data_3H1J
# 
_entry.id   3H1J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H1J         
RCSB  RCSB052574   
WWPDB D_1000052574 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2bcc 
;STIGMATELLIN-BOUND CYTOCHROME BC1 COMPLEX FROM CHICKEN with stigmatellin bound.    
The current entry is a further refinement of this structure, which it will make obsolete.
;
unspecified 
PDB 2pp9 'Bovine bc1 complex with stigmatellin bound' unspecified 
PDB 1sqx 'CRYSTAL STRUCTURE ANALYSIS OF BOVINE BC1 WITH STIGMATELLIN A' unspecified 
PDB 3cx5 'yeast bc1 complex with stigmatellin and cytochrome c bound' unspecified 
PDB 3H1H . unspecified 
PDB 3H1I . unspecified 
PDB 3H1K . unspecified 
PDB 3H1L . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H1J 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Z.'         1 
'Huang, L.'         2 
'Shulmeister, V.M.' 3 
'Chi, Y.-I.'        4 
'Kim, K.K.'         5 
'Hung, L.-W.'       6 
'Crofts, A.R.'      7 
'Berry, E.A.'       8 
'Kim, S.-H.'        9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Electron Transfer by Domain Movement in Cytochrome Bc1' Nature               392 677   684   1998 NATUAS UK 0028-0836 
0006 ? 9565029 ? 
1       'Structure of the avian mitochondrial cytochrome bc1 complex' J.Bioenerg.Biomembr. 31  177   190   1999 ?      US 
0145-479X ?    ? ?       ? 
2       'Mitochondrial cytochrome bc1 complex' 'Subcell Biochem.'   35  541   580   2000 ?      UK 0306-0225 ?    ? ?       ? 
3       
;Physicochemical aspects of the movement of the Rieske iron sulfur protein during quinol oxidation by the bc1 complex from mitochondria and photosynthetic bacteria.
;
Biochemistry         38  15827 15839 1999 BICHAW US 0006-2960 0033 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Z.'         1  
primary 'Huang, L.-S.'      2  
primary 'Shulmeister, V.M.' 3  
primary 'Chi, Y.I.'         4  
primary 'Kim, K.K.'         5  
primary 'Hung, L.W.'        6  
primary 'Crofts, A.R.'      7  
primary 'Berry, E.A.'       8  
primary 'Kim, S.-H.'        9  
1       'Berry, E.A.'       10 
1       'Huang, L.-S.'      11 
1       'Zhang, Z.'         12 
1       'Kim, S.-H.'        13 
2       'Zhang, Z.'         14 
2       'Berry, E.A.'       15 
2       'Huang, L.-S.'      16 
2       'Kim, S.-H.'        17 
3       'Crofts, A.R.'      18 
3       'Hong, S.'          19 
3       'Zhang, Z.'         20 
3       'Berry, E.A.'       21 
# 
_cell.entry_id           3H1J 
_cell.length_a           173.464 
_cell.length_b           182.448 
_cell.length_c           241.328 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H1J 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I'                   49503.840 2  1.10.2.2 
? ?                                   ? 
2  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2'                   46683.809 2  1.10.2.2 
? ?                                   ? 
3  polymer     nat 'Cytochrome b'                                                                            42622.977 2  1.10.2.2 
? ?                                   ? 
4  polymer     nat 'MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN'                                               26973.744 2  1.10.2.2 
? ?                                   ? 
5  polymer     nat 'Cytochrome b-c1 complex subunit Rieske, mitochondrial'                                   21506.188 2  1.10.2.2 
? 'sequence database residues 77-272' ? 
6  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14 KDA PROTEIN'                           13394.397 2  1.10.2.2 
? ?                                   ? 
7  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE UBIQUINONE-BINDING PROTEIN QP-C'          9498.735  2  1.10.2.2 
? ?                                   ? 
8  polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11 KDA PROTEIN, COMPLEX III SUBUNIT VIII' 9057.119  2  1.10.2.2 
? ?                                   ? 
9  polymer     nat 'Cytochrome b-c1 complex subunit Rieske, mitochondrial'                                   4785.649  2  1.10.2.2 
? 'sequence database residues 1-76'   ? 
10 polymer     nat 'MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 7.2 KDA PROTEIN'                          7005.963  2  1.10.2.2 
? ?                                   ? 
11 non-polymer syn 'UNKNOWN LIGAND'                                                                          ?         10 ?        
? ?                                   ? 
12 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                                         616.487   4  ?        
? ?                                   ? 
13 non-polymer syn 'STIGMATELLIN A'                                                                          514.650   2  ?        
? ?                                   ? 
14 non-polymer syn 'Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer'                                        863.343   2  ?        
? ?                                   ? 
15 non-polymer syn 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine                                             749.073   6  ?        
? ?                                   ? 
16 non-polymer syn GLYCEROL                                                                                  92.094    2  ?        
? ?                                   ? 
17 non-polymer syn 'HEME C'                                                                                  618.503   2  ?        
? ?                                   ? 
18 non-polymer syn CARDIOLIPIN                                                                               1464.043  4  ?        
? ?                                   ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'                                                              175.820   2  ?        
? ?                                   ? 
20 non-polymer syn 'DIUNDECYL PHOSPHATIDYL CHOLINE'                                                          622.834   2  ?        
? ?                                   ? 
21 water       nat water                                                                                     18.015    14 ?        
? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 
;Ubiquinol-cytochrome-c reductase complex cytochrome b subunit, Cytochrome b-c1 complex subunit 3, Complex III subunit 3, Complex III subunit III
;
5 'Ubiquinol-cytochrome c reductase iron-sulfur subunit, Rieske iron-sulfur protein, RISP, Complex III subunit 5' 
9 'Ubiquinol-cytochrome c reductase iron-sulfur subunit, Rieske iron-sulfur protein, RISP, Complex III subunit 5' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
A,N ? 
2  'polypeptide(L)' no no 
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
B,O ? 
3  'polypeptide(L)' no no 
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
C,P ? 
4  'polypeptide(L)' no no 
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
D,Q ? 
5  'polypeptide(L)' no no 
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
E,R ? 
6  'polypeptide(L)' no no 
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
F,S ? 
7  'polypeptide(L)' no no 
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
G,T ? 
8  'polypeptide(L)' no no LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK 
LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK H,U ? 
9  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)RPLLC
RESMSGRSARRDLVAGISLNAPASVRY
;
XXXXXXXXXXXXXXXRPLLCRESMSGRSARRDLVAGISLNAPASVRY I,V ? 
10 'polypeptide(L)' no no ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE 
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE J,W ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   ALA n 
1  2   ALA n 
1  3   THR n 
1  4   TYR n 
1  5   ALA n 
1  6   GLN n 
1  7   THR n 
1  8   LEU n 
1  9   GLN n 
1  10  ASN n 
1  11  ILE n 
1  12  PRO n 
1  13  GLU n 
1  14  THR n 
1  15  ASN n 
1  16  VAL n 
1  17  THR n 
1  18  THR n 
1  19  LEU n 
1  20  ASP n 
1  21  ASN n 
1  22  GLY n 
1  23  LEU n 
1  24  ARG n 
1  25  VAL n 
1  26  ALA n 
1  27  SER n 
1  28  GLU n 
1  29  GLU n 
1  30  SER n 
1  31  SER n 
1  32  GLN n 
1  33  PRO n 
1  34  THR n 
1  35  CYS n 
1  36  THR n 
1  37  VAL n 
1  38  GLY n 
1  39  VAL n 
1  40  TRP n 
1  41  ILE n 
1  42  GLY n 
1  43  ALA n 
1  44  GLY n 
1  45  SER n 
1  46  ARG n 
1  47  TYR n 
1  48  GLU n 
1  49  ASN n 
1  50  GLU n 
1  51  LYS n 
1  52  ASN n 
1  53  ASN n 
1  54  GLY n 
1  55  ALA n 
1  56  GLY n 
1  57  TYR n 
1  58  PHE n 
1  59  VAL n 
1  60  GLU n 
1  61  HIS n 
1  62  LEU n 
1  63  ALA n 
1  64  PHE n 
1  65  LYS n 
1  66  GLY n 
1  67  THR n 
1  68  LYS n 
1  69  LYS n 
1  70  ARG n 
1  71  PRO n 
1  72  CYS n 
1  73  ALA n 
1  74  ALA n 
1  75  PHE n 
1  76  GLU n 
1  77  LYS n 
1  78  GLU n 
1  79  VAL n 
1  80  GLU n 
1  81  SER n 
1  82  MET n 
1  83  GLY n 
1  84  ALA n 
1  85  HIS n 
1  86  PHE n 
1  87  ASN n 
1  88  GLY n 
1  89  TYR n 
1  90  THR n 
1  91  SER n 
1  92  ARG n 
1  93  GLU n 
1  94  GLN n 
1  95  THR n 
1  96  ALA n 
1  97  PHE n 
1  98  TYR n 
1  99  ILE n 
1  100 LYS n 
1  101 ALA n 
1  102 LEU n 
1  103 SER n 
1  104 LYS n 
1  105 ASP n 
1  106 MET n 
1  107 PRO n 
1  108 LYS n 
1  109 VAL n 
1  110 VAL n 
1  111 GLU n 
1  112 LEU n 
1  113 LEU n 
1  114 ALA n 
1  115 ASP n 
1  116 VAL n 
1  117 VAL n 
1  118 GLN n 
1  119 ASN n 
1  120 CYS n 
1  121 ALA n 
1  122 LEU n 
1  123 GLU n 
1  124 GLU n 
1  125 SER n 
1  126 GLN n 
1  127 ILE n 
1  128 GLU n 
1  129 LYS n 
1  130 GLU n 
1  131 ARG n 
1  132 GLY n 
1  133 VAL n 
1  134 ILE n 
1  135 LEU n 
1  136 GLN n 
1  137 GLU n 
1  138 LEU n 
1  139 LYS n 
1  140 GLU n 
1  141 MET n 
1  142 ASP n 
1  143 ASN n 
1  144 ASP n 
1  145 MET n 
1  146 THR n 
1  147 ASN n 
1  148 VAL n 
1  149 THR n 
1  150 PHE n 
1  151 ASP n 
1  152 TYR n 
1  153 LEU n 
1  154 HIS n 
1  155 ALA n 
1  156 THR n 
1  157 ALA n 
1  158 PHE n 
1  159 GLN n 
1  160 GLY n 
1  161 THR n 
1  162 ALA n 
1  163 LEU n 
1  164 ALA n 
1  165 ARG n 
1  166 THR n 
1  167 VAL n 
1  168 GLU n 
1  169 GLY n 
1  170 THR n 
1  171 THR n 
1  172 GLU n 
1  173 ASN n 
1  174 ILE n 
1  175 LYS n 
1  176 HIS n 
1  177 LEU n 
1  178 THR n 
1  179 ARG n 
1  180 ALA n 
1  181 ASP n 
1  182 LEU n 
1  183 ALA n 
1  184 SER n 
1  185 TYR n 
1  186 ILE n 
1  187 ASP n 
1  188 THR n 
1  189 HIS n 
1  190 PHE n 
1  191 LYS n 
1  192 ALA n 
1  193 PRO n 
1  194 ARG n 
1  195 MET n 
1  196 VAL n 
1  197 LEU n 
1  198 ALA n 
1  199 ALA n 
1  200 ALA n 
1  201 GLY n 
1  202 GLY n 
1  203 ILE n 
1  204 SER n 
1  205 HIS n 
1  206 LYS n 
1  207 GLU n 
1  208 LEU n 
1  209 VAL n 
1  210 ASP n 
1  211 ALA n 
1  212 ALA n 
1  213 ARG n 
1  214 GLN n 
1  215 HIS n 
1  216 PHE n 
1  217 SER n 
1  218 GLY n 
1  219 VAL n 
1  220 SER n 
1  221 PHE n 
1  222 THR n 
1  223 TYR n 
1  224 LYS n 
1  225 GLU n 
1  226 ASP n 
1  227 ALA n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 LEU n 
1  232 PRO n 
1  233 ARG n 
1  234 CYS n 
1  235 ARG n 
1  236 PHE n 
1  237 THR n 
1  238 GLY n 
1  239 SER n 
1  240 GLU n 
1  241 ILE n 
1  242 ARG n 
1  243 ALA n 
1  244 ARG n 
1  245 ASP n 
1  246 ASP n 
1  247 ALA n 
1  248 LEU n 
1  249 PRO n 
1  250 VAL n 
1  251 ALA n 
1  252 HIS n 
1  253 VAL n 
1  254 ALA n 
1  255 LEU n 
1  256 ALA n 
1  257 VAL n 
1  258 GLU n 
1  259 GLY n 
1  260 PRO n 
1  261 GLY n 
1  262 TRP n 
1  263 ALA n 
1  264 ASP n 
1  265 PRO n 
1  266 ASP n 
1  267 ASN n 
1  268 VAL n 
1  269 VAL n 
1  270 LEU n 
1  271 HIS n 
1  272 VAL n 
1  273 ALA n 
1  274 ASN n 
1  275 ALA n 
1  276 ILE n 
1  277 ILE n 
1  278 GLY n 
1  279 ARG n 
1  280 TYR n 
1  281 ASP n 
1  282 ARG n 
1  283 THR n 
1  284 PHE n 
1  285 GLY n 
1  286 GLY n 
1  287 GLY n 
1  288 LYS n 
1  289 HIS n 
1  290 LEU n 
1  291 SER n 
1  292 SER n 
1  293 ARG n 
1  294 LEU n 
1  295 ALA n 
1  296 ALA n 
1  297 LEU n 
1  298 ALA n 
1  299 VAL n 
1  300 GLU n 
1  301 HIS n 
1  302 LYS n 
1  303 LEU n 
1  304 CYS n 
1  305 HIS n 
1  306 SER n 
1  307 PHE n 
1  308 GLN n 
1  309 THR n 
1  310 PHE n 
1  311 ASN n 
1  312 THR n 
1  313 SER n 
1  314 TYR n 
1  315 SER n 
1  316 ASP n 
1  317 THR n 
1  318 GLY n 
1  319 LEU n 
1  320 PHE n 
1  321 GLY n 
1  322 PHE n 
1  323 HIS n 
1  324 PHE n 
1  325 VAL n 
1  326 ALA n 
1  327 ASP n 
1  328 PRO n 
1  329 LEU n 
1  330 SER n 
1  331 ILE n 
1  332 ASP n 
1  333 ASP n 
1  334 MET n 
1  335 MET n 
1  336 PHE n 
1  337 CYS n 
1  338 ALA n 
1  339 GLN n 
1  340 GLY n 
1  341 GLU n 
1  342 TRP n 
1  343 MET n 
1  344 ARG n 
1  345 LEU n 
1  346 CYS n 
1  347 THR n 
1  348 SER n 
1  349 THR n 
1  350 THR n 
1  351 GLU n 
1  352 SER n 
1  353 GLU n 
1  354 VAL n 
1  355 LYS n 
1  356 ARG n 
1  357 ALA n 
1  358 LYS n 
1  359 ASN n 
1  360 HIS n 
1  361 LEU n 
1  362 ARG n 
1  363 SER n 
1  364 ALA n 
1  365 MET n 
1  366 VAL n 
1  367 ALA n 
1  368 GLN n 
1  369 LEU n 
1  370 ASP n 
1  371 GLY n 
1  372 THR n 
1  373 THR n 
1  374 PRO n 
1  375 VAL n 
1  376 CYS n 
1  377 GLU n 
1  378 THR n 
1  379 ILE n 
1  380 GLY n 
1  381 SER n 
1  382 HIS n 
1  383 LEU n 
1  384 LEU n 
1  385 ASN n 
1  386 TYR n 
1  387 GLY n 
1  388 ARG n 
1  389 ARG n 
1  390 ILE n 
1  391 SER n 
1  392 LEU n 
1  393 GLU n 
1  394 GLU n 
1  395 TRP n 
1  396 ASP n 
1  397 SER n 
1  398 ARG n 
1  399 ILE n 
1  400 SER n 
1  401 ALA n 
1  402 VAL n 
1  403 ASP n 
1  404 ALA n 
1  405 ARG n 
1  406 MET n 
1  407 VAL n 
1  408 ARG n 
1  409 ASP n 
1  410 VAL n 
1  411 CYS n 
1  412 SER n 
1  413 LYS n 
1  414 TYR n 
1  415 ILE n 
1  416 TYR n 
1  417 ASP n 
1  418 LYS n 
1  419 CYS n 
1  420 PRO n 
1  421 ALA n 
1  422 LEU n 
1  423 ALA n 
1  424 ALA n 
1  425 VAL n 
1  426 GLY n 
1  427 PRO n 
1  428 ILE n 
1  429 GLU n 
1  430 GLN n 
1  431 LEU n 
1  432 LEU n 
1  433 ASP n 
1  434 TYR n 
1  435 ASN n 
1  436 ARG n 
1  437 ILE n 
1  438 ARG n 
1  439 SER n 
1  440 GLY n 
1  441 MET n 
1  442 TYR n 
1  443 TRP n 
1  444 ILE n 
1  445 ARG n 
1  446 PHE n 
2  1   SER n 
2  2   LEU n 
2  3   LYS n 
2  4   VAL n 
2  5   ALA n 
2  6   PRO n 
2  7   LYS n 
2  8   VAL n 
2  9   ALA n 
2  10  VAL n 
2  11  SER n 
2  12  ALA n 
2  13  ALA n 
2  14  ALA n 
2  15  GLU n 
2  16  ARG n 
2  17  VAL n 
2  18  LYS n 
2  19  LEU n 
2  20  CYS n 
2  21  PRO n 
2  22  GLY n 
2  23  ALA n 
2  24  GLU n 
2  25  ASP n 
2  26  LEU n 
2  27  GLU n 
2  28  ILE n 
2  29  THR n 
2  30  LYS n 
2  31  LEU n 
2  32  PRO n 
2  33  ASN n 
2  34  GLY n 
2  35  LEU n 
2  36  ILE n 
2  37  ILE n 
2  38  ALA n 
2  39  SER n 
2  40  LEU n 
2  41  GLU n 
2  42  ASN n 
2  43  PHE n 
2  44  SER n 
2  45  PRO n 
2  46  ALA n 
2  47  SER n 
2  48  ARG n 
2  49  ILE n 
2  50  GLY n 
2  51  VAL n 
2  52  PHE n 
2  53  ILE n 
2  54  LYS n 
2  55  ALA n 
2  56  GLY n 
2  57  SER n 
2  58  ARG n 
2  59  TYR n 
2  60  GLU n 
2  61  THR n 
2  62  THR n 
2  63  ALA n 
2  64  ASN n 
2  65  LEU n 
2  66  GLY n 
2  67  THR n 
2  68  ALA n 
2  69  HIS n 
2  70  LEU n 
2  71  LEU n 
2  72  ARG n 
2  73  LEU n 
2  74  ALA n 
2  75  SER n 
2  76  PRO n 
2  77  LEU n 
2  78  THR n 
2  79  THR n 
2  80  LYS n 
2  81  GLY n 
2  82  ALA n 
2  83  SER n 
2  84  SER n 
2  85  PHE n 
2  86  ARG n 
2  87  ILE n 
2  88  THR n 
2  89  ARG n 
2  90  GLY n 
2  91  ILE n 
2  92  GLU n 
2  93  ALA n 
2  94  VAL n 
2  95  GLY n 
2  96  GLY n 
2  97  SER n 
2  98  LEU n 
2  99  SER n 
2  100 VAL n 
2  101 TYR n 
2  102 SER n 
2  103 THR n 
2  104 ARG n 
2  105 GLU n 
2  106 LYS n 
2  107 MET n 
2  108 THR n 
2  109 TYR n 
2  110 CYS n 
2  111 VAL n 
2  112 GLU n 
2  113 CYS n 
2  114 LEU n 
2  115 ARG n 
2  116 ASP n 
2  117 HIS n 
2  118 VAL n 
2  119 ASP n 
2  120 THR n 
2  121 VAL n 
2  122 MET n 
2  123 GLU n 
2  124 TYR n 
2  125 LEU n 
2  126 LEU n 
2  127 ASN n 
2  128 VAL n 
2  129 THR n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 GLU n 
2  134 PHE n 
2  135 ARG n 
2  136 PRO n 
2  137 TRP n 
2  138 GLU n 
2  139 VAL n 
2  140 THR n 
2  141 ASP n 
2  142 LEU n 
2  143 GLN n 
2  144 PRO n 
2  145 GLN n 
2  146 LEU n 
2  147 LYS n 
2  148 VAL n 
2  149 ASP n 
2  150 LYS n 
2  151 ALA n 
2  152 VAL n 
2  153 ALA n 
2  154 PHE n 
2  155 GLN n 
2  156 SER n 
2  157 PRO n 
2  158 GLN n 
2  159 VAL n 
2  160 GLY n 
2  161 VAL n 
2  162 LEU n 
2  163 GLU n 
2  164 ASN n 
2  165 LEU n 
2  166 HIS n 
2  167 ALA n 
2  168 ALA n 
2  169 ALA n 
2  170 TYR n 
2  171 LYS n 
2  172 THR n 
2  173 ALA n 
2  174 LEU n 
2  175 ALA n 
2  176 ASN n 
2  177 PRO n 
2  178 LEU n 
2  179 TYR n 
2  180 CYS n 
2  181 PRO n 
2  182 ASP n 
2  183 TYR n 
2  184 ARG n 
2  185 ILE n 
2  186 GLY n 
2  187 LYS n 
2  188 ILE n 
2  189 THR n 
2  190 SER n 
2  191 GLU n 
2  192 GLN n 
2  193 LEU n 
2  194 HIS n 
2  195 HIS n 
2  196 PHE n 
2  197 VAL n 
2  198 GLN n 
2  199 ASN n 
2  200 ASN n 
2  201 PHE n 
2  202 THR n 
2  203 SER n 
2  204 ALA n 
2  205 ARG n 
2  206 MET n 
2  207 ALA n 
2  208 LEU n 
2  209 VAL n 
2  210 GLY n 
2  211 ILE n 
2  212 GLY n 
2  213 VAL n 
2  214 LYS n 
2  215 HIS n 
2  216 SER n 
2  217 ASP n 
2  218 LEU n 
2  219 LYS n 
2  220 GLN n 
2  221 VAL n 
2  222 ALA n 
2  223 GLU n 
2  224 GLN n 
2  225 PHE n 
2  226 LEU n 
2  227 ASN n 
2  228 ILE n 
2  229 ARG n 
2  230 SER n 
2  231 GLY n 
2  232 ALA n 
2  233 GLY n 
2  234 THR n 
2  235 SER n 
2  236 SER n 
2  237 ALA n 
2  238 LYS n 
2  239 ALA n 
2  240 THR n 
2  241 TYR n 
2  242 TRP n 
2  243 GLY n 
2  244 GLY n 
2  245 GLU n 
2  246 ILE n 
2  247 ARG n 
2  248 GLU n 
2  249 GLN n 
2  250 ASN n 
2  251 GLY n 
2  252 HIS n 
2  253 SER n 
2  254 LEU n 
2  255 VAL n 
2  256 HIS n 
2  257 ALA n 
2  258 ALA n 
2  259 VAL n 
2  260 VAL n 
2  261 THR n 
2  262 GLU n 
2  263 GLY n 
2  264 ALA n 
2  265 ALA n 
2  266 VAL n 
2  267 GLY n 
2  268 SER n 
2  269 ALA n 
2  270 GLU n 
2  271 ALA n 
2  272 ASN n 
2  273 ALA n 
2  274 PHE n 
2  275 SER n 
2  276 VAL n 
2  277 LEU n 
2  278 GLN n 
2  279 HIS n 
2  280 VAL n 
2  281 LEU n 
2  282 GLY n 
2  283 ALA n 
2  284 GLY n 
2  285 PRO n 
2  286 LEU n 
2  287 ILE n 
2  288 LYS n 
2  289 ARG n 
2  290 GLY n 
2  291 SER n 
2  292 SER n 
2  293 VAL n 
2  294 THR n 
2  295 SER n 
2  296 LYS n 
2  297 LEU n 
2  298 TYR n 
2  299 GLN n 
2  300 GLY n 
2  301 VAL n 
2  302 ALA n 
2  303 LYS n 
2  304 ALA n 
2  305 THR n 
2  306 THR n 
2  307 GLN n 
2  308 PRO n 
2  309 PHE n 
2  310 ASP n 
2  311 ALA n 
2  312 SER n 
2  313 ALA n 
2  314 PHE n 
2  315 ASN n 
2  316 VAL n 
2  317 ASN n 
2  318 TYR n 
2  319 SER n 
2  320 ASP n 
2  321 SER n 
2  322 GLY n 
2  323 LEU n 
2  324 PHE n 
2  325 GLY n 
2  326 PHE n 
2  327 TYR n 
2  328 THR n 
2  329 ILE n 
2  330 SER n 
2  331 GLN n 
2  332 ALA n 
2  333 ALA n 
2  334 HIS n 
2  335 ALA n 
2  336 GLY n 
2  337 GLU n 
2  338 VAL n 
2  339 ILE n 
2  340 ARG n 
2  341 ALA n 
2  342 ALA n 
2  343 MET n 
2  344 ASN n 
2  345 GLN n 
2  346 LEU n 
2  347 LYS n 
2  348 ALA n 
2  349 ALA n 
2  350 ALA n 
2  351 GLN n 
2  352 GLY n 
2  353 GLY n 
2  354 VAL n 
2  355 THR n 
2  356 GLU n 
2  357 GLU n 
2  358 ASP n 
2  359 VAL n 
2  360 THR n 
2  361 LYS n 
2  362 ALA n 
2  363 LYS n 
2  364 ASN n 
2  365 GLN n 
2  366 LEU n 
2  367 LYS n 
2  368 ALA n 
2  369 THR n 
2  370 TYR n 
2  371 LEU n 
2  372 MET n 
2  373 SER n 
2  374 VAL n 
2  375 GLU n 
2  376 THR n 
2  377 ALA n 
2  378 GLN n 
2  379 GLY n 
2  380 LEU n 
2  381 LEU n 
2  382 ASN n 
2  383 GLU n 
2  384 ILE n 
2  385 GLY n 
2  386 SER n 
2  387 GLU n 
2  388 ALA n 
2  389 LEU n 
2  390 LEU n 
2  391 SER n 
2  392 GLY n 
2  393 THR n 
2  394 HIS n 
2  395 THR n 
2  396 ALA n 
2  397 PRO n 
2  398 SER n 
2  399 VAL n 
2  400 VAL n 
2  401 ALA n 
2  402 GLN n 
2  403 LYS n 
2  404 ILE n 
2  405 ASP n 
2  406 SER n 
2  407 VAL n 
2  408 THR n 
2  409 SER n 
2  410 ALA n 
2  411 ASP n 
2  412 VAL n 
2  413 VAL n 
2  414 ASN n 
2  415 ALA n 
2  416 ALA n 
2  417 LYS n 
2  418 LYS n 
2  419 PHE n 
2  420 VAL n 
2  421 SER n 
2  422 GLY n 
2  423 LYS n 
2  424 LYS n 
2  425 SER n 
2  426 MET n 
2  427 ALA n 
2  428 ALA n 
2  429 SER n 
2  430 GLY n 
2  431 ASP n 
2  432 LEU n 
2  433 GLY n 
2  434 SER n 
2  435 THR n 
2  436 PRO n 
2  437 PHE n 
2  438 LEU n 
2  439 ASP n 
2  440 GLU n 
2  441 LEU n 
3  1   MET n 
3  2   ALA n 
3  3   PRO n 
3  4   ASN n 
3  5   ILE n 
3  6   ARG n 
3  7   LYS n 
3  8   SER n 
3  9   HIS n 
3  10  PRO n 
3  11  LEU n 
3  12  LEU n 
3  13  LYS n 
3  14  MET n 
3  15  ILE n 
3  16  ASN n 
3  17  ASN n 
3  18  SER n 
3  19  LEU n 
3  20  ILE n 
3  21  ASP n 
3  22  LEU n 
3  23  PRO n 
3  24  ALA n 
3  25  PRO n 
3  26  SER n 
3  27  ASN n 
3  28  ILE n 
3  29  SER n 
3  30  ALA n 
3  31  TRP n 
3  32  TRP n 
3  33  ASN n 
3  34  PHE n 
3  35  GLY n 
3  36  SER n 
3  37  LEU n 
3  38  LEU n 
3  39  ALA n 
3  40  VAL n 
3  41  CYS n 
3  42  LEU n 
3  43  MET n 
3  44  THR n 
3  45  GLN n 
3  46  ILE n 
3  47  LEU n 
3  48  THR n 
3  49  GLY n 
3  50  LEU n 
3  51  LEU n 
3  52  LEU n 
3  53  ALA n 
3  54  MET n 
3  55  HIS n 
3  56  TYR n 
3  57  THR n 
3  58  ALA n 
3  59  ASP n 
3  60  THR n 
3  61  SER n 
3  62  LEU n 
3  63  ALA n 
3  64  PHE n 
3  65  SER n 
3  66  SER n 
3  67  VAL n 
3  68  ALA n 
3  69  HIS n 
3  70  THR n 
3  71  CYS n 
3  72  ARG n 
3  73  ASN n 
3  74  VAL n 
3  75  GLN n 
3  76  TYR n 
3  77  GLY n 
3  78  TRP n 
3  79  LEU n 
3  80  ILE n 
3  81  ARG n 
3  82  ASN n 
3  83  LEU n 
3  84  HIS n 
3  85  ALA n 
3  86  ASN n 
3  87  GLY n 
3  88  ALA n 
3  89  SER n 
3  90  PHE n 
3  91  PHE n 
3  92  PHE n 
3  93  ILE n 
3  94  CYS n 
3  95  ILE n 
3  96  PHE n 
3  97  LEU n 
3  98  HIS n 
3  99  ILE n 
3  100 GLY n 
3  101 ARG n 
3  102 GLY n 
3  103 LEU n 
3  104 TYR n 
3  105 TYR n 
3  106 GLY n 
3  107 SER n 
3  108 TYR n 
3  109 LEU n 
3  110 TYR n 
3  111 LYS n 
3  112 GLU n 
3  113 THR n 
3  114 TRP n 
3  115 ASN n 
3  116 THR n 
3  117 GLY n 
3  118 VAL n 
3  119 ILE n 
3  120 LEU n 
3  121 LEU n 
3  122 LEU n 
3  123 THR n 
3  124 LEU n 
3  125 MET n 
3  126 ALA n 
3  127 THR n 
3  128 ALA n 
3  129 PHE n 
3  130 VAL n 
3  131 GLY n 
3  132 TYR n 
3  133 VAL n 
3  134 LEU n 
3  135 PRO n 
3  136 TRP n 
3  137 GLY n 
3  138 GLN n 
3  139 MET n 
3  140 SER n 
3  141 PHE n 
3  142 TRP n 
3  143 GLY n 
3  144 ALA n 
3  145 THR n 
3  146 VAL n 
3  147 ILE n 
3  148 THR n 
3  149 ASN n 
3  150 LEU n 
3  151 PHE n 
3  152 SER n 
3  153 ALA n 
3  154 ILE n 
3  155 PRO n 
3  156 TYR n 
3  157 ILE n 
3  158 GLY n 
3  159 HIS n 
3  160 THR n 
3  161 LEU n 
3  162 VAL n 
3  163 GLU n 
3  164 TRP n 
3  165 ALA n 
3  166 TRP n 
3  167 GLY n 
3  168 GLY n 
3  169 PHE n 
3  170 SER n 
3  171 VAL n 
3  172 ASP n 
3  173 ASN n 
3  174 PRO n 
3  175 THR n 
3  176 LEU n 
3  177 THR n 
3  178 ARG n 
3  179 PHE n 
3  180 PHE n 
3  181 ALA n 
3  182 LEU n 
3  183 HIS n 
3  184 PHE n 
3  185 LEU n 
3  186 LEU n 
3  187 PRO n 
3  188 PHE n 
3  189 ALA n 
3  190 ILE n 
3  191 ALA n 
3  192 GLY n 
3  193 ILE n 
3  194 THR n 
3  195 ILE n 
3  196 ILE n 
3  197 HIS n 
3  198 LEU n 
3  199 THR n 
3  200 PHE n 
3  201 LEU n 
3  202 HIS n 
3  203 GLU n 
3  204 SER n 
3  205 GLY n 
3  206 SER n 
3  207 ASN n 
3  208 ASN n 
3  209 PRO n 
3  210 LEU n 
3  211 GLY n 
3  212 ILE n 
3  213 SER n 
3  214 SER n 
3  215 ASP n 
3  216 SER n 
3  217 ASP n 
3  218 LYS n 
3  219 ILE n 
3  220 PRO n 
3  221 PHE n 
3  222 HIS n 
3  223 PRO n 
3  224 TYR n 
3  225 TYR n 
3  226 SER n 
3  227 PHE n 
3  228 LYS n 
3  229 ASP n 
3  230 ILE n 
3  231 LEU n 
3  232 GLY n 
3  233 LEU n 
3  234 THR n 
3  235 LEU n 
3  236 MET n 
3  237 LEU n 
3  238 THR n 
3  239 PRO n 
3  240 PHE n 
3  241 LEU n 
3  242 THR n 
3  243 LEU n 
3  244 ALA n 
3  245 LEU n 
3  246 PHE n 
3  247 SER n 
3  248 PRO n 
3  249 ASN n 
3  250 LEU n 
3  251 LEU n 
3  252 GLY n 
3  253 ASP n 
3  254 PRO n 
3  255 GLU n 
3  256 ASN n 
3  257 PHE n 
3  258 THR n 
3  259 PRO n 
3  260 ALA n 
3  261 ASN n 
3  262 PRO n 
3  263 LEU n 
3  264 VAL n 
3  265 THR n 
3  266 PRO n 
3  267 PRO n 
3  268 HIS n 
3  269 ILE n 
3  270 LYS n 
3  271 PRO n 
3  272 GLU n 
3  273 TRP n 
3  274 TYR n 
3  275 PHE n 
3  276 LEU n 
3  277 PHE n 
3  278 ALA n 
3  279 TYR n 
3  280 ALA n 
3  281 ILE n 
3  282 LEU n 
3  283 ARG n 
3  284 SER n 
3  285 ILE n 
3  286 PRO n 
3  287 ASN n 
3  288 LYS n 
3  289 LEU n 
3  290 GLY n 
3  291 GLY n 
3  292 VAL n 
3  293 LEU n 
3  294 ALA n 
3  295 LEU n 
3  296 ALA n 
3  297 ALA n 
3  298 SER n 
3  299 VAL n 
3  300 LEU n 
3  301 ILE n 
3  302 LEU n 
3  303 PHE n 
3  304 LEU n 
3  305 ILE n 
3  306 PRO n 
3  307 PHE n 
3  308 LEU n 
3  309 HIS n 
3  310 LYS n 
3  311 SER n 
3  312 LYS n 
3  313 GLN n 
3  314 ARG n 
3  315 THR n 
3  316 MET n 
3  317 THR n 
3  318 PHE n 
3  319 ARG n 
3  320 PRO n 
3  321 LEU n 
3  322 SER n 
3  323 GLN n 
3  324 THR n 
3  325 LEU n 
3  326 PHE n 
3  327 TRP n 
3  328 LEU n 
3  329 LEU n 
3  330 VAL n 
3  331 ALA n 
3  332 ASN n 
3  333 LEU n 
3  334 LEU n 
3  335 ILE n 
3  336 LEU n 
3  337 THR n 
3  338 TRP n 
3  339 ILE n 
3  340 GLY n 
3  341 SER n 
3  342 GLN n 
3  343 PRO n 
3  344 VAL n 
3  345 GLU n 
3  346 HIS n 
3  347 PRO n 
3  348 PHE n 
3  349 ILE n 
3  350 ILE n 
3  351 ILE n 
3  352 GLY n 
3  353 GLN n 
3  354 MET n 
3  355 ALA n 
3  356 SER n 
3  357 LEU n 
3  358 SER n 
3  359 TYR n 
3  360 PHE n 
3  361 THR n 
3  362 ILE n 
3  363 LEU n 
3  364 LEU n 
3  365 ILE n 
3  366 LEU n 
3  367 PHE n 
3  368 PRO n 
3  369 THR n 
3  370 ILE n 
3  371 GLY n 
3  372 THR n 
3  373 LEU n 
3  374 GLU n 
3  375 ASN n 
3  376 LYS n 
3  377 MET n 
3  378 LEU n 
3  379 ASN n 
3  380 TYR n 
4  1   GLY n 
4  2   GLU n 
4  3   LEU n 
4  4   GLU n 
4  5   LEU n 
4  6   HIS n 
4  7   PRO n 
4  8   PRO n 
4  9   ALA n 
4  10  PHE n 
4  11  PRO n 
4  12  TRP n 
4  13  SER n 
4  14  HIS n 
4  15  GLY n 
4  16  GLY n 
4  17  PRO n 
4  18  LEU n 
4  19  SER n 
4  20  ALA n 
4  21  LEU n 
4  22  ASP n 
4  23  HIS n 
4  24  SER n 
4  25  SER n 
4  26  VAL n 
4  27  ARG n 
4  28  ARG n 
4  29  GLY n 
4  30  PHE n 
4  31  GLN n 
4  32  VAL n 
4  33  TYR n 
4  34  LYS n 
4  35  GLN n 
4  36  VAL n 
4  37  CYS n 
4  38  SER n 
4  39  ALA n 
4  40  CYS n 
4  41  HIS n 
4  42  SER n 
4  43  MET n 
4  44  ASP n 
4  45  TYR n 
4  46  VAL n 
4  47  ALA n 
4  48  PHE n 
4  49  ARG n 
4  50  ASN n 
4  51  LEU n 
4  52  ILE n 
4  53  GLY n 
4  54  VAL n 
4  55  THR n 
4  56  HIS n 
4  57  THR n 
4  58  GLU n 
4  59  ALA n 
4  60  GLU n 
4  61  ALA n 
4  62  LYS n 
4  63  ALA n 
4  64  LEU n 
4  65  ALA n 
4  66  GLU n 
4  67  GLU n 
4  68  VAL n 
4  69  GLU n 
4  70  VAL n 
4  71  GLN n 
4  72  ASP n 
4  73  GLY n 
4  74  PRO n 
4  75  ASP n 
4  76  GLU n 
4  77  ASN n 
4  78  GLY n 
4  79  GLU n 
4  80  LEU n 
4  81  PHE n 
4  82  MET n 
4  83  ARG n 
4  84  PRO n 
4  85  GLY n 
4  86  LYS n 
4  87  ILE n 
4  88  SER n 
4  89  ASP n 
4  90  TYR n 
4  91  PHE n 
4  92  PRO n 
4  93  LYS n 
4  94  PRO n 
4  95  TYR n 
4  96  PRO n 
4  97  ASN n 
4  98  PRO n 
4  99  GLU n 
4  100 ALA n 
4  101 ALA n 
4  102 ARG n 
4  103 ALA n 
4  104 ALA n 
4  105 ASN n 
4  106 ASN n 
4  107 GLY n 
4  108 ALA n 
4  109 LEU n 
4  110 PRO n 
4  111 PRO n 
4  112 ASP n 
4  113 LEU n 
4  114 SER n 
4  115 TYR n 
4  116 ILE n 
4  117 VAL n 
4  118 ASN n 
4  119 ALA n 
4  120 ARG n 
4  121 HIS n 
4  122 GLY n 
4  123 GLY n 
4  124 GLU n 
4  125 ASP n 
4  126 TYR n 
4  127 VAL n 
4  128 PHE n 
4  129 SER n 
4  130 LEU n 
4  131 LEU n 
4  132 THR n 
4  133 GLY n 
4  134 TYR n 
4  135 CYS n 
4  136 ASP n 
4  137 PRO n 
4  138 PRO n 
4  139 ALA n 
4  140 GLY n 
4  141 VAL n 
4  142 VAL n 
4  143 VAL n 
4  144 ARG n 
4  145 GLU n 
4  146 GLY n 
4  147 LEU n 
4  148 HIS n 
4  149 TYR n 
4  150 ASN n 
4  151 PRO n 
4  152 TYR n 
4  153 PHE n 
4  154 PRO n 
4  155 GLY n 
4  156 GLN n 
4  157 ALA n 
4  158 ILE n 
4  159 GLY n 
4  160 MET n 
4  161 ALA n 
4  162 PRO n 
4  163 PRO n 
4  164 ILE n 
4  165 TYR n 
4  166 ASN n 
4  167 GLU n 
4  168 ILE n 
4  169 LEU n 
4  170 GLU n 
4  171 TYR n 
4  172 ASP n 
4  173 ASP n 
4  174 GLY n 
4  175 THR n 
4  176 PRO n 
4  177 ALA n 
4  178 THR n 
4  179 MET n 
4  180 SER n 
4  181 GLN n 
4  182 ILE n 
4  183 ALA n 
4  184 LYS n 
4  185 ASP n 
4  186 VAL n 
4  187 CYS n 
4  188 THR n 
4  189 PHE n 
4  190 LEU n 
4  191 ARG n 
4  192 TRP n 
4  193 ALA n 
4  194 ALA n 
4  195 GLU n 
4  196 PRO n 
4  197 GLU n 
4  198 HIS n 
4  199 ASP n 
4  200 GLN n 
4  201 ARG n 
4  202 LYS n 
4  203 ARG n 
4  204 MET n 
4  205 GLY n 
4  206 LEU n 
4  207 LYS n 
4  208 MET n 
4  209 LEU n 
4  210 LEU n 
4  211 ILE n 
4  212 SER n 
4  213 ALA n 
4  214 LEU n 
4  215 LEU n 
4  216 THR n 
4  217 SER n 
4  218 LEU n 
4  219 LEU n 
4  220 TYR n 
4  221 TYR n 
4  222 MET n 
4  223 LYS n 
4  224 ARG n 
4  225 HIS n 
4  226 LYS n 
4  227 TRP n 
4  228 SER n 
4  229 VAL n 
4  230 LEU n 
4  231 LYS n 
4  232 SER n 
4  233 ARG n 
4  234 LYS n 
4  235 MET n 
4  236 ALA n 
4  237 TYR n 
4  238 ARG n 
4  239 PRO n 
4  240 PRO n 
4  241 LYS n 
5  1   VAL n 
5  2   HIS n 
5  3   ASN n 
5  4   ASP n 
5  5   VAL n 
5  6   THR n 
5  7   VAL n 
5  8   PRO n 
5  9   ASP n 
5  10  PHE n 
5  11  SER n 
5  12  ALA n 
5  13  TYR n 
5  14  ARG n 
5  15  ARG n 
5  16  GLU n 
5  17  ASP n 
5  18  VAL n 
5  19  MET n 
5  20  ASP n 
5  21  ALA n 
5  22  THR n 
5  23  THR n 
5  24  SER n 
5  25  SER n 
5  26  GLN n 
5  27  THR n 
5  28  SER n 
5  29  SER n 
5  30  GLU n 
5  31  ASP n 
5  32  ARG n 
5  33  LYS n 
5  34  GLY n 
5  35  PHE n 
5  36  SER n 
5  37  TYR n 
5  38  LEU n 
5  39  VAL n 
5  40  THR n 
5  41  ALA n 
5  42  THR n 
5  43  ALA n 
5  44  CYS n 
5  45  VAL n 
5  46  ALA n 
5  47  THR n 
5  48  ALA n 
5  49  TYR n 
5  50  ALA n 
5  51  ALA n 
5  52  LYS n 
5  53  ASN n 
5  54  VAL n 
5  55  VAL n 
5  56  THR n 
5  57  GLN n 
5  58  PHE n 
5  59  ILE n 
5  60  SER n 
5  61  SER n 
5  62  LEU n 
5  63  SER n 
5  64  ALA n 
5  65  SER n 
5  66  ALA n 
5  67  ASP n 
5  68  VAL n 
5  69  LEU n 
5  70  ALA n 
5  71  LEU n 
5  72  SER n 
5  73  LYS n 
5  74  ILE n 
5  75  GLU n 
5  76  ILE n 
5  77  LYS n 
5  78  LEU n 
5  79  SER n 
5  80  ASP n 
5  81  ILE n 
5  82  PRO n 
5  83  GLU n 
5  84  GLY n 
5  85  LYS n 
5  86  ASN n 
5  87  VAL n 
5  88  ALA n 
5  89  PHE n 
5  90  LYS n 
5  91  TRP n 
5  92  ARG n 
5  93  GLY n 
5  94  LYS n 
5  95  PRO n 
5  96  LEU n 
5  97  PHE n 
5  98  VAL n 
5  99  ARG n 
5  100 HIS n 
5  101 ARG n 
5  102 THR n 
5  103 GLN n 
5  104 ALA n 
5  105 GLU n 
5  106 ILE n 
5  107 ASN n 
5  108 GLN n 
5  109 GLU n 
5  110 ALA n 
5  111 GLU n 
5  112 VAL n 
5  113 ASP n 
5  114 VAL n 
5  115 SER n 
5  116 LYS n 
5  117 LEU n 
5  118 ARG n 
5  119 ASP n 
5  120 PRO n 
5  121 GLN n 
5  122 HIS n 
5  123 ASP n 
5  124 LEU n 
5  125 ASP n 
5  126 ARG n 
5  127 VAL n 
5  128 LYS n 
5  129 LYS n 
5  130 PRO n 
5  131 GLU n 
5  132 TRP n 
5  133 VAL n 
5  134 ILE n 
5  135 LEU n 
5  136 VAL n 
5  137 GLY n 
5  138 VAL n 
5  139 CYS n 
5  140 THR n 
5  141 HIS n 
5  142 LEU n 
5  143 GLY n 
5  144 CYS n 
5  145 VAL n 
5  146 PRO n 
5  147 ILE n 
5  148 ALA n 
5  149 ASN n 
5  150 SER n 
5  151 GLY n 
5  152 ASP n 
5  153 PHE n 
5  154 GLY n 
5  155 GLY n 
5  156 TYR n 
5  157 TYR n 
5  158 CYS n 
5  159 PRO n 
5  160 CYS n 
5  161 HIS n 
5  162 GLY n 
5  163 SER n 
5  164 HIS n 
5  165 TYR n 
5  166 ASP n 
5  167 ALA n 
5  168 SER n 
5  169 GLY n 
5  170 ARG n 
5  171 ILE n 
5  172 ARG n 
5  173 LYS n 
5  174 GLY n 
5  175 PRO n 
5  176 ALA n 
5  177 PRO n 
5  178 TYR n 
5  179 ASN n 
5  180 LEU n 
5  181 GLU n 
5  182 VAL n 
5  183 PRO n 
5  184 THR n 
5  185 TYR n 
5  186 GLN n 
5  187 PHE n 
5  188 VAL n 
5  189 GLY n 
5  190 ASP n 
5  191 ASP n 
5  192 LEU n 
5  193 VAL n 
5  194 VAL n 
5  195 VAL n 
5  196 GLY n 
6  1   ALA n 
6  2   ALA n 
6  3   ARG n 
6  4   ALA n 
6  5   THR n 
6  6   VAL n 
6  7   ALA n 
6  8   GLY n 
6  9   GLY n 
6  10  GLY n 
6  11  ARG n 
6  12  LEU n 
6  13  MET n 
6  14  ASP n 
6  15  ARG n 
6  16  ILE n 
6  17  ARG n 
6  18  LYS n 
6  19  TRP n 
6  20  TYR n 
6  21  TYR n 
6  22  ASN n 
6  23  ALA n 
6  24  ALA n 
6  25  GLY n 
6  26  PHE n 
6  27  ASN n 
6  28  LYS n 
6  29  TYR n 
6  30  GLY n 
6  31  LEU n 
6  32  MET n 
6  33  ARG n 
6  34  ASP n 
6  35  ASP n 
6  36  THR n 
6  37  LEU n 
6  38  TYR n 
6  39  GLU n 
6  40  ASP n 
6  41  ASP n 
6  42  ASP n 
6  43  VAL n 
6  44  LYS n 
6  45  GLU n 
6  46  ALA n 
6  47  LEU n 
6  48  LYS n 
6  49  ARG n 
6  50  LEU n 
6  51  PRO n 
6  52  GLU n 
6  53  ASP n 
6  54  LEU n 
6  55  TYR n 
6  56  ASN n 
6  57  GLU n 
6  58  ARG n 
6  59  MET n 
6  60  PHE n 
6  61  ARG n 
6  62  ILE n 
6  63  LYS n 
6  64  ARG n 
6  65  ALA n 
6  66  LEU n 
6  67  ASP n 
6  68  LEU n 
6  69  SER n 
6  70  LEU n 
6  71  LYS n 
6  72  HIS n 
6  73  ARG n 
6  74  ILE n 
6  75  LEU n 
6  76  PRO n 
6  77  LYS n 
6  78  GLU n 
6  79  GLN n 
6  80  TRP n 
6  81  VAL n 
6  82  LYS n 
6  83  TYR n 
6  84  GLU n 
6  85  GLU n 
6  86  ASP n 
6  87  LYS n 
6  88  PRO n 
6  89  TYR n 
6  90  LEU n 
6  91  GLU n 
6  92  PRO n 
6  93  TYR n 
6  94  LEU n 
6  95  LYS n 
6  96  GLU n 
6  97  VAL n 
6  98  ILE n 
6  99  ARG n 
6  100 GLU n 
6  101 ARG n 
6  102 LEU n 
6  103 GLU n 
6  104 ARG n 
6  105 GLU n 
6  106 ALA n 
6  107 TRP n 
6  108 ASN n 
6  109 LYS n 
6  110 LYS n 
7  1   GLY n 
7  2   ILE n 
7  3   HIS n 
7  4   PHE n 
7  5   GLY n 
7  6   ASN n 
7  7   LEU n 
7  8   ALA n 
7  9   ARG n 
7  10  VAL n 
7  11  ARG n 
7  12  HIS n 
7  13  ILE n 
7  14  ILE n 
7  15  THR n 
7  16  TYR n 
7  17  SER n 
7  18  LEU n 
7  19  SER n 
7  20  PRO n 
7  21  PHE n 
7  22  GLU n 
7  23  GLN n 
7  24  ARG n 
7  25  ALA n 
7  26  ILE n 
7  27  PRO n 
7  28  ASN n 
7  29  ILE n 
7  30  PHE n 
7  31  SER n 
7  32  ASP n 
7  33  ALA n 
7  34  LEU n 
7  35  PRO n 
7  36  ASN n 
7  37  VAL n 
7  38  TRP n 
7  39  ARG n 
7  40  ARG n 
7  41  PHE n 
7  42  SER n 
7  43  SER n 
7  44  GLN n 
7  45  VAL n 
7  46  PHE n 
7  47  LYS n 
7  48  VAL n 
7  49  ALA n 
7  50  PRO n 
7  51  PRO n 
7  52  PHE n 
7  53  LEU n 
7  54  GLY n 
7  55  ALA n 
7  56  TYR n 
7  57  LEU n 
7  58  LEU n 
7  59  TYR n 
7  60  SER n 
7  61  TRP n 
7  62  GLY n 
7  63  THR n 
7  64  GLN n 
7  65  GLU n 
7  66  PHE n 
7  67  GLU n 
7  68  ARG n 
7  69  LEU n 
7  70  LYS n 
7  71  ARG n 
7  72  LYS n 
7  73  ASN n 
7  74  PRO n 
7  75  ALA n 
7  76  ASP n 
7  77  TYR n 
7  78  GLU n 
7  79  ASN n 
7  80  ASP n 
7  81  GLN n 
8  1   LEU n 
8  2   ARG n 
8  3   GLY n 
8  4   SER n 
8  5   GLY n 
8  6   GLU n 
8  7   GLU n 
8  8   GLU n 
8  9   GLU n 
8  10  GLU n 
8  11  GLU n 
8  12  LEU n 
8  13  VAL n 
8  14  ASP n 
8  15  PRO n 
8  16  LEU n 
8  17  THR n 
8  18  THR n 
8  19  ILE n 
8  20  ARG n 
8  21  GLU n 
8  22  HIS n 
8  23  CYS n 
8  24  GLU n 
8  25  GLN n 
8  26  THR n 
8  27  GLU n 
8  28  LYS n 
8  29  CYS n 
8  30  VAL n 
8  31  LYS n 
8  32  ALA n 
8  33  ARG n 
8  34  GLU n 
8  35  ARG n 
8  36  LEU n 
8  37  GLU n 
8  38  LEU n 
8  39  CYS n 
8  40  ASP n 
8  41  ALA n 
8  42  ARG n 
8  43  VAL n 
8  44  SER n 
8  45  SER n 
8  46  ARG n 
8  47  SER n 
8  48  HIS n 
8  49  THR n 
8  50  GLU n 
8  51  GLU n 
8  52  GLN n 
8  53  CYS n 
8  54  THR n 
8  55  GLU n 
8  56  GLU n 
8  57  LEU n 
8  58  PHE n 
8  59  ASP n 
8  60  PHE n 
8  61  LEU n 
8  62  HIS n 
8  63  ALA n 
8  64  ARG n 
8  65  ASP n 
8  66  HIS n 
8  67  CYS n 
8  68  VAL n 
8  69  ALA n 
8  70  HIS n 
8  71  LYS n 
8  72  LEU n 
8  73  PHE n 
8  74  ASN n 
8  75  LYS n 
8  76  LEU n 
8  77  LYS n 
9  1   UNK n 
9  2   UNK n 
9  3   UNK n 
9  4   UNK n 
9  5   UNK n 
9  6   UNK n 
9  7   UNK n 
9  8   UNK n 
9  9   UNK n 
9  10  UNK n 
9  11  UNK n 
9  12  UNK n 
9  13  UNK n 
9  14  UNK n 
9  15  UNK n 
9  16  ARG n 
9  17  PRO n 
9  18  LEU n 
9  19  LEU n 
9  20  CYS n 
9  21  ARG n 
9  22  GLU n 
9  23  SER n 
9  24  MET n 
9  25  SER n 
9  26  GLY n 
9  27  ARG n 
9  28  SER n 
9  29  ALA n 
9  30  ARG n 
9  31  ARG n 
9  32  ASP n 
9  33  LEU n 
9  34  VAL n 
9  35  ALA n 
9  36  GLY n 
9  37  ILE n 
9  38  SER n 
9  39  LEU n 
9  40  ASN n 
9  41  ALA n 
9  42  PRO n 
9  43  ALA n 
9  44  SER n 
9  45  VAL n 
9  46  ARG n 
9  47  TYR n 
10 1   ALA n 
10 2   LEU n 
10 3   LEU n 
10 4   ARG n 
10 5   GLN n 
10 6   ALA n 
10 7   TYR n 
10 8   SER n 
10 9   ALA n 
10 10  LEU n 
10 11  PHE n 
10 12  ARG n 
10 13  ARG n 
10 14  THR n 
10 15  SER n 
10 16  THR n 
10 17  PHE n 
10 18  ALA n 
10 19  LEU n 
10 20  THR n 
10 21  VAL n 
10 22  VAL n 
10 23  LEU n 
10 24  GLY n 
10 25  ALA n 
10 26  VAL n 
10 27  LEU n 
10 28  PHE n 
10 29  GLU n 
10 30  ARG n 
10 31  ALA n 
10 32  PHE n 
10 33  ASP n 
10 34  GLN n 
10 35  GLY n 
10 36  ALA n 
10 37  ASP n 
10 38  ALA n 
10 39  ILE n 
10 40  PHE n 
10 41  GLU n 
10 42  HIS n 
10 43  LEU n 
10 44  ASN n 
10 45  GLU n 
10 46  GLY n 
10 47  LYS n 
10 48  LEU n 
10 49  TRP n 
10 50  LYS n 
10 51  HIS n 
10 52  ILE n 
10 53  LYS n 
10 54  HIS n 
10 55  LYS n 
10 56  TYR n 
10 57  GLU n 
10 58  ALA n 
10 59  SER n 
10 60  GLU n 
10 61  GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? chicken 'Gallus gallus' 9031 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP CYB_CHICK  P18946 3  
;MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
;
1  ? 
