYS C  3  13  ? 43.605  108.344 78.185  1.00 70.93  ? 13   LYS C CA    1 
ATOM   6679  C  C     . LYS C  3  13  ? 42.127  108.700 78.220  1.00 72.45  ? 13   LYS C C     1 
ATOM   6680  O  O     . LYS C  3  13  ? 41.284  107.898 77.838  1.00 74.10  ? 13   LYS C O     1 
ATOM   6681  C  CB    . LYS C  3  13  ? 44.045  107.799 79.543  1.00 72.10  ? 13   LYS C CB    1 
ATOM   6682  C  CG    . LYS C  3  13  ? 43.232  106.626 80.057  1.00 75.51  ? 13   LYS C CG    1 
ATOM   6683  C  CD    . LYS C  3  13  ? 43.537  106.310 81.533  1.00 78.16  ? 13   LYS C CD    1 
ATOM   6684  C  CE    . LYS C  3  13  ? 44.916  105.671 81.710  1.00 80.59  ? 13   LYS C CE    1 
ATOM   6685  N  NZ    . LYS C  3  13  ? 45.228  105.301 83.131  1.00 81.11  ? 13   LYS C NZ    1 
ATOM   6686  N  N     . MET C  3  14  ? 41.811  109.907 78.677  1.00 73.37  ? 14   MET C N     1 
ATOM   6687  C  CA    . MET C  3  14  ? 40.420  110.345 78.737  1.00 74.09  ? 14   MET C CA    1 
ATOM   6688  C  C     . MET C  3  14  ? 39.911  110.741 77.347  1.00 72.63  ? 14   MET C C     1 
ATOM   6689  O  O     . MET C  3  14  ? 38.944  110.165 76.844  1.00 72.95  ? 14   MET C O     1 
ATOM   6690  C  CB    . MET C  3  14  ? 40.276  111.509 79.717  1.00 76.75  ? 14   MET C CB    1 
ATOM   6691  C  CG    . MET C  3  14  ? 40.463  111.093 81.175  1.00 81.78  ? 14   MET C CG    1 
ATOM   6692  S  SD    . MET C  3  14  ? 40.239  112.445 82.393  1.00 88.05  ? 14   MET C SD    1 
ATOM   6693  C  CE    . MET C  3  14  ? 38.360  112.591 82.495  1.00 87.34  ? 14   MET C CE    1 
ATOM   6694  N  N     . ILE C  3  15  ? 40.558  111.719 76.725  1.00 70.29  ? 15   ILE C N     1 
ATOM   6695  C  CA    . ILE C  3  15  ? 40.159  112.138 75.393  1.00 67.89  ? 15   ILE C CA    1 
ATOM   6696  C  C     . ILE C  3  15  ? 39.940  110.866 74.586  1.00 67.62  ? 15   ILE C C     1 
ATOM   6697  O  O     . ILE C  3  15  ? 38.985  110.753 73.826  1.00 68.67  ? 15   ILE C O     1 
ATOM   6698  C  CB    . ILE C  3  15  ? 41.261  112.975 74.726  1.00 66.35  ? 15   ILE C CB    1 
ATOM   6699  C  CG1   . ILE C  3  15  ? 41.228  114.402 75.251  1.00 66.63  ? 15   ILE C CG1   1 
ATOM   6700  C  CG2   . ILE C  3  15  ? 41.052  113.022 73.239  1.00 65.40  ? 15   ILE C CG2   1 
ATOM   6701  C  CD1   . ILE C  3  15  ? 41.231  114.529 76.757  1.00 69.17  ? 15   ILE C CD1   1 
ATOM   6702  N  N     . ASN C  3  16  ? 40.819  109.895 74.786  1.00 65.87  ? 16   ASN C N     1 
ATOM   6703  C  CA    . ASN C  3  16  ? 40.735  108.632 74.074  1.00 64.90  ? 16   ASN C CA    1 
ATOM   6704  C  C     . ASN C  3  16  ? 39.471  107.849 74.392  1.00 63.28  ? 16   ASN C C     1 
ATOM   6705  O  O     . ASN C  3  16  ? 38.609  107.693 73.543  1.00 63.30  ? 16   ASN C O     1 
ATOM   6706  C  CB    . ASN C  3  16  ? 41.956  107.768 74.399  1.00 66.63  ? 16   ASN C CB    1 
ATOM   6707  C  CG    . ASN C  3  16  ? 42.009  106.478 73.579  1.00 67.30  ? 16   ASN C CG    1 
ATOM   6708  O  OD1   . ASN C  3  16  ? 42.123  106.505 72.347  1.00 67.98  ? 16   ASN C OD1   1 
ATOM   6709  N  ND2   . ASN C  3  16  ? 41.933  105.339 74.266  1.00 66.17  ? 16   ASN C ND2   1 
ATOM   6710  N  N     . ASN C  3  17  ? 39.359  107.354 75.617  1.00 61.65  ? 17   ASN C N     1 
ATOM   6711  C  CA    . ASN C  3  17  ? 38.199  106.548 76.014  1.00 61.42  ? 17   ASN C CA    1 
ATOM   6712  C  C     . ASN C  3  17  ? 36.814  107.163 75.831  1.00 59.53  ? 17   ASN C C     1 
ATOM   6713  O  O     . ASN C  3  17  ? 35.819  106.554 76.250  1.00 58.67  ? 17   ASN C O     1 
ATOM   6714  C  CB    . ASN C  3  17  ? 38.310  106.116 77.482  1.00 63.92  ? 17   ASN C CB    1 
ATOM   6715  C  CG    . ASN C  3  17  ? 39.430  105.129 77.726  1.00 66.85  ? 17   ASN C CG    1 
ATOM   6716  O  OD1   . ASN C  3  17  ? 39.822  104.363 76.832  1.00 70.47  ? 17   ASN C OD1   1 
ATOM   6717  N  ND2   . ASN C  3  17  ? 39.941  105.122 78.952  1.00 66.32  ? 17   ASN C ND2   1 
ATOM   6718  N  N     . SER C  3  18  ? 36.736  108.343 75.211  1.00 56.75  ? 18   SER C N     1 
ATOM   6719  C  CA    . SER C  3  18  ? 35.449  109.018 75.033  1.00 53.36  ? 18   SER C CA    1 
ATOM   6720  C  C     . SER C  3  18  ? 35.236  109.754 73.714  1.00 51.43  ? 18   SER C C     1 
ATOM   6721  O  O     . SER C  3  18  ? 34.160  110.306 73.487  1.00 49.63  ? 18   SER C O     1 
ATOM   6722  C  CB    . SER C  3  18  ? 35.249  110.009 76.164  1.00 53.36  ? 18   SER C CB    1 
ATOM   6723  O  OG    . SER C  3  18  ? 36.283  110.974 76.130  1.00 52.65  ? 18   SER C OG    1 
ATOM   6724  N  N     . LEU C  3  19  ? 36.263  109.775 72.866  1.00 50.22  ? 19   LEU C N     1 
ATOM   6725  C  CA    . LEU C  3  19  ? 36.204  110.432 71.554  1.00 49.14  ? 19   LEU C CA    1 
ATOM   6726  C  C     . LEU C  3  19  ? 36.856  109.643 70.413  1.00 48.27  ? 19   LEU C C     1 
ATOM   6727  O  O     . LEU C  3  19  ? 36.611  109.917 69.243  1.00 47.53  ? 19   LEU C O     1 
ATOM   6728  C  CB    . LEU C  3  19  ? 36.872  111.802 71.608  1.00 49.30  ? 19   LEU C CB    1 
ATOM   6729  C  CG    . LEU C  3  19  ? 36.081  112.893 72.307  1.00 51.32  ? 19   LEU C CG    1 
ATOM   6730  C  CD1   . LEU C  3  19  ? 36.756  114.235 72.133  1.00 51.72  ? 19   LEU C CD1   1 
ATOM   6731  C  CD2   . LEU C  3  19  ? 34.701  112.943 71.705  1.00 53.58  ? 19   LEU C CD2   1 
ATOM   6732  N  N     . ILE C  3  20  ? 37.684  108.663 70.753  1.00 47.14  ? 20   ILE C N     1 
ATOM   6733  C  CA    . ILE C  3  20  ? 38.385  107.885 69.749  1.00 43.88  ? 20   ILE C CA    1 
ATOM   6734  C  C     . ILE C  3  20  ? 38.181  106.377 69.774  1.00 43.09  ? 20   ILE C C     1 
ATOM   6735  O  O     . ILE C  3  20  ? 37.710  105.826 68.797  1.00 43.56  ? 20   ILE C O     1 
ATOM   6736  C  CB    . ILE C  3  20  ? 39.856  108.151 69.843  1.00 42.85  ? 20   ILE C CB    1 
ATOM   6737  C  CG1   . ILE C  3  20  ? 40.113  109.613 69.529  1.00 42.66  ? 20   ILE C CG1   1 
ATOM   6738  C  CG2   . ILE C  3  20  ? 40.586  107.217 68.937  1.00 42.35  ? 20   ILE C CG2   1 
ATOM   6739  C  CD1   . ILE C  3  20  ? 41.539  109.965 69.574  1.00 46.28  ? 20   ILE C CD1   1 
ATOM   6740  N  N     . ASP C  3  21  ? 38.554  105.712 70.869  1.00 41.27  ? 21   ASP C N     1 
ATOM   6741  C  CA    . ASP C  3  21  ? 38.414  104.258 70.991  1.00 39.03  ? 21   ASP C CA    1 
ATOM   6742  C  C     . ASP C  3  21  ? 37.114  103.865 71.635  1.00 38.12  ? 21   ASP C C     1 
ATOM   6743  O  O     . ASP C  3  21  ? 36.913  102.714 72.016  1.00 37.39  ? 21   ASP C O     1 
ATOM   6744  C  CB    . ASP C  3  21  ? 39.545  103.674 71.823  1.00 39.20  ? 21   ASP C CB    1 
ATOM   6745  C  CG    . ASP C  3  21  ? 40.870  103.711 71.105  1.00 40.15  ? 21   ASP C CG    1 
ATOM   6746  O  OD1   . ASP C  3  21  ? 40.978  104.379 70.047  1.00 38.70  ? 21   ASP C OD1   1 
ATOM   6747  O  OD2   . ASP C  3  21  ? 41.808  103.066 71.612  1.00 41.06  ? 21   ASP C OD2   1 
ATOM   6748  N  N     . LEU C  3  22  ? 36.228  104.831 71.772  1.00 37.69  ? 22   LEU C N     1 
ATOM   6749  C  CA    . LEU C  3  22  ? 34.946  104.559 72.381  1.00 38.38  ? 22   LEU C CA    1 
ATOM   6750  C  C     . LEU C  3  22  ? 34.077  103.679 71.500  1.00 37.19  ? 22   LEU C C     1 
ATOM   6751  O  O     . LEU C  3  22  ? 33.916  103.949 70.315  1.00 39.20  ? 22   LEU C O     1 
ATOM   6752  C  CB    . LEU C  3  22  ? 34.201  105.872 72.670  1.00 40.68  ? 22   LEU C CB    1 
ATOM   6753  C  CG    . LEU C  3  22  ? 32.703  105.707 72.983  1.00 41.66  ? 22   LEU C CG    1 
ATOM   6754  C  CD1   . LEU C  3  22  ? 32.571  104.682 74.080  1.00 43.97  ? 22   LEU C CD1   1 
ATOM   6755  C  CD2   . LEU C  3  22  ? 32.045  107.025 73.397  1.00 41.62  ? 22   LEU C CD2   1 
ATOM   6756  N  N     . PRO C  3  23  ? 33.536  102.599 72.064  1.00 34.97  ? 23   PRO C N     1 
ATOM   6757  C  CA    . PRO C  3  23  ? 32.654  101.619 71.423  1.00 35.39  ? 23   PRO C CA    1 
ATOM   6758  C  C     . PRO C  3  23  ? 31.229  102.125 71.187  1.00 35.94  ? 23   PRO C C     1 
ATOM   6759  O  O     . PRO C  3  23  ? 30.469  102.397 72.118  1.00 35.43  ? 23   PRO C O     1 
ATOM   6760  C  CB    . PRO C  3  23  ? 32.701  100.463 72.381  1.00 34.66  ? 23   PRO C CB    1 
ATOM   6761  C  CG    . PRO C  3  23  ? 34.135  100.505 72.750  1.00 35.56  ? 23   PRO C CG    1 
ATOM   6762  C  CD    . PRO C  3  23  ? 34.327  101.939 73.103  1.00 33.80  ? 23   PRO C CD    1 
ATOM   6763  N  N     . ALA C  3  24  ? 30.883  102.226 69.910  1.00 36.76  ? 24   ALA C N     1 
ATOM   6764  C  CA    . ALA C  3  24  ? 29.594  102.720 69.463  1.00 36.96  ? 24   ALA C CA    1 
ATOM   6765  C  C     . ALA C  3  24  ? 28.834  101.684 68.667  1.00 37.09  ? 24   ALA C C     1 
ATOM   6766  O  O     . ALA C  3  24  ? 29.436  100.889 67.930  1.00 39.36  ? 24   ALA C O     1 
ATOM   6767  C  CB    . ALA C  3  24  ? 29.805  103.941 68.584  1.00 36.44  ? 24   ALA C CB    1 
ATOM   6768  N  N     . PRO C  3  25  ? 27.501  101.669 68.804  1.00 35.30  ? 25   PRO C N     1 
ATOM   6769  C  CA    . PRO C  3  25  ? 26.688  100.715 68.056  1.00 34.36  ? 25   PRO C CA    1 
ATOM   6770  C  C     . PRO C  3  25  ? 26.877  101.096 66.584  1.00 33.81  ? 25   PRO C C     1 
ATOM   6771  O  O     . PRO C  3  25  ? 27.060  102.270 66.271  1.00 33.81  ? 25   PRO C O     1 
ATOM   6772  C  CB    . PRO C  3  25  ? 25.290  101.011 68.556  1.00 34.30  ? 25   PRO C CB    1 
ATOM   6773  C  CG    . PRO C  3  25  ? 25.531  101.423 69.947  1.00 33.90  ? 25   PRO C CG    1 
ATOM   6774  C  CD    . PRO C  3  25  ? 26.689  102.353 69.816  1.00 33.71  ? 25   PRO C CD    1 
ATOM   6775  N  N     . SER C  3  26  ? 26.849  100.115 65.692  1.00 32.26  ? 26   SER C N     1 
ATOM   6776  C  CA    . SER C  3  26  ? 27.069  100.373 64.283  1.00 31.80  ? 26   SER C CA    1 
ATOM   6777  C  C     . SER C  3  26  ? 25.887  101.055 63.652  1.00 32.65  ? 26   SER C C     1 
ATOM   6778  O  O     . SER C  3  26  ? 26.018  101.845 62.716  1.00 31.72  ? 26   SER C O     1 
ATOM   6779  C  CB    . SER C  3  26  ? 27.301  99.054  63.587  1.00 30.88  ? 26   SER C CB    1 
ATOM   6780  O  OG    . SER C  3  26  ? 26.269  98.171  63.967  1.00 32.01  ? 26   SER C OG    1 
ATOM   6781  N  N     . ASN C  3  27  ? 24.726  100.762 64.206  1.00 34.56  ? 27   ASN C N     1 
ATOM   6782  C  CA    . ASN C  3  27  ? 23.475  101.271 63.674  1.00 37.45  ? 27   ASN C CA    1 
ATOM   6783  C  C     . ASN C  3  27  ? 22.799  102.510 64.270  1.00 37.56  ? 27   ASN C C     1 
ATOM   6784  O  O     . ASN C  3  27  ? 21.630  102.764 63.955  1.00 38.46  ? 27   ASN C O     1 
ATOM   6785  C  CB    . ASN C  3  27  ? 22.454  100.135 63.677  1.00 39.83  ? 27   ASN C CB    1 
ATOM   6786  C  CG    . ASN C  3  27  ? 22.301  99.525  65.040  1.00 43.04  ? 27   ASN C CG    1 
ATOM   6787  O  OD1   . ASN C  3  27  ? 23.201  98.828  65.523  1.00 45.49  ? 27   ASN C OD1   1 
ATOM   6788  N  ND2   . ASN C  3  27  ? 21.172  99.805  65.692  1.00 43.51  ? 27   ASN C ND2   1 
ATOM   6789  N  N     . ILE C  3  28  ? 23.463  103.291 65.114  1.00 36.09  ? 28   ILE C N     1 
ATOM   6790  C  CA    . ILE C  3  28  ? 22.745  104.453 65.630  1.00 34.45  ? 28   ILE C CA    1 
ATOM   6791  C  C     . ILE C  3  28  ? 22.493  105.499 64.533  1.00 34.78  ? 28   ILE C C     1 
ATOM   6792  O  O     . ILE C  3  28  ? 23.415  105.921 63.808  1.00 34.83  ? 28   ILE C O     1 
ATOM   6793  C  CB    . ILE C  3  28  ? 23.458  105.098 66.824  1.00 32.77  ? 28   ILE C CB    1 
ATOM   6794  C  CG1   . ILE C  3  28  ? 24.957  105.067 66.587  1.00 32.83  ? 28   ILE C CG1   1 
ATOM   6795  C  CG2   . ILE C  3  28  ? 23.039  104.411 68.114  1.00 30.31  ? 28   ILE C CG2   1 
ATOM   6796  C  CD1   . ILE C  3  28  ? 25.749  105.730 67.661  1.00 34.07  ? 28   ILE C CD1   1 
ATOM   6797  N  N     . SER C  3  29  ? 21.219  105.897 64.443  1.00 33.20  ? 29   SER C N     1 
ATOM   6798  C  CA    . SER C  3  29  ? 20.704  106.862 63.482  1.00 31.81  ? 29   SER C CA    1 
ATOM   6799  C  C     . SER C  3  29  ? 20.850  108.353 63.823  1.00 31.46  ? 29   SER C C     1 
ATOM   6800  O  O     . SER C  3  29  ? 21.265  108.738 64.915  1.00 29.57  ? 29   SER C O     1 
ATOM   6801  C  CB    . SER C  3  29  ? 19.224  106.546 63.210  1.00 32.70  ? 29   SER C CB    1 
ATOM   6802  O  OG    . SER C  3  29  ? 18.384  106.734 64.341  1.00 31.13  ? 29   SER C OG    1 
ATOM   6803  N  N     . ALA C  3  30  ? 20.496  109.188 62.857  1.00 31.65  ? 30   ALA C N     1 
ATOM   6804  C  CA    . ALA C  3  30  ? 20.580  110.624 63.025  1.00 32.69  ? 30   ALA C CA    1 
ATOM   6805  C  C     . ALA C  3  30  ? 20.167  111.029 64.425  1.00 34.29  ? 30   ALA C C     1 
ATOM   6806  O  O     . ALA C  3  30  ? 20.864  111.794 65.093  1.00 35.78  ? 30   ALA C O     1 
ATOM   6807  C  CB    . ALA C  3  30  ? 19.699  111.306 62.015  1.00 30.41  ? 30   ALA C CB    1 
ATOM   6808  N  N     . TRP C  3  31  ? 19.044  110.498 64.885  1.00 35.41  ? 31   TRP C N     1 
ATOM   6809  C  CA    . TRP C  3  31  ? 18.546  110.861 66.199  1.00 37.12  ? 31   TRP C CA    1 
ATOM   6810  C  C     . TRP C  3  31  ? 19.569  110.619 67.302  1.00 38.20  ? 31   TRP C C     1 
ATOM   6811  O  O     . TRP C  3  31  ? 19.236  110.648 68.487  1.00 40.49  ? 31   TRP C O     1 
ATOM   6812  C  CB    . TRP C  3  31  ? 17.236  110.118 66.502  1.00 37.66  ? 31   TRP C CB    1 
ATOM   6813  C  CG    . TRP C  3  31  ? 16.222  110.328 65.453  1.00 38.21  ? 31   TRP C CG    1 
ATOM   6814  C  CD1   . TRP C  3  31  ? 16.021  109.561 64.357  1.00 39.60  ? 31   TRP C CD1   1 
ATOM   6815  C  CD2   . TRP C  3  31  ? 15.329  111.432 65.342  1.00 38.78  ? 31   TRP C CD2   1 
ATOM   6816  N  NE1   . TRP C  3  31  ? 15.057  110.121 63.555  1.00 40.64  ? 31   TRP C NE1   1 
ATOM   6817  C  CE2   . TRP C  3  31  ? 14.614  111.274 64.141  1.00 39.94  ? 31   TRP C CE2   1 
ATOM   6818  C  CE3   . TRP C  3  31  ? 15.062  112.542 66.140  1.00 40.30  ? 31   TRP C CE3   1 
ATOM   6819  C  CZ2   . TRP C  3  31  ? 13.644  112.185 63.717  1.00 41.35  ? 31   TRP C CZ2   1 
ATOM   6820  C  CZ3   . TRP C  3  31  ? 14.091  113.454 65.719  1.00 42.37  ? 31   TRP C CZ3   1 
ATOM   6821  C  CH2   . TRP C  3  31  ? 13.395  113.265 64.519  1.00 41.98  ? 31   TRP C CH2   1 
ATOM   6822  N  N     . TRP C  3  32  ? 20.820  110.394 66.930  1.00 37.25  ? 32   TRP C N     1 
ATOM   6823  C  CA    . TRP C  3  32  ? 21.829  110.159 67.944  1.00 37.43  ? 32   TRP C CA    1 
ATOM   6824  C  C     . TRP C  3  32  ? 22.888  111.262 67.967  1.00 37.19  ? 32   TRP C C     1 
ATOM   6825  O  O     . TRP C  3  32  ? 23.833  111.253 68.765  1.00 37.27  ? 32   TRP C O     1 
ATOM   6826  C  CB    . TRP C  3  32  ? 22.448  108.774 67.738  1.00 36.41  ? 32   TRP C CB    1 
ATOM   6827  C  CG    . TRP C  3  32  ? 22.050  107.798 68.793  1.00 34.20  ? 32   TRP C CG    1 
ATOM   6828  C  CD1   . TRP C  3  32  ? 22.687  107.564 69.967  1.00 34.66  ? 32   TRP C CD1   1 
ATOM   6829  C  CD2   . TRP C  3  32  ? 20.896  106.973 68.793  1.00 32.80  ? 32   TRP C CD2   1 
ATOM   6830  N  NE1   . TRP C  3  32  ? 22.000  106.643 70.701  1.00 35.22  ? 32   TRP C NE1   1 
ATOM   6831  C  CE2   . TRP C  3  32  ? 20.893  106.263 69.999  1.00 33.51  ? 32   TRP C CE2   1 
ATOM   6832  C  CE3   . TRP C  3  32  ? 19.864  106.766 67.888  1.00 32.76  ? 32   TRP C CE3   1 
ATOM   6833  C  CZ2   . TRP C  3  32  ? 19.903  105.365 70.324  1.00 33.92  ? 32   TRP C CZ2   1 
ATOM   6834  C  CZ3   . TRP C  3  32  ? 18.883  105.878 68.207  1.00 33.29  ? 32   TRP C CZ3   1 
ATOM   6835  C  CH2   . TRP C  3  32  ? 18.905  105.185 69.414  1.00 35.00  ? 32   TRP C CH2   1 
ATOM   6836  N  N     . ASN C  3  33  ? 22.731  112.233 67.091  1.00 36.36  ? 33   ASN C N     1 
ATOM   6837  C  CA    . ASN C  3  33  ? 23.688  113.308 67.092  1.00 37.20  ? 33   ASN C CA    1 
ATOM   6838  C  C     . ASN C  3  33  ? 23.214  114.359 68.097  1.00 38.94  ? 33   ASN C C     1 
ATOM   6839  O  O     . ASN C  3  33  ? 24.025  115.097 68.673  1.00 40.06  ? 33   ASN C O     1 
ATOM   6840  C  CB    . ASN C  3  33  ? 23.788  113.948 65.706  1.00 35.66  ? 33   ASN C CB    1 
ATOM   6841  C  CG    . ASN C  3  33  ? 24.052  112.947 64.612  1.00 35.13  ? 33   ASN C CG    1 
ATOM   6842  O  OD1   . ASN C  3  33  ? 23.198  112.137 64.263  1.00 34.02  ? 33   ASN C OD1   1 
ATOM   6843  N  ND2   . ASN C  3  33  ? 25.249  112.999 64.058  1.00 36.94  ? 33   ASN C ND2   1 
ATOM   6844  N  N     . PHE C  3  34  ? 21.905  114.407 68.338  1.00 38.74  ? 34   PHE C N     1 
ATOM   6845  C  CA    . PHE C  3  34  ? 21.377  115.439 69.215  1.00 37.64  ? 34   PHE C CA    1 
ATOM   6846  C  C     . PHE C  3  34  ? 22.072  115.609 70.526  1.00 36.80  ? 34   PHE C C     1 
ATOM   6847  O  O     . PHE C  3  34  ? 22.076  116.707 71.094  1.00 36.69  ? 34   PHE C O     1 
ATOM   6848  C  CB    . PHE C  3  34  ? 19.872  115.286 69.349  1.00 37.77  ? 34   PHE C CB    1 
ATOM   6849  C  CG    . PHE C  3  34  ? 19.171  115.623 68.075  1.00 36.50  ? 34   PHE C CG    1 
ATOM   6850  C  CD1   . PHE C  3  34  ? 19.374  116.852 67.483  1.00 34.77  ? 34   PHE C CD1   1 
ATOM   6851  C  CD2   . PHE C  3  34  ? 18.443  114.676 67.388  1.00 36.88  ? 34   PHE C CD2   1 
ATOM   6852  C  CE1   . PHE C  3  34  ? 18.875  117.114 66.233  1.00 34.48  ? 34   PHE C CE1   1 
ATOM   6853  C  CE2   . PHE C  3  34  ? 17.939  114.944 66.130  1.00 35.50  ? 34   PHE C CE2   1 
ATOM   6854  C  CZ    . PHE C  3  34  ? 18.158  116.155 65.557  1.00 34.45  ? 34   PHE C CZ    1 
ATOM   6855  N  N     . GLY C  3  35  ? 22.702  114.543 70.994  1.00 35.51  ? 35   GLY C N     1 
ATOM   6856  C  CA    . GLY C  3  35  ? 23.460  114.677 72.222  1.00 33.91  ? 35   GLY C CA    1 
ATOM   6857  C  C     . GLY C  3  35  ? 24.625  115.631 71.972  1.00 31.36  ? 35   GLY C C     1 
ATOM   6858  O  O     . GLY C  3  35  ? 24.780  116.673 72.614  1.00 29.82  ? 35   GLY C O     1 
ATOM   6859  N  N     . SER C  3  36  ? 25.446  115.269 71.006  1.00 29.22  ? 36   SER C N     1 
ATOM   6860  C  CA    . SER C  3  36  ? 26.579  116.085 70.677  1.00 29.02  ? 36   SER C CA    1 
ATOM   6861  C  C     . SER C  3  36  ? 26.160  117.482 70.251  1.00 29.31  ? 36   SER C C     1 
ATOM   6862  O  O     . SER C  3  36  ? 26.771  118.466 70.666  1.00 29.82  ? 36   SER C O     1 
ATOM   6863  C  CB    . SER C  3  36  ? 27.370  115.432 69.565  1.00 28.54  ? 36   SER C CB    1 
ATOM   6864  O  OG    . SER C  3  36  ? 26.629  115.451 68.369  1.00 30.22  ? 36   SER C OG    1 
ATOM   6865  N  N     . LEU C  3  37  ? 25.132  117.589 69.417  1.00 28.92  ? 37   LEU C N     1 
ATOM   6866  C  CA    . LEU C  3  37  ? 24.704  118.921 68.983  1.00 28.74  ? 37   LEU C CA    1 
ATOM   6867  C  C     . LEU C  3  37  ? 24.325  119.743 70.206  1.00 27.71  ? 37   LEU C C     1 
ATOM   6868  O  O     . LEU C  3  37  ? 24.664  120.929 70.309  1.00 27.29  ? 37   LEU C O     1 
ATOM   6869  C  CB    . LEU C  3  37  ? 23.519  118.843 68.026  1.00 28.21  ? 37   LEU C CB    1 
ATOM   6870  C  CG    . LEU C  3  37  ? 23.771  118.217 66.660  1.00 28.30  ? 37   LEU C CG    1 
ATOM   6871  C  CD1   . LEU C  3  37  ? 22.419  118.150 66.000  1.00 31.11  ? 37   LEU C CD1   1 
ATOM   6872  C  CD2   . LEU C  3  37  ? 24.756  119.011 65.805  1.00 25.05  ? 37   LEU C CD2   1 
ATOM   6873  N  N     . LEU C  3  38  ? 23.616  119.110 71.135  1.00 25.69  ? 38   LEU C N     1 
ATOM   6874  C  CA    . LEU C  3  38  ? 23.237  119.807 72.338  1.00 24.35  ? 38   LEU C CA    1 
ATOM   6875  C  C     . LEU C  3  38  ? 24.518  120.418 72.878  1.00 25.66  ? 38   LEU C C     1 
ATOM   6876  O  O     . LEU C  3  38  ? 24.565  121.612 73.200  1.00 27.50  ? 38   LEU C O     1 
ATOM   6877  C  CB    . LEU C  3  38  ? 22.627  118.840 73.338  1.00 21.06  ? 38   LEU C CB    1 
ATOM   6878  C  CG    . LEU C  3  38  ? 21.138  118.695 73.101  1.00 19.26  ? 38   LEU C CG    1 
ATOM   6879  C  CD1   . LEU C  3  38  ? 20.572  117.724 74.064  1.00 19.98  ? 38   LEU C CD1   1 
ATOM   6880  C  CD2   . LEU C  3  38  ? 20.477  120.034 73.281  1.00 19.45  ? 38   LEU C CD2   1 
ATOM   6881  N  N     . ALA C  3  39  ? 25.569  119.601 72.931  1.00 25.09  ? 39   ALA C N     1 
ATOM   6882  C  CA    . ALA C  3  39  ? 26.864  120.054 73.426  1.00 23.54  ? 39   ALA C CA    1 
ATOM   6883  C  C     . ALA C  3  39  ? 27.185  121.348 72.731  1.00 23.13  ? 39   ALA C C     1 
ATOM   6884  O  O     . ALA C  3  39  ? 27.248  122.398 73.364  1.00 23.79  ? 39   ALA C O     1 
ATOM   6885  C  CB    . ALA C  3  39  ? 27.938  119.026 73.128  1.00 22.21  ? 39   ALA C CB    1 
ATOM   6886  N  N     . VAL C  3  40  ? 27.362  121.258 71.419  1.00 21.96  ? 40   VAL C N     1 
ATOM   6887  C  CA    . VAL C  3  40  ? 27.666  122.412 70.602  1.00 22.50  ? 40   VAL C CA    1 
ATOM   6888  C  C     . VAL C  3  40  ? 26.808  123.615 70.949  1.00 24.06  ? 40   VAL C C     1 
ATOM   6889  O  O     . VAL C  3  40  ? 27.266  124.742 70.876  1.00 24.29  ? 40   VAL C O     1 
ATOM   6890  C  CB    . VAL C  3  40  ? 27.452  122.109 69.151  1.00 22.23  ? 40   VAL C CB    1 
ATOM   6891  C  CG1   . VAL C  3  40  ? 27.857  123.298 68.327  1.00 21.65  ? 40   VAL C CG1   1 
ATOM   6892  C  CG2   . VAL C  3  40  ? 28.234  120.885 68.775  1.00 21.20  ? 40   VAL C CG2   1 
ATOM   6893  N  N     . CYS C  3  41  ? 25.548  123.402 71.295  1.00 25.13  ? 41   CYS C N     1 
ATOM   6894  C  CA    . CYS C  3  41  ? 24.751  124.542 71.672  1.00 26.89  ? 41   CYS C CA    1 
ATOM   6895  C  C     . CYS C  3  41  ? 25.363  125.114 72.930  1.00 28.97  ? 41   CYS C C     1 
ATOM   6896  O  O     . CYS C  3  41  ? 25.701  126.303 72.981  1.00 29.98  ? 41   CYS C O     1 
ATOM   6897  C  CB    . CYS C  3  41  ? 23.319  124.127 71.886  1.00 25.16  ? 41   CYS C CB    1 
ATOM   6898  S  SG    . CYS C  3  41  ? 22.587  123.986 70.286  1.00 29.50  ? 41   CYS C SG    1 
ATOM   6899  N  N     . LEU C  3  42  ? 25.547  124.261 73.934  1.00 29.95  ? 42   LEU C N     1 
ATOM   6900  C  CA    . LEU C  3  42  ? 26.151  124.708 75.178  1.00 31.12  ? 42   LEU C CA    1 
ATOM   6901  C  C     . LEU C  3  42  ? 27.438  125.475 74.916  1.00 31.95  ? 42   LEU C C     1 
ATOM   6902  O  O     . LEU C  3  42  ? 27.660  126.540 75.470  1.00 31.03  ? 42   LEU C O     1 
ATOM   6903  C  CB    . LEU C  3  42  ? 26.480  123.535 76.087  1.00 31.16  ? 42   LEU C CB    1 
ATOM   6904  C  CG    . LEU C  3  42  ? 27.073  124.073 77.397  1.00 31.47  ? 42   LEU C CG    1 
ATOM   6905  C  CD1   . LEU C  3  42  ? 26.012  124.906 78.127  1.00 29.87  ? 42   LEU C CD1   1 
ATOM   6906  C  CD2   . LEU C  3  42  ? 27.551  122.924 78.275  1.00 31.86  ? 42   LEU C CD2   1 
ATOM   6907  N  N     . MET C  3  43  ? 28.296  124.923 74.075  1.00 33.92  ? 43   MET C N     1 
ATOM   6908  C  CA    . MET C  3  43  ? 29.548  125.589 73.782  1.00 37.06  ? 43   MET C CA    1 
ATOM   6909  C  C     . MET C  3  43  ? 29.290  126.917 73.128  1.00 37.21  ? 43   MET C C     1 
ATOM   6910  O  O     . MET C  3  43  ? 30.011  127.877 73.364  1.00 38.20  ? 43   MET C O     1 
ATOM   6911  C  CB    . MET C  3  43  ? 30.437  124.735 72.870  1.00 41.29  ? 43   MET C CB    1 
ATOM   6912  C  CG    . MET C  3  43  ? 31.006  123.502 73.545  1.00 47.98  ? 43   MET C CG    1 
ATOM   6913  S  SD    . MET C  3  43  ? 31.247  123.829 75.320  1.00 56.27  ? 43   MET C SD    1 
ATOM   6914  C  CE    . MET C  3  43  ? 32.534  125.226 75.239  1.00 57.01  ? 43   MET C CE    1 
ATOM   6915  N  N     . THR C  3  44  ? 28.245  126.988 72.319  1.00 37.09  ? 44   THR C N     1 
ATOM   6916  C  CA    . THR C  3  44  ? 27.960  128.229 71.627  1.00 38.02  ? 44   THR C CA    1 
ATOM   6917  C  C     . THR C  3  44  ? 27.244  129.249 72.490  1.00 37.23  ? 44   THR C C     1 
ATOM   6918  O  O     . THR C  3  44  ? 27.321  130.454 72.249  1.00 37.07  ? 44   THR C O     1 
ATOM   6919  C  CB    . THR C  3  44  ? 27.153  127.978 70.358  1.00 39.72  ? 44   THR C CB    1 
ATOM   6920  O  OG1   . THR C  3  44  ? 27.736  126.880 69.651  1.00 42.99  ? 44   THR C OG1   1 
ATOM   6921  C  CG2   . THR C  3  44  ? 27.204  129.201 69.441  1.00 41.01  ? 44   THR C CG2   1 
ATOM   6922  N  N     . GLN C  3  45  ? 26.530  128.791 73.501  1.00 36.11  ? 45   GLN C N     1 
ATOM   6923  C  CA    . GLN C  3  45  ? 25.884  129.769 74.346  1.00 35.18  ? 45   GLN C CA    1 
ATOM   6924  C  C     . GLN C  3  45  ? 26.940  130.377 75.262  1.00 33.80  ? 45   GLN C C     1 
ATOM   6925  O  O     . GLN C  3  45  ? 27.032  131.598 75.390  1.00 34.14  ? 45   GLN C O     1 
ATOM   6926  C  CB    . GLN C  3  45  ? 24.765  129.132 75.161  1.00 35.60  ? 45   GLN C CB    1 
ATOM   6927  C  CG    . GLN C  3  45  ? 23.551  128.741 74.334  1.00 37.59  ? 45   GLN C CG    1 
ATOM   6928  C  CD    . GLN C  3  45  ? 23.099  129.848 73.380  1.00 38.72  ? 45   GLN C CD    1 
ATOM   6929  O  OE1   . GLN C  3  45  ? 23.777  130.155 72.395  1.00 38.86  ? 45   GLN C OE1   1 
ATOM   6930  N  NE2   . GLN C  3  45  ? 21.949  130.447 73.671  1.00 38.41  ? 45   GLN C NE2   1 
ATOM   6931  N  N     . ILE C  3  46  ? 27.761  129.529 75.872  1.00 31.56  ? 46   ILE C N     1 
ATOM   6932  C  CA    . ILE C  3  46  ? 28.788  130.015 76.778  1.00 29.40  ? 46   ILE C CA    1 
ATOM   6933  C  C     . ILE C  3  46  ? 29.757  130.946 76.095  1.00 27.59  ? 46   ILE C C     1 
ATOM   6934  O  O     . ILE C  3  46  ? 30.197  131.940 76.666  1.00 25.98  ? 46   ILE C O     1 
ATOM   6935  C  CB    . ILE C  3  46  ? 29.569  128.868 77.423  1.00 29.30  ? 46   ILE C CB    1 
ATOM   6936  C  CG1   . ILE C  3  46  ? 28.612  127.992 78.225  1.00 30.20  ? 46   ILE C CG1   1 
ATOM   6937  C  CG2   . ILE C  3  46  ? 30.612  129.426 78.361  1.00 28.57  ? 46   ILE C CG2   1 
ATOM   6938  C  CD1   . ILE C  3  46  ? 29.261  126.872 78.953  1.00 31.97  ? 46   ILE C CD1   1 
ATOM   6939  N  N     . LEU C  3  47  ? 30.093  130.642 74.861  1.00 26.16  ? 47   LEU C N     1 
ATOM   6940  C  CA    . LEU C  3  47  ? 31.012  131.517 74.178  1.00 28.69  ? 47   LEU C CA    1 
ATOM   6941  C  C     . LEU C  3  47  ? 30.359  132.888 73.944  1.00 28.58  ? 47   LEU C C     1 
ATOM   6942  O  O     . LEU C  3  47  ? 30.814  133.911 74.479  1.00 29.30  ? 47   LEU C O     1 
ATOM   6943  C  CB    . LEU C  3  47  ? 31.446  130.897 72.846  1.00 30.45  ? 47   LEU C CB    1 
ATOM   6944  C  CG    . LEU C  3  47  ? 32.952  130.819 72.550  1.00 31.48  ? 47   LEU C CG    1 
ATOM   6945  C  CD1   . LEU C  3  47  ? 33.621  132.126 72.991  1.00 32.19  ? 47   LEU C CD1   1 
ATOM   6946  C  CD2   . LEU C  3  47  ? 33.579  129.627 73.288  1.00 31.63  ? 47   LEU C CD2   1 
ATOM   6947  N  N     . THR C  3  48  ? 29.290  132.897 73.150  1.00 26.78  ? 48   THR C N     1 
ATOM   6948  C  CA    . THR C  3  48  ? 28.572  134.118 72.823  1.00 24.69  ? 48   THR C CA    1 
ATOM   6949  C  C     . THR C  3  48  ? 28.150  134.825 74.085  1.00 25.70  ? 48   THR C C     1 
ATOM   6950  O  O     . THR C  3  48  ? 28.080  136.046 74.119  1.00 25.24  ? 48   THR C O     1 
ATOM   6951  C  CB    . THR C  3  48  ? 27.313  133.816 72.023  1.00 23.84  ? 48   THR C CB    1 
ATOM   6952  O  OG1   . THR C  3  48  ? 26.512  132.873 72.741  1.00 20.93  ? 48   THR C OG1   1 
ATOM   6953  C  CG2   . THR C  3  48  ? 27.662  133.232 70.673  1.00 23.04  ? 48   THR C CG2   1 
ATOM   6954  N  N     . GLY C  3  49  ? 27.870  134.042 75.124  1.00 27.22  ? 49   GLY C N     1 
ATOM   6955  C  CA    . GLY C  3  49  ? 27.442  134.599 76.397  1.00 28.03  ? 49   GLY C CA    1 
ATOM   6956  C  C     . GLY C  3  49  ? 28.482  135.429 77.136  1.00 29.00  ? 49   GLY C C     1 
ATOM   6957  O  O     . GLY C  3  49  ? 28.181  136.496 77.701  1.00 26.40  ? 49   GLY C O     1 
ATOM   6958  N  N     . LEU C  3  50  ? 29.709  134.921 77.156  1.00 29.84  ? 50   LEU C N     1 
ATOM   6959  C  CA    . LEU C  3  50  ? 30.782  135.637 77.796  1.00 31.11  ? 50   LEU C CA    1 
ATOM   6960  C  C     . LEU C  3  50  ? 30.903  136.922 77.032  1.00 32.55  ? 50   LEU C C     1 
ATOM   6961  O  O     . LEU C  3  50  ? 30.931  137.998 77.609  1.00 33.92  ? 50   LEU C O     1 
ATOM   6962  C  CB    . LEU C  3  50  ? 32.079  134.863 77.701  1.00 30.17  ? 50   LEU C CB    1 
ATOM   6963  C  CG    . LEU C  3  50  ? 32.124  133.646 78.621  1.00 32.34  ? 50   LEU C CG    1 
ATOM   6964  C  CD1   . LEU C  3  50  ? 33.409  132.899 78.343  1.00 34.60  ? 50   LEU C CD1   1 
ATOM   6965  C  CD2   . LEU C  3  50  ? 32.051  134.053 80.107  1.00 31.69  ? 50   LEU C CD2   1 
ATOM   6966  N  N     . LEU C  3  51  ? 30.944  136.815 75.719  1.00 33.85  ? 51   LEU C N     1 
ATOM   6967  C  CA    . LEU C  3  51  ? 31.064  138.001 74.906  1.00 36.41  ? 51   LEU C CA    1 
ATOM   6968  C  C     . LEU C  3  51  ? 30.009  139.057 75.192  1.00 39.51  ? 51   LEU C C     1 
ATOM   6969  O  O     . LEU C  3  51  ? 30.341  140.247 75.310  1.00 39.22  ? 51   LEU C O     1 
ATOM   6970  C  CB    . LEU C  3  51  ? 31.039  137.602 73.449  1.00 35.25  ? 51   LEU C CB    1 
ATOM   6971  C  CG    . LEU C  3  51  ? 32.403  137.005 73.182  1.00 33.76  ? 51   LEU C CG    1 
ATOM   6972  C  CD1   . LEU C  3  51  ? 32.389  136.141 71.953  1.00 34.54  ? 51   LEU C CD1   1 
ATOM   6973  C  CD2   . LEU C  3  51  ? 33.372  138.157 73.068  1.00 34.48  ? 51   LEU C CD2   1 
ATOM   6974  N  N     . LEU C  3  52  ? 28.747  138.632 75.317  1.00 42.60  ? 52   LEU C N     1 
ATOM   6975  C  CA    . LEU C  3  52  ? 27.664  139.583 75.579  1.00 46.03  ? 52   LEU C CA    1 
ATOM   6976  C  C     . LEU C  3  52  ? 27.763  140.149 76.971  1.00 48.60  ? 52   LEU C C     1 
ATOM   6977  O  O     . LEU C  3  52  ? 27.400  141.306 77.228  1.00 50.18  ? 52   LEU C O     1 
ATOM   6978  C  CB    . LEU C  3  52  ? 26.290  138.947 75.402  1.00 44.47  ? 52   LEU C CB    1 
ATOM   6979  C  CG    . LEU C  3  52  ? 25.842  138.823 73.954  1.00 45.35  ? 52   LEU C CG    1 
ATOM   6980  C  CD1   . LEU C  3  52  ? 24.348  138.707 73.925  1.00 47.20  ? 52   LEU C CD1   1 
ATOM   6981  C  CD2   . LEU C  3  52  ? 26.259  140.040 73.173  1.00 44.48  ? 52   LEU C CD2   1 
ATOM   6982  N  N     . ALA C  3  53  ? 28.258  139.332 77.880  1.00 49.75  ? 53   ALA C N     1 
ATOM   6983  C  CA    . ALA C  3  53  ? 28.397  139.800 79.232  1.00 50.52  ? 53   ALA C CA    1 
ATOM   6984  C  C     . ALA C  3  53  ? 29.523  140.844 79.308  1.00 50.09  ? 53   ALA C C     1 
ATOM   6985  O  O     . ALA C  3  53  ? 29.555  141.661 80.226  1.00 49.64  ? 53   ALA C O     1 
ATOM   6986  C  CB    . ALA C  3  53  ? 28.666  138.625 80.137  1.00 52.60  ? 53   ALA C CB    1 
ATOM   6987  N  N     . MET C  3  54  ? 30.432  140.829 78.339  1.00 49.68  ? 54   MET C N     1 
ATOM   6988  C  CA    . MET C  3  54  ? 31.515  141.795 78.344  1.00 51.72  ? 54   MET C CA    1 
ATOM   6989  C  C     . MET C  3  54  ? 30.978  143.191 78.099  1.00 52.21  ? 54   MET C C     1 
ATOM   6990  O  O     . MET C  3  54  ? 31.677  144.184 78.344  1.00 53.16  ? 54   MET C O     1 
ATOM   6991  C  CB    . MET C  3  54  ? 32.514  141.525 77.241  1.00 53.96  ? 54   MET C CB    1 
ATOM   6992  C  CG    . MET C  3  54  ? 33.074  140.160 77.192  1.00 57.04  ? 54   MET C CG    1 
ATOM   6993  S  SD    . MET C  3  54  ? 34.584  140.259 76.255  1.00 59.25  ? 54   MET C SD    1 
ATOM   6994  C  CE    . MET C  3  54  ? 35.742  139.614 77.583  1.00 59.80  ? 54   MET C CE    1 
ATOM   6995  N  N     . HIS C  3  55  ? 29.756  143.279 77.586  1.00 50.23  ? 55   HIS C N     1 
ATOM   6996  C  CA    . HIS C  3  55  ? 29.191  144.588 77.311  1.00 48.78  ? 55   HIS C CA    1 
ATOM   6997  C  C     . HIS C  3  55  ? 27.882  144.878 78.031  1.00 48.19  ? 55   HIS C C     1 
ATOM   6998  O  O     . HIS C  3  55  ? 27.409  146.015 78.048  1.00 49.04  ? 55   HIS C O     1 
ATOM   6999  C  CB    . HIS C  3  55  ? 29.022  144.764 75.806  1.00 48.06  ? 55   HIS C CB    1 
ATOM   7000  C  CG    . HIS C  3  55  ? 30.285  144.558 75.041  1.00 46.44  ? 55   HIS C CG    1 
ATOM   7001  N  ND1   . HIS C  3  55  ? 30.799  143.306 74.779  1.00 45.82  ? 55   HIS C ND1   1 
ATOM   7002  C  CD2   . HIS C  3  55  ? 31.161  145.445 74.519  1.00 46.83  ? 55   HIS C CD2   1 
ATOM   7003  C  CE1   . HIS C  3  55  ? 31.940  143.430 74.125  1.00 46.70  ? 55   HIS C CE1   1 
ATOM   7004  N  NE2   . HIS C  3  55  ? 32.183  144.718 73.957  1.00 47.82  ? 55   HIS C NE2   1 
ATOM   7005  N  N     . TYR C  3  56  ? 27.294  143.860 78.635  1.00 46.87  ? 56   TYR C N     1 
ATOM   7006  C  CA    . TYR C  3  56  ? 26.048  144.070 79.352  1.00 46.80  ? 56   TYR C CA    1 
ATOM   7007  C  C     . TYR C  3  56  ? 26.301  144.960 80.584  1.00 45.28  ? 56   TYR C C     1 
ATOM   7008  O  O     . TYR C  3  56  ? 27.443  145.157 80.993  1.00 44.11  ? 56   TYR C O     1 
ATOM   7009  C  CB    . TYR C  3  56  ? 25.466  142.708 79.771  1.00 48.80  ? 56   TYR C CB    1 
ATOM   7010  C  CG    . TYR C  3  56  ? 24.086  142.761 80.415  1.00 49.89  ? 56   TYR C CG    1 
ATOM   7011  C  CD1   . TYR C  3  56  ? 22.995  143.307 79.741  1.00 50.87  ? 56   TYR C CD1   1 
ATOM   7012  C  CD2   . TYR C  3  56  ? 23.875  142.264 81.693  1.00 49.68  ? 56   TYR C CD2   1 
ATOM   7013  C  CE1   . TYR C  3  56  ? 21.740  143.355 80.324  1.00 50.23  ? 56   TYR C CE1   1 
ATOM   7014  C  CE2   . TYR C  3  56  ? 22.626  142.313 82.276  1.00 50.32  ? 56   TYR C CE2   1 
ATOM   7015  C  CZ    . TYR C  3  56  ? 21.567  142.858 81.585  1.00 50.30  ? 56   TYR C CZ    1 
ATOM   7016  O  OH    . TYR C  3  56  ? 20.323  142.894 82.154  1.00 52.01  ? 56   TYR C OH    1 
ATOM   7017  N  N     . THR C  3  57  ? 25.230  145.500 81.159  1.00 44.12  ? 57   THR C N     1 
ATOM   7018  C  CA    . THR C  3  57  ? 25.318  146.339 82.355  1.00 44.27  ? 57   THR C CA    1 
ATOM   7019  C  C     . THR C  3  57  ? 24.098  146.061 83.266  1.00 45.44  ? 57   THR C C     1 
ATOM   7020  O  O     . THR C  3  57  ? 23.136  146.817 83.297  1.00 46.65  ? 57   THR C O     1 
ATOM   7021  C  CB    . THR C  3  57  ? 25.375  147.840 81.972  1.00 42.60  ? 57   THR C CB    1 
ATOM   7022  O  OG1   . THR C  3  57  ? 26.556  148.090 81.202  1.00 40.80  ? 57   THR C OG1   1 
ATOM   7023  C  CG2   . THR C  3  57  ? 25.402  148.719 83.209  1.00 40.54  ? 57   THR C CG2   1 
ATOM   7024  N  N     . ALA C  3  58  ? 24.154  144.964 84.010  1.00 45.94  ? 58   ALA C N     1 
ATOM   7025  C  CA    . ALA C  3  58  ? 23.066  144.558 84.887  1.00 45.73  ? 58   ALA C CA    1 
ATOM   7026  C  C     . ALA C  3  58  ? 22.542  145.637 85.812  1.00 46.62  ? 58   ALA C C     1 
ATOM   7027  O  O     . ALA C  3  58  ? 22.942  145.725 86.976  1.00 47.55  ? 58   ALA C O     1 
ATOM   7028  C  CB    . ALA C  3  58  ? 23.503  143.376 85.699  1.00 47.12  ? 58   ALA C CB    1 
ATOM   7029  N  N     . ASP C  3  59  ? 21.621  146.447 85.316  1.00 47.03  ? 59   ASP C N     1 
ATOM   7030  C  CA    . ASP C  3  59  ? 21.075  147.491 86.158  1.00 47.93  ? 59   ASP C CA    1 
ATOM   7031  C  C     . ASP C  3  59  ? 19.908  148.170 85.504  1.00 47.56  ? 59   ASP C C     1 
ATOM   7032  O  O     . ASP C  3  59  ? 20.087  148.882 84.531  1.00 46.65  ? 59   ASP C O     1 