2  UNP UCRI_CHICK Q5ZLR5 5  
;VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
;
77 ? 
3  UNP UCRI_CHICK Q5ZLR5 9  RPLLCRESMSGRSARRDLVAGISLNAPASVRY 45 ? 
4  PDB 3H1J       3H1J   1  
;AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
;
?  ? 
5  PDB 3H1J       3H1J   2  
;SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
;
?  ? 
6  PDB 3H1J       3H1J   4  
;GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
;
?  ? 
7  PDB 3H1J       3H1J   6  
;AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
;
?  ? 
8  PDB 3H1J       3H1J   7  
;GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
;
?  ? 
9  PDB 3H1J       3H1J   8  LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK ?  ? 
10 PDB 3H1J       3H1J   10 ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3H1J C 1  ? 380 ? P18946 1  ? 380 ? 1  380 
2  2  3H1J E 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
3  3  3H1J I 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
4  1  3H1J P 1  ? 380 ? P18946 1  ? 380 ? 1  380 
5  2  3H1J R 1  ? 196 ? Q5ZLR5 77 ? 272 ? 1  196 
6  3  3H1J V 16 ? 47  ? Q5ZLR5 45 ? 76  ? 47 78  
7  4  3H1J A 1  ? 446 ? 3H1J   1  ? 446 ? 1  446 
8  4  3H1J N 1  ? 446 ? 3H1J   1  ? 446 ? 1  446 
9  5  3H1J B 1  ? 441 ? 3H1J   -1 ? 439 ? -1 439 
10 5  3H1J O 1  ? 441 ? 3H1J   -1 ? 439 ? -1 439 
11 6  3H1J D 1  ? 241 ? 3H1J   1  ? 241 ? 1  241 
12 6  3H1J Q 1  ? 241 ? 3H1J   1  ? 241 ? 1  241 
13 7  3H1J F 1  ? 110 ? 3H1J   1  ? 110 ? 1  110 
14 7  3H1J S 1  ? 110 ? 3H1J   1  ? 110 ? 1  110 
15 8  3H1J G 1  ? 81  ? 3H1J   1  ? 81  ? 1  81  
16 8  3H1J T 1  ? 81  ? 3H1J   1  ? 81  ? 1  81  
17 9  3H1J H 1  ? 77  ? 3H1J   2  ? 78  ? 2  78  
18 9  3H1J U 1  ? 77  ? 3H1J   2  ? 78  ? 2  78  
19 10 3H1J J 1  ? 61  ? 3H1J   4  ? 64  ? 4  64  
20 10 3H1J W 1  ? 61  ? 3H1J   4  ? 64  ? 4  64  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ? 'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE                                           ? 'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE                                         ? 'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'         133.103  
CDL non-polymer         . CARDIOLIPIN                                        
;DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-PHOSPHO)-1',3'-SN-GLYCEROL
;
'C81 H156 O17 P2 -2' 1464.043 
CYS 'L-peptide linking' y CYSTEINE                                           ? 'C3 H7 N O2 S'       121.158  
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'                       ? 'Fe2 S2'             175.820  
GLN 'L-peptide linking' y GLUTAMINE                                          ? 'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE                                            ? 'C2 H5 N O2'         75.067   
GOL non-polymer         . GLYCEROL                                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           
92.094   
HEC non-polymer         . 'HEME C'                                           ? 'C34 H34 Fe N4 O4'   618.503  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                  HEME 'C34 H32 Fe N4 O4'   616.487  
HIS 'L-peptide linking' y HISTIDINE                                          ? 'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER                                              ? 'H2 O'               18.015   
ILE 'L-peptide linking' y ISOLEUCINE                                         ? 'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE                                            ? 'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE                                             ? 'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE                                         ? 'C5 H11 N O2 S'      149.211  
PEE non-polymer         . 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine      DOPE 'C41 H83 N O8 P 1'   749.073  
PHE 'L-peptide linking' y PHENYLALANINE                                      ? 'C9 H11 N O2'        165.189  
PLC non-polymer         . 'DIUNDECYL PHOSPHATIDYL CHOLINE'                   ? 'C32 H65 N O8 P 1'   622.834  
PRO 'L-peptide linking' y PROLINE                                            ? 'C5 H9 N O2'         115.130  
SER 'L-peptide linking' y SERINE                                             ? 'C3 H7 N O3'         105.093  
SMA non-polymer         . 'STIGMATELLIN A'                                   ? 'C30 H42 O7'         514.650  
THR 'L-peptide linking' y THREONINE                                          ? 'C4 H9 N O3'         119.119  
TRP 'L-peptide linking' y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE                                           ? 'C9 H11 N O3'        181.189  
UNK 'L-peptide linking' . UNKNOWN                                            ? 'C4 H9 N O2'         103.120  
UNL non-polymer         . 'UNKNOWN LIGAND'                                   ? ?                    ?        
UQ  non-polymer         . 'Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer' ? 'C59 H90 O4'         863.343  
VAL 'L-peptide linking' y VALINE                                             ? 'C5 H11 N O2'        117.146  
# 
_exptl.entry_id          3H1J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.13 
_exptl_crystal.density_percent_sol   70.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.70 
_exptl_crystal_grow.pdbx_details    
;20MM KMES PH 6.7, 75MM NACL, 10% GLYCEROL, AND 6% PEG4000, INHIBITOR WAS ADDED FROM ETHANOLIC SOLUTION, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-10-04 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     3H1J 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42.7 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   141782 
_reflns.number_all                   141782 
_reflns.percent_possible_obs         91.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.184 
_reflns.pdbx_netI_over_sigmaI        11.1 
_reflns.B_iso_Wilson_estimate        76.567 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   31.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.896 
_reflns_shell.meanI_over_sigI_obs    0.972 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2378 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3H1J 
_refine.ls_number_reflns_obs                     141718 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               4094841.58 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.68 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    92.8 
_refine.ls_R_factor_obs                          0.243 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.243 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  2796 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               82.1 
_refine.aniso_B[1][1]                            23.66 
_refine.aniso_B[2][2]                            -18.17 
_refine.aniso_B[3][3]                            -5.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.296397 
_refine.solvent_model_param_bsol                 34.9771 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1bcc' 
_refine.pdbx_method_to_determine_struct          'rigid body refinement' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3H1J 
_refine_analyze.Luzzati_coordinate_error_obs    0.45 
_refine_analyze.Luzzati_sigma_a_obs             0.76 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.51 
_refine_analyze.Luzzati_sigma_a_free            0.76 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31797 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         868 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               32679 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        42.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.92  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.05  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.55  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.50  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   7 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.16 
_refine_ls_shell.number_reflns_R_work             15813 
_refine_ls_shell.R_factor_R_work                  0.385 
_refine_ls_shell.percent_reflns_obs               74.5 
_refine_ls_shell.R_factor_R_free                  0.409 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            1.9 
_refine_ls_shell.number_reflns_R_free             310 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                15813 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param &_1_TOPOLOGY_INFILE_1 'X-RAY DIFFRACTION' 
2 hetero10.par      &_1_TOPOLOGY_INFILE_2 'X-RAY DIFFRACTION' 
3 fnmfmx.par        &_1_TOPOLOGY_INFILE_3 'X-RAY DIFFRACTION' 
4 water.param       &_1_TOPOLOGY_INFILE_4 'X-RAY DIFFRACTION' 
5 prosthw.par       &_1_TOPOLOGY_INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3H1J 
_struct.title                     'Stigmatellin-bound cytochrome bc1 complex from chicken' 
_struct.pdbx_descriptor           
;MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN 2, Cytochrome b, MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN, Cytochrome b-c1 complex subunit Rieske, mitochondrial (E.C.1.10.2.2), MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14 KDA PROTEIN, MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE UBIQUINONE-BINDING PROTEIN QP-C, MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11 KDA PROTEIN, COMPLEX III SUBUNIT VIII, MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 7.2 KDA PROTEIN
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H1J 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEIN, UBIQUINONE, OXIDOREDUCTASE, REDOX ENZYM RESPIRATORY CHAIN, ELECTRON TRANSPORT, HEME, INNER MEMBRANE IRON, MEMBRANE, METAL-BINDING, MITOCHONDRION, TRANSMEMBRANE, stigmatellin, Iron, Mitochondrion inner membrane, Respiratory chain, Transport, Disulfide bond, Iron-sulfur, Transit peptide
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 11 ? 
V  N N 12 ? 
W  N N 12 ? 
X  N N 13 ? 
Y  N N 14 ? 
Z  N N 15 ? 
AA N N 15 ? 
BA N N 11 ? 
CA N N 16 ? 
DA N N 11 ? 
EA N N 11 ? 
FA N N 17 ? 
GA N N 18 ? 
HA N N 19 ? 
IA N N 15 ? 
JA N N 20 ? 
KA N N 11 ? 
LA N N 11 ? 
MA N N 18 ? 
NA N N 15 ? 
OA N N 12 ? 
PA N N 12 ? 
QA N N 11 ? 
RA N N 13 ? 
SA N N 14 ? 
TA N N 18 ? 
UA N N 15 ? 
VA N N 11 ? 
WA N N 16 ? 
XA N N 11 ? 
YA N N 17 ? 
ZA N N 19 ? 
AB N N 11 ? 
BB N N 15 ? 
CB N N 20 ? 
DB N N 18 ? 
EB N N 21 ? 
FB N N 21 ? 
GB N N 21 ? 
HB N N 21 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   THR A 3   ? ILE A 11  ? THR A 3   ILE A 11  1 ? 9  
HELX_P HELX_P2   2   GLY A 54  ? HIS A 61  ? GLY A 54  HIS A 61  1 ? 8  
HELX_P HELX_P3   3   PRO A 71  ? SER A 81  ? PRO A 71  SER A 81  1 ? 11 
HELX_P HELX_P4   4   ASP A 105 ? ASN A 119 ? ASP A 105 ASN A 119 1 ? 15 
HELX_P HELX_P5   5   GLU A 123 ? ASP A 142 ? GLU A 123 ASP A 142 1 ? 20 
HELX_P HELX_P6   6   ASP A 144 ? PHE A 158 ? ASP A 144 PHE A 158 1 ? 15 
HELX_P HELX_P7   7   THR A 161 ? ARG A 165 ? THR A 161 ARG A 165 5 ? 5  
HELX_P HELX_P8   8   THR A 170 ? LEU A 177 ? THR A 170 LEU A 177 1 ? 8  
HELX_P HELX_P9   9   THR A 178 ? PHE A 190 ? THR A 178 PHE A 190 1 ? 13 
HELX_P HELX_P10  10  LYS A 191 ? ARG A 194 ? LYS A 191 ARG A 194 5 ? 4  
HELX_P HELX_P11  11  SER A 204 ? PHE A 216 ? SER A 204 PHE A 216 1 ? 13 
HELX_P HELX_P12  12  THR A 222 ? ALA A 227 ? THR A 222 ALA A 227 1 ? 6  
HELX_P HELX_P13  13  PRO A 265 ? GLY A 278 ? PRO A 265 GLY A 278 1 ? 14 
HELX_P HELX_P14  14  GLY A 286 ? LEU A 290 ? GLY A 286 LEU A 290 5 ? 5  
HELX_P HELX_P15  15  SER A 292 ? LYS A 302 ? SER A 292 LYS A 302 1 ? 11 
HELX_P HELX_P16  16  ASP A 327 ? LEU A 329 ? ASP A 327 LEU A 329 5 ? 3  
HELX_P HELX_P17  17  SER A 330 ? THR A 349 ? SER A 330 THR A 349 1 ? 20 
HELX_P HELX_P18  18  THR A 350 ? GLN A 368 ? THR A 350 GLN A 368 1 ? 19 
HELX_P HELX_P19  19  GLY A 371 ? GLY A 387 ? GLY A 371 GLY A 387 1 ? 17 
HELX_P HELX_P20  20  SER A 391 ? VAL A 402 ? SER A 391 VAL A 402 1 ? 12 
HELX_P HELX_P21  21  ASP A 403 ? ILE A 415 ? ASP A 403 ILE A 415 1 ? 13 
HELX_P HELX_P22  22  ASP A 433 ? SER A 439 ? ASP A 433 SER A 439 1 ? 7  
HELX_P HELX_P23  23  GLY A 440 ? TYR A 442 ? GLY A 440 TYR A 442 5 ? 3  
HELX_P HELX_P24  24  GLY B 56  ? GLU B 60  ? GLY B 54  GLU B 58  5 ? 5  
HELX_P HELX_P25  25  THR B 61  ? LEU B 65  ? THR B 59  LEU B 63  5 ? 5  
HELX_P HELX_P26  26  GLY B 66  ? LEU B 73  ? GLY B 64  LEU B 71  1 ? 8  
HELX_P HELX_P27  27  SER B 83  ? VAL B 94  ? SER B 81  VAL B 92  1 ? 12 
HELX_P HELX_P28  28  HIS B 117 ? ALA B 131 ? HIS B 115 ALA B 129 1 ? 15 
HELX_P HELX_P29  29  ARG B 135 ? GLN B 143 ? ARG B 133 GLN B 141 1 ? 9  
HELX_P HELX_P30  30  GLN B 143 ? PHE B 154 ? GLN B 141 PHE B 152 1 ? 12 
HELX_P HELX_P31  31  SER B 156 ? TYR B 170 ? SER B 154 TYR B 168 1 ? 15 
HELX_P HELX_P32  32  THR B 172 ? ASN B 176 ? THR B 170 ASN B 174 5 ? 5  
HELX_P HELX_P33  33  PRO B 181 ? ILE B 185 ? PRO B 179 ILE B 183 5 ? 5  
HELX_P HELX_P34  34  THR B 189 ? PHE B 201 ? THR B 187 PHE B 199 1 ? 13 
HELX_P HELX_P35  35  LYS B 214 ? LEU B 226 ? LYS B 212 LEU B 224 1 ? 13 
HELX_P HELX_P36  36  SER B 268 ? GLY B 282 ? SER B 266 GLY B 280 1 ? 15 
HELX_P HELX_P37  37  SER B 295 ? LYS B 303 ? SER B 293 LYS B 301 1 ? 9  
HELX_P HELX_P38  38  HIS B 334 ? GLN B 351 ? HIS B 332 GLN B 349 1 ? 18 
HELX_P HELX_P39  39  THR B 355 ? VAL B 374 ? THR B 353 VAL B 372 1 ? 20 
HELX_P HELX_P40  40  THR B 376 ? SER B 391 ? THR B 374 SER B 389 1 ? 16 
HELX_P HELX_P41  41  ALA B 396 ? SER B 406 ? ALA B 394 SER B 404 1 ? 11 
HELX_P HELX_P42  42  THR B 408 ? GLY B 422 ? THR B 406 GLY B 420 1 ? 15 
HELX_P HELX_P43  43  ASP B 431 ? THR B 435 ? ASP B 429 THR B 433 5 ? 5  
HELX_P HELX_P44  44  PHE B 437 ? LEU B 441 ? PHE B 435 LEU B 439 5 ? 5  
HELX_P HELX_P45  45  ASN C 4   ? HIS C 9   ? ASN C 4   HIS C 9   1 ? 6  
HELX_P HELX_P46  46  LEU C 11  ? ILE C 20  ? LEU C 11  ILE C 20  1 ? 10 
HELX_P HELX_P47  47  SER C 29  ? TRP C 32  ? SER C 29  TRP C 32  5 ? 4  
HELX_P HELX_P48  48  ASN C 33  ? MET C 54  ? ASN C 33  MET C 54  1 ? 22 
HELX_P HELX_P49  49  LEU C 62  ? ASN C 73  ? LEU C 62  ASN C 73  1 ? 12 
HELX_P HELX_P50  50  TYR C 76  ? TYR C 105 ? TYR C 76  TYR C 105 1 ? 30 
HELX_P HELX_P51  51  GLY C 106 ? LEU C 109 ? GLY C 106 LEU C 109 5 ? 4  
HELX_P HELX_P52  52  TYR C 110 ? VAL C 133 ? TYR C 110 VAL C 133 1 ? 24 
HELX_P HELX_P53  53  GLY C 137 ? LEU C 150 ? GLY C 137 LEU C 150 1 ? 14 
HELX_P HELX_P54  54  PHE C 151 ? ILE C 154 ? PHE C 151 ILE C 154 5 ? 4  
HELX_P HELX_P55  55  TYR C 156 ? GLY C 167 ? TYR C 156 GLY C 167 1 ? 12 
HELX_P HELX_P56  56  ASP C 172 ? GLY C 205 ? ASP C 172 GLY C 205 1 ? 34 
HELX_P HELX_P57  57  PHE C 221 ? SER C 247 ? PHE C 221 SER C 247 1 ? 27 
HELX_P HELX_P58  58  ASP C 253 ? THR C 258 ? ASP C 253 THR C 258 5 ? 6  
HELX_P HELX_P59  59  GLU C 272 ? TYR C 274 ? GLU C 272 TYR C 274 5 ? 3  
HELX_P HELX_P60  60  PHE C 275 ? ILE C 285 ? PHE C 275 ILE C 285 1 ? 11 
HELX_P HELX_P61  61  ASN C 287 ? ILE C 301 ? ASN C 287 ILE C 301 1 ? 15 
HELX_P HELX_P62  62  LEU C 302 ? HIS C 309 ? LEU C 302 HIS C 309 5 ? 8  
HELX_P HELX_P63  63  ARG C 319 ? GLN C 342 ? ARG C 319 GLN C 342 1 ? 24 
HELX_P HELX_P64  64  PRO C 347 ? ILE C 365 ? PRO C 347 ILE C 365 1 ? 19 
HELX_P HELX_P65  65  ILE C 365 ? LEU C 378 ? ILE C 365 LEU C 378 1 ? 14 
HELX_P HELX_P66  66  ASP D 22  ? VAL D 36  ? ASP D 22  VAL D 36  1 ? 15 
HELX_P HELX_P67  67  CYS D 37  ? CYS D 40  ? CYS D 37  CYS D 40  5 ? 4  
HELX_P HELX_P68  68  ALA D 47  ? ILE D 52  ? ALA D 47  ILE D 52  1 ? 6  
HELX_P HELX_P69  69  THR D 57  ? GLU D 67  ? THR D 57  GLU D 67  1 ? 11 
HELX_P HELX_P70  70  ASN D 97  ? ALA D 104 ? ASN D 97  ALA D 104 1 ? 8  
HELX_P HELX_P71  71  TYR D 115 ? ALA D 119 ? TYR D 115 ALA D 119 5 ? 5  
HELX_P HELX_P72  72  GLY D 122 ? GLY D 133 ? GLY D 122 GLY D 133 1 ? 12 
HELX_P HELX_P73  73  THR D 178 ? GLU D 195 ? THR D 178 GLU D 195 1 ? 18 
HELX_P HELX_P74  74  GLU D 197 ? SER D 232 ? GLU D 197 SER D 232 1 ? 36 
HELX_P HELX_P75  75  VAL E 1   ? VAL E 5   ? VAL E 1   VAL E 5   5 ? 5  
HELX_P HELX_P76  76  ARG E 15  ? MET E 19  ? ARG E 15  MET E 19  5 ? 5  
HELX_P HELX_P77  77  SER E 25  ? SER E 61  ? SER E 25  SER E 61  1 ? 37 
HELX_P HELX_P78  78  THR E 102 ? GLU E 109 ? THR E 102 GLU E 109 1 ? 8  
HELX_P HELX_P79  79  HIS E 122 ? VAL E 127 ? HIS E 122 VAL E 127 1 ? 6  
HELX_P HELX_P80  80  ARG F 11  ? GLY F 25  ? ARG F 11  GLY F 25  1 ? 15 
HELX_P HELX_P81  81  PHE F 26  ? GLY F 30  ? PHE F 26  GLY F 30  5 ? 5  
HELX_P HELX_P82  82  MET F 32  ? LEU F 37  ? MET F 32  LEU F 37  5 ? 6  
HELX_P HELX_P83  83  ASP F 40  ? LEU F 50  ? ASP F 40  LEU F 50  1 ? 11 
HELX_P HELX_P84  84  PRO F 51  ? HIS F 72  ? PRO F 51  HIS F 72  1 ? 22 
HELX_P HELX_P85  85  PRO F 76  ? TRP F 80  ? PRO F 76  TRP F 80  5 ? 5  
HELX_P HELX_P86  86  LYS F 82  ? ASP F 86  ? LYS F 82  ASP F 86  5 ? 5  
HELX_P HELX_P87  87  LEU F 90  ? LYS F 110 ? LEU F 90  LYS F 110 1 ? 21 
HELX_P HELX_P88  88  ASP G 32  ? LEU G 69  ? ASP G 32  LEU G 69  1 ? 38 
HELX_P HELX_P89  89  ASN G 73  ? TYR G 77  ? ASN G 73  TYR G 77  5 ? 5  
HELX_P HELX_P90  90  ASP H 14  ? GLN H 25  ? ASP H 15  GLN H 26  1 ? 12 
HELX_P HELX_P91  91  THR H 26  ? ARG H 46  ? THR H 27  ARG H 47  1 ? 21 
HELX_P HELX_P92  92  CYS H 53  ? ALA H 69  ? CYS H 54  ALA H 70  1 ? 17 
HELX_P HELX_P93  93  LYS H 71  ? LEU H 76  ? LYS H 72  LEU H 77  1 ? 6  
HELX_P HELX_P94  94  CYS I 20  ? SER I 25  ? CYS I 51  SER I 56  1 ? 6  
HELX_P HELX_P95  95  ALA J 1   ? LEU J 10  ? ALA J 4   LEU J 13  1 ? 10 
HELX_P HELX_P96  96  ARG J 13  ? ASN J 44  ? ARG J 16  ASN J 47  1 ? 32 
HELX_P HELX_P97  97  LEU J 48  ? LYS J 53  ? LEU J 51  LYS J 56  1 ? 6  
HELX_P HELX_P98  98  HIS J 54  ? TYR J 56  ? HIS J 57  TYR J 59  5 ? 3  
HELX_P HELX_P99  99  THR K 3   ? ILE K 11  ? THR N 3   ILE N 11  1 ? 9  
HELX_P HELX_P100 100 GLY K 54  ? HIS K 61  ? GLY N 54  HIS N 61  1 ? 8  
HELX_P HELX_P101 101 PRO K 71  ? SER K 81  ? PRO N 71  SER N 81  1 ? 11 
HELX_P HELX_P102 102 ASP K 105 ? ASN K 119 ? ASP N 105 ASN N 119 1 ? 15 
HELX_P HELX_P103 103 GLU K 123 ? ASP K 142 ? GLU N 123 ASP N 142 1 ? 20 
HELX_P HELX_P104 104 ASP K 144 ? PHE K 158 ? ASP N 144 PHE N 158 1 ? 15 
HELX_P HELX_P105 105 THR K 161 ? ARG K 165 ? THR N 161 ARG N 165 5 ? 5  
HELX_P HELX_P106 106 THR K 170 ? LEU K 177 ? THR N 170 LEU N 177 1 ? 8  
HELX_P HELX_P107 107 THR K 178 ? PHE K 190 ? THR N 178 PHE N 190 1 ? 13 
HELX_P HELX_P108 108 LYS K 191 ? ARG K 194 ? LYS N 191 ARG N 194 5 ? 4  
HELX_P HELX_P109 109 SER K 204 ? PHE K 216 ? SER N 204 PHE N 216 1 ? 13 
HELX_P HELX_P110 110 THR K 222 ? ALA K 227 ? THR N 222 ALA N 227 5 ? 6  
HELX_P HELX_P111 111 PRO K 265 ? GLY K 278 ? PRO N 265 GLY N 278 1 ? 14 
HELX_P HELX_P112 112 GLY K 286 ? LEU K 290 ? GLY N 286 LEU N 290 5 ? 5  
HELX_P HELX_P113 113 SER K 292 ? LYS K 302 ? SER N 292 LYS N 302 1 ? 11 
HELX_P HELX_P114 114 ASP K 327 ? LEU K 329 ? ASP N 327 LEU N 329 5 ? 3  
HELX_P HELX_P115 115 SER K 330 ? THR K 349 ? SER N 330 THR N 349 1 ? 20 
HELX_P HELX_P116 116 THR K 350 ? GLN K 368 ? THR N 350 GLN N 368 1 ? 19 
HELX_P HELX_P117 117 GLY K 371 ? GLY K 387 ? GLY N 371 GLY N 387 1 ? 17 
HELX_P HELX_P118 118 SER K 391 ? VAL K 402 ? SER N 391 VAL N 402 1 ? 12 
HELX_P HELX_P119 119 ASP K 403 ? ILE K 415 ? ASP N 403 ILE N 415 1 ? 13 
HELX_P HELX_P120 120 ASP K 433 ? SER K 439 ? ASP N 433 SER N 439 1 ? 7  
HELX_P HELX_P121 121 GLY K 440 ? TYR K 442 ? GLY N 440 TYR N 442 5 ? 3  
HELX_P HELX_P122 122 GLY L 56  ? GLU L 60  ? GLY O 54  GLU O 58  5 ? 5  
HELX_P HELX_P123 123 THR L 61  ? LEU L 65  ? THR O 59  LEU O 63  5 ? 5  
HELX_P HELX_P124 124 GLY L 66  ? LEU L 73  ? GLY O 64  LEU O 71  1 ? 8  
HELX_P HELX_P125 125 SER L 83  ? VAL L 94  ? SER O 81  VAL O 92  1 ? 12 
HELX_P HELX_P126 126 HIS L 117 ? ALA L 131 ? HIS O 115 ALA O 129 1 ? 15 
HELX_P HELX_P127 127 ARG L 135 ? GLN L 143 ? ARG O 133 GLN O 141 1 ? 9  
HELX_P HELX_P128 128 GLN L 143 ? PHE L 154 ? GLN O 141 PHE O 152 1 ? 12 
HELX_P HELX_P129 129 SER L 156 ? TYR L 170 ? SER O 154 TYR O 168 1 ? 15 
HELX_P HELX_P130 130 THR L 172 ? ASN L 176 ? THR O 170 ASN O 174 5 ? 5  
HELX_P HELX_P131 131 PRO L 181 ? ILE L 185 ? PRO O 179 ILE O 183 5 ? 5  
HELX_P HELX_P132 132 THR L 189 ? PHE L 201 ? THR O 187 PHE O 199 1 ? 13 
HELX_P HELX_P133 133 THR L 202 ? ALA L 204 ? THR O 200 ALA O 202 5 ? 3  
HELX_P HELX_P134 134 LYS L 214 ? LEU L 226 ? LYS O 212 LEU O 224 1 ? 13 
HELX_P HELX_P135 135 SER L 268 ? GLY L 282 ? SER O 266 GLY O 280 1 ? 15 
HELX_P HELX_P136 136 SER L 295 ? LYS L 303 ? SER O 293 LYS O 301 1 ? 9  
HELX_P HELX_P137 137 HIS L 334 ? GLN L 351 ? HIS O 332 GLN O 349 1 ? 18 
HELX_P HELX_P138 138 THR L 355 ? VAL L 374 ? THR O 353 VAL O 372 1 ? 20 
HELX_P HELX_P139 139 THR L 376 ? SER L 391 ? THR O 374 SER O 389 1 ? 16 
HELX_P HELX_P140 140 ALA L 396 ? SER L 406 ? ALA O 394 SER O 404 1 ? 11 
HELX_P HELX_P141 141 THR L 408 ? GLY L 422 ? THR O 406 GLY O 420 1 ? 15 
HELX_P HELX_P142 142 ASP L 431 ? THR L 435 ? ASP O 429 THR O 433 5 ? 5  
HELX_P HELX_P143 143 ASN M 4   ? HIS M 9   ? ASN P 4   HIS P 9   1 ? 6  
HELX_P HELX_P144 144 LEU M 11  ? ILE M 20  ? LEU P 11  ILE P 20  1 ? 10 
HELX_P HELX_P145 145 SER M 29  ? TRP M 32  ? SER P 29  TRP P 32  5 ? 4  
HELX_P HELX_P146 146 ASN M 33  ? MET M 54  ? ASN P 33  MET P 54  1 ? 22 
HELX_P HELX_P147 147 LEU M 62  ? ASN M 73  ? LEU P 62  ASN P 73  1 ? 12 
HELX_P HELX_P148 148 TYR M 76  ? TYR M 105 ? TYR P 76  TYR P 105 1 ? 30 
HELX_P HELX_P149 149 GLY M 106 ? LEU M 109 ? GLY P 106 LEU P 109 5 ? 4  
HELX_P HELX_P150 150 TYR M 110 ? LEU M 134 ? TYR P 110 LEU P 134 1 ? 25 
HELX_P HELX_P151 151 GLY M 137 ? LEU M 150 ? GLY P 137 LEU P 150 1 ? 14 
HELX_P HELX_P152 152 PHE M 151 ? ILE M 154 ? PHE P 151 ILE P 154 5 ? 4  
HELX_P HELX_P153 153 GLY M 158 ? GLY M 167 ? GLY P 158 GLY P 167 1 ? 10 
HELX_P HELX_P154 154 ASP M 172 ? GLY M 205 ? ASP P 172 GLY P 205 1 ? 34 
HELX_P HELX_P155 155 PHE M 221 ? SER M 247 ? PHE P 221 SER P 247 1 ? 27 
HELX_P HELX_P156 156 ASP M 253 ? THR M 258 ? ASP P 253 THR P 258 5 ? 6  
HELX_P HELX_P157 157 GLU M 272 ? TYR M 274 ? GLU P 272 TYR P 274 5 ? 3  
HELX_P HELX_P158 158 PHE M 275 ? ILE M 285 ? PHE P 275 ILE P 285 1 ? 11 
HELX_P HELX_P159 159 ASN M 287 ? ILE M 301 ? ASN P 287 ILE P 301 1 ? 15 
HELX_P HELX_P160 160 LEU M 302 ? HIS M 309 ? LEU P 302 HIS P 309 5 ? 8  
HELX_P HELX_P161 161 ARG M 319 ? SER M 341 ? ARG P 319 SER P 341 1 ? 23 
HELX_P HELX_P162 162 PRO M 347 ? ILE M 365 ? PRO P 347 ILE P 365 1 ? 19 
HELX_P HELX_P163 163 ILE M 365 ? LEU M 378 ? ILE P 365 LEU P 378 1 ? 14 
HELX_P HELX_P164 164 ASP N 22  ? VAL N 36  ? ASP Q 22  VAL Q 36  1 ? 15 
HELX_P HELX_P165 165 CYS N 37  ? CYS N 40  ? CYS Q 37  CYS Q 40  5 ? 4  
HELX_P HELX_P166 166 ALA N 47  ? ILE N 52  ? ALA Q 47  ILE Q 52  1 ? 6  
HELX_P HELX_P167 167 THR N 57  ? GLU N 67  ? THR Q 57  GLU Q 67  1 ? 11 
HELX_P HELX_P168 168 ASN N 97  ? ALA N 104 ? ASN Q 97  ALA Q 104 1 ? 8  
HELX_P HELX_P169 169 TYR N 115 ? ARG N 120 ? TYR Q 115 ARG Q 120 1 ? 6  
HELX_P HELX_P170 170 GLY N 122 ? GLY N 133 ? GLY Q 122 GLY Q 133 1 ? 12 
HELX_P HELX_P171 171 THR N 178 ? GLU N 195 ? THR Q 178 GLU Q 195 1 ? 18 
HELX_P HELX_P172 172 GLU N 197 ? SER N 232 ? GLU Q 197 SER Q 232 1 ? 36 
HELX_P HELX_P173 173 VAL O 1   ? VAL O 5   ? VAL R 1   VAL R 5   5 ? 5  
HELX_P HELX_P174 174 ARG O 15  ? MET O 19  ? ARG R 15  MET R 19  5 ? 5  
HELX_P HELX_P175 175 SER O 25  ? SER O 61  ? SER R 25  SER R 61  1 ? 37 
HELX_P HELX_P176 176 THR O 102 ? GLU O 109 ? THR R 102 GLU R 109 1 ? 8  
HELX_P HELX_P177 177 HIS O 122 ? VAL O 127 ? HIS R 122 VAL R 127 1 ? 6  
HELX_P HELX_P178 178 GLY P 10  ? GLY P 25  ? GLY S 10  GLY S 25  1 ? 16 
HELX_P HELX_P179 179 PHE P 26  ? GLY P 30  ? PHE S 26  GLY S 30  5 ? 5  
HELX_P HELX_P180 180 MET P 32  ? LEU P 37  ? MET S 32  LEU S 37  5 ? 6  
HELX_P HELX_P181 181 ASP P 40  ? LEU P 50  ? ASP S 40  LEU S 50  1 ? 11 
HELX_P HELX_P182 182 PRO P 51  ? HIS P 72  ? PRO S 51  HIS S 72  1 ? 22 
HELX_P HELX_P183 183 PRO P 76  ? TRP P 80  ? PRO S 76  TRP S 80  5 ? 5  
HELX_P HELX_P184 184 LYS P 82  ? ASP P 86  ? LYS S 82  ASP S 86  5 ? 5  
HELX_P HELX_P185 185 LEU P 90  ? LYS P 110 ? LEU S 90  LYS S 110 1 ? 21 
HELX_P HELX_P186 186 ASP Q 32  ? LEU Q 69  ? ASP T 32  LEU T 69  1 ? 38 
HELX_P HELX_P187 187 ASN Q 73  ? TYR Q 77  ? ASN T 73  TYR T 77  5 ? 5  
HELX_P HELX_P188 188 ASP R 14  ? THR R 26  ? ASP U 15  THR U 27  1 ? 13 
HELX_P HELX_P189 189 THR R 26  ? ARG R 46  ? THR U 27  ARG U 47  1 ? 21 
HELX_P HELX_P190 190 CYS R 53  ? ALA R 69  ? CYS U 54  ALA U 70  1 ? 17 
HELX_P HELX_P191 191 LYS R 71  ? LEU R 76  ? LYS U 72  LEU U 77  1 ? 6  
HELX_P HELX_P192 192 CYS S 20  ? MET S 24  ? CYS V 51  MET V 55  5 ? 5  
HELX_P HELX_P193 193 ALA T 1   ? LEU T 10  ? ALA W 4   LEU W 13  1 ? 10 
HELX_P HELX_P194 194 ARG T 13  ? ASN T 44  ? ARG W 16  ASN W 47  1 ? 32 
HELX_P HELX_P195 195 LEU T 48  ? LYS T 53  ? LEU W 51  LYS W 56  1 ? 6  
HELX_P HELX_P196 196 HIS T 54  ? TYR T 56  ? HIS W 57  TYR W 59  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 144 SG  ? ? ? 1_555 E  CYS 160 SG  ? ? E CYS 144 E CYS 160 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2  disulf ? ? H CYS 23  SG  ? ? ? 1_555 H  CYS 67  SG  ? ? H CYS 24  H CYS 68  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf3  disulf ? ? H CYS 39  SG  ? ? ? 1_555 H  CYS 53  SG  ? ? H CYS 40  H CYS 54  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4  disulf ? ? O CYS 144 SG  ? ? ? 1_555 O  CYS 160 SG  ? ? R CYS 144 R CYS 160 1_555 ? ? ? ? ? ? ? 2.017 ? 
disulf5  disulf ? ? R CYS 23  SG  ? ? ? 1_555 R  CYS 67  SG  ? ? U CYS 24  U CYS 68  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf6  disulf ? ? R CYS 39  SG  ? ? ? 1_555 R  CYS 53  SG  ? ? U CYS 40  U CYS 54  1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc1  metalc ? ? C HIS 84  NE2 ? ? ? 1_555 V  HEM .   FE  ? ? C HIS 84  C HEM 501 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc2  metalc ? ? C HIS 98  NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 98  C HEM 502 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc3  metalc ? ? C HIS 183 NE2 ? ? ? 1_555 V  HEM .   FE  ? ? C HIS 183 C HEM 501 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc4  metalc ? ? C HIS 197 NE2 ? ? ? 1_555 W  HEM .   FE  ? ? C HIS 197 C HEM 502 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc5  metalc ? ? D HIS 41  NE2 ? ? ? 1_555 FA HEC .   FE  ? ? D HIS 41  D HEC 501 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc6  metalc ? ? D MET 160 SD  ? ? ? 1_555 FA HEC .   FE  ? ? D MET 160 D HEC 501 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc7  metalc ? ? E CYS 139 SG  ? ? ? 1_555 HA FES .   FE1 ? ? E CYS 139 E FES 501 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc8  metalc ? ? E HIS 141 ND1 ? ? ? 1_555 HA FES .   FE2 ? ? E HIS 141 E FES 501 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc9  metalc ? ? E CYS 158 SG  ? ? ? 1_555 HA FES .   FE1 ? ? E CYS 158 E FES 501 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc10 metalc ? ? E HIS 161 ND1 ? ? ? 1_555 HA FES .   FE2 ? ? E HIS 161 E FES 501 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc11 metalc ? ? M HIS 84  NE2 ? ? ? 1_555 OA HEM .   FE  ? ? P HIS 84  P HEM 501 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc12 metalc ? ? M HIS 98  NE2 ? ? ? 1_555 PA HEM .   FE  ? ? P HIS 98  P HEM 502 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc13 metalc ? ? M HIS 183 NE2 ? ? ? 1_555 OA HEM .   FE  ? ? P HIS 183 P HEM 501 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc14 metalc ? ? M HIS 197 NE2 ? ? ? 1_555 PA HEM .   FE  ? ? P HIS 197 P HEM 502 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc15 metalc ? ? N HIS 41  NE2 ? ? ? 1_555 YA HEC .   FE  ? ? Q HIS 41  Q HEC 501 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc16 metalc ? ? N MET 160 SD  ? ? ? 1_555 YA HEC .   FE  ? ? Q MET 160 Q HEC 501 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc17 metalc ? ? O CYS 139 SG  ? ? ? 1_555 ZA FES .   FE1 ? ? R CYS 139 R FES 501 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc18 metalc ? ? O HIS 141 ND1 ? ? ? 1_555 ZA FES .   FE2 ? ? R HIS 141 R FES 501 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc19 metalc ? ? O CYS 158 SG  ? ? ? 1_555 ZA FES .   FE1 ? ? R CYS 158 R FES 501 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc20 metalc ? ? O HIS 161 ND1 ? ? ? 1_555 ZA FES .   FE2 ? ? R HIS 161 R FES 501 1_555 ? ? ? ? ? ? ? 2.117 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 222 C . ? HIS 222 C PRO 223 C ? PRO 223 C 1 0.16  
2 HIS 346 C . ? HIS 346 C PRO 347 C ? PRO 347 C 1 -0.06 
3 GLY 73  D . ? GLY 73  D PRO 74  D ? PRO 74  D 1 -0.08 
4 ALA 2   M . ? ALA 2   P PRO 3   M ? PRO 3   P 1 -0.16 
5 HIS 222 M . ? HIS 222 P PRO 223 M ? PRO 223 P 1 -0.01 
6 HIS 346 M . ? HIS 346 P PRO 347 M ? PRO 347 P 1 -0.05 
7 GLY 73  N . ? GLY 73  Q PRO 74  N ? PRO 74  Q 1 -0.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 6 ? 
D ? 8 ? 
E ? 5 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 3 ? 
J ? 3 ? 
K ? 4 ? 
L ? 6 ? 
M ? 8 ? 
N ? 6 ? 
O ? 8 ? 
P ? 5 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 2 ? 
T ? 3 ? 
U ? 3 ? 
V ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? parallel      
M 6 7 ? anti-parallel 
M 7 8 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? parallel      
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? parallel      
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
O 6 7 ? anti-parallel 
O 7 8 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 15  ? THR A 18  ? ASN A 15  THR A 18  
A 2 ARG A 24  ? GLU A 29  ? ARG A 24  GLU A 29  
A 3 VAL A 196 ? GLY A 201 ? VAL A 196 GLY A 201 
A 4 THR A 34  ? ILE A 41  ? THR A 34  ILE A 41  
A 5 THR A 95  ? LEU A 102 ? THR A 95  LEU A 102 
A 6 HIS A 85  ? THR A 90  ? HIS A 85  THR A 90  
B 1 ARG A 279 ? ASP A 281 ? ARG A 279 ASP A 281 
B 2 SER A 306 ? SER A 313 ? SER A 306 SER A 313 
B 3 GLY A 318 ? ALA A 326 ? GLY A 318 ALA A 326 
B 4 ALA A 251 ? GLU A 258 ? ALA A 251 GLU A 258 
B 5 ALA A 421 ? GLY A 426 ? ALA A 421 GLY A 426 
B 6 SER A 239 ? ASP A 245 ? SER A 239 ASP A 245 
B 7 ARG G 11  ? LEU G 18  ? ARG G 11  LEU G 18  
B 8 LYS D 234 ? TYR D 237 ? LYS D 234 TYR D 237 
C 1 ILE B 28  ? THR B 29  ? ILE B 26  THR B 27  
C 2 ILE B 36  ? ALA B 38  ? ILE B 34  ALA B 36  
C 3 MET B 206 ? VAL B 209 ? MET B 204 VAL B 207 
C 4 GLY B 50  ? ILE B 53  ? GLY B 48  ILE B 51  
C 5 LYS B 106 ? LEU B 114 ? LYS B 104 LEU B 112 
C 6 ALA B 46  ? SER B 47  ? ALA B 44  SER B 45  
D 1 ILE B 28  ? THR B 29  ? ILE B 26  THR B 27  
D 2 ILE B 36  ? ALA B 38  ? ILE B 34  ALA B 36  
D 3 MET B 206 ? VAL B 209 ? MET B 204 VAL B 207 
D 4 GLY B 50  ? ILE B 53  ? GLY B 48  ILE B 51  
D 5 LYS B 106 ? LEU B 114 ? LYS B 104 LEU B 112 
D 6 SER B 97  ? THR B 103 ? SER B 95  THR B 101 
D 7 ALA I 35  ? SER I 38  ? ALA I 66  SER I 69  
D 8 SER I 44  ? VAL I 45  ? SER I 75  VAL I 76  
E 1 GLU B 245 ? GLN B 249 ? GLU B 243 GLN B 247 
E 2 LYS B 424 ? GLY B 430 ? LYS B 422 GLY B 428 
E 3 LEU B 254 ? GLU B 262 ? LEU B 252 GLU B 260 
E 4 SER B 321 ? GLN B 331 ? SER B 319 GLN B 329 
E 5 PHE B 309 ? TYR B 318 ? PHE B 307 TYR B 316 
F 1 PRO C 23  ? PRO C 25  ? PRO C 23  PRO C 25  
F 2 LYS C 218 ? PRO C 220 ? LYS C 218 PRO C 220 
G 1 VAL D 70  ? ASP D 72  ? VAL D 70  ASP D 72  
G 2 PHE D 81  ? ARG D 83  ? PHE D 81  ARG D 83  
H 1 HIS D 148 ? TYR D 149 ? HIS D 148 TYR D 149 
H 2 ALA D 157 ? ILE D 158 ? ALA D 157 ILE D 158 
I 1 ILE E 74  ? ILE E 76  ? ILE E 74  ILE E 76  
I 2 VAL E 193 ? VAL E 195 ? VAL E 193 VAL E 195 
I 3 TYR E 185 ? GLN E 186 ? TYR E 185 GLN E 186 
J 1 LYS E 85  ? ALA E 88  ? LYS E 85  ALA E 88  
J 2 PHE E 97  ? HIS E 100 ? PHE E 97  HIS E 100 
J 3 TRP E 132 ? LEU E 135 ? TRP E 132 LEU E 135 
K 1 ILE E 147 ? ALA E 148 ? ILE E 147 ALA E 148 
K 2 TYR E 156 ? CYS E 158 ? TYR E 156 CYS E 158 
K 3 SER E 163 ? TYR E 165 ? SER E 163 TYR E 165 
K 4 ILE E 171 ? LYS E 173 ? ILE E 171 LYS E 173 
L 1 ASN K 15  ? THR K 18  ? ASN N 15  THR N 18  
L 2 ARG K 24  ? GLU K 29  ? ARG N 24  GLU N 29  
L 3 VAL K 196 ? GLY K 201 ? VAL N 196 GLY N 201 
L 4 THR K 34  ? ILE K 41  ? THR N 34  ILE N 41  
L 5 THR K 95  ? LEU K 102 ? THR N 95  LEU N 102 
L 6 HIS K 85  ? THR K 90  ? HIS N 85  THR N 90  
M 1 ARG K 279 ? ASP K 281 ? ARG N 279 ASP N 281 
M 2 SER K 306 ? SER K 313 ? SER N 306 SER N 313 
M 3 GLY K 318 ? ALA K 326 ? GLY N 318 ALA N 326 
M 4 ALA K 251 ? GLU K 258 ? ALA N 251 GLU N 258 
M 5 ALA K 421 ? GLY K 426 ? ALA N 421 GLY N 426 
M 6 SER K 239 ? ASP K 245 ? SER N 239 ASP N 245 
M 7 ARG Q 11  ? LEU Q 18  ? ARG T 11  LEU T 18  
M 8 LYS N 234 ? TYR N 237 ? LYS Q 234 TYR Q 237 
N 1 ILE L 28  ? LYS L 30  ? ILE O 26  LYS O 28  
N 2 ILE L 36  ? ALA L 38  ? ILE O 34  ALA O 36  
N 3 MET L 206 ? VAL L 209 ? MET O 204 VAL O 207 
N 4 GLY L 50  ? ILE L 53  ? GLY O 48  ILE O 51  
N 5 LYS L 106 ? LEU L 114 ? LYS O 104 LEU O 112 
N 6 ALA L 46  ? SER L 47  ? ALA O 44  SER O 45  
O 1 ILE L 28  ? LYS L 30  ? ILE O 26  LYS O 28  
O 2 ILE L 36  ? ALA L 38  ? ILE O 34  ALA O 36  
O 3 MET L 206 ? VAL L 209 ? MET O 204 VAL O 207 
O 4 GLY L 50  ? ILE L 53  ? GLY O 48  ILE O 51  
O 5 LYS L 106 ? LEU L 114 ? LYS O 104 LEU O 112 
O 6 SER L 97  ? THR L 103 ? SER O 95  THR O 101 
O 7 VAL S 34  ? SER S 38  ? VAL V 65  SER V 69  
O 8 SER S 44  ? ARG S 46  ? SER V 75  ARG V 77  
P 1 GLU L 245 ? GLN L 249 ? GLU O 243 GLN O 247 
P 2 LYS L 424 ? GLY L 430 ? LYS O 422 GLY O 428 
P 3 LEU L 254 ? GLU L 262 ? LEU O 252 GLU O 260 
P 4 SER L 321 ? GLN L 331 ? SER O 319 GLN O 329 
P 5 PHE L 309 ? TYR L 318 ? PHE O 307 TYR O 316 
Q 1 PRO M 23  ? PRO M 25  ? PRO P 23  PRO P 25  
Q 2 LYS M 218 ? PRO M 220 ? LYS P 218 PRO P 220 
R 1 VAL N 70  ? ASP N 72  ? VAL Q 70  ASP Q 72  
R 2 PHE N 81  ? ARG N 83  ? PHE Q 81  ARG Q 83  
S 1 HIS N 148 ? TYR N 149 ? HIS Q 148 TYR Q 149 
S 2 ALA N 157 ? ILE N 158 ? ALA Q 157 ILE Q 158 
T 1 ILE O 74  ? ILE O 76  ? ILE R 74  ILE R 76  
T 2 VAL O 193 ? VAL O 195 ? VAL R 193 VAL R 195 
T 3 TYR O 185 ? GLN O 186 ? TYR R 185 GLN R 186 
U 1 LYS O 85  ? ALA O 88  ? LYS R 85  ALA R 88  
U 2 PHE O 97  ? HIS O 100 ? PHE R 97  HIS R 100 
U 3 TRP O 132 ? LEU O 135 ? TRP R 132 LEU R 135 
V 1 ILE O 147 ? ALA O 148 ? ILE R 147 ALA R 148 
V 2 GLY O 154 ? CYS O 158 ? GLY R 154 CYS R 158 
V 3 SER O 163 ? ASP O 166 ? SER R 163 ASP R 166 
V 4 ILE O 171 ? LYS O 173 ? ILE R 171 LYS R 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 17  ? N THR A 17  O VAL A 25  ? O VAL A 25  
A 2 3 N ALA A 26  ? N ALA A 26  O LEU A 197 ? O LEU A 197 
A 3 4 O ALA A 198 ? O ALA A 198 N GLY A 38  ? N GLY A 38  
A 4 5 N VAL A 37  ? N VAL A 37  O ILE A 99  ? O ILE A 99  
A 5 6 O ALA A 96  ? O ALA A 96  N TYR A 89  ? N TYR A 89  
B 1 2 N TYR A 280 ? N TYR A 280 O PHE A 307 ? O PHE A 307 
B 2 3 N THR A 312 ? N THR A 312 O LEU A 319 ? O LEU A 319 
B 3 4 O PHE A 320 ? O PHE A 320 N VAL A 257 ? N VAL A 257 
B 4 5 N ALA A 256 ? N ALA A 256 O ALA A 421 ? O ALA A 421 
B 5 6 O ALA A 424 ? O ALA A 424 N ALA A 243 ? N ALA A 243 
B 6 7 N GLU A 240 ? N GLU A 240 O SER G 17  ? O SER G 17  
B 7 8 O TYR G 16  ? O TYR G 16  N LYS D 234 ? N LYS D 234 
C 1 2 N THR B 29  ? N THR B 27  O ILE B 37  ? O ILE B 35  
C 2 3 N ILE B 36  ? N ILE B 34  O LEU B 208 ? O LEU B 206 
C 3 4 O ALA B 207 ? O ALA B 205 N PHE B 52  ? N PHE B 50  
C 4 5 N ILE B 53  ? N ILE B 51  O MET B 107 ? O MET B 105 
C 5 6 O CYS B 113 ? O CYS B 111 N SER B 47  ? N SER B 45  
D 1 2 N THR B 29  ? N THR B 27  O ILE B 37  ? O ILE B 35  
D 2 3 N ILE B 36  ? N ILE B 34  O LEU B 208 ? O LEU B 206 
D 3 4 O ALA B 207 ? O ALA B 205 N PHE B 52  ? N PHE B 50  
D 4 5 N ILE B 53  ? N ILE B 51  O MET B 107 ? O MET B 105 
D 5 6 O THR B 108 ? O THR B 106 N TYR B 101 ? N TYR B 99  
D 6 7 N VAL B 100 ? N VAL B 98  O ILE I 37  ? O ILE I 68  
D 7 8 N GLY I 36  ? N GLY I 67  O SER I 44  ? O SER I 75  
E 1 2 N ILE B 246 ? N ILE B 244 O MET B 426 ? O MET B 424 
E 2 3 O SER B 425 ? O SER B 423 N VAL B 260 ? N VAL B 258 
E 3 4 N VAL B 255 ? N VAL B 253 O SER B 330 ? O SER B 328 
E 4 5 O ILE B 329 ? O ILE B 327 N ASP B 310 ? N ASP B 308 
F 1 2 N ALA C 24  ? N ALA C 24  O ILE C 219 ? O ILE C 219 
G 1 2 N VAL D 70  ? N VAL D 70  O ARG D 83  ? O ARG D 83  
H 1 2 N HIS D 148 ? N HIS D 148 O ILE D 158 ? O ILE D 158 
I 1 2 N ILE E 76  ? N ILE E 76  O VAL E 193 ? O VAL E 193 
I 2 3 O VAL E 194 ? O VAL E 194 N GLN E 186 ? N GLN E 186 
J 1 2 N LYS E 85  ? N LYS E 85  O HIS E 100 ? O HIS E 100 
J 2 3 N PHE E 97  ? N PHE E 97  O LEU E 135 ? O LEU E 135 
K 1 2 N ILE E 147 ? N ILE E 147 O TYR E 157 ? O TYR E 157 
K 2 3 N TYR E 156 ? N TYR E 156 O TYR E 165 ? O TYR E 165 
K 3 4 N HIS E 164 ? N HIS E 164 O LYS E 173 ? O LYS E 173 
L 1 2 N THR K 17  ? N THR N 17  O VAL K 25  ? O VAL N 25  
L 2 3 N ALA K 26  ? N ALA N 26  O LEU K 197 ? O LEU N 197 
L 3 4 O ALA K 198 ? O ALA N 198 N GLY K 38  ? N GLY N 38  
L 4 5 N VAL K 37  ? N VAL N 37  O ILE K 99  ? O ILE N 99  
L 5 6 O ALA K 96  ? O ALA N 96  N TYR K 89  ? N TYR N 89  
M 1 2 N TYR K 280 ? N TYR N 280 O PHE K 307 ? O PHE N 307 
M 2 3 N THR K 312 ? N THR N 312 O LEU K 319 ? O LEU N 319 
M 3 4 O PHE K 320 ? O PHE N 320 N VAL K 257 ? N VAL N 257 
M 4 5 N ALA K 256 ? N ALA N 256 O ALA K 421 ? O ALA N 421 
M 5 6 O LEU K 422 ? O LEU N 422 N SER K 239 ? N SER N 239 
M 6 7 N ARG K 242 ? N ARG N 242 O THR Q 15  ? O THR T 15  
M 7 8 O TYR Q 16  ? O TYR T 16  N LYS N 234 ? N LYS Q 234 
N 1 2 N THR L 29  ? N THR O 27  O ILE L 37  ? O ILE O 35  
N 2 3 N ILE L 36  ? N ILE O 34  O LEU L 208 ? O LEU O 206 
N 3 4 O ALA L 207 ? O ALA O 205 N PHE L 52  ? N PHE O 50  
N 4 5 N ILE L 53  ? N ILE O 51  O MET L 107 ? O MET O 105 
N 5 6 O CYS L 113 ? O CYS O 111 N SER L 47  ? N SER O 45  
O 1 2 N THR L 29  ? N THR O 27  O ILE L 37  ? O ILE O 35  
O 2 3 N ILE L 36  ? N ILE O 34  O LEU L 208 ? O LEU O 206 
O 3 4 O ALA L 207 ? O ALA O 205 N PHE L 52  ? N PHE O 50  
O 4 5 N ILE L 53  ? N ILE O 51  O MET L 107 ? O MET O 105 
O 5 6 O THR L 108 ? O THR O 106 N TYR L 101 ? N TYR O 99  
O 6 7 N VAL L 100 ? N VAL O 98  O ILE S 37  ? O ILE V 68  
O 7 8 N VAL S 34  ? N VAL V 65  O ARG S 46  ? O ARG V 77  
P 1 2 N GLU L 248 ? N GLU O 246 O GLY L 430 ? O GLY O 428 
P 2 3 O SER L 425 ? O SER O 423 N VAL L 260 ? N VAL O 258 
P 3 4 N ALA L 257 ? N ALA O 255 O THR L 328 ? O THR O 326 
P 4 5 O ILE L 329 ? O ILE O 327 N ASP L 310 ? N ASP O 308 
Q 1 2 N ALA M 24  ? N ALA P 24  O ILE M 219 ? O ILE P 219 
R 1 2 N VAL N 70  ? N VAL Q 70  O ARG N 83  ? O ARG Q 83  
S 1 2 N HIS N 148 ? N HIS Q 148 O ILE N 158 ? O ILE Q 158 
T 1 2 N ILE O 76  ? N ILE R 76  O VAL O 193 ? O VAL R 193 
T 2 3 O VAL O 194 ? O VAL R 194 N GLN O 186 ? N GLN R 186 
U 1 2 N LYS O 85  ? N LYS R 85  O HIS O 100 ? O HIS R 100 
U 2 3 N PHE O 97  ? N PHE R 97  O LEU O 135 ? O LEU R 135 
V 1 2 N ILE O 147 ? N ILE R 147 O TYR O 157 ? O TYR R 157 
V 2 3 N TYR O 156 ? N TYR R 156 O TYR O 165 ? O TYR R 165 
V 3 4 N HIS O 164 ? N HIS R 164 O LYS O 173 ? O LYS R 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 501'  
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 502'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE SMA C 2001' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UQ C 2002'  
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PEE C 2007' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PEE C 2008' 
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 2010' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL C 2011' 
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL C 2104' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL C 3015' 
BC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEC D 501'  
BC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CDL D 2003' 
BC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES E 501'  
BC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PEE E 2005' 
BC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PLC E 2009' 
BC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL E 2105' 
BC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL E 3103' 
BC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CDL G 2004' 
CC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PEE N 3008' 
CC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM P 501'  
CC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM P 502'  
CC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE SMA P 3001' 
CC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UQ P 3002'  
CC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CDL P 3004' 
CC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PEE P 3007' 
CC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE UNL P 3010' 
CC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL P 3011' 
DC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL P 3104' 
DC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEC Q 501'  
DC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FES R 501'  
DC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNL R 2103' 
DC5 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PEE R 3005' 
DC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PLC R 3009' 
DC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CDL S 3003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 18 GLN C  45  ? GLN C 45   . ? 1_555 ? 
2   AC1 18 GLY C  49  ? GLY C 49   . ? 1_555 ? 
3   AC1 18 LEU C  50  ? LEU C 50   . ? 1_555 ? 
4   AC1 18 LEU C  52  ? LEU C 52   . ? 1_555 ? 
5   AC1 18 ALA C  53  ? ALA C 53   . ? 1_555 ? 
6   AC1 18 ARG C  81  ? ARG C 81   . ? 1_555 ? 
7   AC1 18 HIS C  84  ? HIS C 84   . ? 1_555 ? 
8   AC1 18 ALA C  88  ? ALA C 88   . ? 1_555 ? 
9   AC1 18 LEU C  124 ? LEU C 124  . ? 1_555 ? 
10  AC1 18 THR C  127 ? THR C 127  . ? 1_555 ? 
11  AC1 18 GLY C  131 ? GLY C 131  . ? 1_555 ? 
12  AC1 18 TYR C  132 ? TYR C 132  . ? 1_555 ? 
13  AC1 18 LEU C  134 ? LEU C 134  . ? 1_555 ? 
14  AC1 18 PRO C  135 ? PRO C 135  . ? 1_555 ? 
15  AC1 18 HIS C  183 ? HIS C 183  . ? 1_555 ? 
16  AC1 18 PHE C  184 ? PHE C 184  . ? 1_555 ? 
17  AC1 18 PRO C  187 ? PRO C 187  . ? 1_555 ? 
18  AC1 18 ILE C  190 ? ILE C 190  . ? 1_555 ? 
19  AC2 18 TRP C  32  ? TRP C 32   . ? 1_555 ? 
20  AC2 18 GLY C  35  ? GLY C 35   . ? 1_555 ? 
21  AC2 18 LEU C  38  ? LEU C 38   . ? 1_555 ? 
22  AC2 18 ALA C  39  ? ALA C 39   . ? 1_555 ? 
23  AC2 18 HIS C  98  ? HIS C 98   . ? 1_555 ? 
24  AC2 18 ARG C  101 ? ARG C 101  . ? 1_555 ? 
25  AC2 18 SER C  107 ? SER C 107  . ? 1_555 ? 
26  AC2 18 TRP C  114 ? TRP C 114  . ? 1_555 ? 
27  AC2 18 GLY C  117 ? GLY C 117  . ? 1_555 ? 
28  AC2 18 VAL C  118 ? VAL C 118  . ? 1_555 ? 
29  AC2 18 LEU C  120 ? LEU C 120  . ? 1_555 ? 
30  AC2 18 HIS C  197 ? HIS C 197  . ? 1_555 ? 
31  AC2 18 LEU C  198 ? LEU C 198  . ? 1_555 ? 
32  AC2 18 SER C  206 ? SER C 206  . ? 1_555 ? 
33  AC2 18 ASN C  207 ? ASN C 207  . ? 1_555 ? 
34  AC2 18 HOH FB .   ? HOH C 381  . ? 1_555 ? 
35  AC2 18 HOH FB .   ? HOH C 384  . ? 1_555 ? 
36  AC2 18 UQ  Y  .   ? UQ  C 2002 . ? 1_555 ? 
37  AC3 13 MET C  125 ? MET C 125  . ? 1_555 ? 
38  AC3 13 GLY C  143 ? GLY C 143  . ? 1_555 ? 
39  AC3 13 VAL C  146 ? VAL C 146  . ? 1_555 ? 
40  AC3 13 ILE C  147 ? ILE C 147  . ? 1_555 ? 
41  AC3 13 LEU C  182 ? LEU C 182  . ? 1_555 ? 
42  AC3 13 LYS C  270 ? LYS C 270  . ? 1_555 ? 
43  AC3 13 PRO C  271 ? PRO C 271  . ? 1_555 ? 
44  AC3 13 GLU C  272 ? GLU C 272  . ? 1_555 ? 
45  AC3 13 PHE C  275 ? PHE C 275  . ? 1_555 ? 
46  AC3 13 TYR C  279 ? TYR C 279  . ? 1_555 ? 
47  AC3 13 LEU C  295 ? LEU C 295  . ? 1_555 ? 
48  AC3 13 CYS O  160 ? CYS R 160  . ? 1_555 ? 
49  AC3 13 HIS O  161 ? HIS R 161  . ? 1_555 ? 
50  AC4 10 LEU C  22  ? LEU C 22   . ? 1_555 ? 
51  AC4 10 ILE C  28  ? ILE C 28   . ? 1_555 ? 
52  AC4 10 ALA C  39  ? ALA C 39   . ? 1_555 ? 
53  AC4 10 LEU C  198 ? LEU C 198  . ? 1_555 ? 
54  AC4 10 HIS C  202 ? HIS C 202  . ? 1_555 ? 
55  AC4 10 SER C  206 ? SER C 206  . ? 1_555 ? 
56  AC4 10 PHE C  221 ? PHE C 221  . ? 1_555 ? 
57  AC4 10 ASP C  229 ? ASP C 229  . ? 1_555 ? 
58  AC4 10 HOH FB .   ? HOH C 385  . ? 1_555 ? 
59  AC4 10 HEM W  .   ? HEM C 502  . ? 1_555 ? 
60  AC5 10 TRP C  31  ? TRP C 31   . ? 1_555 ? 
61  AC5 10 PHE C  96  ? PHE C 96   . ? 1_555 ? 
62  AC5 10 TYR C  104 ? TYR C 104  . ? 1_555 ? 
63  AC5 10 TYR C  105 ? TYR C 105  . ? 1_555 ? 
64  AC5 10 PHE C  277 ? PHE C 277  . ? 1_555 ? 
65  AC5 10 THR C  317 ? THR C 317  . ? 1_555 ? 
66  AC5 10 TRP C  327 ? TRP C 327  . ? 1_555 ? 
67  AC5 10 TYR F  29  ? TYR F 29   . ? 1_555 ? 
68  AC5 10 GLN G  44  ? GLN G 44   . ? 1_555 ? 
69  AC5 10 CDL MA .   ? CDL G 2004 . ? 1_555 ? 
70  AC6 4  SER A  439 ? SER A 439  . ? 1_555 ? 
71  AC6 4  TYR A  442 ? TYR A 442  . ? 1_555 ? 
72  AC6 4  HIS C  222 ? HIS C 222  . ? 1_555 ? 
73  AC6 4  PEE IA .   ? PEE E 2005 . ? 1_555 ? 
74  AC7 1  TYR C  274 ? TYR C 274  . ? 1_555 ? 
75  AC8 4  PHE C  64  ? PHE C 64   . ? 1_555 ? 
76  AC8 4  ARG C  81  ? ARG C 81   . ? 1_555 ? 
77  AC8 4  ASN C  256 ? ASN C 256  . ? 1_555 ? 
78  AC8 4  TYR D  115 ? TYR D 115  . ? 1_555 ? 
79  AC9 1  HIS C  159 ? HIS C 159  . ? 1_555 ? 
80  BC1 2  THR C  199 ? THR C 199  . ? 1_555 ? 
81  BC1 2  HIS C  202 ? HIS C 202  . ? 1_555 ? 
82  BC2 15 VAL D  36  ? VAL D 36   . ? 1_555 ? 
83  BC2 15 CYS D  37  ? CYS D 37   . ? 1_555 ? 
84  BC2 15 CYS D  40  ? CYS D 40   . ? 1_555 ? 
85  BC2 15 HIS D  41  ? HIS D 41   . ? 1_555 ? 
86  BC2 15 ASN D  105 ? ASN D 105  . ? 1_555 ? 
87  BC2 15 PRO D  110 ? PRO D 110  . ? 1_555 ? 
88  BC2 15 PRO D  111 ? PRO D 111  . ? 1_555 ? 
89  BC2 15 ILE D  116 ? ILE D 116  . ? 1_555 ? 
90  BC2 15 ARG D  120 ? ARG D 120  . ? 1_555 ? 
91  BC2 15 TYR D  126 ? TYR D 126  . ? 1_555 ? 
92  BC2 15 PHE D  153 ? PHE D 153  . ? 1_555 ? 
93  BC2 15 ILE D  158 ? ILE D 158  . ? 1_555 ? 
94  BC2 15 GLY D  159 ? GLY D 159  . ? 1_555 ? 
95  BC2 15 MET D  160 ? MET D 160  . ? 1_555 ? 
96  BC2 15 PRO D  163 ? PRO D 163  . ? 1_555 ? 
97  BC3 13 ALA C  30  ? ALA C 30   . ? 1_555 ? 
98  BC3 13 LYS C  228 ? LYS C 228  . ? 1_555 ? 
99  BC3 13 GLY C  232 ? GLY C 232  . ? 1_555 ? 
100 BC3 13 MET C  236 ? MET C 236  . ? 1_555 ? 
101 BC3 13 TYR D  220 ? TYR D 220  . ? 1_555 ? 
102 BC3 13 LYS D  223 ? LYS D 223  . ? 1_555 ? 
103 BC3 13 ARG D  224 ? ARG D 224  . ? 1_555 ? 
104 BC3 13 LYS D  231 ? LYS D 231  . ? 1_555 ? 
105 BC3 13 HIS F  72  ? HIS F 72   . ? 1_555 ? 
106 BC3 13 ARG F  73  ? ARG F 73   . ? 1_555 ? 
107 BC3 13 ILE G  29  ? ILE G 29   . ? 1_555 ? 
108 BC3 13 ARG G  40  ? ARG G 40   . ? 1_555 ? 
109 BC3 13 CDL MA .   ? CDL G 2004 . ? 1_555 ? 
110 BC4 8  CYS E  139 ? CYS E 139  . ? 1_555 ? 
111 BC4 8  HIS E  141 ? HIS E 141  . ? 1_555 ? 
112 BC4 8  LEU E  142 ? LEU E 142  . ? 1_555 ? 
113 BC4 8  CYS E  144 ? CYS E 144  . ? 1_555 ? 
114 BC4 8  CYS E  158 ? CYS E 158  . ? 1_555 ? 
115 BC4 8  CYS E  160 ? CYS E 160  . ? 1_555 ? 
116 BC4 8  HIS E  161 ? HIS E 161  . ? 1_555 ? 
117 BC4 8  SER E  163 ? SER E 163  . ? 1_555 ? 
118 BC5 10 TYR A  442 ? TYR A 442  . ? 1_555 ? 
119 BC5 10 PHE C  227 ? PHE C 227  . ? 1_555 ? 
120 BC5 10 PEE AA .   ? PEE C 2008 . ? 1_555 ? 
121 BC5 10 TYR E  37  ? TYR E 37   . ? 1_555 ? 
122 BC5 10 THR E  40  ? THR E 40   . ? 1_555 ? 
123 BC5 10 THR E  47  ? THR E 47   . ? 1_555 ? 
124 BC5 10 PHE J  11  ? PHE J 14   . ? 1_555 ? 
125 BC5 10 PHE J  17  ? PHE J 20   . ? 1_555 ? 
126 BC5 10 VAL J  22  ? VAL J 25   . ? 1_555 ? 
127 BC5 10 GLU J  29  ? GLU J 32   . ? 1_555 ? 
128 BC6 9  LEU C  79  ? LEU C 79   . ? 1_555 ? 
129 BC6 9  GLN D  200 ? GLN D 200  . ? 1_555 ? 
130 BC6 9  MET D  204 ? MET D 204  . ? 1_555 ? 
131 BC6 9  LYS D  207 ? LYS D 207  . ? 1_555 ? 
132 BC6 9  TYR E  49  ? TYR E 49   . ? 1_555 ? 
133 BC6 9  ALA E  50  ? ALA E 50   . ? 1_555 ? 
134 BC6 9  ASN E  53  ? ASN E 53   . ? 1_555 ? 
135 BC6 9  GLN E  57  ? GLN E 57   . ? 1_555 ? 
136 BC6 9  ASP J  33  ? ASP J 36   . ? 1_555 ? 
137 BC7 1  TYR E  178 ? TYR E 178  . ? 1_555 ? 
138 BC8 2  THR E  140 ? THR E 140  . ? 1_555 ? 
139 BC8 2  UNL XA .   ? UNL P 3104 . ? 1_555 ? 
140 BC9 9  SER C  29  ? SER C 29   . ? 1_555 ? 
141 BC9 9  ALA C  30  ? ALA C 30   . ? 1_555 ? 
142 BC9 9  TRP C  31  ? TRP C 31   . ? 1_555 ? 
143 BC9 9  TYR C  105 ? TYR C 105  . ? 1_555 ? 
144 BC9 9  PEE Z  .   ? PEE C 2007 . ? 1_555 ? 
145 BC9 9  CDL GA .   ? CDL D 2003 . ? 1_555 ? 
146 BC9 9  HIS F  72  ? HIS F 72   . ? 1_555 ? 
147 BC9 9  ARG G  40  ? ARG G 40   . ? 1_555 ? 
148 BC9 9  GLN G  44  ? GLN G 44   . ? 1_555 ? 
149 CC1 2  TYR K  442 ? TYR N 442  . ? 1_555 ? 
150 CC1 2  HIS M  222 ? HIS P 222  . ? 1_555 ? 
151 CC2 17 GLN M  45  ? GLN P 45   . ? 1_555 ? 
152 CC2 17 GLY M  49  ? GLY P 49   . ? 1_555 ? 
153 CC2 17 LEU M  50  ? LEU P 50   . ? 1_555 ? 
154 CC2 17 LEU M  52  ? LEU P 52   . ? 1_555 ? 
155 CC2 17 ALA M  53  ? ALA P 53   . ? 1_555 ? 
156 CC2 17 ARG M  81  ? ARG P 81   . ? 1_555 ? 
157 CC2 17 HIS M  84  ? HIS P 84   . ? 1_555 ? 
158 CC2 17 LEU M  124 ? LEU P 124  . ? 1_555 ? 
159 CC2 17 THR M  127 ? THR P 127  . ? 1_555 ? 
160 CC2 17 GLY M  131 ? GLY P 131  . ? 1_555 ? 
161 CC2 17 TYR M  132 ? TYR P 132  . ? 1_555 ? 
162 CC2 17 LEU M  134 ? LEU P 134  . ? 1_555 ? 
163 CC2 17 PRO M  135 ? PRO P 135  . ? 1_555 ? 
164 CC2 17 HIS M  183 ? HIS P 183  . ? 1_555 ? 
165 CC2 17 PHE M  184 ? PHE P 184  . ? 1_555 ? 
166 CC2 17 PRO M  187 ? PRO P 187  . ? 1_555 ? 
167 CC2 17 ILE M  190 ? ILE P 190  . ? 1_555 ? 
168 CC3 17 TRP M  32  ? TRP P 32   . ? 1_555 ? 
169 CC3 17 GLY M  35  ? GLY P 35   . ? 1_555 ? 
170 CC3 17 LEU M  38  ? LEU P 38   . ? 1_555 ? 
171 CC3 17 ALA M  39  ? ALA P 39   . ? 1_555 ? 
172 CC3 17 HIS M  98  ? HIS P 98   . ? 1_555 ? 
173 CC3 17 ARG M  101 ? ARG P 101  . ? 1_555 ? 
174 CC3 17 SER M  107 ? SER P 107  . ? 1_555 ? 
175 CC3 17 TRP M  114 ? TRP P 114  . ? 1_555 ? 
176 CC3 17 GLY M  117 ? GLY P 117  . ? 1_555 ? 
177 CC3 17 VAL M  118 ? VAL P 118  . ? 1_555 ? 
178 CC3 17 LEU M  120 ? LEU P 120  . ? 1_555 ? 
179 CC3 17 HIS M  197 ? HIS P 197  . ? 1_555 ? 
180 CC3 17 LEU M  198 ? LEU P 198  . ? 1_555 ? 
181 CC3 17 SER M  206 ? SER P 206  . ? 1_555 ? 
182 CC3 17 ASN M  207 ? ASN P 207  . ? 1_555 ? 
183 CC3 17 HOH GB .   ? HOH P 381  . ? 1_555 ? 
184 CC3 17 HOH GB .   ? HOH P 384  . ? 1_555 ? 
185 CC4 12 CYS E  160 ? CYS E 160  . ? 1_555 ? 
186 CC4 12 HIS E  161 ? HIS E 161  . ? 1_555 ? 
187 CC4 12 PHE M  129 ? PHE P 129  . ? 1_555 ? 
188 CC4 12 GLY M  143 ? GLY P 143  . ? 1_555 ? 
189 CC4 12 VAL M  146 ? VAL P 146  . ? 1_555 ? 
190 CC4 12 PHE M  179 ? PHE P 179  . ? 1_555 ? 
191 CC4 12 LYS M  270 ? LYS P 270  . ? 1_555 ? 
192 CC4 12 PRO M  271 ? PRO P 271  . ? 1_555 ? 
193 CC4 12 GLU M  272 ? GLU P 272  . ? 1_555 ? 
194 CC4 12 PHE M  275 ? PHE P 275  . ? 1_555 ? 
195 CC4 12 TYR M  279 ? TYR P 279  . ? 1_555 ? 
196 CC4 12 LEU M  295 ? LEU P 295  . ? 1_555 ? 
197 CC5 10 LEU M  22  ? LEU P 22   . ? 1_555 ? 
198 CC5 10 ILE M  28  ? ILE P 28   . ? 1_555 ? 
199 CC5 10 ALA M  39  ? ALA P 39   . ? 1_555 ? 
200 CC5 10 LEU M  198 ? LEU P 198  . ? 1_555 ? 
201 CC5 10 HIS M  202 ? HIS P 202  . ? 1_555 ? 
202 CC5 10 SER M  206 ? SER P 206  . ? 1_555 ? 
203 CC5 10 PHE M  221 ? PHE P 221  . ? 1_555 ? 
204 CC5 10 TYR M  225 ? TYR P 225  . ? 1_555 ? 
205 CC5 10 ASP M  229 ? ASP P 229  . ? 1_555 ? 
206 CC5 10 HOH GB .   ? HOH P 382  . ? 1_555 ? 
207 CC6 10 SER M  29  ? SER P 29   . ? 1_555 ? 
208 CC6 10 ALA M  30  ? ALA P 30   . ? 1_555 ? 
209 CC6 10 TRP M  31  ? TRP P 31   . ? 1_555 ? 
210 CC6 10 TYR M  105 ? TYR P 105  . ? 1_555 ? 
211 CC6 10 PEE UA .   ? PEE P 3007 . ? 1_555 ? 
212 CC6 10 HIS P  72  ? HIS S 72   . ? 1_555 ? 
213 CC6 10 CDL DB .   ? CDL S 3003 . ? 1_555 ? 
214 CC6 10 ARG Q  40  ? ARG T 40   . ? 1_555 ? 
215 CC6 10 PHE Q  41  ? PHE T 41   . ? 1_555 ? 
216 CC6 10 GLN Q  44  ? GLN T 44   . ? 1_555 ? 
217 CC7 9  TRP M  31  ? TRP P 31   . ? 1_555 ? 
218 CC7 9  TYR M  104 ? TYR P 104  . ? 1_555 ? 
219 CC7 9  TYR M  105 ? TYR P 105  . ? 1_555 ? 
220 CC7 9  PHE M  277 ? PHE P 277  . ? 1_555 ? 
221 CC7 9  THR M  317 ? THR P 317  . ? 1_555 ? 
222 CC7 9  TRP M  327 ? TRP P 327  . ? 1_555 ? 
223 CC7 9  CDL TA .   ? CDL P 3004 . ? 1_555 ? 
224 CC7 9  TYR P  29  ? TYR S 29   . ? 1_555 ? 
225 CC7 9  GLN Q  44  ? GLN T 44   . ? 1_555 ? 
226 CC8 1  TYR M  274 ? TYR P 274  . ? 1_555 ? 
227 CC9 5  PHE M  64  ? PHE P 64   . ? 1_555 ? 
228 CC9 5  ARG M  81  ? ARG P 81   . ? 1_555 ? 
229 CC9 5  ASN M  256 ? ASN P 256  . ? 1_555 ? 
230 CC9 5  PHE M  257 ? PHE P 257  . ? 1_555 ? 
231 CC9 5  TYR N  115 ? TYR Q 115  . ? 1_555 ? 
232 DC1 2  UNL LA .   ? UNL E 3103 . ? 1_555 ? 
233 DC1 2  ASN M  149 ? ASN P 149  . ? 1_555 ? 
234 DC2 13 VAL N  36  ? VAL Q 36   . ? 1_555 ? 
235 DC2 13 CYS N  37  ? CYS Q 37   . ? 1_555 ? 
236 DC2 13 CYS N  40  ? CYS Q 40   . ? 1_555 ? 
237 DC2 13 HIS N  41  ? HIS Q 41   . ? 1_555 ? 
238 DC2 13 ASN N  105 ? ASN Q 105  . ? 1_555 ? 
239 DC2 13 PRO N  110 ? PRO Q 110  . ? 1_555 ? 
240 DC2 13 ARG N  120 ? ARG Q 120  . ? 1_555 ? 
241 DC2 13 TYR N  126 ? TYR Q 126  . ? 1_555 ? 
242 DC2 13 PHE N  153 ? PHE Q 153  . ? 1_555 ? 
243 DC2 13 ILE N  158 ? ILE Q 158  . ? 1_555 ? 
244 DC2 13 GLY N  159 ? GLY Q 159  . ? 1_555 ? 
245 DC2 13 MET N  160 ? MET Q 160  . ? 1_555 ? 
246 DC2 13 PRO N  163 ? PRO Q 163  . ? 1_555 ? 
247 DC3 6  CYS O  139 ? CYS R 139  . ? 1_555 ? 
248 DC3 6  HIS O  141 ? HIS R 141  . ? 1_555 ? 
249 DC3 6  LEU O  142 ? LEU R 142  . ? 1_555 ? 
250 DC3 6  CYS O  158 ? CYS R 158  . ? 1_555 ? 
251 DC3 6  HIS O  161 ? HIS R 161  . ? 1_555 ? 
252 DC3 6  SER O  163 ? SER R 163  . ? 1_555 ? 
253 DC4 2  CYS O  139 ? CYS R 139  . ? 1_555 ? 
254 DC4 2  GLY O  143 ? GLY R 143  . ? 1_555 ? 
255 DC5 11 TYR K  442 ? TYR N 442  . ? 1_555 ? 
256 DC5 11 PHE M  227 ? PHE P 227  . ? 1_555 ? 
257 DC5 11 TYR O  37  ? TYR R 37   . ? 1_555 ? 
258 DC5 11 THR O  40  ? THR R 40   . ? 1_555 ? 
259 DC5 11 THR O  47  ? THR R 47   . ? 1_555 ? 
260 DC5 11 PHE T  11  ? PHE W 14   . ? 1_555 ? 
261 DC5 11 ARG T  12  ? ARG W 15   . ? 1_555 ? 
262 DC5 11 PHE T  17  ? PHE W 20   . ? 1_555 ? 
263 DC5 11 ALA T  18  ? ALA W 21   . ? 1_555 ? 
264 DC5 11 VAL T  22  ? VAL W 25   . ? 1_555 ? 
265 DC5 11 GLU T  29  ? GLU W 32   . ? 1_555 ? 
266 DC6 10 LEU M  79  ? LEU P 79   . ? 1_555 ? 
267 DC6 10 LEU M  241 ? LEU P 241  . ? 1_555 ? 
268 DC6 10 GLN N  200 ? GLN Q 200  . ? 1_555 ? 
269 DC6 10 MET N  204 ? MET Q 204  . ? 1_555 ? 
270 DC6 10 LYS N  207 ? LYS Q 207  . ? 1_555 ? 
271 DC6 10 TYR O  49  ? TYR R 49   . ? 1_555 ? 
272 DC6 10 ALA O  50  ? ALA R 50   . ? 1_555 ? 
273 DC6 10 ASN O  53  ? ASN R 53   . ? 1_555 ? 
274 DC6 10 GLN O  57  ? GLN R 57   . ? 1_555 ? 
275 DC6 10 ASP T  33  ? ASP W 36   . ? 1_555 ? 
276 DC7 14 ALA M  30  ? ALA P 30   . ? 1_555 ? 
277 DC7 14 ASN M  33  ? ASN P 33   . ? 1_555 ? 
278 DC7 14 LYS M  228 ? LYS P 228  . ? 1_555 ? 
279 DC7 14 GLY M  232 ? GLY P 232  . ? 1_555 ? 
280 DC7 14 MET M  236 ? MET P 236  . ? 1_555 ? 
281 DC7 14 CDL TA .   ? CDL P 3004 . ? 1_555 ? 
282 DC7 14 TYR N  220 ? TYR Q 220  . ? 1_555 ? 
283 DC7 14 LYS N  223 ? LYS Q 223  . ? 1_555 ? 
284 DC7 14 ARG N  224 ? ARG Q 224  . ? 1_555 ? 
285 DC7 14 LYS N  231 ? LYS Q 231  . ? 1_555 ? 
286 DC7 14 HIS P  72  ? HIS S 72   . ? 1_555 ? 
287 DC7 14 ARG P  73  ? ARG S 73   . ? 1_555 ? 
288 DC7 14 ILE Q  29  ? ILE T 29   . ? 1_555 ? 
289 DC7 14 ARG Q  40  ? ARG T 40   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H1J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H1J 
_atom_sites.fract_transf_matrix[1][1]   0.005765 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005481 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004144 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A  1  2   ? 90.160  83.554  51.455  1.00 106.47 ? 2    ALA A N     1 
ATOM   2     C  CA    . ALA A  1  2   ? 89.361  83.393  50.196  1.00 107.34 ? 2    ALA A CA    1 
ATOM   3     C  C     . ALA A  1  2   ? 88.015  84.128  50.284  1.00 107.84 ? 2    ALA A C     1 
ATOM   4     O  O     . ALA A  1  2   ? 86.961  83.508  50.144  1.00 108.64 ? 2    ALA A O     1 
ATOM   5     C  CB    . ALA A  1  2   ? 89.131  81.900  49.920  1.00 106.19 ? 2    ALA A CB    1 
ATOM   6     N  N     . THR A  1  3   ? 88.060  85.447  50.487  1.00 107.97 ? 3    THR A N     1 
ATOM   7     C  CA    . THR A  1  3   ? 86.861  86.284  50.635  1.00 107.58 ? 3    THR A CA    1 
ATOM   8     C  C     . THR A  1  3   ? 85.590  85.902  49.882  1.00 108.27 ? 3    THR A C     1 
ATOM   9     O  O     . THR A  1  3   ? 85.617  85.468  48.722  1.00 108.03 ? 3    THR A O     1 
ATOM   10    C  CB    . THR A  1  3   ? 87.131  87.758  50.283  1.00 106.81 ? 3    THR A CB    1 
ATOM   11    O  OG1   . THR A  1  3   ? 87.260  87.898  48.862  1.00 106.28 ? 3    THR A OG1   1 
ATOM   12    C  CG2   . THR A  1  3   ? 88.386  88.247  50.974  1.00 106.66 ? 3    THR A CG2   1 
ATOM   13    N  N     . TYR A  1  4   ? 84.479  86.101  50.589  1.00 108.09 ? 4    TYR A N     1 
ATOM   14    C  CA    . TYR A  1  4   ? 83.119  85.854  50.124  1.00 107.77 ? 4    TYR A CA    1 
ATOM   15    C  C     . TYR A  1  4   ? 82.960  86.177  48.637  1.00 107.37 ? 4    TYR A C     1 
ATOM   16    O  O     . TYR A  1  4   ? 82.609  85.311  47.828  1.00 106.22 ? 4    TYR A O     1 
ATOM   17    C  CB    . TYR A  1  4   ? 82.184  86.709  50.992  1.00 107.99 ? 4    TYR A CB    1 
ATOM   18    C  CG    . TYR A  1  4   ? 80.765  86.919  50.506  1.00 108.43 ? 4    TYR A CG    1 
ATOM   19    C  CD1   . TYR A  1  4   ? 79.879  85.850  50.361  1.00 108.57 ? 4    TYR A CD1   1 
ATOM   20    C  CD2   . TYR A  1  4   ? 80.290  88.204  50.254  1.00 107.85 ? 4    TYR A CD2   1 
ATOM   21    C  CE1   . TYR A  1  4   ? 78.548  86.065  49.980  1.00 108.73 ? 4    TYR A CE1   1 
ATOM   22    C  CE2   . TYR A  1  4   ? 78.971  88.428  49.874  1.00 108.02 ? 4    TYR A CE2   1 
ATOM   23    C  CZ    . TYR A  1  4   ? 78.102  87.360  49.739  1.00 108.52 ? 4    TYR A CZ    1 
ATOM   24    O  OH    . TYR A  1  4   ? 76.789  87.596  49.377  1.00 108.78 ? 4    TYR A OH    1 
ATOM   25    N  N     . ALA A  1  5   ? 83.231  87.429  48.287  1.00 106.92 ? 5    ALA A N     1 
ATOM   26    C  CA    . ALA A  1  5   ? 83.129  87.883  46.911  1.00 107.01 ? 5    ALA A CA    1 
ATOM   27    C  C     . ALA A  1  5   ? 83.553  86.791  45.930  1.00 107.47 ? 5    ALA A C     1 
ATOM   28    O  O     . ALA A  1  5   ? 82.798  86.393  45.042  1.00 107.31 ? 5    ALA A O     1 
ATOM   29    C  CB    . ALA A  1  5   ? 83.998  89.111  46.725  1.00 106.63 ? 5    ALA A CB    1 
ATOM   30    N  N     . GLN A  1  6   ? 84.768  86.299  46.119  1.00 108.05 ? 6    GLN A N     1 
ATOM   31    C  CA    . GLN A  1  6   ? 85.335  85.281  45.257  1.00 107.95 ? 6    GLN A CA    1 
ATOM   32    C  C     . GLN A  1  6   ? 84.589  83.962  45.247  1.00 107.10 ? 6    GLN A C     1 
ATOM   33    O  O     . GLN A  1  6   ? 84.297  83.429  44.182  1.00 107.29 ? 6    GLN A O     1 
ATOM   34    C  CB    . GLN A  1  6   ? 86.778  85.064  45.659  1.00 109.38 ? 6    GLN A CB    1 
ATOM   35    C  CG    . GLN A  1  6   ? 87.504  86.370  45.847  1.00 111.34 ? 6    GLN A CG    1 
ATOM   36    C  CD    . GLN A  1  6   ? 88.935  86.166  46.235  1.00 112.91 ? 6    GLN A CD    1 
ATOM   37    O  OE1   . GLN A  1  6   ? 89.228  85.560  47.266  1.00 114.84 ? 6    GLN A OE1   1 
ATOM   38    N  NE2   . GLN A  1  6   ? 89.845  86.664  45.410  1.00 113.51 ? 6    GLN A NE2   1 
ATOM   39    N  N     . THR A  1  7   ? 84.281  83.428  46.422  1.00 106.32 ? 7    THR A N     1 
ATOM   40    C  CA    . THR A  1  7   ? 83.565  82.160  46.479  1.00 106.39 ? 7    THR A CA    1 
ATOM   41    C  C     . THR A  1  7   ? 82.331  82.229  45.599  1.00 106.25 ? 7    THR A C     1 
ATOM   42    O  O     . THR A  1  7   ? 81.878  81.214  45.073  1.00 105.90 ? 7    THR A O     1 
ATOM   43    C  CB    . THR A  1  7   ? 83.117  81.823  47.904  1.00 106.52 ? 7    THR A CB    1 
ATOM   44    O  OG1   . THR A  1  7   ? 82.442  82.952  48.465  1.00 107.89 ? 7    THR A OG1   1 
ATOM   45    C  CG2   . THR A  1  7   ? 84.304  81.465  48.768  1.00 106.37 ? 7    THR A CG2   1 
ATOM   46    N  N     . LEU A  1  8   ? 81.799  83.438  45.437  1.00 106.47 ? 8    LEU A N     1 
ATOM   47    C  CA    . LEU A  1  8   ? 80.607  83.653  44.621  1.00 106.37 ? 8    LEU A CA    1 
ATOM   48    C  C     . LEU A  1  8   ? 80.870  83.483  43.137  1.00 105.35 ? 8    LEU A C     1 
ATOM   49    O  O     . LEU A  1  8   ? 80.147  82.772  42.446  1.00 105.36 ? 8    LEU A O     1 
ATOM   50    C  CB    . LEU A  1  8   ? 80.024  85.052  44.863  1.00 106.91 ? 8    LEU A CB    1 
ATOM   51    C  CG    . LEU A  1  8   ? 79.155  85.293  46.104  1.00 106.67 ? 8    LEU A CG    1 
ATOM   52    C  CD1   . LEU A  1  8   ? 78.637  86.728  46.081  1.00 106.00 ? 8    LEU A CD1   1 
ATOM   53    C  CD2   . LEU A  1  8   ? 77.987  84.309  46.129  1.00 105.51 ? 8    LEU A CD2   1 
ATOM   54    N  N     . GLN A  1  9   ? 81.900  84.149  42.646  1.00 104.80 ? 9    GLN A N     1 
ATOM   55    C  CA    . GLN A  1  9   ? 82.233  84.065  41.239  1.00 105.26 ? 9    GLN A CA    1 
ATOM   56    C  C     . GLN A  1  9   ? 82.858  82.727  40.872  1.00 104.81 ? 9    GLN A C     1 
ATOM   57    O  O     . GLN A  1  9   ? 83.244  82.523  39.722  1.00 104.25 ? 9    GLN A O     1 
ATOM   58    C  CB    . GLN A  1  9   ? 83.181  85.196  40.883  1.00 106.45 ? 9    GLN A CB    1 
ATOM   59    C  CG    . GLN A  1  9   ? 84.374  85.268  41.805  1.00 109.34 ? 9    GLN A CG    1 
ATOM   60    C  CD    . GLN A  1  9   ? 85.168  86.538  41.621  1.00 111.08 ? 9    GLN A CD    1 
ATOM   61    O  OE1   . GLN A  1  9   ? 84.657  87.638  41.844  1.00 111.28 ? 9    GLN A OE1   1 
ATOM   62    N  NE2   . GLN A  1  9   ? 86.428  86.399  41.208  1.00 111.92 ? 9    GLN A NE2   1 
ATOM   63    N  N     . ASN A  1  10  ? 82.949  81.820  41.849  1.00 104.71 ? 10   ASN A N     1 
ATOM   64    C  CA    . ASN A  1  10  ? 83.533  80.490  41.638  1.00 104.51 ? 10   ASN A CA    1 
ATOM   65    C  C     . ASN A  1  10  ? 82.500  79.420  41.426  1.00 103.51 ? 10   ASN A C     1 
ATOM   66    O  O     . ASN A  1  10  ? 82.735  78.435  40.722  1.00 103.69 ? 10   ASN A O     1 
ATOM   67    C  CB    . ASN A  1  10  ? 84.385  80.066  42.826  1.00 105.63 ? 10   ASN A CB    1 
ATOM   68    C  CG    . ASN A  1  10  ? 85.792  80.559  42.721  1.00 107.45 ? 10   ASN A CG    1 
ATOM   69    O  OD1   . ASN A  1  10  ? 86.032  81.768  42.721  1.00 108.99 ? 10   ASN A OD1   1 
ATOM   70    N  ND2   . ASN A  1  10  ? 86.744  79.630  42.621  1.00 108.25 ? 10   ASN A ND2   1 
ATOM   71    N  N     . ILE A  1  11  ? 81.362  79.598  42.073  1.00 102.26 ? 11   ILE A N     1 
ATOM   72    C  CA    . ILE A  1  11  ? 80.297  78.634  41.943  1.00 101.17 ? 11   ILE A CA    1 
ATOM   73    C  C     . ILE A  1  11  ? 80.106  78.381  40.449  1.00 100.21 ? 11   ILE A C     1 
ATOM   74    O  O     . ILE A  1  11  ? 79.952  79.317  39.659  1.00 99.20  ? 11   ILE A O     1 
ATOM   75    C  CB    . ILE A  1  11  ? 78.992  79.168  42.573  1.00 100.86 ? 11   ILE A CB    1 
ATOM   76    C  CG1   . ILE A  1  11  ? 79.292  79.794  43.943  1.00 99.93  ? 11   ILE A CG1   1 
ATOM   77    C  CG2   . ILE A  1  11  ? 77.997  78.022  42.740  1.00 101.39 ? 11   ILE A CG2   1 
ATOM   78    C  CD1   . ILE A  1  11  ? 78.086  80.402  44.645  1.00 97.39  ? 11   ILE A CD1   1 
ATOM   79    N  N     . PRO A  1  12  ? 80.148  77.106  40.039  1.00 99.54  ? 12   PRO A N     1 
ATOM   80    C  CA    . PRO A  1  12  ? 79.978  76.752  38.628  1.00 99.24  ? 12   PRO A CA    1 
ATOM   81    C  C     . PRO A  1  12  ? 78.735  77.372  38.006  1.00 98.92  ? 12   PRO A C     1 
ATOM   82    O  O     . PRO A  1  12  ? 77.705  77.506  38.658  1.00 99.78  ? 12   PRO A O     1 
ATOM   83    C  CB    . PRO A  1  12  ? 79.920  75.222  38.659  1.00 99.00  ? 12   PRO A CB    1 
ATOM   84    C  CG    . PRO A  1  12  ? 79.430  74.912  40.046  1.00 98.52  ? 12   PRO A CG    1 
ATOM   85    C  CD    . PRO A  1  12  ? 80.202  75.897  40.878  1.00 98.84  ? 12   PRO A CD    1 
ATOM   86    N  N     . GLU A  1  13  ? 78.838  77.754  36.743  1.00 98.75  ? 13   GLU A N     1 
ATOM   87    C  CA    . GLU A  1  13  ? 77.712  78.353  36.046  1.00 99.38  ? 13   GLU A CA    1 
ATOM   88    C  C     . GLU A  1  13  ? 76.600  77.335  35.834  1.00 98.49  ? 13   GLU A C     1 
ATOM   89    O  O     . GLU A  1  13  ? 76.852  76.135  35.738  1.00 98.49  ? 13   GLU A O     1 
ATOM   90    C  CB    . GLU A  1  13  ? 78.156  78.888  34.689  1.00 101.98 ? 13   GLU A CB    1 
ATOM   91    C  CG    . GLU A  1  13  ? 77.020  79.482  33.871  1.00 105.76 ? 13   GLU A CG    1 
ATOM   92    C  CD    . GLU A  1  13  ? 77.419  79.783  32.435  1.00 107.69 ? 13   GLU A CD    1 
ATOM   93    O  OE1   . GLU A  1  13  ? 77.711  78.819  31.686  1.00 108.03 ? 13   GLU A OE1   1 
ATOM   94    O  OE2   . GLU A  1  13  ? 77.437  80.983  32.062  1.00 109.00 ? 13   GLU A OE2   1 
ATOM   95    N  N     . THR A  1  14  ? 75.365  77.818  35.764  1.00 97.45  ? 14   THR A N     1 
ATOM   96    C  CA    . THR A  1  14  ? 74.224  76.941  35.542  1.00 96.38  ? 14   THR A CA    1 
ATOM   97    C  C     . THR A  1  14  ? 74.027  76.817  34.040  1.00 95.26  ? 14   THR A C     1 
ATOM   98    O  O     . THR A  1  14  ? 73.845  77.818  33.348  1.00 95.37  ? 14   THR A O     1 
ATOM   99    C  CB    . THR A  1  14  ? 72.941  77.513  36.179  1.00 96.30  ? 14   THR A CB    1 
ATOM   100   O  OG1   . THR A  1  14  ? 73.095  77.559  37.603  1.00 96.34  ? 14   THR A OG1   1 
ATOM   101   C  CG2   . THR A  1  14  ? 71.736  76.646  35.822  1.00 95.23  ? 14   THR A CG2   1 
ATOM   102   N  N     . ASN A  1  15  ? 74.072  75.590  33.535  1.00 93.57  ? 15   ASN A N     1 
ATOM   103   C  CA    . ASN A  1  15  ? 73.915  75.367  32.105  1.00 91.77  ? 15   ASN A CA    1 
ATOM   104   C  C     . ASN A  1  15  ? 72.477  75.134  31.717  1.00 90.20  ? 15   ASN A C     1 
ATOM   105   O  O     . ASN A  1  15  ? 71.710  74.534  32.457  1.00 89.66  ? 15   ASN A O     1 
ATOM   106   C  CB    . ASN A  1  15  ? 74.779  74.186  31.641  1.00 91.87  ? 15   ASN A CB    1 
ATOM   107   C  CG    . ASN A  1  15  ? 76.267  74.511  31.653  1.00 91.23  ? 15   ASN A CG    1 
ATOM   108   O  OD1   . ASN A  1  15  ? 76.704  75.494  31.038  1.00 89.73  ? 15   ASN A OD1   1 
ATOM   109   N  ND2   . ASN A  1  15  ? 77.054  73.689  32.355  1.00 90.38  ? 15   ASN A ND2   1 
ATOM   110   N  N     . VAL A  1  16  ? 72.124  75.621  30.539  1.00 89.87  ? 16   VAL A N     1 
ATOM   111   C  CA    . VAL A  1  16  ? 70.777  75.490  30.028  1.00 90.23  ? 16   VAL A CA    1 
ATOM   112   C  C     . VAL A  1  16  ? 70.810  75.182  28.536  1.00 90.36  ? 16   VAL A C     1 
ATOM   113   O  O     . VAL A  1  16  ? 71.537  75.821  27.775  1.00 90.70  ? 16   VAL A O     1 
ATOM   114   C  CB    . VAL A  1  16  ? 69.987  76.803  30.225  1.00 90.77  ? 16   VAL A CB    1 
ATOM   115   C  CG1   . VAL A  1  16  ? 68.504  76.554  30.005  1.00 92.19  ? 16   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A  1  16  ? 70.252  77.378  31.610  1.00 90.30  ? 16   VAL A CG2   1 
ATOM   117   N  N     . THR A  1  17  ? 70.022  74.203  28.120  1.00 90.27  ? 17   THR A N     1 
ATOM   118   C  CA    . THR A  1  17  ? 69.944  73.836  26.715  1.00 90.85  ? 17   THR A CA    1 
ATOM   119   C  C     . THR A  1  17  ? 68.483  73.521  26.406  1.00 91.69  ? 17   THR A C     1 
ATOM   120   O  O     . THR A  1  17  ? 67.822  72.846  27.190  1.00 92.94  ? 17   THR A O     1 
ATOM   121   C  CB    . THR A  1  17  ? 70.841  72.620  26.420  1.00 90.04  ? 17   THR A CB    1 
ATOM   122   O  OG1   . THR A  1  17  ? 70.709  71.656  27.470  1.00 88.97  ? 17   THR A OG1   1 
ATOM   123   C  CG2   . THR A  1  17  ? 72.296  73.053  26.319  1.00 90.39  ? 17   THR A CG2   1 
ATOM   124   N  N     . THR A  1  18  ? 67.968  74.010  25.281  1.00 91.67  ? 18   THR A N     1 
ATOM   125   C  CA    . THR A  1  18  ? 66.562  73.773  24.938  1.00 91.79  ? 18   THR A CA    1 
ATOM   126   C  C     . THR A  1  18  ? 66.378  72.735  23.841  1.00 91.29  ? 18   THR A C     1 
ATOM   127   O  O     . THR A  1  18  ? 67.171  72.672  22.912  1.00 92.08  ? 18   THR A O     1 
ATOM   128   C  CB    . THR A  1  18  ? 65.896  75.068  24.467  1.00 92.44  ? 18   THR A CB    1 
ATOM   129   O  OG1   . THR A  1  18  ? 66.447  76.173  25.196  1.00 93.42  ? 18   THR A OG1   1 
ATOM   130   C  CG2   . THR A  1  18  ? 64.390  75.004  24.691  1.00 91.52  ? 18   THR A CG2   1 
ATOM   131   N  N     . LEU A  1  19  ? 65.325  71.931  23.937  1.00 90.57  ? 19   LEU A N     1 
ATOM   132   C  CA    . LEU A  1  19  ? 65.066  70.908  22.930  1.00 90.30  ? 19   LEU A CA    1 
ATOM   133   C  C     . LEU A  1  19  ? 64.091  71.408  21.865  1.00 91.49  ? 19   LEU A C     1 
ATOM   134   O  O     . LEU A  1  19  ? 63.445  72.430  22.046  1.00 91.97  ? 19   LEU A O     1 
ATOM   135   C  CB    . LEU A  1  19  ? 64.524  69.643  23.597  1.00 88.83  ? 19   LEU A CB    1 
ATOM   136   C  CG    . LEU A  1  19  ? 65.415  69.016  24.678  1.00 88.37  ? 19   LEU A CG    1 
ATOM   137   C  CD1   . LEU A  1  19  ? 64.814  67.713  25.183  1.00 88.67  ? 19   LEU A CD1   1 
ATOM   138   C  CD2   . LEU A  1  19  ? 66.777  68.752  24.110  1.00 87.44  ? 19   LEU A CD2   1 
ATOM   139   N  N     . ASP A  1  20  ? 63.989  70.682  20.755  1.00 93.66  ? 20   ASP A N     1 
ATOM   140   C  CA    . ASP A  1  20  ? 63.108  71.057  19.643  1.00 95.56  ? 20   ASP A CA    1 
ATOM   141   C  C     . ASP A  1  20  ? 61.631  71.088  20.013  1.00 95.46  ? 20   ASP A C     1 
ATOM   142   O  O     . ASP A  1  20  ? 60.820  71.707  19.318  1.00 96.14  ? 20   ASP A O     1 
ATOM   143   C  CB    . ASP A  1  20  ? 63.282  70.087  18.474  1.00 98.24  ? 20   ASP A CB    1 
ATOM   144   C  CG    . ASP A  1  20  ? 64.711  70.014  17.978  1.00 101.29 ? 20   ASP A CG    1 
ATOM   145   O  OD1   . ASP A  1  20  ? 64.990  69.127  17.140  1.00 103.29 ? 20   ASP A OD1   1 
ATOM   146   O  OD2   . ASP A  1  20  ? 65.552  70.838  18.414  1.00 102.83 ? 20   ASP A OD2   1 
ATOM   147   N  N     . ASN A  1  21  ? 61.282  70.396  21.090  1.00 94.87  ? 21   ASN A N     1 
ATOM   148   C  CA    . ASN A  1  21  ? 59.902  70.342  21.549  1.00 94.06  ? 21   ASN A CA    1 
ATOM   149   C  C     . ASN A  1  21  ? 59.585  71.573  22.394  1.00 92.77  ? 21   ASN A C     1 
ATOM   150   O  O     . ASN A  1  21  ? 58.425  71.968  22.520  1.00 92.10  ? 21   ASN A O     1 
ATOM   151   C  CB    . ASN A  1  21  ? 59.674  69.056  22.357  1.00 95.38  ? 21   ASN A CB    1 
ATOM   152   C  CG    . ASN A  1  21  ? 60.579  68.957  23.584  1.00 96.26  ? 21   ASN A CG    1 
ATOM   153   O  OD1   . ASN A  1  21  ? 61.727  69.407  23.570  1.00 96.23  ? 21   ASN A OD1   1 
ATOM   154   N  ND2   . ASN A  1  21  ? 60.066  68.346  24.645  1.00 96.61  ? 21   ASN A ND2   1 
ATOM   155   N  N     . GLY A  1  22  ? 60.631  72.179  22.955  1.00 91.34  ? 22   GLY A N     1 
ATOM   156   C  CA    . GLY A  1  22  ? 60.468  73.362  23.785  1.00 90.09  ? 22   GLY A CA    1 
ATOM   157   C  C     . GLY A  1  22  ? 61.005  73.187  25.199  1.00 89.09  ? 22   GLY A C     1 
ATOM   158   O  O     . GLY A  1  22  ? 61.321  74.163  25.895  1.00 89.22  ? 22   GLY A O     1 
ATOM   159   N  N     . LEU A  1  23  ? 61.100  71.933  25.627  1.00 87.20  ? 23   LEU A N     1 
ATOM   160   C  CA    . LEU A  1  23  ? 61.597  71.625  26.949  1.00 85.34  ? 23   LEU A CA    1 
ATOM   161   C  C     . LEU A  1  23  ? 62.938  72.294  27.182  1.00 85.21  ? 23   LEU A C     1 
ATOM   162   O  O     . LEU A  1  23  ? 63.796  72.332  26.306  1.00 84.46  ? 23   LEU A O     1 
ATOM   163   C  CB    . LEU A  1  23  ? 61.755  70.124  27.113  1.00 84.24  ? 23   LEU A CB    1 
ATOM   164   C  CG    . LEU A  1  23  ? 62.030  69.736  28.558  1.00 84.08  ? 23   LEU A CG    1 
ATOM   165   C  CD1   . LEU A  1  23  ? 60.771  70.005  29.365  1.00 83.77  ? 23   LEU A CD1   1 
ATOM   166   C  CD2   . LEU A  1  23  ? 62.425  68.275  28.653  1.00 83.19  ? 23   LEU A CD2   1 
ATOM   167   N  N     . ARG A  1  24  ? 63.112  72.835  28.373  1.00 86.02  ? 24   ARG A N     1 
ATOM   168   C  CA    . ARG A  1  24  ? 64.356  73.492  28.708  1.00 87.01  ? 24   ARG A CA    1 
ATOM   169   C  C     . ARG A  1  24  ? 65.036  72.721  29.814  1.00 86.59  ? 24   ARG A C     1 
ATOM   170   O  O     . ARG A  1  24  ? 64.482  72.550  30.899  1.00 87.53  ? 24   ARG A O     1 
ATOM   171   C  CB    . ARG A  1  24  ? 64.094  74.928  29.145  1.00 88.54  ? 24   ARG A CB    1 
ATOM   172   C  CG    . ARG A  1  24  ? 63.616  75.814  28.016  1.00 91.01  ? 24   ARG A CG    1 
ATOM   173   C  CD    . ARG A  1  24  ? 63.278  77.188  28.531  1.00 92.58  ? 24   ARG A CD    1 
ATOM   174   N  NE    . ARG A  1  24  ? 62.052  77.170  29.316  1.00 95.24  ? 24   ARG A NE    1 
ATOM   175   C  CZ    . ARG A  1  24  ? 61.644  78.179  30.075  1.00 96.66  ? 24   ARG A CZ    1 
ATOM   176   N  NH1   . ARG A  1  24  ? 62.374  79.287  30.153  1.00 97.12  ? 24   ARG A NH1   1 
ATOM   177   N  NH2   . ARG A  1  24  ? 60.506  78.081  30.750  1.00 97.84  ? 24   ARG A NH2   1 
ATOM   178   N  N     . VAL A  1  25  ? 66.239  72.246  29.521  1.00 85.52  ? 25   VAL A N     1 
ATOM   179   C  CA    . VAL A  1  25  ? 67.013  71.479  30.478  1.00 83.26  ? 25   VAL A CA    1 
ATOM   180   C  C     . VAL A  1  25  ? 68.104  72.375  31.061  1.00 82.25  ? 25   VAL A C     1 
ATOM   181   O  O     . VAL A  1  25  ? 68.817  73.065  30.327  1.00 81.48  ? 25   VAL A O     1 
ATOM   182   C  CB    . VAL A  1  25  ? 67.638  70.239  29.790  1.00 82.17  ? 25   VAL A CB    1 
ATOM   183   C  CG1   . VAL A  1  25  ? 68.242  69.313  30.829  1.00 82.34  ? 25   VAL A CG1   1 
ATOM   184   C  CG2   . VAL A  1  25  ? 66.580  69.510  28.965  1.00 79.61  ? 25   VAL A CG2   1 
ATOM   185   N  N     . ALA A  1  26  ? 68.217  72.375  32.384  1.00 80.88  ? 26   ALA A N     1 
ATOM   186   C  CA    . ALA A  1  26  ? 69.221  73.188  33.050  1.00 81.04  ? 26   ALA A CA    1 
ATOM   187   C  C     . ALA A  1  26  ? 69.794  72.477  34.269  1.00 80.93  ? 26   ALA A C     1 
ATOM   188   O  O     . ALA A  1  26  ? 69.144  71.619  34.862  1.00 80.41  ? 26   ALA A O     1 
ATOM   189   C  CB    . ALA A  1  26  ? 68.626  74.521  33.452  1.00 81.36  ? 26   ALA A CB    1 
ATOM   190   N  N     . SER A  1  27  ? 71.009  72.844  34.654  1.00 81.38  ? 27   SER A N     1 
ATOM   191   C  CA    . SER A  1  27  ? 71.634  72.194  35.786  1.00 82.59  ? 27   SER A CA    1 
ATOM   192   C  C     . SER A  1  27  ? 72.872  72.901  36.302  1.00 84.30  ? 27   SER A C     1 
ATOM   193   O  O     . SER A  1  27  ? 73.515  73.666  35.589  1.00 84.40  ? 27   SER A O     1 
ATOM   194   C  CB    . SER A  1  27  ? 72.017  70.775  35.392  1.00 82.87  ? 27   SER A CB    1 
ATOM   195   O  OG    . SER A  1  27  ? 72.909  70.794  34.290  1.00 81.59  ? 27   SER A OG    1 
ATOM   196   N  N     . GLU A  1  28  ? 73.191  72.632  37.560  1.00 86.29  ? 28   GLU A N     1 
ATOM   197   C  CA    . GLU A  1  28  ? 74.368  73.187  38.195  1.00 89.46  ? 28   GLU A CA    1 
ATOM   198   C  C     . GLU A  1  28  ? 75.121  71.986  38.708  1.00 92.36  ? 28   GLU A C     1 
ATOM   199   O  O     . GLU A  1  28  ? 74.649  71.283  39.606  1.00 93.41  ? 28   GLU A O     1 
ATOM   200   C  CB    . GLU A  1  28  ? 73.996  74.086  39.355  1.00 89.99  ? 28   GLU A CB    1 
ATOM   201   C  CG    . GLU A  1  28  ? 75.179  74.425  40.226  1.00 91.56  ? 28   GLU A CG    1 
ATOM   202   C  CD    . GLU A  1  28  ? 74.945  75.670  41.049  1.00 92.96  ? 28   GLU A CD    1 
ATOM   203   O  OE1   . GLU A  1  28  ? 74.760  76.752  40.439  1.00 92.20  ? 28   GLU A OE1   1 
ATOM   204   O  OE2   . GLU A  1  28  ? 74.948  75.563  42.298  1.00 92.98  ? 28   GLU A OE2   1 
ATOM   205   N  N     . GLU A  1  29  ? 76.300  71.765  38.135  1.00 94.99  ? 29   GLU A N     1 
ATOM   206   C  CA    . GLU A  1  29  ? 77.135  70.615  38.469  1.00 96.40  ? 29   GLU A CA    1 
ATOM   207   C  C     . GLU A  1  29  ? 78.019  70.766  39.703  1.00 96.45  ? 29   GLU A C     1 
ATOM   208   O  O     . GLU A  1  29  ? 78.820  71.698  39.801  1.00 96.33  ? 29   GLU A O     1 
ATOM   209   C  CB    . GLU A  1  29  ? 77.997  70.273  37.251  1.00 97.71  ? 29   GLU A CB    1 
ATOM   210   C  CG    . GLU A  1  29  ? 78.496  68.843  37.205  1.00 99.52  ? 29   GLU A CG    1 
ATOM   211   C  CD    . GLU A  1  29  ? 79.017  68.471  35.832  1.00 100.17 ? 29   GLU A CD    1 
ATOM   212   O  OE1   . GLU A  1  29  ? 78.239  68.567  34.854  1.00 100.03 ? 29   GLU A OE1   1 
ATOM   213   O  OE2   . GLU A  1  29  ? 80.201  68.085  35.732  1.00 101.31 ? 29   GLU A OE2   1 
ATOM   214   N  N     . SER A  1  30  ? 77.859  69.843  40.644  1.00 96.52  ? 30   SER A N     1 
ATOM   215   C  CA    . SER A  1  30  ? 78.669  69.842  41.854  1.00 98.09  ? 30   SER A CA    1 
ATOM   216   C  C     . SER A  1  30  ? 79.299  68.457  41.921  1.00 99.29  ? 30   SER A C     1 
ATOM   217   O  O     . SER A  1  30  ? 78.917  67.567  41.158  1.00 99.25  ? 30   SER A O     1 