ATOM   7033  C  CB    . ASP C  3  59  ? 22.134  148.535 86.456  1.00 50.00  ? 59   ASP C CB    1 
ATOM   7034  C  CG    . ASP C  3  59  ? 21.693  149.502 87.519  1.00 52.19  ? 59   ASP C CG    1 
ATOM   7035  O  OD1   . ASP C  3  59  ? 21.936  149.235 88.729  1.00 52.24  ? 59   ASP C OD1   1 
ATOM   7036  O  OD2   . ASP C  3  59  ? 21.084  150.521 87.126  1.00 52.91  ? 59   ASP C OD2   1 
ATOM   7037  N  N     . THR C  3  60  ? 18.723  147.971 86.061  1.00 48.46  ? 60   THR C N     1 
ATOM   7038  C  CA    . THR C  3  60  ? 17.504  148.561 85.527  1.00 51.67  ? 60   THR C CA    1 
ATOM   7039  C  C     . THR C  3  60  ? 17.672  149.788 84.625  1.00 53.32  ? 60   THR C C     1 
ATOM   7040  O  O     . THR C  3  60  ? 17.276  149.767 83.456  1.00 55.45  ? 60   THR C O     1 
ATOM   7041  C  CB    . THR C  3  60  ? 16.545  148.943 86.649  1.00 52.33  ? 60   THR C CB    1 
ATOM   7042  O  OG1   . THR C  3  60  ? 17.232  149.753 87.611  1.00 53.67  ? 60   THR C OG1   1 
ATOM   7043  C  CG2   . THR C  3  60  ? 16.009  147.711 87.318  1.00 53.70  ? 60   THR C CG2   1 
ATOM   7044  N  N     . SER C  3  61  ? 18.257  150.856 85.149  1.00 53.99  ? 61   SER C N     1 
ATOM   7045  C  CA    . SER C  3  61  ? 18.429  152.080 84.361  1.00 54.33  ? 61   SER C CA    1 
ATOM   7046  C  C     . SER C  3  61  ? 19.289  151.967 83.101  1.00 52.81  ? 61   SER C C     1 
ATOM   7047  O  O     . SER C  3  61  ? 19.182  152.805 82.195  1.00 52.07  ? 61   SER C O     1 
ATOM   7048  C  CB    . SER C  3  61  ? 19.004  153.185 85.252  1.00 56.76  ? 61   SER C CB    1 
ATOM   7049  O  OG    . SER C  3  61  ? 20.242  152.796 85.829  1.00 59.80  ? 61   SER C OG    1 
ATOM   7050  N  N     . LEU C  3  62  ? 20.125  150.932 83.043  1.00 51.17  ? 62   LEU C N     1 
ATOM   7051  C  CA    . LEU C  3  62  ? 21.034  150.737 81.920  1.00 49.61  ? 62   LEU C CA    1 
ATOM   7052  C  C     . LEU C  3  62  ? 20.928  149.380 81.221  1.00 48.47  ? 62   LEU C C     1 
ATOM   7053  O  O     . LEU C  3  62  ? 21.366  149.220 80.084  1.00 47.94  ? 62   LEU C O     1 
ATOM   7054  C  CB    . LEU C  3  62  ? 22.475  150.946 82.411  1.00 48.88  ? 62   LEU C CB    1 
ATOM   7055  C  CG    . LEU C  3  62  ? 22.791  152.296 83.064  1.00 47.26  ? 62   LEU C CG    1 
ATOM   7056  C  CD1   . LEU C  3  62  ? 23.947  152.152 84.006  1.00 46.57  ? 62   LEU C CD1   1 
ATOM   7057  C  CD2   . LEU C  3  62  ? 23.097  153.323 82.000  1.00 48.08  ? 62   LEU C CD2   1 
ATOM   7058  N  N     . ALA C  3  63  ? 20.348  148.403 81.897  1.00 47.88  ? 63   ALA C N     1 
ATOM   7059  C  CA    . ALA C  3  63  ? 20.245  147.082 81.315  1.00 48.06  ? 63   ALA C CA    1 
ATOM   7060  C  C     . ALA C  3  63  ? 19.712  147.104 79.900  1.00 48.11  ? 63   ALA C C     1 
ATOM   7061  O  O     . ALA C  3  63  ? 20.244  146.414 79.044  1.00 48.94  ? 63   ALA C O     1 
ATOM   7062  C  CB    . ALA C  3  63  ? 19.389  146.190 82.178  1.00 49.52  ? 63   ALA C CB    1 
ATOM   7063  N  N     . PHE C  3  64  ? 18.676  147.883 79.625  1.00 47.77  ? 64   PHE C N     1 
ATOM   7064  C  CA    . PHE C  3  64  ? 18.174  147.883 78.260  1.00 48.68  ? 64   PHE C CA    1 
ATOM   7065  C  C     . PHE C  3  64  ? 19.175  148.480 77.280  1.00 48.41  ? 64   PHE C C     1 
ATOM   7066  O  O     . PHE C  3  64  ? 19.694  147.813 76.394  1.00 47.87  ? 64   PHE C O     1 
ATOM   7067  C  CB    . PHE C  3  64  ? 16.871  148.665 78.154  1.00 49.49  ? 64   PHE C CB    1 
ATOM   7068  C  CG    . PHE C  3  64  ? 16.214  148.563 76.786  1.00 48.92  ? 64   PHE C CG    1 
ATOM   7069  C  CD1   . PHE C  3  64  ? 15.544  147.408 76.395  1.00 48.47  ? 64   PHE C CD1   1 
ATOM   7070  C  CD2   . PHE C  3  64  ? 16.270  149.620 75.890  1.00 48.14  ? 64   PHE C CD2   1 
ATOM   7071  C  CE1   . PHE C  3  64  ? 14.948  147.318 75.145  1.00 46.52  ? 64   PHE C CE1   1 
ATOM   7072  C  CE2   . PHE C  3  64  ? 15.671  149.527 74.637  1.00 46.12  ? 64   PHE C CE2   1 
ATOM   7073  C  CZ    . PHE C  3  64  ? 15.014  148.376 74.271  1.00 45.16  ? 64   PHE C CZ    1 
ATOM   7074  N  N     . SER C  3  65  ? 19.427  149.761 77.459  1.00 49.56  ? 65   SER C N     1 
ATOM   7075  C  CA    . SER C  3  65  ? 20.337  150.522 76.625  1.00 51.79  ? 65   SER C CA    1 
ATOM   7076  C  C     . SER C  3  65  ? 21.764  149.988 76.499  1.00 52.42  ? 65   SER C C     1 
ATOM   7077  O  O     . SER C  3  65  ? 22.563  150.501 75.689  1.00 53.15  ? 65   SER C O     1 
ATOM   7078  C  CB    . SER C  3  65  ? 20.393  151.946 77.154  1.00 54.14  ? 65   SER C CB    1 
ATOM   7079  O  OG    . SER C  3  65  ? 20.835  151.973 78.505  1.00 55.89  ? 65   SER C OG    1 
ATOM   7080  N  N     . SER C  3  66  ? 22.103  148.995 77.314  1.00 51.93  ? 66   SER C N     1 
ATOM   7081  C  CA    . SER C  3  66  ? 23.440  148.409 77.247  1.00 51.81  ? 66   SER C CA    1 
ATOM   7082  C  C     . SER C  3  66  ? 23.412  147.382 76.125  1.00 49.85  ? 66   SER C C     1 
ATOM   7083  O  O     . SER C  3  66  ? 24.324  147.305 75.296  1.00 49.14  ? 66   SER C O     1 
ATOM   7084  C  CB    . SER C  3  66  ? 23.791  147.714 78.557  1.00 53.66  ? 66   SER C CB    1 
ATOM   7085  O  OG    . SER C  3  66  ? 22.971  146.573 78.742  1.00 55.70  ? 66   SER C OG    1 
ATOM   7086  N  N     . VAL C  3  67  ? 22.355  146.583 76.113  1.00 47.06  ? 67   VAL C N     1 
ATOM   7087  C  CA    . VAL C  3  67  ? 22.208  145.604 75.077  1.00 45.62  ? 67   VAL C CA    1 
ATOM   7088  C  C     . VAL C  3  67  ? 22.165  146.407 73.778  1.00 46.81  ? 67   VAL C C     1 
ATOM   7089  O  O     . VAL C  3  67  ? 22.990  146.204 72.896  1.00 47.02  ? 67   VAL C O     1 
ATOM   7090  C  CB    . VAL C  3  67  ? 20.928  144.823 75.278  1.00 43.88  ? 67   VAL C CB    1 
ATOM   7091  C  CG1   . VAL C  3  67  ? 20.775  143.789 74.204  1.00 44.44  ? 67   VAL C CG1   1 
ATOM   7092  C  CG2   . VAL C  3  67  ? 20.959  144.162 76.618  1.00 42.64  ? 67   VAL C CG2   1 
ATOM   7093  N  N     . ALA C  3  68  ? 21.227  147.345 73.678  1.00 48.42  ? 68   ALA C N     1 
ATOM   7094  C  CA    . ALA C  3  68  ? 21.103  148.175 72.478  1.00 49.74  ? 68   ALA C CA    1 
ATOM   7095  C  C     . ALA C  3  68  ? 22.484  148.626 72.066  1.00 51.68  ? 68   ALA C C     1 
ATOM   7096  O  O     . ALA C  3  68  ? 22.919  148.402 70.935  1.00 51.28  ? 68   ALA C O     1 
ATOM   7097  C  CB    . ALA C  3  68  ? 20.240  149.378 72.758  1.00 48.31  ? 68   ALA C CB    1 
ATOM   7098  N  N     . HIS C  3  69  ? 23.172  149.266 73.000  1.00 54.56  ? 69   HIS C N     1 
ATOM   7099  C  CA    . HIS C  3  69  ? 24.514  149.734 72.736  1.00 58.52  ? 69   HIS C CA    1 
ATOM   7100  C  C     . HIS C  3  69  ? 25.357  148.534 72.228  1.00 55.61  ? 69   HIS C C     1 
ATOM   7101  O  O     . HIS C  3  69  ? 25.997  148.624 71.169  1.00 55.13  ? 69   HIS C O     1 
ATOM   7102  C  CB    . HIS C  3  69  ? 25.078  150.406 74.023  1.00 67.68  ? 69   HIS C CB    1 
ATOM   7103  C  CG    . HIS C  3  69  ? 26.574  150.621 74.029  1.00 79.15  ? 69   HIS C CG    1 
ATOM   7104  N  ND1   . HIS C  3  69  ? 27.482  149.594 74.229  1.00 84.31  ? 69   HIS C ND1   1 
ATOM   7105  C  CD2   . HIS C  3  69  ? 27.319  151.749 73.891  1.00 82.69  ? 69   HIS C CD2   1 
ATOM   7106  C  CE1   . HIS C  3  69  ? 28.715  150.078 74.212  1.00 85.23  ? 69   HIS C CE1   1 
ATOM   7107  N  NE2   . HIS C  3  69  ? 28.645  151.383 74.008  1.00 85.79  ? 69   HIS C NE2   1 
ATOM   7108  N  N     . THR C  3  70  ? 25.311  147.402 72.932  1.00 51.66  ? 70   THR C N     1 
ATOM   7109  C  CA    . THR C  3  70  ? 26.103  146.233 72.530  1.00 48.72  ? 70   THR C CA    1 
ATOM   7110  C  C     . THR C  3  70  ? 25.843  145.721 71.129  1.00 48.07  ? 70   THR C C     1 
ATOM   7111  O  O     . THR C  3  70  ? 26.678  145.043 70.550  1.00 47.54  ? 70   THR C O     1 
ATOM   7112  C  CB    . THR C  3  70  ? 25.898  145.062 73.472  1.00 47.31  ? 70   THR C CB    1 
ATOM   7113  O  OG1   . THR C  3  70  ? 26.299  145.452 74.786  1.00 47.89  ? 70   THR C OG1   1 
ATOM   7114  C  CG2   . THR C  3  70  ? 26.717  143.870 73.026  1.00 43.50  ? 70   THR C CG2   1 
ATOM   7115  N  N     . CYS C  3  71  ? 24.682  146.030 70.583  1.00 47.60  ? 71   CYS C N     1 
ATOM   7116  C  CA    . CYS C  3  71  ? 24.373  145.571 69.251  1.00 47.45  ? 71   CYS C CA    1 
ATOM   7117  C  C     . CYS C  3  71  ? 24.797  146.579 68.207  1.00 48.65  ? 71   CYS C C     1 
ATOM   7118  O  O     . CYS C  3  71  ? 25.334  146.203 67.166  1.00 49.83  ? 71   CYS C O     1 
ATOM   7119  C  CB    . CYS C  3  71  ? 22.883  145.326 69.114  1.00 47.42  ? 71   CYS C CB    1 
ATOM   7120  S  SG    . CYS C  3  71  ? 22.291  143.988 70.114  1.00 45.16  ? 71   CYS C SG    1 
ATOM   7121  N  N     . ARG C  3  72  ? 24.560  147.859 68.489  1.00 48.40  ? 72   ARG C N     1 
ATOM   7122  C  CA    . ARG C  3  72  ? 24.878  148.940 67.550  1.00 48.83  ? 72   ARG C CA    1 
ATOM   7123  C  C     . ARG C  3  72  ? 26.338  149.392 67.495  1.00 48.46  ? 72   ARG C C     1 
ATOM   7124  O  O     . ARG C  3  72  ? 26.913  149.589 66.409  1.00 49.01  ? 72   ARG C O     1 
ATOM   7125  C  CB    . ARG C  3  72  ? 24.015  150.156 67.879  1.00 49.35  ? 72   ARG C CB    1 
ATOM   7126  C  CG    . ARG C  3  72  ? 22.532  149.883 67.853  1.00 51.08  ? 72   ARG C CG    1 
ATOM   7127  C  CD    . ARG C  3  72  ? 21.764  150.848 68.751  1.00 51.33  ? 72   ARG C CD    1 
ATOM   7128  N  NE    . ARG C  3  72  ? 20.342  150.874 68.417  1.00 52.01  ? 72   ARG C NE    1 
ATOM   7129  C  CZ    . ARG C  3  72  ? 19.859  151.365 67.280  1.00 51.73  ? 72   ARG C CZ    1 
ATOM   7130  N  NH1   . ARG C  3  72  ? 20.688  151.875 66.376  1.00 51.26  ? 72   ARG C NH1   1 
ATOM   7131  N  NH2   . ARG C  3  72  ? 18.554  151.327 67.039  1.00 51.23  ? 72   ARG C NH2   1 
ATOM   7132  N  N     . ASN C  3  73  ? 26.930  149.546 68.673  1.00 46.61  ? 73   ASN C N     1 
ATOM   7133  C  CA    . ASN C  3  73  ? 28.290  150.025 68.784  1.00 45.01  ? 73   ASN C CA    1 
ATOM   7134  C  C     . ASN C  3  73  ? 29.400  149.006 68.813  1.00 45.17  ? 73   ASN C C     1 
ATOM   7135  O  O     . ASN C  3  73  ? 30.461  149.229 68.248  1.00 46.24  ? 73   ASN C O     1 
ATOM   7136  C  CB    . ASN C  3  73  ? 28.373  150.902 70.006  1.00 42.43  ? 73   ASN C CB    1 
ATOM   7137  C  CG    . ASN C  3  73  ? 27.300  151.926 70.006  1.00 42.04  ? 73   ASN C CG    1 
ATOM   7138  O  OD1   . ASN C  3  73  ? 27.165  152.703 69.061  1.00 42.68  ? 73   ASN C OD1   1 
ATOM   7139  N  ND2   . ASN C  3  73  ? 26.506  151.931 71.050  1.00 43.04  ? 73   ASN C ND2   1 
ATOM   7140  N  N     . VAL C  3  74  ? 29.173  147.886 69.464  1.00 44.52  ? 74   VAL C N     1 
ATOM   7141  C  CA    . VAL C  3  74  ? 30.212  146.894 69.536  1.00 45.24  ? 74   VAL C CA    1 
ATOM   7142  C  C     . VAL C  3  74  ? 30.396  146.146 68.233  1.00 46.44  ? 74   VAL C C     1 
ATOM   7143  O  O     . VAL C  3  74  ? 29.451  145.568 67.706  1.00 47.63  ? 74   VAL C O     1 
ATOM   7144  C  CB    . VAL C  3  74  ? 29.900  145.893 70.593  1.00 45.87  ? 74   VAL C CB    1 
ATOM   7145  C  CG1   . VAL C  3  74  ? 31.162  145.219 71.003  1.00 48.96  ? 74   VAL C CG1   1 
ATOM   7146  C  CG2   . VAL C  3  74  ? 29.234  146.568 71.767  1.00 47.39  ? 74   VAL C CG2   1 
ATOM   7147  N  N     . GLN C  3  75  ? 31.618  146.148 67.717  1.00 47.10  ? 75   GLN C N     1 
ATOM   7148  C  CA    . GLN C  3  75  ? 31.924  145.455 66.472  1.00 47.86  ? 75   GLN C CA    1 
ATOM   7149  C  C     . GLN C  3  75  ? 31.267  144.078 66.455  1.00 46.76  ? 75   GLN C C     1 
ATOM   7150  O  O     . GLN C  3  75  ? 31.405  143.324 67.413  1.00 47.65  ? 75   GLN C O     1 
ATOM   7151  C  CB    . GLN C  3  75  ? 33.429  145.302 66.360  1.00 51.13  ? 75   GLN C CB    1 
ATOM   7152  C  CG    . GLN C  3  75  ? 34.162  146.624 66.257  1.00 57.40  ? 75   GLN C CG    1 
ATOM   7153  C  CD    . GLN C  3  75  ? 34.651  146.901 64.840  1.00 61.80  ? 75   GLN C CD    1 
ATOM   7154  O  OE1   . GLN C  3  75  ? 35.590  146.249 64.342  1.00 64.62  ? 75   GLN C OE1   1 
ATOM   7155  N  NE2   . GLN C  3  75  ? 34.010  147.860 64.173  1.00 63.28  ? 75   GLN C NE2   1 
ATOM   7156  N  N     . TYR C  3  76  ? 30.548  143.752 65.385  1.00 44.27  ? 76   TYR C N     1 
ATOM   7157  C  CA    . TYR C  3  76  ? 29.888  142.453 65.286  1.00 43.39  ? 76   TYR C CA    1 
ATOM   7158  C  C     . TYR C  3  76  ? 29.072  142.047 66.511  1.00 43.14  ? 76   TYR C C     1 
ATOM   7159  O  O     . TYR C  3  76  ? 28.672  140.888 66.652  1.00 43.23  ? 76   TYR C O     1 
ATOM   7160  C  CB    . TYR C  3  76  ? 30.922  141.372 64.987  1.00 42.87  ? 76   TYR C CB    1 
ATOM   7161  C  CG    . TYR C  3  76  ? 31.480  141.500 63.613  1.00 42.91  ? 76   TYR C CG    1 
ATOM   7162  C  CD1   . TYR C  3  76  ? 32.787  141.161 63.343  1.00 44.44  ? 76   TYR C CD1   1 
ATOM   7163  C  CD2   . TYR C  3  76  ? 30.705  142.014 62.587  1.00 44.63  ? 76   TYR C CD2   1 
ATOM   7164  C  CE1   . TYR C  3  76  ? 33.320  141.343 62.082  1.00 47.37  ? 76   TYR C CE1   1 
ATOM   7165  C  CE2   . TYR C  3  76  ? 31.212  142.201 61.326  1.00 46.93  ? 76   TYR C CE2   1 
ATOM   7166  C  CZ    . TYR C  3  76  ? 32.525  141.874 61.069  1.00 49.18  ? 76   TYR C CZ    1 
ATOM   7167  O  OH    . TYR C  3  76  ? 33.046  142.138 59.804  1.00 54.38  ? 76   TYR C OH    1 
ATOM   7168  N  N     . GLY C  3  77  ? 28.831  143.002 67.396  1.00 42.12  ? 77   GLY C N     1 
ATOM   7169  C  CA    . GLY C  3  77  ? 28.057  142.702 68.576  1.00 42.25  ? 77   GLY C CA    1 
ATOM   7170  C  C     . GLY C  3  77  ? 26.707  142.167 68.159  1.00 42.99  ? 77   GLY C C     1 
ATOM   7171  O  O     . GLY C  3  77  ? 26.268  141.121 68.637  1.00 43.99  ? 77   GLY C O     1 
ATOM   7172  N  N     . TRP C  3  78  ? 26.046  142.878 67.253  1.00 42.25  ? 78   TRP C N     1 
ATOM   7173  C  CA    . TRP C  3  78  ? 24.738  142.446 66.780  1.00 41.81  ? 78   TRP C CA    1 
ATOM   7174  C  C     . TRP C  3  78  ? 24.757  140.952 66.452  1.00 41.08  ? 78   TRP C C     1 
ATOM   7175  O  O     . TRP C  3  78  ? 23.912  140.197 66.940  1.00 41.18  ? 78   TRP C O     1 
ATOM   7176  C  CB    . TRP C  3  78  ? 24.337  143.228 65.533  1.00 42.47  ? 78   TRP C CB    1 
ATOM   7177  C  CG    . TRP C  3  78  ? 25.260  143.016 64.345  1.00 41.67  ? 78   TRP C CG    1 
ATOM   7178  C  CD1   . TRP C  3  78  ? 26.368  143.741 64.027  1.00 42.16  ? 78   TRP C CD1   1 
ATOM   7179  C  CD2   . TRP C  3  78  ? 25.135  142.020 63.334  1.00 40.33  ? 78   TRP C CD2   1 
ATOM   7180  N  NE1   . TRP C  3  78  ? 26.935  143.265 62.879  1.00 40.63  ? 78   TRP C NE1   1 
ATOM   7181  C  CE2   . TRP C  3  78  ? 26.199  142.204 62.435  1.00 40.13  ? 78   TRP C CE2   1 
ATOM   7182  C  CE3   . TRP C  3  78  ? 24.228  140.987 63.102  1.00 40.72  ? 78   TRP C CE3   1 
ATOM   7183  C  CZ2   . TRP C  3  78  ? 26.385  141.398 61.325  1.00 41.03  ? 78   TRP C CZ2   1 
ATOM   7184  C  CZ3   . TRP C  3  78  ? 24.411  140.185 62.001  1.00 42.54  ? 78   TRP C CZ3   1 
ATOM   7185  C  CH2   . TRP C  3  78  ? 25.485  140.393 61.121  1.00 42.01  ? 78   TRP C CH2   1 
ATOM   7186  N  N     . LEU C  3  79  ? 25.728  140.541 65.633  1.00 39.21  ? 79   LEU C N     1 
ATOM   7187  C  CA    . LEU C  3  79  ? 25.877  139.143 65.226  1.00 37.61  ? 79   LEU C CA    1 
ATOM   7188  C  C     . LEU C  3  79  ? 26.015  138.257 66.441  1.00 37.44  ? 79   LEU C C     1 
ATOM   7189  O  O     . LEU C  3  79  ? 25.505  137.141 66.480  1.00 37.29  ? 79   LEU C O     1 
ATOM   7190  C  CB    . LEU C  3  79  ? 27.102  138.968 64.334  1.00 35.39  ? 79   LEU C CB    1 
ATOM   7191  C  CG    . LEU C  3  79  ? 27.578  137.533 64.105  1.00 33.27  ? 79   LEU C CG    1 
ATOM   7192  C  CD1   . LEU C  3  79  ? 26.415  136.651 63.762  1.00 32.31  ? 79   LEU C CD1   1 
ATOM   7193  C  CD2   . LEU C  3  79  ? 28.599  137.501 62.989  1.00 33.74  ? 79   LEU C CD2   1 
ATOM   7194  N  N     . ILE C  3  80  ? 26.726  138.754 67.432  1.00 37.48  ? 80   ILE C N     1 
ATOM   7195  C  CA    . ILE C  3  80  ? 26.887  137.993 68.644  1.00 39.58  ? 80   ILE C CA    1 
ATOM   7196  C  C     . ILE C  3  80  ? 25.506  137.824 69.259  1.00 40.49  ? 80   ILE C C     1 
ATOM   7197  O  O     . ILE C  3  80  ? 25.002  136.715 69.397  1.00 40.16  ? 80   ILE C O     1 
ATOM   7198  C  CB    . ILE C  3  80  ? 27.832  138.721 69.617  1.00 39.77  ? 80   ILE C CB    1 
ATOM   7199  C  CG1   . ILE C  3  80  ? 29.238  138.738 69.017  1.00 40.06  ? 80   ILE C CG1   1 
ATOM   7200  C  CG2   . ILE C  3  80  ? 27.807  138.056 70.992  1.00 39.21  ? 80   ILE C CG2   1 
ATOM   7201  C  CD1   . ILE C  3  80  ? 30.340  138.862 70.032  1.00 39.16  ? 80   ILE C CD1   1 
ATOM   7202  N  N     . ARG C  3  81  ? 24.889  138.938 69.611  1.00 42.08  ? 81   ARG C N     1 
ATOM   7203  C  CA    . ARG C  3  81  ? 23.563  138.917 70.196  1.00 44.32  ? 81   ARG C CA    1 
ATOM   7204  C  C     . ARG C  3  81  ? 22.718  137.875 69.460  1.00 43.93  ? 81   ARG C C     1 
ATOM   7205  O  O     . ARG C  3  81  ? 22.450  136.799 70.010  1.00 43.39  ? 81   ARG C O     1 
ATOM   7206  C  CB    . ARG C  3  81  ? 22.932  140.303 70.061  1.00 47.64  ? 81   ARG C CB    1 
ATOM   7207  C  CG    . ARG C  3  81  ? 21.892  140.658 71.111  1.00 52.64  ? 81   ARG C CG    1 
ATOM   7208  C  CD    . ARG C  3  81  ? 20.626  139.856 70.936  1.00 59.18  ? 81   ARG C CD    1 
ATOM   7209  N  NE    . ARG C  3  81  ? 19.542  140.298 71.824  1.00 64.37  ? 81   ARG C NE    1 
ATOM   7210  C  CZ    . ARG C  3  81  ? 18.828  141.412 71.660  1.00 65.76  ? 81   ARG C CZ    1 
ATOM   7211  N  NH1   . ARG C  3  81  ? 19.075  142.221 70.636  1.00 66.55  ? 81   ARG C NH1   1 
ATOM   7212  N  NH2   . ARG C  3  81  ? 17.856  141.709 72.517  1.00 65.87  ? 81   ARG C NH2   1 
ATOM   7213  N  N     . ASN C  3  82  ? 22.325  138.199 68.221  1.00 43.00  ? 82   ASN C N     1 
ATOM   7214  C  CA    . ASN C  3  82  ? 21.504  137.319 67.372  1.00 42.81  ? 82   ASN C CA    1 
ATOM   7215  C  C     . ASN C  3  82  ? 21.823  135.847 67.607  1.00 43.04  ? 82   ASN C C     1 
ATOM   7216  O  O     . ASN C  3  82  ? 20.936  135.051 67.932  1.00 43.92  ? 82   ASN C O     1 
ATOM   7217  C  CB    . ASN C  3  82  ? 21.710  137.614 65.873  1.00 42.81  ? 82   ASN C CB    1 
ATOM   7218  C  CG    . ASN C  3  82  ? 21.299  139.028 65.474  1.00 44.30  ? 82   ASN C CG    1 
ATOM   7219  O  OD1   . ASN C  3  82  ? 21.307  139.376 64.286  1.00 41.63  ? 82   ASN C OD1   1 
ATOM   7220  N  ND2   . ASN C  3  82  ? 20.947  139.853 66.465  1.00 45.78  ? 82   ASN C ND2   1 
ATOM   7221  N  N     . LEU C  3  83  ? 23.093  135.484 67.431  1.00 41.96  ? 83   LEU C N     1 
ATOM   7222  C  CA    . LEU C  3  83  ? 23.530  134.100 67.622  1.00 39.22  ? 83   LEU C CA    1 
ATOM   7223  C  C     . LEU C  3  83  ? 23.167  133.560 68.996  1.00 39.23  ? 83   LEU C C     1 
ATOM   7224  O  O     . LEU C  3  83  ? 22.611  132.454 69.092  1.00 37.96  ? 83   LEU C O     1 
ATOM   7225  C  CB    . LEU C  3  83  ? 25.038  133.988 67.409  1.00 35.85  ? 83   LEU C CB    1 
ATOM   7226  C  CG    . LEU C  3  83  ? 25.439  133.962 65.946  1.00 33.00  ? 83   LEU C CG    1 
ATOM   7227  C  CD1   . LEU C  3  83  ? 26.932  134.068 65.819  1.00 31.94  ? 83   LEU C CD1   1 
ATOM   7228  C  CD2   . LEU C  3  83  ? 24.923  132.685 65.336  1.00 30.18  ? 83   LEU C CD2   1 
ATOM   7229  N  N     . HIS C  3  84  ? 23.466  134.348 70.043  1.00 39.06  ? 84   HIS C N     1 
ATOM   7230  C  CA    . HIS C  3  84  ? 23.192  133.950 71.425  1.00 38.35  ? 84   HIS C CA    1 
ATOM   7231  C  C     . HIS C  3  84  ? 21.731  133.646 71.540  1.00 39.00  ? 84   HIS C C     1 
ATOM   7232  O  O     . HIS C  3  84  ? 21.351  132.558 71.989  1.00 39.90  ? 84   HIS C O     1 
ATOM   7233  C  CB    . HIS C  3  84  ? 23.538  135.049 72.441  1.00 36.75  ? 84   HIS C CB    1 
ATOM   7234  C  CG    . HIS C  3  84  ? 23.509  134.578 73.873  1.00 37.29  ? 84   HIS C CG    1 
ATOM   7235  N  ND1   . HIS C  3  84  ? 24.282  133.527 74.323  1.00 38.02  ? 84   HIS C ND1   1 
ATOM   7236  C  CD2   . HIS C  3  84  ? 22.818  135.020 74.957  1.00 35.67  ? 84   HIS C CD2   1 
ATOM   7237  C  CE1   . HIS C  3  84  ? 24.073  133.346 75.616  1.00 35.94  ? 84   HIS C CE1   1 
ATOM   7238  N  NE2   . HIS C  3  84  ? 23.189  134.237 76.030  1.00 33.85  ? 84   HIS C NE2   1 
ATOM   7239  N  N     . ALA C  3  85  ? 20.914  134.605 71.110  1.00 38.73  ? 85   ALA C N     1 
ATOM   7240  C  CA    . ALA C  3  85  ? 19.465  134.462 71.173  1.00 39.16  ? 85   ALA C CA    1 
ATOM   7241  C  C     . ALA C  3  85  ? 18.879  133.267 70.409  1.00 39.05  ? 85   ALA C C     1 
ATOM   7242  O  O     . ALA C  3  85  ? 18.152  132.457 70.996  1.00 39.19  ? 85   ALA C O     1 
ATOM   7243  C  CB    . ALA C  3  85  ? 18.801  135.748 70.727  1.00 39.31  ? 85   ALA C CB    1 
ATOM   7244  N  N     . ASN C  3  86  ? 19.169  133.141 69.116  1.00 37.98  ? 86   ASN C N     1 
ATOM   7245  C  CA    . ASN C  3  86  ? 18.626  132.007 68.397  1.00 38.58  ? 86   ASN C CA    1 
ATOM   7246  C  C     . ASN C  3  86  ? 19.273  130.746 68.910  1.00 38.89  ? 86   ASN C C     1 
ATOM   7247  O  O     . ASN C  3  86  ? 18.658  129.669 68.896  1.00 39.34  ? 86   ASN C O     1 
ATOM   7248  C  CB    . ASN C  3  86  ? 18.871  132.126 66.918  1.00 39.94  ? 86   ASN C CB    1 
ATOM   7249  C  CG    . ASN C  3  86  ? 18.099  133.243 66.312  1.00 42.78  ? 86   ASN C CG    1 
ATOM   7250  O  OD1   . ASN C  3  86  ? 18.601  134.360 66.223  1.00 45.20  ? 86   ASN C OD1   1 
ATOM   7251  N  ND2   . ASN C  3  86  ? 16.858  132.967 65.902  1.00 43.06  ? 86   ASN C ND2   1 
ATOM   7252  N  N     . GLY C  3  87  ? 20.522  130.878 69.355  1.00 37.78  ? 87   GLY C N     1 
ATOM   7253  C  CA    . GLY C  3  87  ? 21.222  129.730 69.908  1.00 35.50  ? 87   GLY C CA    1 
ATOM   7254  C  C     . GLY C  3  87  ? 20.288  129.093 70.923  1.00 33.23  ? 87   GLY C C     1 
ATOM   7255  O  O     . GLY C  3  87  ? 19.994  127.889 70.882  1.00 33.42  ? 87   GLY C O     1 
ATOM   7256  N  N     . ALA C  3  88  ? 19.797  129.924 71.828  1.00 29.25  ? 88   ALA C N     1 
ATOM   7257  C  CA    . ALA C  3  88  ? 18.889  129.456 72.835  1.00 27.62  ? 88   ALA C CA    1 
ATOM   7258  C  C     . ALA C  3  88  ? 17.841  128.540 72.209  1.00 27.25  ? 88   ALA C C     1 
ATOM   7259  O  O     . ALA C  3  88  ? 17.716  127.363 72.573  1.00 24.94  ? 88   ALA C O     1 
ATOM   7260  C  CB    . ALA C  3  88  ? 18.238  130.627 73.467  1.00 27.95  ? 88   ALA C CB    1 
ATOM   7261  N  N     . SER C  3  89  ? 17.099  129.094 71.254  1.00 28.11  ? 89   SER C N     1 
ATOM   7262  C  CA    . SER C  3  89  ? 16.040  128.359 70.567  1.00 29.25  ? 89   SER C CA    1 
ATOM   7263  C  C     . SER C  3  89  ? 16.576  127.058 70.020  1.00 28.47  ? 89   SER C C     1 
ATOM   7264  O  O     . SER C  3  89  ? 16.042  125.984 70.325  1.00 27.73  ? 89   SER C O     1 
ATOM   7265  C  CB    . SER C  3  89  ? 15.447  129.194 69.429  1.00 29.67  ? 89   SER C CB    1 
ATOM   7266  O  OG    . SER C  3  89  ? 14.879  130.394 69.927  1.00 32.46  ? 89   SER C OG    1 
ATOM   7267  N  N     . PHE C  3  90  ? 17.635  127.151 69.221  1.00 27.63  ? 90   PHE C N     1 
ATOM   7268  C  CA    . PHE C  3  90  ? 18.219  125.951 68.651  1.00 27.64  ? 90   PHE C CA    1 
ATOM   7269  C  C     . PHE C  3  90  ? 18.659  124.981 69.731  1.00 26.92  ? 90   PHE C C     1 
ATOM   7270  O  O     . PHE C  3  90  ? 18.663  123.756 69.529  1.00 25.03  ? 90   PHE C O     1 
ATOM   7271  C  CB    . PHE C  3  90  ? 19.371  126.296 67.716  1.00 27.87  ? 90   PHE C CB    1 
ATOM   7272  C  CG    . PHE C  3  90  ? 18.951  126.382 66.274  1.00 28.73  ? 90   PHE C CG    1 
ATOM   7273  C  CD1   . PHE C  3  90  ? 18.383  127.533 65.769  1.00 28.73  ? 90   PHE C CD1   1 
ATOM   7274  C  CD2   . PHE C  3  90  ? 19.051  125.275 65.443  1.00 28.55  ? 90   PHE C CD2   1 
ATOM   7275  C  CE1   . PHE C  3  90  ? 17.921  127.578 64.463  1.00 28.63  ? 90   PHE C CE1   1 
ATOM   7276  C  CE2   . PHE C  3  90  ? 18.589  125.316 64.142  1.00 28.23  ? 90   PHE C CE2   1 
ATOM   7277  C  CZ    . PHE C  3  90  ? 18.023  126.467 63.652  1.00 28.89  ? 90   PHE C CZ    1 
ATOM   7278  N  N     . PHE C  3  91  ? 19.012  125.526 70.887  1.00 26.05  ? 91   PHE C N     1 
ATOM   7279  C  CA    . PHE C  3  91  ? 19.392  124.667 71.980  1.00 26.46  ? 91   PHE C CA    1 
ATOM   7280  C  C     . PHE C  3  91  ? 18.145  123.852 72.258  1.00 26.26  ? 91   PHE C C     1 
ATOM   7281  O  O     . PHE C  3  91  ? 18.160  122.638 72.039  1.00 27.09  ? 91   PHE C O     1 
ATOM   7282  C  CB    . PHE C  3  91  ? 19.753  125.467 73.214  1.00 29.35  ? 91   PHE C CB    1 
ATOM   7283  C  CG    . PHE C  3  91  ? 20.518  124.674 74.247  1.00 32.51  ? 91   PHE C CG    1 
ATOM   7284  C  CD1   . PHE C  3  91  ? 20.053  123.423 74.672  1.00 32.26  ? 91   PHE C CD1   1 
ATOM   7285  C  CD2   . PHE C  3  91  ? 21.690  125.191 74.823  1.00 33.14  ? 91   PHE C CD2   1 
ATOM   7286  C  CE1   . PHE C  3  91  ? 20.737  122.696 75.660  1.00 31.26  ? 91   PHE C CE1   1 
ATOM   7287  C  CE2   . PHE C  3  91  ? 22.380  124.475 75.810  1.00 32.45  ? 91   PHE C CE2   1 
ATOM   7288  C  CZ    . PHE C  3  91  ? 21.899  123.222 76.229  1.00 31.93  ? 91   PHE C CZ    1 
ATOM   7289  N  N     . PHE C  3  92  ? 17.068  124.519 72.710  1.00 24.31  ? 92   PHE C N     1 
ATOM   7290  C  CA    . PHE C  3  92  ? 15.785  123.845 73.009  1.00 21.33  ? 92   PHE C CA    1 
ATOM   7291  C  C     . PHE C  3  92  ? 15.315  122.888 71.919  1.00 19.31  ? 92   PHE C C     1 
ATOM   7292  O  O     . PHE C  3  92  ? 14.758  121.822 72.217  1.00 16.96  ? 92   PHE C O     1 
ATOM   7293  C  CB    . PHE C  3  92  ? 14.677  124.849 73.275  1.00 19.66  ? 92   PHE C CB    1 
ATOM   7294  C  CG    . PHE C  3  92  ? 14.680  125.370 74.654  1.00 19.58  ? 92   PHE C CG    1 
ATOM   7295  C  CD1   . PHE C  3  92  ? 15.406  126.502 74.983  1.00 20.45  ? 92   PHE C CD1   1 
ATOM   7296  C  CD2   . PHE C  3  92  ? 13.987  124.707 75.648  1.00 20.47  ? 92   PHE C CD2   1 
ATOM   7297  C  CE1   . PHE C  3  92  ? 15.437  126.969 76.308  1.00 22.56  ? 92   PHE C CE1   1 
ATOM   7298  C  CE2   . PHE C  3  92  ? 14.012  125.162 76.980  1.00 22.44  ? 92   PHE C CE2   1 
ATOM   7299  C  CZ    . PHE C  3  92  ? 14.736  126.291 77.312  1.00 21.78  ? 92   PHE C CZ    1 
ATOM   7300  N  N     . ILE C  3  93  ? 15.517  123.277 70.662  1.00 17.04  ? 93   ILE C N     1 
ATOM   7301  C  CA    . ILE C  3  93  ? 15.165  122.395 69.569  1.00 16.92  ? 93   ILE C CA    1 
ATOM   7302  C  C     . ILE C  3  93  ? 15.953  121.118 69.765  1.00 16.49  ? 93   ILE C C     1 
ATOM   7303  O  O     . ILE C  3  93  ? 15.410  120.050 70.041  1.00 16.52  ? 93   ILE C O     1 
ATOM   7304  C  CB    . ILE C  3  93  ? 15.577  122.939 68.235  1.00 15.90  ? 93   ILE C CB    1 
ATOM   7305  C  CG1   . ILE C  3  93  ? 14.742  124.166 67.901  1.00 17.19  ? 93   ILE C CG1   1 
ATOM   7306  C  CG2   . ILE C  3  93  ? 15.398  121.856 67.190  1.00 14.20  ? 93   ILE C CG2   1 
ATOM   7307  C  CD1   . ILE C  3  93  ? 15.099  124.790 66.565  1.00 20.33  ? 93   ILE C CD1   1 
ATOM   7308  N  N     . CYS C  3  94  ? 17.252  121.227 69.609  1.00 15.21  ? 94   CYS C N     1 
ATOM   7309  C  CA    . CYS C  3  94  ? 18.056  120.061 69.814  1.00 18.39  ? 94   CYS C CA    1 
ATOM   7310  C  C     . CYS C  3  94  ? 17.627  119.242 71.037  1.00 20.19  ? 94   CYS C C     1 
ATOM   7311  O  O     . CYS C  3  94  ? 17.512  118.017 70.944  1.00 21.81  ? 94   CYS C O     1 
ATOM   7312  C  CB    . CYS C  3  94  ? 19.496  120.480 69.967  1.00 18.87  ? 94   CYS C CB    1 
ATOM   7313  S  SG    . CYS C  3  94  ? 20.238  120.899 68.405  1.00 22.01  ? 94   CYS C SG    1 
ATOM   7314  N  N     . ILE C  3  95  ? 17.378  119.901 72.171  1.00 19.83  ? 95   ILE C N     1 
ATOM   7315  C  CA    . ILE C  3  95  ? 17.006  119.179 73.384  1.00 19.29  ? 95   ILE C CA    1 
ATOM   7316  C  C     . ILE C  3  95  ? 15.681  118.446 73.300  1.00 20.80  ? 95   ILE C C     1 
ATOM   7317  O  O     . ILE C  3  95  ? 15.556  117.326 73.805  1.00 19.94  ? 95   ILE C O     1 
ATOM   7318  C  CB    . ILE C  3  95  ? 16.980  120.092 74.625  1.00 19.17  ? 95   ILE C CB    1 
ATOM   7319  C  CG1   . ILE C  3  95  ? 16.887  119.220 75.884  1.00 20.03  ? 95   ILE C CG1   1 
ATOM   7320  C  CG2   . ILE C  3  95  ? 15.804  121.042 74.561  1.00 17.25  ? 95   ILE C CG2   1 
ATOM   7321  C  CD1   . ILE C  3  95  ? 17.214  119.937 77.185  1.00 19.61  ? 95   ILE C CD1   1 
ATOM   7322  N  N     . PHE C  3  96  ? 14.688  119.062 72.667  1.00 21.59  ? 96   PHE C N     1 
ATOM   7323  C  CA    . PHE C  3  96  ? 13.393  118.403 72.530  1.00 23.22  ? 96   PHE C CA    1 
ATOM   7324  C  C     . PHE C  3  96  ? 13.477  117.148 71.668  1.00 22.95  ? 96   PHE C C     1 
ATOM   7325  O  O     . PHE C  3  96  ? 12.826  116.157 71.936  1.00 22.67  ? 96   PHE C O     1 
ATOM   7326  C  CB    . PHE C  3  96  ? 12.372  119.358 71.939  1.00 24.49  ? 96   PHE C CB    1 
ATOM   7327  C  CG    . PHE C  3  96  ? 11.912  120.391 72.894  1.00 25.64  ? 96   PHE C CG    1 
ATOM   7328  C  CD1   . PHE C  3  96  ? 11.313  120.015 74.083  1.00 26.94  ? 96   PHE C CD1   1 
ATOM   7329  C  CD2   . PHE C  3  96  ? 12.077  121.737 72.618  1.00 25.90  ? 96   PHE C CD2   1 
ATOM   7330  C  CE1   . PHE C  3  96  ? 10.880  120.967 74.988  1.00 27.90  ? 96   PHE C CE1   1 
ATOM   7331  C  CE2   . PHE C  3  96  ? 11.650  122.701 73.515  1.00 27.27  ? 96   PHE C CE2   1 
ATOM   7332  C  CZ    . PHE C  3  96  ? 11.049  122.317 74.704  1.00 27.05  ? 96   PHE C CZ    1 
ATOM   7333  N  N     . LEU C  3  97  ? 14.268  117.190 70.616  1.00 23.24  ? 97   LEU C N     1 
ATOM   7334  C  CA    . LEU C  3  97  ? 14.412  116.013 69.790  1.00 24.31  ? 97   LEU C CA    1 
ATOM   7335  C  C     . LEU C  3  97  ? 15.233  114.985 70.588  1.00 24.67  ? 97   LEU C C     1 
ATOM   7336  O  O     . LEU C  3  97  ? 14.867  113.816 70.643  1.00 24.40  ? 97   LEU C O     1 
ATOM   7337  C  CB    . LEU C  3  97  ? 15.114  116.394 68.487  1.00 25.89  ? 97   LEU C CB    1 
ATOM   7338  C  CG    . LEU C  3  97  ? 14.542  117.632 67.786  1.00 25.57  ? 97   LEU C CG    1 
ATOM   7339  C  CD1   . LEU C  3  97  ? 15.273  117.861 66.489  1.00 24.96  ? 97   LEU C CD1   1 
ATOM   7340  C  CD2   . LEU C  3  97  ? 13.064  117.439 67.524  1.00 25.14  ? 97   LEU C CD2   1 
ATOM   7341  N  N     . HIS C  3  98  ? 16.326  115.430 71.218  1.00 24.85  ? 98   HIS C N     1 
ATOM   7342  C  CA    . HIS C  3  98  ? 17.180  114.556 72.030  1.00 24.95  ? 98   HIS C CA    1 
ATOM   7343  C  C     . HIS C  3  98  ? 16.303  113.797 73.011  1.00 23.93  ? 98   HIS C C     1 
ATOM   7344  O  O     . HIS C  3  98  ? 16.558  112.625 73.324  1.00 23.77  ? 98   HIS C O     1 
ATOM   7345  C  CB    . HIS C  3  98  ? 18.218  115.371 72.809  1.00 27.92  ? 98   HIS C CB    1 
ATOM   7346  C  CG    . HIS C  3  98  ? 19.226  114.539 73.566  1.00 32.33  ? 98   HIS C CG    1 
ATOM   7347  N  ND1   . HIS C  3  98  ? 20.231  113.822 72.941  1.00 34.06  ? 98   HIS C ND1   1 
ATOM   7348  C  CD2   . HIS C  3  98  ? 19.431  114.382 74.900  1.00 31.39  ? 98   HIS C CD2   1 
ATOM   7349  C  CE1   . HIS C  3  98  ? 21.012  113.271 73.860  1.00 33.02  ? 98   HIS C CE1   1 
ATOM   7350  N  NE2   . HIS C  3  98  ? 20.554  113.596 75.060  1.00 30.79  ? 98   HIS C NE2   1 
ATOM   7351  N  N     . ILE C  3  99  ? 15.267  114.462 73.509  1.00 22.30  ? 99   ILE C N     1 
ATOM   7352  C  CA    . ILE C  3  99  ? 14.358  113.779 74.425  1.00 22.65  ? 99   ILE C CA    1 
ATOM   7353  C  C     . ILE C  3  99  ? 13.489  112.831 73.612  1.00 22.42  ? 99   ILE C C     1 
ATOM   7354  O  O     . ILE C  3  99  ? 13.273  111.684 73.989  1.00 21.53  ? 99   ILE C O     1 
ATOM   7355  C  CB    . ILE C  3  99  ? 13.408  114.738 75.197  1.00 22.09  ? 99   ILE C CB    1 
ATOM   7356  C  CG1   . ILE C  3  99  ? 14.203  115.683 76.103  1.00 22.62  ? 99   ILE C CG1   1 
ATOM   7357  C  CG2   . ILE C  3  99  ? 12.456  113.921 76.039  1.00 19.74  ? 99   ILE C CG2   1 
ATOM   7358  C  CD1   . ILE C  3  99  ? 13.397  116.332 77.202  1.00 20.68  ? 99   ILE C CD1   1 
ATOM   7359  N  N     . GLY C  3  100 ? 12.992  113.330 72.485  1.00 23.60  ? 100  GLY C N     1 
ATOM   7360  C  CA    . GLY C  3  100 ? 12.144  112.522 71.630  1.00 24.36  ? 100  GLY C CA    1 
ATOM   7361  C  C     . GLY C  3  100 ? 12.794  111.180 71.500  1.00 24.07  ? 100  GLY C C     1 
ATOM   7362  O  O     . GLY C  3  100 ? 12.303  110.189 72.029  1.00 23.16  ? 100  GLY C O     1 
ATOM   7363  N  N     . ARG C  3  101 ? 13.923  111.176 70.812  1.00 25.28  ? 101  ARG C N     1 
ATOM   7364  C  CA    . ARG C  3  101 ? 14.687  109.971 70.604  1.00 27.48  ? 101  ARG C CA    1 
ATOM   7365  C  C     . ARG C  3  101 ? 14.600  109.125 71.843  1.00 28.31  ? 101  ARG C C     1 
ATOM   7366  O  O     . ARG C  3  101 ? 14.054  108.022 71.813  1.00 28.48  ? 101  ARG C O     1 
ATOM   7367  C  CB    . ARG C  3  101 ? 16.146  110.310 70.340  1.00 29.53  ? 101  ARG C CB    1 
ATOM   7368  C  CG    . ARG C  3  101 ? 17.072  109.092 70.323  1.00 32.07  ? 101  ARG C CG    1 
ATOM   7369  C  CD    . ARG C  3  101 ? 17.301  108.506 71.725  1.00 33.95  ? 101  ARG C CD    1 
ATOM   7370  N  NE    . ARG C  3  101 ? 18.164  109.345 72.532  1.00 34.36  ? 101  ARG C NE    1 
ATOM   7371  C  CZ    . ARG C  3  101 ? 19.432  109.565 72.214  1.00 36.99  ? 101  ARG C CZ    1 
ATOM   7372  N  NH1   . ARG C  3  101 ? 19.952  108.999 71.122  1.00 36.16  ? 101  ARG C NH1   1 
ATOM   7373  N  NH2   . ARG C  3  101 ? 20.177  110.345 72.980  1.00 39.26  ? 101  ARG C NH2   1 
ATOM   7374  N  N     . GLY C  3  102 ? 15.159  109.635 72.933  1.00 28.78  ? 102  GLY C N     1 
ATOM   7375  C  CA    . GLY C  3  102 ? 15.127  108.883 74.174  1.00 30.53  ? 102  GLY C CA    1 
ATOM   7376  C  C     . GLY C  3  102 ? 13.810  108.162 74.481  1.00 30.42  ? 102  GLY C C     1 
ATOM   7377  O  O     . GLY C  3  102 ? 13.807  106.992 74.894  1.00 30.05  ? 102  GLY C O     1 
ATOM   7378  N  N     . LEU C  3  103 ? 12.690  108.854 74.272  1.00 29.18  ? 103  LEU C N     1 
ATOM   7379  C  CA    . LEU C  3  103 ? 11.393  108.281 74.556  1.00 27.20  ? 103  LEU C CA    1 
ATOM   7380  C  C     . LEU C  3  103 ? 11.058  107.115 73.670  1.00 28.10  ? 103  LEU C C     1 
ATOM   7381  O  O     . LEU C  3  103 ? 10.716  106.051 74.164  1.00 28.38  ? 103  LEU C O     1 
ATOM   7382  C  CB    . LEU C  3  103 ? 10.299  109.326 74.416  1.00 23.46  ? 103  LEU C CB    1 
ATOM   7383  C  CG    . LEU C  3  103 ? 8.945   108.713 74.747  1.00 21.21  ? 103  LEU C CG    1 
ATOM   7384  C  CD1   . LEU C  3  103 ? 9.086   107.978 76.039  1.00 18.03  ? 103  LEU C CD1   1 
ATOM   7385  C  CD2   . LEU C  3  103 ? 7.853   109.769 74.834  1.00 21.11  ? 103  LEU C CD2   1 
ATOM   7386  N  N     . TYR C  3  104 ? 11.162  107.328 72.364  1.00 29.39  ? 104  TYR C N     1 
ATOM   7387  C  CA    . TYR C  3  104 ? 10.833  106.319 71.360  1.00 32.20  ? 104  TYR C CA    1 
ATOM   7388  C  C     . TYR C  3  104 ? 11.740  105.104 71.320  1.00 34.37  ? 104  TYR C C     1 
ATOM   7389  O  O     . TYR C  3  104 ? 11.327  104.034 70.873  1.00 35.89  ? 104  TYR C O     1 
ATOM   7390  C  CB    . TYR C  3  104 ? 10.812  106.968 69.991  1.00 31.98  ? 104  TYR C CB    1 
ATOM   7391  C  CG    . TYR C  3  104 ? 10.506  106.069 68.833  1.00 32.65  ? 104  TYR C CG    1 
ATOM   7392  C  CD1   . TYR C  3  104 ? 9.199   105.854 68.436  1.00 34.30  ? 104  TYR C CD1   1 
ATOM   7393  C  CD2   . TYR C  3  104 ? 11.530  105.554 68.043  1.00 33.53  ? 104  TYR C CD2   1 
ATOM   7394  C  CE1   . TYR C  3  104 ? 8.907   105.161 67.250  1.00 38.01  ? 104  TYR C CE1   1 
ATOM   7395  C  CE2   . TYR C  3  104 ? 11.265  104.864 66.864  1.00 36.46  ? 104  TYR C CE2   1 
ATOM   7396  C  CZ    . TYR C  3  104 ? 9.949   104.674 66.459  1.00 38.55  ? 104  TYR C CZ    1 
ATOM   7397  O  OH    . TYR C  3  104 ? 9.679   104.070 65.240  1.00 38.46  ? 104  TYR C OH    1 
ATOM   7398  N  N     . TYR C  3  105 ? 12.979  105.244 71.764  1.00 36.32  ? 105  TYR C N     1 
ATOM   7399  C  CA    . TYR C  3  105 ? 13.850  104.078 71.757  1.00 38.89  ? 105  TYR C CA    1 
ATOM   7400  C  C     . TYR C  3  105 ? 14.173  103.617 73.171  1.00 40.02  ? 105  TYR C C     1 
ATOM   7401  O  O     . TYR C  3  105 ? 15.170  102.934 73.411  1.00 41.05  ? 105  TYR C O     1 
ATOM   7402  C  CB    . TYR C  3  105 ? 15.137  104.369 71.015  1.00 39.17  ? 105  TYR C CB    1 
ATOM   7403  C  CG    . TYR C  3  105 ? 14.957  104.647 69.552  1.00 40.25  ? 105  TYR C CG    1 
ATOM   7404  C  CD1   . TYR C  3  105 ? 14.550  105.895 69.109  1.00 40.81  ? 105  TYR C CD1   1 
ATOM   7405  C  CD2   . TYR C  3  105 ? 15.284  103.682 68.603  1.00 41.58  ? 105  TYR C CD2   1 
ATOM   7406  C  CE1   . TYR C  3  105 ? 14.488  106.185 67.755  1.00 43.68  ? 105  TYR C CE1   1 
ATOM   7407  C  CE2   . TYR C  3  105 ? 15.227  103.955 67.247  1.00 43.56  ? 105  TYR C CE2   1 
ATOM   7408  C  CZ    . TYR C  3  105 ? 14.834  105.214 66.824  1.00 44.88  ? 105  TYR C CZ    1 
ATOM   7409  O  OH    . TYR C  3  105 ? 14.847  105.520 65.474  1.00 46.74  ? 105  TYR C OH    1 
ATOM   7410  N  N     . GLY C  3  106 ? 13.322  104.007 74.109  1.00 39.98  ? 106  GLY C N     1 
ATOM   7411  C  CA    . GLY C  3  106 ? 13.520  103.613 75.487  1.00 38.39  ? 106  GLY C CA    1 
ATOM   7412  C  C     . GLY C  3  106 ? 14.945  103.724 75.971  1.00 37.02  ? 106  GLY C C     1 
ATOM   7413  O  O     . GLY C  3  106 ? 15.470  102.817 76.604  1.00 36.78  ? 106  GLY C O     1 
ATOM   7414  N  N     . SER C  3  107 ? 15.598  104.825 75.661  1.00 36.04  ? 107  SER C N     1 
ATOM   7415  C  CA    . SER C  3  107 ? 16.939  104.972 76.151  1.00 37.16  ? 107  SER C CA    1 
ATOM   7416  C  C     . SER C  3  107 ? 16.756  105.243 77.636  1.00 38.53  ? 107  SER C C     1 
ATOM   7417  O  O     . SER C  3  107 ? 17.655  105.028 78.447  1.00 39.23  ? 107  SER C O     1 
ATOM   7418  C  CB    . SER C  3  107 ? 17.609  106.145 75.467  1.00 37.20  ? 107  SER C CB    1 
ATOM   7419  O  OG    . SER C  3  107 ? 17.542  105.976 74.067  1.00 37.19  ? 107  SER C OG    1 
ATOM   7420  N  N     . TYR C  3  108 ? 15.561  105.693 77.992  1.00 39.45  ? 108  TYR C N     1 
ATOM   7421  C  CA    . TYR C  3  108 ? 15.252  105.999 79.375  1.00 40.86  ? 108  TYR C CA    1 
ATOM   7422  C  C     . TYR C  3  108 ? 15.442  104.806 80.298  1.00 41.58  ? 108  TYR C C     1 
ATOM   7423  O  O     . TYR C  3  108 ? 15.167  104.885 81.491  1.00 42.61  ? 108  TYR C O     1 
ATOM   7424  C  CB    . TYR C  3  108 ? 13.825  106.531 79.491  1.00 41.75  ? 108  TYR C CB    1 
ATOM   7425  C  CG    . TYR C  3  108 ? 12.762  105.593 78.978  1.00 44.44  ? 108  TYR C CG    1 
ATOM   7426  C  CD1   . TYR C  3  108 ? 12.310  104.523 79.745  1.00 45.51  ? 108  TYR C CD1   1 
ATOM   7427  C  CD2   . TYR C  3  108 ? 12.165  105.811 77.739  1.00 46.51  ? 108  TYR C CD2   1 
ATOM   7428  C  CE1   . TYR C  3  108 ? 11.270  103.691 79.290  1.00 48.20  ? 108  TYR C CE1   1 
ATOM   7429  C  CE2   . TYR C  3  108 ? 11.127  104.994 77.271  1.00 48.07  ? 108  TYR C CE2   1 
ATOM   7430  C  CZ    . TYR C  3  108 ? 10.678  103.938 78.048  1.00 49.10  ? 108  TYR C CZ    1 
ATOM   7431  O  OH    . TYR C  3  108 ? 9.621   103.170 77.587  1.00 50.30  ? 108  TYR C OH    1 
ATOM   7432  N  N     . LEU C  3  109 ? 15.904  103.684 79.772  1.00 41.92  ? 109  LEU C N     1 
ATOM   7433  C  CA    . LEU C  3  109 ? 16.110  102.556 80.656  1.00 41.98  ? 109  LEU C CA    1 
ATOM   7434  C  C     . LEU C  3  109 ? 17.487  102.685 81.286  1.00 42.96  ? 109  LEU C C     1 
ATOM   7435  O  O     . LEU C  3  109 ? 17.841  101.956 82.212  1.00 42.34  ? 109  LEU C O     1 
ATOM   7436  C  CB    . LEU C  3  109 ? 15.941  101.244 79.901  1.00 40.20  ? 109  LEU C CB    1 
ATOM   7437  C  CG    . LEU C  3  109 ? 14.471  100.919 79.616  1.00 38.24  ? 109  LEU C CG    1 
ATOM   7438  C  CD1   . LEU C  3  109 ? 14.334  99.442  79.373  1.00 39.98  ? 109  LEU C CD1   1 
ATOM   7439  C  CD2   . LEU C  3  109 ? 13.607  101.277 80.779  1.00 35.99  ? 109  LEU C CD2   1 
ATOM   7440  N  N     . TYR C  3  110 ? 18.255  103.638 80.774  1.00 44.09  ? 110  TYR C N     1 
ATOM   7441  C  CA    . TYR C  3  110 ? 19.573  103.918 81.309  1.00 46.29  ? 110  TYR C CA    1 
ATOM   7442  C  C     . TYR C  3  110 ? 19.348  104.915 82.442  1.00 47.81  ? 110  TYR C C     1 
ATOM   7443  O  O     . TYR C  3  110 ? 20.120  105.863 82.631  1.00 47.90  ? 110  TYR C O     1 
ATOM   7444  C  CB    . TYR C  3  110 ? 20.458  104.564 80.256  1.00 46.97  ? 110  TYR C CB    1 
ATOM   7445  C  CG    . TYR C  3  110 ? 20.904  103.659 79.134  1.00 48.17  ? 110  TYR C CG    1 
ATOM   7446  C  CD1   . TYR C  3  110 ? 20.986  102.277 79.307  1.00 48.57  ? 110  TYR C CD1   1 
ATOM   7447  C  CD2   . TYR C  3  110 ? 21.342  104.200 77.921  1.00 48.73  ? 110  TYR C CD2   1 
ATOM   7448  C  CE1   . TYR C  3  110 ? 21.499  101.461 78.303  1.00 48.85  ? 110  TYR C CE1   1 
ATOM   7449  C  CE2   . TYR C  3  110 ? 21.854  103.397 76.918  1.00 48.89  ? 110  TYR C CE2   1 
ATOM   7450  C  CZ    . TYR C  3  110 ? 21.929  102.037 77.120  1.00 49.40  ? 110  TYR C CZ    1 
ATOM   7451  O  OH    . TYR C  3  110 ? 22.441  101.256 76.130  1.00 52.90  ? 110  TYR C OH    1 
ATOM   7452  N  N     . LYS C  3  111 ? 18.264  104.680 83.177  1.00 48.77  ? 111  LYS C N     1 
ATOM   7453  C  CA    . LYS C  3  111 ? 17.836  105.507 84.299  1.00 48.70  ? 111  LYS C CA    1 
ATOM   7454  C  C     . LYS C  3  111 ? 18.700  106.700 84.685  1.00 47.93  ? 111  LYS C C     1 
ATOM   7455  O  O     . LYS C  3  111 ? 18.312  107.844 84.436  1.00 48.13  ? 111  LYS C O     1 
ATOM   7456  C  CB    . LYS C  3  111 ? 17.589  104.627 85.518  1.00 50.17  ? 111  LYS C CB    1 
ATOM   7457  C  CG    . LYS C  3  111 ? 16.344  103.746 85.377  1.00 53.62  ? 111  LYS C CG    1 
ATOM   7458  C  CD    . LYS C  3  111 ? 16.081  102.910 86.641  1.00 56.12  ? 111  LYS C CD    1 
ATOM   7459  C  CE    . LYS C  3  111 ? 14.743  102.155 86.569  1.00 57.56  ? 111  LYS C CE    1 
ATOM   7460  N  NZ    . LYS C  3  111 ? 14.631  101.255 85.379  1.00 60.24  ? 111  LYS C NZ    1 
ATOM   7461  N  N     . GLU C  3  112 ? 19.857  106.457 85.291  1.00 47.11  ? 112  GLU C N     1 
ATOM   7462  C  CA    . GLU C  3  112 ? 20.712  107.573 85.695  1.00 47.02  ? 112  GLU C CA    1 
ATOM   7463  C  C     . GLU C  3  112 ? 21.025  108.499 84.528  1.00 43.71  ? 112  GLU C C     1 
ATOM   7464  O  O     . GLU C  3  112 ? 20.837  109.720 84.626  1.00 42.92  ? 112  GLU C O     1 
ATOM   7465  C  CB    . GLU C  3  112 ? 22.015  107.072 86.302  1.00 51.57  ? 112  GLU C CB    1 
ATOM   7466  C  CG    . GLU C  3  112 ? 21.811  106.084 87.418  1.00 59.59  ? 112  GLU C CG    1 
ATOM   7467  C  CD    . GLU C  3  112 ? 22.122  104.655 86.975  1.00 65.08  ? 112  GLU C CD    1 
ATOM   7468  O  OE1   . GLU C  3  112 ? 21.706  104.257 85.849  1.00 65.75  ? 112  GLU C OE1   1 
ATOM   7469  O  OE2   . GLU C  3  112 ? 22.783  103.935 87.767  1.00 68.28  ? 112  GLU C OE2   1 
ATOM   7470  N  N     . THR C  3  113 ? 21.501  107.919 83.427  1.00 39.04  ? 113  THR C N     1 
ATOM   7471  C  CA    . THR C  3  113 ? 21.821  108.706 82.248  1.00 33.80  ? 113  THR C CA    1 
ATOM   7472  C  C     . THR C  3  113 ? 20.637  109.603 81.996  1.00 30.90  ? 113  THR C C     1 
ATOM   7473  O  O     . THR C  3  113 ? 20.788  110.793 81.725  1.00 29.90  ? 113  THR C O     1 
ATOM   7474  C  CB    . THR C  3  113 ? 22.031  107.835 81.006  1.00 33.25  ? 113  THR C CB    1 
ATOM   7475  O  OG1   . THR C  3  113 ? 23.092  106.897 81.236  1.00 33.45  ? 113  THR C OG1   1 
ATOM   7476  C  CG2   . THR C  3  113 ? 22.391  108.709 79.829  1.00 31.79  ? 113  THR C CG2   1 
ATOM   7477  N  N     . TRP C  3  114 ? 19.453  109.014 82.124  1.00 27.61  ? 114  TRP C N     1 
ATOM   7478  C  CA    . TRP C  3  114 ? 18.201  109.722 81.920  1.00 25.36  ? 114  TRP C CA    1 
ATOM   7479  C  C     . TRP C  3  114 ? 17.879  110.750 82.994  1.00 23.49  ? 114  TRP C C     1 
ATOM   7480  O  O     . TRP C  3  114 ? 17.716  111.919 82.687  1.00 22.38  ? 114  TRP C O     1 
ATOM   7481  C  CB    . TRP C  3  114 ? 17.075  108.713 81.789  1.00 25.15  ? 114  TRP C CB    1 
ATOM   7482  C  CG    . TRP C  3  114 ? 15.694  109.279 81.771  1.00 25.88  ? 114  TRP C CG    1 
ATOM   7483  C  CD1   . TRP C  3  114 ? 14.858  109.424 82.840  1.00 26.41  ? 114  TRP C CD1   1 
ATOM   7484  C  CD2   . TRP C  3  114 ? 14.942  109.669 80.620  1.00 26.03  ? 114  TRP C CD2   1 
ATOM   7485  N  NE1   . TRP C  3  114 ? 13.629  109.867 82.425  1.00 26.93  ? 114  TRP C NE1   1 
ATOM   7486  C  CE2   . TRP C  3  114 ? 13.652  110.029 81.067  1.00 25.99  ? 114  TRP C CE2   1 
ATOM   7487  C  CE3   . TRP C  3  114 ? 15.231  109.745 79.256  1.00 27.31  ? 114  TRP C CE3   1 
ATOM   7488  C  CZ2   . TRP C  3  114 ? 12.653  110.458 80.202  1.00 24.98  ? 114  TRP C CZ2   1 
ATOM   7489  C  CZ3   . TRP C  3  114 ? 14.234  110.171 78.393  1.00 28.02  ? 114  TRP C CZ3   1 
ATOM   7490  C  CH2   . TRP C  3  114 ? 12.960  110.521 78.873  1.00 26.90  ? 114  TRP C CH2   1 
ATOM   7491  N  N     . ASN C  3  115 ? 17.798  110.337 84.249  1.00 22.61  ? 115  ASN C N     1 
ATOM   7492  C  CA    . ASN C  3  115 ? 17.491  111.286 85.301  1.00 24.18  ? 115  ASN C CA    1 
ATOM   7493  C  C     . ASN C  3  115 ? 18.314  112.561 85.212  1.00 25.50  ? 115  ASN C C     1 
ATOM   7494  O  O     . ASN C  3  115 ? 17.768  113.676 85.282  1.00 26.27  ? 115  ASN C O     1 
ATOM   7495  C  CB    . ASN C  3  115 ? 17.693  110.651 86.650  1.00 25.39  ? 115  ASN C CB    1 
ATOM   7496  C  CG    . ASN C  3  115 ? 16.695  109.551 86.919  1.00 29.76  ? 115  ASN C CG    1 
ATOM   7497  O  OD1   . ASN C  3  115 ? 15.563  109.560 86.418  1.00 30.85  ? 115  ASN C OD1   1 
ATOM   7498  N  ND2   . ASN C  3  115 ? 17.101  108.595 87.737  1.00 33.50  ? 115  ASN C ND2   1 
ATOM   7499  N  N     . THR C  3  116 ? 19.627  112.404 85.062  1.00 25.81  ? 116  THR C N     1 
ATOM   7500  C  CA    . THR C  3  116 ? 20.527  113.563 84.926  1.00 24.73  ? 116  THR C CA    1 
ATOM   7501  C  C     . THR C  3  116 ? 20.043  114.434 83.757  1.00 24.51  ? 116  THR C C     1 
ATOM   7502  O  O     . THR C  3  116 ? 20.077  115.677 83.799  1.00 22.43  ? 116  THR C O     1 
ATOM   7503  C  CB    . THR C  3  116 ? 21.966  113.121 84.622  1.00 23.56  ? 116  THR C CB    1 
ATOM   7504  O  OG1   . THR C  3  116 ? 21.986  112.370 83.396  1.00 23.68  ? 116  THR C OG1   1 
ATOM   7505  C  CG2   . THR C  3  116 ? 22.507  112.276 85.748  1.00 21.23  ? 116  THR C CG2   1 
ATOM   7506  N  N     . GLY C  3  117 ? 19.603  113.760 82.702  1.00 23.57  ? 117  GLY C N     1 
ATOM   7507  C  CA    . GLY C  3  117 ? 19.103  114.484 81.562  1.00 23.68  ? 117  GLY C CA    1 
ATOM   7508  C  C     . GLY C  3  117 ? 18.029  115.454 82.009  1.00 23.37  ? 117  GLY C C     1 
ATOM   7509  O  O     . GLY C  3  117 ? 18.132  116.668 81.782  1.00 21.89  ? 117  GLY C O     1 
ATOM   7510  N  N     . VAL C  3  118 ? 17.000  114.913 82.658  1.00 23.42  ? 118  VAL C N     1 
ATOM   7511  C  CA    . VAL C  3  118 ? 15.896  115.726 83.134  1.00 23.86  ? 118  VAL C CA    1 
ATOM   7512  C  C     . VAL C  3  118 ? 16.531  116.910 83.810  1.00 25.35  ? 118  VAL C C     1 
ATOM   7513  O  O     . VAL C  3  118 ? 16.314  118.055 83.381  1.00 25.99  ? 118  VAL C O     1 
ATOM   7514  C  CB    . VAL C  3  118 ? 15.040  114.990 84.137  1.00 22.47  ? 118  VAL C CB    1 
ATOM   7515  C  CG1   . VAL C  3  118 ? 13.641  115.511 84.084  1.00 21.32  ? 118  VAL C CG1   1 
ATOM   7516  C  CG2   . VAL C  3  118 ? 15.042  113.544 83.817  1.00 23.43  ? 118  VAL C CG2   1 
ATOM   7517  N  N     . ILE C  3  119 ? 17.332  116.634 84.844  1.00 25.12  ? 119  ILE C N     1 
ATOM   7518  C  CA    . ILE C  3  119 ? 18.035  117.701 85.565  1.00 25.48  ? 119  ILE C CA    1 
ATOM   7519  C  C     . ILE C  3  119 ? 18.589  118.737 84.588  1.00 24.84  ? 119  ILE C C     1 
ATOM   7520  O  O     . ILE C  3  119 ? 18.318  119.939 84.722  1.00 23.99  ? 119  ILE C O     1 
ATOM   7521  C  CB    . ILE C  3  119 ? 19.213  117.169 86.402  1.00 25.25  ? 119  ILE C CB    1 
ATOM   7522  C  CG1   . ILE C  3  119 ? 18.684  116.438 87.626  1.00 25.28  ? 119  ILE C CG1   1 
ATOM   7523  C  CG2   . ILE C  3  119 ? 20.088  118.321 86.862  1.00 21.80  ? 119  ILE C CG2   1 
ATOM   7524  C  CD1   . ILE C  3  119 ? 17.920  117.346 88.580  1.00 28.93  ? 119  ILE C CD1   1 
ATOM   7525  N  N     . LEU C  3  120 ? 19.365  118.274 83.611  1.00 22.65  ? 120  LEU C N     1 
ATOM   7526  C  CA    . LEU C  3  120 ? 19.910  119.187 82.626  1.00 22.09  ? 120  LEU C CA    1 
ATOM   7527  C  C     . LEU C  3  120 ? 18.764  120.006 82.010  1.00 22.76  ? 120  LEU C C     1 
ATOM   7528  O  O     . LEU C  3  120 ? 18.765  121.257 82.070  1.00 22.37  ? 120  LEU C O     1 
ATOM   7529  C  CB    . LEU C  3  120 ? 20.679  118.397 81.571  1.00 18.79  ? 120  LEU C CB    1 
ATOM   7530  C  CG    . LEU C  3  120 ? 21.994  117.910 82.183  1.00 17.90  ? 120  LEU C CG    1 
ATOM   7531  C  CD1   . LEU C  3  120 ? 22.315  116.529 81.725  1.00 16.41  ? 120  LEU C CD1   1 
ATOM   7532  C  CD2   . LEU C  3  120 ? 23.106  118.870 81.835  1.00 17.35  ? 120  LEU C CD2   1 
ATOM   7533  N  N     . LEU C  3  121 ? 17.771  119.314 81.453  1.00 21.29  ? 121  LEU C N     1 
ATOM   7534  C  CA    . LEU C  3  121 ? 16.647  120.016 80.855  1.00 20.77  ? 121  LEU C CA    1 
ATOM   7535  C  C     . LEU C  3  121 ? 16.128  121.083 81.785  1.00 20.44  ? 121  LEU C C     1 
ATOM   7536  O  O     . LEU C  3  121 ? 16.123  122.259 81.438  1.00 19.92  ? 121  LEU C O     1 
ATOM   7537  C  CB    . LEU C  3  121 ? 15.504  119.074 80.550  1.00 21.78  ? 121  LEU C CB    1 
ATOM   7538  C  CG    . LEU C  3  121 ? 14.296  119.852 80.021  1.00 21.43  ? 121  LEU C CG    1 
ATOM   7539  C  CD1   . LEU C  3  121 ? 14.653  120.470 78.697  1.00 21.94  ? 121  LEU C CD1   1 
ATOM   7540  C  CD2   . LEU C  3  121 ? 13.109  118.943 79.847  1.00 21.40  ? 121  LEU C CD2   1 
ATOM   7541  N  N     . LEU C  3  122 ? 15.666  120.666 82.959  1.00 19.74  ? 122  LEU C N     1 
ATOM   7542  C  CA    . LEU C  3  122 ? 15.167  121.614 83.947  1.00 21.08  ? 122  LEU C CA    1 
ATOM   7543  C  C     . LEU C  3  122 ? 16.050  122.861 84.017  1.00 22.97  ? 122  LEU C C     1 
ATOM   7544  O  O     . LEU C  3  122 ? 15.575  123.981 83.789  1.00 23.60  ? 122  LEU C O     1 
ATOM   7545  C  CB    . LEU C  3  122 ? 15.106  120.957 85.317  1.00 17.97  ? 122  LEU C CB    1 
ATOM   7546  C  CG    . LEU C  3  122 ? 13.892  120.049 85.439  1.00 17.39  ? 122  LEU C CG    1 
ATOM   7547  C  CD1   . LEU C  3  122 ? 13.869  119.426 86.797  1.00 18.86  ? 122  LEU C CD1   1 
ATOM   7548  C  CD2   . LEU C  3  122 ? 12.632  120.843 85.227  1.00 17.01  ? 122  LEU C CD2   1 
ATOM   7549  N  N     . THR C  3  123 ? 17.334  122.652 84.322  1.00 22.94  ? 123  THR C N     1 
ATOM   7550  C  CA    . THR C  3  123 ? 18.314  123.731 84.410  1.00 22.29  ? 123  THR C CA    1 
ATOM   7551  C  C     . THR C  3  123 ? 18.269  124.611 83.176  1.00 22.65  ? 123  THR C C     1 
ATOM   7552  O  O     . THR C  3  123 ? 18.075  125.819 83.271  1.00 22.44  ? 123  THR C O     1 
ATOM   7553  C  CB    . THR C  3  123 ? 19.724  123.182 84.526  1.00 21.46  ? 123  THR C CB    1 
ATOM   7554  O  OG1   . THR C  3  123 ? 19.809  122.363 85.681  1.00 21.42  ? 123  THR C OG1   1 
ATOM   7555  C  CG2   . THR C  3  123 ? 20.716  124.294 84.685  1.00 21.87  ? 123  THR C CG2   1 
ATOM   7556  N  N     . LEU C  3  124 ? 18.470  124.018 82.012  1.00 22.23  ? 124  LEU C N     1 
ATOM   7557  C  CA    . LEU C  3  124 ? 18.404  124.810 80.806  1.00 24.90  ? 124  LEU C CA    1 
ATOM   7558  C  C     . LEU C  3  124 ? 17.207  125.781 80.862  1.00 25.39  ? 124  LEU C C     1 
ATOM   7559  O  O     . LEU C  3  124 ? 17.356  126.989 80.676  1.00 24.81  ? 124  LEU C O     1 
ATOM   7560  C  CB    . LEU C  3  124 ? 18.249  123.899 79.606  1.00 27.91  ? 124  LEU C CB    1 
ATOM   7561  C  CG    . LEU C  3  124 ? 17.955  124.694 78.325  1.00 31.47  ? 124  LEU C CG    1 
ATOM   7562  C  CD1   . LEU C  3  124 ? 19.079  125.715 78.038  1.00 32.23  ? 124  LEU C CD1   1 
ATOM   7563  C  CD2   . LEU C  3  124 ? 17.792  123.710 77.160  1.00 33.59  ? 124  LEU C CD2   1 
ATOM   7564  N  N     . MET C  3  125 ? 16.018  125.238 81.106  1.00 25.24  ? 125  MET C N     1 
ATOM   7565  C  CA    . MET C  3  125 ? 14.821  126.046 81.212  1.00 25.11  ? 125  MET C CA    1 
ATOM   7566  C  C     . MET C  3  125 ? 15.040  127.219 82.163  1.00 26.28  ? 125  MET C C     1 
ATOM   7567  O  O     . MET C  3  125 ? 14.761  128.369 81.834  1.00 25.08  ? 125  MET C O     1 
ATOM   7568  C  CB    . MET C  3  125 ? 13.689  125.203 81.743  1.00 24.19  ? 125  MET C CB    1 
ATOM   7569  C  CG    . MET C  3  125 ? 13.159  124.230 80.767  1.00 27.61  ? 125  MET C CG    1 
ATOM   7570  S  SD    . MET C  3  125 ? 11.594  123.556 81.377  1.00 33.69  ? 125  MET C SD    1 
ATOM   7571  C  CE    . MET C  3  125 ? 11.782  121.873 80.990  1.00 33.55  ? 125  MET C CE    1 
ATOM   7572  N  N     . ALA C  3  126 ? 15.522  126.923 83.362  1.00 28.05  ? 126  ALA C N     1 
ATOM   7573  C  CA    . ALA C  3  126 ? 15.773  127.972 84.344  1.00 29.69  ? 126  ALA C CA    1 
ATOM   7574  C  C     . ALA C  3  126 ? 16.752  128.953 83.742  1.00 30.85  ? 126  ALA C C     1 
ATOM   7575  O  O     . ALA C  3  126 ? 16.476  130.142 83.640  1.00 31.47  ? 126  ALA C O     1 
ATOM   7576  C  CB    . ALA C  3  126 ? 16.354  127.385 85.607  1.00 28.73  ? 126  ALA C CB    1 
ATOM   7577  N  N     . THR C  3  127 ? 17.906  128.435 83.343  1.00 32.29  ? 127  THR C N     1 
ATOM   7578  C  CA    . THR C  3  127 ? 18.946  129.250 82.745  1.00 33.73  ? 127  THR C CA    1 
ATOM   7579  C  C     . THR C  3  127 ? 18.362  130.194 81.726  1.00 35.42  ? 127  THR C C     1 
ATOM   7580  O  O     . THR C  3  127 ? 18.486  131.407 81.864  1.00 35.45  ? 127  THR C O     1 
ATOM   7581  C  CB    . THR C  3  127 ? 19.975  128.403 82.025  1.00 33.34  ? 127  THR C CB    1 
ATOM   7582  O  OG1   . THR C  3  127 ? 20.760  127.678 82.980  1.00 31.98  ? 127  THR C OG1   1 
ATOM   7583  C  CG2   . THR C  3  127 ? 20.861  129.293 81.179  1.00 33.03  ? 127  THR C CG2   1 
ATOM   7584  N  N     . ALA C  3  128 ? 17.726  129.627 80.701  1.00 37.49  ? 128  ALA C N     1 
ATOM   7585  C  CA    . ALA C  3  128 ? 17.116  130.418 79.628  1.00 39.95  ? 128  ALA C CA    1 
ATOM   7586  C  C     . ALA C  3  128 ? 16.112  131.433 80.172  1.00 41.29  ? 128  ALA C C     1 
ATOM   7587  O  O     . ALA C  3  128 ? 15.867  132.473 79.553  1.00 41.31  ? 128  ALA C O     1 
ATOM   7588  C  CB    . ALA C  3  128 ? 16.435  129.505 78.608  1.00 39.80  ? 128  ALA C CB    1 
ATOM   7589  N  N     . PHE C  3  129 ? 15.523  131.129 81.324  1.00 41.68  ? 129  PHE C N     1 
ATOM   7590  C  CA    . PHE C  3  129 ? 14.574  132.044 81.910  1.00 41.19  ? 129  PHE C CA    1 
ATOM   7591  C  C     . PHE C  3  129 ? 15.295  133.316 82.273  1.00 40.36  ? 129  PHE C C     1 
ATOM   7592  O  O     . PHE C  3  129 ? 15.061  134.343 81.666  1.00 41.22  ? 129  PHE C O     1 
ATOM   7593  C  CB    . PHE C  3  129 ? 13.938  131.446 83.147  1.00 42.28  ? 129  PHE C CB    1 
ATOM   7594  C  CG    . PHE C  3  129 ? 13.264  132.459 84.019  1.00 44.48  ? 129  PHE C CG    1 
ATOM   7595  C  CD1   . PHE C  3  129 ? 12.691  133.601 83.471  1.00 44.32  ? 129  PHE C CD1   1 
ATOM   7596  C  CD2   . PHE C  3  129 ? 13.165  132.253 85.397  1.00 46.69  ? 129  PHE C CD2   1 
ATOM   7597  C  CE1   . PHE C  3  129 ? 12.025  134.527 84.279  1.00 46.31  ? 129  PHE C CE1   1 
ATOM   7598  C  CE2   . PHE C  3  129 ? 12.500  133.171 86.223  1.00 47.12  ? 129  PHE C CE2   1 
ATOM   7599  C  CZ    . PHE C  3  129 ? 11.927  134.312 85.661  1.00 47.24  ? 129  PHE C CZ    1 
ATOM   7600  N  N     . VAL C  3  130 ? 16.178  133.254 83.257  1.00 39.96  ? 130  VAL C N     1 
ATOM   7601  C  CA    . VAL C  3  130 ? 16.911  134.448 83.666  1.00 41.51  ? 130  VAL C CA    1 
ATOM   7602  C  C     . VAL C  3  130 ? 17.553  135.183 82.489  1.00 40.56  ? 130  VAL C C     1 
ATOM   7603  O  O     . VAL C  3  130 ? 17.486  136.413 82.401  1.00 40.95  ? 130  VAL C O     1 
ATOM   7604  C  CB    . VAL C  3  130 ? 18.025  134.116 84.675  1.00 43.40  ? 130  VAL C CB    1 
ATOM   7605  C  CG1   . VAL C  3  130 ? 17.424  133.722 86.019  1.00 42.20  ? 130  VAL C CG1   1 
ATOM   7606  C  CG2   . VAL C  3  130 ? 18.911  133.002 84.112  1.00 45.13  ? 130  VAL C CG2   1 
ATOM   7607  N  N     . GLY C  3  131 ? 18.177  134.432 81.590  1.00 38.50  ? 131  GLY C N     1 
ATOM   7608  C  CA    . GLY C  3  131 ? 18.818  135.051 80.449  1.00 37.54  ? 131  GLY C CA    1 
ATOM   7609  C  C     . GLY C  3  131 ? 17.921  136.077 79.798  1.00 37.23  ? 131  GLY C C     1 
ATOM   7610  O  O     . GLY C  3  131 ? 18.343  137.195 79.508  1.00 37.69  ? 131  GLY C O     1 
ATOM   7611  N  N     . TYR C  3  132 ? 16.670  135.693 79.585  1.00 36.53  ? 132  TYR C N     1 
ATOM   7612  C  CA    . TYR C  3  132 ? 15.682  136.558 78.953  1.00 35.96  ? 132  TYR C CA    1 
ATOM   7613  C  C     . TYR C  3  132 ? 15.383  137.783 79.775  1.00 33.95  ? 132  TYR C C     1 
ATOM   7614  O  O     . TYR C  3  132 ? 15.234  138.865 79.236  1.00 35.45  ? 132  TYR C O     1 
ATOM   7615  C  CB    . TYR C  3  132 ? 14.383  135.795 78.749  1.00 39.36  ? 132  TYR C CB    1 
ATOM   7616  C  CG    . TYR C  3  132 ? 13.403  136.424 77.788  1.00 43.14  ? 132  TYR C CG    1 
ATOM   7617  C  CD1   . TYR C  3  132 ? 13.793  136.800 76.489  1.00 45.20  ? 132  TYR C CD1   1 
ATOM   7618  C  CD2   . TYR C  3  132 ? 12.054  136.518 78.122  1.00 45.02  ? 132  TYR C CD2   1 
ATOM   7619  C  CE1   . TYR C  3  132 ? 12.842  137.241 75.529  1.00 47.96  ? 132  TYR C CE1   1 
ATOM   7620  C  CE2   . TYR C  3  132 ? 11.094  136.960 77.184  1.00 48.74  ? 132  TYR C CE2   1 
ATOM   7621  C  CZ    . TYR C  3  132 ? 11.484  137.309 75.888  1.00 49.81  ? 132  TYR C CZ    1 
ATOM   7622  O  OH    . TYR C  3  132 ? 10.496  137.645 74.969  1.00 50.15  ? 132  TYR C OH    1 
ATOM   7623  N  N     . VAL C  3  133 ? 15.278  137.629 81.080  1.00 30.06  ? 133  VAL C N     1 
ATOM   7624  C  CA    . VAL C  3  133 ? 14.971  138.778 81.880  1.00 28.61  ? 133  VAL C CA    1 
ATOM   7625  C  C     . VAL C  3  133 ? 16.001  139.882 81.776  1.00 29.10  ? 133  VAL C C     1 
ATOM   7626  O  O     . VAL C  3  133 ? 15.649  141.043 81.909  1.00 30.29  ? 133  VAL C O     1 
ATOM   7627  C  CB    . VAL C  3  133 ? 14.820  138.397 83.313  1.00 28.74  ? 133  VAL C CB    1 
ATOM   7628  C  CG1   . VAL C  3  133 ? 14.400  139.600 84.125  1.00 29.23  ? 133  VAL C CG1   1 
ATOM   7629  C  CG2   . VAL C  3  133 ? 13.785  137.322 83.417  1.00 30.38  ? 133  VAL C CG2   1 
ATOM   7630  N  N     . LEU C  3  134 ? 17.260  139.534 81.520  1.00 28.37  ? 134  LEU C N     1 
ATOM   7631  C  CA    . LEU C  3  134 ? 18.342  140.517 81.419  1.00 27.82  ? 134  LEU C CA    1 
ATOM   7632  C  C     . LEU C  3  134 ? 18.121  141.767 80.573  1.00 28.69  ? 134  LEU C C     1 
ATOM   7633  O  O     . LEU C  3  134 ? 18.297  142.876 81.062  1.00 30.76  ? 134  LEU C O     1 
ATOM   7634  C  CB    . LEU C  3  134 ? 19.596  139.846 80.921  1.00 27.28  ? 134  LEU C CB    1 
ATOM   7635  C  CG    . LEU C  3  134 ? 20.055  138.721 81.813  1.00 28.67  ? 134  LEU C CG    1 
ATOM   7636  C  CD1   . LEU C  3  134 ? 21.218  138.072 81.125  1.00 29.98  ? 134  LEU C CD1   1 
ATOM   7637  C  CD2   . LEU C  3  134 ? 20.440  139.236 83.195  1.00 28.26  ? 134  LEU C CD2   1 
ATOM   7638  N  N     . PRO C  3  135 ? 17.756  141.614 79.292  1.00 27.80  ? 135  PRO C N     1 
ATOM   7639  C  CA    . PRO C  3  135 ? 17.515  142.733 78.372  1.00 27.97  ? 135  PRO C CA    1 
ATOM   7640  C  C     . PRO C  3  135 ? 16.543  143.748 78.921  1.00 28.94  ? 135  PRO C C     1 
ATOM   7641  O  O     . PRO C  3  135 ? 16.394  144.841 78.395  1.00 28.44  ? 135  PRO C O     1 
ATOM   7642  C  CB    . PRO C  3  135 ? 16.957  142.053 77.150  1.00 27.90  ? 135  PRO C CB    1 
ATOM   7643  C  CG    . PRO C  3  135 ? 17.628  140.743 77.189  1.00 29.01  ? 135  PRO C CG    1 
ATOM   7644  C  CD    . PRO C  3  135 ? 17.515  140.338 78.615  1.00 27.43  ? 135  PRO C CD    1 
ATOM   7645  N  N     . TRP C  3  136 ? 15.861  143.353 79.981  1.00 30.89  ? 136  TRP C N     1 
ATOM   7646  C  CA    . TRP C  3  136 ? 14.903  144.204 80.665  1.00 31.80  ? 136  TRP C CA    1 
ATOM   7647  C  C     . TRP C  3  136 ? 13.855  144.835 79.766  1.00 33.51  ? 136  TRP C C     1 
ATOM   7648  O  O     . TRP C  3  136 ? 13.535  146.006 79.917  1.00 35.06  ? 136  TRP C O     1 
ATOM   7649  C  CB    . TRP C  3  136 ? 15.628  145.300 81.438  1.00 29.20  ? 136  TRP C CB    1 
ATOM   7650  C  CG    . TRP C  3  136 ? 14.968  145.603 82.739  1.00 28.83  ? 136  TRP C CG    1 
ATOM   7651  C  CD1   . TRP C  3  136 ? 14.453  146.808 83.148  1.00 31.72  ? 136  TRP C CD1   1 
ATOM   7652  C  CD2   . TRP C  3  136 ? 14.765  144.701 83.823  1.00 26.63  ? 136  TRP C CD2   1 
ATOM   7653  N  NE1   . TRP C  3  136 ? 13.946  146.706 84.433  1.00 29.78  ? 136  TRP C NE1   1 
ATOM   7654  C  CE2   . TRP C  3  136 ? 14.125  145.422 84.862  1.00 25.94  ? 136  TRP C CE2   1 
ATOM   7655  C  CE3   . TRP C  3  136 ? 15.056  143.358 84.020  1.00 25.03  ? 136  TRP C CE3   1 
ATOM   7656  C  CZ2   . TRP C  3  136 ? 13.779  144.848 86.051  1.00 23.17  ? 136  TRP C CZ2   1 
ATOM   7657  C  CZ3   . TRP C  3  136 ? 14.708  142.792 85.209  1.00 25.38  ? 136  TRP C CZ3   1 
ATOM   7658  C  CH2   . TRP C  3  136 ? 14.073  143.536 86.214  1.00 24.09  ? 136  TRP C CH2   1 
ATOM   7659  N  N     . GLY C  3  137 ? 13.320  144.059 78.833  1.00 34.69  ? 137  GLY C N     1 
ATOM   7660  C  CA    . GLY C  3  137 ? 12.282  144.580 77.968  1.00 35.71  ? 137  GLY C CA    1 
ATOM   7661  C  C     . GLY C  3  137 ? 10.935  144.311 78.625  1.00 37.31  ? 137  GLY C C     1 
ATOM   7662  O  O     . GLY C  3  137 ? 10.876  143.831 79.764  1.00 38.39  ? 137  GLY C O     1 
ATOM   7663  N  N     . GLN C  3  138 ? 9.847   144.619 77.930  1.00 36.99  ? 138  GLN C N     1 
ATOM   7664  C  CA    . GLN C  3  138 ? 8.526   144.382 78.487  1.00 35.67  ? 138  GLN C CA    1 
ATOM   7665  C  C     . GLN C  3  138 ? 8.379   142.938 78.884  1.00 34.64  ? 138  GLN C C     1 
ATOM   7666  O  O     . GLN C  3  138 ? 8.014   142.638 80.016  1.00 33.07  ? 138  GLN C O     1 
ATOM   7667  C  CB    . GLN C  3  138 ? 7.452   144.738 77.477  1.00 37.43  ? 138  GLN C CB    1 
ATOM   7668  C  CG    . GLN C  3  138 ? 6.910   146.133 77.655  1.00 38.67  ? 138  GLN C CG    1 
ATOM   7669  C  CD    . GLN C  3  138 ? 6.273   146.328 79.016  1.00 38.73  ? 138  GLN C CD    1 
ATOM   7670  O  OE1   . GLN C  3  138 ? 6.928   146.196 80.046  1.00 37.61  ? 138  GLN C OE1   1 
ATOM   7671  N  NE2   . GLN C  3  138 ? 4.983   146.645 79.023  1.00 38.81  ? 138  GLN C NE2   1 
ATOM   7672  N  N     . MET C  3  139 ? 8.662   142.037 77.951  1.00 34.94  ? 139  MET C N     1 
ATOM   7673  C  CA    . MET C  3  139 ? 8.556   140.625 78.268  1.00 37.26  ? 139  MET C CA    1 
ATOM   7674  C  C     . MET C  3  139 ? 9.485   140.336 79.428  1.00 37.14  ? 139  MET C C     1 
ATOM   7675  O  O     . MET C  3  139 ? 9.037   139.887 80.495  1.00 38.79  ? 139  MET C O     1 
ATOM   7676  C  CB    . MET C  3  139 ? 8.938   139.739 77.081  1.00 38.57  ? 139  MET C CB    1 
ATOM   7677  C  CG    . MET C  3  139 ? 8.022   139.904 75.884  1.00 43.68  ? 139  MET C CG    1 
ATOM   7678  S  SD    . MET C  3  139 ? 6.248   140.056 76.273  1.00 48.52  ? 139  MET C SD    1 
ATOM   7679  C  CE    . MET C  3  139 ? 5.605   138.720 75.293  1.00 48.21  ? 139  MET C CE    1 
ATOM   7680  N  N     . SER C  3  140 ? 10.773  140.604 79.221  1.00 34.44  ? 140  SER C N     1 
ATOM   7681  C  CA    . SER C  3  140 ? 11.760  140.366 80.262  1.00 32.07  ? 140  SER C CA    1 
ATOM   7682  C  C     . SER C  3  140 ? 11.150  140.583 81.632  1.00 31.83  ? 140  SER C C     1 
ATOM   7683  O  O     . SER C  3  140 ? 11.187  139.698 82.499  1.00 31.54  ? 140  SER C O     1 
ATOM   7684  C  CB    . SER C  3  140 ? 12.945  141.314 80.113  1.00 30.19  ? 140  SER C CB    1 
ATOM   7685  O  OG    . SER C  3  140 ? 13.675  141.057 78.938  1.00 28.75  ? 140  SER C OG    1 
ATOM   7686  N  N     . PHE C  3  141 ? 10.558  141.763 81.801  1.00 31.36  ? 141  PHE C N     1 
ATOM   7687  C  CA    . PHE C  3  141 ? 9.984   142.146 83.077  1.00 32.04  ? 141  PHE C CA    1 
ATOM   7688  C  C     . PHE C  3  141 ? 8.885   141.266 83.559  1.00 32.12  ? 141  PHE C C     1 
ATOM   7689  O  O     . PHE C  3  141 ? 9.025   140.549 84.549  1.00 32.02  ? 141  PHE C O     1 
ATOM   7690  C  CB    . PHE C  3  141 ? 9.443   143.560 83.042  1.00 32.50  ? 141  PHE C CB    1 
ATOM   7691  C  CG    . PHE C  3  141 ? 9.052   144.071 84.397  1.00 34.40  ? 141  PHE C CG    1 
ATOM   7692  C  CD1   . PHE C  3  141 ? 10.016  144.600 85.257  1.00 34.85  ? 141  PHE C CD1   1 
ATOM   7693  C  CD2   . PHE C  3  141 ? 7.731   143.990 84.834  1.00 35.39  ? 141  PHE C CD2   1 
ATOM   7694  C  CE1   . PHE C  3  141 ? 9.675   145.041 86.525  1.00 35.73  ? 141  PHE C CE1   1 
ATOM   7695  C  CE2   . PHE C  3  141 ? 7.368   144.429 86.108  1.00 36.41  ? 141  PHE C CE2   1 
ATOM   7696  C  CZ    . PHE C  3  141 ? 8.343   144.956 86.954  1.00 37.84  ? 141  PHE C CZ    1 
ATOM   7697  N  N     . TRP C  3  142 ? 7.772   141.348 82.857  1.00 32.59  ? 142  TRP C N     1 
ATOM   7698  C  CA    . TRP C  3  142 ? 6.606   140.580 83.213  1.00 33.98  ? 142  TRP C CA    1 
ATOM   7699  C  C     . TRP C  3  142 ? 6.819   139.074 83.319  1.00 34.36  ? 142  TRP C C     1 
ATOM   7700  O  O     . TRP C  3  142 ? 6.222   138.423 84.191  1.00 33.75  ? 142  TRP C O     1 
ATOM   7701  C  CB    . TRP C  3  142 ? 5.510   140.948 82.248  1.00 34.98  ? 142  TRP C CB    1 
ATOM   7702  C  CG    . TRP C  3  142 ? 5.242   142.384 82.391  1.00 35.05  ? 142  TRP C CG    1 
ATOM   7703  C  CD1   . TRP C  3  142 ? 5.652   143.384 81.570  1.00 34.77  ? 142  TRP C CD1   1 
ATOM   7704  C  CD2   . TRP C  3  142 ? 4.588   142.999 83.486  1.00 35.46  ? 142  TRP C CD2   1 
ATOM   7705  N  NE1   . TRP C  3  142 ? 5.294   144.598 82.089  1.00 34.76  ? 142  TRP C NE1   1 
ATOM   7706  C  CE2   . TRP C  3  142 ? 4.638   144.389 83.270  1.00 35.95  ? 142  TRP C CE2   1 
ATOM   7707  C  CE3   . TRP C  3  142 ? 3.964   142.510 84.637  1.00 36.80  ? 142  TRP C CE3   1 
ATOM   7708  C  CZ2   . TRP C  3  142 ? 4.088   145.305 84.162  1.00 38.66  ? 142  TRP C CZ2   1 
ATOM   7709  C  CZ3   . TRP C  3  142 ? 3.418   143.414 85.528  1.00 39.96  ? 142  TRP C CZ3   1 
ATOM   7710  C  CH2   . TRP C  3  142 ? 3.483   144.803 85.285  1.00 40.63  ? 142  TRP C CH2   1 
ATOM   7711  N  N     . GLY C  3  143 ? 7.662   138.519 82.446  1.00 34.10  ? 143  GLY C N     1 
ATOM   7712  C  CA    . GLY C  3  143 ? 7.967   137.102 82.547  1.00 34.62  ? 143  GLY C CA    1 
ATOM   7713  C  C     . GLY C  3  143 ? 8.575   136.894 83.939  1.00 35.05  ? 143  GLY C C     1 
ATOM   7714  O  O     . GLY C  3  143 ? 8.137   136.039 84.743  1.00 33.78  ? 143  GLY C O     1 
ATOM   7715  N  N     . ALA C  3  144 ? 9.594   137.700 84.234  1.00 34.11  ? 144  ALA C N     1 
ATOM   7716  C  CA    . ALA C  3  144 ? 10.250  137.644 85.527  1.00 33.36  ? 144  ALA C CA    1 
ATOM   7717  C  C     . ALA C  3  144 ? 9.171   137.656 86.622  1.00 33.29  ? 144  ALA C C     1 
ATOM   7718  O  O     . ALA C  3  144 ? 9.188   136.824 87.519  1.00 33.58  ? 144  ALA C O     1 
ATOM   7719  C  CB    . ALA C  3  144 ? 11.183  138.829 85.676  1.00 32.03  ? 144  ALA C CB    1 
ATOM   7720  N  N     . THR C  3  145 ? 8.219   138.579 86.513  1.00 32.33  ? 145  THR C N     1 
ATOM   7721  C  CA    . THR C  3  145 ? 7.123   138.726 87.477  1.00 32.63  ? 145  THR C CA    1 
ATOM   7722  C  C     . THR C  3  145 ? 6.202   137.513 87.616  1.00 31.86  ? 145  THR C C     1 
ATOM   7723  O  O     . THR C  3  145 ? 5.616   137.275 88.676  1.00 31.86  ? 145  THR C O     1 
ATOM   7724  C  CB    . THR C  3  145 ? 6.205   139.896 87.101  1.00 33.53  ? 145  THR C CB    1 
ATOM   7725  O  OG1   . THR C  3  145 ? 6.981   140.938 86.503  1.00 35.02  ? 145  THR C OG1   1 
ATOM   7726  C  CG2   . THR C  3  145 ? 5.490   140.439 88.347  1.00 34.25  ? 145  THR C CG2   1 
ATOM   7727  N  N     . VAL C  3  146 ? 6.045   136.756 86.540  1.00 29.83  ? 146  VAL C N     1 
ATOM   7728  C  CA    . VAL C  3  146 ? 5.167   135.602 86.595  1.00 27.68  ? 146  VAL C CA    1 
ATOM   7729  C  C     . VAL C  3  146 ? 5.896   134.385 87.075  1.00 27.68  ? 146  VAL C C     1 
ATOM   7730  O  O     . VAL C  3  146 ? 5.594   133.844 88.136  1.00 26.66  ? 146  VAL C O     1 
ATOM   7731  C  CB    . VAL C  3  146 ? 4.572   135.291 85.219  1.00 25.40  ? 146  VAL C CB    1 
ATOM   7732  C  CG1   . VAL C  3  146 ? 3.702   134.066 85.286  1.00 21.37  ? 146  VAL C CG1   1 
ATOM   7733  C  CG2   . VAL C  3  146 ? 3.776   136.460 84.750  1.00 23.94  ? 146  VAL C CG2   1 
ATOM   7734  N  N     . ILE C  3  147 ? 6.864   133.967 86.275  1.00 27.65  ? 147  ILE C N     1 
ATOM   7735  C  CA    . ILE C  3  147 ? 7.635   132.786 86.574  1.00 29.37  ? 147  ILE C CA    1 
ATOM   7736  C  C     . ILE C  3  147 ? 8.008   132.691 88.036  1.00 31.30  ? 147  ILE C C     1 
ATOM   7737  O  O     . ILE C  3  147 ? 7.709   131.692 88.691  1.00 30.19  ? 147  ILE C O     1 
ATOM   7738  C  CB    . ILE C  3  147 ? 8.872   132.737 85.710  1.00 28.97  ? 147  ILE C CB    1 
ATOM   7739  C  CG1   . ILE C  3  147 ? 8.438   132.751 84.254  1.00 29.50  ? 147  ILE C CG1   1 
ATOM   7740  C  CG2   . ILE C  3  147 ? 9.644   131.472 85.982  1.00 28.45  ? 147  ILE C CG2   1 
ATOM   7741  C  CD1   . ILE C  3  147 ? 9.544   132.641 83.271  1.00 32.14  ? 147  ILE C CD1   1 