ATOM   218   C  CB    . SER A  1  30  ? 77.812  70.091  43.100  1.00 98.59  ? 30   SER A CB    1 
ATOM   219   O  OG    . SER A  1  30  ? 77.262  68.887  43.618  1.00 98.42  ? 30   SER A OG    1 
ATOM   220   N  N     . SER A  1  31  ? 80.263  68.275  42.821  1.00 100.38 ? 31   SER A N     1 
ATOM   221   C  CA    . SER A  1  31  ? 80.942  66.988  42.969  1.00 100.93 ? 31   SER A CA    1 
ATOM   222   C  C     . SER A  1  31  ? 80.088  66.007  43.764  1.00 101.37 ? 31   SER A C     1 
ATOM   223   O  O     . SER A  1  31  ? 80.389  64.817  43.843  1.00 101.56 ? 31   SER A O     1 
ATOM   224   C  CB    . SER A  1  31  ? 82.279  67.182  43.681  1.00 101.04 ? 31   SER A CB    1 
ATOM   225   O  OG    . SER A  1  31  ? 82.078  67.555  45.033  1.00 100.07 ? 31   SER A OG    1 
ATOM   226   N  N     . GLN A  1  32  ? 79.022  66.526  44.354  1.00 102.03 ? 32   GLN A N     1 
ATOM   227   C  CA    . GLN A  1  32  ? 78.105  65.737  45.160  1.00 102.38 ? 32   GLN A CA    1 
ATOM   228   C  C     . GLN A  1  32  ? 77.830  64.342  44.578  1.00 101.68 ? 32   GLN A C     1 
ATOM   229   O  O     . GLN A  1  32  ? 77.479  64.202  43.404  1.00 101.38 ? 32   GLN A O     1 
ATOM   230   C  CB    . GLN A  1  32  ? 76.789  66.507  45.309  1.00 103.83 ? 32   GLN A CB    1 
ATOM   231   C  CG    . GLN A  1  32  ? 76.033  66.224  46.591  1.00 106.55 ? 32   GLN A CG    1 
ATOM   232   C  CD    . GLN A  1  32  ? 76.707  66.832  47.807  1.00 107.90 ? 32   GLN A CD    1 
ATOM   233   O  OE1   . GLN A  1  32  ? 76.991  68.037  47.834  1.00 107.95 ? 32   GLN A OE1   1 
ATOM   234   N  NE2   . GLN A  1  32  ? 76.963  66.005  48.824  1.00 108.09 ? 32   GLN A NE2   1 
ATOM   235   N  N     . PRO A  1  33  ? 77.996  63.290  45.399  1.00 101.23 ? 33   PRO A N     1 
ATOM   236   C  CA    . PRO A  1  33  ? 77.762  61.899  44.984  1.00 100.54 ? 33   PRO A CA    1 
ATOM   237   C  C     . PRO A  1  33  ? 76.266  61.649  44.837  1.00 100.09 ? 33   PRO A C     1 
ATOM   238   O  O     . PRO A  1  33  ? 75.820  60.787  44.082  1.00 99.21  ? 33   PRO A O     1 
ATOM   239   C  CB    . PRO A  1  33  ? 78.360  61.099  46.132  1.00 100.63 ? 33   PRO A CB    1 
ATOM   240   C  CG    . PRO A  1  33  ? 78.081  61.975  47.316  1.00 100.97 ? 33   PRO A CG    1 
ATOM   241   C  CD    . PRO A  1  33  ? 78.473  63.343  46.793  1.00 100.92 ? 33   PRO A CD    1 
ATOM   242   N  N     . THR A  1  34  ? 75.502  62.426  45.590  1.00 100.99 ? 34   THR A N     1 
ATOM   243   C  CA    . THR A  1  34  ? 74.050  62.358  45.586  1.00 100.33 ? 34   THR A CA    1 
ATOM   244   C  C     . THR A  1  34  ? 73.540  63.568  44.803  1.00 99.33  ? 34   THR A C     1 
ATOM   245   O  O     . THR A  1  34  ? 74.308  64.487  44.513  1.00 98.31  ? 34   THR A O     1 
ATOM   246   C  CB    . THR A  1  34  ? 73.514  62.384  47.033  1.00 100.52 ? 34   THR A CB    1 
ATOM   247   O  OG1   . THR A  1  34  ? 72.107  62.642  47.016  1.00 102.01 ? 34   THR A OG1   1 
ATOM   248   C  CG2   . THR A  1  34  ? 74.238  63.448  47.861  1.00 98.95  ? 34   THR A CG2   1 
ATOM   249   N  N     . CYS A  1  35  ? 72.261  63.573  44.442  1.00 99.30  ? 35   CYS A N     1 
ATOM   250   C  CA    . CYS A  1  35  ? 71.719  64.703  43.681  1.00 99.50  ? 35   CYS A CA    1 
ATOM   251   C  C     . CYS A  1  35  ? 70.191  64.861  43.738  1.00 99.92  ? 35   CYS A C     1 
ATOM   252   O  O     . CYS A  1  35  ? 69.492  64.189  44.512  1.00 100.34 ? 35   CYS A O     1 
ATOM   253   C  CB    . CYS A  1  35  ? 72.145  64.594  42.211  1.00 98.19  ? 35   CYS A CB    1 
ATOM   254   S  SG    . CYS A  1  35  ? 71.284  63.273  41.306  1.00 94.38  ? 35   CYS A SG    1 
ATOM   255   N  N     . THR A  1  36  ? 69.693  65.776  42.908  1.00 99.25  ? 36   THR A N     1 
ATOM   256   C  CA    . THR A  1  36  ? 68.268  66.056  42.799  1.00 97.96  ? 36   THR A CA    1 
ATOM   257   C  C     . THR A  1  36  ? 67.971  66.506  41.372  1.00 96.51  ? 36   THR A C     1 
ATOM   258   O  O     . THR A  1  36  ? 68.709  67.309  40.792  1.00 95.44  ? 36   THR A O     1 
ATOM   259   C  CB    . THR A  1  36  ? 67.820  67.175  43.773  1.00 98.96  ? 36   THR A CB    1 
ATOM   260   O  OG1   . THR A  1  36  ? 68.116  66.788  45.119  1.00 100.03 ? 36   THR A OG1   1 
ATOM   261   C  CG2   . THR A  1  36  ? 66.319  67.416  43.660  1.00 99.66  ? 36   THR A CG2   1 
ATOM   262   N  N     . VAL A  1  37  ? 66.902  65.957  40.807  1.00 95.39  ? 37   VAL A N     1 
ATOM   263   C  CA    . VAL A  1  37  ? 66.469  66.300  39.457  1.00 95.50  ? 37   VAL A CA    1 
ATOM   264   C  C     . VAL A  1  37  ? 64.957  66.307  39.444  1.00 95.00  ? 37   VAL A C     1 
ATOM   265   O  O     . VAL A  1  37  ? 64.319  65.470  40.090  1.00 95.68  ? 37   VAL A O     1 
ATOM   266   C  CB    . VAL A  1  37  ? 66.942  65.276  38.384  1.00 95.83  ? 37   VAL A CB    1 
ATOM   267   C  CG1   . VAL A  1  37  ? 68.440  65.176  38.397  1.00 96.78  ? 37   VAL A CG1   1 
ATOM   268   C  CG2   . VAL A  1  37  ? 66.310  63.912  38.622  1.00 95.10  ? 37   VAL A CG2   1 
ATOM   269   N  N     . GLY A  1  38  ? 64.381  67.247  38.706  1.00 93.52  ? 38   GLY A N     1 
ATOM   270   C  CA    . GLY A  1  38  ? 62.938  67.314  38.637  1.00 91.21  ? 38   GLY A CA    1 
ATOM   271   C  C     . GLY A  1  38  ? 62.447  68.214  37.530  1.00 89.55  ? 38   GLY A C     1 
ATOM   272   O  O     . GLY A  1  38  ? 63.214  68.982  36.937  1.00 88.53  ? 38   GLY A O     1 
ATOM   273   N  N     . VAL A  1  39  ? 61.153  68.105  37.250  1.00 87.68  ? 39   VAL A N     1 
ATOM   274   C  CA    . VAL A  1  39  ? 60.518  68.912  36.226  1.00 86.18  ? 39   VAL A CA    1 
ATOM   275   C  C     . VAL A  1  39  ? 59.625  69.987  36.873  1.00 84.80  ? 39   VAL A C     1 
ATOM   276   O  O     . VAL A  1  39  ? 58.661  69.676  37.572  1.00 84.28  ? 39   VAL A O     1 
ATOM   277   C  CB    . VAL A  1  39  ? 59.688  68.015  35.261  1.00 86.36  ? 39   VAL A CB    1 
ATOM   278   C  CG1   . VAL A  1  39  ? 58.645  67.241  36.021  1.00 86.26  ? 39   VAL A CG1   1 
ATOM   279   C  CG2   . VAL A  1  39  ? 59.031  68.865  34.198  1.00 87.10  ? 39   VAL A CG2   1 
ATOM   280   N  N     . TRP A  1  40  ? 59.982  71.251  36.654  1.00 83.60  ? 40   TRP A N     1 
ATOM   281   C  CA    . TRP A  1  40  ? 59.240  72.391  37.185  1.00 82.44  ? 40   TRP A CA    1 
ATOM   282   C  C     . TRP A  1  40  ? 58.304  72.950  36.127  1.00 81.61  ? 40   TRP A C     1 
ATOM   283   O  O     . TRP A  1  40  ? 58.707  73.734  35.276  1.00 81.59  ? 40   TRP A O     1 
ATOM   284   C  CB    . TRP A  1  40  ? 60.205  73.484  37.647  1.00 82.94  ? 40   TRP A CB    1 
ATOM   285   C  CG    . TRP A  1  40  ? 60.613  73.315  39.060  1.00 84.67  ? 40   TRP A CG    1 
ATOM   286   C  CD1   . TRP A  1  40  ? 60.005  73.849  40.152  1.00 85.76  ? 40   TRP A CD1   1 
ATOM   287   C  CD2   . TRP A  1  40  ? 61.651  72.474  39.552  1.00 85.80  ? 40   TRP A CD2   1 
ATOM   288   N  NE1   . TRP A  1  40  ? 60.595  73.390  41.301  1.00 85.82  ? 40   TRP A NE1   1 
ATOM   289   C  CE2   . TRP A  1  40  ? 61.610  72.541  40.961  1.00 86.41  ? 40   TRP A CE2   1 
ATOM   290   C  CE3   . TRP A  1  40  ? 62.613  71.662  38.939  1.00 86.61  ? 40   TRP A CE3   1 
ATOM   291   C  CZ2   . TRP A  1  40  ? 62.489  71.829  41.769  1.00 88.12  ? 40   TRP A CZ2   1 
ATOM   292   C  CZ3   . TRP A  1  40  ? 63.489  70.951  39.740  1.00 87.98  ? 40   TRP A CZ3   1 
ATOM   293   C  CH2   . TRP A  1  40  ? 63.421  71.039  41.144  1.00 89.30  ? 40   TRP A CH2   1 
ATOM   294   N  N     . ILE A  1  41  ? 57.048  72.535  36.187  1.00 80.46  ? 41   ILE A N     1 
ATOM   295   C  CA    . ILE A  1  41  ? 56.049  72.981  35.238  1.00 78.98  ? 41   ILE A CA    1 
ATOM   296   C  C     . ILE A  1  41  ? 55.519  74.369  35.595  1.00 79.27  ? 41   ILE A C     1 
ATOM   297   O  O     . ILE A  1  41  ? 55.454  74.751  36.765  1.00 78.74  ? 41   ILE A O     1 
ATOM   298   C  CB    . ILE A  1  41  ? 54.867  71.996  35.201  1.00 78.59  ? 41   ILE A CB    1 
ATOM   299   C  CG1   . ILE A  1  41  ? 55.396  70.564  35.120  1.00 77.50  ? 41   ILE A CG1   1 
ATOM   300   C  CG2   . ILE A  1  41  ? 53.966  72.298  34.005  1.00 78.17  ? 41   ILE A CG2   1 
ATOM   301   C  CD1   . ILE A  1  41  ? 54.324  69.498  35.285  1.00 77.17  ? 41   ILE A CD1   1 
ATOM   302   N  N     . GLY A  1  42  ? 55.156  75.122  34.564  1.00 79.58  ? 42   GLY A N     1 
ATOM   303   C  CA    . GLY A  1  42  ? 54.605  76.446  34.758  1.00 79.85  ? 42   GLY A CA    1 
ATOM   304   C  C     . GLY A  1  42  ? 53.092  76.327  34.728  1.00 80.85  ? 42   GLY A C     1 
ATOM   305   O  O     . GLY A  1  42  ? 52.431  76.828  33.820  1.00 81.35  ? 42   GLY A O     1 
ATOM   306   N  N     . ALA A  1  43  ? 52.549  75.632  35.722  1.00 81.36  ? 43   ALA A N     1 
ATOM   307   C  CA    . ALA A  1  43  ? 51.111  75.428  35.844  1.00 80.91  ? 43   ALA A CA    1 
ATOM   308   C  C     . ALA A  1  43  ? 50.729  75.467  37.322  1.00 80.45  ? 43   ALA A C     1 
ATOM   309   O  O     . ALA A  1  43  ? 51.563  75.205  38.189  1.00 81.19  ? 43   ALA A O     1 
ATOM   310   C  CB    . ALA A  1  43  ? 50.718  74.088  35.239  1.00 81.16  ? 43   ALA A CB    1 
ATOM   311   N  N     . GLY A  1  44  ? 49.468  75.799  37.598  1.00 79.25  ? 44   GLY A N     1 
ATOM   312   C  CA    . GLY A  1  44  ? 48.985  75.871  38.966  1.00 76.18  ? 44   GLY A CA    1 
ATOM   313   C  C     . GLY A  1  44  ? 47.489  76.099  38.999  1.00 74.51  ? 44   GLY A C     1 
ATOM   314   O  O     . GLY A  1  44  ? 46.811  75.930  37.989  1.00 74.81  ? 44   GLY A O     1 
ATOM   315   N  N     . SER A  1  45  ? 46.968  76.490  40.155  1.00 72.77  ? 45   SER A N     1 
ATOM   316   C  CA    . SER A  1  45  ? 45.538  76.742  40.292  1.00 70.14  ? 45   SER A CA    1 
ATOM   317   C  C     . SER A  1  45  ? 45.140  78.014  39.558  1.00 68.82  ? 45   SER A C     1 
ATOM   318   O  O     . SER A  1  45  ? 43.959  78.238  39.285  1.00 69.64  ? 45   SER A O     1 
ATOM   319   C  CB    . SER A  1  45  ? 45.160  76.868  41.765  1.00 69.76  ? 45   SER A CB    1 
ATOM   320   O  OG    . SER A  1  45  ? 45.941  77.873  42.385  1.00 71.09  ? 45   SER A OG    1 
ATOM   321   N  N     . ARG A  1  46  ? 46.115  78.860  39.240  1.00 66.30  ? 46   ARG A N     1 
ATOM   322   C  CA    . ARG A  1  46  ? 45.779  80.079  38.527  1.00 64.75  ? 46   ARG A CA    1 
ATOM   323   C  C     . ARG A  1  46  ? 45.408  79.749  37.109  1.00 65.26  ? 46   ARG A C     1 
ATOM   324   O  O     . ARG A  1  46  ? 44.680  80.502  36.472  1.00 66.82  ? 46   ARG A O     1 
ATOM   325   C  CB    . ARG A  1  46  ? 46.922  81.081  38.488  1.00 62.45  ? 46   ARG A CB    1 
ATOM   326   C  CG    . ARG A  1  46  ? 46.504  82.317  37.728  1.00 59.05  ? 46   ARG A CG    1 
ATOM   327   C  CD    . ARG A  1  46  ? 47.560  83.389  37.708  1.00 59.74  ? 46   ARG A CD    1 
ATOM   328   N  NE    . ARG A  1  46  ? 47.065  84.567  36.997  1.00 58.65  ? 46   ARG A NE    1 
ATOM   329   C  CZ    . ARG A  1  46  ? 47.763  85.683  36.821  1.00 56.83  ? 46   ARG A CZ    1 
ATOM   330   N  NH1   . ARG A  1  46  ? 48.998  85.782  37.301  1.00 55.94  ? 46   ARG A NH1   1 
ATOM   331   N  NH2   . ARG A  1  46  ? 47.216  86.698  36.172  1.00 54.75  ? 46   ARG A NH2   1 
ATOM   332   N  N     . TYR A  1  47  ? 45.922  78.629  36.609  1.00 64.81  ? 47   TYR A N     1 
ATOM   333   C  CA    . TYR A  1  47  ? 45.618  78.213  35.249  1.00 63.69  ? 47   TYR A CA    1 
ATOM   334   C  C     . TYR A  1  47  ? 44.294  77.507  35.230  1.00 63.58  ? 47   TYR A C     1 
ATOM   335   O  O     . TYR A  1  47  ? 43.675  77.398  34.179  1.00 64.00  ? 47   TYR A O     1 
ATOM   336   C  CB    . TYR A  1  47  ? 46.691  77.282  34.688  1.00 62.53  ? 47   TYR A CB    1 
ATOM   337   C  CG    . TYR A  1  47  ? 48.011  77.966  34.467  1.00 61.91  ? 47   TYR A CG    1 
ATOM   338   C  CD1   . TYR A  1  47  ? 48.901  78.156  35.516  1.00 62.61  ? 47   TYR A CD1   1 
ATOM   339   C  CD2   . TYR A  1  47  ? 48.358  78.454  33.217  1.00 61.48  ? 47   TYR A CD2   1 
ATOM   340   C  CE1   . TYR A  1  47  ? 50.108  78.815  35.327  1.00 63.14  ? 47   TYR A CE1   1 
ATOM   341   C  CE2   . TYR A  1  47  ? 49.559  79.117  33.011  1.00 62.16  ? 47   TYR A CE2   1 
ATOM   342   C  CZ    . TYR A  1  47  ? 50.434  79.297  34.070  1.00 63.18  ? 47   TYR A CZ    1 
ATOM   343   O  OH    . TYR A  1  47  ? 51.631  79.965  33.883  1.00 63.02  ? 47   TYR A OH    1 
ATOM   344   N  N     . GLU A  1  48  ? 43.859  77.020  36.387  1.00 63.54  ? 48   GLU A N     1 
ATOM   345   C  CA    . GLU A  1  48  ? 42.586  76.328  36.446  1.00 64.03  ? 48   GLU A CA    1 
ATOM   346   C  C     . GLU A  1  48  ? 41.543  77.421  36.385  1.00 65.77  ? 48   GLU A C     1 
ATOM   347   O  O     . GLU A  1  48  ? 41.828  78.578  36.710  1.00 65.05  ? 48   GLU A O     1 
ATOM   348   C  CB    . GLU A  1  48  ? 42.422  75.555  37.757  1.00 62.95  ? 48   GLU A CB    1 
ATOM   349   C  CG    . GLU A  1  48  ? 43.682  74.883  38.276  1.00 64.70  ? 48   GLU A CG    1 
ATOM   350   C  CD    . GLU A  1  48  ? 43.470  74.186  39.620  1.00 65.63  ? 48   GLU A CD    1 
ATOM   351   O  OE1   . GLU A  1  48  ? 42.766  74.764  40.472  1.00 67.20  ? 48   GLU A OE1   1 
ATOM   352   O  OE2   . GLU A  1  48  ? 44.010  73.074  39.838  1.00 64.76  ? 48   GLU A OE2   1 
ATOM   353   N  N     . ASN A  1  49  ? 40.346  77.057  35.939  1.00 67.51  ? 49   ASN A N     1 
ATOM   354   C  CA    . ASN A  1  49  ? 39.252  77.997  35.881  1.00 69.04  ? 49   ASN A CA    1 
ATOM   355   C  C     . ASN A  1  49  ? 38.277  77.557  36.968  1.00 71.41  ? 49   ASN A C     1 
ATOM   356   O  O     . ASN A  1  49  ? 38.629  76.734  37.811  1.00 72.60  ? 49   ASN A O     1 
ATOM   357   C  CB    . ASN A  1  49  ? 38.625  78.003  34.485  1.00 68.49  ? 49   ASN A CB    1 
ATOM   358   C  CG    . ASN A  1  49  ? 37.849  76.749  34.164  1.00 69.10  ? 49   ASN A CG    1 
ATOM   359   O  OD1   . ASN A  1  49  ? 37.488  76.538  33.008  1.00 71.58  ? 49   ASN A OD1   1 
ATOM   360   N  ND2   . ASN A  1  49  ? 37.566  75.924  35.167  1.00 68.19  ? 49   ASN A ND2   1 
ATOM   361   N  N     . GLU A  1  50  ? 37.060  78.080  36.959  1.00 74.62  ? 50   GLU A N     1 
ATOM   362   C  CA    . GLU A  1  50  ? 36.076  77.734  37.986  1.00 76.52  ? 50   GLU A CA    1 
ATOM   363   C  C     . GLU A  1  50  ? 35.570  76.282  37.994  1.00 74.95  ? 50   GLU A C     1 
ATOM   364   O  O     . GLU A  1  50  ? 35.288  75.721  39.053  1.00 72.26  ? 50   GLU A O     1 
ATOM   365   C  CB    . GLU A  1  50  ? 34.900  78.720  37.891  1.00 82.01  ? 50   GLU A CB    1 
ATOM   366   C  CG    . GLU A  1  50  ? 33.725  78.423  38.800  1.00 89.33  ? 50   GLU A CG    1 
ATOM   367   C  CD    . GLU A  1  50  ? 32.786  77.401  38.187  1.00 94.67  ? 50   GLU A CD    1 
ATOM   368   O  OE1   . GLU A  1  50  ? 32.173  77.718  37.138  1.00 96.25  ? 50   GLU A OE1   1 
ATOM   369   O  OE2   . GLU A  1  50  ? 32.669  76.281  38.746  1.00 99.22  ? 50   GLU A OE2   1 
ATOM   370   N  N     . LYS A  1  51  ? 35.473  75.668  36.822  1.00 75.32  ? 51   LYS A N     1 
ATOM   371   C  CA    . LYS A  1  51  ? 34.980  74.301  36.733  1.00 76.53  ? 51   LYS A CA    1 
ATOM   372   C  C     . LYS A  1  51  ? 35.958  73.224  37.164  1.00 76.32  ? 51   LYS A C     1 
ATOM   373   O  O     . LYS A  1  51  ? 35.543  72.166  37.638  1.00 76.16  ? 51   LYS A O     1 
ATOM   374   C  CB    . LYS A  1  51  ? 34.496  74.010  35.313  1.00 78.85  ? 51   LYS A CB    1 
ATOM   375   C  CG    . LYS A  1  51  ? 33.047  74.420  35.071  1.00 81.28  ? 51   LYS A CG    1 
ATOM   376   C  CD    . LYS A  1  51  ? 32.695  74.386  33.594  1.00 83.29  ? 51   LYS A CD    1 
ATOM   377   C  CE    . LYS A  1  51  ? 33.481  75.446  32.822  1.00 84.49  ? 51   LYS A CE    1 
ATOM   378   N  NZ    . LYS A  1  51  ? 33.173  75.421  31.361  1.00 86.47  ? 51   LYS A NZ    1 
ATOM   379   N  N     . ASN A  1  52  ? 37.253  73.482  37.002  1.00 75.93  ? 52   ASN A N     1 
ATOM   380   C  CA    . ASN A  1  52  ? 38.264  72.501  37.383  1.00 74.12  ? 52   ASN A CA    1 
ATOM   381   C  C     . ASN A  1  52  ? 39.206  72.966  38.498  1.00 73.18  ? 52   ASN A C     1 
ATOM   382   O  O     . ASN A  1  52  ? 40.290  72.426  38.637  1.00 74.27  ? 52   ASN A O     1 
ATOM   383   C  CB    . ASN A  1  52  ? 39.081  72.096  36.156  1.00 73.34  ? 52   ASN A CB    1 
ATOM   384   C  CG    . ASN A  1  52  ? 39.867  73.247  35.585  1.00 73.59  ? 52   ASN A CG    1 
ATOM   385   O  OD1   . ASN A  1  52  ? 39.386  74.370  35.553  1.00 75.27  ? 52   ASN A OD1   1 
ATOM   386   N  ND2   . ASN A  1  52  ? 41.077  72.975  35.117  1.00 74.36  ? 52   ASN A ND2   1 
ATOM   387   N  N     . ASN A  1  53  ? 38.810  73.966  39.281  1.00 71.43  ? 53   ASN A N     1 
ATOM   388   C  CA    . ASN A  1  53  ? 39.652  74.422  40.384  1.00 70.89  ? 53   ASN A CA    1 
ATOM   389   C  C     . ASN A  1  53  ? 39.957  73.181  41.235  1.00 71.43  ? 53   ASN A C     1 
ATOM   390   O  O     . ASN A  1  53  ? 39.050  72.538  41.757  1.00 68.98  ? 53   ASN A O     1 
ATOM   391   C  CB    . ASN A  1  53  ? 38.904  75.465  41.232  1.00 70.61  ? 53   ASN A CB    1 
ATOM   392   C  CG    . ASN A  1  53  ? 39.758  76.043  42.377  1.00 70.13  ? 53   ASN A CG    1 
ATOM   393   O  OD1   . ASN A  1  53  ? 39.230  76.430  43.432  1.00 69.42  ? 53   ASN A OD1   1 
ATOM   394   N  ND2   . ASN A  1  53  ? 41.068  76.121  42.164  1.00 67.43  ? 53   ASN A ND2   1 
ATOM   395   N  N     . GLY A  1  54  ? 41.233  72.840  41.363  1.00 73.08  ? 54   GLY A N     1 
ATOM   396   C  CA    . GLY A  1  54  ? 41.603  71.677  42.146  1.00 76.20  ? 54   GLY A CA    1 
ATOM   397   C  C     . GLY A  1  54  ? 42.133  70.516  41.317  1.00 78.52  ? 54   GLY A C     1 
ATOM   398   O  O     . GLY A  1  54  ? 42.461  69.462  41.856  1.00 78.95  ? 54   GLY A O     1 
ATOM   399   N  N     . ALA A  1  55  ? 42.205  70.692  40.002  1.00 80.15  ? 55   ALA A N     1 
ATOM   400   C  CA    . ALA A  1  55  ? 42.722  69.649  39.126  1.00 80.52  ? 55   ALA A CA    1 
ATOM   401   C  C     . ALA A  1  55  ? 44.217  69.436  39.425  1.00 81.11  ? 55   ALA A C     1 
ATOM   402   O  O     . ALA A  1  55  ? 44.629  68.362  39.874  1.00 81.88  ? 55   ALA A O     1 
ATOM   403   C  CB    . ALA A  1  55  ? 42.528  70.047  37.670  1.00 80.00  ? 55   ALA A CB    1 
ATOM   404   N  N     . GLY A  1  56  ? 45.024  70.465  39.190  1.00 80.30  ? 56   GLY A N     1 
ATOM   405   C  CA    . GLY A  1  56  ? 46.449  70.345  39.441  1.00 80.15  ? 56   GLY A CA    1 
ATOM   406   C  C     . GLY A  1  56  ? 46.826  69.717  40.774  1.00 79.16  ? 56   GLY A C     1 
ATOM   407   O  O     . GLY A  1  56  ? 47.938  69.203  40.935  1.00 79.72  ? 56   GLY A O     1 
ATOM   408   N  N     . TYR A  1  57  ? 45.908  69.765  41.732  1.00 77.65  ? 57   TYR A N     1 
ATOM   409   C  CA    . TYR A  1  57  ? 46.156  69.204  43.052  1.00 76.86  ? 57   TYR A CA    1 
ATOM   410   C  C     . TYR A  1  57  ? 45.718  67.752  43.074  1.00 77.19  ? 57   TYR A C     1 
ATOM   411   O  O     . TYR A  1  57  ? 46.353  66.909  43.705  1.00 78.01  ? 57   TYR A O     1 
ATOM   412   C  CB    . TYR A  1  57  ? 45.377  69.981  44.109  1.00 75.90  ? 57   TYR A CB    1 
ATOM   413   C  CG    . TYR A  1  57  ? 45.772  69.653  45.527  1.00 74.30  ? 57   TYR A CG    1 
ATOM   414   C  CD1   . TYR A  1  57  ? 47.056  69.923  45.988  1.00 74.41  ? 57   TYR A CD1   1 
ATOM   415   C  CD2   . TYR A  1  57  ? 44.861  69.088  46.414  1.00 73.63  ? 57   TYR A CD2   1 
ATOM   416   C  CE1   . TYR A  1  57  ? 47.424  69.641  47.303  1.00 73.38  ? 57   TYR A CE1   1 
ATOM   417   C  CE2   . TYR A  1  57  ? 45.218  68.801  47.727  1.00 72.59  ? 57   TYR A CE2   1 
ATOM   418   C  CZ    . TYR A  1  57  ? 46.496  69.083  48.163  1.00 72.19  ? 57   TYR A CZ    1 
ATOM   419   O  OH    . TYR A  1  57  ? 46.837  68.835  49.465  1.00 72.08  ? 57   TYR A OH    1 
ATOM   420   N  N     . PHE A  1  58  ? 44.615  67.471  42.393  1.00 76.80  ? 58   PHE A N     1 
ATOM   421   C  CA    . PHE A  1  58  ? 44.089  66.119  42.316  1.00 75.61  ? 58   PHE A CA    1 
ATOM   422   C  C     . PHE A  1  58  ? 45.111  65.342  41.500  1.00 76.12  ? 58   PHE A C     1 
ATOM   423   O  O     . PHE A  1  58  ? 45.440  64.203  41.817  1.00 77.02  ? 58   PHE A O     1 
ATOM   424   C  CB    . PHE A  1  58  ? 42.728  66.123  41.610  1.00 73.71  ? 58   PHE A CB    1 
ATOM   425   C  CG    . PHE A  1  58  ? 41.807  65.031  42.060  1.00 72.20  ? 58   PHE A CG    1 
ATOM   426   C  CD1   . PHE A  1  58  ? 40.467  65.296  42.293  1.00 71.50  ? 58   PHE A CD1   1 
ATOM   427   C  CD2   . PHE A  1  58  ? 42.277  63.738  42.257  1.00 73.56  ? 58   PHE A CD2   1 
ATOM   428   C  CE1   . PHE A  1  58  ? 39.602  64.295  42.720  1.00 72.25  ? 58   PHE A CE1   1 
ATOM   429   C  CE2   . PHE A  1  58  ? 41.423  62.722  42.685  1.00 73.55  ? 58   PHE A CE2   1 
ATOM   430   C  CZ    . PHE A  1  58  ? 40.079  63.004  42.917  1.00 73.64  ? 58   PHE A CZ    1 
ATOM   431   N  N     . VAL A  1  59  ? 45.625  65.984  40.457  1.00 76.02  ? 59   VAL A N     1 
ATOM   432   C  CA    . VAL A  1  59  ? 46.619  65.372  39.591  1.00 76.11  ? 59   VAL A CA    1 
ATOM   433   C  C     . VAL A  1  59  ? 47.913  65.134  40.368  1.00 76.41  ? 59   VAL A C     1 
ATOM   434   O  O     . VAL A  1  59  ? 48.598  64.130  40.152  1.00 76.22  ? 59   VAL A O     1 
ATOM   435   C  CB    . VAL A  1  59  ? 46.889  66.268  38.356  1.00 75.92  ? 59   VAL A CB    1 
ATOM   436   C  CG1   . VAL A  1  59  ? 48.088  65.766  37.574  1.00 74.55  ? 59   VAL A CG1   1 
ATOM   437   C  CG2   . VAL A  1  59  ? 45.660  66.279  37.468  1.00 75.67  ? 59   VAL A CG2   1 
ATOM   438   N  N     . GLU A  1  60  ? 48.236  66.047  41.283  1.00 76.12  ? 60   GLU A N     1 
ATOM   439   C  CA    . GLU A  1  60  ? 49.446  65.911  42.089  1.00 75.92  ? 60   GLU A CA    1 
ATOM   440   C  C     . GLU A  1  60  ? 49.357  64.619  42.877  1.00 76.41  ? 60   GLU A C     1 
ATOM   441   O  O     . GLU A  1  60  ? 50.349  63.933  43.071  1.00 77.66  ? 60   GLU A O     1 
ATOM   442   C  CB    . GLU A  1  60  ? 49.590  67.073  43.070  1.00 74.64  ? 60   GLU A CB    1 
ATOM   443   C  CG    . GLU A  1  60  ? 50.980  67.194  43.647  1.00 73.71  ? 60   GLU A CG    1 
ATOM   444   C  CD    . GLU A  1  60  ? 50.997  67.824  45.017  1.00 73.65  ? 60   GLU A CD    1 
ATOM   445   O  OE1   . GLU A  1  60  ? 50.529  67.160  45.965  1.00 72.27  ? 60   GLU A OE1   1 
ATOM   446   O  OE2   . GLU A  1  60  ? 51.477  68.973  45.152  1.00 74.19  ? 60   GLU A OE2   1 
ATOM   447   N  N     . HIS A  1  61  ? 48.150  64.294  43.324  1.00 77.31  ? 61   HIS A N     1 
ATOM   448   C  CA    . HIS A  1  61  ? 47.901  63.083  44.100  1.00 78.68  ? 61   HIS A CA    1 
ATOM   449   C  C     . HIS A  1  61  ? 47.980  61.795  43.283  1.00 80.38  ? 61   HIS A C     1 
ATOM   450   O  O     . HIS A  1  61  ? 47.875  60.699  43.834  1.00 81.13  ? 61   HIS A O     1 
ATOM   451   C  CB    . HIS A  1  61  ? 46.516  63.146  44.754  1.00 77.53  ? 61   HIS A CB    1 
ATOM   452   C  CG    . HIS A  1  61  ? 46.475  63.935  46.024  1.00 77.17  ? 61   HIS A CG    1 
ATOM   453   N  ND1   . HIS A  1  61  ? 46.031  63.400  47.215  1.00 76.76  ? 61   HIS A ND1   1 
ATOM   454   C  CD2   . HIS A  1  61  ? 46.804  65.221  46.289  1.00 76.99  ? 61   HIS A CD2   1 
ATOM   455   C  CE1   . HIS A  1  61  ? 46.088  64.322  48.158  1.00 76.43  ? 61   HIS A CE1   1 
ATOM   456   N  NE2   . HIS A  1  61  ? 46.554  65.436  47.622  1.00 77.18  ? 61   HIS A NE2   1 
ATOM   457   N  N     . LEU A  1  62  ? 48.153  61.908  41.973  1.00 81.22  ? 62   LEU A N     1 
ATOM   458   C  CA    . LEU A  1  62  ? 48.200  60.708  41.155  1.00 81.63  ? 62   LEU A CA    1 
ATOM   459   C  C     . LEU A  1  62  ? 49.498  60.525  40.387  1.00 83.22  ? 62   LEU A C     1 
ATOM   460   O  O     . LEU A  1  62  ? 49.788  59.424  39.917  1.00 84.61  ? 62   LEU A O     1 
ATOM   461   C  CB    . LEU A  1  62  ? 47.013  60.686  40.186  1.00 78.91  ? 62   LEU A CB    1 
ATOM   462   C  CG    . LEU A  1  62  ? 45.619  60.540  40.803  1.00 76.59  ? 62   LEU A CG    1 
ATOM   463   C  CD1   . LEU A  1  62  ? 44.565  60.608  39.712  1.00 76.12  ? 62   LEU A CD1   1 
ATOM   464   C  CD2   . LEU A  1  62  ? 45.516  59.224  41.546  1.00 75.73  ? 62   LEU A CD2   1 
ATOM   465   N  N     . ALA A  1  63  ? 50.284  61.589  40.263  1.00 83.56  ? 63   ALA A N     1 
ATOM   466   C  CA    . ALA A  1  63  ? 51.546  61.498  39.543  1.00 84.06  ? 63   ALA A CA    1 
ATOM   467   C  C     . ALA A  1  63  ? 52.478  60.528  40.244  1.00 84.78  ? 63   ALA A C     1 
ATOM   468   O  O     . ALA A  1  63  ? 53.577  60.261  39.768  1.00 86.27  ? 63   ALA A O     1 
ATOM   469   C  CB    . ALA A  1  63  ? 52.201  62.863  39.461  1.00 84.08  ? 63   ALA A CB    1 
ATOM   470   N  N     . PHE A  1  64  ? 52.039  59.994  41.377  1.00 85.01  ? 64   PHE A N     1 
ATOM   471   C  CA    . PHE A  1  64  ? 52.867  59.068  42.133  1.00 84.33  ? 64   PHE A CA    1 
ATOM   472   C  C     . PHE A  1  64  ? 52.226  57.715  42.362  1.00 83.00  ? 64   PHE A C     1 
ATOM   473   O  O     . PHE A  1  64  ? 52.864  56.818  42.893  1.00 82.62  ? 64   PHE A O     1 
ATOM   474   C  CB    . PHE A  1  64  ? 53.237  59.693  43.479  1.00 86.47  ? 64   PHE A CB    1 
ATOM   475   C  CG    . PHE A  1  64  ? 54.202  60.840  43.368  1.00 87.92  ? 64   PHE A CG    1 
ATOM   476   C  CD1   . PHE A  1  64  ? 54.152  61.906  44.268  1.00 88.62  ? 64   PHE A CD1   1 
ATOM   477   C  CD2   . PHE A  1  64  ? 55.160  60.859  42.363  1.00 88.46  ? 64   PHE A CD2   1 
ATOM   478   C  CE1   . PHE A  1  64  ? 55.044  62.975  44.166  1.00 89.01  ? 64   PHE A CE1   1 
ATOM   479   C  CE2   . PHE A  1  64  ? 56.050  61.917  42.251  1.00 89.47  ? 64   PHE A CE2   1 
ATOM   480   C  CZ    . PHE A  1  64  ? 55.995  62.982  43.156  1.00 89.97  ? 64   PHE A CZ    1 
ATOM   481   N  N     . LYS A  1  65  ? 50.966  57.560  41.976  1.00 82.05  ? 65   LYS A N     1 
ATOM   482   C  CA    . LYS A  1  65  ? 50.302  56.277  42.168  1.00 82.11  ? 65   LYS A CA    1 
ATOM   483   C  C     . LYS A  1  65  ? 50.497  55.338  40.977  1.00 82.82  ? 65   LYS A C     1 
ATOM   484   O  O     . LYS A  1  65  ? 49.827  54.298  40.876  1.00 82.10  ? 65   LYS A O     1 
ATOM   485   C  CB    . LYS A  1  65  ? 48.809  56.472  42.477  1.00 80.44  ? 65   LYS A CB    1 
ATOM   486   C  CG    . LYS A  1  65  ? 48.520  56.726  43.955  1.00 78.06  ? 65   LYS A CG    1 
ATOM   487   C  CD    . LYS A  1  65  ? 49.410  57.835  44.481  1.00 78.27  ? 65   LYS A CD    1 
ATOM   488   C  CE    . LYS A  1  65  ? 49.205  58.100  45.956  1.00 77.66  ? 65   LYS A CE    1 
ATOM   489   N  NZ    . LYS A  1  65  ? 50.133  59.182  46.395  1.00 77.53  ? 65   LYS A NZ    1 
ATOM   490   N  N     . GLY A  1  66  ? 51.420  55.712  40.086  1.00 82.46  ? 66   GLY A N     1 
ATOM   491   C  CA    . GLY A  1  66  ? 51.731  54.877  38.939  1.00 82.46  ? 66   GLY A CA    1 
ATOM   492   C  C     . GLY A  1  66  ? 51.407  55.393  37.555  1.00 82.82  ? 66   GLY A C     1 
ATOM   493   O  O     . GLY A  1  66  ? 50.462  56.160  37.377  1.00 81.16  ? 66   GLY A O     1 
ATOM   494   N  N     . THR A  1  67  ? 52.205  54.949  36.577  1.00 84.83  ? 67   THR A N     1 
ATOM   495   C  CA    . THR A  1  67  ? 52.040  55.317  35.166  1.00 86.84  ? 67   THR A CA    1 
ATOM   496   C  C     . THR A  1  67  ? 51.482  54.130  34.372  1.00 89.08  ? 67   THR A C     1 
ATOM   497   O  O     . THR A  1  67  ? 51.251  53.051  34.924  1.00 89.54  ? 67   THR A O     1 
ATOM   498   C  CB    . THR A  1  67  ? 53.382  55.745  34.490  1.00 85.63  ? 67   THR A CB    1 
ATOM   499   O  OG1   . THR A  1  67  ? 54.089  54.588  34.024  1.00 84.07  ? 67   THR A OG1   1 
ATOM   500   C  CG2   . THR A  1  67  ? 54.255  56.511  35.468  1.00 85.13  ? 67   THR A CG2   1 
ATOM   501   N  N     . LYS A  1  68  ? 51.265  54.338  33.075  1.00 91.27  ? 68   LYS A N     1 
ATOM   502   C  CA    . LYS A  1  68  ? 50.734  53.288  32.215  1.00 92.58  ? 68   LYS A CA    1 
ATOM   503   C  C     . LYS A  1  68  ? 51.714  52.127  32.160  1.00 93.75  ? 68   LYS A C     1 
ATOM   504   O  O     . LYS A  1  68  ? 51.335  50.974  32.392  1.00 94.20  ? 68   LYS A O     1 
ATOM   505   C  CB    . LYS A  1  68  ? 50.483  53.830  30.805  1.00 92.32  ? 68   LYS A CB    1 
ATOM   506   C  CG    . LYS A  1  68  ? 49.200  54.623  30.685  1.00 92.09  ? 68   LYS A CG    1 
ATOM   507   C  CD    . LYS A  1  68  ? 49.116  55.383  29.369  1.00 91.89  ? 68   LYS A CD    1 
ATOM   508   C  CE    . LYS A  1  68  ? 47.770  56.091  29.250  1.00 92.15  ? 68   LYS A CE    1 
ATOM   509   N  NZ    . LYS A  1  68  ? 47.659  56.948  28.040  1.00 91.33  ? 68   LYS A NZ    1 
ATOM   510   N  N     . LYS A  1  69  ? 52.977  52.432  31.867  1.00 93.78  ? 69   LYS A N     1 
ATOM   511   C  CA    . LYS A  1  69  ? 53.993  51.392  31.789  1.00 93.80  ? 69   LYS A CA    1 
ATOM   512   C  C     . LYS A  1  69  ? 54.177  50.660  33.122  1.00 93.81  ? 69   LYS A C     1 
ATOM   513   O  O     . LYS A  1  69  ? 54.013  49.439  33.203  1.00 94.20  ? 69   LYS A O     1 
ATOM   514   C  CB    . LYS A  1  69  ? 55.335  51.980  31.345  1.00 93.54  ? 69   LYS A CB    1 
ATOM   515   C  CG    . LYS A  1  69  ? 55.350  52.555  29.934  1.00 94.56  ? 69   LYS A CG    1 
ATOM   516   C  CD    . LYS A  1  69  ? 56.787  52.726  29.425  1.00 95.22  ? 69   LYS A CD    1 
ATOM   517   C  CE    . LYS A  1  69  ? 57.673  53.457  30.452  1.00 96.53  ? 69   LYS A CE    1 
ATOM   518   N  NZ    . LYS A  1  69  ? 59.090  53.691  30.024  1.00 95.35  ? 69   LYS A NZ    1 
ATOM   519   N  N     . ARG A  1  70  ? 54.504  51.412  34.169  1.00 93.25  ? 70   ARG A N     1 
ATOM   520   C  CA    . ARG A  1  70  ? 54.732  50.825  35.485  1.00 90.85  ? 70   ARG A CA    1 
ATOM   521   C  C     . ARG A  1  70  ? 53.709  51.179  36.555  1.00 90.73  ? 70   ARG A C     1 
ATOM   522   O  O     . ARG A  1  70  ? 53.853  52.187  37.242  1.00 90.18  ? 70   ARG A O     1 
ATOM   523   C  CB    . ARG A  1  70  ? 56.135  51.195  35.972  1.00 87.64  ? 70   ARG A CB    1 
ATOM   524   C  CG    . ARG A  1  70  ? 56.476  52.648  35.855  1.00 83.21  ? 70   ARG A CG    1 
ATOM   525   C  CD    . ARG A  1  70  ? 57.972  52.800  35.826  1.00 82.64  ? 70   ARG A CD    1 
ATOM   526   N  NE    . ARG A  1  70  ? 58.448  53.125  34.488  1.00 83.58  ? 70   ARG A NE    1 
ATOM   527   C  CZ    . ARG A  1  70  ? 59.727  53.117  34.117  1.00 83.66  ? 70   ARG A CZ    1 
ATOM   528   N  NH1   . ARG A  1  70  ? 60.673  52.793  34.987  1.00 83.13  ? 70   ARG A NH1   1 
ATOM   529   N  NH2   . ARG A  1  70  ? 60.059  53.443  32.870  1.00 83.69  ? 70   ARG A NH2   1 
ATOM   530   N  N     . PRO A  1  71  ? 52.674  50.332  36.723  1.00 90.98  ? 71   PRO A N     1 
ATOM   531   C  CA    . PRO A  1  71  ? 51.607  50.523  37.711  1.00 92.04  ? 71   PRO A CA    1 
ATOM   532   C  C     . PRO A  1  71  ? 52.102  50.840  39.126  1.00 93.19  ? 71   PRO A C     1 
ATOM   533   O  O     . PRO A  1  71  ? 53.307  50.932  39.368  1.00 92.93  ? 71   PRO A O     1 
ATOM   534   C  CB    . PRO A  1  71  ? 50.823  49.210  37.635  1.00 91.47  ? 71   PRO A CB    1 
ATOM   535   C  CG    . PRO A  1  71  ? 51.820  48.236  37.119  1.00 90.40  ? 71   PRO A CG    1 
ATOM   536   C  CD    . PRO A  1  71  ? 52.507  49.036  36.049  1.00 90.20  ? 71   PRO A CD    1 
ATOM   537   N  N     . CYS A  1  72  ? 51.161  50.995  40.055  1.00 94.77  ? 72   CYS A N     1 
ATOM   538   C  CA    . CYS A  1  72  ? 51.478  51.351  41.438  1.00 95.94  ? 72   CYS A CA    1 
ATOM   539   C  C     . CYS A  1  72  ? 52.737  50.703  42.014  1.00 96.18  ? 72   CYS A C     1 
ATOM   540   O  O     . CYS A  1  72  ? 53.809  51.320  42.009  1.00 95.72  ? 72   CYS A O     1 
ATOM   541   C  CB    . CYS A  1  72  ? 50.277  51.070  42.357  1.00 96.92  ? 72   CYS A CB    1 
ATOM   542   S  SG    . CYS A  1  72  ? 50.115  52.257  43.743  1.00 97.36  ? 72   CYS A SG    1 
ATOM   543   N  N     . ALA A  1  73  ? 52.619  49.474  42.515  1.00 96.05  ? 73   ALA A N     1 
ATOM   544   C  CA    . ALA A  1  73  ? 53.775  48.797  43.099  1.00 95.82  ? 73   ALA A CA    1 
ATOM   545   C  C     . ALA A  1  73  ? 54.998  48.887  42.189  1.00 95.77  ? 73   ALA A C     1 
ATOM   546   O  O     . ALA A  1  73  ? 56.092  49.240  42.631  1.00 94.96  ? 73   ALA A O     1 
ATOM   547   C  CB    . ALA A  1  73  ? 53.443  47.346  43.384  1.00 96.40  ? 73   ALA A CB    1 
ATOM   548   N  N     . ALA A  1  74  ? 54.803  48.575  40.912  1.00 95.99  ? 74   ALA A N     1 
ATOM   549   C  CA    . ALA A  1  74  ? 55.890  48.620  39.942  1.00 96.16  ? 74   ALA A CA    1 
ATOM   550   C  C     . ALA A  1  74  ? 56.682  49.917  40.064  1.00 96.60  ? 74   ALA A C     1 
ATOM   551   O  O     . ALA A  1  74  ? 57.919  49.906  40.106  1.00 96.66  ? 74   ALA A O     1 
ATOM   552   C  CB    . ALA A  1  74  ? 55.330  48.480  38.537  1.00 96.33  ? 74   ALA A CB    1 
ATOM   553   N  N     . PHE A  1  75  ? 55.956  51.032  40.124  1.00 96.42  ? 75   PHE A N     1 
ATOM   554   C  CA    . PHE A  1  75  ? 56.575  52.341  40.240  1.00 96.01  ? 75   PHE A CA    1 
ATOM   555   C  C     . PHE A  1  75  ? 57.249  52.479  41.595  1.00 96.41  ? 75   PHE A C     1 
ATOM   556   O  O     . PHE A  1  75  ? 58.472  52.590  41.682  1.00 96.93  ? 75   PHE A O     1 
ATOM   557   C  CB    . PHE A  1  75  ? 55.529  53.449  40.077  1.00 95.15  ? 75   PHE A CB    1 
ATOM   558   C  CG    . PHE A  1  75  ? 56.116  54.842  40.040  1.00 94.91  ? 75   PHE A CG    1 
ATOM   559   C  CD1   . PHE A  1  75  ? 56.656  55.357  38.867  1.00 94.45  ? 75   PHE A CD1   1 
ATOM   560   C  CD2   . PHE A  1  75  ? 56.161  55.628  41.189  1.00 94.93  ? 75   PHE A CD2   1 
ATOM   561   C  CE1   . PHE A  1  75  ? 57.236  56.635  38.839  1.00 94.38  ? 75   PHE A CE1   1 
ATOM   562   C  CE2   . PHE A  1  75  ? 56.740  56.906  41.168  1.00 94.27  ? 75   PHE A CE2   1 
ATOM   563   C  CZ    . PHE A  1  75  ? 57.277  57.406  39.991  1.00 93.66  ? 75   PHE A CZ    1 
ATOM   564   N  N     . GLU A  1  76  ? 56.447  52.464  42.654  1.00 96.52  ? 76   GLU A N     1 
ATOM   565   C  CA    . GLU A  1  76  ? 56.972  52.608  44.009  1.00 96.57  ? 76   GLU A CA    1 
ATOM   566   C  C     . GLU A  1  76  ? 58.141  51.677  44.283  1.00 95.01  ? 76   GLU A C     1 
ATOM   567   O  O     . GLU A  1  76  ? 59.196  52.117  44.745  1.00 93.76  ? 76   GLU A O     1 
ATOM   568   C  CB    . GLU A  1  76  ? 55.868  52.355  45.037  1.00 98.75  ? 76   GLU A CB    1 
ATOM   569   C  CG    . GLU A  1  76  ? 54.726  53.353  44.969  1.00 100.75 ? 76   GLU A CG    1 
ATOM   570   C  CD    . GLU A  1  76  ? 53.706  53.155  46.074  1.00 101.65 ? 76   GLU A CD    1 
ATOM   571   O  OE1   . GLU A  1  76  ? 52.907  52.191  45.994  1.00 100.65 ? 76   GLU A OE1   1 
ATOM   572   O  OE2   . GLU A  1  76  ? 53.715  53.965  47.027  1.00 102.43 ? 76   GLU A OE2   1 
ATOM   573   N  N     . LYS A  1  77  ? 57.948  50.391  43.999  1.00 93.35  ? 77   LYS A N     1 
ATOM   574   C  CA    . LYS A  1  77  ? 58.995  49.403  44.223  1.00 91.50  ? 77   LYS A CA    1 
ATOM   575   C  C     . LYS A  1  77  ? 60.272  49.832  43.534  1.00 89.43  ? 77   LYS A C     1 
ATOM   576   O  O     . LYS A  1  77  ? 61.324  49.947  44.157  1.00 88.49  ? 77   LYS A O     1 
ATOM   577   C  CB    . LYS A  1  77  ? 58.585  48.029  43.692  1.00 91.94  ? 77   LYS A CB    1 
ATOM   578   C  CG    . LYS A  1  77  ? 59.709  47.000  43.788  1.00 92.35  ? 77   LYS A CG    1 
ATOM   579   C  CD    . LYS A  1  77  ? 59.265  45.590  43.420  1.00 92.05  ? 77   LYS A CD    1 
ATOM   580   C  CE    . LYS A  1  77  ? 60.405  44.596  43.632  1.00 92.21  ? 77   LYS A CE    1 
ATOM   581   N  NZ    . LYS A  1  77  ? 59.958  43.191  43.417  1.00 92.11  ? 77   LYS A NZ    1 
ATOM   582   N  N     . GLU A  1  78  ? 60.176  50.069  42.239  1.00 87.27  ? 78   GLU A N     1 
ATOM   583   C  CA    . GLU A  1  78  ? 61.345  50.479  41.504  1.00 87.20  ? 78   GLU A CA    1 
ATOM   584   C  C     . GLU A  1  78  ? 62.025  51.695  42.125  1.00 88.09  ? 78   GLU A C     1 
ATOM   585   O  O     . GLU A  1  78  ? 63.255  51.774  42.168  1.00 87.86  ? 78   GLU A O     1 
ATOM   586   C  CB    . GLU A  1  78  ? 60.970  50.790  40.066  1.00 86.34  ? 78   GLU A CB    1 
ATOM   587   C  CG    . GLU A  1  78  ? 62.142  51.295  39.259  1.00 84.12  ? 78   GLU A CG    1 
ATOM   588   C  CD    . GLU A  1  78  ? 61.781  51.513  37.823  1.00 83.41  ? 78   GLU A CD    1 
ATOM   589   O  OE1   . GLU A  1  78  ? 62.674  51.967  37.078  1.00 83.87  ? 78   GLU A OE1   1 
ATOM   590   O  OE2   . GLU A  1  78  ? 60.612  51.227  37.450  1.00 81.01  ? 78   GLU A OE2   1 
ATOM   591   N  N     . VAL A  1  79  ? 61.223  52.643  42.604  1.00 89.48  ? 79   VAL A N     1 
ATOM   592   C  CA    . VAL A  1  79  ? 61.758  53.870  43.196  1.00 90.27  ? 79   VAL A CA    1 
ATOM   593   C  C     . VAL A  1  79  ? 62.220  53.725  44.644  1.00 91.16  ? 79   VAL A C     1 
ATOM   594   O  O     . VAL A  1  79  ? 63.277  54.235  45.022  1.00 91.39  ? 79   VAL A O     1 
ATOM   595   C  CB    . VAL A  1  79  ? 60.733  55.019  43.127  1.00 89.54  ? 79   VAL A CB    1 
ATOM   596   C  CG1   . VAL A  1  79  ? 61.319  56.265  43.774  1.00 89.44  ? 79   VAL A CG1   1 
ATOM   597   C  CG2   . VAL A  1  79  ? 60.359  55.302  41.678  1.00 88.09  ? 79   VAL A CG2   1 
ATOM   598   N  N     . GLU A  1  80  ? 61.426  53.045  45.458  1.00 92.16  ? 80   GLU A N     1 
ATOM   599   C  CA    . GLU A  1  80  ? 61.791  52.850  46.851  1.00 93.39  ? 80   GLU A CA    1 
ATOM   600   C  C     . GLU A  1  80  ? 63.086  52.056  46.937  1.00 94.32  ? 80   GLU A C     1 
ATOM   601   O  O     . GLU A  1  80  ? 63.984  52.390  47.719  1.00 95.14  ? 80   GLU A O     1 
ATOM   602   C  CB    . GLU A  1  80  ? 60.692  52.091  47.583  1.00 92.92  ? 80   GLU A CB    1 
ATOM   603   C  CG    . GLU A  1  80  ? 59.386  52.822  47.654  1.00 93.67  ? 80   GLU A CG    1 
ATOM   604   C  CD    . GLU A  1  80  ? 58.357  52.052  48.434  1.00 94.15  ? 80   GLU A CD    1 
ATOM   605   O  OE1   . GLU A  1  80  ? 58.686  51.629  49.563  1.00 92.28  ? 80   GLU A OE1   1 
ATOM   606   O  OE2   . GLU A  1  80  ? 57.227  51.875  47.922  1.00 95.23  ? 80   GLU A OE2   1 
ATOM   607   N  N     . SER A  1  81  ? 63.173  51.015  46.108  1.00 94.46  ? 81   SER A N     1 
ATOM   608   C  CA    . SER A  1  81  ? 64.323  50.116  46.074  1.00 93.77  ? 81   SER A CA    1 
ATOM   609   C  C     . SER A  1  81  ? 65.646  50.718  45.611  1.00 92.70  ? 81   SER A C     1 
ATOM   610   O  O     . SER A  1  81  ? 66.693  50.099  45.793  1.00 93.51  ? 81   SER A O     1 
ATOM   611   C  CB    . SER A  1  81  ? 64.003  48.892  45.218  1.00 94.16  ? 81   SER A CB    1 
ATOM   612   O  OG    . SER A  1  81  ? 63.758  49.281  43.884  1.00 95.61  ? 81   SER A OG    1 
ATOM   613   N  N     . MET A  1  82  ? 65.621  51.901  45.006  1.00 91.07  ? 82   MET A N     1 
ATOM   614   C  CA    . MET A  1  82  ? 66.876  52.513  44.582  1.00 90.14  ? 82   MET A CA    1 
ATOM   615   C  C     . MET A  1  82  ? 67.276  53.644  45.530  1.00 90.26  ? 82   MET A C     1 
ATOM   616   O  O     . MET A  1  82  ? 68.110  54.503  45.197  1.00 88.84  ? 82   MET A O     1 
ATOM   617   C  CB    . MET A  1  82  ? 66.796  52.999  43.125  1.00 88.51  ? 82   MET A CB    1 
ATOM   618   C  CG    . MET A  1  82  ? 65.637  53.899  42.787  1.00 87.40  ? 82   MET A CG    1 
ATOM   619   S  SD    . MET A  1  82  ? 65.523  54.217  41.005  1.00 87.19  ? 82   MET A SD    1 
ATOM   620   C  CE    . MET A  1  82  ? 66.880  55.402  40.772  1.00 86.20  ? 82   MET A CE    1 
ATOM   621   N  N     . GLY A  1  83  ? 66.675  53.606  46.722  1.00 90.59  ? 83   GLY A N     1 
ATOM   622   C  CA    . GLY A  1  83  ? 66.942  54.582  47.766  1.00 91.63  ? 83   GLY A CA    1 
ATOM   623   C  C     . GLY A  1  83  ? 66.697  56.016  47.355  1.00 92.24  ? 83   GLY A C     1 
ATOM   624   O  O     . GLY A  1  83  ? 67.379  56.929  47.833  1.00 92.52  ? 83   GLY A O     1 
ATOM   625   N  N     . ALA A  1  84  ? 65.716  56.213  46.476  1.00 92.37  ? 84   ALA A N     1 
ATOM   626   C  CA    . ALA A  1  84  ? 65.381  57.540  45.975  1.00 91.93  ? 84   ALA A CA    1 
ATOM   627   C  C     . ALA A  1  84  ? 64.134  58.076  46.622  1.00 92.17  ? 84   ALA A C     1 
ATOM   628   O  O     . ALA A  1  84  ? 63.257  57.321  47.032  1.00 91.56  ? 84   ALA A O     1 
ATOM   629   C  CB    . ALA A  1  84  ? 65.190  57.505  44.472  1.00 90.95  ? 84   ALA A CB    1 
ATOM   630   N  N     . HIS A  1  85  ? 64.063  59.399  46.697  1.00 93.48  ? 85   HIS A N     1 
ATOM   631   C  CA    . HIS A  1  85  ? 62.923  60.082  47.285  1.00 93.49  ? 85   HIS A CA    1 
ATOM   632   C  C     . HIS A  1  85  ? 62.221  60.892  46.221  1.00 92.33  ? 85   HIS A C     1 
ATOM   633   O  O     . HIS A  1  85  ? 62.806  61.789  45.613  1.00 91.32  ? 85   HIS A O     1 
ATOM   634   C  CB    . HIS A  1  85  ? 63.389  60.998  48.411  1.00 95.75  ? 85   HIS A CB    1 
ATOM   635   C  CG    . HIS A  1  85  ? 64.030  60.267  49.546  1.00 98.93  ? 85   HIS A CG    1 
ATOM   636   N  ND1   . HIS A  1  85  ? 64.724  60.909  50.548  1.00 99.79  ? 85   HIS A ND1   1 
ATOM   637   C  CD2   . HIS A  1  85  ? 64.074  58.946  49.841  1.00 99.89  ? 85   HIS A CD2   1 
ATOM   638   C  CE1   . HIS A  1  85  ? 65.169  60.013  51.412  1.00 100.81 ? 85   HIS A CE1   1 
ATOM   639   N  NE2   . HIS A  1  85  ? 64.787  58.815  51.007  1.00 100.57 ? 85   HIS A NE2   1 
ATOM   640   N  N     . PHE A  1  86  ? 60.964  60.551  45.986  1.00 91.75  ? 86   PHE A N     1 
ATOM   641   C  CA    . PHE A  1  86  ? 60.175  61.257  45.002  1.00 92.05  ? 86   PHE A CA    1 
ATOM   642   C  C     . PHE A  1  86  ? 59.127  62.056  45.758  1.00 90.73  ? 86   PHE A C     1 
ATOM   643   O  O     . PHE A  1  86  ? 58.555  61.590  46.747  1.00 91.02  ? 86   PHE A O     1 
ATOM   644   C  CB    . PHE A  1  86  ? 59.495  60.279  44.047  1.00 94.79  ? 86   PHE A CB    1 
ATOM   645   C  CG    . PHE A  1  86  ? 59.232  60.854  42.685  1.00 98.59  ? 86   PHE A CG    1 
ATOM   646   C  CD1   . PHE A  1  86  ? 59.167  62.238  42.498  1.00 99.87  ? 86   PHE A CD1   1 
ATOM   647   C  CD2   . PHE A  1  86  ? 59.038  60.014  41.586  1.00 100.76 ? 86   PHE A CD2   1 
ATOM   648   C  CE1   . PHE A  1  86  ? 58.914  62.782  41.238  1.00 101.59 ? 86   PHE A CE1   1 
ATOM   649   C  CE2   . PHE A  1  86  ? 58.783  60.542  40.315  1.00 102.02 ? 86   PHE A CE2   1 
ATOM   650   C  CZ    . PHE A  1  86  ? 58.720  61.929  40.140  1.00 102.46 ? 86   PHE A CZ    1 
ATOM   651   N  N     . ASN A  1  87  ? 58.866  63.262  45.286  1.00 88.01  ? 87   ASN A N     1 
ATOM   652   C  CA    . ASN A  1  87  ? 57.908  64.113  45.947  1.00 85.31  ? 87   ASN A CA    1 
ATOM   653   C  C     . ASN A  1  87  ? 57.771  65.399  45.138  1.00 84.11  ? 87   ASN A C     1 
ATOM   654   O  O     . ASN A  1  87  ? 58.609  65.697  44.287  1.00 84.93  ? 87   ASN A O     1 
ATOM   655   C  CB    . ASN A  1  87  ? 58.415  64.365  47.374  1.00 84.17  ? 87   ASN A CB    1 
ATOM   656   C  CG    . ASN A  1  87  ? 58.126  65.759  47.870  1.00 83.46  ? 87   ASN A CG    1 
ATOM   657   O  OD1   . ASN A  1  87  ? 56.973  66.138  48.059  1.00 83.70  ? 87   ASN A OD1   1 
ATOM   658   N  ND2   . ASN A  1  87  ? 59.183  66.536  48.091  1.00 82.03  ? 87   ASN A ND2   1 
ATOM   659   N  N     . GLY A  1  88  ? 56.702  66.147  45.381  1.00 82.05  ? 88   GLY A N     1 
ATOM   660   C  CA    . GLY A  1  88  ? 56.504  67.389  44.654  1.00 79.81  ? 88   GLY A CA    1 
ATOM   661   C  C     . GLY A  1  88  ? 55.532  68.340  45.327  1.00 77.31  ? 88   GLY A C     1 
ATOM   662   O  O     . GLY A  1  88  ? 55.299  68.252  46.526  1.00 77.32  ? 88   GLY A O     1 
ATOM   663   N  N     . TYR A  1  89  ? 54.953  69.245  44.548  1.00 75.37  ? 89   TYR A N     1 
ATOM   664   C  CA    . TYR A  1  89  ? 54.009  70.212  45.083  1.00 73.34  ? 89   TYR A CA    1 
ATOM   665   C  C     . TYR A  1  89  ? 53.274  70.941  43.966  1.00 73.07  ? 89   TYR A C     1 
ATOM   666   O  O     . TYR A  1  89  ? 53.591  70.773  42.789  1.00 73.93  ? 89   TYR A O     1 
ATOM   667   C  CB    . TYR A  1  89  ? 54.751  71.219  45.957  1.00 71.61  ? 89   TYR A CB    1 
ATOM   668   C  CG    . TYR A  1  89  ? 55.704  72.123  45.206  1.00 69.50  ? 89   TYR A CG    1 
ATOM   669   C  CD1   . TYR A  1  89  ? 55.231  73.171  44.433  1.00 67.16  ? 89   TYR A CD1   1 
ATOM   670   C  CD2   . TYR A  1  89  ? 57.082  71.954  45.309  1.00 69.15  ? 89   TYR A CD2   1 
ATOM   671   C  CE1   . TYR A  1  89  ? 56.096  74.033  43.792  1.00 67.56  ? 89   TYR A CE1   1 
ATOM   672   C  CE2   . TYR A  1  89  ? 57.960  72.818  44.668  1.00 67.76  ? 89   TYR A CE2   1 
ATOM   673   C  CZ    . TYR A  1  89  ? 57.459  73.860  43.914  1.00 67.48  ? 89   TYR A CZ    1 
ATOM   674   O  OH    . TYR A  1  89  ? 58.313  74.760  43.308  1.00 67.27  ? 89   TYR A OH    1 
ATOM   675   N  N     . THR A  1  90  ? 52.303  71.765  44.338  1.00 71.64  ? 90   THR A N     1 
ATOM   676   C  CA    . THR A  1  90  ? 51.533  72.511  43.355  1.00 71.24  ? 90   THR A CA    1 
ATOM   677   C  C     . THR A  1  90  ? 51.051  73.837  43.943  1.00 70.00  ? 90   THR A C     1 
ATOM   678   O  O     . THR A  1  90  ? 50.207  73.857  44.830  1.00 71.13  ? 90   THR A O     1 
ATOM   679   C  CB    . THR A  1  90  ? 50.335  71.657  42.855  1.00 72.78  ? 90   THR A CB    1 
ATOM   680   O  OG1   . THR A  1  90  ? 49.374  72.501  42.216  1.00 74.19  ? 90   THR A OG1   1 
ATOM   681   C  CG2   . THR A  1  90  ? 49.679  70.907  44.003  1.00 73.71  ? 90   THR A CG2   1 
ATOM   682   N  N     . SER A  1  91  ? 51.603  74.946  43.458  1.00 67.91  ? 91   SER A N     1 
ATOM   683   C  CA    . SER A  1  91  ? 51.233  76.260  43.962  1.00 65.75  ? 91   SER A CA    1 
ATOM   684   C  C     . SER A  1  91  ? 50.128  76.867  43.109  1.00 66.13  ? 91   SER A C     1 
ATOM   685   O  O     . SER A  1  91  ? 49.435  76.150  42.380  1.00 65.55  ? 91   SER A O     1 
ATOM   686   C  CB    . SER A  1  91  ? 52.449  77.183  43.968  1.00 63.89  ? 91   SER A CB    1 
ATOM   687   O  OG    . SER A  1  91  ? 52.417  78.057  42.855  1.00 64.77  ? 91   SER A OG    1 
ATOM   688   N  N     . ARG A  1  92  ? 49.959  78.186  43.199  1.00 66.33  ? 92   ARG A N     1 
ATOM   689   C  CA    . ARG A  1  92  ? 48.922  78.854  42.427  1.00 65.21  ? 92   ARG A CA    1 
ATOM   690   C  C     . ARG A  1  92  ? 49.326  78.944  40.981  1.00 65.04  ? 92   ARG A C     1 
ATOM   691   O  O     . ARG A  1  92  ? 48.490  78.757  40.107  1.00 64.65  ? 92   ARG A O     1 
ATOM   692   C  CB    . ARG A  1  92  ? 48.622  80.252  42.980  1.00 65.66  ? 92   ARG A CB    1 
ATOM   693   C  CG    . ARG A  1  92  ? 47.715  80.237  44.191  1.00 64.46  ? 92   ARG A CG    1 
ATOM   694   C  CD    . ARG A  1  92  ? 47.212  81.615  44.594  1.00 62.84  ? 92   ARG A CD    1 
ATOM   695   N  NE    . ARG A  1  92  ? 46.265  81.448  45.687  1.00 64.00  ? 92   ARG A NE    1 
ATOM   696   C  CZ    . ARG A  1  92  ? 46.609  81.148  46.937  1.00 63.93  ? 92   ARG A CZ    1 
ATOM   697   N  NH1   . ARG A  1  92  ? 47.879  81.007  47.255  1.00 63.95  ? 92   ARG A NH1   1 
ATOM   698   N  NH2   . ARG A  1  92  ? 45.680  80.938  47.860  1.00 65.68  ? 92   ARG A NH2   1 
ATOM   699   N  N     . GLU A  1  93  ? 50.595  79.235  40.712  1.00 65.09  ? 93   GLU A N     1 
ATOM   700   C  CA    . GLU A  1  93  ? 51.005  79.299  39.319  1.00 66.68  ? 93   GLU A CA    1 
ATOM   701   C  C     . GLU A  1  93  ? 52.320  78.587  38.980  1.00 67.61  ? 93   GLU A C     1 
ATOM   702   O  O     . GLU A  1  93  ? 52.983  78.911  37.990  1.00 69.57  ? 93   GLU A O     1 
ATOM   703   C  CB    . GLU A  1  93  ? 51.021  80.752  38.821  1.00 64.57  ? 93   GLU A CB    1 
ATOM   704   C  CG    . GLU A  1  93  ? 52.052  81.663  39.432  1.00 63.80  ? 93   GLU A CG    1 
ATOM   705   C  CD    . GLU A  1  93  ? 52.145  82.993  38.674  1.00 63.85  ? 93   GLU A CD    1 
ATOM   706   O  OE1   . GLU A  1  93  ? 51.177  83.335  37.949  1.00 61.23  ? 93   GLU A OE1   1 
ATOM   707   O  OE2   . GLU A  1  93  ? 53.179  83.695  38.815  1.00 62.08  ? 93   GLU A OE2   1 
ATOM   708   N  N     . GLN A  1  94  ? 52.669  77.593  39.792  1.00 66.96  ? 94   GLN A N     1 
ATOM   709   C  CA    . GLN A  1  94  ? 53.877  76.798  39.593  1.00 65.94  ? 94   GLN A CA    1 
ATOM   710   C  C     . GLN A  1  94  ? 53.694  75.421  40.214  1.00 66.87  ? 94   GLN A C     1 
ATOM   711   O  O     . GLN A  1  94  ? 53.311  75.305  41.375  1.00 67.84  ? 94   GLN A O     1 
ATOM   712   C  CB    . GLN A  1  94  ? 55.092  77.476  40.227  1.00 63.82  ? 94   GLN A CB    1 
ATOM   713   C  CG    . GLN A  1  94  ? 56.352  76.641  40.129  1.00 62.99  ? 94   GLN A CG    1 
ATOM   714   C  CD    . GLN A  1  94  ? 57.611  77.413  40.474  1.00 62.37  ? 94   GLN A CD    1 
ATOM   715   O  OE1   . GLN A  1  94  ? 57.869  78.490  39.927  1.00 62.18  ? 94   GLN A OE1   1 
ATOM   716   N  NE2   . GLN A  1  94  ? 58.413  76.859  41.375  1.00 61.02  ? 94   GLN A NE2   1 
ATOM   717   N  N     . THR A  1  95  ? 53.959  74.379  39.438  1.00 67.66  ? 95   THR A N     1 
ATOM   718   C  CA    . THR A  1  95  ? 53.833  73.008  39.922  1.00 68.14  ? 95   THR A CA    1 
ATOM   719   C  C     . THR A  1  95  ? 55.196  72.355  39.784  1.00 68.88  ? 95   THR A C     1 
ATOM   720   O  O     . THR A  1  95  ? 55.963  72.732  38.908  1.00 68.98  ? 95   THR A O     1 
ATOM   721   C  CB    . THR A  1  95  ? 52.818  72.227  39.080  1.00 67.50  ? 95   THR A CB    1 
ATOM   722   O  OG1   . THR A  1  95  ? 51.515  72.791  39.265  1.00 67.75  ? 95   THR A OG1   1 
ATOM   723   C  CG2   . THR A  1  95  ? 52.798  70.769  39.480  1.00 66.35  ? 95   THR A CG2   1 
ATOM   724   N  N     . ALA A  1  96  ? 55.512  71.394  40.647  1.00 69.95  ? 96   ALA A N     1 
ATOM   725   C  CA    . ALA A  1  96  ? 56.806  70.719  40.552  1.00 71.94  ? 96   ALA A CA    1 
ATOM   726   C  C     . ALA A  1  96  ? 56.820  69.248  40.995  1.00 73.08  ? 96   ALA A C     1 
ATOM   727   O  O     . ALA A  1  96  ? 56.088  68.852  41.902  1.00 73.80  ? 96   ALA A O     1 
ATOM   728   C  CB    . ALA A  1  96  ? 57.861  71.506  41.337  1.00 70.02  ? 96   ALA A CB    1 
ATOM   729   N  N     . PHE A  1  97  ? 57.648  68.447  40.323  1.00 74.06  ? 97   PHE A N     1 
ATOM   730   C  CA    . PHE A  1  97  ? 57.842  67.029  40.644  1.00 75.28  ? 97   PHE A CA    1 
ATOM   731   C  C     . PHE A  1  97  ? 59.344  66.756  40.549  1.00 76.56  ? 97   PHE A C     1 
ATOM   732   O  O     . PHE A  1  97  ? 59.948  66.964  39.492  1.00 76.71  ? 97   PHE A O     1 
ATOM   733   C  CB    . PHE A  1  97  ? 57.125  66.131  39.654  1.00 73.69  ? 97   PHE A CB    1 
ATOM   734   C  CG    . PHE A  1  97  ? 55.660  66.353  39.590  1.00 73.68  ? 97   PHE A CG    1 
ATOM   735   C  CD1   . PHE A  1  97  ? 55.089  66.950  38.469  1.00 74.22  ? 97   PHE A CD1   1 
ATOM   736   C  CD2   . PHE A  1  97  ? 54.839  65.914  40.616  1.00 73.79  ? 97   PHE A CD2   1 
ATOM   737   C  CE1   . PHE A  1  97  ? 53.713  67.099  38.361  1.00 74.26  ? 97   PHE A CE1   1 
ATOM   738   C  CE2   . PHE A  1  97  ? 53.460  66.054  40.527  1.00 74.62  ? 97   PHE A CE2   1 
ATOM   739   C  CZ    . PHE A  1  97  ? 52.892  66.648  39.394  1.00 75.05  ? 97   PHE A CZ    1 
ATOM   740   N  N     . TYR A  1  98  ? 59.944  66.279  41.636  1.00 77.67  ? 98   TYR A N     1 
ATOM   741   C  CA    . TYR A  1  98  ? 61.380  66.030  41.636  1.00 79.08  ? 98   TYR A CA    1 
ATOM   742   C  C     . TYR A  1  98  ? 61.813  64.843  42.493  1.00 78.84  ? 98   TYR A C     1 
ATOM   743   O  O     . TYR A  1  98  ? 61.119  64.457  43.433  1.00 78.95  ? 98   TYR A O     1 
ATOM   744   C  CB    . TYR A  1  98  ? 62.096  67.292  42.105  1.00 80.64  ? 98   TYR A CB    1 
ATOM   745   C  CG    . TYR A  1  98  ? 61.662  67.719  43.477  1.00 83.93  ? 98   TYR A CG    1 
ATOM   746   C  CD1   . TYR A  1  98  ? 62.288  67.206  44.617  1.00 85.58  ? 98   TYR A CD1   1 
ATOM   747   C  CD2   . TYR A  1  98  ? 60.597  68.608  43.644  1.00 84.59  ? 98   TYR A CD2   1 
ATOM   748   C  CE1   . TYR A  1  98  ? 61.864  67.568  45.893  1.00 86.92  ? 98   TYR A CE1   1 
ATOM   749   C  CE2   . TYR A  1  98  ? 60.161  68.976  44.913  1.00 85.76  ? 98   TYR A CE2   1 
ATOM   750   C  CZ    . TYR A  1  98  ? 60.800  68.452  46.035  1.00 87.38  ? 98   TYR A CZ    1 
ATOM   751   O  OH    . TYR A  1  98  ? 60.393  68.810  47.301  1.00 88.60  ? 98   TYR A OH    1 
ATOM   752   N  N     . ILE A  1  99  ? 62.978  64.283  42.162  1.00 78.61  ? 99   ILE A N     1 
ATOM   753   C  CA    . ILE A  1  99  ? 63.532  63.138  42.875  1.00 77.21  ? 99   ILE A CA    1 
ATOM   754   C  C     . ILE A  1  99  ? 64.904  63.413  43.484  1.00 77.79  ? 99   ILE A C     1 
ATOM   755   O  O     . ILE A  1  99  ? 65.673  64.237  42.978  1.00 77.54  ? 99   ILE A O     1 
ATOM   756   C  CB    . ILE A  1  99  ? 63.665  61.921  41.939  1.00 75.42  ? 99   ILE A CB    1 
ATOM   757   C  CG1   . ILE A  1  99  ? 62.309  61.608  41.314  1.00 76.10  ? 99   ILE A CG1   1 
ATOM   758   C  CG2   . ILE A  1  99  ? 64.165  60.719  42.715  1.00 75.12  ? 99   ILE A CG2   1 
ATOM   759   C  CD1   . ILE A  1  99  ? 62.256  60.334  40.500  1.00 75.45  ? 99   ILE A CD1   1 
ATOM   760   N  N     . LYS A  1  100 ? 65.188  62.730  44.591  1.00 78.47  ? 100  LYS A N     1 
ATOM   761   C  CA    . LYS A  1  100 ? 66.476  62.832  45.268  1.00 79.56  ? 100  LYS A CA    1 
ATOM   762   C  C     . LYS A  1  100 ? 67.116  61.443  45.156  1.00 81.62  ? 100  LYS A C     1 
ATOM   763   O  O     . LYS A  1  100 ? 66.732  60.502  45.862  1.00 81.88  ? 100  LYS A O     1 
ATOM   764   C  CB    . LYS A  1  100 ? 66.295  63.228  46.737  1.00 78.01  ? 100  LYS A CB    1 
ATOM   765   C  CG    . LYS A  1  100 ? 65.908  64.685  46.931  1.00 75.32  ? 100  LYS A CG    1 
ATOM   766   C  CD    . LYS A  1  100 ? 66.014  65.143  48.374  1.00 73.27  ? 100  LYS A CD    1 
ATOM   767   C  CE    . LYS A  1  100 ? 67.426  64.992  48.919  1.00 74.92  ? 100  LYS A CE    1 
ATOM   768   N  NZ    . LYS A  1  100 ? 68.487  65.400  47.954  1.00 77.28  ? 100  LYS A NZ    1 
ATOM   769   N  N     . ALA A  1  101 ? 68.080  61.325  44.244  1.00 83.28  ? 101  ALA A N     1 
ATOM   770   C  CA    . ALA A  1  101 ? 68.763  60.056  43.990  1.00 84.28  ? 101  ALA A CA    1 
ATOM   771   C  C     . ALA A  1  101 ? 70.285  60.181  43.831  1.00 84.89  ? 101  ALA A C     1 
ATOM   772   O  O     . ALA A  1  101 ? 70.837  61.287  43.716  1.00 84.52  ? 101  ALA A O     1 
ATOM   773   C  CB    . ALA A  1  101 ? 68.167  59.389  42.739  1.00 84.28  ? 101  ALA A CB    1 
ATOM   774   N  N     . LEU A  1  102 ? 70.947  59.024  43.822  1.00 84.39  ? 102  LEU A N     1 
ATOM   775   C  CA    . LEU A  1  102 ? 72.394  58.941  43.684  1.00 83.35  ? 102  LEU A CA    1 
ATOM   776   C  C     . LEU A  1  102 ? 72.753  59.480  42.313  1.00 83.68  ? 102  LEU A C     1 
ATOM   777   O  O     . LEU A  1  102 ? 72.128  59.100  41.317  1.00 83.88  ? 102  LEU A O     1 
ATOM   778   C  CB    . LEU A  1  102 ? 72.827  57.482  43.802  1.00 81.90  ? 102  LEU A CB    1 
ATOM   779   C  CG    . LEU A  1  102 ? 72.358  56.790  45.083  1.00 81.18  ? 102  LEU A CG    1 
ATOM   780   C  CD1   . LEU A  1  102 ? 72.287  55.285  44.884  1.00 80.20  ? 102  LEU A CD1   1 
ATOM   781   C  CD2   . LEU A  1  102 ? 73.291  57.161  46.219  1.00 80.46  ? 102  LEU A CD2   1 
ATOM   782   N  N     . SER A  1  103 ? 73.748  60.364  42.259  1.00 83.23  ? 103  SER A N     1 
ATOM   783   C  CA    . SER A  1  103 ? 74.172  60.946  40.988  1.00 84.02  ? 103  SER A CA    1 
ATOM   784   C  C     . SER A  1  103 ? 74.293  59.845  39.927  1.00 85.50  ? 103  SER A C     1 
ATOM   785   O  O     . SER A  1  103 ? 74.154  60.088  38.722  1.00 84.71  ? 103  SER A O     1 
ATOM   786   C  CB    . SER A  1  103 ? 75.506  61.675  41.163  1.00 83.26  ? 103  SER A CB    1 
ATOM   787   O  OG    . SER A  1  103 ? 75.369  62.836  41.966  1.00 81.71  ? 103  SER A OG    1 
ATOM   788   N  N     . LYS A  1  104 ? 74.546  58.631  40.400  1.00 87.17  ? 104  LYS A N     1 
ATOM   789   C  CA    . LYS A  1  104 ? 74.666  57.469  39.545  1.00 89.02  ? 104  LYS A CA    1 
ATOM   790   C  C     . LYS A  1  104 ? 73.386  57.286  38.734  1.00 90.81  ? 104  LYS A C     1 
ATOM   791   O  O     . LYS A  1  104 ? 73.438  57.163  37.510  1.00 92.30  ? 104  LYS A O     1 
ATOM   792   C  CB    . LYS A  1  104 ? 74.927  56.227  40.406  1.00 89.46  ? 104  LYS A CB    1 
ATOM   793   C  CG    . LYS A  1  104 ? 74.770  54.891  39.679  1.00 91.15  ? 104  LYS A CG    1 
ATOM   794   C  CD    . LYS A  1  104 ? 75.353  53.712  40.474  1.00 92.57  ? 104  LYS A CD    1 
ATOM   795   C  CE    . LYS A  1  104 ? 74.646  53.471  41.807  1.00 93.36  ? 104  LYS A CE    1 
ATOM   796   N  NZ    . LYS A  1  104 ? 73.221  53.045  41.654  1.00 93.80  ? 104  LYS A NZ    1 
ATOM   797   N  N     . ASP A  1  105 ? 72.243  57.289  39.421  1.00 91.57  ? 105  ASP A N     1 
ATOM   798   C  CA    . ASP A  1  105 ? 70.935  57.092  38.789  1.00 92.12  ? 105  ASP A CA    1 
ATOM   799   C  C     . ASP A  1  105 ? 70.387  58.282  38.000  1.00 91.37  ? 105  ASP A C     1 
ATOM   800   O  O     . ASP A  1  105 ? 69.264  58.231  37.480  1.00 89.70  ? 105  ASP A O     1 
ATOM   801   C  CB    . ASP A  1  105 ? 69.904  56.698  39.848  1.00 94.69  ? 105  ASP A CB    1 
ATOM   802   C  CG    . ASP A  1  105 ? 70.371  55.558  40.716  1.00 96.33  ? 105  ASP A CG    1 
ATOM   803   O  OD1   . ASP A  1  105 ? 71.437  54.985  40.408  1.00 97.43  ? 105  ASP A OD1   1 
ATOM   804   O  OD2   . ASP A  1  105 ? 69.671  55.237  41.704  1.00 98.16  ? 105  ASP A OD2   1 
ATOM   805   N  N     . MET A  1  106 ? 71.174  59.348  37.914  1.00 91.69  ? 106  MET A N     1 
ATOM   806   C  CA    . MET A  1  106 ? 70.766  60.556  37.197  1.00 91.61  ? 106  MET A CA    1 
ATOM   807   C  C     . MET A  1  106 ? 69.906  60.273  35.956  1.00 91.01  ? 106  MET A C     1 
ATOM   808   O  O     . MET A  1  106 ? 68.819  60.828  35.815  1.00 90.05  ? 106  MET A O     1 
ATOM   809   C  CB    . MET A  1  106 ? 72.008  61.377  36.823  1.00 91.61  ? 106  MET A CB    1 
ATOM   810   C  CG    . MET A  1  106 ? 71.730  62.610  35.983  1.00 91.66  ? 106  MET A CG    1 
ATOM   811   S  SD    . MET A  1  106 ? 71.612  62.268  34.217  1.00 92.61  ? 106  MET A SD    1 
ATOM   812   C  CE    . MET A  1  106 ? 69.933  62.544  33.926  1.00 91.22  ? 106  MET A CE    1 
ATOM   813   N  N     . PRO A  1  107 ? 70.384  59.405  35.044  1.00 91.09  ? 107  PRO A N     1 
ATOM   814   C  CA    . PRO A  1  107 ? 69.635  59.071  33.826  1.00 90.31  ? 107  PRO A CA    1 
ATOM   815   C  C     . PRO A  1  107 ? 68.379  58.197  33.963  1.00 89.23  ? 107  PRO A C     1 
ATOM   816   O  O     . PRO A  1  107 ? 67.454  58.328  33.164  1.00 89.52  ? 107  PRO A O     1 
ATOM   817   C  CB    . PRO A  1  107 ? 70.700  58.428  32.936  1.00 90.01  ? 107  PRO A CB    1 
ATOM   818   C  CG    . PRO A  1  107 ? 71.623  57.800  33.918  1.00 90.39  ? 107  PRO A CG    1 
ATOM   819   C  CD    . PRO A  1  107 ? 71.760  58.881  34.956  1.00 90.93  ? 107  PRO A CD    1 
ATOM   820   N  N     . LYS A  1  108 ? 68.328  57.307  34.946  1.00 88.37  ? 108  LYS A N     1 
ATOM   821   C  CA    . LYS A  1  108 ? 67.138  56.467  35.089  1.00 88.27  ? 108  LYS A CA    1 
ATOM   822   C  C     . LYS A  1  108 ? 66.004  57.292  35.659  1.00 88.90  ? 108  LYS A C     1 
ATOM   823   O  O     . LYS A  1  108 ? 64.829  57.053  35.361  1.00 88.67  ? 108  LYS A O     1 
ATOM   824   C  CB    . LYS A  1  108 ? 67.398  55.288  36.024  1.00 88.24  ? 108  LYS A CB    1 
ATOM   825   C  CG    . LYS A  1  108 ? 66.184  54.371  36.219  1.00 86.85  ? 108  LYS A CG    1 
ATOM   826   C  CD    . LYS A  1  108 ? 65.783  53.703  34.907  1.00 86.23  ? 108  LYS A CD    1 
ATOM   827   C  CE    . LYS A  1  108 ? 64.742  52.619  35.122  1.00 84.99  ? 108  LYS A CE    1 
ATOM   828   N  NZ    . LYS A  1  108 ? 64.460  51.858  33.869  1.00 83.81  ? 108  LYS A NZ    1 
ATOM   829   N  N     . VAL A  1  109 ? 66.375  58.258  36.496  1.00 89.41  ? 109  VAL A N     1 
ATOM   830   C  CA    . VAL A  1  109 ? 65.417  59.149  37.139  1.00 88.64  ? 109  VAL A CA    1 
ATOM   831   C  C     . VAL A  1  109 ? 64.681  59.975  36.083  1.00 88.34  ? 109  VAL A C     1 
ATOM   832   O  O     . VAL A  1  109 ? 63.454  60.034  36.081  1.00 87.81  ? 109  VAL A O     1 
ATOM   833   C  CB    . VAL A  1  109 ? 66.140  60.080  38.140  1.00 88.22  ? 109  VAL A CB    1 
ATOM   834   C  CG1   . VAL A  1  109 ? 65.145  61.004  38.823  1.00 88.50  ? 109  VAL A CG1   1 
ATOM   835   C  CG2   . VAL A  1  109 ? 66.878  59.241  39.167  1.00 86.96  ? 109  VAL A CG2   1 
ATOM   836   N  N     . VAL A  1  110 ? 65.440  60.603  35.187  1.00 88.24  ? 110  VAL A N     1 
ATOM   837   C  CA    . VAL A  1  110 ? 64.860  61.406  34.119  1.00 88.05  ? 110  VAL A CA    1 
ATOM   838   C  C     . VAL A  1  110 ? 63.814  60.584  33.388  1.00 88.81  ? 110  VAL A C     1 
ATOM   839   O  O     . VAL A  1  110 ? 62.750  61.091  33.034  1.00 89.55  ? 110  VAL A O     1 
ATOM   840   C  CB    . VAL A  1  110 ? 65.921  61.856  33.110  1.00 87.38  ? 110  VAL A CB    1 
ATOM   841   C  CG1   . VAL A  1  110 ? 65.255  62.542  31.945  1.00 87.22  ? 110  VAL A CG1   1 
ATOM   842   C  CG2   . VAL A  1  110 ? 66.898  62.807  33.775  1.00 86.92  ? 110  VAL A CG2   1 
ATOM   843   N  N     . GLU A  1  111 ? 64.123  59.313  33.162  1.00 89.29  ? 111  GLU A N     1 
ATOM   844   C  CA    . GLU A  1  111 ? 63.192  58.413  32.494  1.00 90.22  ? 111  GLU A CA    1 
ATOM   845   C  C     . GLU A  1  111 ? 61.924  58.363  33.332  1.00 89.70  ? 111  GLU A C     1 
ATOM   846   O  O     . GLU A  1  111 ? 60.815  58.521  32.818  1.00 89.57  ? 111  GLU A O     1 
ATOM   847   C  CB    . GLU A  1  111 ? 63.792  57.011  32.389  1.00 91.98  ? 111  GLU A CB    1 
ATOM   848   C  CG    . GLU A  1  111 ? 62.869  55.972  31.771  1.00 94.82  ? 111  GLU A CG    1 
ATOM   849   C  CD    . GLU A  1  111 ? 63.393  54.559  31.958  1.00 97.35  ? 111  GLU A CD    1 
ATOM   850   O  OE1   . GLU A  1  111 ? 64.532  54.274  31.528  1.00 98.47  ? 111  GLU A OE1   1 
ATOM   851   O  OE2   . GLU A  1  111 ? 62.669  53.729  32.545  1.00 99.23  ? 111  GLU A OE2   1 
ATOM   852   N  N     . LEU A  1  112 ? 62.106  58.145  34.633  1.00 88.99  ? 112  LEU A N     1 
ATOM   853   C  CA    . LEU A  1  112 ? 60.992  58.084  35.571  1.00 87.97  ? 112  LEU A CA    1 
ATOM   854   C  C     . LEU A  1  112 ? 60.184  59.392  35.567  1.00 87.84  ? 112  LEU A C     1 
ATOM   855   O  O     . LEU A  1  112 ? 58.948  59.358  35.474  1.00 88.51  ? 112  LEU A O     1 
ATOM   856   C  CB    . LEU A  1  112 ? 61.515  57.778  36.979  1.00 86.01  ? 112  LEU A CB    1 
ATOM   857   C  CG    . LEU A  1  112 ? 62.052  56.361  37.166  1.00 84.42  ? 112  LEU A CG    1 
ATOM   858   C  CD1   . LEU A  1  112 ? 62.681  56.228  38.541  1.00 84.45  ? 112  LEU A CD1   1 
ATOM   859   C  CD2   . LEU A  1  112 ? 60.920  55.364  36.989  1.00 81.40  ? 112  LEU A CD2   1 
ATOM   860   N  N     . LEU A  1  113 ? 60.876  60.533  35.664  1.00 86.04  ? 113  LEU A N     1 
ATOM   861   C  CA    . LEU A  1  113 ? 60.218  61.836  35.654  1.00 83.37  ? 113  LEU A CA    1 
ATOM   862   C  C     . LEU A  1  113 ? 59.346  61.915  34.412  1.00 82.93  ? 113  LEU A C     1 
ATOM   863   O  O     . LEU A  1  113 ? 58.141  62.151  34.492  1.00 82.59  ? 113  LEU A O     1 
ATOM   864   C  CB    . LEU A  1  113 ? 61.253  62.951  35.627  1.00 82.21  ? 113  LEU A CB    1 
ATOM   865   C  CG    . LEU A  1  113 ? 62.142  63.059  36.865  1.00 83.13  ? 113  LEU A CG    1 
ATOM   866   C  CD1   . LEU A  1  113 ? 63.240  64.092  36.629  1.00 84.92  ? 113  LEU A CD1   1 
ATOM   867   C  CD2   . LEU A  1  113 ? 61.305  63.455  38.056  1.00 83.00  ? 113  LEU A CD2   1 
ATOM   868   N  N     . ALA A  1  114 ? 59.964  61.692  33.260  1.00 82.54  ? 114  ALA A N     1 
ATOM   869   C  CA    . ALA A  1  114 ? 59.253  61.728  31.993  1.00 82.50  ? 114  ALA A CA    1 
ATOM   870   C  C     . ALA A  1  114 ? 58.015  60.847  32.011  1.00 83.06  ? 114  ALA A C     1 
ATOM   871   O  O     . ALA A  1  114 ? 56.953  61.256  31.553  1.00 83.70  ? 114  ALA A O     1 
ATOM   872   C  CB    . ALA A  1  114 ? 60.171  61.293  30.876  1.00 81.76  ? 114  ALA A CB    1 
ATOM   873   N  N     . ASP A  1  115 ? 58.150  59.637  32.546  1.00 83.84  ? 115  ASP A N     1 
ATOM   874   C  CA    . ASP A  1  115 ? 57.034  58.692  32.594  1.00 84.35  ? 115  ASP A CA    1 
ATOM   875   C  C     . ASP A  1  115 ? 55.870  59.188  33.458  1.00 84.52  ? 115  ASP A C     1 
ATOM   876   O  O     . ASP A  1  115 ? 54.720  58.776  33.258  1.00 84.50  ? 115  ASP A O     1 
ATOM   877   C  CB    . ASP A  1  115 ? 57.526  57.315  33.090  1.00 84.37  ? 115  ASP A CB    1 
ATOM   878   C  CG    . ASP A  1  115 ? 56.471  56.210  32.928  1.00 84.85  ? 115  ASP A CG    1 
ATOM   879   O  OD1   . ASP A  1  115 ? 55.727  56.218  31.916  1.00 84.29  ? 115  ASP A OD1   1 
ATOM   880   O  OD2   . ASP A  1  115 ? 56.397  55.320  33.807  1.00 83.74  ? 115  ASP A OD2   1 
ATOM   881   N  N     . VAL A  1  116 ? 56.163  60.082  34.404  1.00 83.98  ? 116  VAL A N     1 
ATOM   882   C  CA    . VAL A  1  116 ? 55.128  60.620  35.292  1.00 81.94  ? 116  VAL A CA    1 
ATOM   883   C  C     . VAL A  1  116 ? 54.338  61.763  34.661  1.00 80.81  ? 116  VAL A C     1 
ATOM   884   O  O     . VAL A  1  116 ? 53.105  61.705  34.601  1.00 80.14  ? 116  VAL A O     1 
ATOM   885   C  CB    . VAL A  1  116 ? 55.732  61.111  36.610  1.00 81.21  ? 116  VAL A CB    1 
ATOM   886   C  CG1   . VAL A  1  116 ? 54.650  61.708  37.476  1.00 81.70  ? 116  VAL A CG1   1 
ATOM   887   C  CG2   . VAL A  1  116 ? 56.406  59.953  37.327  1.00 80.81  ? 116  VAL A CG2   1 
ATOM   888   N  N     . VAL A  1  117 ? 55.050  62.790  34.193  1.00 79.21  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117 ? 54.420  63.947  33.559  1.00 78.13  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117 ? 53.699  63.587  32.261  1.00 78.86  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117 ? 52.784  64.287  31.833  1.00 78.17  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117 ? 55.451  65.045  33.215  1.00 76.93  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117 ? 56.259  65.407  34.435  1.00 75.87  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117 ? 56.353  64.576  32.102  1.00 77.45  ? 117  VAL A CG2   1 
ATOM   895   N  N     . GLN A  1  118 ? 54.107  62.486  31.643  1.00 80.20  ? 118  GLN A N     1 
ATOM   896   C  CA    . GLN A  1  118 ? 53.523  62.073  30.381  1.00 81.33  ? 118  GLN A CA    1 
ATOM   897   C  C     . GLN A  1  118 ? 52.524  60.933  30.426  1.00 82.50  ? 118  GLN A C     1 
ATOM   898   O  O     . GLN A  1  118 ? 51.422  61.060  29.888  1.00 83.60  ? 118  GLN A O     1 
ATOM   899   C  CB    . GLN A  1  118 ? 54.637  61.721  29.403  1.00 81.43  ? 118  GLN A CB    1 
ATOM   900   C  CG    . GLN A  1  118 ? 55.549  62.884  29.100  1.00 83.34  ? 118  GLN A CG    1 
ATOM   901   C  CD    . GLN A  1  118 ? 56.820  62.462  28.411  1.00 85.00  ? 118  GLN A CD    1 
ATOM   902   O  OE1   . GLN A  1  118 ? 57.672  63.290  28.106  1.00 86.82  ? 118  GLN A OE1   1 
ATOM   903   N  NE2   . GLN A  1  118 ? 56.963  61.166  28.168  1.00 87.48  ? 118  GLN A NE2   1 
ATOM   904   N  N     . ASN A  1  119 ? 52.890  59.824  31.063  1.00 83.41  ? 119  ASN A N     1 
ATOM   905   C  CA    . ASN A  1  119 ? 52.001  58.662  31.101  1.00 84.65  ? 119  ASN A CA    1 
ATOM   906   C  C     . ASN A  1  119 ? 51.338  58.342  32.420  1.00 84.26  ? 119  ASN A C     1 
ATOM   907   O  O     . ASN A  1  119 ? 51.339  57.189  32.835  1.00 85.12  ? 119  ASN A O     1 
ATOM   908   C  CB    . ASN A  1  119 ? 52.749  57.410  30.638  1.00 86.53  ? 119  ASN A CB    1 
ATOM   909   C  CG    . ASN A  1  119 ? 53.353  57.580  29.277  1.00 88.26  ? 119  ASN A CG    1 
ATOM   910   O  OD1   . ASN A  1  119 ? 52.640  57.696  28.276  1.00 87.97  ? 119  ASN A OD1   1 
ATOM   911   N  ND2   . ASN A  1  119 ? 54.682  57.617  29.226  1.00 90.07  ? 119  ASN A ND2   1 
ATOM   912   N  N     . CYS A  1  120 ? 50.759  59.329  33.085  1.00 83.81  ? 120  CYS A N     1 
ATOM   913   C  CA    . CYS A  1  120 ? 50.106  59.030  34.347  1.00 82.68  ? 120  CYS A CA    1 
ATOM   914   C  C     . CYS A  1  120 ? 48.950  58.074  34.093  1.00 80.55  ? 120  CYS A C     1 
ATOM   915   O  O     . CYS A  1  120 ? 48.100  58.320  33.250  1.00 78.65  ? 120  CYS A O     1 
ATOM   916   C  CB    . CYS A  1  120 ? 49.597  60.302  35.014  1.00 84.30  ? 120  CYS A CB    1 
ATOM   917   S  SG    . CYS A  1  120 ? 48.885  59.985  36.635  1.00 87.16  ? 120  CYS A SG    1 
ATOM   918   N  N     . ALA A  1  121 ? 48.940  56.970  34.825  1.00 80.74  ? 121  ALA A N     1 
ATOM   919   C  CA    . ALA A  1  121 ? 47.902  55.964  34.685  1.00 81.77  ? 121  ALA A CA    1 
ATOM   920   C  C     . ALA A  1  121 ? 46.526  56.570  34.885  1.00 83.14  ? 121  ALA A C     1 
ATOM   921   O  O     . ALA A  1  121 ? 45.635  56.369  34.067  1.00 83.40  ? 121  ALA A O     1 
ATOM   922   C  CB    . ALA A  1  121 ? 48.125  54.848  35.688  1.00 81.31  ? 121  ALA A CB    1 
ATOM   923   N  N     . LEU A  1  122 ? 46.362  57.321  35.972  1.00 84.53  ? 122  LEU A N     1 
ATOM   924   C  CA    . LEU A  1  122 ? 45.083  57.946  36.292  1.00 85.21  ? 122  LEU A CA    1 
ATOM   925   C  C     . LEU A  1  122 ? 44.055  56.851  36.452  1.00 86.00  ? 122  LEU A C     1 
ATOM   926   O  O     . LEU A  1  122 ? 42.919  56.976  35.998  1.00 85.72  ? 122  LEU A O     1 
ATOM   927   C  CB    . LEU A  1  122 ? 44.629  58.901  35.182  1.00 85.29  ? 122  LEU A CB    1 
ATOM   928   C  CG    . LEU A  1  122 ? 45.498  60.134  34.921  1.00 85.88  ? 122  LEU A CG    1 
ATOM   929   C  CD1   . LEU A  1  122 ? 44.851  61.011  33.855  1.00 84.56  ? 122  LEU A CD1   1 
ATOM   930   C  CD2   . LEU A  1  122 ? 45.679  60.908  36.210  1.00 85.75  ? 122  LEU A CD2   1 
ATOM   931   N  N     . GLU A  1  123 ? 44.466  55.770  37.099  1.00 87.55  ? 123  GLU A N     1 
ATOM   932   C  CA    . GLU A  1  123 ? 43.576  54.650  37.318  1.00 90.15  ? 123  GLU A CA    1 
ATOM   933   C  C     . GLU A  1  123 ? 42.277  55.113  37.970  1.00 90.14  ? 123  GLU A C     1 
ATOM   934   O  O     . GLU A  1  123 ? 42.256  55.489  39.138  1.00 89.10  ? 123  GLU A O     1 
ATOM   935   C  CB    . GLU A  1  123 ? 44.258  53.603  38.195  1.00 92.40  ? 123  GLU A CB    1 
ATOM   936   C  CG    . GLU A  1  123 ? 43.488  52.292  38.254  1.00 95.86  ? 123  GLU A CG    1 
ATOM   937   C  CD    . GLU A  1  123 ? 43.316  51.638  36.882  1.00 97.21  ? 123  GLU A CD    1 
ATOM   938   O  OE1   . GLU A  1  123 ? 42.605  50.608  36.813  1.00 98.27  ? 123  GLU A OE1   1 