ATOM   7742  N  N     . THR C  3  148 ? 8.649   133.730 88.559  1.00 33.51  ? 148  THR C N     1 
ATOM   7743  C  CA    . THR C  3  148 ? 9.026   133.715 89.965  1.00 35.78  ? 148  THR C CA    1 
ATOM   7744  C  C     . THR C  3  148 ? 7.778   133.527 90.813  1.00 36.95  ? 148  THR C C     1 
ATOM   7745  O  O     . THR C  3  148 ? 7.709   132.606 91.633  1.00 35.47  ? 148  THR C O     1 
ATOM   7746  C  CB    . THR C  3  148 ? 9.731   135.025 90.398  1.00 36.66  ? 148  THR C CB    1 
ATOM   7747  O  OG1   . THR C  3  148 ? 9.053   136.149 89.832  1.00 39.73  ? 148  THR C OG1   1 
ATOM   7748  C  CG2   . THR C  3  148 ? 11.172  135.033 89.945  1.00 37.45  ? 148  THR C CG2   1 
ATOM   7749  N  N     . ASN C  3  149 ? 6.781   134.384 90.589  1.00 39.18  ? 149  ASN C N     1 
ATOM   7750  C  CA    . ASN C  3  149 ? 5.535   134.322 91.352  1.00 41.04  ? 149  ASN C CA    1 
ATOM   7751  C  C     . ASN C  3  149 ? 4.985   132.900 91.492  1.00 41.39  ? 149  ASN C C     1 
ATOM   7752  O  O     . ASN C  3  149 ? 4.322   132.576 92.477  1.00 41.17  ? 149  ASN C O     1 
ATOM   7753  C  CB    . ASN C  3  149 ? 4.481   135.258 90.740  1.00 40.95  ? 149  ASN C CB    1 
ATOM   7754  C  CG    . ASN C  3  149 ? 4.089   136.386 91.693  1.00 42.87  ? 149  ASN C CG    1 
ATOM   7755  O  OD1   . ASN C  3  149 ? 3.402   137.335 91.312  1.00 44.90  ? 149  ASN C OD1   1 
ATOM   7756  N  ND2   . ASN C  3  149 ? 4.527   136.279 92.946  1.00 42.86  ? 149  ASN C ND2   1 
ATOM   7757  N  N     . LEU C  3  150 ? 5.272   132.053 90.511  1.00 41.22  ? 150  LEU C N     1 
ATOM   7758  C  CA    . LEU C  3  150 ? 4.825   130.679 90.548  1.00 40.40  ? 150  LEU C CA    1 
ATOM   7759  C  C     . LEU C  3  150 ? 5.040   130.082 91.911  1.00 41.81  ? 150  LEU C C     1 
ATOM   7760  O  O     . LEU C  3  150 ? 4.197   129.347 92.402  1.00 42.28  ? 150  LEU C O     1 
ATOM   7761  C  CB    . LEU C  3  150 ? 5.609   129.867 89.557  1.00 38.79  ? 150  LEU C CB    1 
ATOM   7762  C  CG    . LEU C  3  150 ? 5.200   130.214 88.155  1.00 37.61  ? 150  LEU C CG    1 
ATOM   7763  C  CD1   . LEU C  3  150 ? 6.153   129.595 87.166  1.00 36.83  ? 150  LEU C CD1   1 
ATOM   7764  C  CD2   . LEU C  3  150 ? 3.793   129.712 87.976  1.00 38.08  ? 150  LEU C CD2   1 
ATOM   7765  N  N     . PHE C  3  151 ? 6.172   130.401 92.524  1.00 43.01  ? 151  PHE C N     1 
ATOM   7766  C  CA    . PHE C  3  151 ? 6.504   129.856 93.835  1.00 45.19  ? 151  PHE C CA    1 
ATOM   7767  C  C     . PHE C  3  151 ? 5.627   130.358 94.963  1.00 45.57  ? 151  PHE C C     1 
ATOM   7768  O  O     . PHE C  3  151 ? 5.606   129.795 96.063  1.00 43.89  ? 151  PHE C O     1 
ATOM   7769  C  CB    . PHE C  3  151 ? 7.972   130.129 94.130  1.00 46.71  ? 151  PHE C CB    1 
ATOM   7770  C  CG    . PHE C  3  151 ? 8.872   129.525 93.126  1.00 48.35  ? 151  PHE C CG    1 
ATOM   7771  C  CD1   . PHE C  3  151 ? 8.975   130.075 91.869  1.00 50.04  ? 151  PHE C CD1   1 
ATOM   7772  C  CD2   . PHE C  3  151 ? 9.501   128.321 93.380  1.00 49.69  ? 151  PHE C CD2   1 
ATOM   7773  C  CE1   . PHE C  3  151 ? 9.684   129.424 90.872  1.00 52.45  ? 151  PHE C CE1   1 
ATOM   7774  C  CE2   . PHE C  3  151 ? 10.211  127.663 92.389  1.00 51.53  ? 151  PHE C CE2   1 
ATOM   7775  C  CZ    . PHE C  3  151 ? 10.302  128.210 91.133  1.00 51.98  ? 151  PHE C CZ    1 
ATOM   7776  N  N     . SER C  3  152 ? 4.892   131.422 94.682  1.00 46.91  ? 152  SER C N     1 
ATOM   7777  C  CA    . SER C  3  152 ? 4.000   131.973 95.677  1.00 48.63  ? 152  SER C CA    1 
ATOM   7778  C  C     . SER C  3  152 ? 2.928   130.936 95.898  1.00 49.67  ? 152  SER C C     1 
ATOM   7779  O  O     . SER C  3  152 ? 2.133   131.059 96.812  1.00 51.49  ? 152  SER C O     1 
ATOM   7780  C  CB    . SER C  3  152 ? 3.345   133.264 95.181  1.00 48.39  ? 152  SER C CB    1 
ATOM   7781  O  OG    . SER C  3  152 ? 2.494   133.017 94.076  1.00 47.24  ? 152  SER C OG    1 
ATOM   7782  N  N     . ALA C  3  153 ? 2.910   129.911 95.055  1.00 50.04  ? 153  ALA C N     1 
ATOM   7783  C  CA    . ALA C  3  153 ? 1.904   128.863 95.159  1.00 51.04  ? 153  ALA C CA    1 
ATOM   7784  C  C     . ALA C  3  153 ? 2.156   127.906 96.301  1.00 52.03  ? 153  ALA C C     1 
ATOM   7785  O  O     . ALA C  3  153 ? 1.220   127.283 96.802  1.00 51.05  ? 153  ALA C O     1 
ATOM   7786  C  CB    . ALA C  3  153 ? 1.826   128.091 93.864  1.00 50.77  ? 153  ALA C CB    1 
ATOM   7787  N  N     . ILE C  3  154 ? 3.423   127.784 96.697  1.00 54.34  ? 154  ILE C N     1 
ATOM   7788  C  CA    . ILE C  3  154 ? 3.802   126.879 97.775  1.00 56.14  ? 154  ILE C CA    1 
ATOM   7789  C  C     . ILE C  3  154 ? 3.409   127.501 99.078  1.00 58.36  ? 154  ILE C C     1 
ATOM   7790  O  O     . ILE C  3  154 ? 3.715   128.656 99.351  1.00 57.24  ? 154  ILE C O     1 
ATOM   7791  C  CB    . ILE C  3  154 ? 5.310   126.632 97.873  1.00 55.55  ? 154  ILE C CB    1 
ATOM   7792  C  CG1   . ILE C  3  154 ? 5.906   126.330 96.502  1.00 54.47  ? 154  ILE C CG1   1 
ATOM   7793  C  CG2   . ILE C  3  154 ? 5.554   125.473 98.833  1.00 55.40  ? 154  ILE C CG2   1 
ATOM   7794  C  CD1   . ILE C  3  154 ? 7.400   126.249 96.528  1.00 53.22  ? 154  ILE C CD1   1 
ATOM   7795  N  N     . PRO C  3  155 ? 2.723   126.736 99.915  1.00 61.53  ? 155  PRO C N     1 
ATOM   7796  C  CA    . PRO C  3  155 ? 2.350   127.363 101.178 1.00 63.86  ? 155  PRO C CA    1 
ATOM   7797  C  C     . PRO C  3  155 ? 3.530   127.561 102.137 1.00 65.85  ? 155  PRO C C     1 
ATOM   7798  O  O     . PRO C  3  155 ? 4.524   126.828 102.089 1.00 65.04  ? 155  PRO C O     1 
ATOM   7799  C  CB    . PRO C  3  155 ? 1.248   126.434 101.711 1.00 64.34  ? 155  PRO C CB    1 
ATOM   7800  C  CG    . PRO C  3  155 ? 1.528   125.102 101.046 1.00 62.68  ? 155  PRO C CG    1 
ATOM   7801  C  CD    . PRO C  3  155 ? 1.999   125.472 99.676  1.00 61.95  ? 155  PRO C CD    1 
ATOM   7802  N  N     . TYR C  3  156 ? 3.415   128.588 102.979 1.00 68.87  ? 156  TYR C N     1 
ATOM   7803  C  CA    . TYR C  3  156 ? 4.423   128.921 103.983 1.00 71.86  ? 156  TYR C CA    1 
ATOM   7804  C  C     . TYR C  3  156 ? 5.687   129.475 103.353 1.00 71.83  ? 156  TYR C C     1 
ATOM   7805  O  O     . TYR C  3  156 ? 5.767   130.665 103.057 1.00 72.10  ? 156  TYR C O     1 
ATOM   7806  C  CB    . TYR C  3  156 ? 4.736   127.687 104.839 1.00 75.93  ? 156  TYR C CB    1 
ATOM   7807  C  CG    . TYR C  3  156 ? 3.494   127.062 105.477 1.00 82.39  ? 156  TYR C CG    1 
ATOM   7808  C  CD1   . TYR C  3  156 ? 3.591   125.930 106.308 1.00 84.14  ? 156  TYR C CD1   1 
ATOM   7809  C  CD2   . TYR C  3  156 ? 2.207   127.590 105.231 1.00 84.86  ? 156  TYR C CD2   1 
ATOM   7810  C  CE1   . TYR C  3  156 ? 2.435   125.342 106.875 1.00 86.07  ? 156  TYR C CE1   1 
ATOM   7811  C  CE2   . TYR C  3  156 ? 1.049   127.009 105.788 1.00 86.13  ? 156  TYR C CE2   1 
ATOM   7812  C  CZ    . TYR C  3  156 ? 1.170   125.892 106.605 1.00 86.69  ? 156  TYR C CZ    1 
ATOM   7813  O  OH    . TYR C  3  156 ? 0.028   125.345 107.146 1.00 87.55  ? 156  TYR C OH    1 
ATOM   7814  N  N     . ILE C  3  157 ? 6.676   128.619 103.144 1.00 71.77  ? 157  ILE C N     1 
ATOM   7815  C  CA    . ILE C  3  157 ? 7.935   129.042 102.535 1.00 72.43  ? 157  ILE C CA    1 
ATOM   7816  C  C     . ILE C  3  157 ? 7.705   129.885 101.286 1.00 72.19  ? 157  ILE C C     1 
ATOM   7817  O  O     . ILE C  3  157 ? 8.540   130.705 100.906 1.00 71.31  ? 157  ILE C O     1 
ATOM   7818  C  CB    . ILE C  3  157 ? 8.770   127.822 102.122 1.00 73.17  ? 157  ILE C CB    1 
ATOM   7819  C  CG1   . ILE C  3  157 ? 7.949   126.926 101.184 1.00 73.48  ? 157  ILE C CG1   1 
ATOM   7820  C  CG2   . ILE C  3  157 ? 9.202   127.045 103.359 1.00 74.85  ? 157  ILE C CG2   1 
ATOM   7821  C  CD1   . ILE C  3  157 ? 8.671   125.661 100.714 1.00 73.62  ? 157  ILE C CD1   1 
ATOM   7822  N  N     . GLY C  3  158 ? 6.554   129.662 100.661 1.00 72.90  ? 158  GLY C N     1 
ATOM   7823  C  CA    . GLY C  3  158 ? 6.188   130.341 99.432  1.00 73.28  ? 158  GLY C CA    1 
ATOM   7824  C  C     . GLY C  3  158 ? 6.434   131.822 99.322  1.00 73.61  ? 158  GLY C C     1 
ATOM   7825  O  O     . GLY C  3  158 ? 7.433   132.256 98.758  1.00 72.75  ? 158  GLY C O     1 
ATOM   7826  N  N     . HIS C  3  159 ? 5.505   132.602 99.852  1.00 75.24  ? 159  HIS C N     1 
ATOM   7827  C  CA    . HIS C  3  159 ? 5.617   134.042 99.780  1.00 77.34  ? 159  HIS C CA    1 
ATOM   7828  C  C     . HIS C  3  159 ? 7.025   134.490 100.107 1.00 76.92  ? 159  HIS C C     1 
ATOM   7829  O  O     . HIS C  3  159 ? 7.492   135.497 99.586  1.00 77.07  ? 159  HIS C O     1 
ATOM   7830  C  CB    . HIS C  3  159 ? 4.588   134.703 100.698 1.00 80.80  ? 159  HIS C CB    1 
ATOM   7831  C  CG    . HIS C  3  159 ? 3.167   134.540 100.229 1.00 84.75  ? 159  HIS C CG    1 
ATOM   7832  N  ND1   . HIS C  3  159 ? 2.783   134.753 98.919  1.00 85.28  ? 159  HIS C ND1   1 
ATOM   7833  C  CD2   . HIS C  3  159 ? 2.032   134.222 100.904 1.00 85.97  ? 159  HIS C CD2   1 
ATOM   7834  C  CE1   . HIS C  3  159 ? 1.477   134.575 98.808  1.00 86.29  ? 159  HIS C CE1   1 
ATOM   7835  N  NE2   . HIS C  3  159 ? 0.997   134.253 99.997  1.00 86.69  ? 159  HIS C NE2   1 
ATOM   7836  N  N     . THR C  3  160 ? 7.718   133.730 100.945 1.00 76.71  ? 160  THR C N     1 
ATOM   7837  C  CA    . THR C  3  160 ? 9.091   134.090 101.291 1.00 76.56  ? 160  THR C CA    1 
ATOM   7838  C  C     . THR C  3  160 ? 10.030  133.735 100.138 1.00 73.87  ? 160  THR C C     1 
ATOM   7839  O  O     . THR C  3  160 ? 10.783  134.582 99.665  1.00 74.07  ? 160  THR C O     1 
ATOM   7840  C  CB    . THR C  3  160 ? 9.578   133.383 102.600 1.00 78.64  ? 160  THR C CB    1 
ATOM   7841  O  OG1   . THR C  3  160 ? 8.881   133.925 103.738 1.00 79.80  ? 160  THR C OG1   1 
ATOM   7842  C  CG2   . THR C  3  160 ? 11.088  133.589 102.792 1.00 79.03  ? 160  THR C CG2   1 
ATOM   7843  N  N     . LEU C  3  161 ? 9.972   132.489 99.684  1.00 70.51  ? 161  LEU C N     1 
ATOM   7844  C  CA    . LEU C  3  161 ? 10.816  132.036 98.583  1.00 67.26  ? 161  LEU C CA    1 
ATOM   7845  C  C     . LEU C  3  161 ? 10.893  133.099 97.476  1.00 65.55  ? 161  LEU C C     1 
ATOM   7846  O  O     . LEU C  3  161 ? 11.942  133.314 96.867  1.00 64.46  ? 161  LEU C O     1 
ATOM   7847  C  CB    . LEU C  3  161 ? 10.259  130.730 98.030  1.00 66.02  ? 161  LEU C CB    1 
ATOM   7848  C  CG    . LEU C  3  161 ? 11.255  129.605 97.781  1.00 63.44  ? 161  LEU C CG    1 
ATOM   7849  C  CD1   . LEU C  3  161 ? 10.543  128.284 97.997  1.00 62.56  ? 161  LEU C CD1   1 
ATOM   7850  C  CD2   . LEU C  3  161 ? 11.842  129.720 96.376  1.00 62.31  ? 161  LEU C CD2   1 
ATOM   7851  N  N     . VAL C  3  162 ? 9.782   133.771 97.217  1.00 63.12  ? 162  VAL C N     1 
ATOM   7852  C  CA    . VAL C  3  162 ? 9.802   134.804 96.217  1.00 61.82  ? 162  VAL C CA    1 
ATOM   7853  C  C     . VAL C  3  162 ? 10.743  135.881 96.724  1.00 63.47  ? 162  VAL C C     1 
ATOM   7854  O  O     . VAL C  3  162 ? 11.758  136.162 96.083  1.00 62.61  ? 162  VAL C O     1 
ATOM   7855  C  CB    . VAL C  3  162 ? 8.427   135.376 96.019  1.00 59.88  ? 162  VAL C CB    1 
ATOM   7856  C  CG1   . VAL C  3  162 ? 8.387   136.228 94.773  1.00 59.48  ? 162  VAL C CG1   1 
ATOM   7857  C  CG2   . VAL C  3  162 ? 7.459   134.255 95.907  1.00 60.24  ? 162  VAL C CG2   1 
ATOM   7858  N  N     . GLU C  3  163 ? 10.419  136.457 97.887  1.00 65.91  ? 163  GLU C N     1 
ATOM   7859  C  CA    . GLU C  3  163 ? 11.237  137.511 98.499  1.00 68.65  ? 163  GLU C CA    1 
ATOM   7860  C  C     . GLU C  3  163 ? 12.667  137.382 98.001  1.00 67.97  ? 163  GLU C C     1 
ATOM   7861  O  O     . GLU C  3  163 ? 13.189  138.299 97.368  1.00 68.36  ? 163  GLU C O     1 
ATOM   7862  C  CB    . GLU C  3  163 ? 11.207  137.426 100.047 1.00 72.84  ? 163  GLU C CB    1 
ATOM   7863  C  CG    . GLU C  3  163 ? 12.320  138.272 100.777 1.00 81.27  ? 163  GLU C CG    1 
ATOM   7864  C  CD    . GLU C  3  163 ? 12.341  138.173 102.351 1.00 85.49  ? 163  GLU C CD    1 
ATOM   7865  O  OE1   . GLU C  3  163 ? 12.388  137.050 102.918 1.00 86.81  ? 163  GLU C OE1   1 
ATOM   7866  O  OE2   . GLU C  3  163 ? 12.339  139.235 103.029 1.00 87.94  ? 163  GLU C OE2   1 
ATOM   7867  N  N     . TRP C  3  164 ? 13.282  136.227 98.258  1.00 66.82  ? 164  TRP C N     1 
ATOM   7868  C  CA    . TRP C  3  164 ? 14.655  135.990 97.841  1.00 65.17  ? 164  TRP C CA    1 
ATOM   7869  C  C     . TRP C  3  164 ? 14.788  136.238 96.365  1.00 63.92  ? 164  TRP C C     1 
ATOM   7870  O  O     . TRP C  3  164 ? 15.483  137.151 95.947  1.00 63.70  ? 164  TRP C O     1 
ATOM   7871  C  CB    . TRP C  3  164 ? 15.100  134.557 98.151  1.00 65.93  ? 164  TRP C CB    1 
ATOM   7872  C  CG    . TRP C  3  164 ? 15.159  134.234 99.605  1.00 67.50  ? 164  TRP C CG    1 
ATOM   7873  C  CD1   . TRP C  3  164 ? 15.164  135.125 100.637 1.00 68.55  ? 164  TRP C CD1   1 
ATOM   7874  C  CD2   . TRP C  3  164 ? 15.153  132.922 100.206 1.00 68.57  ? 164  TRP C CD2   1 
ATOM   7875  N  NE1   . TRP C  3  164 ? 15.146  134.455 101.845 1.00 69.94  ? 164  TRP C NE1   1 
ATOM   7876  C  CE2   . TRP C  3  164 ? 15.141  133.103 101.607 1.00 69.27  ? 164  TRP C CE2   1 
ATOM   7877  C  CE3   . TRP C  3  164 ? 15.152  131.612 99.696  1.00 67.90  ? 164  TRP C CE3   1 
ATOM   7878  C  CZ2   . TRP C  3  164 ? 15.125  132.018 102.507 1.00 67.79  ? 164  TRP C CZ2   1 
ATOM   7879  C  CZ3   . TRP C  3  164 ? 15.135  130.532 100.598 1.00 66.05  ? 164  TRP C CZ3   1 
ATOM   7880  C  CH2   . TRP C  3  164 ? 15.121  130.747 101.981 1.00 65.70  ? 164  TRP C CH2   1 
ATOM   7881  N  N     . ALA C  3  165 ? 14.116  135.423 95.575  1.00 63.18  ? 165  ALA C N     1 
ATOM   7882  C  CA    . ALA C  3  165 ? 14.190  135.566 94.138  1.00 64.97  ? 165  ALA C CA    1 
ATOM   7883  C  C     . ALA C  3  165 ? 14.375  137.015 93.711  1.00 66.50  ? 165  ALA C C     1 
ATOM   7884  O  O     . ALA C  3  165 ? 15.371  137.364 93.077  1.00 66.55  ? 165  ALA C O     1 
ATOM   7885  C  CB    . ALA C  3  165 ? 12.942  135.008 93.504  1.00 65.66  ? 165  ALA C CB    1 
ATOM   7886  N  N     . TRP C  3  166 ? 13.415  137.862 94.068  1.00 68.05  ? 166  TRP C N     1 
ATOM   7887  C  CA    . TRP C  3  166 ? 13.460  139.276 93.687  1.00 68.78  ? 166  TRP C CA    1 
ATOM   7888  C  C     . TRP C  3  166 ? 14.474  140.110 94.463  1.00 69.50  ? 166  TRP C C     1 
ATOM   7889  O  O     . TRP C  3  166 ? 14.980  141.125 93.967  1.00 68.69  ? 166  TRP C O     1 
ATOM   7890  C  CB    . TRP C  3  166 ? 12.078  139.902 93.860  1.00 67.98  ? 166  TRP C CB    1 
ATOM   7891  C  CG    . TRP C  3  166 ? 11.006  139.260 93.057  1.00 66.44  ? 166  TRP C CG    1 
ATOM   7892  C  CD1   . TRP C  3  166 ? 11.157  138.472 91.957  1.00 65.55  ? 166  TRP C CD1   1 
ATOM   7893  C  CD2   . TRP C  3  166 ? 9.607   139.413 93.252  1.00 66.56  ? 166  TRP C CD2   1 
ATOM   7894  N  NE1   . TRP C  3  166 ? 9.936   138.127 91.452  1.00 65.16  ? 166  TRP C NE1   1 
ATOM   7895  C  CE2   . TRP C  3  166 ? 8.963   138.693 92.230  1.00 66.30  ? 166  TRP C CE2   1 
ATOM   7896  C  CE3   . TRP C  3  166 ? 8.829   140.097 94.194  1.00 67.83  ? 166  TRP C CE3   1 
ATOM   7897  C  CZ2   . TRP C  3  166 ? 7.573   138.633 92.118  1.00 67.54  ? 166  TRP C CZ2   1 
ATOM   7898  C  CZ3   . TRP C  3  166 ? 7.442   140.040 94.085  1.00 68.74  ? 166  TRP C CZ3   1 
ATOM   7899  C  CH2   . TRP C  3  166 ? 6.830   139.311 93.052  1.00 68.54  ? 166  TRP C CH2   1 
ATOM   7900  N  N     . GLY C  3  167 ? 14.757  139.675 95.685  1.00 70.36  ? 167  GLY C N     1 
ATOM   7901  C  CA    . GLY C  3  167 ? 15.691  140.395 96.519  1.00 71.13  ? 167  GLY C CA    1 
ATOM   7902  C  C     . GLY C  3  167 ? 15.010  141.646 97.029  1.00 71.80  ? 167  GLY C C     1 
ATOM   7903  O  O     . GLY C  3  167 ? 15.595  142.447 97.755  1.00 73.34  ? 167  GLY C O     1 
ATOM   7904  N  N     . GLY C  3  168 ? 13.760  141.827 96.639  1.00 71.54  ? 168  GLY C N     1 
ATOM   7905  C  CA    . GLY C  3  168 ? 13.036  142.989 97.092  1.00 71.61  ? 168  GLY C CA    1 
ATOM   7906  C  C     . GLY C  3  168 ? 11.663  142.519 97.478  1.00 71.89  ? 168  GLY C C     1 
ATOM   7907  O  O     . GLY C  3  168 ? 11.491  141.399 97.963  1.00 70.99  ? 168  GLY C O     1 
ATOM   7908  N  N     . PHE C  3  169 ? 10.679  143.376 97.259  1.00 72.61  ? 169  PHE C N     1 
ATOM   7909  C  CA    . PHE C  3  169 ? 9.315   143.022 97.567  1.00 72.96  ? 169  PHE C CA    1 
ATOM   7910  C  C     . PHE C  3  169 ? 8.497   143.131 96.298  1.00 70.96  ? 169  PHE C C     1 
ATOM   7911  O  O     . PHE C  3  169 ? 7.289   142.907 96.294  1.00 70.49  ? 169  PHE C O     1 
ATOM   7912  C  CB    . PHE C  3  169 ? 8.795   143.906 98.700  1.00 76.94  ? 169  PHE C CB    1 
ATOM   7913  C  CG    . PHE C  3  169 ? 9.028   143.311 100.082 1.00 81.57  ? 169  PHE C CG    1 
ATOM   7914  C  CD1   . PHE C  3  169 ? 9.063   144.124 101.222 1.00 83.46  ? 169  PHE C CD1   1 
ATOM   7915  C  CD2   . PHE C  3  169 ? 9.175   141.924 100.248 1.00 82.90  ? 169  PHE C CD2   1 
ATOM   7916  C  CE1   . PHE C  3  169 ? 9.242   143.561 102.517 1.00 84.30  ? 169  PHE C CE1   1 
ATOM   7917  C  CE2   . PHE C  3  169 ? 9.351   141.356 101.531 1.00 83.83  ? 169  PHE C CE2   1 
ATOM   7918  C  CZ    . PHE C  3  169 ? 9.384   142.177 102.666 1.00 83.69  ? 169  PHE C CZ    1 
ATOM   7919  N  N     . SER C  3  170 ? 9.200   143.453 95.217  1.00 68.96  ? 170  SER C N     1 
ATOM   7920  C  CA    . SER C  3  170 ? 8.630   143.562 93.873  1.00 67.75  ? 170  SER C CA    1 
ATOM   7921  C  C     . SER C  3  170 ? 9.825   143.401 92.956  1.00 64.90  ? 170  SER C C     1 
ATOM   7922  O  O     . SER C  3  170 ? 10.956  143.667 93.382  1.00 64.43  ? 170  SER C O     1 
ATOM   7923  C  CB    . SER C  3  170 ? 7.999   144.933 93.625  1.00 70.43  ? 170  SER C CB    1 
ATOM   7924  O  OG    . SER C  3  170 ? 8.990   145.921 93.377  1.00 73.84  ? 170  SER C OG    1 
ATOM   7925  N  N     . VAL C  3  171 ? 9.599   142.985 91.710  1.00 60.70  ? 171  VAL C N     1 
ATOM   7926  C  CA    . VAL C  3  171 ? 10.724  142.795 90.804  1.00 56.70  ? 171  VAL C CA    1 
ATOM   7927  C  C     . VAL C  3  171 ? 11.412  144.084 90.453  1.00 54.20  ? 171  VAL C C     1 
ATOM   7928  O  O     . VAL C  3  171 ? 10.909  144.858 89.648  1.00 53.72  ? 171  VAL C O     1 
ATOM   7929  C  CB    . VAL C  3  171 ? 10.322  142.152 89.506  1.00 55.90  ? 171  VAL C CB    1 
ATOM   7930  C  CG1   . VAL C  3  171 ? 11.538  142.106 88.593  1.00 53.97  ? 171  VAL C CG1   1 
ATOM   7931  C  CG2   . VAL C  3  171 ? 9.761   140.759 89.772  1.00 56.05  ? 171  VAL C CG2   1 
ATOM   7932  N  N     . ASP C  3  172 ? 12.570  144.308 91.058  1.00 51.40  ? 172  ASP C N     1 
ATOM   7933  C  CA    . ASP C  3  172 ? 13.322  145.514 90.795  1.00 48.44  ? 172  ASP C CA    1 
ATOM   7934  C  C     . ASP C  3  172 ? 14.784  145.181 90.617  1.00 46.54  ? 172  ASP C C     1 
ATOM   7935  O  O     . ASP C  3  172 ? 15.167  144.012 90.655  1.00 45.38  ? 172  ASP C O     1 
ATOM   7936  C  CB    . ASP C  3  172 ? 13.163  146.507 91.927  1.00 50.00  ? 172  ASP C CB    1 
ATOM   7937  C  CG    . ASP C  3  172 ? 13.380  147.935 91.476  1.00 51.54  ? 172  ASP C CG    1 
ATOM   7938  O  OD1   . ASP C  3  172 ? 14.128  148.153 90.497  1.00 50.18  ? 172  ASP C OD1   1 
ATOM   7939  O  OD2   . ASP C  3  172 ? 12.807  148.846 92.114  1.00 53.85  ? 172  ASP C OD2   1 
ATOM   7940  N  N     . ASN C  3  173 ? 15.593  146.220 90.439  1.00 45.19  ? 173  ASN C N     1 
ATOM   7941  C  CA    . ASN C  3  173 ? 17.018  146.059 90.200  1.00 46.15  ? 173  ASN C CA    1 
ATOM   7942  C  C     . ASN C  3  173 ? 17.635  144.834 90.889  1.00 46.09  ? 173  ASN C C     1 
ATOM   7943  O  O     . ASN C  3  173 ? 18.155  143.909 90.233  1.00 45.75  ? 173  ASN C O     1 
ATOM   7944  C  CB    . ASN C  3  173 ? 17.762  147.326 90.614  1.00 46.92  ? 173  ASN C CB    1 
ATOM   7945  C  CG    . ASN C  3  173 ? 19.195  147.334 90.120  1.00 49.57  ? 173  ASN C CG    1 
ATOM   7946  O  OD1   . ASN C  3  173 ? 19.451  147.478 88.920  1.00 49.50  ? 173  ASN C OD1   1 
ATOM   7947  N  ND2   . ASN C  3  173 ? 20.142  147.154 91.042  1.00 51.59  ? 173  ASN C ND2   1 
ATOM   7948  N  N     . PRO C  3  174 ? 17.564  144.797 92.222  1.00 45.25  ? 174  PRO C N     1 
ATOM   7949  C  CA    . PRO C  3  174 ? 18.131  143.662 92.945  1.00 43.99  ? 174  PRO C CA    1 
ATOM   7950  C  C     . PRO C  3  174 ? 17.902  142.353 92.213  1.00 41.88  ? 174  PRO C C     1 
ATOM   7951  O  O     . PRO C  3  174 ? 18.773  141.494 92.192  1.00 43.30  ? 174  PRO C O     1 
ATOM   7952  C  CB    . PRO C  3  174 ? 17.409  143.717 94.291  1.00 44.95  ? 174  PRO C CB    1 
ATOM   7953  C  CG    . PRO C  3  174 ? 16.120  144.387 93.960  1.00 45.00  ? 174  PRO C CG    1 
ATOM   7954  C  CD    . PRO C  3  174 ? 16.596  145.503 93.071  1.00 45.27  ? 174  PRO C CD    1 
ATOM   7955  N  N     . THR C  3  175 ? 16.729  142.206 91.612  1.00 38.36  ? 175  THR C N     1 
ATOM   7956  C  CA    . THR C  3  175 ? 16.429  140.994 90.880  1.00 34.93  ? 175  THR C CA    1 
ATOM   7957  C  C     . THR C  3  175 ? 17.393  140.935 89.701  1.00 34.05  ? 175  THR C C     1 
ATOM   7958  O  O     . THR C  3  175 ? 18.224  140.034 89.595  1.00 33.09  ? 175  THR C O     1 
ATOM   7959  C  CB    . THR C  3  175 ? 14.993  141.016 90.348  1.00 33.03  ? 175  THR C CB    1 
ATOM   7960  O  OG1   . THR C  3  175 ? 14.123  141.506 91.362  1.00 32.36  ? 175  THR C OG1   1 
ATOM   7961  C  CG2   . THR C  3  175 ? 14.547  139.644 89.985  1.00 31.43  ? 175  THR C CG2   1 
ATOM   7962  N  N     . LEU C  3  176 ? 17.297  141.932 88.836  1.00 32.82  ? 176  LEU C N     1 
ATOM   7963  C  CA    . LEU C  3  176 ? 18.116  141.983 87.648  1.00 32.54  ? 176  LEU C CA    1 
ATOM   7964  C  C     . LEU C  3  176 ? 19.554  141.641 87.878  1.00 32.72  ? 176  LEU C C     1 
ATOM   7965  O  O     . LEU C  3  176 ? 20.145  140.933 87.076  1.00 32.96  ? 176  LEU C O     1 
ATOM   7966  C  CB    . LEU C  3  176 ? 18.030  143.351 86.999  1.00 33.54  ? 176  LEU C CB    1 
ATOM   7967  C  CG    . LEU C  3  176 ? 18.842  143.516 85.710  1.00 35.33  ? 176  LEU C CG    1 
ATOM   7968  C  CD1   . LEU C  3  176 ? 18.472  142.430 84.690  1.00 33.82  ? 176  LEU C CD1   1 
ATOM   7969  C  CD2   . LEU C  3  176 ? 18.585  144.921 85.147  1.00 36.39  ? 176  LEU C CD2   1 
ATOM   7970  N  N     . THR C  3  177 ? 20.137  142.129 88.964  1.00 33.27  ? 177  THR C N     1 
ATOM   7971  C  CA    . THR C  3  177 ? 21.545  141.821 89.193  1.00 35.40  ? 177  THR C CA    1 
ATOM   7972  C  C     . THR C  3  177 ? 21.722  140.356 89.520  1.00 35.08  ? 177  THR C C     1 
ATOM   7973  O  O     . THR C  3  177 ? 22.427  139.635 88.814  1.00 34.09  ? 177  THR C O     1 
ATOM   7974  C  CB    . THR C  3  177 ? 22.168  142.655 90.343  1.00 36.45  ? 177  THR C CB    1 
ATOM   7975  O  OG1   . THR C  3  177 ? 21.267  142.661 91.452  1.00 39.64  ? 177  THR C OG1   1 
ATOM   7976  C  CG2   . THR C  3  177 ? 22.447  144.098 89.904  1.00 36.64  ? 177  THR C CG2   1 
ATOM   7977  N  N     . ARG C  3  178 ? 21.063  139.906 90.577  1.00 35.57  ? 178  ARG C N     1 
ATOM   7978  C  CA    . ARG C  3  178 ? 21.206  138.521 90.969  1.00 36.88  ? 178  ARG C CA    1 
ATOM   7979  C  C     . ARG C  3  178 ? 20.791  137.590 89.841  1.00 36.84  ? 178  ARG C C     1 
ATOM   7980  O  O     . ARG C  3  178 ? 21.298  136.463 89.723  1.00 38.59  ? 178  ARG C O     1 
ATOM   7981  C  CB    . ARG C  3  178 ? 20.415  138.227 92.248  1.00 37.81  ? 178  ARG C CB    1 
ATOM   7982  C  CG    . ARG C  3  178 ? 18.910  138.152 92.123  1.00 38.71  ? 178  ARG C CG    1 
ATOM   7983  C  CD    . ARG C  3  178 ? 18.334  138.002 93.526  1.00 39.77  ? 178  ARG C CD    1 
ATOM   7984  N  NE    . ARG C  3  178 ? 18.820  139.088 94.374  1.00 40.37  ? 178  ARG C NE    1 
ATOM   7985  C  CZ    . ARG C  3  178 ? 18.593  139.199 95.675  1.00 40.17  ? 178  ARG C CZ    1 
ATOM   7986  N  NH1   . ARG C  3  178 ? 17.877  138.284 96.316  1.00 38.47  ? 178  ARG C NH1   1 
ATOM   7987  N  NH2   . ARG C  3  178 ? 19.090  140.239 96.331  1.00 41.26  ? 178  ARG C NH2   1 
ATOM   7988  N  N     . PHE C  3  179 ? 19.881  138.047 88.997  1.00 34.50  ? 179  PHE C N     1 
ATOM   7989  C  CA    . PHE C  3  179 ? 19.478  137.196 87.898  1.00 32.63  ? 179  PHE C CA    1 
ATOM   7990  C  C     . PHE C  3  179 ? 20.626  137.111 86.917  1.00 31.14  ? 179  PHE C C     1 
ATOM   7991  O  O     . PHE C  3  179 ? 20.909  136.045 86.393  1.00 32.80  ? 179  PHE C O     1 
ATOM   7992  C  CB    . PHE C  3  179 ? 18.253  137.752 87.201  1.00 32.88  ? 179  PHE C CB    1 
ATOM   7993  C  CG    . PHE C  3  179 ? 16.973  137.201 87.706  1.00 30.72  ? 179  PHE C CG    1 
ATOM   7994  C  CD1   . PHE C  3  179 ? 16.735  137.100 89.054  1.00 29.24  ? 179  PHE C CD1   1 
ATOM   7995  C  CD2   . PHE C  3  179 ? 15.977  136.840 86.824  1.00 30.87  ? 179  PHE C CD2   1 
ATOM   7996  C  CE1   . PHE C  3  179 ? 15.521  136.651 89.514  1.00 29.16  ? 179  PHE C CE1   1 
ATOM   7997  C  CE2   . PHE C  3  179 ? 14.753  136.393 87.281  1.00 31.09  ? 179  PHE C CE2   1 
ATOM   7998  C  CZ    . PHE C  3  179 ? 14.526  136.298 88.626  1.00 29.65  ? 179  PHE C CZ    1 
ATOM   7999  N  N     . PHE C  3  180 ? 21.283  138.230 86.651  1.00 27.97  ? 180  PHE C N     1 
ATOM   8000  C  CA    . PHE C  3  180 ? 22.398  138.195 85.735  1.00 26.96  ? 180  PHE C CA    1 
ATOM   8001  C  C     . PHE C  3  180 ? 23.433  137.233 86.309  1.00 27.80  ? 180  PHE C C     1 
ATOM   8002  O  O     . PHE C  3  180 ? 23.838  136.275 85.642  1.00 27.75  ? 180  PHE C O     1 
ATOM   8003  C  CB    . PHE C  3  180 ? 23.009  139.581 85.592  1.00 26.56  ? 180  PHE C CB    1 
ATOM   8004  C  CG    . PHE C  3  180 ? 24.336  139.598 84.869  1.00 25.86  ? 180  PHE C CG    1 
ATOM   8005  C  CD1   . PHE C  3  180 ? 25.483  140.071 85.499  1.00 25.26  ? 180  PHE C CD1   1 
ATOM   8006  C  CD2   . PHE C  3  180 ? 24.433  139.176 83.550  1.00 24.93  ? 180  PHE C CD2   1 
ATOM   8007  C  CE1   . PHE C  3  180 ? 26.696  140.123 84.814  1.00 26.01  ? 180  PHE C CE1   1 
ATOM   8008  C  CE2   . PHE C  3  180 ? 25.649  139.227 82.862  1.00 24.48  ? 180  PHE C CE2   1 
ATOM   8009  C  CZ    . PHE C  3  180 ? 26.776  139.700 83.493  1.00 24.29  ? 180  PHE C CZ    1 
ATOM   8010  N  N     . ALA C  3  181 ? 23.850  137.491 87.551  1.00 27.31  ? 181  ALA C N     1 
ATOM   8011  C  CA    . ALA C  3  181 ? 24.845  136.662 88.231  1.00 26.60  ? 181  ALA C CA    1 
ATOM   8012  C  C     . ALA C  3  181 ? 24.486  135.200 88.091  1.00 26.70  ? 181  ALA C C     1 
ATOM   8013  O  O     . ALA C  3  181 ? 25.340  134.361 87.836  1.00 26.60  ? 181  ALA C O     1 
ATOM   8014  C  CB    . ALA C  3  181 ? 24.914  137.025 89.681  1.00 26.49  ? 181  ALA C CB    1 
ATOM   8015  N  N     . LEU C  3  182 ? 23.206  134.909 88.256  1.00 27.45  ? 182  LEU C N     1 
ATOM   8016  C  CA    . LEU C  3  182 ? 22.686  133.553 88.148  1.00 28.33  ? 182  LEU C CA    1 
ATOM   8017  C  C     . LEU C  3  182 ? 22.836  132.972 86.734  1.00 26.64  ? 182  LEU C C     1 
ATOM   8018  O  O     . LEU C  3  182 ? 23.349  131.864 86.533  1.00 22.44  ? 182  LEU C O     1 
ATOM   8019  C  CB    . LEU C  3  182 ? 21.217  133.574 88.550  1.00 30.96  ? 182  LEU C CB    1 
ATOM   8020  C  CG    . LEU C  3  182 ? 20.623  132.204 88.795  1.00 34.34  ? 182  LEU C CG    1 
ATOM   8021  C  CD1   . LEU C  3  182 ? 21.712  131.270 89.304  1.00 36.17  ? 182  LEU C CD1   1 
ATOM   8022  C  CD2   . LEU C  3  182 ? 19.495  132.333 89.808  1.00 35.11  ? 182  LEU C CD2   1 
ATOM   8023  N  N     . HIS C  3  183 ? 22.362  133.747 85.766  1.00 27.29  ? 183  HIS C N     1 
ATOM   8024  C  CA    . HIS C  3  183 ? 22.432  133.374 84.375  1.00 27.97  ? 183  HIS C CA    1 
ATOM   8025  C  C     . HIS C  3  183 ? 23.898  133.173 84.046  1.00 28.96  ? 183  HIS C C     1 
ATOM   8026  O  O     . HIS C  3  183 ? 24.256  132.254 83.323  1.00 30.29  ? 183  HIS C O     1 
ATOM   8027  C  CB    . HIS C  3  183 ? 21.848  134.480 83.482  1.00 27.06  ? 183  HIS C CB    1 
ATOM   8028  C  CG    . HIS C  3  183 ? 21.820  134.123 82.025  1.00 28.78  ? 183  HIS C CG    1 
ATOM   8029  N  ND1   . HIS C  3  183 ? 21.126  133.035 81.549  1.00 30.45  ? 183  HIS C ND1   1 
ATOM   8030  C  CD2   . HIS C  3  183 ? 22.419  134.686 80.945  1.00 28.32  ? 183  HIS C CD2   1 
ATOM   8031  C  CE1   . HIS C  3  183 ? 21.299  132.942 80.244  1.00 29.22  ? 183  HIS C CE1   1 
ATOM   8032  N  NE2   . HIS C  3  183 ? 22.078  133.930 79.853  1.00 28.50  ? 183  HIS C NE2   1 
ATOM   8033  N  N     . PHE C  3  184 ? 24.762  134.019 84.585  1.00 28.85  ? 184  PHE C N     1 
ATOM   8034  C  CA    . PHE C  3  184 ? 26.172  133.876 84.264  1.00 30.14  ? 184  PHE C CA    1 
ATOM   8035  C  C     . PHE C  3  184 ? 26.684  132.527 84.747  1.00 31.26  ? 184  PHE C C     1 
ATOM   8036  O  O     . PHE C  3  184 ? 27.341  131.797 84.011  1.00 32.10  ? 184  PHE C O     1 
ATOM   8037  C  CB    . PHE C  3  184 ? 26.982  135.019 84.894  1.00 29.15  ? 184  PHE C CB    1 
ATOM   8038  C  CG    . PHE C  3  184 ? 28.405  135.104 84.407  1.00 27.86  ? 184  PHE C CG    1 
ATOM   8039  C  CD1   . PHE C  3  184 ? 28.918  136.305 83.950  1.00 26.72  ? 184  PHE C CD1   1 
ATOM   8040  C  CD2   . PHE C  3  184 ? 29.221  133.987 84.389  1.00 28.32  ? 184  PHE C CD2   1 
ATOM   8041  C  CE1   . PHE C  3  184 ? 30.222  136.393 83.477  1.00 26.89  ? 184  PHE C CE1   1 
ATOM   8042  C  CE2   . PHE C  3  184 ? 30.519  134.068 83.920  1.00 29.54  ? 184  PHE C CE2   1 
ATOM   8043  C  CZ    . PHE C  3  184 ? 31.021  135.280 83.460  1.00 28.53  ? 184  PHE C CZ    1 
ATOM   8044  N  N     . LEU C  3  185 ? 26.351  132.197 85.984  1.00 31.37  ? 185  LEU C N     1 
ATOM   8045  C  CA    . LEU C  3  185 ? 26.791  130.964 86.612  1.00 32.13  ? 185  LEU C CA    1 
ATOM   8046  C  C     . LEU C  3  185 ? 26.241  129.667 86.040  1.00 32.10  ? 185  LEU C C     1 
ATOM   8047  O  O     . LEU C  3  185 ? 27.007  128.794 85.611  1.00 31.00  ? 185  LEU C O     1 
ATOM   8048  C  CB    . LEU C  3  185 ? 26.442  131.022 88.097  1.00 34.14  ? 185  LEU C CB    1 
ATOM   8049  C  CG    . LEU C  3  185 ? 26.329  129.683 88.829  1.00 34.38  ? 185  LEU C CG    1 
ATOM   8050  C  CD1   . LEU C  3  185 ? 27.696  129.031 88.868  1.00 35.66  ? 185  LEU C CD1   1 
ATOM   8051  C  CD2   . LEU C  3  185 ? 25.798  129.891 90.231  1.00 32.70  ? 185  LEU C CD2   1 
ATOM   8052  N  N     . LEU C  3  186 ? 24.913  129.550 86.079  1.00 31.55  ? 186  LEU C N     1 
ATOM   8053  C  CA    . LEU C  3  186 ? 24.181  128.365 85.625  1.00 30.74  ? 186  LEU C CA    1 
ATOM   8054  C  C     . LEU C  3  186 ? 24.690  127.591 84.429  1.00 29.81  ? 186  LEU C C     1 
ATOM   8055  O  O     . LEU C  3  186 ? 24.884  126.379 84.493  1.00 30.06  ? 186  LEU C O     1 
ATOM   8056  C  CB    . LEU C  3  186 ? 22.724  128.719 85.380  1.00 30.67  ? 186  LEU C CB    1 
ATOM   8057  C  CG    . LEU C  3  186 ? 21.972  128.832 86.693  1.00 29.54  ? 186  LEU C CG    1 
ATOM   8058  C  CD1   . LEU C  3  186 ? 20.475  128.940 86.436  1.00 27.77  ? 186  LEU C CD1   1 
ATOM   8059  C  CD2   . LEU C  3  186 ? 22.299  127.602 87.520  1.00 28.14  ? 186  LEU C CD2   1 
ATOM   8060  N  N     . PRO C  3  187 ? 24.875  128.264 83.307  1.00 28.26  ? 187  PRO C N     1 
ATOM   8061  C  CA    . PRO C  3  187 ? 25.371  127.516 82.159  1.00 29.63  ? 187  PRO C CA    1 
ATOM   8062  C  C     . PRO C  3  187 ? 26.494  126.537 82.579  1.00 30.48  ? 187  PRO C C     1 
ATOM   8063  O  O     . PRO C  3  187 ? 26.498  125.363 82.198  1.00 29.42  ? 187  PRO C O     1 
ATOM   8064  C  CB    . PRO C  3  187 ? 25.857  128.627 81.236  1.00 30.12  ? 187  PRO C CB    1 
ATOM   8065  C  CG    . PRO C  3  187 ? 24.939  129.759 81.571  1.00 27.42  ? 187  PRO C CG    1 
ATOM   8066  C  CD    . PRO C  3  187 ? 24.909  129.707 83.059  1.00 26.88  ? 187  PRO C CD    1 
ATOM   8067  N  N     . PHE C  3  188 ? 27.425  127.031 83.392  1.00 31.34  ? 188  PHE C N     1 
ATOM   8068  C  CA    . PHE C  3  188 ? 28.541  126.227 83.874  1.00 31.75  ? 188  PHE C CA    1 
ATOM   8069  C  C     . PHE C  3  188 ? 28.094  124.999 84.617  1.00 30.35  ? 188  PHE C C     1 
ATOM   8070  O  O     . PHE C  3  188 ? 28.688  123.947 84.479  1.00 30.11  ? 188  PHE C O     1 
ATOM   8071  C  CB    . PHE C  3  188 ? 29.446  127.070 84.759  1.00 33.97  ? 188  PHE C CB    1 
ATOM   8072  C  CG    . PHE C  3  188 ? 30.167  128.149 83.998  1.00 37.47  ? 188  PHE C CG    1 
ATOM   8073  C  CD1   . PHE C  3  188 ? 29.869  129.492 84.203  1.00 38.31  ? 188  PHE C CD1   1 
ATOM   8074  C  CD2   . PHE C  3  188 ? 31.115  127.818 83.032  1.00 37.30  ? 188  PHE C CD2   1 
ATOM   8075  C  CE1   . PHE C  3  188 ? 30.510  130.487 83.449  1.00 38.44  ? 188  PHE C CE1   1 
ATOM   8076  C  CE2   . PHE C  3  188 ? 31.754  128.805 82.279  1.00 37.15  ? 188  PHE C CE2   1 
ATOM   8077  C  CZ    . PHE C  3  188 ? 31.452  130.137 82.485  1.00 37.62  ? 188  PHE C CZ    1 
ATOM   8078  N  N     . ALA C  3  189 ? 27.042  125.138 85.403  1.00 29.78  ? 189  ALA C N     1 
ATOM   8079  C  CA    . ALA C  3  189 ? 26.495  124.015 86.149  1.00 30.00  ? 189  ALA C CA    1 
ATOM   8080  C  C     . ALA C  3  189 ? 26.030  122.951 85.180  1.00 30.32  ? 189  ALA C C     1 
ATOM   8081  O  O     . ALA C  3  189 ? 26.197  121.757 85.420  1.00 30.06  ? 189  ALA C O     1 
ATOM   8082  C  CB    . ALA C  3  189 ? 25.340  124.465 86.964  1.00 30.99  ? 189  ALA C CB    1 
ATOM   8083  N  N     . ILE C  3  190 ? 25.415  123.388 84.092  1.00 29.92  ? 190  ILE C N     1 
ATOM   8084  C  CA    . ILE C  3  190 ? 24.962  122.448 83.093  1.00 30.77  ? 190  ILE C CA    1 
ATOM   8085  C  C     . ILE C  3  190 ? 26.189  121.694 82.589  1.00 30.62  ? 190  ILE C C     1 
ATOM   8086  O  O     . ILE C  3  190 ? 26.268  120.466 82.697  1.00 30.04  ? 190  ILE C O     1 
ATOM   8087  C  CB    . ILE C  3  190 ? 24.263  123.193 81.964  1.00 31.24  ? 190  ILE C CB    1 
ATOM   8088  C  CG1   . ILE C  3  190 ? 22.855  123.548 82.441  1.00 32.01  ? 190  ILE C CG1   1 
ATOM   8089  C  CG2   . ILE C  3  190 ? 24.270  122.357 80.674  1.00 30.20  ? 190  ILE C CG2   1 
ATOM   8090  C  CD1   . ILE C  3  190 ? 22.180  124.682 81.698  1.00 33.63  ? 190  ILE C CD1   1 
ATOM   8091  N  N     . ALA C  3  191 ? 27.151  122.448 82.067  1.00 29.75  ? 191  ALA C N     1 
ATOM   8092  C  CA    . ALA C  3  191 ? 28.392  121.885 81.558  1.00 29.40  ? 191  ALA C CA    1 
ATOM   8093  C  C     . ALA C  3  191 ? 28.879  120.772 82.490  1.00 29.88  ? 191  ALA C C     1 
ATOM   8094  O  O     . ALA C  3  191 ? 29.266  119.680 82.062  1.00 29.56  ? 191  ALA C O     1 
ATOM   8095  C  CB    . ALA C  3  191 ? 29.436  122.977 81.473  1.00 28.12  ? 191  ALA C CB    1 
ATOM   8096  N  N     . GLY C  3  192 ? 28.855  121.060 83.781  1.00 29.50  ? 192  GLY C N     1 