ATOM   939   O  OE2   . GLU A  1  123 ? 43.893  52.144  35.884  1.00 96.58  ? 123  GLU A OE2   1 
ATOM   940   N  N     . GLU A  1  124 ? 41.194  55.067  37.206  1.00 91.65  ? 124  GLU A N     1 
ATOM   941   C  CA    . GLU A  1  124 ? 39.893  55.496  37.692  1.00 94.05  ? 124  GLU A CA    1 
ATOM   942   C  C     . GLU A  1  124 ? 39.477  54.846  39.013  1.00 93.46  ? 124  GLU A C     1 
ATOM   943   O  O     . GLU A  1  124 ? 38.479  55.230  39.628  1.00 94.62  ? 124  GLU A O     1 
ATOM   944   C  CB    . GLU A  1  124 ? 38.827  55.221  36.635  1.00 96.72  ? 124  GLU A CB    1 
ATOM   945   C  CG    . GLU A  1  124 ? 37.491  55.860  36.966  1.00 102.47 ? 124  GLU A CG    1 
ATOM   946   C  CD    . GLU A  1  124 ? 36.371  55.353  36.087  1.00 105.73 ? 124  GLU A CD    1 
ATOM   947   O  OE1   . GLU A  1  124 ? 36.039  54.147  36.178  1.00 107.23 ? 124  GLU A OE1   1 
ATOM   948   O  OE2   . GLU A  1  124 ? 35.826  56.162  35.303  1.00 108.51 ? 124  GLU A OE2   1 
ATOM   949   N  N     . SER A  1  125 ? 40.233  53.855  39.451  1.00 92.11  ? 125  SER A N     1 
ATOM   950   C  CA    . SER A  1  125 ? 39.917  53.182  40.698  1.00 90.58  ? 125  SER A CA    1 
ATOM   951   C  C     . SER A  1  125 ? 40.544  54.004  41.807  1.00 89.65  ? 125  SER A C     1 
ATOM   952   O  O     . SER A  1  125 ? 39.922  54.273  42.828  1.00 89.54  ? 125  SER A O     1 
ATOM   953   C  CB    . SER A  1  125 ? 40.518  51.785  40.691  1.00 91.20  ? 125  SER A CB    1 
ATOM   954   O  OG    . SER A  1  125 ? 40.337  51.171  39.424  1.00 92.30  ? 125  SER A OG    1 
ATOM   955   N  N     . GLN A  1  126 ? 41.793  54.396  41.573  1.00 88.36  ? 126  GLN A N     1 
ATOM   956   C  CA    . GLN A  1  126 ? 42.582  55.191  42.503  1.00 86.80  ? 126  GLN A CA    1 
ATOM   957   C  C     . GLN A  1  126 ? 41.938  56.559  42.656  1.00 85.68  ? 126  GLN A C     1 
ATOM   958   O  O     . GLN A  1  126 ? 41.826  57.092  43.758  1.00 86.30  ? 126  GLN A O     1 
ATOM   959   C  CB    . GLN A  1  126 ? 44.007  55.353  41.959  1.00 87.32  ? 126  GLN A CB    1 
ATOM   960   C  CG    . GLN A  1  126 ? 44.994  56.023  42.913  1.00 88.11  ? 126  GLN A CG    1 
ATOM   961   C  CD    . GLN A  1  126 ? 45.499  55.087  44.007  1.00 88.00  ? 126  GLN A CD    1 
ATOM   962   O  OE1   . GLN A  1  126 ? 46.141  54.079  43.728  1.00 88.09  ? 126  GLN A OE1   1 
ATOM   963   N  NE2   . GLN A  1  126 ? 45.212  55.425  45.257  1.00 88.74  ? 126  GLN A NE2   1 
ATOM   964   N  N     . ILE A  1  127 ? 41.522  57.129  41.534  1.00 83.70  ? 127  ILE A N     1 
ATOM   965   C  CA    . ILE A  1  127 ? 40.888  58.432  41.545  1.00 81.47  ? 127  ILE A CA    1 
ATOM   966   C  C     . ILE A  1  127 ? 39.849  58.532  42.658  1.00 81.31  ? 127  ILE A C     1 
ATOM   967   O  O     . ILE A  1  127 ? 39.913  59.436  43.484  1.00 82.59  ? 127  ILE A O     1 
ATOM   968   C  CB    . ILE A  1  127 ? 40.212  58.735  40.189  1.00 79.77  ? 127  ILE A CB    1 
ATOM   969   C  CG1   . ILE A  1  127 ? 41.277  59.064  39.146  1.00 78.07  ? 127  ILE A CG1   1 
ATOM   970   C  CG2   . ILE A  1  127 ? 39.237  59.890  40.331  1.00 78.94  ? 127  ILE A CG2   1 
ATOM   971   C  CD1   . ILE A  1  127 ? 40.710  59.505  37.827  1.00 76.00  ? 127  ILE A CD1   1 
ATOM   972   N  N     . GLU A  1  128 ? 38.901  57.604  42.694  1.00 79.51  ? 128  GLU A N     1 
ATOM   973   C  CA    . GLU A  1  128 ? 37.875  57.654  43.721  1.00 78.59  ? 128  GLU A CA    1 
ATOM   974   C  C     . GLU A  1  128 ? 38.435  57.571  45.130  1.00 78.38  ? 128  GLU A C     1 
ATOM   975   O  O     . GLU A  1  128 ? 37.788  58.005  46.080  1.00 79.43  ? 128  GLU A O     1 
ATOM   976   C  CB    . GLU A  1  128 ? 36.855  56.545  43.510  1.00 78.61  ? 128  GLU A CB    1 
ATOM   977   C  CG    . GLU A  1  128 ? 36.090  56.680  42.220  1.00 80.09  ? 128  GLU A CG    1 
ATOM   978   C  CD    . GLU A  1  128 ? 35.474  58.054  42.061  1.00 81.88  ? 128  GLU A CD    1 
ATOM   979   O  OE1   . GLU A  1  128 ? 34.788  58.518  42.999  1.00 82.47  ? 128  GLU A OE1   1 
ATOM   980   O  OE2   . GLU A  1  128 ? 35.670  58.671  40.994  1.00 82.73  ? 128  GLU A OE2   1 
ATOM   981   N  N     . LYS A  1  129 ? 39.630  57.011  45.274  1.00 78.21  ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A  1  129 ? 40.249  56.904  46.592  1.00 77.85  ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A  1  129 ? 40.862  58.246  46.972  1.00 76.14  ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A  1  129 ? 40.583  58.785  48.045  1.00 76.34  ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A  1  129 ? 41.334  55.822  46.609  1.00 79.14  ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A  1  129 ? 42.190  55.835  47.885  1.00 81.62  ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A  1  129 ? 43.292  54.783  47.851  1.00 83.84  ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A  1  129 ? 44.290  54.952  48.993  1.00 83.89  ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A  1  129 ? 45.281  53.831  49.012  1.00 84.70  ? 129  LYS A NZ    1 
ATOM   990   N  N     . GLU A  1  130 ? 41.704  58.772  46.090  1.00 73.50  ? 130  GLU A N     1 
ATOM   991   C  CA    . GLU A  1  130 ? 42.338  60.056  46.321  1.00 72.81  ? 130  GLU A CA    1 
ATOM   992   C  C     . GLU A  1  130 ? 41.272  61.130  46.552  1.00 72.48  ? 130  GLU A C     1 
ATOM   993   O  O     . GLU A  1  130 ? 41.488  62.099  47.285  1.00 73.33  ? 130  GLU A O     1 
ATOM   994   C  CB    . GLU A  1  130 ? 43.187  60.436  45.115  1.00 73.26  ? 130  GLU A CB    1 
ATOM   995   C  CG    . GLU A  1  130 ? 44.268  59.444  44.841  1.00 75.21  ? 130  GLU A CG    1 
ATOM   996   C  CD    . GLU A  1  130 ? 45.167  59.283  46.029  1.00 76.28  ? 130  GLU A CD    1 
ATOM   997   O  OE1   . GLU A  1  130 ? 45.812  60.281  46.409  1.00 75.55  ? 130  GLU A OE1   1 
ATOM   998   O  OE2   . GLU A  1  130 ? 45.219  58.165  46.589  1.00 78.60  ? 130  GLU A OE2   1 
ATOM   999   N  N     . ARG A  1  131 ? 40.116  60.962  45.921  1.00 69.89  ? 131  ARG A N     1 
ATOM   1000  C  CA    . ARG A  1  131 ? 39.056  61.931  46.073  1.00 65.97  ? 131  ARG A CA    1 
ATOM   1001  C  C     . ARG A  1  131 ? 38.775  62.050  47.553  1.00 63.98  ? 131  ARG A C     1 
ATOM   1002  O  O     . ARG A  1  131 ? 38.669  63.151  48.076  1.00 64.09  ? 131  ARG A O     1 
ATOM   1003  C  CB    . ARG A  1  131 ? 37.810  61.474  45.328  1.00 66.75  ? 131  ARG A CB    1 
ATOM   1004  C  CG    . ARG A  1  131 ? 36.732  62.532  45.212  1.00 67.87  ? 131  ARG A CG    1 
ATOM   1005  C  CD    . ARG A  1  131 ? 35.452  61.942  44.647  1.00 69.19  ? 131  ARG A CD    1 
ATOM   1006  N  NE    . ARG A  1  131 ? 35.652  61.322  43.337  1.00 69.88  ? 131  ARG A NE    1 
ATOM   1007  C  CZ    . ARG A  1  131 ? 35.881  61.988  42.211  1.00 70.23  ? 131  ARG A CZ    1 
ATOM   1008  N  NH1   . ARG A  1  131 ? 35.946  63.311  42.205  1.00 71.74  ? 131  ARG A NH1   1 
ATOM   1009  N  NH2   . ARG A  1  131 ? 36.040  61.324  41.082  1.00 70.54  ? 131  ARG A NH2   1 
ATOM   1010  N  N     . GLY A  1  132 ? 38.681  60.909  48.227  1.00 62.81  ? 132  GLY A N     1 
ATOM   1011  C  CA    . GLY A  1  132 ? 38.411  60.902  49.655  1.00 61.98  ? 132  GLY A CA    1 
ATOM   1012  C  C     . GLY A  1  132 ? 39.588  61.386  50.480  1.00 61.52  ? 132  GLY A C     1 
ATOM   1013  O  O     . GLY A  1  132 ? 39.419  61.893  51.588  1.00 60.98  ? 132  GLY A O     1 
ATOM   1014  N  N     . VAL A  1  133 ? 40.789  61.230  49.935  1.00 61.79  ? 133  VAL A N     1 
ATOM   1015  C  CA    . VAL A  1  133 ? 42.005  61.662  50.618  1.00 62.09  ? 133  VAL A CA    1 
ATOM   1016  C  C     . VAL A  1  133 ? 42.116  63.189  50.617  1.00 63.25  ? 133  VAL A C     1 
ATOM   1017  O  O     . VAL A  1  133 ? 42.298  63.817  51.665  1.00 63.11  ? 133  VAL A O     1 
ATOM   1018  C  CB    . VAL A  1  133 ? 43.255  61.063  49.948  1.00 59.58  ? 133  VAL A CB    1 
ATOM   1019  C  CG1   . VAL A  1  133 ? 44.503  61.636  50.574  1.00 59.41  ? 133  VAL A CG1   1 
ATOM   1020  C  CG2   . VAL A  1  133 ? 43.235  59.566  50.089  1.00 59.23  ? 133  VAL A CG2   1 
ATOM   1021  N  N     . ILE A  1  134 ? 42.016  63.782  49.434  1.00 64.02  ? 134  ILE A N     1 
ATOM   1022  C  CA    . ILE A  1  134 ? 42.076  65.226  49.318  1.00 65.06  ? 134  ILE A CA    1 
ATOM   1023  C  C     . ILE A  1  134 ? 41.020  65.811  50.253  1.00 66.66  ? 134  ILE A C     1 
ATOM   1024  O  O     . ILE A  1  134 ? 41.323  66.698  51.056  1.00 66.69  ? 134  ILE A O     1 
ATOM   1025  C  CB    . ILE A  1  134 ? 41.757  65.680  47.900  1.00 64.61  ? 134  ILE A CB    1 
ATOM   1026  C  CG1   . ILE A  1  134 ? 42.574  64.863  46.901  1.00 64.41  ? 134  ILE A CG1   1 
ATOM   1027  C  CG2   . ILE A  1  134 ? 42.066  67.140  47.759  1.00 63.37  ? 134  ILE A CG2   1 
ATOM   1028  C  CD1   . ILE A  1  134 ? 42.289  65.193  45.452  1.00 64.98  ? 134  ILE A CD1   1 
ATOM   1029  N  N     . LEU A  1  135 ? 39.784  65.308  50.150  1.00 67.12  ? 135  LEU A N     1 
ATOM   1030  C  CA    . LEU A  1  135 ? 38.693  65.785  50.999  1.00 67.54  ? 135  LEU A CA    1 
ATOM   1031  C  C     . LEU A  1  135 ? 39.091  65.743  52.454  1.00 68.53  ? 135  LEU A C     1 
ATOM   1032  O  O     . LEU A  1  135 ? 38.668  66.588  53.244  1.00 69.09  ? 135  LEU A O     1 
ATOM   1033  C  CB    . LEU A  1  135 ? 37.439  64.941  50.826  1.00 67.24  ? 135  LEU A CB    1 
ATOM   1034  C  CG    . LEU A  1  135 ? 36.595  65.150  49.574  1.00 68.86  ? 135  LEU A CG    1 
ATOM   1035  C  CD1   . LEU A  1  135 ? 35.316  64.337  49.720  1.00 67.65  ? 135  LEU A CD1   1 
ATOM   1036  C  CD2   . LEU A  1  135 ? 36.272  66.627  49.387  1.00 67.86  ? 135  LEU A CD2   1 
ATOM   1037  N  N     . GLN A  1  136 ? 39.906  64.752  52.801  1.00 69.63  ? 136  GLN A N     1 
ATOM   1038  C  CA    . GLN A  1  136 ? 40.372  64.589  54.168  1.00 70.64  ? 136  GLN A CA    1 
ATOM   1039  C  C     . GLN A  1  136 ? 41.457  65.604  54.512  1.00 69.79  ? 136  GLN A C     1 
ATOM   1040  O  O     . GLN A  1  136 ? 41.463  66.175  55.601  1.00 70.16  ? 136  GLN A O     1 
ATOM   1041  C  CB    . GLN A  1  136 ? 40.895  63.169  54.372  1.00 73.51  ? 136  GLN A CB    1 
ATOM   1042  C  CG    . GLN A  1  136 ? 41.493  62.927  55.753  1.00 79.52  ? 136  GLN A CG    1 
ATOM   1043  C  CD    . GLN A  1  136 ? 40.575  63.380  56.883  1.00 82.98  ? 136  GLN A CD    1 
ATOM   1044  O  OE1   . GLN A  1  136 ? 39.461  62.858  57.054  1.00 85.40  ? 136  GLN A OE1   1 
ATOM   1045  N  NE2   . GLN A  1  136 ? 41.039  64.361  57.661  1.00 83.42  ? 136  GLN A NE2   1 
ATOM   1046  N  N     . GLU A  1  137 ? 42.375  65.830  53.583  1.00 68.62  ? 137  GLU A N     1 
ATOM   1047  C  CA    . GLU A  1  137 ? 43.443  66.789  53.810  1.00 68.05  ? 137  GLU A CA    1 
ATOM   1048  C  C     . GLU A  1  137 ? 42.847  68.184  53.953  1.00 68.12  ? 137  GLU A C     1 
ATOM   1049  O  O     . GLU A  1  137 ? 43.407  69.033  54.642  1.00 67.54  ? 137  GLU A O     1 
ATOM   1050  C  CB    . GLU A  1  137 ? 44.438  66.763  52.650  1.00 68.57  ? 137  GLU A CB    1 
ATOM   1051  C  CG    . GLU A  1  137 ? 44.905  65.365  52.271  1.00 68.09  ? 137  GLU A CG    1 
ATOM   1052  C  CD    . GLU A  1  137 ? 45.976  65.399  51.215  1.00 66.77  ? 137  GLU A CD    1 
ATOM   1053  O  OE1   . GLU A  1  137 ? 45.868  66.275  50.332  1.00 64.22  ? 137  GLU A OE1   1 
ATOM   1054  O  OE2   . GLU A  1  137 ? 46.907  64.556  51.267  1.00 66.93  ? 137  GLU A OE2   1 
ATOM   1055  N  N     . LEU A  1  138 ? 41.716  68.435  53.298  1.00 68.42  ? 138  LEU A N     1 
ATOM   1056  C  CA    . LEU A  1  138 ? 41.098  69.745  53.429  1.00 69.23  ? 138  LEU A CA    1 
ATOM   1057  C  C     . LEU A  1  138 ? 40.631  69.919  54.870  1.00 70.61  ? 138  LEU A C     1 
ATOM   1058  O  O     . LEU A  1  138 ? 40.945  70.929  55.502  1.00 72.00  ? 138  LEU A O     1 
ATOM   1059  C  CB    . LEU A  1  138 ? 39.929  69.918  52.460  1.00 67.55  ? 138  LEU A CB    1 
ATOM   1060  C  CG    . LEU A  1  138 ? 40.295  70.094  50.982  1.00 66.89  ? 138  LEU A CG    1 
ATOM   1061  C  CD1   . LEU A  1  138 ? 39.077  70.565  50.207  1.00 65.48  ? 138  LEU A CD1   1 
ATOM   1062  C  CD2   . LEU A  1  138 ? 41.411  71.104  50.837  1.00 65.24  ? 138  LEU A CD2   1 
ATOM   1063  N  N     . LYS A  1  139 ? 39.901  68.941  55.402  1.00 70.71  ? 139  LYS A N     1 
ATOM   1064  C  CA    . LYS A  1  139 ? 39.449  69.030  56.788  1.00 72.00  ? 139  LYS A CA    1 
ATOM   1065  C  C     . LYS A  1  139 ? 40.635  69.444  57.663  1.00 71.84  ? 139  LYS A C     1 
ATOM   1066  O  O     . LYS A  1  139 ? 40.508  70.260  58.577  1.00 71.43  ? 139  LYS A O     1 
ATOM   1067  C  CB    . LYS A  1  139 ? 38.942  67.679  57.297  1.00 74.49  ? 139  LYS A CB    1 
ATOM   1068  C  CG    . LYS A  1  139 ? 37.777  67.072  56.542  1.00 79.00  ? 139  LYS A CG    1 
ATOM   1069  C  CD    . LYS A  1  139 ? 36.453  67.767  56.819  1.00 82.36  ? 139  LYS A CD    1 
ATOM   1070  C  CE    . LYS A  1  139 ? 35.304  67.029  56.103  1.00 84.46  ? 139  LYS A CE    1 
ATOM   1071  N  NZ    . LYS A  1  139 ? 33.982  67.736  56.192  1.00 85.41  ? 139  LYS A NZ    1 
ATOM   1072  N  N     . GLU A  1  140 ? 41.799  68.877  57.375  1.00 71.68  ? 140  GLU A N     1 
ATOM   1073  C  CA    . GLU A  1  140 ? 42.977  69.182  58.166  1.00 71.46  ? 140  GLU A CA    1 
ATOM   1074  C  C     . GLU A  1  140 ? 43.515  70.576  57.903  1.00 68.89  ? 140  GLU A C     1 
ATOM   1075  O  O     . GLU A  1  140 ? 43.593  71.385  58.809  1.00 68.87  ? 140  GLU A O     1 
ATOM   1076  C  CB    . GLU A  1  140 ? 44.065  68.134  57.913  1.00 74.72  ? 140  GLU A CB    1 
ATOM   1077  C  CG    . GLU A  1  140 ? 43.573  66.690  58.041  1.00 79.97  ? 140  GLU A CG    1 
ATOM   1078  C  CD    . GLU A  1  140 ? 44.666  65.660  57.757  1.00 83.57  ? 140  GLU A CD    1 
ATOM   1079  O  OE1   . GLU A  1  140 ? 45.542  65.470  58.626  1.00 86.27  ? 140  GLU A OE1   1 
ATOM   1080  O  OE2   . GLU A  1  140 ? 44.660  65.046  56.664  1.00 84.24  ? 140  GLU A OE2   1 
ATOM   1081  N  N     . MET A  1  141 ? 43.873  70.863  56.662  1.00 66.99  ? 141  MET A N     1 
ATOM   1082  C  CA    . MET A  1  141 ? 44.424  72.168  56.321  1.00 65.92  ? 141  MET A CA    1 
ATOM   1083  C  C     . MET A  1  141 ? 43.564  73.321  56.788  1.00 65.16  ? 141  MET A C     1 
ATOM   1084  O  O     . MET A  1  141 ? 44.050  74.440  56.965  1.00 63.88  ? 141  MET A O     1 
ATOM   1085  C  CB    . MET A  1  141 ? 44.616  72.274  54.816  1.00 66.13  ? 141  MET A CB    1 
ATOM   1086  C  CG    . MET A  1  141 ? 45.484  71.195  54.241  1.00 66.97  ? 141  MET A CG    1 
ATOM   1087  S  SD    . MET A  1  141 ? 45.597  71.344  52.471  1.00 68.65  ? 141  MET A SD    1 
ATOM   1088  C  CE    . MET A  1  141 ? 47.064  72.408  52.333  1.00 69.69  ? 141  MET A CE    1 
ATOM   1089  N  N     . ASP A  1  142 ? 42.282  73.041  56.982  1.00 65.75  ? 142  ASP A N     1 
ATOM   1090  C  CA    . ASP A  1  142 ? 41.338  74.061  57.412  1.00 66.71  ? 142  ASP A CA    1 
ATOM   1091  C  C     . ASP A  1  142 ? 41.624  74.474  58.848  1.00 65.89  ? 142  ASP A C     1 
ATOM   1092  O  O     . ASP A  1  142 ? 41.189  75.527  59.290  1.00 65.71  ? 142  ASP A O     1 
ATOM   1093  C  CB    . ASP A  1  142 ? 39.903  73.538  57.271  1.00 68.10  ? 142  ASP A CB    1 
ATOM   1094  C  CG    . ASP A  1  142 ? 38.926  74.601  56.759  1.00 69.50  ? 142  ASP A CG    1 
ATOM   1095  O  OD1   . ASP A  1  142 ? 39.268  75.344  55.808  1.00 68.15  ? 142  ASP A OD1   1 
ATOM   1096  O  OD2   . ASP A  1  142 ? 37.803  74.676  57.300  1.00 70.54  ? 142  ASP A OD2   1 
ATOM   1097  N  N     . ASN A  1  143 ? 42.362  73.644  59.572  1.00 66.73  ? 143  ASN A N     1 
ATOM   1098  C  CA    . ASN A  1  143 ? 42.716  73.961  60.949  1.00 67.24  ? 143  ASN A CA    1 
ATOM   1099  C  C     . ASN A  1  143 ? 44.081  74.606  61.018  1.00 67.52  ? 143  ASN A C     1 
ATOM   1100  O  O     . ASN A  1  143 ? 44.691  74.670  62.073  1.00 68.34  ? 143  ASN A O     1 
ATOM   1101  C  CB    . ASN A  1  143 ? 42.703  72.718  61.834  1.00 67.72  ? 143  ASN A CB    1 
ATOM   1102  C  CG    . ASN A  1  143 ? 41.306  72.220  62.103  1.00 69.93  ? 143  ASN A CG    1 
ATOM   1103  O  OD1   . ASN A  1  143 ? 40.410  73.006  62.401  1.00 71.20  ? 143  ASN A OD1   1 
ATOM   1104  N  ND2   . ASN A  1  143 ? 41.109  70.907  62.007  1.00 71.61  ? 143  ASN A ND2   1 
ATOM   1105  N  N     . ASP A  1  144 ? 44.570  75.074  59.885  1.00 68.09  ? 144  ASP A N     1 
ATOM   1106  C  CA    . ASP A  1  144 ? 45.845  75.747  59.874  1.00 69.66  ? 144  ASP A CA    1 
ATOM   1107  C  C     . ASP A  1  144 ? 45.560  77.228  59.616  1.00 72.37  ? 144  ASP A C     1 
ATOM   1108  O  O     . ASP A  1  144 ? 45.550  77.685  58.465  1.00 72.22  ? 144  ASP A O     1 
ATOM   1109  C  CB    . ASP A  1  144 ? 46.724  75.190  58.774  1.00 69.38  ? 144  ASP A CB    1 
ATOM   1110  C  CG    . ASP A  1  144 ? 48.111  75.769  58.805  1.00 69.30  ? 144  ASP A CG    1 
ATOM   1111  O  OD1   . ASP A  1  144 ? 48.271  76.923  59.272  1.00 70.63  ? 144  ASP A OD1   1 
ATOM   1112  O  OD2   . ASP A  1  144 ? 49.040  75.073  58.346  1.00 69.03  ? 144  ASP A OD2   1 
ATOM   1113  N  N     . MET A  1  145 ? 45.312  77.963  60.699  1.00 74.62  ? 145  MET A N     1 
ATOM   1114  C  CA    . MET A  1  145 ? 45.013  79.391  60.641  1.00 76.05  ? 145  MET A CA    1 
ATOM   1115  C  C     . MET A  1  145 ? 45.864  80.119  59.626  1.00 76.69  ? 145  MET A C     1 
ATOM   1116  O  O     . MET A  1  145 ? 45.351  80.911  58.836  1.00 78.33  ? 145  MET A O     1 
ATOM   1117  C  CB    . MET A  1  145 ? 45.254  80.049  61.992  1.00 78.20  ? 145  MET A CB    1 
ATOM   1118  C  CG    . MET A  1  145 ? 44.509  79.449  63.142  1.00 81.09  ? 145  MET A CG    1 
ATOM   1119  S  SD    . MET A  1  145 ? 42.775  79.531  62.845  1.00 86.84  ? 145  MET A SD    1 
ATOM   1120  C  CE    . MET A  1  145 ? 42.471  77.895  62.022  1.00 83.67  ? 145  MET A CE    1 
ATOM   1121  N  N     . THR A  1  146 ? 47.168  79.869  59.657  1.00 76.25  ? 146  THR A N     1 
ATOM   1122  C  CA    . THR A  1  146 ? 48.056  80.544  58.731  1.00 76.65  ? 146  THR A CA    1 
ATOM   1123  C  C     . THR A  1  146 ? 47.626  80.328  57.292  1.00 75.74  ? 146  THR A C     1 
ATOM   1124  O  O     . THR A  1  146 ? 47.602  81.274  56.508  1.00 75.02  ? 146  THR A O     1 
ATOM   1125  C  CB    . THR A  1  146 ? 49.501  80.089  58.898  1.00 77.34  ? 146  THR A CB    1 
ATOM   1126  O  OG1   . THR A  1  146 ? 49.935  80.363  60.235  1.00 78.82  ? 146  THR A OG1   1 
ATOM   1127  C  CG2   . THR A  1  146 ? 50.395  80.851  57.937  1.00 78.00  ? 146  THR A CG2   1 
ATOM   1128  N  N     . ASN A  1  147 ? 47.275  79.095  56.947  1.00 74.91  ? 147  ASN A N     1 
ATOM   1129  C  CA    . ASN A  1  147 ? 46.831  78.801  55.590  1.00 76.00  ? 147  ASN A CA    1 
ATOM   1130  C  C     . ASN A  1  147 ? 45.511  79.497  55.326  1.00 73.84  ? 147  ASN A C     1 
ATOM   1131  O  O     . ASN A  1  147 ? 45.392  80.298  54.396  1.00 74.23  ? 147  ASN A O     1 
ATOM   1132  C  CB    . ASN A  1  147 ? 46.656  77.298  55.380  1.00 81.25  ? 147  ASN A CB    1 
ATOM   1133  C  CG    . ASN A  1  147 ? 47.943  76.526  55.628  1.00 87.71  ? 147  ASN A CG    1 
ATOM   1134  O  OD1   . ASN A  1  147 ? 49.056  77.102  55.568  1.00 90.14  ? 147  ASN A OD1   1 
ATOM   1135  N  ND2   . ASN A  1  147 ? 47.812  75.214  55.898  1.00 87.54  ? 147  ASN A ND2   1 
ATOM   1136  N  N     . VAL A  1  148 ? 44.517  79.183  56.148  1.00 70.68  ? 148  VAL A N     1 
ATOM   1137  C  CA    . VAL A  1  148 ? 43.204  79.793  56.010  1.00 66.68  ? 148  VAL A CA    1 
ATOM   1138  C  C     . VAL A  1  148 ? 43.367  81.287  55.752  1.00 65.35  ? 148  VAL A C     1 
ATOM   1139  O  O     . VAL A  1  148 ? 42.723  81.858  54.855  1.00 65.15  ? 148  VAL A O     1 
ATOM   1140  C  CB    . VAL A  1  148 ? 42.373  79.603  57.291  1.00 65.06  ? 148  VAL A CB    1 
ATOM   1141  C  CG1   . VAL A  1  148 ? 41.046  80.335  57.168  1.00 64.77  ? 148  VAL A CG1   1 
ATOM   1142  C  CG2   . VAL A  1  148 ? 42.144  78.128  57.534  1.00 64.64  ? 148  VAL A CG2   1 
ATOM   1143  N  N     . THR A  1  149 ? 44.259  81.903  56.524  1.00 62.35  ? 149  THR A N     1 
ATOM   1144  C  CA    . THR A  1  149 ? 44.507  83.330  56.434  1.00 59.35  ? 149  THR A CA    1 
ATOM   1145  C  C     . THR A  1  149 ? 45.121  83.839  55.149  1.00 58.28  ? 149  THR A C     1 
ATOM   1146  O  O     . THR A  1  149 ? 44.786  84.940  54.713  1.00 59.13  ? 149  THR A O     1 
ATOM   1147  C  CB    . THR A  1  149 ? 45.368  83.803  57.584  1.00 58.45  ? 149  THR A CB    1 
ATOM   1148  O  OG1   . THR A  1  149 ? 44.715  83.495  58.817  1.00 59.31  ? 149  THR A OG1   1 
ATOM   1149  C  CG2   . THR A  1  149 ? 45.560  85.296  57.504  1.00 58.74  ? 149  THR A CG2   1 
ATOM   1150  N  N     . PHE A  1  150 ? 46.022  83.071  54.542  1.00 56.32  ? 150  PHE A N     1 
ATOM   1151  C  CA    . PHE A  1  150 ? 46.627  83.526  53.296  1.00 54.11  ? 150  PHE A CA    1 
ATOM   1152  C  C     . PHE A  1  150 ? 45.707  83.265  52.131  1.00 53.20  ? 150  PHE A C     1 
ATOM   1153  O  O     . PHE A  1  150 ? 45.644  84.055  51.180  1.00 51.16  ? 150  PHE A O     1 
ATOM   1154  C  CB    . PHE A  1  150 ? 47.978  82.864  53.055  1.00 54.42  ? 150  PHE A CB    1 
ATOM   1155  C  CG    . PHE A  1  150 ? 49.096  83.500  53.823  1.00 54.86  ? 150  PHE A CG    1 
ATOM   1156  C  CD1   . PHE A  1  150 ? 49.432  83.044  55.102  1.00 54.50  ? 150  PHE A CD1   1 
ATOM   1157  C  CD2   . PHE A  1  150 ? 49.760  84.609  53.306  1.00 53.97  ? 150  PHE A CD2   1 
ATOM   1158  C  CE1   . PHE A  1  150 ? 50.406  83.687  55.854  1.00 55.10  ? 150  PHE A CE1   1 
ATOM   1159  C  CE2   . PHE A  1  150 ? 50.740  85.264  54.058  1.00 55.32  ? 150  PHE A CE2   1 
ATOM   1160  C  CZ    . PHE A  1  150 ? 51.062  84.803  55.334  1.00 54.49  ? 150  PHE A CZ    1 
ATOM   1161  N  N     . ASP A  1  151 ? 44.992  82.149  52.198  1.00 53.47  ? 151  ASP A N     1 
ATOM   1162  C  CA    . ASP A  1  151 ? 44.044  81.832  51.144  1.00 54.11  ? 151  ASP A CA    1 
ATOM   1163  C  C     . ASP A  1  151 ? 43.057  82.999  51.112  1.00 53.12  ? 151  ASP A C     1 
ATOM   1164  O  O     . ASP A  1  151 ? 42.827  83.615  50.062  1.00 53.19  ? 151  ASP A O     1 
ATOM   1165  C  CB    . ASP A  1  151 ? 43.312  80.524  51.452  1.00 55.56  ? 151  ASP A CB    1 
ATOM   1166  C  CG    . ASP A  1  151 ? 44.103  79.305  51.034  1.00 57.12  ? 151  ASP A CG    1 
ATOM   1167  O  OD1   . ASP A  1  151 ? 45.088  79.482  50.289  1.00 61.01  ? 151  ASP A OD1   1 
ATOM   1168  O  OD2   . ASP A  1  151 ? 43.741  78.173  51.426  1.00 57.58  ? 151  ASP A OD2   1 
ATOM   1169  N  N     . TYR A  1  152 ? 42.495  83.299  52.280  1.00 49.68  ? 152  TYR A N     1 
ATOM   1170  C  CA    . TYR A  1  152 ? 41.559  84.388  52.404  1.00 47.61  ? 152  TYR A CA    1 
ATOM   1171  C  C     . TYR A  1  152 ? 42.198  85.658  51.904  1.00 47.30  ? 152  TYR A C     1 
ATOM   1172  O  O     . TYR A  1  152 ? 41.561  86.436  51.196  1.00 48.40  ? 152  TYR A O     1 
ATOM   1173  C  CB    . TYR A  1  152 ? 41.145  84.565  53.854  1.00 47.11  ? 152  TYR A CB    1 
ATOM   1174  C  CG    . TYR A  1  152 ? 40.083  83.610  54.323  1.00 46.00  ? 152  TYR A CG    1 
ATOM   1175  C  CD1   . TYR A  1  152 ? 39.617  83.669  55.619  1.00 44.90  ? 152  TYR A CD1   1 
ATOM   1176  C  CD2   . TYR A  1  152 ? 39.532  82.661  53.469  1.00 47.14  ? 152  TYR A CD2   1 
ATOM   1177  C  CE1   . TYR A  1  152 ? 38.631  82.815  56.062  1.00 47.51  ? 152  TYR A CE1   1 
ATOM   1178  C  CE2   . TYR A  1  152 ? 38.540  81.796  53.903  1.00 47.71  ? 152  TYR A CE2   1 
ATOM   1179  C  CZ    . TYR A  1  152 ? 38.094  81.879  55.206  1.00 47.60  ? 152  TYR A CZ    1 
ATOM   1180  O  OH    . TYR A  1  152 ? 37.119  81.028  55.672  1.00 47.87  ? 152  TYR A OH    1 
ATOM   1181  N  N     . LEU A  1  153 ? 43.453  85.881  52.272  1.00 46.40  ? 153  LEU A N     1 
ATOM   1182  C  CA    . LEU A  1  153 ? 44.135  87.078  51.812  1.00 48.17  ? 153  LEU A CA    1 
ATOM   1183  C  C     . LEU A  1  153 ? 44.016  87.172  50.287  1.00 51.04  ? 153  LEU A C     1 
ATOM   1184  O  O     . LEU A  1  153 ? 43.605  88.202  49.735  1.00 51.15  ? 153  LEU A O     1 
ATOM   1185  C  CB    . LEU A  1  153 ? 45.606  87.063  52.215  1.00 46.13  ? 153  LEU A CB    1 
ATOM   1186  C  CG    . LEU A  1  153 ? 46.350  88.335  51.795  1.00 44.25  ? 153  LEU A CG    1 
ATOM   1187  C  CD1   . LEU A  1  153 ? 45.654  89.558  52.349  1.00 44.08  ? 153  LEU A CD1   1 
ATOM   1188  C  CD2   . LEU A  1  153 ? 47.756  88.292  52.290  1.00 43.82  ? 153  LEU A CD2   1 
ATOM   1189  N  N     . HIS A  1  154 ? 44.373  86.097  49.600  1.00 53.74  ? 154  HIS A N     1 
ATOM   1190  C  CA    . HIS A  1  154 ? 44.258  86.086  48.145  1.00 56.26  ? 154  HIS A CA    1 
ATOM   1191  C  C     . HIS A  1  154 ? 42.784  86.209  47.740  1.00 56.35  ? 154  HIS A C     1 
ATOM   1192  O  O     . HIS A  1  154 ? 42.425  86.917  46.783  1.00 55.35  ? 154  HIS A O     1 
ATOM   1193  C  CB    . HIS A  1  154 ? 44.799  84.778  47.577  1.00 58.87  ? 154  HIS A CB    1 
ATOM   1194  C  CG    . HIS A  1  154 ? 46.290  84.669  47.607  1.00 61.72  ? 154  HIS A CG    1 
ATOM   1195  N  ND1   . HIS A  1  154 ? 46.990  84.295  48.732  1.00 61.55  ? 154  HIS A ND1   1 
ATOM   1196  C  CD2   . HIS A  1  154 ? 47.211  84.860  46.633  1.00 62.89  ? 154  HIS A CD2   1 
ATOM   1197  C  CE1   . HIS A  1  154 ? 48.280  84.254  48.448  1.00 63.26  ? 154  HIS A CE1   1 
ATOM   1198  N  NE2   . HIS A  1  154 ? 48.441  84.593  47.181  1.00 63.64  ? 154  HIS A NE2   1 
ATOM   1199  N  N     . ALA A  1  155 ? 41.941  85.496  48.480  1.00 54.85  ? 155  ALA A N     1 
ATOM   1200  C  CA    . ALA A  1  155 ? 40.520  85.477  48.224  1.00 53.65  ? 155  ALA A CA    1 
ATOM   1201  C  C     . ALA A  1  155 ? 39.915  86.880  48.111  1.00 54.73  ? 155  ALA A C     1 
ATOM   1202  O  O     . ALA A  1  155 ? 38.989  87.106  47.314  1.00 54.91  ? 155  ALA A O     1 
ATOM   1203  C  CB    . ALA A  1  155 ? 39.834  84.686  49.306  1.00 51.24  ? 155  ALA A CB    1 
ATOM   1204  N  N     . THR A  1  156 ? 40.429  87.829  48.888  1.00 53.95  ? 156  THR A N     1 
ATOM   1205  C  CA    . THR A  1  156 ? 39.873  89.167  48.818  1.00 55.68  ? 156  THR A CA    1 
ATOM   1206  C  C     . THR A  1  156 ? 40.783  90.134  48.064  1.00 56.06  ? 156  THR A C     1 
ATOM   1207  O  O     . THR A  1  156 ? 40.294  90.983  47.312  1.00 55.70  ? 156  THR A O     1 
ATOM   1208  C  CB    . THR A  1  156 ? 39.546  89.730  50.243  1.00 58.01  ? 156  THR A CB    1 
ATOM   1209  O  OG1   . THR A  1  156 ? 38.593  90.813  50.143  1.00 58.31  ? 156  THR A OG1   1 
ATOM   1210  C  CG2   . THR A  1  156 ? 40.818  90.221  50.934  1.00 56.71  ? 156  THR A CG2   1 
ATOM   1211  N  N     . ALA A  1  157 ? 42.099  90.011  48.245  1.00 56.09  ? 157  ALA A N     1 
ATOM   1212  C  CA    . ALA A  1  157 ? 43.032  90.906  47.549  1.00 54.54  ? 157  ALA A CA    1 
ATOM   1213  C  C     . ALA A  1  157 ? 42.889  90.735  46.041  1.00 53.88  ? 157  ALA A C     1 
ATOM   1214  O  O     . ALA A  1  157 ? 42.987  91.703  45.298  1.00 53.35  ? 157  ALA A O     1 
ATOM   1215  C  CB    . ALA A  1  157 ? 44.457  90.625  47.970  1.00 53.64  ? 157  ALA A CB    1 
ATOM   1216  N  N     . PHE A  1  158 ? 42.651  89.499  45.599  1.00 54.15  ? 158  PHE A N     1 
ATOM   1217  C  CA    . PHE A  1  158 ? 42.488  89.194  44.176  1.00 54.13  ? 158  PHE A CA    1 
ATOM   1218  C  C     . PHE A  1  158 ? 41.076  88.731  43.887  1.00 55.49  ? 158  PHE A C     1 
ATOM   1219  O  O     . PHE A  1  158 ? 40.840  88.021  42.915  1.00 57.09  ? 158  PHE A O     1 
ATOM   1220  C  CB    . PHE A  1  158 ? 43.476  88.102  43.720  1.00 51.67  ? 158  PHE A CB    1 
ATOM   1221  C  CG    . PHE A  1  158 ? 44.913  88.522  43.799  1.00 48.80  ? 158  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A  1  158 ? 45.757  87.979  44.757  1.00 46.01  ? 158  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A  1  158 ? 45.398  89.539  42.978  1.00 48.15  ? 158  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A  1  158 ? 47.061  88.448  44.908  1.00 45.06  ? 158  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A  1  158 ? 46.707  90.013  43.126  1.00 46.47  ? 158  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A  1  158 ? 47.536  89.466  44.095  1.00 43.37  ? 158  PHE A CZ    1 
ATOM   1227  N  N     . GLN A  1  159 ? 40.139  89.128  44.737  1.00 56.20  ? 159  GLN A N     1 
ATOM   1228  C  CA    . GLN A  1  159 ? 38.747  88.747  44.562  1.00 55.69  ? 159  GLN A CA    1 
ATOM   1229  C  C     . GLN A  1  159 ? 38.320  88.962  43.115  1.00 55.61  ? 159  GLN A C     1 
ATOM   1230  O  O     . GLN A  1  159 ? 38.731  89.947  42.475  1.00 55.06  ? 159  GLN A O     1 
ATOM   1231  C  CB    . GLN A  1  159 ? 37.860  89.591  45.480  1.00 55.82  ? 159  GLN A CB    1 
ATOM   1232  C  CG    . GLN A  1  159 ? 38.153  91.089  45.392  1.00 56.49  ? 159  GLN A CG    1 
ATOM   1233  C  CD    . GLN A  1  159 ? 37.015  91.939  45.917  1.00 55.35  ? 159  GLN A CD    1 
ATOM   1234  O  OE1   . GLN A  1  159 ? 35.963  92.037  45.294  1.00 57.47  ? 159  GLN A OE1   1 
ATOM   1235  N  NE2   . GLN A  1  159 ? 37.217  92.550  47.068  1.00 54.68  ? 159  GLN A NE2   1 
ATOM   1236  N  N     . GLY A  1  160 ? 37.508  88.033  42.610  1.00 54.94  ? 160  GLY A N     1 
ATOM   1237  C  CA    . GLY A  1  160 ? 36.997  88.135  41.255  1.00 54.95  ? 160  GLY A CA    1 
ATOM   1238  C  C     . GLY A  1  160 ? 37.909  87.621  40.160  1.00 55.37  ? 160  GLY A C     1 
ATOM   1239  O  O     . GLY A  1  160 ? 37.528  87.562  38.992  1.00 54.21  ? 160  GLY A O     1 
ATOM   1240  N  N     . THR A  1  161 ? 39.126  87.253  40.536  1.00 56.35  ? 161  THR A N     1 
ATOM   1241  C  CA    . THR A  1  161 ? 40.088  86.754  39.571  1.00 55.93  ? 161  THR A CA    1 
ATOM   1242  C  C     . THR A  1  161 ? 40.460  85.319  39.902  1.00 57.95  ? 161  THR A C     1 
ATOM   1243  O  O     . THR A  1  161 ? 39.958  84.752  40.871  1.00 58.21  ? 161  THR A O     1 
ATOM   1244  C  CB    . THR A  1  161 ? 41.350  87.568  39.587  1.00 53.53  ? 161  THR A CB    1 
ATOM   1245  O  OG1   . THR A  1  161 ? 42.148  87.137  40.686  1.00 52.43  ? 161  THR A OG1   1 
ATOM   1246  C  CG2   . THR A  1  161 ? 41.030  89.042  39.743  1.00 52.01  ? 161  THR A CG2   1 
ATOM   1247  N  N     . ALA A  1  162 ? 41.353  84.742  39.099  1.00 60.51  ? 162  ALA A N     1 
ATOM   1248  C  CA    . ALA A  1  162 ? 41.778  83.354  39.272  1.00 61.65  ? 162  ALA A CA    1 
ATOM   1249  C  C     . ALA A  1  162 ? 42.743  83.195  40.432  1.00 62.00  ? 162  ALA A C     1 
ATOM   1250  O  O     . ALA A  1  162 ? 42.796  82.130  41.059  1.00 62.77  ? 162  ALA A O     1 
ATOM   1251  C  CB    . ALA A  1  162 ? 42.415  82.840  37.990  1.00 62.75  ? 162  ALA A CB    1 
ATOM   1252  N  N     . LEU A  1  163 ? 43.511  84.246  40.705  1.00 60.39  ? 163  LEU A N     1 
ATOM   1253  C  CA    . LEU A  1  163 ? 44.456  84.224  41.805  1.00 60.86  ? 163  LEU A CA    1 
ATOM   1254  C  C     . LEU A  1  163 ? 43.780  84.203  43.166  1.00 62.29  ? 163  LEU A C     1 
ATOM   1255  O  O     . LEU A  1  163 ? 44.439  84.037  44.187  1.00 64.42  ? 163  LEU A O     1 
ATOM   1256  C  CB    . LEU A  1  163 ? 45.372  85.432  41.739  1.00 60.29  ? 163  LEU A CB    1 
ATOM   1257  C  CG    . LEU A  1  163 ? 46.609  85.145  40.903  1.00 61.66  ? 163  LEU A CG    1 
ATOM   1258  C  CD1   . LEU A  1  163 ? 47.497  86.383  40.802  1.00 60.53  ? 163  LEU A CD1   1 
ATOM   1259  C  CD2   . LEU A  1  163 ? 47.358  83.987  41.552  1.00 62.71  ? 163  LEU A CD2   1 
ATOM   1260  N  N     . ALA A  1  164 ? 42.465  84.374  43.189  1.00 61.77  ? 164  ALA A N     1 
ATOM   1261  C  CA    . ALA A  1  164 ? 41.743  84.380  44.443  1.00 59.88  ? 164  ALA A CA    1 
ATOM   1262  C  C     . ALA A  1  164 ? 41.241  83.000  44.767  1.00 59.45  ? 164  ALA A C     1 
ATOM   1263  O  O     . ALA A  1  164 ? 40.376  82.845  45.608  1.00 60.79  ? 164  ALA A O     1 
ATOM   1264  C  CB    . ALA A  1  164 ? 40.586  85.341  44.365  1.00 61.03  ? 164  ALA A CB    1 
ATOM   1265  N  N     . ARG A  1  165 ? 41.761  81.986  44.094  1.00 60.38  ? 165  ARG A N     1 
ATOM   1266  C  CA    . ARG A  1  165 ? 41.306  80.626  44.372  1.00 60.91  ? 165  ARG A CA    1 
ATOM   1267  C  C     . ARG A  1  165 ? 42.381  79.919  45.152  1.00 60.80  ? 165  ARG A C     1 
ATOM   1268  O  O     . ARG A  1  165 ? 43.542  80.319  45.105  1.00 60.58  ? 165  ARG A O     1 
ATOM   1269  C  CB    . ARG A  1  165 ? 41.022  79.829  43.081  1.00 59.76  ? 165  ARG A CB    1 
ATOM   1270  C  CG    . ARG A  1  165 ? 39.871  80.343  42.241  1.00 57.48  ? 165  ARG A CG    1 
ATOM   1271  C  CD    . ARG A  1  165 ? 39.165  79.212  41.517  1.00 58.87  ? 165  ARG A CD    1 
ATOM   1272  N  NE    . ARG A  1  165 ? 38.143  79.688  40.581  1.00 59.87  ? 165  ARG A NE    1 
ATOM   1273  C  CZ    . ARG A  1  165 ? 38.410  80.369  39.467  1.00 60.44  ? 165  ARG A CZ    1 
ATOM   1274  N  NH1   . ARG A  1  165 ? 39.672  80.658  39.141  1.00 61.57  ? 165  ARG A NH1   1 
ATOM   1275  N  NH2   . ARG A  1  165 ? 37.421  80.773  38.683  1.00 60.14  ? 165  ARG A NH2   1 
ATOM   1276  N  N     . THR A  1  166 ? 41.982  78.878  45.874  1.00 60.74  ? 166  THR A N     1 
ATOM   1277  C  CA    . THR A  1  166 ? 42.924  78.086  46.644  1.00 61.94  ? 166  THR A CA    1 
ATOM   1278  C  C     . THR A  1  166 ? 43.536  77.079  45.671  1.00 61.69  ? 166  THR A C     1 
ATOM   1279  O  O     . THR A  1  166 ? 42.973  76.827  44.596  1.00 61.77  ? 166  THR A O     1 
ATOM   1280  C  CB    . THR A  1  166 ? 42.221  77.307  47.793  1.00 63.06  ? 166  THR A CB    1 
ATOM   1281  O  OG1   . THR A  1  166 ? 41.168  76.501  47.252  1.00 64.66  ? 166  THR A OG1   1 
ATOM   1282  C  CG2   . THR A  1  166 ? 41.632  78.258  48.817  1.00 63.24  ? 166  THR A CG2   1 
ATOM   1283  N  N     . VAL A  1  167 ? 44.688  76.518  46.035  1.00 60.63  ? 167  VAL A N     1 
ATOM   1284  C  CA    . VAL A  1  167 ? 45.336  75.532  45.184  1.00 58.30  ? 167  VAL A CA    1 
ATOM   1285  C  C     . VAL A  1  167 ? 44.553  74.240  45.277  1.00 58.62  ? 167  VAL A C     1 
ATOM   1286  O  O     . VAL A  1  167 ? 44.269  73.604  44.268  1.00 58.27  ? 167  VAL A O     1 
ATOM   1287  C  CB    . VAL A  1  167 ? 46.766  75.249  45.633  1.00 56.49  ? 167  VAL A CB    1 
ATOM   1288  C  CG1   . VAL A  1  167 ? 47.308  74.088  44.863  1.00 56.40  ? 167  VAL A CG1   1 
ATOM   1289  C  CG2   . VAL A  1  167 ? 47.632  76.453  45.404  1.00 55.88  ? 167  VAL A CG2   1 
ATOM   1290  N  N     . GLU A  1  168 ? 44.196  73.865  46.499  1.00 59.01  ? 168  GLU A N     1 
ATOM   1291  C  CA    . GLU A  1  168 ? 43.449  72.639  46.734  1.00 60.82  ? 168  GLU A CA    1 
ATOM   1292  C  C     . GLU A  1  168 ? 42.063  72.595  46.060  1.00 61.01  ? 168  GLU A C     1 
ATOM   1293  O  O     . GLU A  1  168 ? 41.508  71.509  45.873  1.00 62.01  ? 168  GLU A O     1 
ATOM   1294  C  CB    . GLU A  1  168 ? 43.275  72.406  48.239  1.00 63.12  ? 168  GLU A CB    1 
ATOM   1295  C  CG    . GLU A  1  168 ? 44.558  72.296  49.064  1.00 64.05  ? 168  GLU A CG    1 
ATOM   1296  C  CD    . GLU A  1  168 ? 45.365  73.581  49.108  1.00 65.63  ? 168  GLU A CD    1 
ATOM   1297  O  OE1   . GLU A  1  168 ? 44.783  74.669  49.310  1.00 68.29  ? 168  GLU A OE1   1 
ATOM   1298  O  OE2   . GLU A  1  168 ? 46.599  73.501  48.957  1.00 67.45  ? 168  GLU A OE2   1 