ATOM   8097  C  CA    . GLY C  3  192 ? 29.300  120.083 84.744  1.00 29.10  ? 192  GLY C CA    1 
ATOM   8098  C  C     . GLY C  3  192 ? 28.434  118.853 84.699  1.00 29.32  ? 192  GLY C C     1 
ATOM   8099  O  O     . GLY C  3  192 ? 28.912  117.758 84.418  1.00 29.15  ? 192  GLY C O     1 
ATOM   8100  N  N     . ILE C  3  193 ? 27.151  119.036 84.979  1.00 29.89  ? 193  ILE C N     1 
ATOM   8101  C  CA    . ILE C  3  193 ? 26.210  117.921 84.973  1.00 30.29  ? 193  ILE C CA    1 
ATOM   8102  C  C     . ILE C  3  193 ? 26.328  117.105 83.668  1.00 31.00  ? 193  ILE C C     1 
ATOM   8103  O  O     . ILE C  3  193 ? 26.319  115.872 83.699  1.00 31.81  ? 193  ILE C O     1 
ATOM   8104  C  CB    . ILE C  3  193 ? 24.782  118.433 85.155  1.00 29.58  ? 193  ILE C CB    1 
ATOM   8105  C  CG1   . ILE C  3  193 ? 24.762  119.476 86.262  1.00 28.17  ? 193  ILE C CG1   1 
ATOM   8106  C  CG2   . ILE C  3  193 ? 23.877  117.304 85.563  1.00 28.89  ? 193  ILE C CG2   1 
ATOM   8107  C  CD1   . ILE C  3  193 ? 23.453  120.171 86.417  1.00 28.49  ? 193  ILE C CD1   1 
ATOM   8108  N  N     . THR C  3  194 ? 26.443  117.784 82.530  1.00 28.21  ? 194  THR C N     1 
ATOM   8109  C  CA    . THR C  3  194 ? 26.614  117.084 81.269  1.00 26.53  ? 194  THR C CA    1 
ATOM   8110  C  C     . THR C  3  194 ? 27.745  116.076 81.421  1.00 26.61  ? 194  THR C C     1 
ATOM   8111  O  O     . THR C  3  194 ? 27.611  114.921 81.039  1.00 25.02  ? 194  THR C O     1 
ATOM   8112  C  CB    . THR C  3  194 ? 27.004  118.046 80.190  1.00 27.00  ? 194  THR C CB    1 
ATOM   8113  O  OG1   . THR C  3  194 ? 26.073  119.133 80.209  1.00 29.23  ? 194  THR C OG1   1 
ATOM   8114  C  CG2   . THR C  3  194 ? 27.036  117.348 78.808  1.00 22.95  ? 194  THR C CG2   1 
ATOM   8115  N  N     . ILE C  3  195 ? 28.866  116.523 81.980  1.00 27.10  ? 195  ILE C N     1 
ATOM   8116  C  CA    . ILE C  3  195 ? 30.020  115.645 82.196  1.00 27.77  ? 195  ILE C CA    1 
ATOM   8117  C  C     . ILE C  3  195 ? 29.581  114.385 82.905  1.00 27.28  ? 195  ILE C C     1 
ATOM   8118  O  O     . ILE C  3  195 ? 30.077  113.299 82.651  1.00 26.44  ? 195  ILE C O     1 
ATOM   8119  C  CB    . ILE C  3  195 ? 31.068  116.283 83.101  1.00 28.89  ? 195  ILE C CB    1 
ATOM   8120  C  CG1   . ILE C  3  195 ? 31.565  117.600 82.502  1.00 29.61  ? 195  ILE C CG1   1 
ATOM   8121  C  CG2   . ILE C  3  195 ? 32.199  115.306 83.316  1.00 25.68  ? 195  ILE C CG2   1 
ATOM   8122  C  CD1   . ILE C  3  195 ? 32.526  117.424 81.373  1.00 31.55  ? 195  ILE C CD1   1 
ATOM   8123  N  N     . ILE C  3  196 ? 28.663  114.549 83.835  1.00 27.66  ? 196  ILE C N     1 
ATOM   8124  C  CA    . ILE C  3  196 ? 28.161  113.414 84.558  1.00 29.68  ? 196  ILE C CA    1 
ATOM   8125  C  C     . ILE C  3  196 ? 27.279  112.592 83.631  1.00 31.23  ? 196  ILE C C     1 
ATOM   8126  O  O     . ILE C  3  196 ? 27.523  111.395 83.450  1.00 31.88  ? 196  ILE C O     1 
ATOM   8127  C  CB    . ILE C  3  196 ? 27.369  113.869 85.774  1.00 30.09  ? 196  ILE C CB    1 
ATOM   8128  C  CG1   . ILE C  3  196 ? 28.320  114.545 86.759  1.00 30.84  ? 196  ILE C CG1   1 
ATOM   8129  C  CG2   . ILE C  3  196 ? 26.670  112.688 86.410  1.00 29.88  ? 196  ILE C CG2   1 
ATOM   8130  C  CD1   . ILE C  3  196 ? 27.626  115.213 87.896  1.00 29.99  ? 196  ILE C CD1   1 
ATOM   8131  N  N     . HIS C  3  197 ? 26.267  113.245 83.045  1.00 31.96  ? 197  HIS C N     1 
ATOM   8132  C  CA    . HIS C  3  197 ? 25.316  112.619 82.110  1.00 31.26  ? 197  HIS C CA    1 
ATOM   8133  C  C     . HIS C  3  197 ? 26.104  111.652 81.247  1.00 32.26  ? 197  HIS C C     1 
ATOM   8134  O  O     . HIS C  3  197 ? 25.768  110.465 81.165  1.00 32.70  ? 197  HIS C O     1 
ATOM   8135  C  CB    . HIS C  3  197 ? 24.682  113.696 81.239  1.00 30.11  ? 197  HIS C CB    1 
ATOM   8136  C  CG    . HIS C  3  197 ? 23.625  113.204 80.299  1.00 30.11  ? 197  HIS C CG    1 
ATOM   8137  N  ND1   . HIS C  3  197 ? 22.397  112.752 80.730  1.00 30.49  ? 197  HIS C ND1   1 
ATOM   8138  C  CD2   . HIS C  3  197 ? 23.559  113.237 78.945  1.00 29.77  ? 197  HIS C CD2   1 
ATOM   8139  C  CE1   . HIS C  3  197 ? 21.616  112.544 79.683  1.00 30.42  ? 197  HIS C CE1   1 
ATOM   8140  N  NE2   . HIS C  3  197 ? 22.295  112.834 78.586  1.00 29.38  ? 197  HIS C NE2   1 
ATOM   8141  N  N     . LEU C  3  198 ? 27.175  112.161 80.630  1.00 32.16  ? 198  LEU C N     1 
ATOM   8142  C  CA    . LEU C  3  198 ? 28.033  111.336 79.781  1.00 30.82  ? 198  LEU C CA    1 
ATOM   8143  C  C     . LEU C  3  198 ? 28.732  110.233 80.515  1.00 29.31  ? 198  LEU C C     1 
ATOM   8144  O  O     . LEU C  3  198 ? 29.006  109.198 79.938  1.00 29.02  ? 198  LEU C O     1 
ATOM   8145  C  CB    . LEU C  3  198 ? 29.090  112.163 79.077  1.00 31.20  ? 198  LEU C CB    1 
ATOM   8146  C  CG    . LEU C  3  198 ? 28.705  112.493 77.648  1.00 32.05  ? 198  LEU C CG    1 
ATOM   8147  C  CD1   . LEU C  3  198 ? 29.947  112.866 76.862  1.00 32.84  ? 198  LEU C CD1   1 
ATOM   8148  C  CD2   . LEU C  3  198 ? 28.046  111.291 77.024  1.00 32.23  ? 198  LEU C CD2   1 
ATOM   8149  N  N     . THR C  3  199 ? 29.053  110.452 81.777  1.00 28.19  ? 199  THR C N     1 
ATOM   8150  C  CA    . THR C  3  199 ? 29.698  109.398 82.513  1.00 29.30  ? 199  THR C CA    1 
ATOM   8151  C  C     . THR C  3  199 ? 28.731  108.245 82.747  1.00 29.39  ? 199  THR C C     1 
ATOM   8152  O  O     . THR C  3  199 ? 29.002  107.112 82.356  1.00 31.63  ? 199  THR C O     1 
ATOM   8153  C  CB    . THR C  3  199 ? 30.232  109.891 83.837  1.00 29.18  ? 199  THR C CB    1 
ATOM   8154  O  OG1   . THR C  3  199 ? 31.586  110.318 83.649  1.00 29.33  ? 199  THR C OG1   1 
ATOM   8155  C  CG2   . THR C  3  199 ? 30.165  108.768 84.893  1.00 29.95  ? 199  THR C CG2   1 
ATOM   8156  N  N     . PHE C  3  200 ? 27.609  108.518 83.389  1.00 27.56  ? 200  PHE C N     1 
ATOM   8157  C  CA    . PHE C  3  200 ? 26.653  107.466 83.623  1.00 27.37  ? 200  PHE C CA    1 
ATOM   8158  C  C     . PHE C  3  200 ? 26.400  106.728 82.326  1.00 28.41  ? 200  PHE C C     1 
ATOM   8159  O  O     . PHE C  3  200 ? 26.261  105.508 82.299  1.00 27.26  ? 200  PHE C O     1 
ATOM   8160  C  CB    . PHE C  3  200 ? 25.348  108.048 84.117  1.00 27.93  ? 200  PHE C CB    1 
ATOM   8161  C  CG    . PHE C  3  200 ? 25.343  108.384 85.570  1.00 27.30  ? 200  PHE C CG    1 
ATOM   8162  C  CD1   . PHE C  3  200 ? 25.539  107.392 86.513  1.00 27.25  ? 200  PHE C CD1   1 
ATOM   8163  C  CD2   . PHE C  3  200 ? 25.071  109.678 86.000  1.00 26.69  ? 200  PHE C CD2   1 
ATOM   8164  C  CE1   . PHE C  3  200 ? 25.459  107.676 87.859  1.00 28.20  ? 200  PHE C CE1   1 
ATOM   8165  C  CE2   . PHE C  3  200 ? 24.989  109.976 87.349  1.00 27.10  ? 200  PHE C CE2   1 
ATOM   8166  C  CZ    . PHE C  3  200 ? 25.181  108.974 88.283  1.00 28.00  ? 200  PHE C CZ    1 
ATOM   8167  N  N     . LEU C  3  201 ? 26.328  107.474 81.237  1.00 31.22  ? 201  LEU C N     1 
ATOM   8168  C  CA    . LEU C  3  201 ? 26.099  106.836 79.956  1.00 36.00  ? 201  LEU C CA    1 
ATOM   8169  C  C     . LEU C  3  201 ? 27.203  105.784 79.726  1.00 39.98  ? 201  LEU C C     1 
ATOM   8170  O  O     . LEU C  3  201 ? 26.923  104.581 79.710  1.00 40.70  ? 201  LEU C O     1 
ATOM   8171  C  CB    . LEU C  3  201 ? 26.118  107.875 78.835  1.00 33.59  ? 201  LEU C CB    1 
ATOM   8172  C  CG    . LEU C  3  201 ? 25.620  107.291 77.519  1.00 33.14  ? 201  LEU C CG    1 
ATOM   8173  C  CD1   . LEU C  3  201 ? 24.145  107.061 77.699  1.00 33.11  ? 201  LEU C CD1   1 
ATOM   8174  C  CD2   . LEU C  3  201 ? 25.908  108.198 76.316  1.00 31.29  ? 201  LEU C CD2   1 
ATOM   8175  N  N     . HIS C  3  202 ? 28.447  106.254 79.579  1.00 42.91  ? 202  HIS C N     1 
ATOM   8176  C  CA    . HIS C  3  202 ? 29.617  105.414 79.347  1.00 45.92  ? 202  HIS C CA    1 
ATOM   8177  C  C     . HIS C  3  202 ? 29.675  104.151 80.179  1.00 47.74  ? 202  HIS C C     1 
ATOM   8178  O  O     . HIS C  3  202 ? 30.526  103.302 79.953  1.00 49.08  ? 202  HIS C O     1 
ATOM   8179  C  CB    . HIS C  3  202 ? 30.890  106.202 79.601  1.00 49.62  ? 202  HIS C CB    1 
ATOM   8180  C  CG    . HIS C  3  202 ? 31.166  107.256 78.579  1.00 56.67  ? 202  HIS C CG    1 
ATOM   8181  N  ND1   . HIS C  3  202 ? 32.254  108.101 78.659  1.00 60.58  ? 202  HIS C ND1   1 
ATOM   8182  C  CD2   . HIS C  3  202 ? 30.496  107.613 77.455  1.00 60.45  ? 202  HIS C CD2   1 
ATOM   8183  C  CE1   . HIS C  3  202 ? 32.241  108.934 77.631  1.00 62.30  ? 202  HIS C CE1   1 
ATOM   8184  N  NE2   . HIS C  3  202 ? 31.185  108.659 76.884  1.00 62.40  ? 202  HIS C NE2   1 
ATOM   8185  N  N     . GLU C  3  203 ? 28.799  104.020 81.159  1.00 48.79  ? 203  GLU C N     1 
ATOM   8186  C  CA    . GLU C  3  203 ? 28.801  102.819 81.967  1.00 50.90  ? 203  GLU C CA    1 
ATOM   8187  C  C     . GLU C  3  203 ? 28.150  101.685 81.204  1.00 51.22  ? 203  GLU C C     1 
ATOM   8188  O  O     . GLU C  3  203 ? 28.508  100.516 81.375  1.00 50.60  ? 203  GLU C O     1 
ATOM   8189  C  CB    . GLU C  3  203 ? 28.019  103.055 83.246  1.00 54.57  ? 203  GLU C CB    1 
ATOM   8190  C  CG    . GLU C  3  203 ? 28.764  103.853 84.277  1.00 59.51  ? 203  GLU C CG    1 
ATOM   8191  C  CD    . GLU C  3  203 ? 29.850  103.049 84.925  1.00 61.44  ? 203  GLU C CD    1 
ATOM   8192  O  OE1   . GLU C  3  203 ? 29.513  102.029 85.573  1.00 62.78  ? 203  GLU C OE1   1 
ATOM   8193  O  OE2   . GLU C  3  203 ? 31.029  103.443 84.775  1.00 62.58  ? 203  GLU C OE2   1 
ATOM   8194  N  N     . SER C  3  204 ? 27.195  102.056 80.352  1.00 52.32  ? 204  SER C N     1 
ATOM   8195  C  CA    . SER C  3  204 ? 26.393  101.114 79.548  1.00 52.77  ? 204  SER C CA    1 
ATOM   8196  C  C     . SER C  3  204 ? 26.634  101.101 78.031  1.00 51.04  ? 204  SER C C     1 
ATOM   8197  O  O     . SER C  3  204 ? 26.186  100.185 77.327  1.00 50.60  ? 204  SER C O     1 
ATOM   8198  C  CB    . SER C  3  204 ? 24.903  101.416 79.779  1.00 54.22  ? 204  SER C CB    1 
ATOM   8199  O  OG    . SER C  3  204 ? 24.591  102.751 79.378  1.00 54.37  ? 204  SER C OG    1 
ATOM   8200  N  N     . GLY C  3  205 ? 27.332  102.118 77.533  1.00 48.90  ? 205  GLY C N     1 
ATOM   8201  C  CA    . GLY C  3  205 ? 27.553  102.221 76.106  1.00 44.11  ? 205  GLY C CA    1 
ATOM   8202  C  C     . GLY C  3  205 ? 26.263  102.863 75.654  1.00 41.26  ? 205  GLY C C     1 
ATOM   8203  O  O     . GLY C  3  205 ? 25.370  103.097 76.477  1.00 40.86  ? 205  GLY C O     1 
ATOM   8204  N  N     . SER C  3  206 ? 26.135  103.154 74.370  1.00 38.07  ? 206  SER C N     1 
ATOM   8205  C  CA    . SER C  3  206 ? 24.914  103.782 73.891  1.00 34.52  ? 206  SER C CA    1 
ATOM   8206  C  C     . SER C  3  206 ? 23.878  102.743 73.534  1.00 33.41  ? 206  SER C C     1 
ATOM   8207  O  O     . SER C  3  206 ? 24.195  101.563 73.327  1.00 32.45  ? 206  SER C O     1 
ATOM   8208  C  CB    . SER C  3  206 ? 25.220  104.654 72.683  1.00 32.41  ? 206  SER C CB    1 
ATOM   8209  O  OG    . SER C  3  206 ? 26.411  105.371 72.926  1.00 32.08  ? 206  SER C OG    1 
ATOM   8210  N  N     . ASN C  3  207 ? 22.630  103.181 73.484  1.00 32.47  ? 207  ASN C N     1 
ATOM   8211  C  CA    . ASN C  3  207 ? 21.532  102.297 73.131  1.00 33.22  ? 207  ASN C CA    1 
ATOM   8212  C  C     . ASN C  3  207 ? 21.625  102.086 71.626  1.00 33.63  ? 207  ASN C C     1 
ATOM   8213  O  O     . ASN C  3  207 ? 22.724  102.074 71.093  1.00 35.85  ? 207  ASN C O     1 
ATOM   8214  C  CB    . ASN C  3  207 ? 20.221  102.969 73.471  1.00 34.55  ? 207  ASN C CB    1 
ATOM   8215  C  CG    . ASN C  3  207 ? 19.082  102.005 73.508  1.00 36.00  ? 207  ASN C CG    1 
ATOM   8216  O  OD1   . ASN C  3  207 ? 17.924  102.395 73.696  1.00 38.46  ? 207  ASN C OD1   1 
ATOM   8217  N  ND2   . ASN C  3  207 ? 19.394  100.726 73.339  1.00 35.27  ? 207  ASN C ND2   1 
ATOM   8218  N  N     . ASN C  3  208 ? 20.495  101.924 70.937  1.00 31.93  ? 208  ASN C N     1 
ATOM   8219  C  CA    . ASN C  3  208 ? 20.495  101.761 69.475  1.00 29.93  ? 208  ASN C CA    1 
ATOM   8220  C  C     . ASN C  3  208 ? 19.145  101.278 68.946  1.00 29.16  ? 208  ASN C C     1 
ATOM   8221  O  O     . ASN C  3  208 ? 18.522  100.391 69.515  1.00 28.87  ? 208  ASN C O     1 
ATOM   8222  C  CB    . ASN C  3  208 ? 21.566  100.784 69.037  1.00 30.15  ? 208  ASN C CB    1 
ATOM   8223  C  CG    . ASN C  3  208 ? 21.010  99.430  68.779  1.00 31.10  ? 208  ASN C CG    1 
ATOM   8224  O  OD1   . ASN C  3  208 ? 20.167  99.271  67.901  1.00 32.14  ? 208  ASN C OD1   1 
ATOM   8225  N  ND2   . ASN C  3  208 ? 21.454  98.438  69.548  1.00 31.29  ? 208  ASN C ND2   1 
ATOM   8226  N  N     . PRO C  3  209 ? 18.715  101.813 67.805  1.00 28.56  ? 209  PRO C N     1 
ATOM   8227  C  CA    . PRO C  3  209 ? 17.462  101.540 67.100  1.00 28.68  ? 209  PRO C CA    1 
ATOM   8228  C  C     . PRO C  3  209 ? 16.706  100.257 67.374  1.00 29.57  ? 209  PRO C C     1 
ATOM   8229  O  O     . PRO C  3  209 ? 15.557  100.304 67.783  1.00 30.16  ? 209  PRO C O     1 
ATOM   8230  C  CB    . PRO C  3  209 ? 17.860  101.667 65.652  1.00 29.17  ? 209  PRO C CB    1 
ATOM   8231  C  CG    . PRO C  3  209 ? 18.809  102.782 65.717  1.00 29.30  ? 209  PRO C CG    1 
ATOM   8232  C  CD    . PRO C  3  209 ? 19.680  102.428 66.888  1.00 28.35  ? 209  PRO C CD    1 
ATOM   8233  N  N     . LEU C  3  210 ? 17.339  99.117  67.150  1.00 31.18  ? 210  LEU C N     1 
ATOM   8234  C  CA    . LEU C  3  210 ? 16.690  97.823  67.343  1.00 33.51  ? 210  LEU C CA    1 
ATOM   8235  C  C     . LEU C  3  210 ? 16.431  97.417  68.799  1.00 36.10  ? 210  LEU C C     1 
ATOM   8236  O  O     . LEU C  3  210 ? 15.573  96.573  69.091  1.00 36.62  ? 210  LEU C O     1 
ATOM   8237  C  CB    . LEU C  3  210 ? 17.516  96.753  66.648  1.00 32.17  ? 210  LEU C CB    1 
ATOM   8238  C  CG    . LEU C  3  210 ? 17.529  96.907  65.137  1.00 30.19  ? 210  LEU C CG    1 
ATOM   8239  C  CD1   . LEU C  3  210 ? 18.668  96.109  64.493  1.00 30.92  ? 210  LEU C CD1   1 
ATOM   8240  C  CD2   . LEU C  3  210 ? 16.188  96.459  64.659  1.00 27.44  ? 210  LEU C CD2   1 
ATOM   8241  N  N     . GLY C  3  211 ? 17.170  98.011  69.720  1.00 37.43  ? 211  GLY C N     1 
ATOM   8242  C  CA    . GLY C  3  211 ? 16.942  97.675  71.106  1.00 40.71  ? 211  GLY C CA    1 
ATOM   8243  C  C     . GLY C  3  211 ? 17.338  96.267  71.485  1.00 42.68  ? 211  GLY C C     1 
ATOM   8244  O  O     . GLY C  3  211 ? 16.598  95.585  72.193  1.00 43.16  ? 211  GLY C O     1 
ATOM   8245  N  N     . ILE C  3  212 ? 18.503  95.836  71.010  1.00 44.81  ? 212  ILE C N     1 
ATOM   8246  C  CA    . ILE C  3  212 ? 19.047  94.510  71.322  1.00 46.94  ? 212  ILE C CA    1 
ATOM   8247  C  C     . ILE C  3  212 ? 20.563  94.608  71.390  1.00 49.11  ? 212  ILE C C     1 
ATOM   8248  O  O     . ILE C  3  212 ? 21.167  95.411  70.681  1.00 50.25  ? 212  ILE C O     1 
ATOM   8249  C  CB    . ILE C  3  212 ? 18.697  93.472  70.257  1.00 45.29  ? 212  ILE C CB    1 
ATOM   8250  C  CG1   . ILE C  3  212 ? 18.842  94.094  68.881  1.00 44.33  ? 212  ILE C CG1   1 
ATOM   8251  C  CG2   . ILE C  3  212 ? 17.299  92.928  70.475  1.00 44.74  ? 212  ILE C CG2   1 
ATOM   8252  C  CD1   . ILE C  3  212 ? 18.529  93.123  67.779  1.00 45.80  ? 212  ILE C CD1   1 
ATOM   8253  N  N     . SER C  3  213 ? 21.172  93.790  72.238  1.00 50.94  ? 213  SER C N     1 
ATOM   8254  C  CA    . SER C  3  213 ? 22.627  93.799  72.407  1.00 54.02  ? 213  SER C CA    1 
ATOM   8255  C  C     . SER C  3  213 ? 23.400  94.171  71.141  1.00 53.91  ? 213  SER C C     1 
ATOM   8256  O  O     . SER C  3  213 ? 23.293  93.500  70.123  1.00 54.70  ? 213  SER C O     1 
ATOM   8257  C  CB    . SER C  3  213 ? 23.095  92.424  72.908  1.00 57.27  ? 213  SER C CB    1 
ATOM   8258  O  OG    . SER C  3  213 ? 24.513  92.310  72.977  1.00 61.07  ? 213  SER C OG    1 
ATOM   8259  N  N     . SER C  3  214 ? 24.187  95.237  71.215  1.00 54.07  ? 214  SER C N     1 
ATOM   8260  C  CA    . SER C  3  214 ? 24.979  95.697  70.076  1.00 53.86  ? 214  SER C CA    1 
ATOM   8261  C  C     . SER C  3  214 ? 26.422  95.207  70.169  1.00 52.55  ? 214  SER C C     1 
ATOM   8262  O  O     . SER C  3  214 ? 27.231  95.429  69.275  1.00 51.06  ? 214  SER C O     1 
ATOM   8263  C  CB    . SER C  3  214 ? 24.933  97.237  70.000  1.00 55.29  ? 214  SER C CB    1 
ATOM   8264  O  OG    . SER C  3  214 ? 24.690  97.850  71.271  1.00 57.23  ? 214  SER C OG    1 
ATOM   8265  N  N     . ASP C  3  215 ? 26.726  94.523  71.261  1.00 52.74  ? 215  ASP C N     1 
ATOM   8266  C  CA    . ASP C  3  215 ? 28.067  94.011  71.503  1.00 53.77  ? 215  ASP C CA    1 
ATOM   8267  C  C     . ASP C  3  215 ? 28.559  93.157  70.326  1.00 53.54  ? 215  ASP C C     1 
ATOM   8268  O  O     . ASP C  3  215 ? 29.770  93.002  70.102  1.00 53.93  ? 215  ASP C O     1 
ATOM   8269  C  CB    . ASP C  3  215 ? 28.090  93.170  72.796  1.00 55.14  ? 215  ASP C CB    1 
ATOM   8270  C  CG    . ASP C  3  215 ? 27.711  93.970  74.062  1.00 56.43  ? 215  ASP C CG    1 
ATOM   8271  O  OD1   . ASP C  3  215 ? 27.646  93.325  75.130  1.00 57.76  ? 215  ASP C OD1   1 
ATOM   8272  O  OD2   . ASP C  3  215 ? 27.483  95.206  74.016  1.00 55.21  ? 215  ASP C OD2   1 
ATOM   8273  N  N     . SER C  3  216 ? 27.619  92.615  69.562  1.00 52.32  ? 216  SER C N     1 
ATOM   8274  C  CA    . SER C  3  216 ? 27.970  91.748  68.438  1.00 50.76  ? 216  SER C CA    1 
ATOM   8275  C  C     . SER C  3  216 ? 28.443  92.478  67.192  1.00 48.76  ? 216  SER C C     1 
ATOM   8276  O  O     . SER C  3  216 ? 28.662  91.868  66.149  1.00 47.33  ? 216  SER C O     1 
ATOM   8277  C  CB    . SER C  3  216 ? 26.772  90.859  68.091  1.00 51.40  ? 216  SER C CB    1 
ATOM   8278  O  OG    . SER C  3  216 ? 25.620  91.261  68.816  1.00 52.49  ? 216  SER C OG    1 
ATOM   8279  N  N     . ASP C  3  217 ? 28.623  93.785  67.301  1.00 47.67  ? 217  ASP C N     1 
ATOM   8280  C  CA    . ASP C  3  217 ? 29.038  94.556  66.146  1.00 46.22  ? 217  ASP C CA    1 
ATOM   8281  C  C     . ASP C  3  217 ? 29.224  96.015  66.509  1.00 44.77  ? 217  ASP C C     1 
ATOM   8282  O  O     . ASP C  3  217 ? 28.462  96.869  66.048  1.00 44.54  ? 217  ASP C O     1 
ATOM   8283  C  CB    . ASP C  3  217 ? 27.969  94.451  65.052  1.00 46.96  ? 217  ASP C CB    1 
ATOM   8284  C  CG    . ASP C  3  217 ? 28.316  95.245  63.809  1.00 47.21  ? 217  ASP C CG    1 
ATOM   8285  O  OD1   . ASP C  3  217 ? 27.437  95.958  63.293  1.00 46.91  ? 217  ASP C OD1   1 
ATOM   8286  O  OD2   . ASP C  3  217 ? 29.464  95.148  63.337  1.00 49.85  ? 217  ASP C OD2   1 
ATOM   8287  N  N     . LYS C  3  218 ? 30.218  96.313  67.337  1.00 42.71  ? 218  LYS C N     1 
ATOM   8288  C  CA    . LYS C  3  218 ? 30.451  97.702  67.698  1.00 40.46  ? 218  LYS C CA    1 
ATOM   8289  C  C     . LYS C  3  218 ? 31.554  98.285  66.845  1.00 38.69  ? 218  LYS C C     1 
ATOM   8290  O  O     . LYS C  3  218 ? 32.305  97.557  66.200  1.00 40.08  ? 218  LYS C O     1 
ATOM   8291  C  CB    . LYS C  3  218 ? 30.796  97.821  69.170  1.00 40.84  ? 218  LYS C CB    1 
ATOM   8292  C  CG    . LYS C  3  218 ? 29.685  97.292  70.051  1.00 41.50  ? 218  LYS C CG    1 
ATOM   8293  C  CD    . LYS C  3  218 ? 29.121  98.328  71.010  1.00 40.49  ? 218  LYS C CD    1 
ATOM   8294  C  CE    . LYS C  3  218 ? 28.246  97.605  72.016  1.00 40.52  ? 218  LYS C CE    1 
ATOM   8295  N  NZ    . LYS C  3  218 ? 27.766  98.441  73.136  1.00 43.43  ? 218  LYS C NZ    1 
ATOM   8296  N  N     . ILE C  3  219 ? 31.653  99.600  66.839  1.00 35.82  ? 219  ILE C N     1 
ATOM   8297  C  CA    . ILE C  3  219 ? 32.656  100.253 66.028  1.00 34.82  ? 219  ILE C CA    1 
ATOM   8298  C  C     . ILE C  3  219 ? 33.282  101.424 66.759  1.00 35.18  ? 219  ILE C C     1 
ATOM   8299  O  O     . ILE C  3  219 ? 32.590  102.182 67.443  1.00 37.15  ? 219  ILE C O     1 
ATOM   8300  C  CB    . ILE C  3  219 ? 32.027  100.750 64.750  1.00 33.54  ? 219  ILE C CB    1 
ATOM   8301  C  CG1   . ILE C  3  219 ? 30.764  101.545 65.079  1.00 34.08  ? 219  ILE C CG1   1 
ATOM   8302  C  CG2   . ILE C  3  219 ? 31.669  99.586  63.890  1.00 32.08  ? 219  ILE C CG2   1 
ATOM   8303  C  CD1   . ILE C  3  219 ? 29.993  102.025 63.866  1.00 34.48  ? 219  ILE C CD1   1 
ATOM   8304  N  N     . PRO C  3  220 ? 34.598  101.612 66.597  1.00 33.20  ? 220  PRO C N     1 
ATOM   8305  C  CA    . PRO C  3  220 ? 35.306  102.703 67.258  1.00 31.60  ? 220  PRO C CA    1 
ATOM   8306  C  C     . PRO C  3  220 ? 34.607  104.008 66.957  1.00 31.15  ? 220  PRO C C     1 
ATOM   8307  O  O     . PRO C  3  220 ? 34.304  104.284 65.797  1.00 30.96  ? 220  PRO C O     1 
ATOM   8308  C  CB    . PRO C  3  220 ? 36.679  102.637 66.624  1.00 30.71  ? 220  PRO C CB    1 
ATOM   8309  C  CG    . PRO C  3  220 ? 36.344  102.286 65.238  1.00 31.46  ? 220  PRO C CG    1 
ATOM   8310  C  CD    . PRO C  3  220 ? 35.357  101.160 65.426  1.00 32.53  ? 220  PRO C CD    1 
ATOM   8311  N  N     . PHE C  3  221 ? 34.343  104.791 68.000  1.00 30.95  ? 221  PHE C N     1 
ATOM   8312  C  CA    . PHE C  3  221 ? 33.691  106.076 67.851  1.00 32.98  ? 221  PHE C CA    1 
ATOM   8313  C  C     . PHE C  3  221 ? 34.298  106.855 66.668  1.00 35.03  ? 221  PHE C C     1 
ATOM   8314  O  O     . PHE C  3  221 ? 33.568  107.508 65.897  1.00 35.07  ? 221  PHE C O     1 
ATOM   8315  C  CB    . PHE C  3  221 ? 33.840  106.905 69.124  1.00 33.76  ? 221  PHE C CB    1 
ATOM   8316  C  CG    . PHE C  3  221 ? 33.002  108.137 69.112  1.00 36.38  ? 221  PHE C CG    1 
ATOM   8317  C  CD1   . PHE C  3  221 ? 31.686  108.080 69.539  1.00 36.59  ? 221  PHE C CD1   1 
ATOM   8318  C  CD2   . PHE C  3  221 ? 33.475  109.319 68.531  1.00 37.66  ? 221  PHE C CD2   1 
ATOM   8319  C  CE1   . PHE C  3  221 ? 30.841  109.163 69.382  1.00 36.98  ? 221  PHE C CE1   1 
ATOM   8320  C  CE2   . PHE C  3  221 ? 32.635  110.419 68.365  1.00 37.67  ? 221  PHE C CE2   1 
ATOM   8321  C  CZ    . PHE C  3  221 ? 31.310  110.337 68.791  1.00 38.06  ? 221  PHE C CZ    1 
ATOM   8322  N  N     . HIS C  3  222 ? 35.634  106.800 66.549  1.00 36.19  ? 222  HIS C N     1 
ATOM   8323  C  CA    . HIS C  3  222 ? 36.384  107.451 65.461  1.00 35.28  ? 222  HIS C CA    1 
ATOM   8324  C  C     . HIS C  3  222 ? 36.765  106.370 64.460  1.00 34.79  ? 222  HIS C C     1 
ATOM   8325  O  O     . HIS C  3  222 ? 37.195  105.285 64.859  1.00 36.75  ? 222  HIS C O     1 
ATOM   8326  C  CB    . HIS C  3  222 ? 37.676  108.080 65.975  1.00 35.33  ? 222  HIS C CB    1 
ATOM   8327  C  CG    . HIS C  3  222 ? 38.456  108.776 64.906  1.00 35.79  ? 222  HIS C CG    1 
ATOM   8328  N  ND1   . HIS C  3  222 ? 38.384  110.137 64.693  1.00 36.19  ? 222  HIS C ND1   1 
ATOM   8329  C  CD2   . HIS C  3  222 ? 39.264  108.289 63.937  1.00 36.84  ? 222  HIS C CD2   1 
ATOM   8330  C  CE1   . HIS C  3  222 ? 39.109  110.458 63.637  1.00 35.93  ? 222  HIS C CE1   1 
ATOM   8331  N  NE2   . HIS C  3  222 ? 39.653  109.355 63.159  1.00 37.88  ? 222  HIS C NE2   1 
ATOM   8332  N  N     . PRO C  3  223 ? 36.673  106.655 63.151  1.00 33.13  ? 223  PRO C N     1 
ATOM   8333  C  CA    . PRO C  3  223 ? 36.256  107.886 62.490  1.00 30.65  ? 223  PRO C CA    1 
ATOM   8334  C  C     . PRO C  3  223 ? 34.771  107.895 62.274  1.00 28.62  ? 223  PRO C C     1 
ATOM   8335  O  O     . PRO C  3  223 ? 34.186  108.919 61.946  1.00 26.82  ? 223  PRO C O     1 
ATOM   8336  C  CB    . PRO C  3  223 ? 36.997  107.805 61.176  1.00 32.17  ? 223  PRO C CB    1 
ATOM   8337  C  CG    . PRO C  3  223 ? 36.797  106.370 60.831  1.00 32.11  ? 223  PRO C CG    1 
ATOM   8338  C  CD    . PRO C  3  223 ? 37.039  105.645 62.140  1.00 33.20  ? 223  PRO C CD    1 
ATOM   8339  N  N     . TYR C  3  224 ? 34.171  106.730 62.436  1.00 28.05  ? 224  TYR C N     1 
ATOM   8340  C  CA    . TYR C  3  224 ? 32.750  106.605 62.247  1.00 28.85  ? 224  TYR C CA    1 
ATOM   8341  C  C     . TYR C  3  224 ? 31.959  107.761 62.841  1.00 29.33  ? 224  TYR C C     1 
ATOM   8342  O  O     . TYR C  3  224 ? 31.707  108.752 62.151  1.00 30.63  ? 224  TYR C O     1 
ATOM   8343  C  CB    . TYR C  3  224 ? 32.300  105.280 62.814  1.00 29.31  ? 224  TYR C CB    1 
ATOM   8344  C  CG    . TYR C  3  224 ? 32.835  104.141 62.005  1.00 32.11  ? 224  TYR C CG    1 
ATOM   8345  C  CD1   . TYR C  3  224 ? 32.949  102.872 62.548  1.00 33.95  ? 224  TYR C CD1   1 
ATOM   8346  C  CD2   . TYR C  3  224 ? 33.178  104.317 60.662  1.00 32.25  ? 224  TYR C CD2   1 
ATOM   8347  C  CE1   . TYR C  3  224 ? 33.386  101.795 61.765  1.00 34.97  ? 224  TYR C CE1   1 
ATOM   8348  C  CE2   . TYR C  3  224 ? 33.616  103.253 59.872  1.00 32.10  ? 224  TYR C CE2   1 
ATOM   8349  C  CZ    . TYR C  3  224 ? 33.717  101.995 60.426  1.00 33.39  ? 224  TYR C CZ    1 
ATOM   8350  O  OH    . TYR C  3  224 ? 34.140  100.931 59.664  1.00 31.71  ? 224  TYR C OH    1 
ATOM   8351  N  N     . TYR C  3  225 ? 31.599  107.671 64.116  1.00 27.96  ? 225  TYR C N     1 
ATOM   8352  C  CA    . TYR C  3  225 ? 30.804  108.724 64.707  1.00 27.21  ? 225  TYR C CA    1 
ATOM   8353  C  C     . TYR C  3  225 ? 31.422  110.085 64.818  1.00 28.25  ? 225  TYR C C     1 
ATOM   8354  O  O     . TYR C  3  225 ? 30.713  111.070 64.969  1.00 28.85  ? 225  TYR C O     1 
ATOM   8355  C  CB    . TYR C  3  225 ? 30.246  108.257 66.029  1.00 24.57  ? 225  TYR C CB    1 
ATOM   8356  C  CG    . TYR C  3  225 ? 29.391  107.064 65.771  1.00 24.97  ? 225  TYR C CG    1 
ATOM   8357  C  CD1   . TYR C  3  225 ? 29.945  105.797 65.783  1.00 27.04  ? 225  TYR C CD1   1 
ATOM   8358  C  CD2   . TYR C  3  225 ? 28.070  107.200 65.368  1.00 24.74  ? 225  TYR C CD2   1 
ATOM   8359  C  CE1   . TYR C  3  225 ? 29.230  104.695 65.398  1.00 26.99  ? 225  TYR C CE1   1 
ATOM   8360  C  CE2   . TYR C  3  225 ? 27.339  106.107 64.971  1.00 26.91  ? 225  TYR C CE2   1 
ATOM   8361  C  CZ    . TYR C  3  225 ? 27.931  104.846 64.985  1.00 28.57  ? 225  TYR C CZ    1 
ATOM   8362  O  OH    . TYR C  3  225 ? 27.243  103.736 64.534  1.00 30.86  ? 225  TYR C OH    1 
ATOM   8363  N  N     . SER C  3  226 ? 32.735  110.170 64.715  1.00 29.95  ? 226  SER C N     1 
ATOM   8364  C  CA    . SER C  3  226 ? 33.356  111.475 64.777  1.00 32.76  ? 226  SER C CA    1 
ATOM   8365  C  C     . SER C  3  226 ? 32.947  112.229 63.513  1.00 34.66  ? 226  SER C C     1 
ATOM   8366  O  O     . SER C  3  226 ? 32.343  113.294 63.591  1.00 35.65  ? 226  SER C O     1 
ATOM   8367  C  CB    . SER C  3  226 ? 34.860  111.327 64.845  1.00 32.07  ? 226  SER C CB    1 
ATOM   8368  O  OG    . SER C  3  226 ? 35.229  110.202 64.073  1.00 33.56  ? 226  SER C OG    1 
ATOM   8369  N  N     . PHE C  3  227 ? 33.244  111.672 62.344  1.00 36.47  ? 227  PHE C N     1 
ATOM   8370  C  CA    . PHE C  3  227 ? 32.877  112.348 61.101  1.00 38.09  ? 227  PHE C CA    1 
ATOM   8371  C  C     . PHE C  3  227 ? 31.401  112.634 61.101  1.00 37.25  ? 227  PHE C C     1 
ATOM   8372  O  O     . PHE C  3  227 ? 30.971  113.737 60.754  1.00 35.07  ? 227  PHE C O     1 
ATOM   8373  C  CB    . PHE C  3  227 ? 33.235  111.496 59.879  1.00 40.94  ? 227  PHE C CB    1 
ATOM   8374  C  CG    . PHE C  3  227 ? 34.660  111.655 59.435  1.00 43.94  ? 227  PHE C CG    1 
ATOM   8375  C  CD1   . PHE C  3  227 ? 35.112  112.872 58.936  1.00 45.10  ? 227  PHE C CD1   1 
ATOM   8376  C  CD2   . PHE C  3  227 ? 35.570  110.621 59.584  1.00 45.30  ? 227  PHE C CD2   1 
ATOM   8377  C  CE1   . PHE C  3  227 ? 36.452  113.057 58.598  1.00 45.59  ? 227  PHE C CE1   1 
ATOM   8378  C  CE2   . PHE C  3  227 ? 36.916  110.799 59.249  1.00 47.35  ? 227  PHE C CE2   1 
ATOM   8379  C  CZ    . PHE C  3  227 ? 37.355  112.021 58.758  1.00 46.75  ? 227  PHE C CZ    1 
ATOM   8380  N  N     . LYS C  3  228 ? 30.634  111.633 61.524  1.00 37.77  ? 228  LYS C N     1 
ATOM   8381  C  CA    . LYS C  3  228 ? 29.182  111.758 61.570  1.00 39.31  ? 228  LYS C CA    1 
ATOM   8382  C  C     . LYS C  3  228 ? 28.718  112.912 62.429  1.00 39.55  ? 228  LYS C C     1 
ATOM   8383  O  O     . LYS C  3  228 ? 27.635  113.431 62.220  1.00 40.49  ? 228  LYS C O     1 
ATOM   8384  C  CB    . LYS C  3  228 ? 28.518  110.468 62.058  1.00 39.47  ? 228  LYS C CB    1 
ATOM   8385  C  CG    . LYS C  3  228 ? 26.992  110.493 61.983  1.00 40.33  ? 228  LYS C CG    1 
ATOM   8386  C  CD    . LYS C  3  228 ? 26.413  109.082 61.900  1.00 45.04  ? 228  LYS C CD    1 
ATOM   8387  C  CE    . LYS C  3  228 ? 24.886  109.085 61.848  1.00 47.10  ? 228  LYS C CE    1 
ATOM   8388  N  NZ    . LYS C  3  228 ? 24.287  107.714 61.740  1.00 49.67  ? 228  LYS C NZ    1 
ATOM   8389  N  N     . ASP C  3  229 ? 29.521  113.320 63.400  1.00 39.20  ? 229  ASP C N     1 
ATOM   8390  C  CA    . ASP C  3  229 ? 29.126  114.441 64.230  1.00 37.79  ? 229  ASP C CA    1 
ATOM   8391  C  C     . ASP C  3  229 ? 29.378  115.740 63.522  1.00 37.34  ? 229  ASP C C     1 
ATOM   8392  O  O     . ASP C  3  229 ? 28.575  116.654 63.620  1.00 37.47  ? 229  ASP C O     1 
ATOM   8393  C  CB    . ASP C  3  229 ? 29.881  114.430 65.539  1.00 37.63  ? 229  ASP C CB    1 
ATOM   8394  C  CG    . ASP C  3  229 ? 29.255  113.516 66.527  1.00 39.17  ? 229  ASP C CG    1 
ATOM   8395  O  OD1   . ASP C  3  229 ? 29.894  113.189 67.543  1.00 40.61  ? 229  ASP C OD1   1 
ATOM   8396  O  OD2   . ASP C  3  229 ? 28.100  113.128 66.277  1.00 40.42  ? 229  ASP C OD2   1 
ATOM   8397  N  N     . ILE C  3  230 ? 30.488  115.818 62.799  1.00 36.77  ? 230  ILE C N     1 
ATOM   8398  C  CA    . ILE C  3  230 ? 30.826  117.040 62.093  1.00 37.13  ? 230  ILE C CA    1 
ATOM   8399  C  C     . ILE C  3  230 ? 29.775  117.354 61.054  1.00 36.61  ? 230  ILE C C     1 
ATOM   8400  O  O     . ILE C  3  230 ? 29.393  118.513 60.891  1.00 36.18  ? 230  ILE C O     1 
ATOM   8401  C  CB    . ILE C  3  230 ? 32.191  116.937 61.405  1.00 38.09  ? 230  ILE C CB    1 
ATOM   8402  C  CG1   . ILE C  3  230 ? 33.282  116.775 62.457  1.00 39.34  ? 230  ILE C CG1   1 
ATOM   8403  C  CG2   . ILE C  3  230 ? 32.468  118.199 60.606  1.00 37.52  ? 230  ILE C CG2   1 
ATOM   8404  C  CD1   . ILE C  3  230 ? 33.330  117.923 63.475  1.00 38.44  ? 230  ILE C CD1   1 
ATOM   8405  N  N     . LEU C  3  231 ? 29.314  116.322 60.349  1.00 35.44  ? 231  LEU C N     1 
ATOM   8406  C  CA    . LEU C  3  231 ? 28.285  116.498 59.331  1.00 34.50  ? 231  LEU C CA    1 
ATOM   8407  C  C     . LEU C  3  231 ? 27.065  117.071 60.049  1.00 35.36  ? 231  LEU C C     1 
ATOM   8408  O  O     . LEU C  3  231 ? 26.546  118.137 59.703  1.00 34.56  ? 231  LEU C O     1 
ATOM   8409  C  CB    . LEU C  3  231 ? 27.933  115.150 58.714  1.00 32.93  ? 231  LEU C CB    1 
ATOM   8410  C  CG    . LEU C  3  231 ? 26.995  115.143 57.509  1.00 31.82  ? 231  LEU C CG    1 
ATOM   8411  C  CD1   . LEU C  3  231 ? 27.809  114.808 56.288  1.00 31.91  ? 231  LEU C CD1   1 
ATOM   8412  C  CD2   . LEU C  3  231 ? 25.890  114.112 57.676  1.00 31.90  ? 231  LEU C CD2   1 
ATOM   8413  N  N     . GLY C  3  232 ? 26.626  116.349 61.073  1.00 36.24  ? 232  GLY C N     1 
ATOM   8414  C  CA    . GLY C  3  232 ? 25.489  116.785 61.855  1.00 37.70  ? 232  GLY C CA    1 
ATOM   8415  C  C     . GLY C  3  232 ? 25.753  118.160 62.421  1.00 38.63  ? 232  GLY C C     1 
ATOM   8416  O  O     . GLY C  3  232 ? 24.829  118.886 62.765  1.00 38.76  ? 232  GLY C O     1 
ATOM   8417  N  N     . LEU C  3  233 ? 27.025  118.525 62.534  1.00 39.68  ? 233  LEU C N     1 
ATOM   8418  C  CA    . LEU C  3  233 ? 27.349  119.842 63.046  1.00 39.63  ? 233  LEU C CA    1 
ATOM   8419  C  C     . LEU C  3  233 ? 26.900  120.843 61.994  1.00 40.82  ? 233  LEU C C     1 
ATOM   8420  O  O     . LEU C  3  233 ? 25.938  121.573 62.215  1.00 43.34  ? 233  LEU C O     1 
ATOM   8421  C  CB    . LEU C  3  233 ? 28.845  120.013 63.299  1.00 36.25  ? 233  LEU C CB    1 
ATOM   8422  C  CG    . LEU C  3  233 ? 29.035  121.412 63.877  1.00 34.31  ? 233  LEU C CG    1 
ATOM   8423  C  CD1   . LEU C  3  233 ? 28.659  121.387 65.325  1.00 31.74  ? 233  LEU C CD1   1 
ATOM   8424  C  CD2   . LEU C  3  233 ? 30.447  121.869 63.713  1.00 35.30  ? 233  LEU C CD2   1 
ATOM   8425  N  N     . THR C  3  234 ? 27.571  120.859 60.843  1.00 40.08  ? 234  THR C N     1 
ATOM   8426  C  CA    . THR C  3  234 ? 27.217  121.798 59.778  1.00 39.95  ? 234  THR C CA    1 
ATOM   8427  C  C     . THR C  3  234 ? 25.725  121.791 59.433  1.00 39.46  ? 234  THR C C     1 
ATOM   8428  O  O     . THR C  3  234 ? 25.122  122.852 59.191  1.00 39.56  ? 234  THR C O     1 
ATOM   8429  C  CB    . THR C  3  234 ? 28.003  121.511 58.481  1.00 39.94  ? 234  THR C CB    1 
ATOM   8430  O  OG1   . THR C  3  234 ? 27.904  120.119 58.174  1.00 40.56  ? 234  THR C OG1   1 
ATOM   8431  C  CG2   . THR C  3  234 ? 29.463  121.912 58.627  1.00 39.23  ? 234  THR C CG2   1 
ATOM   8432  N  N     . LEU C  3  235 ? 25.133  120.601 59.414  1.00 37.38  ? 235  LEU C N     1 
ATOM   8433  C  CA    . LEU C  3  235 ? 23.729  120.477 59.084  1.00 36.71  ? 235  LEU C CA    1 
ATOM   8434  C  C     . LEU C  3  235 ? 22.858  121.359 59.963  1.00 37.03  ? 235  LEU C C     1 
ATOM   8435  O  O     . LEU C  3  235 ? 22.115  122.200 59.463  1.00 37.68  ? 235  LEU C O     1 
ATOM   8436  C  CB    . LEU C  3  235 ? 23.323  119.023 59.191  1.00 36.36  ? 235  LEU C CB    1 
ATOM   8437  C  CG    . LEU C  3  235 ? 23.946  118.241 58.044  1.00 36.30  ? 235  LEU C CG    1 
ATOM   8438  C  CD1   . LEU C  3  235 ? 23.833  116.760 58.280  1.00 37.20  ? 235  LEU C CD1   1 
ATOM   8439  C  CD2   . LEU C  3  235 ? 23.254  118.634 56.770  1.00 35.77  ? 235  LEU C CD2   1 
ATOM   8440  N  N     . MET C  3  236 ? 22.940  121.184 61.273  1.00 36.64  ? 236  MET C N     1 
ATOM   8441  C  CA    . MET C  3  236 ? 22.155  122.028 62.155  1.00 36.50  ? 236  MET C CA    1 
ATOM   8442  C  C     . MET C  3  236 ? 22.689  123.454 62.000  1.00 35.68  ? 236  MET C C     1 
ATOM   8443  O  O     . MET C  3  236 ? 21.946  124.387 61.725  1.00 35.75  ? 236  MET C O     1 
ATOM   8444  C  CB    . MET C  3  236 ? 22.295  121.553 63.593  1.00 38.07  ? 236  MET C CB    1 
ATOM   8445  C  CG    . MET C  3  236 ? 21.663  122.453 64.615  1.00 42.16  ? 236  MET C CG    1 
ATOM   8446  S  SD    . MET C  3  236 ? 22.925  122.910 65.830  1.00 51.78  ? 236  MET C SD    1 
ATOM   8447  C  CE    . MET C  3  236 ? 22.246  124.369 66.549  1.00 50.20  ? 236  MET C CE    1 
ATOM   8448  N  N     . LEU C  3  237 ? 23.998  123.615 62.123  1.00 34.95  ? 237  LEU C N     1 
ATOM   8449  C  CA    . LEU C  3  237 ? 24.613  124.937 62.007  1.00 33.19  ? 237  LEU C CA    1 
ATOM   8450  C  C     . LEU C  3  237 ? 24.059  125.785 60.879  1.00 30.23  ? 237  LEU C C     1 
ATOM   8451  O  O     . LEU C  3  237 ? 24.131  127.012 60.923  1.00 28.88  ? 237  LEU C O     1 
ATOM   8452  C  CB    . LEU C  3  237 ? 26.129  124.822 61.837  1.00 33.36  ? 237  LEU C CB    1 
ATOM   8453  C  CG    . LEU C  3  237 ? 26.866  125.878 62.653  1.00 34.20  ? 237  LEU C CG    1 
ATOM   8454  C  CD1   . LEU C  3  237 ? 26.446  125.767 64.115  1.00 35.08  ? 237  LEU C CD1   1 
ATOM   8455  C  CD2   . LEU C  3  237 ? 28.348  125.678 62.528  1.00 36.26  ? 237  LEU C CD2   1 
ATOM   8456  N  N     . THR C  3  238 ? 23.489  125.149 59.874  1.00 27.29  ? 238  THR C N     1 
ATOM   8457  C  CA    . THR C  3  238 ? 22.986  125.942 58.792  1.00 27.17  ? 238  THR C CA    1 
ATOM   8458  C  C     . THR C  3  238 ? 21.723  126.732 59.140  1.00 26.99  ? 238  THR C C     1 
ATOM   8459  O  O     . THR C  3  238 ? 21.783  127.954 59.285  1.00 28.81  ? 238  THR C O     1 
ATOM   8460  C  CB    . THR C  3  238 ? 22.769  125.087 57.532  1.00 26.80  ? 238  THR C CB    1 
ATOM   8461  O  OG1   . THR C  3  238 ? 24.033  124.604 57.061  1.00 23.82  ? 238  THR C OG1   1 
ATOM   8462  C  CG2   . THR C  3  238 ? 22.113  125.918 56.436  1.00 26.54  ? 238  THR C CG2   1 
ATOM   8463  N  N     . PRO C  3  239 ? 20.574  126.063 59.303  1.00 24.73  ? 239  PRO C N     1 
ATOM   8464  C  CA    . PRO C  3  239 ? 19.375  126.837 59.623  1.00 23.52  ? 239  PRO C CA    1 
ATOM   8465  C  C     . PRO C  3  239 ? 19.614  127.823 60.741  1.00 23.74  ? 239  PRO C C     1 
ATOM   8466  O  O     . PRO C  3  239 ? 19.119  128.946 60.676  1.00 24.02  ? 239  PRO C O     1 
ATOM   8467  C  CB    . PRO C  3  239 ? 18.356  125.773 59.978  1.00 22.05  ? 239  PRO C CB    1 
ATOM   8468  C  CG    . PRO C  3  239 ? 19.192  124.695 60.499  1.00 23.58  ? 239  PRO C CG    1 
ATOM   8469  C  CD    . PRO C  3  239 ? 20.356  124.641 59.571  1.00 23.08  ? 239  PRO C CD    1 
ATOM   8470  N  N     . PHE C  3  240 ? 20.383  127.413 61.749  1.00 23.52  ? 240  PHE C N     1 
ATOM   8471  C  CA    . PHE C  3  240 ? 20.701  128.287 62.876  1.00 24.48  ? 240  PHE C CA    1 
ATOM   8472  C  C     . PHE C  3  240 ? 21.228  129.614 62.333  1.00 25.77  ? 240  PHE C C     1 
ATOM   8473  O  O     . PHE C  3  240 ? 20.630  130.660 62.570  1.00 27.16  ? 240  PHE C O     1 
ATOM   8474  C  CB    . PHE C  3  240 ? 21.754  127.644 63.767  1.00 24.27  ? 240  PHE C CB    1 
ATOM   8475  C  CG    . PHE C  3  240 ? 22.223  128.522 64.887  1.00 24.53  ? 240  PHE C CG    1 
ATOM   8476  C  CD1   . PHE C  3  240 ? 23.571  128.584 65.221  1.00 24.43  ? 240  PHE C CD1   1 
ATOM   8477  C  CD2   . PHE C  3  240 ? 21.323  129.281 65.613  1.00 25.51  ? 240  PHE C CD2   1 
ATOM   8478  C  CE1   . PHE C  3  240 ? 24.015  129.391 66.259  1.00 25.14  ? 240  PHE C CE1   1 
ATOM   8479  C  CE2   . PHE C  3  240 ? 21.759  130.102 66.665  1.00 27.16  ? 240  PHE C CE2   1 
ATOM   8480  C  CZ    . PHE C  3  240 ? 23.107  130.156 66.986  1.00 26.42  ? 240  PHE C CZ    1 
ATOM   8481  N  N     . LEU C  3  241 ? 22.337  129.583 61.600  1.00 25.15  ? 241  LEU C N     1 
ATOM   8482  C  CA    . LEU C  3  241 ? 22.874  130.813 61.022  1.00 25.38  ? 241  LEU C CA    1 
ATOM   8483  C  C     . LEU C  3  241 ? 21.854  131.470 60.100  1.00 26.89  ? 241  LEU C C     1 
ATOM   8484  O  O     . LEU C  3  241 ? 21.534  132.653 60.257  1.00 27.65  ? 241  LEU C O     1 
ATOM   8485  C  CB    . LEU C  3  241 ? 24.147  130.531 60.234  1.00 22.96  ? 241  LEU C CB    1 
ATOM   8486  C  CG    . LEU C  3  241 ? 25.235  129.913 61.087  1.00 21.74  ? 241  LEU C CG    1 
ATOM   8487  C  CD1   . LEU C  3  241 ? 26.558  130.290 60.507  1.00 20.43  ? 241  LEU C CD1   1 
ATOM   8488  C  CD2   . LEU C  3  241 ? 25.133  130.423 62.501  1.00 22.65  ? 241  LEU C CD2   1 
ATOM   8489  N  N     . THR C  3  242 ? 21.358  130.695 59.137  1.00 27.54  ? 242  THR C N     1 
ATOM   8490  C  CA    . THR C  3  242 ? 20.346  131.161 58.185  1.00 27.56  ? 242  THR C CA    1 
ATOM   8491  C  C     . THR C  3  242 ? 19.340  132.006 58.927  1.00 27.06  ? 242  THR C C     1 
ATOM   8492  O  O     . THR C  3  242 ? 19.122  133.180 58.612  1.00 25.99  ? 242  THR C O     1 
ATOM   8493  C  CB    . THR C  3  242 ? 19.584  129.987 57.567  1.00 27.61  ? 242  THR C CB    1 
ATOM   8494  O  OG1   . THR C  3  242 ? 20.484  129.202 56.778  1.00 28.59  ? 242  THR C OG1   1 
ATOM   8495  C  CG2   . THR C  3  242 ? 18.441  130.498 56.711  1.00 26.85  ? 242  THR C CG2   1 
ATOM   8496  N  N     . LEU C  3  243 ? 18.737  131.369 59.920  1.00 25.27  ? 243  LEU C N     1 
ATOM   8497  C  CA    . LEU C  3  243 ? 17.759  131.990 60.772  1.00 25.25  ? 243  LEU C CA    1 
ATOM   8498  C  C     . LEU C  3  243 ? 18.295  133.272 61.389  1.00 25.80  ? 243  LEU C C     1 
ATOM   8499  O  O     . LEU C  3  243 ? 17.646  134.313 61.351  1.00 25.65  ? 243  LEU C O     1 
ATOM   8500  C  CB    . LEU C  3  243 ? 17.394  131.033 61.884  1.00 24.42  ? 243  LEU C CB    1 
ATOM   8501  C  CG    . LEU C  3  243 ? 16.144  131.477 62.593  1.00 24.17  ? 243  LEU C CG    1 
ATOM   8502  C  CD1   . LEU C  3  243 ? 15.069  131.623 61.532  1.00 23.36  ? 243  LEU C CD1   1 
ATOM   8503  C  CD2   . LEU C  3  243 ? 15.736  130.466 63.630  1.00 23.44  ? 243  LEU C CD2   1 
ATOM   8504  N  N     . ALA C  3  244 ? 19.491  133.189 61.950  1.00 26.55  ? 244  ALA C N     1 
ATOM   8505  C  CA    . ALA C  3  244 ? 20.112  134.330 62.601  1.00 29.22  ? 244  ALA C CA    1 
ATOM   8506  C  C     . ALA C  3  244 ? 20.814  135.323 61.695  1.00 30.60  ? 244  ALA C C     1 
ATOM   8507  O  O     . ALA C  3  244 ? 21.340  136.324 62.156  1.00 31.31  ? 244  ALA C O     1 
ATOM   8508  C  CB    . ALA C  3  244 ? 21.078  133.855 63.645  1.00 30.30  ? 244  ALA C CB    1 
ATOM   8509  N  N     . LEU C  3  245 ? 20.844  135.066 60.409  1.00 32.68  ? 245  LEU C N     1 
ATOM   8510  C  CA    . LEU C  3  245 ? 21.505  136.012 59.543  1.00 36.02  ? 245  LEU C CA    1 
ATOM   8511  C  C     . LEU C  3  245 ? 20.493  136.729 58.673  1.00 38.37  ? 245  LEU C C     1 
ATOM   8512  O  O     . LEU C  3  245 ? 20.667  137.898 58.327  1.00 39.05  ? 245  LEU C O     1 
ATOM   8513  C  CB    . LEU C  3  245 ? 22.522  135.293 58.664  1.00 36.18  ? 245  LEU C CB    1 
ATOM   8514  C  CG    . LEU C  3  245 ? 23.891  135.056 59.291  1.00 36.42  ? 245  LEU C CG    1 
ATOM   8515  C  CD1   . LEU C  3  245 ? 24.765  134.311 58.305  1.00 37.17  ? 245  LEU C CD1   1 
ATOM   8516  C  CD2   . LEU C  3  245 ? 24.522  136.385 59.657  1.00 35.64  ? 245  LEU C CD2   1 
ATOM   8517  N  N     . PHE C  3  246 ? 19.421  136.023 58.328  1.00 39.90  ? 246  PHE C N     1 
ATOM   8518  C  CA    . PHE C  3  246 ? 18.393  136.589 57.468  1.00 39.95  ? 246  PHE C CA    1 
ATOM   8519  C  C     . PHE C  3  246 ? 17.108  136.988 58.181  1.00 40.44  ? 246  PHE C C     1 
ATOM   8520  O  O     . PHE C  3  246 ? 16.407  137.881 57.718  1.00 40.84  ? 246  PHE C O     1 
ATOM   8521  C  CB    . PHE C  3  246 ? 18.058  135.602 56.361  1.00 39.66  ? 246  PHE C CB    1 
ATOM   8522  C  CG    . PHE C  3  246 ? 19.212  135.278 55.456  1.00 38.37  ? 246  PHE C CG    1 
ATOM   8523  C  CD1   . PHE C  3  246 ? 19.828  134.041 55.510  1.00 37.87  ? 246  PHE C CD1   1 
ATOM   8524  C  CD2   . PHE C  3  246 ? 19.643  136.195 54.504  1.00 36.90  ? 246  PHE C CD2   1 
ATOM   8525  C  CE1   . PHE C  3  246 ? 20.854  133.730 54.613  1.00 38.42  ? 246  PHE C CE1   1 
ATOM   8526  C  CE2   . PHE C  3  246 ? 20.663  135.886 53.612  1.00 35.26  ? 246  PHE C CE2   1 
ATOM   8527  C  CZ    . PHE C  3  246 ? 21.266  134.659 53.663  1.00 35.15  ? 246  PHE C CZ    1 
ATOM   8528  N  N     . SER C  3  247 ? 16.787  136.321 59.285  1.00 40.63  ? 247  SER C N     1 
ATOM   8529  C  CA    . SER C  3  247 ? 15.580  136.647 60.028  1.00 42.37  ? 247  SER C CA    1 
ATOM   8530  C  C     . SER C  3  247 ? 15.789  136.440 61.508  1.00 41.68  ? 247  SER C C     1 
ATOM   8531  O  O     . SER C  3  247 ? 15.121  135.641 62.148  1.00 42.23  ? 247  SER C O     1 
ATOM   8532  C  CB    . SER C  3  247 ? 14.405  135.792 59.566  1.00 44.73  ? 247  SER C CB    1 
ATOM   8533  O  OG    . SER C  3  247 ? 13.285  136.021 60.415  1.00 48.49  ? 247  SER C OG    1 
ATOM   8534  N  N     . PRO C  3  248 ? 16.710  137.188 62.077  1.00 41.71  ? 248  PRO C N     1 
ATOM   8535  C  CA    . PRO C  3  248 ? 17.050  137.116 63.494  1.00 43.85  ? 248  PRO C CA    1 
ATOM   8536  C  C     . PRO C  3  248 ? 15.844  137.037 64.379  1.00 45.79  ? 248  PRO C C     1 
ATOM   8537  O  O     . PRO C  3  248 ? 15.662  136.092 65.141  1.00 46.60  ? 248  PRO C O     1 
ATOM   8538  C  CB    . PRO C  3  248 ? 17.804  138.411 63.740  1.00 43.51  ? 248  PRO C CB    1 
ATOM   8539  C  CG    . PRO C  3  248 ? 18.407  138.693 62.418  1.00 45.03  ? 248  PRO C CG    1 
ATOM   8540  C  CD    . PRO C  3  248 ? 17.306  138.368 61.452  1.00 42.05  ? 248  PRO C CD    1 
ATOM   8541  N  N     . ASN C  3  249 ? 15.003  138.045 64.253  1.00 48.10  ? 249  ASN C N     1 
ATOM   8542  C  CA    . ASN C  3  249 ? 13.831  138.145 65.093  1.00 50.08  ? 249  ASN C CA    1 
ATOM   8543  C  C     . ASN C  3  249 ? 12.625  137.334 64.701  1.00 48.96  ? 249  ASN C C     1 
ATOM   8544  O  O     . ASN C  3  249 ? 11.532  137.596 65.199  1.00 49.23  ? 249  ASN C O     1 
ATOM   8545  C  CB    . ASN C  3  249 ? 13.464  139.611 65.221  1.00 54.06  ? 249  ASN C CB    1 
ATOM   8546  C  CG    . ASN C  3  249 ? 14.629  140.438 65.733  1.00 58.70  ? 249  ASN C CG    1 
ATOM   8547  O  OD1   . ASN C  3  249 ? 14.948  140.410 66.937  1.00 61.36  ? 249  ASN C OD1   1 
ATOM   8548  N  ND2   . ASN C  3  249 ? 15.299  141.160 64.818  1.00 60.07  ? 249  ASN C ND2   1 
ATOM   8549  N  N     . LEU C  3  250 ? 12.811  136.350 63.827  1.00 46.84  ? 250  LEU C N     1 
ATOM   8550  C  CA    . LEU C  3  250 ? 11.685  135.531 63.438  1.00 45.24  ? 250  LEU C CA    1 
ATOM   8551  C  C     . LEU C  3  250 ? 11.132  134.825 64.670  1.00 45.61  ? 250  LEU C C     1 
ATOM   8552  O  O     . LEU C  3  250 ? 9.995   135.058 65.058  1.00 46.56  ? 250  LEU C O     1 
ATOM   8553  C  CB    . LEU C  3  250 ? 12.084  134.503 62.391  1.00 43.48  ? 250  LEU C CB    1 
ATOM   8554  C  CG    . LEU C  3  250 ? 10.907  133.639 61.928  1.00 42.68  ? 250  LEU C CG    1 
ATOM   8555  C  CD1   . LEU C  3  250 ? 9.808   134.536 61.456  1.00 43.85  ? 250  LEU C CD1   1 
ATOM   8556  C  CD2   . LEU C  3  250 ? 11.312  132.712 60.810  1.00 42.58  ? 250  LEU C CD2   1 
ATOM   8557  N  N     . LEU C  3  251 ? 11.936  133.982 65.303  1.00 45.60  ? 251  LEU C N     1 
ATOM   8558  C  CA    . LEU C  3  251 ? 11.480  133.258 66.487  1.00 46.88  ? 251  LEU C CA    1 
ATOM   8559  C  C     . LEU C  3  251 ? 11.253  134.152 67.726  1.00 48.69  ? 251  LEU C C     1 
ATOM   8560  O  O     . LEU C  3  251 ? 10.764  133.674 68.759  1.00 49.01  ? 251  LEU C O     1 
ATOM   8561  C  CB    . LEU C  3  251 ? 12.496  132.170 66.861  1.00 45.37  ? 251  LEU C CB    1 
ATOM   8562  C  CG    . LEU C  3  251 ? 12.919  131.102 65.862  1.00 43.22  ? 251  LEU C CG    1 
ATOM   8563  C  CD1   . LEU C  3  251 ? 13.995  130.264 66.475  1.00 43.11  ? 251  LEU C CD1   1 
ATOM   8564  C  CD2   . LEU C  3  251 ? 11.763  130.235 65.508  1.00 43.75  ? 251  LEU C CD2   1 
ATOM   8565  N  N     . GLY C  3  252 ? 11.587  135.439 67.626  1.00 49.65  ? 252  GLY C N     1 
ATOM   8566  C  CA    . GLY C  3  252 ? 11.461  136.317 68.783  1.00 50.20  ? 252  GLY C CA    1 
ATOM   8567  C  C     . GLY C  3  252 ? 10.415  137.418 68.854  1.00 50.54  ? 252  GLY C C     1 
ATOM   8568  O  O     . GLY C  3  252 ? 10.361  138.312 67.991  1.00 51.98  ? 252  GLY C O     1 
ATOM   8569  N  N     . ASP C  3  253 ? 9.610   137.353 69.921  1.00 49.28  ? 253  ASP C N     1 
ATOM   8570  C  CA    . ASP C  3  253 ? 8.537   138.306 70.215  1.00 47.35  ? 253  ASP C CA    1 
ATOM   8571  C  C     . ASP C  3  253 ? 9.119   139.698 70.168  1.00 45.84  ? 253  ASP C C     1 
ATOM   8572  O  O     . ASP C  3  253 ? 10.152  139.964 70.762  1.00 46.62  ? 253  ASP C O     1 
ATOM   8573  C  CB    . ASP C  3  253 ? 7.963   138.046 71.602  1.00 47.75  ? 253  ASP C CB    1 
ATOM   8574  C  CG    . ASP C  3  253 ? 6.771   138.899 71.889  1.00 48.11  ? 253  ASP C CG    1 
ATOM   8575  O  OD1   . ASP C  3  253 ? 6.852   140.114 71.590  1.00 48.14  ? 253  ASP C OD1   1 
ATOM   8576  O  OD2   . ASP C  3  253 ? 5.771   138.351 72.407  1.00 47.65  ? 253  ASP C OD2   1 
ATOM   8577  N  N     . PRO C  3  254 ? 8.446   140.615 69.485  1.00 44.39  ? 254  PRO C N     1 
ATOM   8578  C  CA    . PRO C  3  254 ? 8.939   141.977 69.366  1.00 45.00  ? 254  PRO C CA    1 
ATOM   8579  C  C     . PRO C  3  254 ? 8.470   142.905 70.462  1.00 44.71  ? 254  PRO C C     1 
ATOM   8580  O  O     . PRO C  3  254 ? 8.960   144.028 70.603  1.00 44.08  ? 254  PRO C O     1 
ATOM   8581  C  CB    . PRO C  3  254 ? 8.432   142.372 67.998  1.00 44.73  ? 254  PRO C CB    1 
ATOM   8582  C  CG    . PRO C  3  254 ? 7.082   141.795 68.029  1.00 44.52  ? 254  PRO C CG    1 
ATOM   8583  C  CD    . PRO C  3  254 ? 7.224   140.443 68.695  1.00 43.83  ? 254  PRO C CD    1 
ATOM   8584  N  N     . GLU C  3  255 ? 7.518   142.435 71.243  1.00 45.14  ? 255  GLU C N     1 
ATOM   8585  C  CA    . GLU C  3  255 ? 7.016   143.248 72.322  1.00 48.08  ? 255  GLU C CA    1 
ATOM   8586  C  C     . GLU C  3  255 ? 8.147   143.487 73.313  1.00 47.59  ? 255  GLU C C     1 
ATOM   8587  O  O     . GLU C  3  255 ? 8.043   144.318 74.217  1.00 48.13  ? 255  GLU C O     1 
ATOM   8588  C  CB    . GLU C  3  255 ? 5.870   142.533 73.019  1.00 51.84  ? 255  GLU C CB    1 
ATOM   8589  C  CG    . GLU C  3  255 ? 5.147   143.380 74.051  1.00 59.06  ? 255  GLU C CG    1 
ATOM   8590  C  CD    . GLU C  3  255 ? 4.407   144.572 73.434  1.00 63.33  ? 255  GLU C CD    1 
ATOM   8591  O  OE1   . GLU C  3  255 ? 3.591   144.346 72.495  1.00 64.70  ? 255  GLU C OE1   1 
ATOM   8592  O  OE2   . GLU C  3  255 ? 4.636   145.725 73.902  1.00 65.52  ? 255  GLU C OE2   1 
ATOM   8593  N  N     . ASN C  3  256 ? 9.235   142.755 73.133  1.00 46.92  ? 256  ASN C N     1 
ATOM   8594  C  CA    . ASN C  3  256 ? 10.379  142.871 74.025  1.00 46.69  ? 256  ASN C CA    1 
ATOM   8595  C  C     . ASN C  3  256 ? 11.323  143.946 73.530  1.00 46.96  ? 256  ASN C C     1 
ATOM   8596  O  O     . ASN C  3  256 ? 12.451  144.039 73.988  1.00 48.87  ? 256  ASN C O     1 
ATOM   8597  C  CB    . ASN C  3  256 ? 11.111  141.528 74.116  1.00 45.98  ? 256  ASN C CB    1 
ATOM   8598  C  CG    . ASN C  3  256 ? 11.967  141.394 75.366  1.00 44.44  ? 256  ASN C CG    1 
ATOM   8599  O  OD1   . ASN C  3  256 ? 11.524  141.663 76.498  1.00 42.26  ? 256  ASN C OD1   1 
ATOM   8600  N  ND2   . ASN C  3  256 ? 13.200  140.942 75.167  1.00 42.76  ? 256  ASN C ND2   1 
ATOM   8601  N  N     . PHE C  3  257 ? 10.873  144.743 72.573  1.00 45.87  ? 257  PHE C N     1 
ATOM   8602  C  CA    . PHE C  3  257 ? 11.694  145.824 72.081  1.00 44.97  ? 257  PHE C CA    1 
ATOM   8603  C  C     . PHE C  3  257 ? 11.180  147.096 72.723  1.00 45.15  ? 257  PHE C C     1 
ATOM   8604  O  O     . PHE C  3  257 ? 11.490  148.211 72.310  1.00 46.32  ? 257  PHE C O     1 
ATOM   8605  C  CB    . PHE C  3  257 ? 11.596  145.915 70.579  1.00 44.01  ? 257  PHE C CB    1 
ATOM   8606  C  CG    . PHE C  3  257 ? 12.622  145.117 69.875  1.00 44.85  ? 257  PHE C CG    1 
ATOM   8607  C  CD1   . PHE C  3  257 ? 12.633  143.739 69.982  1.00 45.54  ? 257  PHE C CD1   1 
ATOM   8608  C  CD2   . PHE C  3  257 ? 13.583  145.742 69.086  1.00 45.52  ? 257  PHE C CD2   1 
ATOM   8609  C  CE1   . PHE C  3  257 ? 13.596  142.982 69.303  1.00 47.31  ? 257  PHE C CE1   1 
ATOM   8610  C  CE2   . PHE C  3  257 ? 14.552  144.999 68.400  1.00 46.25  ? 257  PHE C CE2   1 
ATOM   8611  C  CZ    . PHE C  3  257 ? 14.559  143.619 68.507  1.00 46.55  ? 257  PHE C CZ    1 
ATOM   8612  N  N     . THR C  3  258 ? 10.375  146.921 73.750  1.00 44.79  ? 258  THR C N     1 
ATOM   8613  C  CA    . THR C  3  258 ? 9.831   148.055 74.435  1.00 46.43  ? 258  THR C CA    1 
ATOM   8614  C  C     . THR C  3  258 ? 10.233  147.925 75.891  1.00 47.49  ? 258  THR C C     1 
ATOM   8615  O  O     . THR C  3  258 ? 9.706   147.090 76.624  1.00 47.94  ? 258  THR C O     1 
ATOM   8616  C  CB    . THR C  3  258 ? 8.290   148.109 74.254  1.00 47.22  ? 258  THR C CB    1 
ATOM   8617  O  OG1   . THR C  3  258 ? 7.967   148.982 73.157  1.00 47.95  ? 258  THR C OG1   1 
ATOM   8618  C  CG2   . THR C  3  258 ? 7.608   148.619 75.504  1.00 49.21  ? 258  THR C CG2   1 
ATOM   8619  N  N     . PRO C  3  259 ? 11.206  148.743 76.321  1.00 48.45  ? 259  PRO C N     1 
ATOM   8620  C  CA    . PRO C  3  259 ? 11.697  148.731 77.697  1.00 49.10  ? 259  PRO C CA    1 
ATOM   8621  C  C     . PRO C  3  259 ? 10.600  148.400 78.703  1.00 49.53  ? 259  PRO C C     1 
ATOM   8622  O  O     . PRO C  3  259 ? 9.459   148.855 78.593  1.00 48.13  ? 259  PRO C O     1 
ATOM   8623  C  CB    . PRO C  3  259 ? 12.253  150.137 77.867  1.00 48.97  ? 259  PRO C CB    1 
ATOM   8624  C  CG    . PRO C  3  259 ? 12.874  150.376 76.531  1.00 49.23  ? 259  PRO C CG    1 
ATOM   8625  C  CD    . PRO C  3  259 ? 11.831  149.839 75.557  1.00 49.16  ? 259  PRO C CD    1 
ATOM   8626  N  N     . ALA C  3  260 ? 10.961  147.580 79.676  1.00 50.12  ? 260  ALA C N     1 
ATOM   8627  C  CA    . ALA C  3  260 ? 10.032  147.174 80.699  1.00 49.92  ? 260  ALA C CA    1 
ATOM   8628  C  C     . ALA C  3  260 ? 9.300   148.399 81.256  1.00 50.57  ? 260  ALA C C     1 
ATOM   8629  O  O     . ALA C  3  260 ? 9.847   149.510 81.291  1.00 50.27  ? 260  ALA C O     1 
ATOM   8630  C  CB    . ALA C  3  260 ? 10.788  146.430 81.809  1.00 47.64  ? 260  ALA C CB    1 
ATOM   8631  N  N     . ASN C  3  261 ? 8.053   148.174 81.665  1.00 50.99  ? 261  ASN C N     1 
ATOM   8632  C  CA    . ASN C  3  261 ? 7.185   149.190 82.246  1.00 51.04  ? 261  ASN C CA    1 
ATOM   8633  C  C     . ASN C  3  261 ? 6.513   148.461 83.401  1.00 49.82  ? 261  ASN C C     1 
ATOM   8634  O  O     . ASN C  3  261 ? 5.575   147.709 83.199  1.00 47.99  ? 261  ASN C O     1 
ATOM   8635  C  CB    . ASN C  3  261 ? 6.134   149.632 81.221  1.00 53.34  ? 261  ASN C CB    1 
ATOM   8636  C  CG    . ASN C  3  261 ? 5.291   150.810 81.697  1.00 54.48  ? 261  ASN C CG    1 
ATOM   8637  O  OD1   . ASN C  3  261 ? 4.705   150.785 82.783  1.00 55.18  ? 261  ASN C OD1   1 
ATOM   8638  N  ND2   . ASN C  3  261 ? 5.214   151.841 80.868  1.00 54.69  ? 261  ASN C ND2   1 
ATOM   8639  N  N     . PRO C  3  262 ? 6.998   148.673 84.627  1.00 50.35  ? 262  PRO C N     1 
ATOM   8640  C  CA    . PRO C  3  262 ? 6.471   148.046 85.840  1.00 51.80  ? 262  PRO C CA    1 
ATOM   8641  C  C     . PRO C  3  262 ? 4.985   148.267 86.010  1.00 52.23  ? 262  PRO C C     1 
ATOM   8642  O  O     . PRO C  3  262 ? 4.358   147.644 86.875  1.00 52.29  ? 262  PRO C O     1 
ATOM   8643  C  CB    . PRO C  3  262 ? 7.247   148.738 86.964  1.00 52.32  ? 262  PRO C CB    1 
ATOM   8644  C  CG    . PRO C  3  262 ? 8.502   149.168 86.313  1.00 52.58  ? 262  PRO C CG    1 
ATOM   8645  C  CD    . PRO C  3  262 ? 8.020   149.668 84.973  1.00 52.02  ? 262  PRO C CD    1 
ATOM   8646  N  N     . LEU C  3  263 ? 4.435   149.146 85.176  1.00 52.01  ? 263  LEU C N     1 
ATOM   8647  C  CA    . LEU C  3  263 ? 3.032   149.518 85.261  1.00 52.96  ? 263  LEU C CA    1 
ATOM   8648  C  C     . LEU C  3  263 ? 2.100   149.021 84.189  1.00 53.31  ? 263  LEU C C     1 
ATOM   8649  O  O     . LEU C  3  263 ? 0.887   149.131 84.329  1.00 53.38  ? 263  LEU C O     1 
ATOM   8650  C  CB    . LEU C  3  263 ? 2.922   151.029 85.282  1.00 53.65  ? 263  LEU C CB    1 
ATOM   8651  C  CG    . LEU C  3  263 ? 3.748   151.705 86.358  1.00 54.93  ? 263  LEU C CG    1 
ATOM   8652  C  CD1   . LEU C  3  263 ? 3.859   153.190 86.042  1.00 56.08  ? 263  LEU C CD1   1 
ATOM   8653  C  CD2   . LEU C  3  263 ? 3.104   151.452 87.720  1.00 55.91  ? 263  LEU C CD2   1 
ATOM   8654  N  N     . VAL C  3  264 ? 2.639   148.491 83.109  1.00 53.97  ? 264  VAL C N     1 
ATOM   8655  C  CA    . VAL C  3  264 ? 1.764   148.048 82.044  1.00 55.26  ? 264  VAL C CA    1 
ATOM   8656  C  C     . VAL C  3  264 ? 2.094   146.667 81.511  1.00 56.60  ? 264  VAL C C     1 
ATOM   8657  O  O     . VAL C  3  264 ? 3.104   146.488 80.837  1.00 58.51  ? 264  VAL C O     1 
ATOM   8658  C  CB    . VAL C  3  264 ? 1.823   149.036 80.878  1.00 55.28  ? 264  VAL C CB    1 
ATOM   8659  C  CG1   . VAL C  3  264 ? 0.731   148.706 79.862  1.00 55.38  ? 264  VAL C CG1   1 
ATOM   8660  C  CG2   . VAL C  3  264 ? 1.708   150.462 81.401  1.00 54.61  ? 264  VAL C CG2   1 
ATOM   8661  N  N     . THR C  3  265 ? 1.258   145.682 81.803  1.00 56.41  ? 265  THR C N     1 
ATOM   8662  C  CA    . THR C  3  265 ? 1.526   144.357 81.284  1.00 57.02  ? 265  THR C CA    1 
ATOM   8663  C  C     . THR C  3  265 ? 0.912   144.353 79.899  1.00 58.48  ? 265  THR C C     1 
ATOM   8664  O  O     . THR C  3  265 ? -0.293  144.533 79.761  1.00 59.42  ? 265  THR C O     1 
ATOM   8665  C  CB    . THR C  3  265 ? 0.847   143.276 82.115  1.00 57.16  ? 265  THR C CB    1 
ATOM   8666  O  OG1   . THR C  3  265 ? 1.084   143.527 83.503  1.00 58.54  ? 265  THR C OG1   1 
ATOM   8667  C  CG2   . THR C  3  265 ? 1.400   141.898 81.752  1.00 55.43  ? 265  THR C CG2   1 
ATOM   8668  N  N     . PRO C  3  266 ? 1.733   144.177 78.849  1.00 59.62  ? 266  PRO C N     1 
ATOM   8669  C  CA    . PRO C  3  266 ? 1.232   144.155 77.476  1.00 59.90  ? 266  PRO C CA    1 
ATOM   8670  C  C     . PRO C  3  266 ? -0.035  143.338 77.333  1.00 60.75  ? 266  PRO C C     1 
ATOM   8671  O  O     . PRO C  3  266 ? -0.163  142.248 77.854  1.00 60.92  ? 266  PRO C O     1 
ATOM   8672  C  CB    . PRO C  3  266 ? 2.399   143.568 76.706  1.00 59.59  ? 266  PRO C CB    1 
ATOM   8673  C  CG    . PRO C  3  266 ? 3.545   144.232 77.372  1.00 59.89  ? 266  PRO C CG    1 
ATOM   8674  C  CD    . PRO C  3  266 ? 3.200   144.051 78.851  1.00 60.44  ? 266  PRO C CD    1 
ATOM   8675  N  N     . PRO C  3  267 ? -0.996  143.870 76.613  1.00 62.10  ? 267  PRO C N     1 
ATOM   8676  C  CA    . PRO C  3  267 ? -2.261  143.190 76.404  1.00 64.21  ? 267  PRO C CA    1 
ATOM   8677  C  C     . PRO C  3  267 ? -2.077  141.808 75.807  1.00 66.24  ? 267  PRO C C     1 
ATOM   8678  O  O     . PRO C  3  267 ? -2.805  140.878 76.157  1.00 66.59  ? 267  PRO C O     1 
ATOM   8679  C  CB    . PRO C  3  267 ? -2.978  144.130 75.459  1.00 65.61  ? 267  PRO C CB    1 
ATOM   8680  C  CG    . PRO C  3  267 ? -1.851  144.659 74.634  1.00 65.46  ? 267  PRO C CG    1 
ATOM   8681  C  CD    . PRO C  3  267 ? -0.845  144.998 75.687  1.00 63.59  ? 267  PRO C CD    1 
ATOM   8682  N  N     . HIS C  3  268 ? -1.112  141.685 74.897  1.00 68.56  ? 268  HIS C N     1 
ATOM   8683  C  CA    . HIS C  3  268 ? -0.823  140.413 74.227  1.00 70.54  ? 268  HIS C CA    1 
ATOM   8684  C  C     . HIS C  3  268 ? 0.520   139.846 74.660  1.00 68.99  ? 268  HIS C C     1 
ATOM   8685  O  O     . HIS C  3  268 ? 1.524   139.976 73.950  1.00 68.20  ? 268  HIS C O     1 
ATOM   8686  C  CB    . HIS C  3  268 ? -0.837  140.596 72.706  1.00 74.93  ? 268  HIS C CB    1 
ATOM   8687  C  CG    . HIS C  3  268 ? -2.213  140.736 72.126  1.00 78.51  ? 268  HIS C CG    1 
ATOM   8688  N  ND1   . HIS C  3  268 ? -2.438  141.160 70.832  1.00 80.01  ? 268  HIS C ND1   1 
ATOM   8689  C  CD2   . HIS C  3  268 ? -3.435  140.498 72.661  1.00 79.52  ? 268  HIS C CD2   1 
ATOM   8690  C  CE1   . HIS C  3  268 ? -3.738  141.180 70.597  1.00 80.52  ? 268  HIS C CE1   1 
ATOM   8691  N  NE2   . HIS C  3  268 ? -4.365  140.783 71.690  1.00 80.81  ? 268  HIS C NE2   1 
ATOM   8692  N  N     . ILE C  3  269 ? 0.506   139.206 75.828  1.00 67.53  ? 269  ILE C N     1 
ATOM   8693  C  CA    . ILE C  3  269 ? 1.688   138.609 76.442  1.00 66.69  ? 269  ILE C CA    1 
ATOM   8694  C  C     . ILE C  3  269 ? 1.693   137.095 76.292  1.00 66.53  ? 269  ILE C C     1 
ATOM   8695  O  O     . ILE C  3  269 ? 0.851   136.407 76.867  1.00 66.83  ? 269  ILE C O     1 
ATOM   8696  C  CB    . ILE C  3  269 ? 1.737   138.930 77.946  1.00 65.84  ? 269  ILE C CB    1 
ATOM   8697  C  CG1   . ILE C  3  269 ? 3.010   138.369 78.573  1.00 64.61  ? 269  ILE C CG1   1 
ATOM   8698  C  CG2   . ILE C  3  269 ? 0.529   138.325 78.641  1.00 65.09  ? 269  ILE C CG2   1 
ATOM   8699  C  CD1   . ILE C  3  269 ? 3.053   138.560 80.070  1.00 64.74  ? 269  ILE C CD1   1 
ATOM   8700  N  N     . LYS C  3  270 ? 2.644   136.578 75.521  1.00 65.88  ? 270  LYS C N     1 
ATOM   8701  C  CA    . LYS C  3  270 ? 2.758   135.141 75.312  1.00 64.94  ? 270  LYS C CA    1 
ATOM   8702  C  C     . LYS C  3  270 ? 4.225   134.752 75.454  1.00 63.20  ? 270  LYS C C     1 
ATOM   8703  O  O     . LYS C  3  270 ? 5.089   135.359 74.844  1.00 65.37  ? 270  LYS C O     1 
ATOM   8704  C  CB    . LYS C  3  270 ? 2.215   134.766 73.929  1.00 66.14  ? 270  LYS C CB    1 
ATOM   8705  C  CG    . LYS C  3  270 ? 0.714   135.119 73.719  1.00 69.74  ? 270  LYS C CG    1 
ATOM   8706  C  CD    . LYS C  3  270 ? -0.250  134.469 74.772  1.00 70.65  ? 270  LYS C CD    1 
ATOM   8707  C  CE    . LYS C  3  270 ? -1.761  134.764 74.519  1.00 69.80  ? 270  LYS C CE    1 
ATOM   8708  N  NZ    . LYS C  3  270 ? -2.212  136.192 74.695  1.00 68.09  ? 270  LYS C NZ    1 
ATOM   8709  N  N     . PRO C  3  271 ? 4.516   133.733 76.270  1.00 60.79  ? 271  PRO C N     1 
ATOM   8710  C  CA    . PRO C  3  271 ? 5.831   133.166 76.591  1.00 59.55  ? 271  PRO C CA    1 
ATOM   8711  C  C     . PRO C  3  271 ? 6.746   132.861 75.407  1.00 58.91  ? 271  PRO C C     1 
ATOM   8712  O  O     . PRO C  3  271 ? 6.287   132.765 74.271  1.00 60.33  ? 271  PRO C O     1 
ATOM   8713  C  CB    . PRO C  3  271 ? 5.471   131.886 77.335  1.00 59.89  ? 271  PRO C CB    1 
ATOM   8714  C  CG    . PRO C  3  271 ? 4.162   132.203 77.954  1.00 60.02  ? 271  PRO C CG    1 
ATOM   8715  C  CD    . PRO C  3  271 ? 3.450   132.898 76.839  1.00 60.13  ? 271  PRO C CD    1 
ATOM   8716  N  N     . GLU C  3  272 ? 8.040   132.700 75.677  1.00 57.11  ? 272  GLU C N     1 
ATOM   8717  C  CA    . GLU C  3  272 ? 8.994   132.348 74.628  1.00 55.26  ? 272  GLU C CA    1 
ATOM   8718  C  C     . GLU C  3  272 ? 8.376   131.081 74.048  1.00 52.25  ? 272  GLU C C     1 
ATOM   8719  O  O     . GLU C  3  272 ? 7.784   130.310 74.798  1.00 51.53  ? 272  GLU C O     1 
ATOM   8720  C  CB    . GLU C  3  272 ? 10.358  131.985 75.228  1.00 57.61  ? 272  GLU C CB    1 
ATOM   8721  C  CG    . GLU C  3  272 ? 11.075  133.063 76.058  1.00 63.11  ? 272  GLU C CG    1 
ATOM   8722  C  CD    . GLU C  3  272 ? 10.637  133.128 77.533  1.00 65.21  ? 272  GLU C CD    1 
ATOM   8723  O  OE1   . GLU C  3  272 ? 9.450   133.421 77.775  1.00 67.47  ? 272  GLU C OE1   1 
ATOM   8724  O  OE2   . GLU C  3  272 ? 11.473  132.901 78.446  1.00 64.86  ? 272  GLU C OE2   1 
ATOM   8725  N  N     . TRP C  3  273 ? 8.503   130.843 72.745  1.00 48.89  ? 273  TRP C N     1 
ATOM   8726  C  CA    . TRP C  3  273 ? 7.913   129.634 72.164  1.00 46.06  ? 273  TRP C CA    1 
ATOM   8727  C  C     . TRP C  3  273 ? 8.241   128.299 72.849  1.00 44.78  ? 273  TRP C C     1 
ATOM   8728  O  O     . TRP C  3  273 ? 7.358   127.458 73.046  1.00 44.26  ? 273  TRP C O     1 
ATOM   8729  C  CB    . TRP C  3  273 ? 8.267   129.517 70.687  1.00 46.00  ? 273  TRP C CB    1 
ATOM   8730  C  CG    . TRP C  3  273 ? 9.676   129.108 70.353  1.00 46.40  ? 273  TRP C CG    1 
ATOM   8731  C  CD1   . TRP C  3  273 ? 10.658  129.905 69.823  1.00 48.08  ? 273  TRP C CD1   1 
ATOM   8732  C  CD2   . TRP C  3  273 ? 10.234  127.797 70.437  1.00 45.16  ? 273  TRP C CD2   1 
ATOM   8733  N  NE1   . TRP C  3  273 ? 11.789  129.167 69.568  1.00 47.41  ? 273  TRP C NE1   1 
ATOM   8734  C  CE2   . TRP C  3  273 ? 11.554  127.871 69.937  1.00 46.68  ? 273  TRP C CE2   1 
ATOM   8735  C  CE3   . TRP C  3  273 ? 9.749   126.571 70.877  1.00 43.59  ? 273  TRP C CE3   1 
ATOM   8736  C  CZ2   . TRP C  3  273 ? 12.387  126.763 69.870  1.00 46.85  ? 273  TRP C CZ2   1 
ATOM   8737  C  CZ3   . TRP C  3  273 ? 10.570  125.476 70.810  1.00 44.83  ? 273  TRP C CZ3   1 
ATOM   8738  C  CH2   . TRP C  3  273 ? 11.879  125.574 70.309  1.00 46.68  ? 273  TRP C CH2   1 
ATOM   8739  N  N     . TYR C  3  274 ? 9.503   128.092 73.208  1.00 42.99  ? 274  TYR C N     1 
ATOM   8740  C  CA    . TYR C  3  274 ? 9.896   126.848 73.858  1.00 41.39  ? 274  TYR C CA    1 
ATOM   8741  C  C     . TYR C  3  274 ? 9.262   126.588 75.232  1.00 39.47  ? 274  TYR C C     1 
ATOM   8742  O  O     . TYR C  3  274 ? 9.537   125.583 75.861  1.00 37.55  ? 274  TYR C O     1 
ATOM   8743  C  CB    . TYR C  3  274 ? 11.439  126.748 73.917  1.00 42.22  ? 274  TYR C CB    1 
ATOM   8744  C  CG    . TYR C  3  274 ? 12.158  127.952 74.508  1.00 43.20  ? 274  TYR C CG    1 
ATOM   8745  C  CD1   . TYR C  3  274 ? 11.959  128.316 75.845  1.00 43.40  ? 274  TYR C CD1   1 
ATOM   8746  C  CD2   . TYR C  3  274 ? 13.016  128.742 73.729  1.00 41.95  ? 274  TYR C CD2   1 
ATOM   8747  C  CE1   . TYR C  3  274 ? 12.582  129.428 76.393  1.00 42.64  ? 274  TYR C CE1   1 
ATOM   8748  C  CE2   . TYR C  3  274 ? 13.646  129.863 74.272  1.00 41.83  ? 274  TYR C CE2   1 
ATOM   8749  C  CZ    . TYR C  3  274 ? 13.416  130.195 75.611  1.00 42.96  ? 274  TYR C CZ    1 
ATOM   8750  O  OH    . TYR C  3  274 ? 13.989  131.296 76.199  1.00 43.39  ? 274  TYR C OH    1 
ATOM   8751  N  N     . PHE C  3  275 ? 8.410   127.486 75.702  1.00 39.06  ? 275  PHE C N     1 
ATOM   8752  C  CA    . PHE C  3  275 ? 7.755   127.264 76.983  1.00 40.99  ? 275  PHE C CA    1 
ATOM   8753  C  C     . PHE C  3  275 ? 6.261   127.118 76.763  1.00 43.89  ? 275  PHE C C     1 
ATOM   8754  O  O     . PHE C  3  275 ? 5.546   126.584 77.618  1.00 46.36  ? 275  PHE C O     1 
ATOM   8755  C  CB    . PHE C  3  275 ? 7.936   128.427 77.948  1.00 39.30  ? 275  PHE C CB    1 
ATOM   8756  C  CG    . PHE C  3  275 ? 9.279   128.507 78.567  1.00 39.22  ? 275  PHE C CG    1 
ATOM   8757  C  CD1   . PHE C  3  275 ? 10.041  127.378 78.749  1.00 38.76  ? 275  PHE C CD1   1 
ATOM   8758  C  CD2   . PHE C  3  275 ? 9.779   129.737 79.000  1.00 39.41  ? 275  PHE C CD2   1 
ATOM   8759  C  CE1   . PHE C  3  275 ? 11.285  127.473 79.355  1.00 39.97  ? 275  PHE C CE1   1 
ATOM   8760  C  CE2   . PHE C  3  275 ? 11.021  129.844 79.607  1.00 37.94  ? 275  PHE C CE2   1 
ATOM   8761  C  CZ    . PHE C  3  275 ? 11.774  128.717 79.786  1.00 38.77  ? 275  PHE C CZ    1 
ATOM   8762  N  N     . LEU C  3  276 ? 5.782   127.604 75.625  1.00 44.47  ? 276  LEU C N     1 
ATOM   8763  C  CA    . LEU C  3  276 ? 4.354   127.552 75.316  1.00 43.80  ? 276  LEU C CA    1 
ATOM   8764  C  C     . LEU C  3  276 ? 3.578   126.327 75.805  1.00 42.40  ? 276  LEU C C     1 
ATOM   8765  O  O     . LEU C  3  276 ? 2.582   126.474 76.510  1.00 40.92  ? 276  LEU C O     1 
ATOM   8766  C  CB    . LEU C  3  276 ? 4.149   127.741 73.809  1.00 45.38  ? 276  LEU C CB    1 
ATOM   8767  C  CG    . LEU C  3  276 ? 4.541   129.151 73.356  1.00 45.45  ? 276  LEU C CG    1 
ATOM   8768  C  CD1   . LEU C  3  276 ? 4.228   129.362 71.890  1.00 43.39  ? 276  LEU C CD1   1 
ATOM   8769  C  CD2   . LEU C  3  276 ? 3.785   130.154 74.219  1.00 46.20  ? 276  LEU C CD2   1 
ATOM   8770  N  N     . PHE C  3  277 ? 4.031   125.125 75.460  1.00 41.55  ? 277  PHE C N     1 
ATOM   8771  C  CA    . PHE C  3  277 ? 3.308   123.935 75.882  1.00 40.81  ? 277  PHE C CA    1 
ATOM   8772  C  C     . PHE C  3  277 ? 3.000   123.940 77.379  1.00 41.41  ? 277  PHE C C     1 
ATOM   8773  O  O     . PHE C  3  277 ? 1.864   123.690 77.788  1.00 43.64  ? 277  PHE C O     1 
ATOM   8774  C  CB    . PHE C  3  277 ? 4.068   122.662 75.486  1.00 37.74  ? 277  PHE C CB    1 
ATOM   8775  C  CG    . PHE C  3  277 ? 5.185   122.295 76.408  1.00 35.74  ? 277  PHE C CG    1 
ATOM   8776  C  CD1   . PHE C  3  277 ? 4.931   121.830 77.673  1.00 35.92  ? 277  PHE C CD1   1 
ATOM   8777  C  CD2   . PHE C  3  277 ? 6.496   122.358 75.989  1.00 37.18  ? 277  PHE C CD2   1 
ATOM   8778  C  CE1   . PHE C  3  277 ? 5.967   121.426 78.510  1.00 37.24  ? 277  PHE C CE1   1 
ATOM   8779  C  CE2   . PHE C  3  277 ? 7.542   121.950 76.821  1.00 37.00  ? 277  PHE C CE2   1 
ATOM   8780  C  CZ    . PHE C  3  277 ? 7.273   121.485 78.080  1.00 37.12  ? 277  PHE C CZ    1 
ATOM   8781  N  N     . ALA C  3  278 ? 3.988   124.240 78.208  1.00 40.15  ? 278  ALA C N     1 
ATOM   8782  C  CA    . ALA C  3  278 ? 3.739   124.238 79.644  1.00 39.51  ? 278  ALA C CA    1 
ATOM   8783  C  C     . ALA C  3  278 ? 2.779   125.347 79.971  1.00 38.58  ? 278  ALA C C     1 
ATOM   8784  O  O     . ALA C  3  278 ? 1.854   125.176 80.761  1.00 38.42  ? 278  ALA C O     1 
ATOM   8785  C  CB    . ALA C  3  278 ? 5.023   124.443 80.397  1.00 40.66  ? 278  ALA C CB    1 
ATOM   8786  N  N     . TYR C  3  279 ? 3.027   126.492 79.351  1.00 37.65  ? 279  TYR C N     1 
ATOM   8787  C  CA    . TYR C  3  279 ? 2.211   127.673 79.539  1.00 37.13  ? 279  TYR C CA    1 
ATOM   8788  C  C     . TYR C  3  279 ? 0.777   127.260 79.422  1.00 35.55  ? 279  TYR C C     1 
ATOM   8789  O  O     . TYR C  3  279 ? -0.034  127.580 80.273  1.00 35.73  ? 279  TYR C O     1 
ATOM   8790  C  CB    . TYR C  3  279 ? 2.518   128.697 78.459  1.00 40.17  ? 279  TYR C CB    1 
ATOM   8791  C  CG    . TYR C  3  279 ? 1.620   129.896 78.491  1.00 42.97  ? 279  TYR C CG    1 
ATOM   8792  C  CD1   . TYR C  3  279 ? 1.333   130.526 79.693  1.00 44.87  ? 279  TYR C CD1   1 
ATOM   8793  C  CD2   . TYR C  3  279 ? 1.113   130.447 77.315  1.00 45.07  ? 279  TYR C CD2   1 
ATOM   8794  C  CE1   . TYR C  3  279 ? 0.569   131.690 79.741  1.00 47.49  ? 279  TYR C CE1   1 
ATOM   8795  C  CE2   . TYR C  3  279 ? 0.340   131.610 77.341  1.00 48.43  ? 279  TYR C CE2   1 
ATOM   8796  C  CZ    . TYR C  3  279 ? 0.076   132.230 78.565  1.00 49.50  ? 279  TYR C CZ    1 
ATOM   8797  O  OH    . TYR C  3  279 ? -0.662  133.397 78.620  1.00 51.56  ? 279  TYR C OH    1 
ATOM   8798  N  N     . ALA C  3  280 ? 0.489   126.528 78.353  1.00 33.21  ? 280  ALA C N     1 
ATOM   8799  C  CA    . ALA C  3  280 ? -0.847  126.051 78.069  1.00 31.35  ? 280  ALA C CA    1 
ATOM   8800  C  C     . ALA C  3  280 ? -1.410  125.214 79.206  1.00 30.69  ? 280  ALA C C     1 
ATOM   8801  O  O     . ALA C  3  280 ? -2.459  125.528 79.763  1.00 31.50  ? 280  ALA C O     1 
ATOM   8802  C  CB    . ALA C  3  280 ? -0.839  125.246 76.780  1.00 31.17  ? 280  ALA C CB    1 
ATOM   8803  N  N     . ILE C  3  281 ? -0.721  124.147 79.564  1.00 29.42  ? 281  ILE C N     1 
ATOM   8804  C  CA    . ILE C  3  281 ? -1.233  123.316 80.621  1.00 30.13  ? 281  ILE C CA    1 
ATOM   8805  C  C     . ILE C  3  281 ? -1.648  124.165 81.816  1.00 32.36  ? 281  ILE C C     1 