ATOM   1299  N  N     . GLY A  1  169 ? 41.495  73.752  45.717  1.00 59.35  ? 169  GLY A N     1 
ATOM   1300  C  CA    . GLY A  1  169 ? 40.186  73.769  45.074  1.00 59.19  ? 169  GLY A CA    1 
ATOM   1301  C  C     . GLY A  1  169 ? 38.970  73.644  45.990  1.00 60.22  ? 169  GLY A C     1 
ATOM   1302  O  O     . GLY A  1  169 ? 39.099  73.504  47.201  1.00 59.47  ? 169  GLY A O     1 
ATOM   1303  N  N     . THR A  1  170 ? 37.778  73.675  45.402  1.00 61.59  ? 170  THR A N     1 
ATOM   1304  C  CA    . THR A  1  170 ? 36.514  73.579  46.142  1.00 63.32  ? 170  THR A CA    1 
ATOM   1305  C  C     . THR A  1  170 ? 36.117  72.178  46.587  1.00 63.25  ? 170  THR A C     1 
ATOM   1306  O  O     . THR A  1  170 ? 36.517  71.194  45.984  1.00 64.05  ? 170  THR A O     1 
ATOM   1307  C  CB    . THR A  1  170 ? 35.357  74.060  45.289  1.00 64.99  ? 170  THR A CB    1 
ATOM   1308  O  OG1   . THR A  1  170 ? 35.729  75.277  44.636  1.00 66.32  ? 170  THR A OG1   1 
ATOM   1309  C  CG2   . THR A  1  170 ? 34.113  74.271  46.150  1.00 66.84  ? 170  THR A CG2   1 
ATOM   1310  N  N     . THR A  1  171 ? 35.291  72.094  47.624  1.00 63.36  ? 171  THR A N     1 
ATOM   1311  C  CA    . THR A  1  171 ? 34.830  70.802  48.108  1.00 63.81  ? 171  THR A CA    1 
ATOM   1312  C  C     . THR A  1  171 ? 33.987  70.134  47.025  1.00 65.24  ? 171  THR A C     1 
ATOM   1313  O  O     . THR A  1  171 ? 33.923  68.912  46.946  1.00 64.98  ? 171  THR A O     1 
ATOM   1314  C  CB    . THR A  1  171 ? 33.971  70.949  49.381  1.00 63.76  ? 171  THR A CB    1 
ATOM   1315  O  OG1   . THR A  1  171 ? 34.815  71.199  50.507  1.00 63.84  ? 171  THR A OG1   1 
ATOM   1316  C  CG2   . THR A  1  171 ? 33.166  69.687  49.638  1.00 63.19  ? 171  THR A CG2   1 
ATOM   1317  N  N     . GLU A  1  172 ? 33.338  70.939  46.188  1.00 67.36  ? 172  GLU A N     1 
ATOM   1318  C  CA    . GLU A  1  172 ? 32.507  70.394  45.113  1.00 69.14  ? 172  GLU A CA    1 
ATOM   1319  C  C     . GLU A  1  172 ? 33.339  69.839  43.984  1.00 69.69  ? 172  GLU A C     1 
ATOM   1320  O  O     . GLU A  1  172 ? 33.084  68.746  43.499  1.00 70.78  ? 172  GLU A O     1 
ATOM   1321  C  CB    . GLU A  1  172 ? 31.561  71.450  44.543  1.00 69.97  ? 172  GLU A CB    1 
ATOM   1322  C  CG    . GLU A  1  172 ? 30.381  71.707  45.429  1.00 73.43  ? 172  GLU A CG    1 
ATOM   1323  C  CD    . GLU A  1  172 ? 29.539  70.463  45.654  1.00 75.34  ? 172  GLU A CD    1 
ATOM   1324  O  OE1   . GLU A  1  172 ? 28.799  70.085  44.718  1.00 76.31  ? 172  GLU A OE1   1 
ATOM   1325  O  OE2   . GLU A  1  172 ? 29.621  69.865  46.759  1.00 76.23  ? 172  GLU A OE2   1 
ATOM   1326  N  N     . ASN A  1  173 ? 34.328  70.600  43.549  1.00 69.59  ? 173  ASN A N     1 
ATOM   1327  C  CA    . ASN A  1  173 ? 35.167  70.136  42.473  1.00 70.14  ? 173  ASN A CA    1 
ATOM   1328  C  C     . ASN A  1  173 ? 35.869  68.828  42.837  1.00 71.55  ? 173  ASN A C     1 
ATOM   1329  O  O     . ASN A  1  173 ? 35.985  67.913  42.015  1.00 72.24  ? 173  ASN A O     1 
ATOM   1330  C  CB    . ASN A  1  173 ? 36.169  71.224  42.132  1.00 69.74  ? 173  ASN A CB    1 
ATOM   1331  C  CG    . ASN A  1  173 ? 35.507  72.412  41.510  1.00 68.63  ? 173  ASN A CG    1 
ATOM   1332  O  OD1   . ASN A  1  173 ? 34.448  72.820  41.955  1.00 70.32  ? 173  ASN A OD1   1 
ATOM   1333  N  ND2   . ASN A  1  173 ? 36.119  72.979  40.477  1.00 68.88  ? 173  ASN A ND2   1 
ATOM   1334  N  N     . ILE A  1  174 ? 36.332  68.726  44.072  1.00 72.42  ? 174  ILE A N     1 
ATOM   1335  C  CA    . ILE A  1  174 ? 37.001  67.513  44.479  1.00 73.99  ? 174  ILE A CA    1 
ATOM   1336  C  C     . ILE A  1  174 ? 35.998  66.385  44.409  1.00 75.45  ? 174  ILE A C     1 
ATOM   1337  O  O     . ILE A  1  174 ? 36.300  65.316  43.893  1.00 76.96  ? 174  ILE A O     1 
ATOM   1338  C  CB    . ILE A  1  174 ? 37.578  67.648  45.897  1.00 73.92  ? 174  ILE A CB    1 
ATOM   1339  C  CG1   . ILE A  1  174 ? 38.796  68.571  45.844  1.00 72.84  ? 174  ILE A CG1   1 
ATOM   1340  C  CG2   . ILE A  1  174 ? 37.961  66.277  46.460  1.00 73.34  ? 174  ILE A CG2   1 
ATOM   1341  C  CD1   . ILE A  1  174 ? 39.359  68.887  47.186  1.00 74.58  ? 174  ILE A CD1   1 
ATOM   1342  N  N     . LYS A  1  175 ? 34.790  66.633  44.900  1.00 76.94  ? 175  LYS A N     1 
ATOM   1343  C  CA    . LYS A  1  175 ? 33.746  65.612  44.888  1.00 78.36  ? 175  LYS A CA    1 
ATOM   1344  C  C     . LYS A  1  175 ? 33.277  65.219  43.495  1.00 78.48  ? 175  LYS A C     1 
ATOM   1345  O  O     . LYS A  1  175 ? 32.709  64.142  43.327  1.00 78.76  ? 175  LYS A O     1 
ATOM   1346  C  CB    . LYS A  1  175 ? 32.511  66.075  45.680  1.00 78.63  ? 175  LYS A CB    1 
ATOM   1347  C  CG    . LYS A  1  175 ? 32.653  66.042  47.191  1.00 80.53  ? 175  LYS A CG    1 
ATOM   1348  C  CD    . LYS A  1  175 ? 31.358  66.468  47.894  1.00 80.55  ? 175  LYS A CD    1 
ATOM   1349  C  CE    . LYS A  1  175 ? 30.191  65.546  47.556  1.00 80.94  ? 175  LYS A CE    1 
ATOM   1350  N  NZ    . LYS A  1  175 ? 28.985  65.802  48.390  1.00 80.67  ? 175  LYS A NZ    1 
ATOM   1351  N  N     . HIS A  1  176 ? 33.519  66.063  42.496  1.00 78.91  ? 176  HIS A N     1 
ATOM   1352  C  CA    . HIS A  1  176 ? 33.014  65.763  41.160  1.00 79.83  ? 176  HIS A CA    1 
ATOM   1353  C  C     . HIS A  1  176 ? 33.973  65.709  39.988  1.00 79.41  ? 176  HIS A C     1 
ATOM   1354  O  O     . HIS A  1  176 ? 33.575  65.262  38.904  1.00 79.51  ? 176  HIS A O     1 
ATOM   1355  C  CB    . HIS A  1  176 ? 31.879  66.739  40.811  1.00 81.78  ? 176  HIS A CB    1 
ATOM   1356  C  CG    . HIS A  1  176 ? 30.760  66.741  41.806  1.00 83.94  ? 176  HIS A CG    1 
ATOM   1357  N  ND1   . HIS A  1  176 ? 30.138  65.584  42.230  1.00 85.40  ? 176  HIS A ND1   1 
ATOM   1358  C  CD2   . HIS A  1  176 ? 30.170  67.754  42.482  1.00 84.40  ? 176  HIS A CD2   1 
ATOM   1359  C  CE1   . HIS A  1  176 ? 29.216  65.883  43.127  1.00 85.82  ? 176  HIS A CE1   1 
ATOM   1360  N  NE2   . HIS A  1  176 ? 29.215  67.194  43.298  1.00 87.09  ? 176  HIS A NE2   1 
ATOM   1361  N  N     . LEU A  1  177 ? 35.213  66.156  40.170  1.00 78.21  ? 177  LEU A N     1 
ATOM   1362  C  CA    . LEU A  1  177 ? 36.148  66.132  39.054  1.00 77.21  ? 177  LEU A CA    1 
ATOM   1363  C  C     . LEU A  1  177 ? 36.137  64.749  38.422  1.00 77.78  ? 177  LEU A C     1 
ATOM   1364  O  O     . LEU A  1  177 ? 35.958  63.745  39.114  1.00 76.81  ? 177  LEU A O     1 
ATOM   1365  C  CB    . LEU A  1  177 ? 37.554  66.510  39.511  1.00 76.16  ? 177  LEU A CB    1 
ATOM   1366  C  CG    . LEU A  1  177 ? 37.843  68.011  39.559  1.00 75.04  ? 177  LEU A CG    1 
ATOM   1367  C  CD1   . LEU A  1  177 ? 39.223  68.277  40.145  1.00 76.57  ? 177  LEU A CD1   1 
ATOM   1368  C  CD2   . LEU A  1  177 ? 37.769  68.569  38.159  1.00 74.56  ? 177  LEU A CD2   1 
ATOM   1369  N  N     . THR A  1  178 ? 36.301  64.710  37.103  1.00 78.23  ? 178  THR A N     1 
ATOM   1370  C  CA    . THR A  1  178 ? 36.291  63.458  36.354  1.00 79.03  ? 178  THR A CA    1 
ATOM   1371  C  C     . THR A  1  178 ? 37.663  63.072  35.818  1.00 78.38  ? 178  THR A C     1 
ATOM   1372  O  O     . THR A  1  178 ? 38.513  63.925  35.562  1.00 77.98  ? 178  THR A O     1 
ATOM   1373  C  CB    . THR A  1  178 ? 35.291  63.541  35.161  1.00 80.57  ? 178  THR A CB    1 
ATOM   1374  O  OG1   . THR A  1  178 ? 33.949  63.539  35.665  1.00 83.20  ? 178  THR A OG1   1 
ATOM   1375  C  CG2   . THR A  1  178 ? 35.481  62.375  34.181  1.00 82.47  ? 178  THR A CG2   1 
ATOM   1376  N  N     . ARG A  1  179 ? 37.871  61.769  35.659  1.00 78.47  ? 179  ARG A N     1 
ATOM   1377  C  CA    . ARG A  1  179 ? 39.125  61.260  35.133  1.00 77.79  ? 179  ARG A CA    1 
ATOM   1378  C  C     . ARG A  1  179 ? 39.471  62.111  33.926  1.00 76.65  ? 179  ARG A C     1 
ATOM   1379  O  O     . ARG A  1  179 ? 40.606  62.539  33.749  1.00 75.82  ? 179  ARG A O     1 
ATOM   1380  C  CB    . ARG A  1  179 ? 38.964  59.799  34.710  1.00 79.64  ? 179  ARG A CB    1 
ATOM   1381  C  CG    . ARG A  1  179 ? 40.217  59.228  34.096  1.00 82.07  ? 179  ARG A CG    1 
ATOM   1382  C  CD    . ARG A  1  179 ? 40.101  57.760  33.711  1.00 84.18  ? 179  ARG A CD    1 
ATOM   1383  N  NE    . ARG A  1  179 ? 41.383  57.279  33.192  1.00 86.40  ? 179  ARG A NE    1 
ATOM   1384  C  CZ    . ARG A  1  179 ? 41.990  57.783  32.119  1.00 87.72  ? 179  ARG A CZ    1 
ATOM   1385  N  NH1   . ARG A  1  179 ? 41.429  58.782  31.441  1.00 88.61  ? 179  ARG A NH1   1 
ATOM   1386  N  NH2   . ARG A  1  179 ? 43.169  57.311  31.736  1.00 87.08  ? 179  ARG A NH2   1 
ATOM   1387  N  N     . ALA A  1  180 ? 38.458  62.365  33.110  1.00 76.04  ? 180  ALA A N     1 
ATOM   1388  C  CA    . ALA A  1  180 ? 38.608  63.171  31.913  1.00 75.86  ? 180  ALA A CA    1 
ATOM   1389  C  C     . ALA A  1  180 ? 39.184  64.557  32.222  1.00 76.35  ? 180  ALA A C     1 
ATOM   1390  O  O     . ALA A  1  180 ? 40.074  65.040  31.516  1.00 76.70  ? 180  ALA A O     1 
ATOM   1391  C  CB    . ALA A  1  180 ? 37.259  63.306  31.228  1.00 75.54  ? 180  ALA A CB    1 
ATOM   1392  N  N     . ASP A  1  181 ? 38.677  65.193  33.279  1.00 76.28  ? 181  ASP A N     1 
ATOM   1393  C  CA    . ASP A  1  181 ? 39.125  66.529  33.672  1.00 75.13  ? 181  ASP A CA    1 
ATOM   1394  C  C     . ASP A  1  181 ? 40.599  66.483  34.010  1.00 74.06  ? 181  ASP A C     1 
ATOM   1395  O  O     . ASP A  1  181 ? 41.385  67.283  33.510  1.00 73.44  ? 181  ASP A O     1 
ATOM   1396  C  CB    . ASP A  1  181 ? 38.349  67.027  34.895  1.00 76.84  ? 181  ASP A CB    1 
ATOM   1397  C  CG    . ASP A  1  181 ? 36.865  66.733  34.803  1.00 79.31  ? 181  ASP A CG    1 
ATOM   1398  O  OD1   . ASP A  1  181 ? 36.524  65.623  34.346  1.00 80.65  ? 181  ASP A OD1   1 
ATOM   1399  O  OD2   . ASP A  1  181 ? 36.038  67.585  35.200  1.00 79.71  ? 181  ASP A OD2   1 
ATOM   1400  N  N     . LEU A  1  182 ? 40.972  65.538  34.864  1.00 73.24  ? 182  LEU A N     1 
ATOM   1401  C  CA    . LEU A  1  182 ? 42.364  65.413  35.256  1.00 73.09  ? 182  LEU A CA    1 
ATOM   1402  C  C     . LEU A  1  182 ? 43.176  65.154  34.002  1.00 72.82  ? 182  LEU A C     1 
ATOM   1403  O  O     . LEU A  1  182 ? 44.290  65.658  33.843  1.00 73.01  ? 182  LEU A O     1 
ATOM   1404  C  CB    . LEU A  1  182 ? 42.535  64.253  36.225  1.00 72.13  ? 182  LEU A CB    1 
ATOM   1405  C  CG    . LEU A  1  182 ? 41.466  64.107  37.305  1.00 72.29  ? 182  LEU A CG    1 
ATOM   1406  C  CD1   . LEU A  1  182 ? 42.019  63.171  38.369  1.00 72.20  ? 182  LEU A CD1   1 
ATOM   1407  C  CD2   . LEU A  1  182 ? 41.109  65.457  37.930  1.00 71.48  ? 182  LEU A CD2   1 
ATOM   1408  N  N     . ALA A  1  183 ? 42.587  64.369  33.109  1.00 72.30  ? 183  ALA A N     1 
ATOM   1409  C  CA    . ALA A  1  183 ? 43.212  64.012  31.852  1.00 71.71  ? 183  ALA A CA    1 
ATOM   1410  C  C     . ALA A  1  183 ? 43.598  65.247  31.061  1.00 72.62  ? 183  ALA A C     1 
ATOM   1411  O  O     . ALA A  1  183 ? 44.777  65.494  30.830  1.00 72.68  ? 183  ALA A O     1 
ATOM   1412  C  CB    . ALA A  1  183 ? 42.272  63.161  31.047  1.00 71.97  ? 183  ALA A CB    1 
ATOM   1413  N  N     . SER A  1  184 ? 42.604  66.031  30.654  1.00 74.27  ? 184  SER A N     1 
ATOM   1414  C  CA    . SER A  1  184 ? 42.868  67.240  29.871  1.00 75.94  ? 184  SER A CA    1 
ATOM   1415  C  C     . SER A  1  184 ? 43.770  68.232  30.605  1.00 75.47  ? 184  SER A C     1 
ATOM   1416  O  O     . SER A  1  184 ? 44.618  68.885  29.983  1.00 75.32  ? 184  SER A O     1 
ATOM   1417  C  CB    . SER A  1  184 ? 41.555  67.931  29.473  1.00 76.56  ? 184  SER A CB    1 
ATOM   1418  O  OG    . SER A  1  184 ? 40.824  68.320  30.615  1.00 78.68  ? 184  SER A OG    1 
ATOM   1419  N  N     . TYR A  1  185 ? 43.586  68.353  31.919  1.00 74.71  ? 185  TYR A N     1 
ATOM   1420  C  CA    . TYR A  1  185 ? 44.415  69.263  32.694  1.00 73.42  ? 185  TYR A CA    1 
ATOM   1421  C  C     . TYR A  1  185 ? 45.848  68.956  32.304  1.00 74.01  ? 185  TYR A C     1 
ATOM   1422  O  O     . TYR A  1  185 ? 46.592  69.843  31.873  1.00 73.94  ? 185  TYR A O     1 
ATOM   1423  C  CB    . TYR A  1  185 ? 44.248  69.048  34.206  1.00 71.06  ? 185  TYR A CB    1 
ATOM   1424  C  CG    . TYR A  1  185 ? 45.190  69.920  35.023  1.00 68.81  ? 185  TYR A CG    1 
ATOM   1425  C  CD1   . TYR A  1  185 ? 44.978  71.290  35.142  1.00 66.66  ? 185  TYR A CD1   1 
ATOM   1426  C  CD2   . TYR A  1  185 ? 46.355  69.393  35.576  1.00 68.28  ? 185  TYR A CD2   1 
ATOM   1427  C  CE1   . TYR A  1  185 ? 45.905  72.114  35.775  1.00 66.36  ? 185  TYR A CE1   1 
ATOM   1428  C  CE2   . TYR A  1  185 ? 47.285  70.209  36.208  1.00 67.63  ? 185  TYR A CE2   1 
ATOM   1429  C  CZ    . TYR A  1  185 ? 47.060  71.569  36.300  1.00 67.23  ? 185  TYR A CZ    1 
ATOM   1430  O  OH    . TYR A  1  185 ? 48.015  72.377  36.881  1.00 67.04  ? 185  TYR A OH    1 
ATOM   1431  N  N     . ILE A  1  186 ? 46.212  67.683  32.437  1.00 74.38  ? 186  ILE A N     1 
ATOM   1432  C  CA    . ILE A  1  186 ? 47.554  67.224  32.116  1.00 75.21  ? 186  ILE A CA    1 
ATOM   1433  C  C     . ILE A  1  186 ? 47.951  67.555  30.680  1.00 77.12  ? 186  ILE A C     1 
ATOM   1434  O  O     . ILE A  1  186 ? 49.041  68.088  30.434  1.00 76.79  ? 186  ILE A O     1 
ATOM   1435  C  CB    . ILE A  1  186 ? 47.678  65.713  32.331  1.00 72.66  ? 186  ILE A CB    1 
ATOM   1436  C  CG1   . ILE A  1  186 ? 47.195  65.365  33.734  1.00 72.91  ? 186  ILE A CG1   1 
ATOM   1437  C  CG2   . ILE A  1  186 ? 49.114  65.289  32.185  1.00 71.55  ? 186  ILE A CG2   1 
ATOM   1438  C  CD1   . ILE A  1  186 ? 47.339  63.899  34.098  1.00 73.36  ? 186  ILE A CD1   1 
ATOM   1439  N  N     . ASP A  1  187 ? 47.060  67.257  29.740  1.00 78.79  ? 187  ASP A N     1 
ATOM   1440  C  CA    . ASP A  1  187 ? 47.330  67.503  28.328  1.00 81.51  ? 187  ASP A CA    1 
ATOM   1441  C  C     . ASP A  1  187 ? 47.506  68.965  27.987  1.00 81.71  ? 187  ASP A C     1 
ATOM   1442  O  O     . ASP A  1  187 ? 48.376  69.325  27.192  1.00 82.76  ? 187  ASP A O     1 
ATOM   1443  C  CB    . ASP A  1  187 ? 46.202  66.962  27.459  1.00 84.79  ? 187  ASP A CB    1 
ATOM   1444  C  CG    . ASP A  1  187 ? 45.925  65.505  27.712  1.00 88.94  ? 187  ASP A CG    1 
ATOM   1445  O  OD1   . ASP A  1  187 ? 46.877  64.695  27.586  1.00 90.48  ? 187  ASP A OD1   1 
ATOM   1446  O  OD2   . ASP A  1  187 ? 44.754  65.176  28.034  1.00 90.98  ? 187  ASP A OD2   1 
ATOM   1447  N  N     . THR A  1  188 ? 46.671  69.804  28.583  1.00 80.61  ? 188  THR A N     1 
ATOM   1448  C  CA    . THR A  1  188 ? 46.701  71.229  28.307  1.00 79.35  ? 188  THR A CA    1 
ATOM   1449  C  C     . THR A  1  188 ? 47.865  71.987  28.931  1.00 78.86  ? 188  THR A C     1 
ATOM   1450  O  O     . THR A  1  188 ? 48.412  72.908  28.325  1.00 77.51  ? 188  THR A O     1 
ATOM   1451  C  CB    . THR A  1  188 ? 45.406  71.888  28.791  1.00 79.06  ? 188  THR A CB    1 
ATOM   1452  O  OG1   . THR A  1  188 ? 44.294  71.023  28.522  1.00 77.82  ? 188  THR A OG1   1 
ATOM   1453  C  CG2   . THR A  1  188 ? 45.202  73.207  28.084  1.00 77.89  ? 188  THR A CG2   1 
ATOM   1454  N  N     . HIS A  1  189 ? 48.252  71.591  30.137  1.00 79.21  ? 189  HIS A N     1 
ATOM   1455  C  CA    . HIS A  1  189 ? 49.305  72.295  30.848  1.00 80.28  ? 189  HIS A CA    1 
ATOM   1456  C  C     . HIS A  1  189 ? 50.681  71.674  30.869  1.00 81.48  ? 189  HIS A C     1 
ATOM   1457  O  O     . HIS A  1  189 ? 51.657  72.365  30.596  1.00 82.26  ? 189  HIS A O     1 
ATOM   1458  C  CB    . HIS A  1  189 ? 48.842  72.563  32.274  1.00 80.01  ? 189  HIS A CB    1 
ATOM   1459  C  CG    . HIS A  1  189 ? 47.539  73.288  32.343  1.00 79.45  ? 189  HIS A CG    1 
ATOM   1460  N  ND1   . HIS A  1  189 ? 47.402  74.609  31.973  1.00 78.63  ? 189  HIS A ND1   1 
ATOM   1461  C  CD2   . HIS A  1  189 ? 46.300  72.861  32.679  1.00 79.01  ? 189  HIS A CD2   1 
ATOM   1462  C  CE1   . HIS A  1  189 ? 46.134  74.964  32.079  1.00 79.05  ? 189  HIS A CE1   1 
ATOM   1463  N  NE2   . HIS A  1  189 ? 45.445  73.922  32.505  1.00 79.64  ? 189  HIS A NE2   1 
ATOM   1464  N  N     . PHE A  1  190 ? 50.777  70.389  31.210  1.00 83.04  ? 190  PHE A N     1 
ATOM   1465  C  CA    . PHE A  1  190 ? 52.082  69.718  31.254  1.00 83.61  ? 190  PHE A CA    1 
ATOM   1466  C  C     . PHE A  1  190 ? 52.647  69.607  29.837  1.00 84.47  ? 190  PHE A C     1 
ATOM   1467  O  O     . PHE A  1  190 ? 52.669  68.526  29.250  1.00 84.67  ? 190  PHE A O     1 
ATOM   1468  C  CB    . PHE A  1  190 ? 51.957  68.319  31.875  1.00 81.65  ? 190  PHE A CB    1 
ATOM   1469  C  CG    . PHE A  1  190 ? 51.567  68.321  33.334  1.00 80.31  ? 190  PHE A CG    1 
ATOM   1470  C  CD1   . PHE A  1  190 ? 51.488  67.129  34.038  1.00 79.51  ? 190  PHE A CD1   1 
ATOM   1471  C  CD2   . PHE A  1  190 ? 51.276  69.502  34.003  1.00 80.19  ? 190  PHE A CD2   1 
ATOM   1472  C  CE1   . PHE A  1  190 ? 51.129  67.109  35.383  1.00 78.48  ? 190  PHE A CE1   1 
ATOM   1473  C  CE2   . PHE A  1  190 ? 50.915  69.487  35.348  1.00 78.85  ? 190  PHE A CE2   1 
ATOM   1474  C  CZ    . PHE A  1  190 ? 50.844  68.285  36.034  1.00 78.18  ? 190  PHE A CZ    1 
ATOM   1475  N  N     . LYS A  1  191 ? 53.097  70.739  29.300  1.00 85.34  ? 191  LYS A N     1 
ATOM   1476  C  CA    . LYS A  1  191 ? 53.644  70.802  27.955  1.00 86.27  ? 191  LYS A CA    1 
ATOM   1477  C  C     . LYS A  1  191 ? 55.068  71.351  27.883  1.00 86.90  ? 191  LYS A C     1 
ATOM   1478  O  O     . LYS A  1  191 ? 55.405  72.377  28.475  1.00 87.12  ? 191  LYS A O     1 
ATOM   1479  C  CB    . LYS A  1  191 ? 52.718  71.618  27.063  1.00 86.27  ? 191  LYS A CB    1 
ATOM   1480  C  CG    . LYS A  1  191 ? 51.433  70.893  26.749  1.00 88.47  ? 191  LYS A CG    1 
ATOM   1481  C  CD    . LYS A  1  191 ? 50.629  71.624  25.682  1.00 91.73  ? 191  LYS A CD    1 
ATOM   1482  C  CE    . LYS A  1  191 ? 49.481  70.760  25.150  1.00 92.47  ? 191  LYS A CE    1 
ATOM   1483  N  NZ    . LYS A  1  191 ? 48.627  71.482  24.156  1.00 94.36  ? 191  LYS A NZ    1 
ATOM   1484  N  N     . ALA A  1  192 ? 55.891  70.640  27.126  1.00 87.12  ? 192  ALA A N     1 
ATOM   1485  C  CA    . ALA A  1  192 ? 57.298  70.953  26.935  1.00 87.35  ? 192  ALA A CA    1 
ATOM   1486  C  C     . ALA A  1  192 ? 57.772  72.406  27.071  1.00 87.06  ? 192  ALA A C     1 
ATOM   1487  O  O     . ALA A  1  192 ? 58.585  72.720  27.947  1.00 88.21  ? 192  ALA A O     1 
ATOM   1488  C  CB    . ALA A  1  192 ? 57.749  70.387  25.595  1.00 87.54  ? 192  ALA A CB    1 
ATOM   1489  N  N     . PRO A  1  193 ? 57.276  73.311  26.214  1.00 86.35  ? 193  PRO A N     1 
ATOM   1490  C  CA    . PRO A  1  193 ? 57.725  74.705  26.312  1.00 85.50  ? 193  PRO A CA    1 
ATOM   1491  C  C     . PRO A  1  193 ? 57.455  75.356  27.665  1.00 84.73  ? 193  PRO A C     1 
ATOM   1492  O  O     . PRO A  1  193 ? 58.021  76.404  27.987  1.00 84.69  ? 193  PRO A O     1 
ATOM   1493  C  CB    . PRO A  1  193 ? 56.983  75.384  25.163  1.00 85.44  ? 193  PRO A CB    1 
ATOM   1494  C  CG    . PRO A  1  193 ? 55.686  74.627  25.118  1.00 86.05  ? 193  PRO A CG    1 
ATOM   1495  C  CD    . PRO A  1  193 ? 56.133  73.187  25.289  1.00 86.64  ? 193  PRO A CD    1 
ATOM   1496  N  N     . ARG A  1  194 ? 56.608  74.714  28.464  1.00 83.56  ? 194  ARG A N     1 
ATOM   1497  C  CA    . ARG A  1  194 ? 56.249  75.233  29.776  1.00 82.12  ? 194  ARG A CA    1 
ATOM   1498  C  C     . ARG A  1  194 ? 56.885  74.468  30.926  1.00 81.00  ? 194  ARG A C     1 
ATOM   1499  O  O     . ARG A  1  194 ? 56.771  74.879  32.076  1.00 80.31  ? 194  ARG A O     1 
ATOM   1500  C  CB    . ARG A  1  194 ? 54.724  75.248  29.923  1.00 82.69  ? 194  ARG A CB    1 
ATOM   1501  C  CG    . ARG A  1  194 ? 54.054  76.326  29.068  1.00 84.07  ? 194  ARG A CG    1 
ATOM   1502  C  CD    . ARG A  1  194 ? 52.570  76.082  28.864  1.00 83.39  ? 194  ARG A CD    1 
ATOM   1503  N  NE    . ARG A  1  194 ? 51.847  76.023  30.126  1.00 83.77  ? 194  ARG A NE    1 
ATOM   1504  C  CZ    . ARG A  1  194 ? 50.566  75.691  30.223  1.00 84.11  ? 194  ARG A CZ    1 
ATOM   1505  N  NH1   . ARG A  1  194 ? 49.884  75.401  29.122  1.00 83.55  ? 194  ARG A NH1   1 
ATOM   1506  N  NH2   . ARG A  1  194 ? 49.979  75.621  31.414  1.00 83.88  ? 194  ARG A NH2   1 
ATOM   1507  N  N     . MET A  1  195 ? 57.559  73.364  30.617  1.00 80.27  ? 195  MET A N     1 
ATOM   1508  C  CA    . MET A  1  195 ? 58.224  72.570  31.643  1.00 79.48  ? 195  MET A CA    1 
ATOM   1509  C  C     . MET A  1  195 ? 59.722  72.864  31.632  1.00 79.25  ? 195  MET A C     1 
ATOM   1510  O  O     . MET A  1  195 ? 60.251  73.406  30.658  1.00 78.79  ? 195  MET A O     1 
ATOM   1511  C  CB    . MET A  1  195 ? 57.979  71.082  31.401  1.00 79.29  ? 195  MET A CB    1 
ATOM   1512  C  CG    . MET A  1  195 ? 56.506  70.709  31.368  1.00 80.49  ? 195  MET A CG    1 
ATOM   1513  S  SD    . MET A  1  195 ? 56.199  68.927  31.285  1.00 82.10  ? 195  MET A SD    1 
ATOM   1514  C  CE    . MET A  1  195 ? 55.730  68.749  29.595  1.00 82.75  ? 195  MET A CE    1 
ATOM   1515  N  N     . VAL A  1  196 ? 60.393  72.524  32.727  1.00 79.02  ? 196  VAL A N     1 
ATOM   1516  C  CA    . VAL A  1  196 ? 61.832  72.736  32.853  1.00 79.37  ? 196  VAL A CA    1 
ATOM   1517  C  C     . VAL A  1  196 ? 62.496  71.601  33.628  1.00 81.85  ? 196  VAL A C     1 
ATOM   1518  O  O     . VAL A  1  196 ? 62.246  71.427  34.829  1.00 83.25  ? 196  VAL A O     1 
ATOM   1519  C  CB    . VAL A  1  196 ? 62.161  74.042  33.589  1.00 77.33  ? 196  VAL A CB    1 
ATOM   1520  C  CG1   . VAL A  1  196 ? 63.657  74.138  33.835  1.00 75.23  ? 196  VAL A CG1   1 
ATOM   1521  C  CG2   . VAL A  1  196 ? 61.698  75.214  32.778  1.00 77.43  ? 196  VAL A CG2   1 
ATOM   1522  N  N     . LEU A  1  197 ? 63.338  70.828  32.941  1.00 82.25  ? 197  LEU A N     1 
ATOM   1523  C  CA    . LEU A  1  197 ? 64.054  69.725  33.576  1.00 80.60  ? 197  LEU A CA    1 
ATOM   1524  C  C     . LEU A  1  197 ? 65.291  70.336  34.197  1.00 80.29  ? 197  LEU A C     1 
ATOM   1525  O  O     . LEU A  1  197 ? 66.185  70.798  33.487  1.00 79.50  ? 197  LEU A O     1 
ATOM   1526  C  CB    . LEU A  1  197 ? 64.460  68.674  32.543  1.00 79.77  ? 197  LEU A CB    1 
ATOM   1527  C  CG    . LEU A  1  197 ? 65.144  67.427  33.115  1.00 79.90  ? 197  LEU A CG    1 
ATOM   1528  C  CD1   . LEU A  1  197 ? 64.146  66.595  33.917  1.00 79.08  ? 197  LEU A CD1   1 
ATOM   1529  C  CD2   . LEU A  1  197 ? 65.739  66.606  31.977  1.00 79.88  ? 197  LEU A CD2   1 
ATOM   1530  N  N     . ALA A  1  198 ? 65.329  70.363  35.523  1.00 80.76  ? 198  ALA A N     1 
ATOM   1531  C  CA    . ALA A  1  198 ? 66.467  70.938  36.226  1.00 81.67  ? 198  ALA A CA    1 
ATOM   1532  C  C     . ALA A  1  198 ? 67.129  69.876  37.076  1.00 81.83  ? 198  ALA A C     1 
ATOM   1533  O  O     . ALA A  1  198 ? 66.474  68.913  37.497  1.00 82.54  ? 198  ALA A O     1 
ATOM   1534  C  CB    . ALA A  1  198 ? 66.016  72.110  37.100  1.00 81.70  ? 198  ALA A CB    1 
ATOM   1535  N  N     . ALA A  1  199 ? 68.425  70.051  37.322  1.00 80.86  ? 199  ALA A N     1 
ATOM   1536  C  CA    . ALA A  1  199 ? 69.168  69.094  38.124  1.00 80.39  ? 199  ALA A CA    1 
ATOM   1537  C  C     . ALA A  1  199 ? 70.315  69.781  38.833  1.00 80.70  ? 199  ALA A C     1 
ATOM   1538  O  O     . ALA A  1  199 ? 70.797  70.826  38.392  1.00 79.18  ? 199  ALA A O     1 
ATOM   1539  C  CB    . ALA A  1  199 ? 69.690  67.963  37.242  1.00 78.63  ? 199  ALA A CB    1 
ATOM   1540  N  N     . ALA A  1  200 ? 70.733  69.190  39.945  1.00 82.38  ? 200  ALA A N     1 
ATOM   1541  C  CA    . ALA A  1  200 ? 71.835  69.723  40.725  1.00 85.15  ? 200  ALA A CA    1 
ATOM   1542  C  C     . ALA A  1  200 ? 72.550  68.589  41.436  1.00 87.71  ? 200  ALA A C     1 
ATOM   1543  O  O     . ALA A  1  200 ? 71.918  67.655  41.938  1.00 87.69  ? 200  ALA A O     1 
ATOM   1544  C  CB    . ALA A  1  200 ? 71.331  70.719  41.726  1.00 85.22  ? 200  ALA A CB    1 
ATOM   1545  N  N     . GLY A  1  201 ? 73.877  68.681  41.464  1.00 90.47  ? 201  GLY A N     1 
ATOM   1546  C  CA    . GLY A  1  201 ? 74.692  67.662  42.104  1.00 92.99  ? 201  GLY A CA    1 
ATOM   1547  C  C     . GLY A  1  201 ? 75.823  67.161  41.218  1.00 94.25  ? 201  GLY A C     1 
ATOM   1548  O  O     . GLY A  1  201 ? 76.338  67.892  40.352  1.00 94.23  ? 201  GLY A O     1 
ATOM   1549  N  N     . GLY A  1  202 ? 76.219  65.911  41.450  1.00 94.51  ? 202  GLY A N     1 
ATOM   1550  C  CA    . GLY A  1  202 ? 77.276  65.311  40.659  1.00 94.37  ? 202  GLY A CA    1 
ATOM   1551  C  C     . GLY A  1  202 ? 76.640  64.775  39.399  1.00 93.96  ? 202  GLY A C     1 
ATOM   1552  O  O     . GLY A  1  202 ? 76.357  63.584  39.292  1.00 93.35  ? 202  GLY A O     1 
ATOM   1553  N  N     . ILE A  1  203 ? 76.405  65.664  38.441  1.00 93.66  ? 203  ILE A N     1 
ATOM   1554  C  CA    . ILE A  1  203 ? 75.769  65.271  37.199  1.00 93.76  ? 203  ILE A CA    1 
ATOM   1555  C  C     . ILE A  1  203 ? 76.337  66.017  36.008  1.00 93.41  ? 203  ILE A C     1 
ATOM   1556  O  O     . ILE A  1  203 ? 76.636  67.200  36.095  1.00 92.23  ? 203  ILE A O     1 
ATOM   1557  C  CB    . ILE A  1  203 ? 74.250  65.526  37.276  1.00 94.46  ? 203  ILE A CB    1 
ATOM   1558  C  CG1   . ILE A  1  203 ? 73.643  64.620  38.346  1.00 95.85  ? 203  ILE A CG1   1 
ATOM   1559  C  CG2   . ILE A  1  203 ? 73.590  65.285  35.918  1.00 94.09  ? 203  ILE A CG2   1 
ATOM   1560  C  CD1   . ILE A  1  203 ? 72.214  64.941  38.678  1.00 97.81  ? 203  ILE A CD1   1 
ATOM   1561  N  N     . SER A  1  204 ? 76.489  65.306  34.895  1.00 93.64  ? 204  SER A N     1 
ATOM   1562  C  CA    . SER A  1  204 ? 77.002  65.898  33.669  1.00 93.39  ? 204  SER A CA    1 
ATOM   1563  C  C     . SER A  1  204 ? 75.834  66.552  32.970  1.00 92.26  ? 204  SER A C     1 
ATOM   1564  O  O     . SER A  1  204 ? 74.817  65.908  32.716  1.00 90.32  ? 204  SER A O     1 
ATOM   1565  C  CB    . SER A  1  204 ? 77.602  64.822  32.755  1.00 94.42  ? 204  SER A CB    1 
ATOM   1566  O  OG    . SER A  1  204 ? 77.994  65.372  31.505  1.00 95.41  ? 204  SER A OG    1 
ATOM   1567  N  N     . HIS A  1  205 ? 75.972  67.832  32.665  1.00 92.36  ? 205  HIS A N     1 
ATOM   1568  C  CA    . HIS A  1  205 ? 74.887  68.512  31.995  1.00 94.38  ? 205  HIS A CA    1 
ATOM   1569  C  C     . HIS A  1  205 ? 74.592  67.785  30.692  1.00 95.40  ? 205  HIS A C     1 
ATOM   1570  O  O     . HIS A  1  205 ? 73.433  67.549  30.331  1.00 95.09  ? 205  HIS A O     1 
ATOM   1571  C  CB    . HIS A  1  205 ? 75.247  69.971  31.716  1.00 94.61  ? 205  HIS A CB    1 
ATOM   1572  C  CG    . HIS A  1  205 ? 74.154  70.728  31.030  1.00 95.09  ? 205  HIS A CG    1 
ATOM   1573  N  ND1   . HIS A  1  205 ? 72.847  70.691  31.461  1.00 95.38  ? 205  HIS A ND1   1 
ATOM   1574  C  CD2   . HIS A  1  205 ? 74.166  71.516  29.930  1.00 95.43  ? 205  HIS A CD2   1 
ATOM   1575  C  CE1   . HIS A  1  205 ? 72.099  71.420  30.653  1.00 96.47  ? 205  HIS A CE1   1 
ATOM   1576  N  NE2   . HIS A  1  205 ? 72.875  71.932  29.716  1.00 96.18  ? 205  HIS A NE2   1 
ATOM   1577  N  N     . LYS A  1  206 ? 75.660  67.418  29.995  1.00 96.50  ? 206  LYS A N     1 
ATOM   1578  C  CA    . LYS A  1  206 ? 75.518  66.722  28.735  1.00 96.78  ? 206  LYS A CA    1 
ATOM   1579  C  C     . LYS A  1  206 ? 74.762  65.415  28.960  1.00 96.82  ? 206  LYS A C     1 
ATOM   1580  O  O     . LYS A  1  206 ? 73.771  65.147  28.290  1.00 96.00  ? 206  LYS A O     1 
ATOM   1581  C  CB    . LYS A  1  206 ? 76.893  66.454  28.125  1.00 97.49  ? 206  LYS A CB    1 
ATOM   1582  C  CG    . LYS A  1  206 ? 76.821  65.758  26.774  1.00 99.68  ? 206  LYS A CG    1 
ATOM   1583  C  CD    . LYS A  1  206 ? 78.160  65.160  26.361  1.00 99.68  ? 206  LYS A CD    1 
ATOM   1584  C  CE    . LYS A  1  206 ? 77.952  63.937  25.473  1.00 99.99  ? 206  LYS A CE    1 
ATOM   1585  N  NZ    . LYS A  1  206 ? 77.212  62.844  26.186  1.00 99.50  ? 206  LYS A NZ    1 
ATOM   1586  N  N     . GLU A  1  207 ? 75.216  64.603  29.908  1.00 97.95  ? 207  GLU A N     1 
ATOM   1587  C  CA    . GLU A  1  207 ? 74.536  63.339  30.171  1.00 99.86  ? 207  GLU A CA    1 
ATOM   1588  C  C     . GLU A  1  207 ? 73.076  63.623  30.465  1.00 100.46 ? 207  GLU A C     1 
ATOM   1589  O  O     . GLU A  1  207 ? 72.182  62.914  30.002  1.00 100.30 ? 207  GLU A O     1 
ATOM   1590  C  CB    . GLU A  1  207 ? 75.160  62.610  31.364  1.00 100.30 ? 207  GLU A CB    1 
ATOM   1591  C  CG    . GLU A  1  207 ? 76.542  62.049  31.095  1.00 102.31 ? 207  GLU A CG    1 
ATOM   1592  C  CD    . GLU A  1  207 ? 77.059  61.175  32.228  1.00 103.71 ? 207  GLU A CD    1 
ATOM   1593  O  OE1   . GLU A  1  207 ? 76.403  60.154  32.536  1.00 103.66 ? 207  GLU A OE1   1 
ATOM   1594  O  OE2   . GLU A  1  207 ? 78.123  61.503  32.806  1.00 104.05 ? 207  GLU A OE2   1 
ATOM   1595  N  N     . LEU A  1  208 ? 72.847  64.684  31.230  1.00 101.21 ? 208  LEU A N     1 
ATOM   1596  C  CA    . LEU A  1  208 ? 71.501  65.085  31.615  1.00 101.31 ? 208  LEU A CA    1 
ATOM   1597  C  C     . LEU A  1  208 ? 70.613  65.356  30.410  1.00 100.95 ? 208  LEU A C     1 
ATOM   1598  O  O     . LEU A  1  208 ? 69.492  64.845  30.324  1.00 101.07 ? 208  LEU A O     1 
ATOM   1599  C  CB    . LEU A  1  208 ? 71.560  66.335  32.504  1.00 101.25 ? 208  LEU A CB    1 
ATOM   1600  C  CG    . LEU A  1  208 ? 70.240  66.991  32.934  1.00 100.17 ? 208  LEU A CG    1 
ATOM   1601  C  CD1   . LEU A  1  208 ? 69.372  65.989  33.672  1.00 100.47 ? 208  LEU A CD1   1 
ATOM   1602  C  CD2   . LEU A  1  208 ? 70.532  68.188  33.819  1.00 99.27  ? 208  LEU A CD2   1 
ATOM   1603  N  N     . VAL A  1  209 ? 71.121  66.153  29.476  1.00 100.41 ? 209  VAL A N     1 
ATOM   1604  C  CA    . VAL A  1  209 ? 70.353  66.507  28.295  1.00 100.36 ? 209  VAL A CA    1 
ATOM   1605  C  C     . VAL A  1  209 ? 70.145  65.365  27.300  1.00 100.63 ? 209  VAL A C     1 
ATOM   1606  O  O     . VAL A  1  209 ? 69.146  65.354  26.587  1.00 99.41  ? 209  VAL A O     1 
ATOM   1607  C  CB    . VAL A  1  209 ? 70.974  67.733  27.590  1.00 99.54  ? 209  VAL A CB    1 
ATOM   1608  C  CG1   . VAL A  1  209 ? 72.429  67.483  27.286  1.00 101.80 ? 209  VAL A CG1   1 
ATOM   1609  C  CG2   . VAL A  1  209 ? 70.206  68.047  26.336  1.00 98.70  ? 209  VAL A CG2   1 
ATOM   1610  N  N     . ASP A  1  210 ? 71.068  64.403  27.252  1.00 102.47 ? 210  ASP A N     1 
ATOM   1611  C  CA    . ASP A  1  210 ? 70.919  63.264  26.337  1.00 103.97 ? 210  ASP A CA    1 
ATOM   1612  C  C     . ASP A  1  210 ? 69.742  62.442  26.827  1.00 103.81 ? 210  ASP A C     1 
ATOM   1613  O  O     . ASP A  1  210 ? 68.925  61.971  26.035  1.00 103.51 ? 210  ASP A O     1 
ATOM   1614  C  CB    . ASP A  1  210 ? 72.167  62.364  26.321  1.00 106.11 ? 210  ASP A CB    1 
ATOM   1615  C  CG    . ASP A  1  210 ? 73.394  63.045  25.721  1.00 107.85 ? 210  ASP A CG    1 
ATOM   1616  O  OD1   . ASP A  1  210 ? 73.270  63.680  24.646  1.00 108.37 ? 210  ASP A OD1   1 
ATOM   1617  O  OD2   . ASP A  1  210 ? 74.489  62.926  26.322  1.00 107.91 ? 210  ASP A OD2   1 
ATOM   1618  N  N     . ALA A  1  211 ? 69.679  62.270  28.147  1.00 104.45 ? 211  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  211 ? 68.609  61.520  28.797  1.00 104.65 ? 211  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  211 ? 67.295  62.242  28.540  1.00 105.09 ? 211  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  211 ? 66.258  61.605  28.317  1.00 104.99 ? 211  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  211 ? 68.869  61.430  30.288  1.00 104.39 ? 211  ALA A CB    1 
ATOM   1623  N  N     . ALA A  1  212 ? 67.354  63.575  28.579  1.00 104.91 ? 212  ALA A N     1 
ATOM   1624  C  CA    . ALA A  1  212 ? 66.186  64.416  28.329  1.00 104.71 ? 212  ALA A CA    1 
ATOM   1625  C  C     . ALA A  1  212 ? 65.684  64.134  26.913  1.00 105.31 ? 212  ALA A C     1 
ATOM   1626  O  O     . ALA A  1  212 ? 64.501  63.860  26.704  1.00 105.43 ? 212  ALA A O     1 
ATOM   1627  C  CB    . ALA A  1  212 ? 66.556  65.889  28.474  1.00 103.70 ? 212  ALA A CB    1 
ATOM   1628  N  N     . ARG A  1  213 ? 66.597  64.193  25.945  1.00 105.67 ? 213  ARG A N     1 
ATOM   1629  C  CA    . ARG A  1  213 ? 66.258  63.936  24.552  1.00 104.86 ? 213  ARG A CA    1 
ATOM   1630  C  C     . ARG A  1  213 ? 65.550  62.605  24.420  1.00 105.03 ? 213  ARG A C     1 
ATOM   1631  O  O     . ARG A  1  213 ? 64.574  62.488  23.680  1.00 105.74 ? 213  ARG A O     1 
ATOM   1632  C  CB    . ARG A  1  213 ? 67.515  63.893  23.679  1.00 104.18 ? 213  ARG A CB    1 
ATOM   1633  C  CG    . ARG A  1  213 ? 68.257  65.198  23.579  1.00 105.18 ? 213  ARG A CG    1 
ATOM   1634  C  CD    . ARG A  1  213 ? 69.449  65.094  22.635  1.00 105.44 ? 213  ARG A CD    1 
ATOM   1635  N  NE    . ARG A  1  213 ? 70.216  66.342  22.587  1.00 106.91 ? 213  ARG A NE    1 
ATOM   1636  C  CZ    . ARG A  1  213 ? 69.729  67.518  22.185  1.00 107.82 ? 213  ARG A CZ    1 
ATOM   1637  N  NH1   . ARG A  1  213 ? 68.463  67.623  21.788  1.00 108.51 ? 213  ARG A NH1   1 
ATOM   1638  N  NH2   . ARG A  1  213 ? 70.507  68.598  22.178  1.00 107.54 ? 213  ARG A NH2   1 
ATOM   1639  N  N     . GLN A  1  214 ? 66.028  61.606  25.152  1.00 104.71 ? 214  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  214 ? 65.456  60.279  25.045  1.00 105.57 ? 214  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  214 ? 64.014  60.066  25.478  1.00 105.78 ? 214  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  214 ? 63.231  59.508  24.711  1.00 106.10 ? 214  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  214 ? 66.346  59.259  25.748  1.00 106.41 ? 214  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  214 ? 66.010  57.828  25.344  1.00 107.61 ? 214  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  214 ? 67.177  56.876  25.508  1.00 107.89 ? 214  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  214 ? 67.550  56.515  26.626  1.00 107.64 ? 214  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  214 ? 67.769  56.469  24.386  1.00 108.56 ? 214  GLN A NE2   1 
ATOM   1648  N  N     . HIS A  1  215 ? 63.644  60.489  26.683  1.00 105.72 ? 215  HIS A N     1 
ATOM   1649  C  CA    . HIS A  1  215 ? 62.265  60.278  27.125  1.00 105.68 ? 215  HIS A CA    1 
ATOM   1650  C  C     . HIS A  1  215 ? 61.394  61.521  27.007  1.00 105.70 ? 215  HIS A C     1 
ATOM   1651  O  O     . HIS A  1  215 ? 60.172  61.427  26.891  1.00 104.43 ? 215  HIS A O     1 
ATOM   1652  C  CB    . HIS A  1  215 ? 62.256  59.757  28.550  1.00 105.75 ? 215  HIS A CB    1 
ATOM   1653  C  CG    . HIS A  1  215 ? 63.337  58.761  28.823  1.00 106.27 ? 215  HIS A CG    1 
ATOM   1654  N  ND1   . HIS A  1  215 ? 64.666  59.118  28.924  1.00 106.45 ? 215  HIS A ND1   1 
ATOM   1655  C  CD2   . HIS A  1  215 ? 63.287  57.426  29.033  1.00 105.45 ? 215  HIS A CD2   1 
ATOM   1656  C  CE1   . HIS A  1  215 ? 65.387  58.045  29.193  1.00 105.51 ? 215  HIS A CE1   1 
ATOM   1657  N  NE2   . HIS A  1  215 ? 64.574  57.006  29.266  1.00 105.51 ? 215  HIS A NE2   1 
ATOM   1658  N  N     . PHE A  1  216 ? 62.027  62.687  27.042  1.00 106.68 ? 216  PHE A N     1 