ATOM   8806  O  O     . ILE C  3  281 ? -2.798  124.092 82.238  1.00 32.28  ? 281  ILE C O     1 
ATOM   8807  C  CB    . ILE C  3  281 ? -0.200  122.229 80.984  1.00 30.62  ? 281  ILE C CB    1 
ATOM   8808  C  CG1   . ILE C  3  281 ? -0.032  121.326 79.747  1.00 30.54  ? 281  ILE C CG1   1 
ATOM   8809  C  CG2   . ILE C  3  281 ? -0.625  121.447 82.257  1.00 27.17  ? 281  ILE C CG2   1 
ATOM   8810  C  CD1   . ILE C  3  281 ? 0.902   120.139 79.894  1.00 31.25  ? 281  ILE C CD1   1 
ATOM   8811  N  N     . LEU C  3  282 ? -0.755  125.012 82.328  1.00 34.68  ? 282  LEU C N     1 
ATOM   8812  C  CA    . LEU C  3  282 ? -1.090  125.839 83.495  1.00 37.03  ? 282  LEU C CA    1 
ATOM   8813  C  C     . LEU C  3  282 ? -2.269  126.751 83.278  1.00 39.46  ? 282  LEU C C     1 
ATOM   8814  O  O     . LEU C  3  282 ? -2.999  127.076 84.221  1.00 39.91  ? 282  LEU C O     1 
ATOM   8815  C  CB    . LEU C  3  282 ? 0.089   126.705 83.927  1.00 37.03  ? 282  LEU C CB    1 
ATOM   8816  C  CG    . LEU C  3  282 ? -0.181  127.577 85.170  1.00 37.44  ? 282  LEU C CG    1 
ATOM   8817  C  CD1   . LEU C  3  282 ? 1.138   127.950 85.802  1.00 37.77  ? 282  LEU C CD1   1 
ATOM   8818  C  CD2   . LEU C  3  282 ? -0.951  128.828 84.820  1.00 36.98  ? 282  LEU C CD2   1 
ATOM   8819  N  N     . ARG C  3  283 ? -2.425  127.186 82.033  1.00 42.56  ? 283  ARG C N     1 
ATOM   8820  C  CA    . ARG C  3  283 ? -3.494  128.090 81.644  1.00 45.29  ? 283  ARG C CA    1 
ATOM   8821  C  C     . ARG C  3  283 ? -4.827  127.390 81.549  1.00 47.59  ? 283  ARG C C     1 
ATOM   8822  O  O     . ARG C  3  283 ? -5.866  128.042 81.535  1.00 49.63  ? 283  ARG C O     1 
ATOM   8823  C  CB    . ARG C  3  283 ? -3.177  128.731 80.308  1.00 44.41  ? 283  ARG C CB    1 
ATOM   8824  C  CG    . ARG C  3  283 ? -3.082  130.231 80.377  1.00 44.95  ? 283  ARG C CG    1 
ATOM   8825  C  CD    . ARG C  3  283 ? -2.766  130.758 79.014  1.00 43.80  ? 283  ARG C CD    1 
ATOM   8826  N  NE    . ARG C  3  283 ? -3.508  129.981 78.043  1.00 44.50  ? 283  ARG C NE    1 
ATOM   8827  C  CZ    . ARG C  3  283 ? -3.630  130.305 76.769  1.00 44.56  ? 283  ARG C CZ    1 
ATOM   8828  N  NH1   . ARG C  3  283 ? -3.047  131.412 76.309  1.00 42.84  ? 283  ARG C NH1   1 
ATOM   8829  N  NH2   . ARG C  3  283 ? -4.344  129.514 75.969  1.00 44.95  ? 283  ARG C NH2   1 
ATOM   8830  N  N     . SER C  3  284 ? -4.803  126.066 81.470  1.00 49.14  ? 284  SER C N     1 
ATOM   8831  C  CA    . SER C  3  284 ? -6.035  125.313 81.404  1.00 50.80  ? 284  SER C CA    1 
ATOM   8832  C  C     . SER C  3  284 ? -6.529  124.930 82.786  1.00 50.54  ? 284  SER C C     1 
ATOM   8833  O  O     . SER C  3  284 ? -7.685  124.598 82.946  1.00 52.03  ? 284  SER C O     1 
ATOM   8834  C  CB    . SER C  3  284 ? -5.869  124.075 80.526  1.00 52.31  ? 284  SER C CB    1 
ATOM   8835  O  OG    . SER C  3  284 ? -6.020  124.418 79.152  1.00 54.90  ? 284  SER C OG    1 
ATOM   8836  N  N     . ILE C  3  285 ? -5.669  124.960 83.790  1.00 50.76  ? 285  ILE C N     1 
ATOM   8837  C  CA    . ILE C  3  285 ? -6.145  124.652 85.131  1.00 53.32  ? 285  ILE C CA    1 
ATOM   8838  C  C     . ILE C  3  285 ? -6.486  125.974 85.801  1.00 55.78  ? 285  ILE C C     1 
ATOM   8839  O  O     . ILE C  3  285 ? -5.587  126.696 86.247  1.00 56.18  ? 285  ILE C O     1 
ATOM   8840  C  CB    . ILE C  3  285 ? -5.085  123.947 86.008  1.00 52.89  ? 285  ILE C CB    1 
ATOM   8841  C  CG1   . ILE C  3  285 ? -4.870  122.520 85.531  1.00 52.49  ? 285  ILE C CG1   1 
ATOM   8842  C  CG2   . ILE C  3  285 ? -5.552  123.905 87.464  1.00 52.10  ? 285  ILE C CG2   1 
ATOM   8843  C  CD1   . ILE C  3  285 ? -4.542  122.424 84.091  1.00 53.83  ? 285  ILE C CD1   1 
ATOM   8844  N  N     . PRO C  3  286 ? -7.784  126.325 85.864  1.00 57.76  ? 286  PRO C N     1 
ATOM   8845  C  CA    . PRO C  3  286 ? -8.178  127.584 86.500  1.00 59.53  ? 286  PRO C CA    1 
ATOM   8846  C  C     . PRO C  3  286 ? -8.189  127.487 88.035  1.00 59.99  ? 286  PRO C C     1 
ATOM   8847  O  O     . PRO C  3  286 ? -9.238  127.345 88.669  1.00 59.53  ? 286  PRO C O     1 
ATOM   8848  C  CB    . PRO C  3  286 ? -9.549  127.859 85.887  1.00 58.91  ? 286  PRO C CB    1 
ATOM   8849  C  CG    . PRO C  3  286 ? -10.094 126.499 85.735  1.00 59.14  ? 286  PRO C CG    1 
ATOM   8850  C  CD    . PRO C  3  286 ? -8.932  125.723 85.168  1.00 58.49  ? 286  PRO C CD    1 
ATOM   8851  N  N     . ASN C  3  287 ? -6.981  127.548 88.596  1.00 60.96  ? 287  ASN C N     1 
ATOM   8852  C  CA    . ASN C  3  287 ? -6.710  127.505 90.034  1.00 61.09  ? 287  ASN C CA    1 
ATOM   8853  C  C     . ASN C  3  287 ? -5.213  127.751 90.230  1.00 60.18  ? 287  ASN C C     1 
ATOM   8854  O  O     . ASN C  3  287 ? -4.386  126.981 89.729  1.00 61.50  ? 287  ASN C O     1 
ATOM   8855  C  CB    . ASN C  3  287 ? -7.046  126.147 90.625  1.00 62.57  ? 287  ASN C CB    1 
ATOM   8856  C  CG    . ASN C  3  287 ? -6.744  126.085 92.105  1.00 65.01  ? 287  ASN C CG    1 
ATOM   8857  O  OD1   . ASN C  3  287 ? -5.642  126.438 92.549  1.00 64.81  ? 287  ASN C OD1   1 
ATOM   8858  N  ND2   . ASN C  3  287 ? -7.725  125.643 92.887  1.00 68.24  ? 287  ASN C ND2   1 
ATOM   8859  N  N     . LYS C  3  288 ? -4.865  128.810 90.958  1.00 57.24  ? 288  LYS C N     1 
ATOM   8860  C  CA    . LYS C  3  288 ? -3.460  129.146 91.180  1.00 53.53  ? 288  LYS C CA    1 
ATOM   8861  C  C     . LYS C  3  288 ? -2.646  127.876 91.314  1.00 51.30  ? 288  LYS C C     1 
ATOM   8862  O  O     . LYS C  3  288 ? -1.864  127.511 90.436  1.00 49.80  ? 288  LYS C O     1 
ATOM   8863  C  CB    . LYS C  3  288 ? -3.307  129.966 92.459  1.00 53.27  ? 288  LYS C CB    1 
ATOM   8864  C  CG    . LYS C  3  288 ? -1.990  130.725 92.608  1.00 51.40  ? 288  LYS C CG    1 
ATOM   8865  C  CD    . LYS C  3  288 ? -1.914  131.427 93.977  1.00 50.69  ? 288  LYS C CD    1 
ATOM   8866  C  CE    . LYS C  3  288 ? -0.943  132.610 93.946  1.00 50.49  ? 288  LYS C CE    1 
ATOM   8867  N  NZ    . LYS C  3  288 ? -0.961  133.431 95.202  1.00 50.29  ? 288  LYS C NZ    1 
ATOM   8868  N  N     . LEU C  3  289 ? -2.881  127.189 92.420  1.00 50.08  ? 289  LEU C N     1 
ATOM   8869  C  CA    . LEU C  3  289 ? -2.162  125.972 92.741  1.00 50.06  ? 289  LEU C CA    1 
ATOM   8870  C  C     . LEU C  3  289 ? -2.230  124.870 91.688  1.00 50.20  ? 289  LEU C C     1 
ATOM   8871  O  O     . LEU C  3  289 ? -1.199  124.302 91.297  1.00 50.56  ? 289  LEU C O     1 
ATOM   8872  C  CB    . LEU C  3  289 ? -2.645  125.455 94.089  1.00 47.97  ? 289  LEU C CB    1 
ATOM   8873  C  CG    . LEU C  3  289 ? -1.766  124.373 94.697  1.00 46.68  ? 289  LEU C CG    1 
ATOM   8874  C  CD1   . LEU C  3  289 ? -0.301  124.632 94.406  1.00 47.13  ? 289  LEU C CD1   1 
ATOM   8875  C  CD2   . LEU C  3  289 ? -2.008  124.353 96.178  1.00 47.52  ? 289  LEU C CD2   1 
ATOM   8876  N  N     . GLY C  3  290 ? -3.438  124.564 91.229  1.00 50.28  ? 290  GLY C N     1 
ATOM   8877  C  CA    . GLY C  3  290 ? -3.586  123.529 90.222  1.00 49.56  ? 290  GLY C CA    1 
ATOM   8878  C  C     . GLY C  3  290 ? -2.715  123.870 89.035  1.00 48.70  ? 290  GLY C C     1 
ATOM   8879  O  O     . GLY C  3  290 ? -1.862  123.085 88.613  1.00 47.23  ? 290  GLY C O     1 
ATOM   8880  N  N     . GLY C  3  291 ? -2.937  125.070 88.511  1.00 48.97  ? 291  GLY C N     1 
ATOM   8881  C  CA    . GLY C  3  291 ? -2.170  125.546 87.378  1.00 48.52  ? 291  GLY C CA    1 
ATOM   8882  C  C     . GLY C  3  291 ? -0.705  125.267 87.621  1.00 47.00  ? 291  GLY C C     1 
ATOM   8883  O  O     . GLY C  3  291 ? -0.040  124.599 86.820  1.00 48.20  ? 291  GLY C O     1 
ATOM   8884  N  N     . VAL C  3  292 ? -0.199  125.767 88.742  1.00 43.86  ? 292  VAL C N     1 
ATOM   8885  C  CA    . VAL C  3  292 ? 1.190   125.551 89.068  1.00 40.56  ? 292  VAL C CA    1 
ATOM   8886  C  C     . VAL C  3  292 ? 1.511   124.062 89.073  1.00 38.96  ? 292  VAL C C     1 
ATOM   8887  O  O     . VAL C  3  292 ? 2.410   123.623 88.353  1.00 38.86  ? 292  VAL C O     1 
ATOM   8888  C  CB    . VAL C  3  292 ? 1.534   126.152 90.420  1.00 39.91  ? 292  VAL C CB    1 
ATOM   8889  C  CG1   . VAL C  3  292 ? 2.773   125.471 90.968  1.00 41.36  ? 292  VAL C CG1   1 
ATOM   8890  C  CG2   . VAL C  3  292 ? 1.775   127.652 90.273  1.00 37.19  ? 292  VAL C CG2   1 
ATOM   8891  N  N     . LEU C  3  293 ? 0.775   123.292 89.871  1.00 36.35  ? 293  LEU C N     1 
ATOM   8892  C  CA    . LEU C  3  293 ? 0.992   121.850 89.947  1.00 35.12  ? 293  LEU C CA    1 
ATOM   8893  C  C     . LEU C  3  293 ? 0.969   121.142 88.587  1.00 35.20  ? 293  LEU C C     1 
ATOM   8894  O  O     . LEU C  3  293 ? 1.861   120.334 88.282  1.00 34.78  ? 293  LEU C O     1 
ATOM   8895  C  CB    . LEU C  3  293 ? -0.039  121.233 90.862  1.00 33.13  ? 293  LEU C CB    1 
ATOM   8896  C  CG    . LEU C  3  293 ? 0.178   121.782 92.258  1.00 33.16  ? 293  LEU C CG    1 
ATOM   8897  C  CD1   . LEU C  3  293 ? -1.023  121.442 93.097  1.00 35.11  ? 293  LEU C CD1   1 
ATOM   8898  C  CD2   . LEU C  3  293 ? 1.446   121.212 92.848  1.00 31.27  ? 293  LEU C CD2   1 
ATOM   8899  N  N     . ALA C  3  294 ? -0.045  121.442 87.774  1.00 34.40  ? 294  ALA C N     1 
ATOM   8900  C  CA    . ALA C  3  294 ? -0.162  120.851 86.436  1.00 33.34  ? 294  ALA C CA    1 
ATOM   8901  C  C     . ALA C  3  294 ? 1.171   121.002 85.728  1.00 32.31  ? 294  ALA C C     1 
ATOM   8902  O  O     . ALA C  3  294 ? 1.743   120.030 85.232  1.00 31.21  ? 294  ALA C O     1 
ATOM   8903  C  CB    . ALA C  3  294 ? -1.244  121.563 85.639  1.00 33.32  ? 294  ALA C CB    1 
ATOM   8904  N  N     . LEU C  3  295 ? 1.642   122.248 85.697  1.00 30.97  ? 295  LEU C N     1 
ATOM   8905  C  CA    . LEU C  3  295 ? 2.917   122.601 85.100  1.00 29.74  ? 295  LEU C CA    1 
ATOM   8906  C  C     . LEU C  3  295 ? 4.033   121.748 85.706  1.00 29.90  ? 295  LEU C C     1 
ATOM   8907  O  O     . LEU C  3  295 ? 4.780   121.081 84.991  1.00 29.86  ? 295  LEU C O     1 
ATOM   8908  C  CB    . LEU C  3  295 ? 3.212   124.072 85.350  1.00 27.69  ? 295  LEU C CB    1 
ATOM   8909  C  CG    . LEU C  3  295 ? 4.599   124.563 84.914  1.00 27.72  ? 295  LEU C CG    1 
ATOM   8910  C  CD1   . LEU C  3  295 ? 4.795   124.483 83.421  1.00 25.63  ? 295  LEU C CD1   1 
ATOM   8911  C  CD2   . LEU C  3  295 ? 4.737   125.996 85.355  1.00 29.62  ? 295  LEU C CD2   1 
ATOM   8912  N  N     . ALA C  3  296 ? 4.151   121.769 87.026  1.00 29.60  ? 296  ALA C N     1 
ATOM   8913  C  CA    . ALA C  3  296 ? 5.178   120.983 87.680  1.00 29.81  ? 296  ALA C CA    1 
ATOM   8914  C  C     . ALA C  3  296 ? 5.271   119.650 86.995  1.00 30.49  ? 296  ALA C C     1 
ATOM   8915  O  O     . ALA C  3  296 ? 6.207   119.390 86.245  1.00 30.98  ? 296  ALA C O     1 
ATOM   8916  C  CB    . ALA C  3  296 ? 4.826   120.774 89.087  1.00 30.45  ? 296  ALA C CB    1 
ATOM   8917  N  N     . ALA C  3  297 ? 4.268   118.815 87.229  1.00 31.02  ? 297  ALA C N     1 
ATOM   8918  C  CA    . ALA C  3  297 ? 4.249   117.483 86.639  1.00 32.54  ? 297  ALA C CA    1 
ATOM   8919  C  C     . ALA C  3  297 ? 4.367   117.485 85.121  1.00 32.55  ? 297  ALA C C     1 
ATOM   8920  O  O     . ALA C  3  297 ? 4.806   116.494 84.520  1.00 32.43  ? 297  ALA C O     1 
ATOM   8921  C  CB    . ALA C  3  297 ? 2.992   116.754 87.048  1.00 32.94  ? 297  ALA C CB    1 
ATOM   8922  N  N     . SER C  3  298 ? 3.982   118.592 84.495  1.00 32.33  ? 298  SER C N     1 
ATOM   8923  C  CA    . SER C  3  298 ? 4.048   118.669 83.038  1.00 31.72  ? 298  SER C CA    1 
ATOM   8924  C  C     . SER C  3  298 ? 5.451   118.339 82.568  1.00 29.31  ? 298  SER C C     1 
ATOM   8925  O  O     . SER C  3  298 ? 5.641   117.828 81.471  1.00 28.20  ? 298  SER C O     1 
ATOM   8926  C  CB    . SER C  3  298 ? 3.679   120.059 82.544  1.00 32.31  ? 298  SER C CB    1 
ATOM   8927  O  OG    . SER C  3  298 ? 4.828   120.876 82.536  1.00 33.85  ? 298  SER C OG    1 
ATOM   8928  N  N     . VAL C  3  299 ? 6.432   118.647 83.402  1.00 26.49  ? 299  VAL C N     1 
ATOM   8929  C  CA    . VAL C  3  299 ? 7.800   118.365 83.057  1.00 25.58  ? 299  VAL C CA    1 
ATOM   8930  C  C     . VAL C  3  299 ? 8.335   117.283 83.969  1.00 26.27  ? 299  VAL C C     1 
ATOM   8931  O  O     . VAL C  3  299 ? 8.948   116.318 83.513  1.00 27.55  ? 299  VAL C O     1 
ATOM   8932  C  CB    . VAL C  3  299 ? 8.642   119.620 83.165  1.00 24.14  ? 299  VAL C CB    1 
ATOM   8933  C  CG1   . VAL C  3  299 ? 10.054  119.271 83.531  1.00 23.61  ? 299  VAL C CG1   1 
ATOM   8934  C  CG2   . VAL C  3  299 ? 8.624   120.337 81.831  1.00 24.86  ? 299  VAL C CG2   1 
ATOM   8935  N  N     . LEU C  3  300 ? 8.093   117.432 85.261  1.00 26.00  ? 300  LEU C N     1 
ATOM   8936  C  CA    . LEU C  3  300 ? 8.546   116.446 86.225  1.00 26.06  ? 300  LEU C CA    1 
ATOM   8937  C  C     . LEU C  3  300 ? 8.135   115.034 85.886  1.00 27.86  ? 300  LEU C C     1 
ATOM   8938  O  O     . LEU C  3  300 ? 8.789   114.089 86.310  1.00 29.61  ? 300  LEU C O     1 
ATOM   8939  C  CB    . LEU C  3  300 ? 8.012   116.776 87.590  1.00 24.58  ? 300  LEU C CB    1 
ATOM   8940  C  CG    . LEU C  3  300 ? 8.932   117.772 88.251  1.00 26.27  ? 300  LEU C CG    1 
ATOM   8941  C  CD1   . LEU C  3  300 ? 8.112   118.637 89.211  1.00 27.20  ? 300  LEU C CD1   1 
ATOM   8942  C  CD2   . LEU C  3  300 ? 10.089  117.024 88.929  1.00 24.75  ? 300  LEU C CD2   1 
ATOM   8943  N  N     . ILE C  3  301 ? 7.054   114.873 85.130  1.00 28.85  ? 301  ILE C N     1 
ATOM   8944  C  CA    . ILE C  3  301 ? 6.603   113.532 84.766  1.00 28.23  ? 301  ILE C CA    1 
ATOM   8945  C  C     . ILE C  3  301 ? 7.693   112.718 84.066  1.00 27.75  ? 301  ILE C C     1 
ATOM   8946  O  O     . ILE C  3  301 ? 7.699   111.494 84.161  1.00 27.52  ? 301  ILE C O     1 
ATOM   8947  C  CB    . ILE C  3  301 ? 5.383   113.571 83.859  1.00 28.53  ? 301  ILE C CB    1 
ATOM   8948  C  CG1   . ILE C  3  301 ? 4.838   112.155 83.711  1.00 27.57  ? 301  ILE C CG1   1 
ATOM   8949  C  CG2   . ILE C  3  301 ? 5.747   114.190 82.516  1.00 27.51  ? 301  ILE C CG2   1 
ATOM   8950  C  CD1   . ILE C  3  301 ? 3.685   112.063 82.764  1.00 29.77  ? 301  ILE C CD1   1 
ATOM   8951  N  N     . LEU C  3  302 ? 8.601   113.401 83.363  1.00 26.12  ? 302  LEU C N     1 
ATOM   8952  C  CA    . LEU C  3  302 ? 9.714   112.749 82.683  1.00 24.83  ? 302  LEU C CA    1 
ATOM   8953  C  C     . LEU C  3  302 ? 10.348  111.704 83.583  1.00 25.80  ? 302  LEU C C     1 
ATOM   8954  O  O     . LEU C  3  302 ? 10.583  110.571 83.169  1.00 26.04  ? 302  LEU C O     1 
ATOM   8955  C  CB    . LEU C  3  302 ? 10.757  113.781 82.314  1.00 22.50  ? 302  LEU C CB    1 
ATOM   8956  C  CG    . LEU C  3  302 ? 10.274  114.520 81.089  1.00 22.85  ? 302  LEU C CG    1 
ATOM   8957  C  CD1   . LEU C  3  302 ? 10.956  115.852 80.947  1.00 24.05  ? 302  LEU C CD1   1 
ATOM   8958  C  CD2   . LEU C  3  302 ? 10.541  113.648 79.912  1.00 22.98  ? 302  LEU C CD2   1 
ATOM   8959  N  N     . PHE C  3  303 ? 10.619  112.091 84.824  1.00 25.16  ? 303  PHE C N     1 
ATOM   8960  C  CA    . PHE C  3  303 ? 11.232  111.185 85.766  1.00 26.14  ? 303  PHE C CA    1 
ATOM   8961  C  C     . PHE C  3  303 ? 10.523  109.850 85.853  1.00 29.04  ? 303  PHE C C     1 
ATOM   8962  O  O     . PHE C  3  303 ? 11.163  108.836 86.128  1.00 30.66  ? 303  PHE C O     1 
ATOM   8963  C  CB    . PHE C  3  303 ? 11.291  111.831 87.139  1.00 23.95  ? 303  PHE C CB    1 
ATOM   8964  C  CG    . PHE C  3  303 ? 12.439  112.792 87.308  1.00 24.34  ? 303  PHE C CG    1 
ATOM   8965  C  CD1   . PHE C  3  303 ? 12.231  114.084 87.766  1.00 24.70  ? 303  PHE C CD1   1 
ATOM   8966  C  CD2   . PHE C  3  303 ? 13.736  112.405 87.022  1.00 24.89  ? 303  PHE C CD2   1 
ATOM   8967  C  CE1   . PHE C  3  303 ? 13.301  114.976 87.933  1.00 24.01  ? 303  PHE C CE1   1 
ATOM   8968  C  CE2   . PHE C  3  303 ? 14.810  113.299 87.188  1.00 25.10  ? 303  PHE C CE2   1 
ATOM   8969  C  CZ    . PHE C  3  303 ? 14.587  114.582 87.642  1.00 23.36  ? 303  PHE C CZ    1 
ATOM   8970  N  N     . LEU C  3  304 ? 9.214   109.846 85.600  1.00 31.60  ? 304  LEU C N     1 
ATOM   8971  C  CA    . LEU C  3  304 ? 8.402   108.624 85.666  1.00 34.04  ? 304  LEU C CA    1 
ATOM   8972  C  C     . LEU C  3  304 ? 8.519   107.658 84.496  1.00 35.64  ? 304  LEU C C     1 
ATOM   8973  O  O     . LEU C  3  304 ? 8.591   106.446 84.706  1.00 36.48  ? 304  LEU C O     1 
ATOM   8974  C  CB    . LEU C  3  304 ? 6.924   108.956 85.827  1.00 34.12  ? 304  LEU C CB    1 
ATOM   8975  C  CG    . LEU C  3  304 ? 6.491   109.595 87.133  1.00 35.08  ? 304  LEU C CG    1 
ATOM   8976  C  CD1   . LEU C  3  304 ? 4.966   109.505 87.263  1.00 34.94  ? 304  LEU C CD1   1 
ATOM   8977  C  CD2   . LEU C  3  304 ? 7.178   108.884 88.272  1.00 33.88  ? 304  LEU C CD2   1 
ATOM   8978  N  N     . ILE C  3  305 ? 8.513   108.179 83.273  1.00 36.22  ? 305  ILE C N     1 
ATOM   8979  C  CA    . ILE C  3  305 ? 8.614   107.326 82.104  1.00 38.06  ? 305  ILE C CA    1 
ATOM   8980  C  C     . ILE C  3  305 ? 9.377   106.033 82.374  1.00 41.36  ? 305  ILE C C     1 
ATOM   8981  O  O     . ILE C  3  305 ? 8.895   104.958 82.053  1.00 43.45  ? 305  ILE C O     1 
ATOM   8982  C  CB    . ILE C  3  305 ? 9.305   108.025 80.972  1.00 36.45  ? 305  ILE C CB    1 
ATOM   8983  C  CG1   . ILE C  3  305 ? 8.558   109.295 80.629  1.00 36.21  ? 305  ILE C CG1   1 
ATOM   8984  C  CG2   . ILE C  3  305 ? 9.332   107.128 79.777  1.00 36.48  ? 305  ILE C CG2   1 
ATOM   8985  C  CD1   . ILE C  3  305 ? 7.170   109.041 80.133  1.00 37.30  ? 305  ILE C CD1   1 
ATOM   8986  N  N     . PRO C  3  306 ? 10.577  106.116 82.968  1.00 42.89  ? 306  PRO C N     1 
ATOM   8987  C  CA    . PRO C  3  306 ? 11.331  104.893 83.240  1.00 43.76  ? 306  PRO C CA    1 
ATOM   8988  C  C     . PRO C  3  306 ? 10.549  103.831 83.979  1.00 45.47  ? 306  PRO C C     1 
ATOM   8989  O  O     . PRO C  3  306 ? 10.841  102.655 83.845  1.00 46.90  ? 306  PRO C O     1 
ATOM   8990  C  CB    . PRO C  3  306 ? 12.508  105.394 84.051  1.00 44.17  ? 306  PRO C CB    1 
ATOM   8991  C  CG    . PRO C  3  306 ? 12.746  106.751 83.458  1.00 44.19  ? 306  PRO C CG    1 
ATOM   8992  C  CD    . PRO C  3  306 ? 11.361  107.307 83.342  1.00 43.56  ? 306  PRO C CD    1 
ATOM   8993  N  N     . PHE C  3  307 ? 9.556   104.226 84.763  1.00 47.63  ? 307  PHE C N     1 
ATOM   8994  C  CA    . PHE C  3  307 ? 8.783   103.238 85.505  1.00 50.86  ? 307  PHE C CA    1 
ATOM   8995  C  C     . PHE C  3  307 ? 7.517   102.881 84.782  1.00 50.04  ? 307  PHE C C     1 
ATOM   8996  O  O     . PHE C  3  307 ? 6.862   101.906 85.114  1.00 50.29  ? 307  PHE C O     1 
ATOM   8997  C  CB    . PHE C  3  307 ? 8.473   103.745 86.911  1.00 55.16  ? 307  PHE C CB    1 
ATOM   8998  C  CG    . PHE C  3  307 ? 9.710   104.116 87.703  1.00 62.01  ? 307  PHE C CG    1 
ATOM   8999  C  CD1   . PHE C  3  307 ? 10.787  103.225 87.809  1.00 64.90  ? 307  PHE C CD1   1 
ATOM   9000  C  CD2   . PHE C  3  307 ? 9.807   105.350 88.348  1.00 64.47  ? 307  PHE C CD2   1 
ATOM   9001  C  CE1   . PHE C  3  307 ? 11.949  103.559 88.551  1.00 66.10  ? 307  PHE C CE1   1 
ATOM   9002  C  CE2   . PHE C  3  307 ? 10.962  105.693 89.093  1.00 66.15  ? 307  PHE C CE2   1 
ATOM   9003  C  CZ    . PHE C  3  307 ? 12.032  104.793 89.191  1.00 66.24  ? 307  PHE C CZ    1 
ATOM   9004  N  N     . LEU C  3  308 ? 7.187   103.682 83.781  1.00 50.25  ? 308  LEU C N     1 
ATOM   9005  C  CA    . LEU C  3  308 ? 5.998   103.456 82.971  1.00 51.83  ? 308  LEU C CA    1 
ATOM   9006  C  C     . LEU C  3  308 ? 6.389   102.775 81.656  1.00 52.95  ? 308  LEU C C     1 
ATOM   9007  O  O     . LEU C  3  308 ? 5.911   103.140 80.557  1.00 53.18  ? 308  LEU C O     1 
ATOM   9008  C  CB    . LEU C  3  308 ? 5.286   104.781 82.685  1.00 51.78  ? 308  LEU C CB    1 
ATOM   9009  C  CG    . LEU C  3  308 ? 4.769   105.578 83.880  1.00 50.32  ? 308  LEU C CG    1 
ATOM   9010  C  CD1   . LEU C  3  308 ? 3.786   106.610 83.389  1.00 49.58  ? 308  LEU C CD1   1 
ATOM   9011  C  CD2   . LEU C  3  308 ? 4.077   104.654 84.856  1.00 50.35  ? 308  LEU C CD2   1 
ATOM   9012  N  N     . HIS C  3  309 ? 7.290   101.801 81.789  1.00 52.88  ? 309  HIS C N     1 
ATOM   9013  C  CA    . HIS C  3  309 ? 7.778   101.007 80.662  1.00 52.97  ? 309  HIS C CA    1 
ATOM   9014  C  C     . HIS C  3  309 ? 7.299   99.599  80.963  1.00 53.29  ? 309  HIS C C     1 
ATOM   9015  O  O     . HIS C  3  309 ? 7.600   99.061  82.029  1.00 54.08  ? 309  HIS C O     1 
ATOM   9016  C  CB    . HIS C  3  309 ? 9.312   101.036 80.593  1.00 51.11  ? 309  HIS C CB    1 
ATOM   9017  C  CG    . HIS C  3  309 ? 9.886   100.281 79.432  1.00 49.57  ? 309  HIS C CG    1 
ATOM   9018  N  ND1   . HIS C  3  309 ? 9.831   100.745 78.135  1.00 49.76  ? 309  HIS C ND1   1 
ATOM   9019  C  CD2   . HIS C  3  309 ? 10.502  99.078  79.371  1.00 49.39  ? 309  HIS C CD2   1 
ATOM   9020  C  CE1   . HIS C  3  309 ? 10.384  99.861  77.326  1.00 49.26  ? 309  HIS C CE1   1 
ATOM   9021  N  NE2   . HIS C  3  309 ? 10.799  98.839  78.051  1.00 49.78  ? 309  HIS C NE2   1 
ATOM   9022  N  N     . LYS C  3  310 ? 6.557   99.003  80.039  1.00 52.80  ? 310  LYS C N     1 
ATOM   9023  C  CA    . LYS C  3  310 ? 6.038   97.684  80.292  1.00 54.12  ? 310  LYS C CA    1 
ATOM   9024  C  C     . LYS C  3  310 ? 6.353   96.689  79.194  1.00 55.04  ? 310  LYS C C     1 
ATOM   9025  O  O     . LYS C  3  310 ? 6.297   95.481  79.419  1.00 55.46  ? 310  LYS C O     1 
ATOM   9026  C  CB    . LYS C  3  310 ? 4.525   97.773  80.499  1.00 55.16  ? 310  LYS C CB    1 
ATOM   9027  C  CG    . LYS C  3  310 ? 4.071   98.575  81.715  1.00 55.72  ? 310  LYS C CG    1 
ATOM   9028  C  CD    . LYS C  3  310 ? 4.141   97.740  82.998  1.00 59.09  ? 310  LYS C CD    1 
ATOM   9029  C  CE    . LYS C  3  310 ? 3.636   98.518  84.234  1.00 61.02  ? 310  LYS C CE    1 
ATOM   9030  N  NZ    . LYS C  3  310 ? 3.692   97.759  85.538  1.00 60.72  ? 310  LYS C NZ    1 
ATOM   9031  N  N     . SER C  3  311 ? 6.698   97.182  78.011  1.00 55.80  ? 311  SER C N     1 
ATOM   9032  C  CA    . SER C  3  311 ? 6.979   96.283  76.890  1.00 58.27  ? 311  SER C CA    1 
ATOM   9033  C  C     . SER C  3  311 ? 8.186   95.371  77.092  1.00 58.54  ? 311  SER C C     1 
ATOM   9034  O  O     . SER C  3  311 ? 9.243   95.820  77.534  1.00 58.51  ? 311  SER C O     1 
ATOM   9035  C  CB    . SER C  3  311 ? 7.169   97.080  75.593  1.00 59.73  ? 311  SER C CB    1 
ATOM   9036  O  OG    . SER C  3  311 ? 7.220   96.218  74.461  1.00 61.44  ? 311  SER C OG    1 
ATOM   9037  N  N     . LYS C  3  312 ? 8.014   94.091  76.751  1.00 58.77  ? 312  LYS C N     1 
ATOM   9038  C  CA    . LYS C  3  312 ? 9.070   93.089  76.872  1.00 58.65  ? 312  LYS C CA    1 
ATOM   9039  C  C     . LYS C  3  312 ? 10.229  93.487  75.974  1.00 57.01  ? 312  LYS C C     1 
ATOM   9040  O  O     . LYS C  3  312 ? 11.374  93.060  76.188  1.00 57.90  ? 312  LYS C O     1 
ATOM   9041  C  CB    . LYS C  3  312 ? 8.548   91.706  76.463  1.00 61.23  ? 312  LYS C CB    1 
ATOM   9042  C  CG    . LYS C  3  312 ? 7.609   91.025  77.483  1.00 66.28  ? 312  LYS C CG    1 
ATOM   9043  C  CD    . LYS C  3  312 ? 8.372   90.156  78.520  1.00 71.03  ? 312  LYS C CD    1 
ATOM   9044  C  CE    . LYS C  3  312 ? 7.443   89.292  79.416  1.00 72.73  ? 312  LYS C CE    1 
ATOM   9045  N  NZ    . LYS C  3  312 ? 6.576   90.090  80.352  1.00 74.97  ? 312  LYS C NZ    1 
ATOM   9046  N  N     . GLN C  3  313 ? 9.912   94.308  74.972  1.00 54.12  ? 313  GLN C N     1 
ATOM   9047  C  CA    . GLN C  3  313 ? 10.885  94.819  74.013  1.00 51.28  ? 313  GLN C CA    1 
ATOM   9048  C  C     . GLN C  3  313 ? 11.234  96.228  74.458  1.00 49.55  ? 313  GLN C C     1 
ATOM   9049  O  O     . GLN C  3  313 ? 10.480  96.846  75.207  1.00 48.50  ? 313  GLN C O     1 
ATOM   9050  C  CB    . GLN C  3  313 ? 10.280  94.839  72.615  1.00 51.20  ? 313  GLN C CB    1 
ATOM   9051  C  CG    . GLN C  3  313 ? 9.706   93.501  72.195  1.00 49.90  ? 313  GLN C CG    1 
ATOM   9052  C  CD    . GLN C  3  313 ? 9.097   93.530  70.812  1.00 49.49  ? 313  GLN C CD    1 
ATOM   9053  O  OE1   . GLN C  3  313 ? 8.129   94.250  70.551  1.00 48.14  ? 313  GLN C OE1   1 
ATOM   9054  N  NE2   . GLN C  3  313 ? 9.664   92.744  69.912  1.00 48.99  ? 313  GLN C NE2   1 
ATOM   9055  N  N     . ARG C  3  314 ? 12.356  96.754  73.994  1.00 47.70  ? 314  ARG C N     1 
ATOM   9056  C  CA    . ARG C  3  314 ? 12.758  98.076  74.445  1.00 46.48  ? 314  ARG C CA    1 
ATOM   9057  C  C     . ARG C  3  314 ? 12.376  99.266  73.605  1.00 46.38  ? 314  ARG C C     1 
ATOM   9058  O  O     . ARG C  3  314 ? 11.903  100.266 74.133  1.00 47.48  ? 314  ARG C O     1 
ATOM   9059  C  CB    . ARG C  3  314 ? 14.260  98.122  74.655  1.00 45.87  ? 314  ARG C CB    1 
ATOM   9060  C  CG    . ARG C  3  314 ? 14.782  99.462  75.122  1.00 42.51  ? 314  ARG C CG    1 
ATOM   9061  C  CD    . ARG C  3  314 ? 16.281  99.410  75.168  1.00 41.16  ? 314  ARG C CD    1 
ATOM   9062  N  NE    . ARG C  3  314 ? 16.835  100.391 76.082  1.00 39.74  ? 314  ARG C NE    1 
ATOM   9063  C  CZ    . ARG C  3  314 ? 18.114  100.422 76.414  1.00 39.44  ? 314  ARG C CZ    1 
ATOM   9064  N  NH1   . ARG C  3  314 ? 18.949  99.523  75.891  1.00 39.60  ? 314  ARG C NH1   1 
ATOM   9065  N  NH2   . ARG C  3  314 ? 18.546  101.330 77.277  1.00 37.88  ? 314  ARG C NH2   1 
ATOM   9066  N  N     . THR C  3  315 ? 12.612  99.195  72.308  1.00 45.44  ? 315  THR C N     1 
ATOM   9067  C  CA    . THR C  3  315 ? 12.277  100.325 71.469  1.00 44.59  ? 315  THR C CA    1 
ATOM   9068  C  C     . THR C  3  315 ? 10.952  100.095 70.798  1.00 43.92  ? 315  THR C C     1 
ATOM   9069  O  O     . THR C  3  315 ? 10.457  98.968  70.718  1.00 43.55  ? 315  THR C O     1 
ATOM   9070  C  CB    . THR C  3  315 ? 13.317  100.537 70.403  1.00 44.95  ? 315  THR C CB    1 
ATOM   9071  O  OG1   . THR C  3  315 ? 13.353  99.385  69.555  1.00 45.65  ? 315  THR C OG1   1 
ATOM   9072  C  CG2   . THR C  3  315 ? 14.671  100.733 71.043  1.00 45.46  ? 315  THR C CG2   1 
ATOM   9073  N  N     . MET C  3  316 ? 10.377  101.179 70.312  1.00 43.13  ? 316  MET C N     1 
ATOM   9074  C  CA    . MET C  3  316 ? 9.097   101.098 69.645  1.00 43.74  ? 316  MET C CA    1 
ATOM   9075  C  C     . MET C  3  316 ? 9.257   100.655 68.191  1.00 45.16  ? 316  MET C C     1 
ATOM   9076  O  O     . MET C  3  316 ? 8.280   100.580 67.438  1.00 46.77  ? 316  MET C O     1 
ATOM   9077  C  CB    . MET C  3  316 ? 8.416   102.457 69.695  1.00 41.80  ? 316  MET C CB    1 
ATOM   9078  C  CG    . MET C  3  316 ? 8.343   103.031 71.077  1.00 39.26  ? 316  MET C CG    1 
ATOM   9079  S  SD    . MET C  3  316 ? 7.592   104.627 71.057  1.00 37.18  ? 316  MET C SD    1 
ATOM   9080  C  CE    . MET C  3  316 ? 6.545   104.489 72.392  1.00 36.87  ? 316  MET C CE    1 
ATOM   9081  N  N     . THR C  3  317 ? 10.486  100.355 67.791  1.00 44.97  ? 317  THR C N     1 
ATOM   9082  C  CA    . THR C  3  317 ? 10.724  99.948  66.416  1.00 43.55  ? 317  THR C CA    1 
ATOM   9083  C  C     . THR C  3  317 ? 9.774   98.819  66.007  1.00 44.14  ? 317  THR C C     1 
ATOM   9084  O  O     . THR C  3  317 ? 9.251   98.809  64.891  1.00 44.46  ? 317  THR C O     1 
ATOM   9085  C  CB    . THR C  3  317 ? 12.184  99.502  66.230  1.00 41.60  ? 317  THR C CB    1 
ATOM   9086  O  OG1   . THR C  3  317 ? 13.031  100.305 67.059  1.00 40.31  ? 317  THR C OG1   1 
ATOM   9087  C  CG2   . THR C  3  317 ? 12.618  99.693  64.801  1.00 40.27  ? 317  THR C CG2   1 
ATOM   9088  N  N     . PHE C  3  318 ? 9.517   97.899  66.929  1.00 44.30  ? 318  PHE C N     1 
ATOM   9089  C  CA    . PHE C  3  318 ? 8.663   96.760  66.640  1.00 46.11  ? 318  PHE C CA    1 
ATOM   9090  C  C     . PHE C  3  318 ? 7.348   96.789  67.392  1.00 48.91  ? 318  PHE C C     1 
ATOM   9091  O  O     . PHE C  3  318 ? 6.792   95.740  67.736  1.00 49.36  ? 318  PHE C O     1 
ATOM   9092  C  CB    . PHE C  3  318 ? 9.398   95.473  66.993  1.00 44.79  ? 318  PHE C CB    1 
ATOM   9093  C  CG    . PHE C  3  318 ? 10.698  95.291  66.270  1.00 43.60  ? 318  PHE C CG    1 
ATOM   9094  C  CD1   . PHE C  3  318 ? 11.756  94.616  66.875  1.00 43.15  ? 318  PHE C CD1   1 
ATOM   9095  C  CD2   . PHE C  3  318 ? 10.870  95.774  64.993  1.00 43.36  ? 318  PHE C CD2   1 
ATOM   9096  C  CE1   . PHE C  3  318 ? 12.960  94.429  66.220  1.00 42.24  ? 318  PHE C CE1   1 
ATOM   9097  C  CE2   . PHE C  3  318 ? 12.067  95.589  64.337  1.00 44.01  ? 318  PHE C CE2   1 
ATOM   9098  C  CZ    . PHE C  3  318 ? 13.117  94.913  64.958  1.00 43.20  ? 318  PHE C CZ    1 
ATOM   9099  N  N     . ARG C  3  319 ? 6.843   97.987  67.654  1.00 51.90  ? 319  ARG C N     1 
ATOM   9100  C  CA    . ARG C  3  319 ? 5.581   98.127  68.378  1.00 54.43  ? 319  ARG C CA    1 
ATOM   9101  C  C     . ARG C  3  319 ? 4.724   99.178  67.694  1.00 54.44  ? 319  ARG C C     1 
ATOM   9102  O  O     . ARG C  3  319 ? 4.522   100.277 68.203  1.00 55.52  ? 319  ARG C O     1 
ATOM   9103  C  CB    . ARG C  3  319 ? 5.848   98.527  69.832  1.00 56.53  ? 319  ARG C CB    1 
ATOM   9104  C  CG    . ARG C  3  319 ? 6.772   97.571  70.589  1.00 59.80  ? 319  ARG C CG    1 
ATOM   9105  C  CD    . ARG C  3  319 ? 6.878   97.957  72.053  1.00 61.25  ? 319  ARG C CD    1 
ATOM   9106  N  NE    . ARG C  3  319 ? 7.520   99.251  72.222  1.00 63.09  ? 319  ARG C NE    1 
ATOM   9107  C  CZ    . ARG C  3  319 ? 7.385   100.010 73.303  1.00 64.96  ? 319  ARG C CZ    1 
ATOM   9108  N  NH1   . ARG C  3  319 ? 6.629   99.607  74.312  1.00 64.98  ? 319  ARG C NH1   1 
ATOM   9109  N  NH2   . ARG C  3  319 ? 8.009   101.179 73.378  1.00 67.23  ? 319  ARG C NH2   1 
ATOM   9110  N  N     . PRO C  3  320 ? 4.183   98.833  66.530  1.00 54.73  ? 320  PRO C N     1 
ATOM   9111  C  CA    . PRO C  3  320 ? 3.343   99.747  65.755  1.00 53.81  ? 320  PRO C CA    1 
ATOM   9112  C  C     . PRO C  3  320 ? 2.358   100.493 66.635  1.00 51.82  ? 320  PRO C C     1 
ATOM   9113  O  O     . PRO C  3  320 ? 2.156   101.701 66.474  1.00 51.50  ? 320  PRO C O     1 
ATOM   9114  C  CB    . PRO C  3  320 ? 2.654   98.814  64.768  1.00 55.40  ? 320  PRO C CB    1 
ATOM   9115  C  CG    . PRO C  3  320 ? 2.534   97.541  65.566  1.00 56.47  ? 320  PRO C CG    1 
ATOM   9116  C  CD    . PRO C  3  320 ? 3.903   97.432  66.173  1.00 55.67  ? 320  PRO C CD    1 
ATOM   9117  N  N     . LEU C  3  321 ? 1.754   99.768  67.569  1.00 49.35  ? 321  LEU C N     1 
ATOM   9118  C  CA    . LEU C  3  321 ? 0.795   100.378 68.463  1.00 47.78  ? 321  LEU C CA    1 
ATOM   9119  C  C     . LEU C  3  321 ? 1.438   101.507 69.233  1.00 46.05  ? 321  LEU C C     1 
ATOM   9120  O  O     . LEU C  3  321 ? 1.062   102.657 69.074  1.00 46.66  ? 321  LEU C O     1 
ATOM   9121  C  CB    . LEU C  3  321 ? 0.220   99.344  69.419  1.00 48.37  ? 321  LEU C CB    1 
ATOM   9122  C  CG    . LEU C  3  321 ? -0.697  98.294  68.777  1.00 48.89  ? 321  LEU C CG    1 
ATOM   9123  C  CD1   . LEU C  3  321 ? -1.601  97.722  69.863  1.00 49.75  ? 321  LEU C CD1   1 
ATOM   9124  C  CD2   . LEU C  3  321 ? -1.558  98.912  67.688  1.00 47.89  ? 321  LEU C CD2   1 
ATOM   9125  N  N     . SER C  3  322 ? 2.413   101.190 70.065  1.00 44.21  ? 322  SER C N     1 
ATOM   9126  C  CA    . SER C  3  322 ? 3.093   102.231 70.808  1.00 43.79  ? 322  SER C CA    1 
ATOM   9127  C  C     . SER C  3  322 ? 3.455   103.396 69.887  1.00 43.05  ? 322  SER C C     1 
ATOM   9128  O  O     . SER C  3  322 ? 3.148   104.550 70.193  1.00 43.74  ? 322  SER C O     1 
ATOM   9129  C  CB    . SER C  3  322 ? 4.356   101.676 71.455  1.00 44.03  ? 322  SER C CB    1 
ATOM   9130  O  OG    . SER C  3  322 ? 4.022   100.727 72.451  1.00 45.79  ? 322  SER C OG    1 
ATOM   9131  N  N     . GLN C  3  323 ? 4.098   103.096 68.761  1.00 41.92  ? 323  GLN C N     1 
ATOM   9132  C  CA    . GLN C  3  323 ? 4.489   104.133 67.813  1.00 41.25  ? 323  GLN C CA    1 
ATOM   9133  C  C     . GLN C  3  323 ? 3.368   105.126 67.577  1.00 39.96  ? 323  GLN C C     1 
ATOM   9134  O  O     . GLN C  3  323 ? 3.483   106.316 67.865  1.00 39.72  ? 323  GLN C O     1 
ATOM   9135  C  CB    . GLN C  3  323 ? 4.864   103.525 66.476  1.00 41.99  ? 323  GLN C CB    1 
ATOM   9136  C  CG    . GLN C  3  323 ? 6.086   102.687 66.514  1.00 45.49  ? 323  GLN C CG    1 
ATOM   9137  C  CD    . GLN C  3  323 ? 6.612   102.445 65.130  1.00 48.98  ? 323  GLN C CD    1 
ATOM   9138  O  OE1   . GLN C  3  323 ? 6.905   103.402 64.398  1.00 50.45  ? 323  GLN C OE1   1 
ATOM   9139  N  NE2   . GLN C  3  323 ? 6.737   101.169 64.746  1.00 49.91  ? 323  GLN C NE2   1 
ATOM   9140  N  N     . THR C  3  324 ? 2.277   104.624 67.033  1.00 38.15  ? 324  THR C N     1 
ATOM   9141  C  CA    . THR C  3  324 ? 1.147   105.468 66.751  1.00 37.79  ? 324  THR C CA    1 
ATOM   9142  C  C     . THR C  3  324 ? 0.823   106.331 67.951  1.00 36.63  ? 324  THR C C     1 
ATOM   9143  O  O     . THR C  3  324 ? 0.528   107.514 67.823  1.00 36.79  ? 324  THR C O     1 
ATOM   9144  C  CB    . THR C  3  324 ? -0.041  104.597 66.350  1.00 39.92  ? 324  THR C CB    1 
ATOM   9145  O  OG1   . THR C  3  324 ? -0.257  104.754 64.941  1.00 42.79  ? 324  THR C OG1   1 
ATOM   9146  C  CG2   . THR C  3  324 ? -1.304  104.947 67.146  1.00 40.74  ? 324  THR C CG2   1 
ATOM   9147  N  N     . LEU C  3  325 ? 0.898   105.741 69.130  1.00 36.02  ? 325  LEU C N     1 
ATOM   9148  C  CA    . LEU C  3  325 ? 0.607   106.489 70.333  1.00 35.21  ? 325  LEU C CA    1 
ATOM   9149  C  C     . LEU C  3  325 ? 1.642   107.591 70.445  1.00 33.95  ? 325  LEU C C     1 
ATOM   9150  O  O     . LEU C  3  325 ? 1.296   108.772 70.521  1.00 32.89  ? 325  LEU C O     1 
ATOM   9151  C  CB    . LEU C  3  325 ? 0.651   105.570 71.543  1.00 35.97  ? 325  LEU C CB    1 
ATOM   9152  C  CG    . LEU C  3  325 ? -0.198  106.038 72.720  1.00 38.81  ? 325  LEU C CG    1 
ATOM   9153  C  CD1   . LEU C  3  325 ? -1.420  106.842 72.243  1.00 39.93  ? 325  LEU C CD1   1 
ATOM   9154  C  CD2   . LEU C  3  325 ? -0.635  104.810 73.515  1.00 39.83  ? 325  LEU C CD2   1 
ATOM   9155  N  N     . PHE C  3  326 ? 2.911   107.199 70.430  1.00 32.54  ? 326  PHE C N     1 
ATOM   9156  C  CA    . PHE C  3  326 ? 4.016   108.150 70.494  1.00 32.63  ? 326  PHE C CA    1 
ATOM   9157  C  C     . PHE C  3  326 ? 3.718   109.402 69.648  1.00 33.14  ? 326  PHE C C     1 
ATOM   9158  O  O     . PHE C  3  326 ? 3.514   110.494 70.178  1.00 33.48  ? 326  PHE C O     1 
ATOM   9159  C  CB    . PHE C  3  326 ? 5.295   107.478 69.992  1.00 31.66  ? 326  PHE C CB    1 
ATOM   9160  C  CG    . PHE C  3  326 ? 6.495   108.403 69.900  1.00 32.49  ? 326  PHE C CG    1 
ATOM   9161  C  CD1   . PHE C  3  326 ? 7.367   108.553 70.971  1.00 32.62  ? 326  PHE C CD1   1 
ATOM   9162  C  CD2   . PHE C  3  326 ? 6.767   109.105 68.725  1.00 33.09  ? 326  PHE C CD2   1 
ATOM   9163  C  CE1   . PHE C  3  326 ? 8.495   109.387 70.873  1.00 32.03  ? 326  PHE C CE1   1 
ATOM   9164  C  CE2   . PHE C  3  326 ? 7.891   109.942 68.619  1.00 31.80  ? 326  PHE C CE2   1 
ATOM   9165  C  CZ    . PHE C  3  326 ? 8.753   110.079 69.694  1.00 31.76  ? 326  PHE C CZ    1 
ATOM   9166  N  N     . TRP C  3  327 ? 3.688   109.242 68.332  1.00 33.06  ? 327  TRP C N     1 
ATOM   9167  C  CA    . TRP C  3  327 ? 3.425   110.361 67.428  1.00 33.29  ? 327  TRP C CA    1 
ATOM   9168  C  C     . TRP C  3  327 ? 2.198   111.182 67.789  1.00 33.55  ? 327  TRP C C     1 
ATOM   9169  O  O     . TRP C  3  327 ? 2.156   112.404 67.623  1.00 32.38  ? 327  TRP C O     1 
ATOM   9170  C  CB    . TRP C  3  327 ? 3.273   109.828 66.026  1.00 33.51  ? 327  TRP C CB    1 
ATOM   9171  C  CG    . TRP C  3  327 ? 4.519   109.326 65.539  1.00 33.30  ? 327  TRP C CG    1 
ATOM   9172  C  CD1   . TRP C  3  327 ? 4.849   108.038 65.316  1.00 34.19  ? 327  TRP C CD1   1 
ATOM   9173  C  CD2   . TRP C  3  327 ? 5.665   110.099 65.250  1.00 34.21  ? 327  TRP C CD2   1 
ATOM   9174  N  NE1   . TRP C  3  327 ? 6.150   107.949 64.898  1.00 35.81  ? 327  TRP C NE1   1 
ATOM   9175  C  CE2   . TRP C  3  327 ? 6.673   109.211 64.851  1.00 35.46  ? 327  TRP C CE2   1 
ATOM   9176  C  CE3   . TRP C  3  327 ? 5.943   111.460 65.293  1.00 35.46  ? 327  TRP C CE3   1 
ATOM   9177  C  CZ2   . TRP C  3  327 ? 7.941   109.639 64.494  1.00 36.85  ? 327  TRP C CZ2   1 
ATOM   9178  C  CZ3   . TRP C  3  327 ? 7.202   111.885 64.939  1.00 37.73  ? 327  TRP C CZ3   1 
ATOM   9179  C  CH2   . TRP C  3  327 ? 8.190   110.977 64.544  1.00 37.01  ? 327  TRP C CH2   1 
ATOM   9180  N  N     . LEU C  3  328 ? 1.178   110.491 68.258  1.00 33.75  ? 328  LEU C N     1 
ATOM   9181  C  CA    . LEU C  3  328 ? -0.017  111.168 68.664  1.00 33.96  ? 328  LEU C CA    1 
ATOM   9182  C  C     . LEU C  3  328 ? 0.422   112.141 69.771  1.00 32.84  ? 328  LEU C C     1 
ATOM   9183  O  O     . LEU C  3  328 ? 0.020   113.308 69.779  1.00 32.06  ? 328  LEU C O     1 
ATOM   9184  C  CB    . LEU C  3  328 ? -1.003  110.142 69.192  1.00 35.99  ? 328  LEU C CB    1 
ATOM   9185  C  CG    . LEU C  3  328 ? -2.352  110.755 69.504  1.00 38.00  ? 328  LEU C CG    1 
ATOM   9186  C  CD1   . LEU C  3  328 ? -2.949  111.296 68.207  1.00 38.10  ? 328  LEU C CD1   1 
ATOM   9187  C  CD2   . LEU C  3  328 ? -3.241  109.710 70.167  1.00 38.64  ? 328  LEU C CD2   1 
ATOM   9188  N  N     . LEU C  3  329 ? 1.265   111.651 70.687  1.00 30.21  ? 329  LEU C N     1 
ATOM   9189  C  CA    . LEU C  3  329 ? 1.795   112.452 71.797  1.00 28.10  ? 329  LEU C CA    1 
ATOM   9190  C  C     . LEU C  3  329 ? 2.646   113.617 71.307  1.00 27.57  ? 329  LEU C C     1 
ATOM   9191  O  O     . LEU C  3  329 ? 2.582   114.717 71.865  1.00 26.95  ? 329  LEU C O     1 
ATOM   9192  C  CB    . LEU C  3  329 ? 2.664   111.603 72.695  1.00 26.98  ? 329  LEU C CB    1 
ATOM   9193  C  CG    . LEU C  3  329 ? 3.403   112.403 73.755  1.00 25.73  ? 329  LEU C CG    1 
ATOM   9194  C  CD1   . LEU C  3  329 ? 2.433   112.624 74.904  1.00 25.77  ? 329  LEU C CD1   1 
ATOM   9195  C  CD2   . LEU C  3  329 ? 4.657   111.655 74.226  1.00 24.65  ? 329  LEU C CD2   1 
ATOM   9196  N  N     . VAL C  3  330 ? 3.477   113.360 70.297  1.00 25.91  ? 330  VAL C N     1 
ATOM   9197  C  CA    . VAL C  3  330 ? 4.303   114.413 69.721  1.00 25.54  ? 330  VAL C CA    1 
ATOM   9198  C  C     . VAL C  3  330 ? 3.307   115.483 69.357  1.00 26.93  ? 330  VAL C C     1 
ATOM   9199  O  O     . VAL C  3  330 ? 3.284   116.569 69.940  1.00 28.40  ? 330  VAL C O     1 
ATOM   9200  C  CB    . VAL C  3  330 ? 4.978   113.978 68.422  1.00 23.43  ? 330  VAL C CB    1 
ATOM   9201  C  CG1   . VAL C  3  330 ? 5.613   115.165 67.748  1.00 20.75  ? 330  VAL C CG1   1 
ATOM   9202  C  CG2   . VAL C  3  330 ? 6.017   112.938 68.707  1.00 24.68  ? 330  VAL C CG2   1 
ATOM   9203  N  N     . ALA C  3  331 ? 2.458   115.144 68.398  1.00 27.31  ? 331  ALA C N     1 
ATOM   9204  C  CA    . ALA C  3  331 ? 1.423   116.044 67.928  1.00 27.33  ? 331  ALA C CA    1 
ATOM   9205  C  C     . ALA C  3  331 ? 0.608   116.628 69.083  1.00 26.88  ? 331  ALA C C     1 
ATOM   9206  O  O     . ALA C  3  331 ? 0.146   117.760 69.001  1.00 26.10  ? 331  ALA C O     1 
ATOM   9207  C  CB    . ALA C  3  331 ? 0.525   115.309 66.990  1.00 28.35  ? 331  ALA C CB    1 
ATOM   9208  N  N     . ASN C  3  332 ? 0.422   115.856 70.151  1.00 25.93  ? 332  ASN C N     1 
ATOM   9209  C  CA    . ASN C  3  332 ? -0.331  116.343 71.291  1.00 25.54  ? 332  ASN C CA    1 
ATOM   9210  C  C     . ASN C  3  332 ? 0.389   117.568 71.852  1.00 24.75  ? 332  ASN C C     1 
ATOM   9211  O  O     . ASN C  3  332 ? -0.234  118.533 72.295  1.00 25.56  ? 332  ASN C O     1 
ATOM   9212  C  CB    . ASN C  3  332 ? -0.471  115.247 72.353  1.00 26.60  ? 332  ASN C CB    1 
ATOM   9213  C  CG    . ASN C  3  332 ? -1.428  115.643 73.489  1.00 30.01  ? 332  ASN C CG    1 
ATOM   9214  O  OD1   . ASN C  3  332 ? -2.351  116.449 73.306  1.00 31.55  ? 332  ASN C OD1   1 
ATOM   9215  N  ND2   . ASN C  3  332 ? -1.224  115.054 74.659  1.00 29.98  ? 332  ASN C ND2   1 
ATOM   9216  N  N     . LEU C  3  333 ? 1.706   117.548 71.821  1.00 22.94  ? 333  LEU C N     1 
ATOM   9217  C  CA    . LEU C  3  333 ? 2.447   118.694 72.312  1.00 24.33  ? 333  LEU C CA    1 
ATOM   9218  C  C     . LEU C  3  333 ? 2.358   119.801 71.272  1.00 24.96  ? 333  LEU C C     1 
ATOM   9219  O  O     . LEU C  3  333 ? 2.070   120.968 71.553  1.00 23.21  ? 333  LEU C O     1 
ATOM   9220  C  CB    . LEU C  3  333 ? 3.903   118.310 72.524  1.00 24.48  ? 333  LEU C CB    1 
ATOM   9221  C  CG    . LEU C  3  333 ? 4.114   117.264 73.614  1.00 25.22  ? 333  LEU C CG    1 
ATOM   9222  C  CD1   . LEU C  3  333 ? 5.498   116.692 73.471  1.00 25.21  ? 333  LEU C CD1   1 
ATOM   9223  C  CD2   . LEU C  3  333 ? 3.909   117.884 74.998  1.00 23.63  ? 333  LEU C CD2   1 
ATOM   9224  N  N     . LEU C  3  334 ? 2.626   119.406 70.047  1.00 27.11  ? 334  LEU C N     1 
ATOM   9225  C  CA    . LEU C  3  334 ? 2.575   120.324 68.942  1.00 30.31  ? 334  LEU C CA    1 
ATOM   9226  C  C     . LEU C  3  334 ? 1.275   121.128 69.040  1.00 30.86  ? 334  LEU C C     1 
ATOM   9227  O  O     . LEU C  3  334 ? 1.205   122.274 68.615  1.00 33.02  ? 334  LEU C O     1 
ATOM   9228  C  CB    . LEU C  3  334 ? 2.633   119.525 67.641  1.00 32.82  ? 334  LEU C CB    1 
ATOM   9229  C  CG    . LEU C  3  334 ? 2.675   120.321 66.346  1.00 35.73  ? 334  LEU C CG    1 
ATOM   9230  C  CD1   . LEU C  3  334 ? 3.709   121.432 66.489  1.00 37.74  ? 334  LEU C CD1   1 
ATOM   9231  C  CD2   . LEU C  3  334 ? 3.010   119.381 65.180  1.00 37.11  ? 334  LEU C CD2   1 
ATOM   9232  N  N     . ILE C  3  335 ? 0.244   120.525 69.616  1.00 29.64  ? 335  ILE C N     1 
ATOM   9233  C  CA    . ILE C  3  335 ? -1.033  121.195 69.745  1.00 27.24  ? 335  ILE C CA    1 
ATOM   9234  C  C     . ILE C  3  335 ? -0.925  122.087 70.920  1.00 25.81  ? 335  ILE C C     1 
ATOM   9235  O  O     . ILE C  3  335 ? -0.961  123.294 70.781  1.00 24.34  ? 335  ILE C O     1 
ATOM   9236  C  CB    . ILE C  3  335 ? -2.163  120.191 69.969  1.00 28.33  ? 335  ILE C CB    1 
ATOM   9237  C  CG1   . ILE C  3  335 ? -2.449  119.457 68.648  1.00 29.56  ? 335  ILE C CG1   1 
ATOM   9238  C  CG2   . ILE C  3  335 ? -3.391  120.895 70.492  1.00 27.08  ? 335  ILE C CG2   1 
ATOM   9239  C  CD1   . ILE C  3  335 ? -3.172  118.137 68.792  1.00 29.32  ? 335  ILE C CD1   1 
ATOM   9240  N  N     . LEU C  3  336 ? -0.777  121.483 72.085  1.00 26.13  ? 336  LEU C N     1 
ATOM   9241  C  CA    . LEU C  3  336 ? -0.648  122.251 73.306  1.00 28.97  ? 336  LEU C CA    1 
ATOM   9242  C  C     . LEU C  3  336 ? 0.114   123.536 73.059  1.00 31.87  ? 336  LEU C C     1 
ATOM   9243  O  O     . LEU C  3  336 ? -0.262  124.584 73.588  1.00 33.64  ? 336  LEU C O     1 
ATOM   9244  C  CB    . LEU C  3  336 ? 0.068   121.439 74.366  1.00 26.71  ? 336  LEU C CB    1 
ATOM   9245  C  CG    . LEU C  3  336 ? -0.882  120.501 75.077  1.00 26.59  ? 336  LEU C CG    1 
ATOM   9246  C  CD1   . LEU C  3  336 ? -0.288  119.110 75.256  1.00 25.95  ? 336  LEU C CD1   1 
ATOM   9247  C  CD2   . LEU C  3  336 ? -1.211  121.138 76.391  1.00 26.05  ? 336  LEU C CD2   1 
ATOM   9248  N  N     . THR C  3  337 ? 1.171   123.462 72.248  1.00 33.23  ? 337  THR C N     1 
ATOM   9249  C  CA    . THR C  3  337 ? 1.973   124.646 71.951  1.00 34.12  ? 337  THR C CA    1 
ATOM   9250  C  C     . THR C  3  337 ? 1.127   125.706 71.258  1.00 34.82  ? 337  THR C C     1 
ATOM   9251  O  O     . THR C  3  337 ? 1.057   126.857 71.699  1.00 35.15  ? 337  THR C O     1 
ATOM   9252  C  CB    . THR C  3  337 ? 3.200   124.297 71.075  1.00 34.15  ? 337  THR C CB    1 
ATOM   9253  O  OG1   . THR C  3  337 ? 4.317   123.972 71.918  1.00 35.65  ? 337  THR C OG1   1 
ATOM   9254  C  CG2   . THR C  3  337 ? 3.574   125.469 70.186  1.00 33.32  ? 337  THR C CG2   1 
ATOM   9255  N  N     . TRP C  3  338 ? 0.482   125.311 70.172  1.00 35.36  ? 338  TRP C N     1 
ATOM   9256  C  CA    . TRP C  3  338 ? -0.374  126.218 69.428  1.00 36.43  ? 338  TRP C CA    1 
ATOM   9257  C  C     . TRP C  3  338 ? -1.233  126.977 70.417  1.00 36.82  ? 338  TRP C C     1 
ATOM   9258  O  O     . TRP C  3  338 ? -1.120  128.201 70.540  1.00 37.15  ? 338  TRP C O     1 
ATOM   9259  C  CB    . TRP C  3  338 ? -1.248  125.410 68.489  1.00 38.49  ? 338  TRP C CB    1 
ATOM   9260  C  CG    . TRP C  3  338 ? -2.407  126.134 67.898  1.00 41.16  ? 338  TRP C CG    1 
ATOM   9261  C  CD1   . TRP C  3  338 ? -2.369  127.254 67.111  1.00 41.77  ? 338  TRP C CD1   1 
ATOM   9262  C  CD2   . TRP C  3  338 ? -3.779  125.699 67.918  1.00 42.58  ? 338  TRP C CD2   1 
ATOM   9263  N  NE1   . TRP C  3  338 ? -3.632  127.532 66.626  1.00 44.43  ? 338  TRP C NE1   1 
ATOM   9264  C  CE2   . TRP C  3  338 ? -4.514  126.594 67.107  1.00 44.35  ? 338  TRP C CE2   1 
ATOM   9265  C  CE3   . TRP C  3  338 ? -4.457  124.634 68.538  1.00 41.32  ? 338  TRP C CE3   1 
ATOM   9266  C  CZ2   . TRP C  3  338 ? -5.899  126.453 66.898  1.00 43.78  ? 338  TRP C CZ2   1 
ATOM   9267  C  CZ3   . TRP C  3  338 ? -5.825  124.494 68.331  1.00 40.60  ? 338  TRP C CZ3   1 
ATOM   9268  C  CH2   . TRP C  3  338 ? -6.530  125.399 67.518  1.00 42.42  ? 338  TRP C CH2   1 
ATOM   9269  N  N     . ILE C  3  339 ? -2.072  126.240 71.142  1.00 36.08  ? 339  ILE C N     1 
ATOM   9270  C  CA    . ILE C  3  339 ? -2.948  126.845 72.127  1.00 35.60  ? 339  ILE C CA    1 
ATOM   9271  C  C     . ILE C  3  339 ? -2.240  127.918 72.914  1.00 35.94  ? 339  ILE C C     1 
ATOM   9272  O  O     . ILE C  3  339 ? -2.761  129.008 73.070  1.00 36.56  ? 339  ILE C O     1 
ATOM   9273  C  CB    . ILE C  3  339 ? -3.457  125.841 73.117  1.00 34.80  ? 339  ILE C CB    1 
ATOM   9274  C  CG1   . ILE C  3  339 ? -4.275  124.782 72.391  1.00 34.63  ? 339  ILE C CG1   1 
ATOM   9275  C  CG2   . ILE C  3  339 ? -4.285  126.559 74.169  1.00 35.36  ? 339  ILE C CG2   1 
ATOM   9276  C  CD1   . ILE C  3  339 ? -5.463  125.334 71.671  1.00 35.95  ? 339  ILE C CD1   1 
ATOM   9277  N  N     . GLY C  3  340 ? -1.052  127.606 73.413  1.00 36.25  ? 340  GLY C N     1 
ATOM   9278  C  CA    . GLY C  3  340 ? -0.304  128.589 74.173  1.00 36.98  ? 340  GLY C CA    1 
ATOM   9279  C  C     . GLY C  3  340 ? -0.272  129.915 73.454  1.00 37.06  ? 340  GLY C C     1 
ATOM   9280  O  O     . GLY C  3  340 ? -0.508  130.978 74.033  1.00 35.39  ? 340  GLY C O     1 
ATOM   9281  N  N     . SER C  3  341 ? -0.003  129.846 72.164  1.00 38.70  ? 341  SER C N     1 
ATOM   9282  C  CA    . SER C  3  341 ? 0.070   131.051 71.374  1.00 43.14  ? 341  SER C CA    1 
ATOM   9283  C  C     . SER C  3  341 ? -1.301  131.635 71.080  1.00 44.58  ? 341  SER C C     1 
ATOM   9284  O  O     . SER C  3  341 ? -1.415  132.623 70.364  1.00 45.50  ? 341  SER C O     1 
ATOM   9285  C  CB    . SER C  3  341 ? 0.814   130.781 70.059  1.00 44.84  ? 341  SER C CB    1 
ATOM   9286  O  OG    . SER C  3  341 ? -0.058  130.339 69.033  1.00 47.39  ? 341  SER C OG    1 
ATOM   9287  N  N     . GLN C  3  342 ? -2.347  131.038 71.628  1.00 46.31  ? 342  GLN C N     1 
ATOM   9288  C  CA    . GLN C  3  342 ? -3.685  131.549 71.366  1.00 49.21  ? 342  GLN C CA    1 
ATOM   9289  C  C     . GLN C  3  342 ? -4.387  132.060 72.605  1.00 50.45  ? 342  GLN C C     1 
ATOM   9290  O  O     . GLN C  3  342 ? -4.398  131.403 73.637  1.00 53.14  ? 342  GLN C O     1 
ATOM   9291  C  CB    . GLN C  3  342 ? -4.528  130.475 70.711  1.00 50.48  ? 342  GLN C CB    1 
ATOM   9292  C  CG    . GLN C  3  342 ? -3.965  130.010 69.400  1.00 54.10  ? 342  GLN C CG    1 
ATOM   9293  C  CD    . GLN C  3  342 ? -3.784  131.145 68.423  1.00 57.01  ? 342  GLN C CD    1 
ATOM   9294  O  OE1   . GLN C  3  342 ? -3.264  130.957 67.312  1.00 59.94  ? 342  GLN C OE1   1 
ATOM   9295  N  NE2   . GLN C  3  342 ? -4.212  132.339 68.824  1.00 58.28  ? 342  GLN C NE2   1 
ATOM   9296  N  N     . PRO C  3  343 ? -5.013  133.233 72.510  1.00 50.41  ? 343  PRO C N     1 
ATOM   9297  C  CA    . PRO C  3  343 ? -5.729  133.867 73.622  1.00 50.85  ? 343  PRO C CA    1 
ATOM   9298  C  C     . PRO C  3  343 ? -6.673  132.962 74.378  1.00 50.84  ? 343  PRO C C     1 
ATOM   9299  O  O     . PRO C  3  343 ? -7.046  131.904 73.889  1.00 49.50  ? 343  PRO C O     1 
ATOM   9300  C  CB    . PRO C  3  343 ? -6.440  135.031 72.952  1.00 51.07  ? 343  PRO C CB    1 
ATOM   9301  C  CG    . PRO C  3  343 ? -6.621  134.540 71.554  1.00 50.67  ? 343  PRO C CG    1 
ATOM   9302  C  CD    . PRO C  3  343 ? -5.314  133.910 71.245  1.00 49.64  ? 343  PRO C CD    1 
ATOM   9303  N  N     . VAL C  3  344 ? -7.049  133.396 75.576  1.00 52.41  ? 344  VAL C N     1 
ATOM   9304  C  CA    . VAL C  3  344 ? -7.942  132.630 76.431  1.00 55.27  ? 344  VAL C CA    1 
ATOM   9305  C  C     . VAL C  3  344 ? -9.402  132.888 76.117  1.00 56.49  ? 344  VAL C C     1 
ATOM   9306  O  O     . VAL C  3  344 ? -10.030 133.766 76.711  1.00 57.95  ? 344  VAL C O     1 
ATOM   9307  C  CB    . VAL C  3  344 ? -7.697  132.958 77.911  1.00 56.65  ? 344  VAL C CB    1 
ATOM   9308  C  CG1   . VAL C  3  344 ? -8.730  132.250 78.807  1.00 56.79  ? 344  VAL C CG1   1 
ATOM   9309  C  CG2   . VAL C  3  344 ? -6.283  132.541 78.282  1.00 57.88  ? 344  VAL C CG2   1 
ATOM   9310  N  N     . GLU C  3  345 ? -9.929  132.106 75.178  1.00 57.22  ? 345  GLU C N     1 
ATOM   9311  C  CA    . GLU C  3  345 ? -11.319 132.193 74.735  1.00 57.32  ? 345  GLU C CA    1 
ATOM   9312  C  C     . GLU C  3  345 ? -11.742 130.872 74.138  1.00 57.24  ? 345  GLU C C     1 
ATOM   9313  O  O     . GLU C  3  345 ? -11.021 129.884 74.207  1.00 57.49  ? 345  GLU C O     1 
ATOM   9314  C  CB    . GLU C  3  345 ? -11.487 133.274 73.671  1.00 57.39  ? 345  GLU C CB    1 
ATOM   9315  C  CG    . GLU C  3  345 ? -11.677 134.659 74.217  1.00 57.27  ? 345  GLU C CG    1 
ATOM   9316  C  CD    . GLU C  3  345 ? -11.057 135.693 73.329  1.00 57.88  ? 345  GLU C CD    1 
ATOM   9317  O  OE1   . GLU C  3  345 ? -11.240 135.582 72.092  1.00 57.47  ? 345  GLU C OE1   1 
ATOM   9318  O  OE2   . GLU C  3  345 ? -10.391 136.611 73.875  1.00 58.62  ? 345  GLU C OE2   1 
ATOM   9319  N  N     . HIS C  3  346 ? -12.915 130.862 73.531  1.00 57.40  ? 346  HIS C N     1 
ATOM   9320  C  CA    . HIS C  3  346 ? -13.405 129.647 72.920  1.00 57.91  ? 346  HIS C CA    1 
ATOM   9321  C  C     . HIS C  3  346 ? -13.073 129.712 71.437  1.00 55.35  ? 346  HIS C C     1 
ATOM   9322  O  O     . HIS C  3  346 ? -13.071 130.799 70.862  1.00 54.31  ? 346  HIS C O     1 
ATOM   9323  C  CB    . HIS C  3  346 ? -14.905 129.560 73.113  1.00 62.99  ? 346  HIS C CB    1 
ATOM   9324  C  CG    . HIS C  3  346 ? -15.498 128.271 72.646  1.00 68.08  ? 346  HIS C CG    1 
ATOM   9325  N  ND1   . HIS C  3  346 ? -15.415 127.108 73.380  1.00 70.54  ? 346  HIS C ND1   1 
ATOM   9326  C  CD2   . HIS C  3  346 ? -16.192 127.964 71.522  1.00 70.26  ? 346  HIS C CD2   1 
ATOM   9327  C  CE1   . HIS C  3  346 ? -16.039 126.140 72.728  1.00 73.79  ? 346  HIS C CE1   1 
ATOM   9328  N  NE2   . HIS C  3  346 ? -16.520 126.633 71.598  1.00 72.74  ? 346  HIS C NE2   1 
ATOM   9329  N  N     . PRO C  3  347 ? -12.768 128.559 70.800  1.00 53.52  ? 347  PRO C N     1 
ATOM   9330  C  CA    . PRO C  3  347 ? -12.696 127.179 71.310  1.00 51.75  ? 347  PRO C CA    1 
ATOM   9331  C  C     . PRO C  3  347 ? -11.455 126.936 72.188  1.00 50.63  ? 347  PRO C C     1 
ATOM   9332  O  O     . PRO C  3  347 ? -11.501 126.210 73.198  1.00 50.07  ? 347  PRO C O     1 
ATOM   9333  C  CB    . PRO C  3  347 ? -12.658 126.352 70.027  1.00 50.87  ? 347  PRO C CB    1 
ATOM   9334  C  CG    . PRO C  3  347 ? -11.847 127.198 69.128  1.00 50.76  ? 347  PRO C CG    1 
ATOM   9335  C  CD    . PRO C  3  347 ? -12.452 128.577 69.360  1.00 52.73  ? 347  PRO C CD    1 
ATOM   9336  N  N     . PHE C  3  348 ? -10.357 127.561 71.768  1.00 47.93  ? 348  PHE C N     1 
ATOM   9337  C  CA    . PHE C  3  348 ? -9.072  127.493 72.433  1.00 44.60  ? 348  PHE C CA    1 
ATOM   9338  C  C     . PHE C  3  348 ? -9.040  126.964 73.850  1.00 45.23  ? 348  PHE C C     1 
ATOM   9339  O  O     . PHE C  3  348 ? -8.317  126.017 74.123  1.00 46.84  ? 348  PHE C O     1 
ATOM   9340  C  CB    . PHE C  3  348 ? -8.442  128.865 72.400  1.00 40.70  ? 348  PHE C CB    1 
ATOM   9341  C  CG    . PHE C  3  348 ? -8.137  129.330 71.037  1.00 39.23  ? 348  PHE C CG    1 
ATOM   9342  C  CD1   . PHE C  3  348 ? -7.805  130.648 70.794  1.00 39.52  ? 348  PHE C CD1   1 
ATOM   9343  C  CD2   . PHE C  3  348 ? -8.125  128.433 69.980  1.00 39.19  ? 348  PHE C CD2   1 
ATOM   9344  C  CE1   . PHE C  3  348 ? -7.453  131.072 69.500  1.00 39.02  ? 348  PHE C CE1   1 
ATOM   9345  C  CE2   . PHE C  3  348 ? -7.774  128.844 68.685  1.00 38.88  ? 348  PHE C CE2   1 
ATOM   9346  C  CZ    . PHE C  3  348 ? -7.437  130.164 68.448  1.00 38.00  ? 348  PHE C CZ    1 
ATOM   9347  N  N     . ILE C  3  349 ? -9.814  127.550 74.757  1.00 44.60  ? 349  ILE C N     1 
ATOM   9348  C  CA    . ILE C  3  349 ? -9.758  127.092 76.136  1.00 44.65  ? 349  ILE C CA    1 
ATOM   9349  C  C     . ILE C  3  349 ? -10.071 125.618 76.310  1.00 43.80  ? 349  ILE C C     1 
ATOM   9350  O  O     . ILE C  3  349 ? -9.296  124.867 76.917  1.00 43.34  ? 349  ILE C O     1 
ATOM   9351  C  CB    . ILE C  3  349 ? -10.698 127.881 77.064  1.00 46.86  ? 349  ILE C CB    1 
ATOM   9352  C  CG1   . ILE C  3  349 ? -10.365 129.376 77.029  1.00 48.15  ? 349  ILE C CG1   1 
ATOM   9353  C  CG2   . ILE C  3  349 ? -10.510 127.393 78.506  1.00 48.21  ? 349  ILE C CG2   1 
ATOM   9354  C  CD1   . ILE C  3  349 ? -11.033 130.184 78.148  1.00 49.59  ? 349  ILE C CD1   1 
ATOM   9355  N  N     . ILE C  3  350 ? -11.211 125.191 75.792  1.00 42.70  ? 350  ILE C N     1 
ATOM   9356  C  CA    . ILE C  3  350 ? -11.564 123.798 75.949  1.00 40.87  ? 350  ILE C CA    1 
ATOM   9357  C  C     . ILE C  3  350 ? -10.582 122.921 75.182  1.00 39.08  ? 350  ILE C C     1 
ATOM   9358  O  O     . ILE C  3  350 ? -10.088 121.926 75.722  1.00 37.50  ? 350  ILE C O     1 
ATOM   9359  C  CB    . ILE C  3  350 ? -12.989 123.544 75.481  1.00 41.44  ? 350  ILE C CB    1 
ATOM   9360  C  CG1   . ILE C  3  350 ? -13.325 122.063 75.663  1.00 42.13  ? 350  ILE C CG1   1 
ATOM   9361  C  CG2   . ILE C  3  350 ? -13.135 123.990 74.056  1.00 40.40  ? 350  ILE C CG2   1 
ATOM   9362  C  CD1   . ILE C  3  350 ? -13.093 121.535 77.089  1.00 42.24  ? 350  ILE C CD1   1 
ATOM   9363  N  N     . ILE C  3  351 ? -10.290 123.294 73.936  1.00 37.18  ? 351  ILE C N     1 
ATOM   9364  C  CA    . ILE C  3  351 ? -9.340  122.528 73.139  1.00 36.99  ? 351  ILE C CA    1 
ATOM   9365  C  C     . ILE C  3  351 ? -8.098  122.299 73.987  1.00 39.19  ? 351  ILE C C     1 
ATOM   9366  O  O     . ILE C  3  351 ? -7.506  121.222 73.971  1.00 39.65  ? 351  ILE C O     1 
ATOM   9367  C  CB    . ILE C  3  351 ? -8.890  123.270 71.881  1.00 34.90  ? 351  ILE C CB    1 
ATOM   9368  C  CG1   . ILE C  3  351 ? -10.088 123.656 71.031  1.00 34.46  ? 351  ILE C CG1   1 
ATOM   9369  C  CG2   . ILE C  3  351 ? -7.981  122.385 71.071  1.00 33.88  ? 351  ILE C CG2   1 
ATOM   9370  C  CD1   . ILE C  3  351 ? -9.709  124.269 69.704  1.00 33.58  ? 351  ILE C CD1   1 
ATOM   9371  N  N     . GLY C  3  352 ? -7.713  123.328 74.732  1.00 41.08  ? 352  GLY C N     1 
ATOM   9372  C  CA    . GLY C  3  352 ? -6.550  123.235 75.593  1.00 42.93  ? 352  GLY C CA    1 
ATOM   9373  C  C     . GLY C  3  352 ? -6.761  122.218 76.691  1.00 45.01  ? 352  GLY C C     1 
ATOM   9374  O  O     . GLY C  3  352 ? -6.080  121.188 76.730  1.00 44.99  ? 352  GLY C O     1 
ATOM   9375  N  N     . GLN C  3  353 ? -7.711  122.495 77.578  1.00 46.56  ? 353  GLN C N     1 
ATOM   9376  C  CA    . GLN C  3  353 ? -7.993  121.587 78.676  1.00 48.60  ? 353  GLN C CA    1 
ATOM   9377  C  C     . GLN C  3  353 ? -7.938  120.127 78.216  1.00 49.38  ? 353  GLN C C     1 
ATOM   9378  O  O     . GLN C  3  353 ? -7.464  119.261 78.951  1.00 50.63  ? 353  GLN C O     1 
ATOM   9379  C  CB    . GLN C  3  353 ? -9.360  121.901 79.278  1.00 50.01  ? 353  GLN C CB    1 
ATOM   9380  C  CG    . GLN C  3  353 ? -9.439  123.229 80.012  1.00 52.49  ? 353  GLN C CG    1 
ATOM   9381  C  CD    . GLN C  3  353 ? -10.876 123.615 80.347  1.00 55.08  ? 353  GLN C CD    1 
ATOM   9382  O  OE1   . GLN C  3  353 ? -11.682 123.861 79.449  1.00 56.64  ? 353  GLN C OE1   1 
ATOM   9383  N  NE2   . GLN C  3  353 ? -11.205 123.660 81.639  1.00 55.65  ? 353  GLN C NE2   1 
ATOM   9384  N  N     . MET C  3  354 ? -8.398  119.843 77.001  1.00 49.12  ? 354  MET C N     1 
ATOM   9385  C  CA    . MET C  3  354 ? -8.368  118.466 76.525  1.00 49.35  ? 354  MET C CA    1 
ATOM   9386  C  C     . MET C  3  354 ? -6.944  117.968 76.311  1.00 46.70  ? 354  MET C C     1 
ATOM   9387  O  O     . MET C  3  354 ? -6.513  117.014 76.963  1.00 46.65  ? 354  MET C O     1 
ATOM   9388  C  CB    . MET C  3  354 ? -9.169  118.323 75.225  1.00 54.02  ? 354  MET C CB    1 
ATOM   9389  C  CG    . MET C  3  354 ? -10.700 118.315 75.406  1.00 61.40  ? 354  MET C CG    1 
ATOM   9390  S  SD    . MET C  3  354 ? -11.414 116.800 76.217  1.00 69.66  ? 354  MET C SD    1 
ATOM   9391  C  CE    . MET C  3  354 ? -11.822 117.406 77.922  1.00 67.71  ? 354  MET C CE    1 
ATOM   9392  N  N     . ALA C  3  355 ? -6.216  118.630 75.411  1.00 42.76  ? 355  ALA C N     1 
ATOM   9393  C  CA    . ALA C  3  355 ? -4.836  118.261 75.075  1.00 38.40  ? 355  ALA C CA    1 
ATOM   9394  C  C     . ALA C  3  355 ? -4.008  117.985 76.302  1.00 34.92  ? 355  ALA C C     1 
ATOM   9395  O  O     . ALA C  3  355 ? -3.122  117.132 76.284  1.00 31.98  ? 355  ALA C O     1 
ATOM   9396  C  CB    . ALA C  3  355 ? -4.185  119.359 74.254  1.00 38.71  ? 355  ALA C CB    1 
ATOM   9397  N  N     . SER C  3  356 ? -4.294  118.742 77.354  1.00 32.49  ? 356  SER C N     1 
ATOM   9398  C  CA    . SER C  3  356 ? -3.611  118.588 78.622  1.00 32.08  ? 356  SER C CA    1 
ATOM   9399  C  C     . SER C  3  356 ? -4.094  117.287 79.234  1.00 33.38  ? 356  SER C C     1 
ATOM   9400  O  O     . SER C  3  356 ? -3.322  116.509 79.799  1.00 35.58  ? 356  SER C O     1 
ATOM   9401  C  CB    . SER C  3  356 ? -3.956  119.734 79.548  1.00 28.93  ? 356  SER C CB    1 
ATOM   9402  O  OG    . SER C  3  356 ? -3.708  120.950 78.899  1.00 26.80  ? 356  SER C OG    1 
ATOM   9403  N  N     . LEU C  3  357 ? -5.388  117.044 79.136  1.00 33.12  ? 357  LEU C N     1 
ATOM   9404  C  CA    . LEU C  3  357 ? -5.910  115.816 79.675  1.00 32.73  ? 357  LEU C CA    1 
ATOM   9405  C  C     . LEU C  3  357 ? -5.252  114.741 78.826  1.00 33.04  ? 357  LEU C C     1 
ATOM   9406  O  O     . LEU C  3  357 ? -4.797  113.701 79.321  1.00 31.83  ? 357  LEU C O     1 
ATOM   9407  C  CB    . LEU C  3  357 ? -7.420  115.802 79.523  1.00 31.72  ? 357  LEU C CB    1 
ATOM   9408  C  CG    . LEU C  3  357 ? -8.090  114.901 80.541  1.00 31.92  ? 357  LEU C CG    1 
ATOM   9409  C  CD1   . LEU C  3  357 ? -7.325  114.919 81.851  1.00 33.16  ? 357  LEU C CD1   1 
ATOM   9410  C  CD2   . LEU C  3  357 ? -9.502  115.383 80.737  1.00 32.60  ? 357  LEU C CD2   1 
ATOM   9411  N  N     . SER C  3  358 ? -5.166  115.058 77.539  1.00 33.69  ? 358  SER C N     1 
ATOM   9412  C  CA    . SER C  3  358 ? -4.575  114.203 76.513  1.00 35.37  ? 358  SER C CA    1 
ATOM   9413  C  C     . SER C  3  358 ? -3.176  113.781 76.913  1.00 34.88  ? 358  SER C C     1 
ATOM   9414  O  O     . SER C  3  358 ? -2.873  112.592 77.084  1.00 33.38  ? 358  SER C O     1 
ATOM   9415  C  CB    . SER C  3  358 ? -4.508  114.986 75.201  1.00 36.79  ? 358  SER C CB    1 
ATOM   9416  O  OG    . SER C  3  358 ? -4.004  114.195 74.146  1.00 40.79  ? 358  SER C OG    1 
ATOM   9417  N  N     . TYR C  3  359 ? -2.335  114.801 77.037  1.00 34.66  ? 359  TYR C N     1 
ATOM   9418  C  CA    . TYR C  3  359 ? -0.948  114.671 77.425  1.00 34.53  ? 359  TYR C CA    1 
ATOM   9419  C  C     . TYR C  3  359 ? -0.789  113.647 78.524  1.00 34.77  ? 359  TYR C C     1 
ATOM   9420  O  O     . TYR C  3  359 ? -0.404  112.508 78.271  1.00 35.62  ? 359  TYR C O     1 
ATOM   9421  C  CB    . TYR C  3  359 ? -0.438  116.030 77.894  1.00 35.03  ? 359  TYR C CB    1 
ATOM   9422  C  CG    . TYR C  3  359 ? 0.993   116.056 78.350  1.00 37.27  ? 359  TYR C CG    1 
ATOM   9423  C  CD1   . TYR C  3  359 ? 2.035   115.826 77.462  1.00 38.27  ? 359  TYR C CD1   1 
ATOM   9424  C  CD2   . TYR C  3  359 ? 1.310   116.314 79.674  1.00 40.03  ? 359  TYR C CD2   1 
ATOM   9425  C  CE1   . TYR C  3  359 ? 3.356   115.851 77.879  1.00 39.55  ? 359  TYR C CE1   1 
ATOM   9426  C  CE2   . TYR C  3  359 ? 2.630   116.341 80.113  1.00 41.49  ? 359  TYR C CE2   1 
ATOM   9427  C  CZ    . TYR C  3  359 ? 3.645   116.108 79.209  1.00 41.50  ? 359  TYR C CZ    1 
ATOM   9428  O  OH    . TYR C  3  359 ? 4.946   116.127 79.649  1.00 42.85  ? 359  TYR C OH    1 
ATOM   9429  N  N     . PHE C  3  360 ? -1.116  114.047 79.741  1.00 34.72  ? 360  PHE C N     1 
ATOM   9430  C  CA    . PHE C  3  360 ? -0.976  113.170 80.889  1.00 37.09  ? 360  PHE C CA    1 
ATOM   9431  C  C     . PHE C  3  360 ? -1.416  111.728 80.742  1.00 38.54  ? 360  PHE C C     1 
ATOM   9432  O  O     . PHE C  3  360 ? -0.749  110.796 81.225  1.00 37.28  ? 360  PHE C O     1 
ATOM   9433  C  CB    . PHE C  3  360 ? -1.675  113.790 82.082  1.00 37.46  ? 360  PHE C CB    1 
ATOM   9434  C  CG    . PHE C  3  360 ? -0.888  114.869 82.704  1.00 36.87  ? 360  PHE C CG    1 
ATOM   9435  C  CD1   . PHE C  3  360 ? -0.793  116.089 82.093  1.00 37.72  ? 360  PHE C CD1   1 
ATOM   9436  C  CD2   . PHE C  3  360 ? -0.145  114.632 83.840  1.00 37.07  ? 360  PHE C CD2   1 
ATOM   9437  C  CE1   . PHE C  3  360 ? 0.045   117.068 82.598  1.00 39.16  ? 360  PHE C CE1   1 
ATOM   9438  C  CE2   . PHE C  3  360 ? 0.690   115.597 84.349  1.00 38.38  ? 360  PHE C CE2   1 
ATOM   9439  C  CZ    . PHE C  3  360 ? 0.789   116.819 83.726  1.00 39.05  ? 360  PHE C CZ    1 
ATOM   9440  N  N     . THR C  3  361 ? -2.534  111.539 80.066  1.00 40.36  ? 361  THR C N     1 
ATOM   9441  C  CA    . THR C  3  361 ? -3.057  110.199 79.897  1.00 42.97  ? 361  THR C CA    1 
ATOM   9442  C  C     . THR C  3  361 ? -2.205  109.305 79.003  1.00 43.41  ? 361  THR C C     1 
ATOM   9443  O  O     . THR C  3  361 ? -1.998  108.112 79.294  1.00 42.72  ? 361  THR C O     1 
ATOM   9444  C  CB    . THR C  3  361 ? -4.452  110.270 79.348  1.00 43.64  ? 361  THR C CB    1 
ATOM   9445  O  OG1   . THR C  3  361 ? -5.119  111.389 79.949  1.00 45.62  ? 361  THR C OG1   1 
ATOM   9446  C  CG2   . THR C  3  361 ? -5.197  108.983 79.669  1.00 43.06  ? 361  THR C CG2   1 
ATOM   9447  N  N     . ILE C  3  362 ? -1.716  109.881 77.913  1.00 42.78  ? 362  ILE C N     1 
ATOM   9448  C  CA    . ILE C  3  362 ? -0.898  109.118 77.002  1.00 42.79  ? 362  ILE C CA    1 
ATOM   9449  C  C     . ILE C  3  362 ? 0.302   108.609 77.766  1.00 41.12  ? 362  ILE C C     1 
ATOM   9450  O  O     . ILE C  3  362 ? 0.691   107.448 77.659  1.00 40.10  ? 362  ILE C O     1 
ATOM   9451  C  CB    . ILE C  3  362 ? -0.414  109.976 75.855  1.00 45.38  ? 362  ILE C CB    1 
ATOM   9452  C  CG1   . ILE C  3  362 ? -1.614  110.513 75.065  1.00 47.69  ? 362  ILE C CG1   1 
ATOM   9453  C  CG2   . ILE C  3  362 ? 0.495   109.153 74.964  1.00 46.75  ? 362  ILE C CG2   1 
ATOM   9454  C  CD1   . ILE C  3  362 ? -1.223  111.321 73.822  1.00 50.62  ? 362  ILE C CD1   1 
ATOM   9455  N  N     . LEU C  3  363 ? 0.872   109.496 78.559  1.00 39.57  ? 363  LEU C N     1 
ATOM   9456  C  CA    . LEU C  3  363 ? 2.035   109.152 79.345  1.00 39.35  ? 363  LEU C CA    1 
ATOM   9457  C  C     . LEU C  3  363 ? 1.737   108.300 80.555  1.00 39.29  ? 363  LEU C C     1 
ATOM   9458  O  O     . LEU C  3  363 ? 2.422   107.311 80.777  1.00 41.68  ? 363  LEU C O     1 
ATOM   9459  C  CB    . LEU C  3  363 ? 2.740   110.408 79.821  1.00 38.73  ? 363  LEU C CB    1 
ATOM   9460  C  CG    . LEU C  3  363 ? 3.385   111.202 78.711  1.00 37.81  ? 363  LEU C CG    1 
ATOM   9461  C  CD1   . LEU C  3  363 ? 3.850   112.543 79.230  1.00 36.27  ? 363  LEU C CD1   1 
ATOM   9462  C  CD2   . LEU C  3  363 ? 4.527   110.383 78.176  1.00 37.34  ? 363  LEU C CD2   1 
ATOM   9463  N  N     . LEU C  3  364 ? 0.739   108.674 81.348  1.00 36.11  ? 364  LEU C N     1 
ATOM   9464  C  CA    . LEU C  3  364 ? 0.450   107.906 82.542  1.00 33.64  ? 364  LEU C CA    1 
ATOM   9465  C  C     . LEU C  3  364 ? -0.369  106.648 82.349  1.00 34.97  ? 364  LEU C C     1 
ATOM   9466  O  O     . LEU C  3  364 ? -0.237  105.703 83.132  1.00 35.11  ? 364  LEU C O     1 
ATOM   9467  C  CB    . LEU C  3  364 ? -0.261  108.771 83.553  1.00 30.54  ? 364  LEU C CB    1 
ATOM   9468  C  CG    . LEU C  3  364 ? 0.482   109.979 84.063  1.00 29.34  ? 364  LEU C CG    1 
ATOM   9469  C  CD1   . LEU C  3  364 ? -0.330  110.595 85.173  1.00 29.47  ? 364  LEU C CD1   1 
ATOM   9470  C  CD2   . LEU C  3  364 ? 1.831   109.578 84.582  1.00 29.82  ? 364  LEU C CD2   1 
ATOM   9471  N  N     . ILE C  3  365 ? -1.202  106.615 81.308  1.00 35.88  ? 365  ILE C N     1 
ATOM   9472  C  CA    . ILE C  3  365 ? -2.075  105.461 81.106  1.00 36.55  ? 365  ILE C CA    1 
ATOM   9473  C  C     . ILE C  3  365 ? -2.013  104.655 79.825  1.00 37.31  ? 365  ILE C C     1 
ATOM   9474  O  O     . ILE C  3  365 ? -1.803  103.436 79.876  1.00 37.51  ? 365  ILE C O     1 
ATOM   9475  C  CB    . ILE C  3  365 ? -3.531  105.870 81.324  1.00 35.78  ? 365  ILE C CB    1 
ATOM   9476  C  CG1   . ILE C  3  365 ? -3.773  106.081 82.818  1.00 34.09  ? 365  ILE C CG1   1 
ATOM   9477  C  CG2   . ILE C  3  365 ? -4.468  104.820 80.754  1.00 35.08  ? 365  ILE C CG2   1 
ATOM   9478  C  CD1   . ILE C  3  365 ? -4.882  107.070 83.102  1.00 35.52  ? 365  ILE C CD1   1 
ATOM   9479  N  N     . LEU C  3  366 ? -2.221  105.300 78.683  1.00 37.38  ? 366  LEU C N     1 
ATOM   9480  C  CA    . LEU C  3  366 ? -2.202  104.551 77.433  1.00 38.28  ? 366  LEU C CA    1 
ATOM   9481  C  C     . LEU C  3  366 ? -0.890  103.834 77.229  1.00 40.08  ? 366  LEU C C     1 
ATOM   9482  O  O     . LEU C  3  366 ? -0.856  102.617 77.026  1.00 41.65  ? 366  LEU C O     1 
ATOM   9483  C  CB    . LEU C  3  366 ? -2.441  105.463 76.255  1.00 35.39  ? 366  LEU C CB    1 
ATOM   9484  C  CG    . LEU C  3  366 ? -3.579  106.423 76.502  1.00 35.22  ? 366  LEU C CG    1 
ATOM   9485  C  CD1   . LEU C  3  366 ? -4.007  106.985 75.160  1.00 35.79  ? 366  LEU C CD1   1 
ATOM   9486  C  CD2   . LEU C  3  366 ? -4.719  105.710 77.204  1.00 33.96  ? 366  LEU C CD2   1 
ATOM   9487  N  N     . PHE C  3  367 ? 0.198   104.586 77.303  1.00 40.72  ? 367  PHE C N     1 
ATOM   9488  C  CA    . PHE C  3  367 ? 1.518   104.003 77.097  1.00 41.54  ? 367  PHE C CA    1 
ATOM   9489  C  C     . PHE C  3  367 ? 1.792   102.700 77.832  1.00 40.93  ? 367  PHE C C     1 
ATOM   9490  O  O     . PHE C  3  367 ? 2.149   101.689 77.221  1.00 41.25  ? 367  PHE C O     1 
ATOM   9491  C  CB    . PHE C  3  367 ? 2.611   105.028 77.434  1.00 42.23  ? 367  PHE C CB    1 
ATOM   9492  C  CG    . PHE C  3  367 ? 3.194   105.692 76.229  1.00 40.84  ? 367  PHE C CG    1 
ATOM   9493  C  CD1   . PHE C  3  367 ? 3.865   106.884 76.338  1.00 40.31  ? 367  PHE C CD1   1 
ATOM   9494  C  CD2   . PHE C  3  367 ? 3.025   105.130 74.970  1.00 41.07  ? 367  PHE C CD2   1 
ATOM   9495  C  CE1   . PHE C  3  367 ? 4.353   107.509 75.203  1.00 41.52  ? 367  PHE C CE1   1 
ATOM   9496  C  CE2   . PHE C  3  367 ? 3.505   105.746 73.835  1.00 40.50  ? 367  PHE C CE2   1 
ATOM   9497  C  CZ    . PHE C  3  367 ? 4.167   106.933 73.947  1.00 41.00  ? 367  PHE C CZ    1 
ATOM   9498  N  N     . PRO C  3  368 ? 1.629   102.704 79.152  1.00 39.47  ? 368  PRO C N     1 
ATOM   9499  C  CA    . PRO C  3  368 ? 1.892   101.474 79.873  1.00 39.43  ? 368  PRO C CA    1 
ATOM   9500  C  C     . PRO C  3  368 ? 0.853   100.440 79.488  1.00 39.21  ? 368  PRO C C     1 
ATOM   9501  O  O     . PRO C  3  368 ? 1.132   99.248  79.457  1.00 40.17  ? 368  PRO C O     1 
ATOM   9502  C  CB    . PRO C  3  368 ? 1.784   101.917 81.317  1.00 40.32  ? 368  PRO C CB    1 
ATOM   9503  C  CG    . PRO C  3  368 ? 0.654   102.886 81.245  1.00 40.64  ? 368  PRO C CG    1 
ATOM   9504  C  CD    . PRO C  3  368 ? 1.021   103.708 80.035  1.00 39.40  ? 368  PRO C CD    1 
ATOM   9505  N  N     . THR C  3  369 ? -0.344  100.893 79.167  1.00 37.64  ? 369  THR C N     1 
ATOM   9506  C  CA    . THR C  3  369 ? -1.368  99.951  78.814  1.00 38.45  ? 369  THR C CA    1 
ATOM   9507  C  C     . THR C  3  369 ? -1.174  99.358  77.428  1.00 40.25  ? 369  THR C C     1 
ATOM   9508  O  O     . THR C  3  369 ? -1.064  98.147  77.298  1.00 41.78  ? 369  THR C O     1 
ATOM   9509  C  CB    . THR C  3  369 ? -2.704  100.599 78.966  1.00 37.68  ? 369  THR C CB    1 
ATOM   9510  O  OG1   . THR C  3  369 ? -2.827  101.017 80.328  1.00 37.21  ? 369  THR C OG1   1 
ATOM   9511  C  CG2   . THR C  3  369 ? -3.824  99.626  78.627  1.00 38.98  ? 369  THR C CG2   1 
ATOM   9512  N  N     . ILE C  3  370 ? -1.126  100.181 76.391  1.00 41.55  ? 370  ILE C N     1 
ATOM   9513  C  CA    . ILE C  3  370 ? -0.903  99.659  75.044  1.00 43.86  ? 370  ILE C CA    1 
ATOM   9514  C  C     . ILE C  3  370 ? 0.343   98.776  75.072  1.00 45.10  ? 370  ILE C C     1