ATOM   1659  C  CA    . PHE A  1  216 ? 61.308  63.943  26.888  1.00 108.31 ? 216  PHE A CA    1 
ATOM   1660  C  C     . PHE A  1  216 ? 61.374  64.276  25.401  1.00 109.37 ? 216  PHE A C     1 
ATOM   1661  O  O     . PHE A  1  216 ? 61.956  65.278  24.977  1.00 109.08 ? 216  PHE A O     1 
ATOM   1662  C  CB    . PHE A  1  216 ? 61.957  65.041  27.738  1.00 108.42 ? 216  PHE A CB    1 
ATOM   1663  C  CG    . PHE A  1  216 ? 61.676  64.910  29.216  1.00 108.56 ? 216  PHE A CG    1 
ATOM   1664  C  CD1   . PHE A  1  216 ? 62.712  64.983  30.149  1.00 108.31 ? 216  PHE A CD1   1 
ATOM   1665  C  CD2   . PHE A  1  216 ? 60.375  64.710  29.676  1.00 108.41 ? 216  PHE A CD2   1 
ATOM   1666  C  CE1   . PHE A  1  216 ? 62.457  64.858  31.516  1.00 108.03 ? 216  PHE A CE1   1 
ATOM   1667  C  CE2   . PHE A  1  216 ? 60.109  64.585  31.038  1.00 108.60 ? 216  PHE A CE2   1 
ATOM   1668  C  CZ    . PHE A  1  216 ? 61.154  64.658  31.961  1.00 108.62 ? 216  PHE A CZ    1 
ATOM   1669  N  N     . SER A  1  217 ? 60.771  63.391  24.617  1.00 111.03 ? 217  SER A N     1 
ATOM   1670  C  CA    . SER A  1  217 ? 60.738  63.515  23.169  1.00 112.77 ? 217  SER A CA    1 
ATOM   1671  C  C     . SER A  1  217 ? 59.364  63.961  22.697  1.00 113.53 ? 217  SER A C     1 
ATOM   1672  O  O     . SER A  1  217 ? 58.714  63.270  21.910  1.00 113.38 ? 217  SER A O     1 
ATOM   1673  C  CB    . SER A  1  217 ? 61.078  62.168  22.527  1.00 113.32 ? 217  SER A CB    1 
ATOM   1674  O  OG    . SER A  1  217 ? 60.137  61.176  22.916  1.00 113.35 ? 217  SER A OG    1 
ATOM   1675  N  N     . GLY A  1  218 ? 58.911  65.105  23.195  1.00 114.16 ? 218  GLY A N     1 
ATOM   1676  C  CA    . GLY A  1  218 ? 57.621  65.607  22.769  1.00 114.42 ? 218  GLY A CA    1 
ATOM   1677  C  C     . GLY A  1  218 ? 57.761  66.077  21.333  1.00 114.47 ? 218  GLY A C     1 
ATOM   1678  O  O     . GLY A  1  218 ? 58.863  66.430  20.895  1.00 114.65 ? 218  GLY A O     1 
ATOM   1679  N  N     . VAL A  1  219 ? 56.658  66.072  20.590  1.00 114.03 ? 219  VAL A N     1 
ATOM   1680  C  CA    . VAL A  1  219 ? 56.680  66.511  19.198  1.00 113.25 ? 219  VAL A CA    1 
ATOM   1681  C  C     . VAL A  1  219 ? 55.852  67.781  19.054  1.00 112.88 ? 219  VAL A C     1 
ATOM   1682  O  O     . VAL A  1  219 ? 54.868  67.968  19.764  1.00 113.36 ? 219  VAL A O     1 
ATOM   1683  C  CB    . VAL A  1  219 ? 56.075  65.452  18.257  1.00 113.06 ? 219  VAL A CB    1 
ATOM   1684  C  CG1   . VAL A  1  219 ? 56.496  65.744  16.824  1.00 112.14 ? 219  VAL A CG1   1 
ATOM   1685  C  CG2   . VAL A  1  219 ? 56.486  64.054  18.697  1.00 112.38 ? 219  VAL A CG2   1 
ATOM   1686  N  N     . SER A  1  220 ? 56.243  68.655  18.137  1.00 112.13 ? 220  SER A N     1 
ATOM   1687  C  CA    . SER A  1  220 ? 55.491  69.882  17.932  1.00 111.05 ? 220  SER A CA    1 
ATOM   1688  C  C     . SER A  1  220 ? 55.310  70.156  16.441  1.00 109.84 ? 220  SER A C     1 
ATOM   1689  O  O     . SER A  1  220 ? 56.276  70.403  15.721  1.00 109.60 ? 220  SER A O     1 
ATOM   1690  C  CB    . SER A  1  220 ? 56.199  71.056  18.622  1.00 111.06 ? 220  SER A CB    1 
ATOM   1691  O  OG    . SER A  1  220 ? 57.554  71.158  18.212  1.00 111.98 ? 220  SER A OG    1 
ATOM   1692  N  N     . PHE A  1  221 ? 54.065  70.097  15.980  1.00 108.48 ? 221  PHE A N     1 
ATOM   1693  C  CA    . PHE A  1  221 ? 53.772  70.343  14.580  1.00 107.88 ? 221  PHE A CA    1 
ATOM   1694  C  C     . PHE A  1  221 ? 53.318  71.784  14.328  1.00 108.26 ? 221  PHE A C     1 
ATOM   1695  O  O     . PHE A  1  221 ? 53.982  72.529  13.598  1.00 108.70 ? 221  PHE A O     1 
ATOM   1696  C  CB    . PHE A  1  221 ? 52.716  69.354  14.087  1.00 106.85 ? 221  PHE A CB    1 
ATOM   1697  C  CG    . PHE A  1  221 ? 53.102  67.913  14.282  1.00 106.83 ? 221  PHE A CG    1 
ATOM   1698  C  CD1   . PHE A  1  221 ? 52.969  67.306  15.526  1.00 106.11 ? 221  PHE A CD1   1 
ATOM   1699  C  CD2   . PHE A  1  221 ? 53.622  67.165  13.225  1.00 106.31 ? 221  PHE A CD2   1 
ATOM   1700  C  CE1   . PHE A  1  221 ? 53.346  65.976  15.713  1.00 105.05 ? 221  PHE A CE1   1 
ATOM   1701  C  CE2   . PHE A  1  221 ? 54.002  65.837  13.408  1.00 104.81 ? 221  PHE A CE2   1 
ATOM   1702  C  CZ    . PHE A  1  221 ? 53.862  65.244  14.653  1.00 103.94 ? 221  PHE A CZ    1 
ATOM   1703  N  N     . THR A  1  222 ? 52.200  72.181  14.932  1.00 108.14 ? 222  THR A N     1 
ATOM   1704  C  CA    . THR A  1  222 ? 51.685  73.539  14.754  1.00 107.98 ? 222  THR A CA    1 
ATOM   1705  C  C     . THR A  1  222 ? 52.319  74.529  15.709  1.00 106.99 ? 222  THR A C     1 
ATOM   1706  O  O     . THR A  1  222 ? 52.835  74.157  16.759  1.00 106.76 ? 222  THR A O     1 
ATOM   1707  C  CB    . THR A  1  222 ? 50.164  73.626  14.976  1.00 108.94 ? 222  THR A CB    1 
ATOM   1708  O  OG1   . THR A  1  222 ? 49.838  73.079  16.261  1.00 109.41 ? 222  THR A OG1   1 
ATOM   1709  C  CG2   . THR A  1  222 ? 49.414  72.893  13.871  1.00 109.68 ? 222  THR A CG2   1 
ATOM   1710  N  N     . TYR A  1  223 ? 52.256  75.800  15.329  1.00 106.24 ? 223  TYR A N     1 
ATOM   1711  C  CA    . TYR A  1  223 ? 52.802  76.890  16.124  1.00 105.59 ? 223  TYR A CA    1 
ATOM   1712  C  C     . TYR A  1  223 ? 52.157  76.925  17.510  1.00 105.08 ? 223  TYR A C     1 
ATOM   1713  O  O     . TYR A  1  223 ? 52.832  77.131  18.520  1.00 104.14 ? 223  TYR A O     1 
ATOM   1714  C  CB    . TYR A  1  223 ? 52.565  78.226  15.402  1.00 105.99 ? 223  TYR A CB    1 
ATOM   1715  C  CG    . TYR A  1  223 ? 51.097  78.574  15.144  1.00 106.21 ? 223  TYR A CG    1 
ATOM   1716  C  CD1   . TYR A  1  223 ? 50.605  79.854  15.429  1.00 106.37 ? 223  TYR A CD1   1 
ATOM   1717  C  CD2   . TYR A  1  223 ? 50.205  77.633  14.616  1.00 105.99 ? 223  TYR A CD2   1 
ATOM   1718  C  CE1   . TYR A  1  223 ? 49.260  80.189  15.201  1.00 105.70 ? 223  TYR A CE1   1 
ATOM   1719  C  CE2   . TYR A  1  223 ? 48.860  77.960  14.383  1.00 105.74 ? 223  TYR A CE2   1 
ATOM   1720  C  CZ    . TYR A  1  223 ? 48.392  79.239  14.678  1.00 105.88 ? 223  TYR A CZ    1 
ATOM   1721  O  OH    . TYR A  1  223 ? 47.066  79.570  14.459  1.00 104.27 ? 223  TYR A OH    1 
ATOM   1722  N  N     . LYS A  1  224 ? 50.843  76.724  17.538  1.00 104.87 ? 224  LYS A N     1 
ATOM   1723  C  CA    . LYS A  1  224 ? 50.066  76.723  18.771  1.00 105.37 ? 224  LYS A CA    1 
ATOM   1724  C  C     . LYS A  1  224 ? 50.795  76.011  19.909  1.00 105.17 ? 224  LYS A C     1 
ATOM   1725  O  O     . LYS A  1  224 ? 50.922  76.542  21.010  1.00 105.54 ? 224  LYS A O     1 
ATOM   1726  C  CB    . LYS A  1  224 ? 48.724  76.028  18.532  1.00 106.57 ? 224  LYS A CB    1 
ATOM   1727  C  CG    . LYS A  1  224 ? 47.744  76.775  17.650  1.00 108.04 ? 224  LYS A CG    1 
ATOM   1728  C  CD    . LYS A  1  224 ? 47.049  77.891  18.419  1.00 111.04 ? 224  LYS A CD    1 
ATOM   1729  C  CE    . LYS A  1  224 ? 45.874  78.476  17.629  1.00 112.94 ? 224  LYS A CE    1 
ATOM   1730  N  NZ    . LYS A  1  224 ? 44.833  77.449  17.325  1.00 113.39 ? 224  LYS A NZ    1 
ATOM   1731  N  N     . GLU A  1  225 ? 51.258  74.800  19.627  1.00 104.56 ? 225  GLU A N     1 
ATOM   1732  C  CA    . GLU A  1  225 ? 51.962  73.977  20.598  1.00 104.13 ? 225  GLU A CA    1 
ATOM   1733  C  C     . GLU A  1  225 ? 53.215  74.619  21.197  1.00 103.79 ? 225  GLU A C     1 
ATOM   1734  O  O     . GLU A  1  225 ? 53.484  74.472  22.392  1.00 104.34 ? 225  GLU A O     1 
ATOM   1735  C  CB    . GLU A  1  225 ? 52.346  72.653  19.946  1.00 105.16 ? 225  GLU A CB    1 
ATOM   1736  C  CG    . GLU A  1  225 ? 51.170  71.835  19.450  1.00 105.88 ? 225  GLU A CG    1 
ATOM   1737  C  CD    . GLU A  1  225 ? 51.616  70.635  18.641  1.00 107.23 ? 225  GLU A CD    1 
ATOM   1738  O  OE1   . GLU A  1  225 ? 52.504  69.891  19.114  1.00 108.53 ? 225  GLU A OE1   1 
ATOM   1739  O  OE2   . GLU A  1  225 ? 51.081  70.435  17.533  1.00 107.24 ? 225  GLU A OE2   1 
ATOM   1740  N  N     . ASP A  1  226 ? 53.986  75.318  20.368  1.00 102.77 ? 226  ASP A N     1 
ATOM   1741  C  CA    . ASP A  1  226 ? 55.225  75.963  20.813  1.00 101.58 ? 226  ASP A CA    1 
ATOM   1742  C  C     . ASP A  1  226 ? 54.999  77.206  21.669  1.00 99.59  ? 226  ASP A C     1 
ATOM   1743  O  O     . ASP A  1  226 ? 55.899  77.658  22.380  1.00 99.02  ? 226  ASP A O     1 
ATOM   1744  C  CB    . ASP A  1  226 ? 56.093  76.350  19.600  1.00 103.22 ? 226  ASP A CB    1 
ATOM   1745  C  CG    . ASP A  1  226 ? 56.802  75.155  18.969  1.00 104.06 ? 226  ASP A CG    1 
ATOM   1746  O  OD1   . ASP A  1  226 ? 56.105  74.220  18.511  1.00 104.85 ? 226  ASP A OD1   1 
ATOM   1747  O  OD2   . ASP A  1  226 ? 58.057  75.157  18.930  1.00 103.37 ? 226  ASP A OD2   1 
ATOM   1748  N  N     . ALA A  1  227 ? 53.791  77.749  21.596  1.00 97.89  ? 227  ALA A N     1 
ATOM   1749  C  CA    . ALA A  1  227 ? 53.430  78.957  22.328  1.00 96.04  ? 227  ALA A CA    1 
ATOM   1750  C  C     . ALA A  1  227 ? 53.086  78.763  23.803  1.00 95.06  ? 227  ALA A C     1 
ATOM   1751  O  O     . ALA A  1  227 ? 52.464  77.774  24.203  1.00 94.95  ? 227  ALA A O     1 
ATOM   1752  C  CB    . ALA A  1  227 ? 52.275  79.644  21.626  1.00 95.35  ? 227  ALA A CB    1 
ATOM   1753  N  N     . VAL A  1  228 ? 53.513  79.733  24.601  1.00 93.95  ? 228  VAL A N     1 
ATOM   1754  C  CA    . VAL A  1  228 ? 53.260  79.759  26.034  1.00 92.20  ? 228  VAL A CA    1 
ATOM   1755  C  C     . VAL A  1  228 ? 52.161  80.800  26.195  1.00 91.45  ? 228  VAL A C     1 
ATOM   1756  O  O     . VAL A  1  228 ? 52.363  81.970  25.864  1.00 91.50  ? 228  VAL A O     1 
ATOM   1757  C  CB    . VAL A  1  228 ? 54.513  80.215  26.816  1.00 91.73  ? 228  VAL A CB    1 
ATOM   1758  C  CG1   . VAL A  1  228 ? 55.155  81.418  26.133  1.00 91.32  ? 228  VAL A CG1   1 
ATOM   1759  C  CG2   . VAL A  1  228 ? 54.127  80.588  28.228  1.00 91.36  ? 228  VAL A CG2   1 
ATOM   1760  N  N     . PRO A  1  229 ? 50.980  80.392  26.695  1.00 90.57  ? 229  PRO A N     1 
ATOM   1761  C  CA    . PRO A  1  229 ? 49.867  81.329  26.875  1.00 89.41  ? 229  PRO A CA    1 
ATOM   1762  C  C     . PRO A  1  229 ? 50.150  82.399  27.916  1.00 88.01  ? 229  PRO A C     1 
ATOM   1763  O  O     . PRO A  1  229 ? 50.927  82.187  28.849  1.00 87.91  ? 229  PRO A O     1 
ATOM   1764  C  CB    . PRO A  1  229 ? 48.717  80.416  27.289  1.00 89.46  ? 229  PRO A CB    1 
ATOM   1765  C  CG    . PRO A  1  229 ? 49.414  79.390  28.119  1.00 90.09  ? 229  PRO A CG    1 
ATOM   1766  C  CD    . PRO A  1  229 ? 50.646  79.078  27.274  1.00 90.82  ? 229  PRO A CD    1 
ATOM   1767  N  N     . ILE A  1  230 ? 49.540  83.562  27.738  1.00 87.02  ? 230  ILE A N     1 
ATOM   1768  C  CA    . ILE A  1  230 ? 49.711  84.638  28.702  1.00 86.08  ? 230  ILE A CA    1 
ATOM   1769  C  C     . ILE A  1  230 ? 48.393  84.685  29.463  1.00 84.63  ? 230  ILE A C     1 
ATOM   1770  O  O     . ILE A  1  230 ? 47.315  84.800  28.874  1.00 84.00  ? 230  ILE A O     1 
ATOM   1771  C  CB    . ILE A  1  230 ? 49.974  86.017  28.035  1.00 86.75  ? 230  ILE A CB    1 
ATOM   1772  C  CG1   . ILE A  1  230 ? 51.229  85.959  27.158  1.00 87.83  ? 230  ILE A CG1   1 
ATOM   1773  C  CG2   . ILE A  1  230 ? 50.183  87.076  29.113  1.00 85.99  ? 230  ILE A CG2   1 
ATOM   1774  C  CD1   . ILE A  1  230 ? 51.510  87.243  26.380  1.00 88.21  ? 230  ILE A CD1   1 
ATOM   1775  N  N     . LEU A  1  231 ? 48.491  84.565  30.779  1.00 82.73  ? 231  LEU A N     1 
ATOM   1776  C  CA    . LEU A  1  231 ? 47.322  84.576  31.630  1.00 79.58  ? 231  LEU A CA    1 
ATOM   1777  C  C     . LEU A  1  231 ? 46.678  85.936  31.690  1.00 77.52  ? 231  LEU A C     1 
ATOM   1778  O  O     . LEU A  1  231 ? 47.327  86.959  31.487  1.00 76.29  ? 231  LEU A O     1 
ATOM   1779  C  CB    . LEU A  1  231 ? 47.707  84.131  33.035  1.00 79.85  ? 231  LEU A CB    1 
ATOM   1780  C  CG    . LEU A  1  231 ? 47.641  82.627  33.236  1.00 79.25  ? 231  LEU A CG    1 
ATOM   1781  C  CD1   . LEU A  1  231 ? 48.457  82.222  34.437  1.00 79.82  ? 231  LEU A CD1   1 
ATOM   1782  C  CD2   . LEU A  1  231 ? 46.184  82.232  33.392  1.00 80.91  ? 231  LEU A CD2   1 
ATOM   1783  N  N     . PRO A  1  232 ? 45.376  85.962  31.968  1.00 76.50  ? 232  PRO A N     1 
ATOM   1784  C  CA    . PRO A  1  232 ? 44.639  87.213  32.062  1.00 75.74  ? 232  PRO A CA    1 
ATOM   1785  C  C     . PRO A  1  232 ? 45.062  87.826  33.378  1.00 74.61  ? 232  PRO A C     1 
ATOM   1786  O  O     . PRO A  1  232 ? 45.245  87.116  34.369  1.00 74.98  ? 232  PRO A O     1 
ATOM   1787  C  CB    . PRO A  1  232 ? 43.196  86.750  32.075  1.00 75.47  ? 232  PRO A CB    1 
ATOM   1788  C  CG    . PRO A  1  232 ? 43.288  85.524  32.907  1.00 77.93  ? 232  PRO A CG    1 
ATOM   1789  C  CD    . PRO A  1  232 ? 44.514  84.827  32.333  1.00 77.95  ? 232  PRO A CD    1 
ATOM   1790  N  N     . ARG A  1  233 ? 45.222  89.140  33.368  1.00 73.64  ? 233  ARG A N     1 
ATOM   1791  C  CA    . ARG A  1  233 ? 45.648  89.903  34.528  1.00 73.07  ? 233  ARG A CA    1 
ATOM   1792  C  C     . ARG A  1  233 ? 44.666  89.868  35.706  1.00 72.41  ? 233  ARG A C     1 
ATOM   1793  O  O     . ARG A  1  233 ? 43.451  89.995  35.517  1.00 72.65  ? 233  ARG A O     1 
ATOM   1794  C  CB    . ARG A  1  233 ? 45.883  91.327  34.071  1.00 74.65  ? 233  ARG A CB    1 
ATOM   1795  C  CG    . ARG A  1  233 ? 46.466  92.216  35.090  1.00 76.52  ? 233  ARG A CG    1 
ATOM   1796  C  CD    . ARG A  1  233 ? 47.227  93.320  34.384  1.00 79.29  ? 233  ARG A CD    1 
ATOM   1797  N  NE    . ARG A  1  233 ? 48.650  93.234  34.668  1.00 80.29  ? 233  ARG A NE    1 
ATOM   1798  C  CZ    . ARG A  1  233 ? 49.147  93.079  35.893  1.00 82.85  ? 233  ARG A CZ    1 
ATOM   1799  N  NH1   . ARG A  1  233 ? 48.329  92.992  36.941  1.00 84.77  ? 233  ARG A NH1   1 
ATOM   1800  N  NH2   . ARG A  1  233 ? 50.460  93.014  36.079  1.00 83.07  ? 233  ARG A NH2   1 
ATOM   1801  N  N     . CYS A  1  234 ? 45.198  89.688  36.917  1.00 70.55  ? 234  CYS A N     1 
ATOM   1802  C  CA    . CYS A  1  234 ? 44.383  89.633  38.132  1.00 68.06  ? 234  CYS A CA    1 
ATOM   1803  C  C     . CYS A  1  234 ? 44.327  90.988  38.824  1.00 66.94  ? 234  CYS A C     1 
ATOM   1804  O  O     . CYS A  1  234 ? 45.362  91.577  39.160  1.00 67.86  ? 234  CYS A O     1 
ATOM   1805  C  CB    . CYS A  1  234 ? 44.934  88.584  39.080  1.00 67.69  ? 234  CYS A CB    1 
ATOM   1806  S  SG    . CYS A  1  234 ? 44.501  86.931  38.566  1.00 69.63  ? 234  CYS A SG    1 
ATOM   1807  N  N     . ARG A  1  235 ? 43.108  91.467  39.044  1.00 63.69  ? 235  ARG A N     1 
ATOM   1808  C  CA    . ARG A  1  235 ? 42.885  92.774  39.637  1.00 61.68  ? 235  ARG A CA    1 
ATOM   1809  C  C     . ARG A  1  235 ? 42.940  92.829  41.155  1.00 61.52  ? 235  ARG A C     1 
ATOM   1810  O  O     . ARG A  1  235 ? 42.114  92.208  41.841  1.00 62.63  ? 235  ARG A O     1 
ATOM   1811  C  CB    . ARG A  1  235 ? 41.540  93.310  39.150  1.00 60.10  ? 235  ARG A CB    1 
ATOM   1812  C  CG    . ARG A  1  235 ? 41.128  94.637  39.757  1.00 60.10  ? 235  ARG A CG    1 
ATOM   1813  C  CD    . ARG A  1  235 ? 39.628  94.789  39.705  1.00 57.39  ? 235  ARG A CD    1 
ATOM   1814  N  NE    . ARG A  1  235 ? 38.994  93.708  40.447  1.00 58.46  ? 235  ARG A NE    1 
ATOM   1815  C  CZ    . ARG A  1  235 ? 37.732  93.328  40.282  1.00 59.33  ? 235  ARG A CZ    1 
ATOM   1816  N  NH1   . ARG A  1  235 ? 36.966  93.951  39.397  1.00 60.84  ? 235  ARG A NH1   1 
ATOM   1817  N  NH2   . ARG A  1  235 ? 37.238  92.313  40.986  1.00 58.97  ? 235  ARG A NH2   1 
ATOM   1818  N  N     . PHE A  1  236 ? 43.904  93.588  41.676  1.00 59.82  ? 236  PHE A N     1 
ATOM   1819  C  CA    . PHE A  1  236 ? 44.054  93.748  43.123  1.00 58.52  ? 236  PHE A CA    1 
ATOM   1820  C  C     . PHE A  1  236 ? 42.970  94.680  43.618  1.00 57.85  ? 236  PHE A C     1 
ATOM   1821  O  O     . PHE A  1  236 ? 42.574  95.594  42.903  1.00 59.70  ? 236  PHE A O     1 
ATOM   1822  C  CB    . PHE A  1  236 ? 45.394  94.361  43.474  1.00 57.54  ? 236  PHE A CB    1 
ATOM   1823  C  CG    . PHE A  1  236 ? 45.601  94.541  44.945  1.00 57.17  ? 236  PHE A CG    1 
ATOM   1824  C  CD1   . PHE A  1  236 ? 46.264  93.573  45.695  1.00 57.34  ? 236  PHE A CD1   1 
ATOM   1825  C  CD2   . PHE A  1  236 ? 45.139  95.682  45.590  1.00 56.27  ? 236  PHE A CD2   1 
ATOM   1826  C  CE1   . PHE A  1  236 ? 46.470  93.744  47.067  1.00 56.34  ? 236  PHE A CE1   1 
ATOM   1827  C  CE2   . PHE A  1  236 ? 45.341  95.861  46.963  1.00 55.39  ? 236  PHE A CE2   1 
ATOM   1828  C  CZ    . PHE A  1  236 ? 46.009  94.891  47.698  1.00 55.46  ? 236  PHE A CZ    1 
ATOM   1829  N  N     . THR A  1  237 ? 42.514  94.474  44.848  1.00 56.96  ? 237  THR A N     1 
ATOM   1830  C  CA    . THR A  1  237 ? 41.438  95.289  45.404  1.00 55.80  ? 237  THR A CA    1 
ATOM   1831  C  C     . THR A  1  237 ? 41.586  95.619  46.878  1.00 55.23  ? 237  THR A C     1 
ATOM   1832  O  O     . THR A  1  237 ? 41.532  94.729  47.725  1.00 54.49  ? 237  THR A O     1 
ATOM   1833  C  CB    . THR A  1  237 ? 40.077  94.581  45.243  1.00 55.94  ? 237  THR A CB    1 
ATOM   1834  O  OG1   . THR A  1  237 ? 39.802  94.370  43.855  1.00 57.91  ? 237  THR A OG1   1 
ATOM   1835  C  CG2   . THR A  1  237 ? 38.976  95.404  45.861  1.00 55.03  ? 237  THR A CG2   1 
ATOM   1836  N  N     . GLY A  1  238 ? 41.758  96.900  47.186  1.00 55.33  ? 238  GLY A N     1 
ATOM   1837  C  CA    . GLY A  1  238 ? 41.856  97.298  48.577  1.00 55.19  ? 238  GLY A CA    1 
ATOM   1838  C  C     . GLY A  1  238 ? 40.548  96.840  49.194  1.00 56.06  ? 238  GLY A C     1 
ATOM   1839  O  O     . GLY A  1  238 ? 39.497  97.414  48.934  1.00 57.01  ? 238  GLY A O     1 
ATOM   1840  N  N     . SER A  1  239 ? 40.605  95.786  49.995  1.00 55.88  ? 239  SER A N     1 
ATOM   1841  C  CA    . SER A  1  239 ? 39.413  95.234  50.620  1.00 54.80  ? 239  SER A CA    1 
ATOM   1842  C  C     . SER A  1  239 ? 39.803  94.452  51.864  1.00 55.56  ? 239  SER A C     1 
ATOM   1843  O  O     . SER A  1  239 ? 40.983  94.388  52.224  1.00 56.41  ? 239  SER A O     1 
ATOM   1844  C  CB    . SER A  1  239 ? 38.738  94.288  49.646  1.00 55.47  ? 239  SER A CB    1 
ATOM   1845  O  OG    . SER A  1  239 ? 39.655  93.286  49.219  1.00 54.16  ? 239  SER A OG    1 
ATOM   1846  N  N     . GLU A  1  240 ? 38.814  93.850  52.518  1.00 54.81  ? 240  GLU A N     1 
ATOM   1847  C  CA    . GLU A  1  240 ? 39.083  93.045  53.700  1.00 54.57  ? 240  GLU A CA    1 
ATOM   1848  C  C     . GLU A  1  240 ? 38.048  91.952  53.851  1.00 55.02  ? 240  GLU A C     1 
ATOM   1849  O  O     . GLU A  1  240 ? 36.916  92.080  53.385  1.00 57.25  ? 240  GLU A O     1 
ATOM   1850  C  CB    . GLU A  1  240 ? 39.075  93.900  54.962  1.00 54.22  ? 240  GLU A CB    1 
ATOM   1851  C  CG    . GLU A  1  240 ? 37.764  94.615  55.206  1.00 56.63  ? 240  GLU A CG    1 
ATOM   1852  C  CD    . GLU A  1  240 ? 37.642  95.127  56.628  1.00 57.89  ? 240  GLU A CD    1 
ATOM   1853  O  OE1   . GLU A  1  240 ? 38.578  95.817  57.094  1.00 56.81  ? 240  GLU A OE1   1 
ATOM   1854  O  OE2   . GLU A  1  240 ? 36.606  94.840  57.274  1.00 58.76  ? 240  GLU A OE2   1 
ATOM   1855  N  N     . ILE A  1  241 ? 38.457  90.859  54.477  1.00 54.07  ? 241  ILE A N     1 
ATOM   1856  C  CA    . ILE A  1  241 ? 37.558  89.747  54.756  1.00 53.05  ? 241  ILE A CA    1 
ATOM   1857  C  C     . ILE A  1  241 ? 37.829  89.337  56.200  1.00 52.28  ? 241  ILE A C     1 
ATOM   1858  O  O     . ILE A  1  241 ? 38.941  88.940  56.560  1.00 53.08  ? 241  ILE A O     1 
ATOM   1859  C  CB    . ILE A  1  241 ? 37.779  88.549  53.812  1.00 53.11  ? 241  ILE A CB    1 
ATOM   1860  C  CG1   . ILE A  1  241 ? 37.143  87.302  54.429  1.00 52.03  ? 241  ILE A CG1   1 
ATOM   1861  C  CG2   . ILE A  1  241 ? 39.252  88.380  53.511  1.00 52.78  ? 241  ILE A CG2   1 
ATOM   1862  C  CD1   . ILE A  1  241 ? 37.179  86.110  53.547  1.00 53.03  ? 241  ILE A CD1   1 
ATOM   1863  N  N     . ARG A  1  242 ? 36.806  89.468  57.033  1.00 49.61  ? 242  ARG A N     1 
ATOM   1864  C  CA    . ARG A  1  242 ? 36.929  89.157  58.438  1.00 46.62  ? 242  ARG A CA    1 
ATOM   1865  C  C     . ARG A  1  242 ? 36.140  87.921  58.798  1.00 47.43  ? 242  ARG A C     1 
ATOM   1866  O  O     . ARG A  1  242 ? 34.910  87.957  58.896  1.00 48.30  ? 242  ARG A O     1 
ATOM   1867  C  CB    . ARG A  1  242 ? 36.447  90.340  59.273  1.00 42.36  ? 242  ARG A CB    1 
ATOM   1868  C  CG    . ARG A  1  242 ? 37.143  91.629  58.922  1.00 40.98  ? 242  ARG A CG    1 
ATOM   1869  C  CD    . ARG A  1  242 ? 36.897  92.711  59.956  1.00 39.73  ? 242  ARG A CD    1 
ATOM   1870  N  NE    . ARG A  1  242 ? 37.643  93.932  59.655  1.00 39.87  ? 242  ARG A NE    1 
ATOM   1871  C  CZ    . ARG A  1  242 ? 38.189  94.726  60.581  1.00 42.21  ? 242  ARG A CZ    1 
ATOM   1872  N  NH1   . ARG A  1  242 ? 38.066  94.420  61.871  1.00 41.03  ? 242  ARG A NH1   1 
ATOM   1873  N  NH2   . ARG A  1  242 ? 38.870  95.819  60.222  1.00 41.00  ? 242  ARG A NH2   1 
ATOM   1874  N  N     . ALA A  1  243 ? 36.857  86.821  58.988  1.00 47.41  ? 243  ALA A N     1 
ATOM   1875  C  CA    . ALA A  1  243 ? 36.231  85.560  59.371  1.00 48.20  ? 243  ALA A CA    1 
ATOM   1876  C  C     . ALA A  1  243 ? 36.389  85.432  60.890  1.00 48.49  ? 243  ALA A C     1 
ATOM   1877  O  O     . ALA A  1  243 ? 37.430  85.007  61.389  1.00 49.42  ? 243  ALA A O     1 
ATOM   1878  C  CB    . ALA A  1  243 ? 36.911  84.404  58.656  1.00 47.64  ? 243  ALA A CB    1 
ATOM   1879  N  N     . ARG A  1  244 ? 35.347  85.795  61.626  1.00 47.20  ? 244  ARG A N     1 
ATOM   1880  C  CA    . ARG A  1  244 ? 35.425  85.767  63.064  1.00 45.61  ? 244  ARG A CA    1 
ATOM   1881  C  C     . ARG A  1  244 ? 34.882  84.552  63.795  1.00 47.39  ? 244  ARG A C     1 
ATOM   1882  O  O     . ARG A  1  244 ? 33.774  84.076  63.521  1.00 48.58  ? 244  ARG A O     1 
ATOM   1883  C  CB    . ARG A  1  244 ? 34.765  87.012  63.610  1.00 42.78  ? 244  ARG A CB    1 
ATOM   1884  C  CG    . ARG A  1  244 ? 34.628  87.003  65.100  1.00 43.92  ? 244  ARG A CG    1 
ATOM   1885  C  CD    . ARG A  1  244 ? 34.200  88.345  65.595  1.00 43.93  ? 244  ARG A CD    1 
ATOM   1886  N  NE    . ARG A  1  244 ? 33.965  88.350  67.024  1.00 42.37  ? 244  ARG A NE    1 
ATOM   1887  C  CZ    . ARG A  1  244 ? 33.512  89.410  67.666  1.00 42.58  ? 244  ARG A CZ    1 
ATOM   1888  N  NH1   . ARG A  1  244 ? 33.263  90.516  66.982  1.00 42.19  ? 244  ARG A NH1   1 
ATOM   1889  N  NH2   . ARG A  1  244 ? 33.300  89.360  68.971  1.00 44.15  ? 244  ARG A NH2   1 
ATOM   1890  N  N     . ASP A  1  245 ? 35.686  84.075  64.744  1.00 47.67  ? 245  ASP A N     1 
ATOM   1891  C  CA    . ASP A  1  245 ? 35.339  82.948  65.597  1.00 48.33  ? 245  ASP A CA    1 
ATOM   1892  C  C     . ASP A  1  245 ? 36.007  83.189  66.944  1.00 50.02  ? 245  ASP A C     1 
ATOM   1893  O  O     . ASP A  1  245 ? 37.172  82.842  67.129  1.00 50.88  ? 245  ASP A O     1 
ATOM   1894  C  CB    . ASP A  1  245 ? 35.863  81.645  65.015  1.00 49.50  ? 245  ASP A CB    1 
ATOM   1895  C  CG    . ASP A  1  245 ? 35.358  80.432  65.763  1.00 50.98  ? 245  ASP A CG    1 
ATOM   1896  O  OD1   . ASP A  1  245 ? 34.764  80.619  66.843  1.00 51.10  ? 245  ASP A OD1   1 
ATOM   1897  O  OD2   . ASP A  1  245 ? 35.553  79.295  65.273  1.00 52.82  ? 245  ASP A OD2   1 
ATOM   1898  N  N     . ASP A  1  246 ? 35.278  83.788  67.881  1.00 50.92  ? 246  ASP A N     1 
ATOM   1899  C  CA    . ASP A  1  246 ? 35.822  84.061  69.206  1.00 51.15  ? 246  ASP A CA    1 
ATOM   1900  C  C     . ASP A  1  246 ? 36.224  82.803  69.969  1.00 50.84  ? 246  ASP A C     1 
ATOM   1901  O  O     . ASP A  1  246 ? 36.682  82.882  71.101  1.00 50.65  ? 246  ASP A O     1 
ATOM   1902  C  CB    . ASP A  1  246 ? 34.813  84.832  70.046  1.00 52.54  ? 246  ASP A CB    1 
ATOM   1903  C  CG    . ASP A  1  246 ? 34.658  86.257  69.597  1.00 55.11  ? 246  ASP A CG    1 
ATOM   1904  O  OD1   . ASP A  1  246 ? 35.634  86.807  69.031  1.00 57.29  ? 246  ASP A OD1   1 
ATOM   1905  O  OD2   . ASP A  1  246 ? 33.570  86.830  69.830  1.00 55.26  ? 246  ASP A OD2   1 
ATOM   1906  N  N     . ALA A  1  247 ? 36.061  81.643  69.352  1.00 50.71  ? 247  ALA A N     1 
ATOM   1907  C  CA    . ALA A  1  247 ? 36.402  80.403  70.019  1.00 50.17  ? 247  ALA A CA    1 
ATOM   1908  C  C     . ALA A  1  247 ? 37.837  79.983  69.802  1.00 50.88  ? 247  ALA A C     1 
ATOM   1909  O  O     . ALA A  1  247 ? 38.334  79.140  70.533  1.00 53.41  ? 247  ALA A O     1 
ATOM   1910  C  CB    . ALA A  1  247 ? 35.483  79.304  69.572  1.00 48.16  ? 247  ALA A CB    1 
ATOM   1911  N  N     . LEU A  1  248 ? 38.512  80.540  68.806  1.00 51.02  ? 248  LEU A N     1 
ATOM   1912  C  CA    . LEU A  1  248 ? 39.900  80.152  68.584  1.00 52.11  ? 248  LEU A CA    1 
ATOM   1913  C  C     . LEU A  1  248 ? 40.805  80.915  69.546  1.00 53.08  ? 248  LEU A C     1 
ATOM   1914  O  O     . LEU A  1  248 ? 40.596  82.091  69.827  1.00 53.75  ? 248  LEU A O     1 
ATOM   1915  C  CB    . LEU A  1  248 ? 40.313  80.425  67.140  1.00 53.63  ? 248  LEU A CB    1 
ATOM   1916  C  CG    . LEU A  1  248 ? 39.313  79.936  66.085  1.00 54.03  ? 248  LEU A CG    1 
ATOM   1917  C  CD1   . LEU A  1  248 ? 39.851  80.230  64.691  1.00 53.10  ? 248  LEU A CD1   1 
ATOM   1918  C  CD2   . LEU A  1  248 ? 39.054  78.452  66.267  1.00 53.80  ? 248  LEU A CD2   1 
ATOM   1919  N  N     . PRO A  1  249 ? 41.829  80.245  70.068  1.00 53.78  ? 249  PRO A N     1 
ATOM   1920  C  CA    . PRO A  1  249 ? 42.793  80.815  71.014  1.00 53.93  ? 249  PRO A CA    1 
ATOM   1921  C  C     . PRO A  1  249 ? 43.448  82.118  70.620  1.00 53.63  ? 249  PRO A C     1 
ATOM   1922  O  O     . PRO A  1  249 ? 43.408  83.087  71.374  1.00 54.03  ? 249  PRO A O     1 
ATOM   1923  C  CB    . PRO A  1  249 ? 43.809  79.694  71.186  1.00 53.90  ? 249  PRO A CB    1 
ATOM   1924  C  CG    . PRO A  1  249 ? 43.720  78.960  69.899  1.00 55.57  ? 249  PRO A CG    1 
ATOM   1925  C  CD    . PRO A  1  249 ? 42.239  78.894  69.664  1.00 53.88  ? 249  PRO A CD    1 
ATOM   1926  N  N     . VAL A  1  250 ? 44.070  82.135  69.449  1.00 54.12  ? 250  VAL A N     1 
ATOM   1927  C  CA    . VAL A  1  250 ? 44.739  83.337  68.972  1.00 54.71  ? 250  VAL A CA    1 
ATOM   1928  C  C     . VAL A  1  250 ? 44.033  83.833  67.735  1.00 55.05  ? 250  VAL A C     1 
ATOM   1929  O  O     . VAL A  1  250 ? 43.143  83.171  67.225  1.00 56.97  ? 250  VAL A O     1 
ATOM   1930  C  CB    . VAL A  1  250 ? 46.167  83.052  68.579  1.00 54.68  ? 250  VAL A CB    1 
ATOM   1931  C  CG1   . VAL A  1  250 ? 46.914  82.463  69.744  1.00 55.25  ? 250  VAL A CG1   1 
ATOM   1932  C  CG2   . VAL A  1  250 ? 46.171  82.108  67.405  1.00 53.55  ? 250  VAL A CG2   1 
ATOM   1933  N  N     . ALA A  1  251 ? 44.448  84.991  67.243  1.00 54.92  ? 251  ALA A N     1 
ATOM   1934  C  CA    . ALA A  1  251 ? 43.846  85.575  66.062  1.00 54.75  ? 251  ALA A CA    1 
ATOM   1935  C  C     . ALA A  1  251 ? 44.930  85.799  65.045  1.00 56.08  ? 251  ALA A C     1 
ATOM   1936  O  O     . ALA A  1  251 ? 46.041  86.185  65.389  1.00 57.32  ? 251  ALA A O     1 
ATOM   1937  C  CB    . ALA A  1  251 ? 43.201  86.892  66.408  1.00 54.29  ? 251  ALA A CB    1 
ATOM   1938  N  N     . HIS A  1  252 ? 44.611  85.560  63.785  1.00 56.71  ? 252  HIS A N     1 
ATOM   1939  C  CA    . HIS A  1  252 ? 45.577  85.766  62.730  1.00 57.02  ? 252  HIS A CA    1 
ATOM   1940  C  C     . HIS A  1  252 ? 45.199  86.999  61.939  1.00 56.85  ? 252  HIS A C     1 
ATOM   1941  O  O     . HIS A  1  252 ? 44.017  87.269  61.729  1.00 56.51  ? 252  HIS A O     1 
ATOM   1942  C  CB    . HIS A  1  252 ? 45.620  84.542  61.827  1.00 58.97  ? 252  HIS A CB    1 
ATOM   1943  C  CG    . HIS A  1  252 ? 46.289  83.362  62.458  1.00 62.25  ? 252  HIS A CG    1 
ATOM   1944  N  ND1   . HIS A  1  252 ? 47.509  82.876  62.028  1.00 62.64  ? 252  HIS A ND1   1 
ATOM   1945  C  CD2   . HIS A  1  252 ? 45.932  82.602  63.522  1.00 62.02  ? 252  HIS A CD2   1 
ATOM   1946  C  CE1   . HIS A  1  252 ? 47.873  81.868  62.802  1.00 62.53  ? 252  HIS A CE1   1 
ATOM   1947  N  NE2   . HIS A  1  252 ? 46.935  81.682  63.715  1.00 62.49  ? 252  HIS A NE2   1 
ATOM   1948  N  N     . VAL A  1  253 ? 46.207  87.758  61.520  1.00 56.15  ? 253  VAL A N     1 
ATOM   1949  C  CA    . VAL A  1  253 ? 45.978  88.965  60.742  1.00 55.68  ? 253  VAL A CA    1 
ATOM   1950  C  C     . VAL A  1  253 ? 47.047  89.111  59.663  1.00 56.25  ? 253  VAL A C     1 
ATOM   1951  O  O     . VAL A  1  253 ? 48.237  89.001  59.932  1.00 56.44  ? 253  VAL A O     1 
ATOM   1952  C  CB    . VAL A  1  253 ? 45.977  90.237  61.650  1.00 54.70  ? 253  VAL A CB    1 
ATOM   1953  C  CG1   . VAL A  1  253 ? 45.998  91.488  60.802  1.00 53.74  ? 253  VAL A CG1   1 
ATOM   1954  C  CG2   . VAL A  1  253 ? 44.739  90.259  62.527  1.00 52.63  ? 253  VAL A CG2   1 
ATOM   1955  N  N     . ALA A  1  254 ? 46.611  89.346  58.434  1.00 56.54  ? 254  ALA A N     1 
ATOM   1956  C  CA    . ALA A  1  254 ? 47.537  89.532  57.335  1.00 56.88  ? 254  ALA A CA    1 
ATOM   1957  C  C     . ALA A  1  254 ? 47.069  90.730  56.548  1.00 57.54  ? 254  ALA A C     1 
ATOM   1958  O  O     . ALA A  1  254 ? 45.888  90.848  56.233  1.00 58.89  ? 254  ALA A O     1 
ATOM   1959  C  CB    . ALA A  1  254 ? 47.556  88.320  56.459  1.00 58.20  ? 254  ALA A CB    1 
ATOM   1960  N  N     . LEU A  1  255 ? 48.003  91.616  56.235  1.00 57.58  ? 255  LEU A N     1 
ATOM   1961  C  CA    . LEU A  1  255 ? 47.715  92.834  55.493  1.00 58.62  ? 255  LEU A CA    1 
ATOM   1962  C  C     . LEU A  1  255 ? 48.728  92.926  54.371  1.00 60.48  ? 255  LEU A C     1 
ATOM   1963  O  O     . LEU A  1  255 ? 49.900  92.631  54.582  1.00 61.81  ? 255  LEU A O     1 
ATOM   1964  C  CB    . LEU A  1  255 ? 47.884  94.052  56.402  1.00 57.41  ? 255  LEU A CB    1 
ATOM   1965  C  CG    . LEU A  1  255 ? 47.595  95.402  55.753  1.00 55.38  ? 255  LEU A CG    1 
ATOM   1966  C  CD1   . LEU A  1  255 ? 46.087  95.613  55.697  1.00 55.41  ? 255  LEU A CD1   1 
ATOM   1967  C  CD2   . LEU A  1  255 ? 48.262  96.500  56.535  1.00 53.14  ? 255  LEU A CD2   1 
ATOM   1968  N  N     . ALA A  1  256 ? 48.300  93.343  53.186  1.00 62.25  ? 256  ALA A N     1 
ATOM   1969  C  CA    . ALA A  1  256 ? 49.237  93.447  52.075  1.00 64.97  ? 256  ALA A CA    1 
ATOM   1970  C  C     . ALA A  1  256 ? 48.817  94.428  50.987  1.00 66.44  ? 256  ALA A C     1 
ATOM   1971  O  O     . ALA A  1  256 ? 47.666  94.880  50.934  1.00 66.36  ? 256  ALA A O     1 
ATOM   1972  C  CB    . ALA A  1  256 ? 49.472  92.058  51.453  1.00 65.19  ? 256  ALA A CB    1 
ATOM   1973  N  N     . VAL A  1  257 ? 49.780  94.750  50.127  1.00 66.73  ? 257  VAL A N     1 
ATOM   1974  C  CA    . VAL A  1  257 ? 49.564  95.642  49.006  1.00 67.77  ? 257  VAL A CA    1 
ATOM   1975  C  C     . VAL A  1  257 ? 50.020  94.882  47.778  1.00 69.77  ? 257  VAL A C     1 
ATOM   1976  O  O     . VAL A  1  257 ? 50.831  93.966  47.898  1.00 70.32  ? 257  VAL A O     1 
ATOM   1977  C  CB    . VAL A  1  257 ? 50.394  96.900  49.136  1.00 66.44  ? 257  VAL A CB    1 
ATOM   1978  C  CG1   . VAL A  1  257 ? 49.960  97.660  50.361  1.00 66.75  ? 257  VAL A CG1   1 
ATOM   1979  C  CG2   . VAL A  1  257 ? 51.844  96.544  49.229  1.00 66.49  ? 257  VAL A CG2   1 
ATOM   1980  N  N     . GLU A  1  258 ? 49.500  95.248  46.607  1.00 71.64  ? 258  GLU A N     1 
ATOM   1981  C  CA    . GLU A  1  258 ? 49.882  94.565  45.378  1.00 72.26  ? 258  GLU A CA    1 
ATOM   1982  C  C     . GLU A  1  258 ? 51.385  94.748  45.173  1.00 74.08  ? 258  GLU A C     1 
ATOM   1983  O  O     . GLU A  1  258 ? 51.917  95.857  45.328  1.00 73.16  ? 258  GLU A O     1 
ATOM   1984  C  CB    . GLU A  1  258 ? 49.121  95.126  44.167  1.00 71.25  ? 258  GLU A CB    1 
ATOM   1985  C  CG    . GLU A  1  258 ? 49.153  94.198  42.938  1.00 73.61  ? 258  GLU A CG    1 
ATOM   1986  C  CD    . GLU A  1  258 ? 48.480  94.788  41.688  1.00 75.44  ? 258  GLU A CD    1 
ATOM   1987  O  OE1   . GLU A  1  258 ? 47.408  95.425  41.810  1.00 75.97  ? 258  GLU A OE1   1 
ATOM   1988  O  OE2   . GLU A  1  258 ? 49.018  94.601  40.572  1.00 75.39  ? 258  GLU A OE2   1 
ATOM   1989  N  N     . GLY A  1  259 ? 52.062  93.640  44.861  1.00 75.18  ? 259  GLY A N     1 
ATOM   1990  C  CA    . GLY A  1  259 ? 53.491  93.665  44.614  1.00 74.27  ? 259  GLY A CA    1 
ATOM   1991  C  C     . GLY A  1  259 ? 53.669  93.721  43.112  1.00 74.22  ? 259  GLY A C     1 
ATOM   1992  O  O     . GLY A  1  259 ? 52.720  93.424  42.387  1.00 73.77  ? 259  GLY A O     1 
ATOM   1993  N  N     . PRO A  1  260 ? 54.864  94.073  42.607  1.00 74.14  ? 260  PRO A N     1 
ATOM   1994  C  CA    . PRO A  1  260 ? 55.114  94.158  41.163  1.00 73.83  ? 260  PRO A CA    1 
ATOM   1995  C  C     . PRO A  1  260 ? 55.062  92.838  40.375  1.00 73.80  ? 260  PRO A C     1 
ATOM   1996  O  O     . PRO A  1  260 ? 54.213  92.657  39.508  1.00 74.57  ? 260  PRO A O     1 
ATOM   1997  C  CB    . PRO A  1  260 ? 56.486  94.811  41.104  1.00 72.74  ? 260  PRO A CB    1 
ATOM   1998  C  CG    . PRO A  1  260 ? 57.158  94.195  42.278  1.00 73.48  ? 260  PRO A CG    1 
ATOM   1999  C  CD    . PRO A  1  260 ? 56.109  94.300  43.360  1.00 73.46  ? 260  PRO A CD    1 
ATOM   2000  N  N     . GLY A  1  261 ? 55.964  91.913  40.668  1.00 72.81  ? 261  GLY A N     1 
ATOM   2001  C  CA    . GLY A  1  261 ? 55.971  90.667  39.926  1.00 72.01  ? 261  GLY A CA    1 
ATOM   2002  C  C     . GLY A  1  261 ? 57.415  90.270  39.710  1.00 71.97  ? 261  GLY A C     1 
ATOM   2003  O  O     . GLY A  1  261 ? 58.298  91.131  39.676  1.00 72.67  ? 261  GLY A O     1 
ATOM   2004  N  N     . TRP A  1  262 ? 57.663  88.975  39.557  1.00 69.89  ? 262  TRP A N     1 
ATOM   2005  C  CA    . TRP A  1  262 ? 59.017  88.477  39.390  1.00 67.24  ? 262  TRP A CA    1 
ATOM   2006  C  C     . TRP A  1  262 ? 59.961  89.405  38.656  1.00 67.62  ? 262  TRP A C     1 
ATOM   2007  O  O     . TRP A  1  262 ? 60.937  89.880  39.236  1.00 68.03  ? 262  TRP A O     1 
ATOM   2008  C  CB    . TRP A  1  262 ? 58.984  87.129  38.699  1.00 64.10  ? 262  TRP A CB    1 
ATOM   2009  C  CG    . TRP A  1  262 ? 58.376  86.093  39.548  1.00 61.92  ? 262  TRP A CG    1 
ATOM   2010  C  CD1   . TRP A  1  262 ? 57.219  85.411  39.316  1.00 61.24  ? 262  TRP A CD1   1 
ATOM   2011  C  CD2   . TRP A  1  262 ? 58.880  85.619  40.792  1.00 60.87  ? 262  TRP A CD2   1 
ATOM   2012  N  NE1   . TRP A  1  262 ? 56.971  84.535  40.344  1.00 61.06  ? 262  TRP A NE1   1 
ATOM   2013  C  CE2   . TRP A  1  262 ? 57.981  84.645  41.265  1.00 61.24  ? 262  TRP A CE2   1 
ATOM   2014  C  CE3   . TRP A  1  262 ? 60.008  85.922  41.557  1.00 61.22  ? 262  TRP A CE3   1 
ATOM   2015  C  CZ2   . TRP A  1  262 ? 58.177  83.970  42.470  1.00 61.21  ? 262  TRP A CZ2   1 
ATOM   2016  C  CZ3   . TRP A  1  262 ? 60.200  85.248  42.755  1.00 60.56  ? 262  TRP A CZ3   1 
ATOM   2017  C  CH2   . TRP A  1  262 ? 59.291  84.287  43.196  1.00 60.11  ? 262  TRP A CH2   1 
ATOM   2018  N  N     . ALA A  1  263 ? 59.649  89.677  37.393  1.00 67.42  ? 263  ALA A N     1 
ATOM   2019  C  CA    . ALA A  1  263 ? 60.482  90.513  36.531  1.00 68.17  ? 263  ALA A CA    1 
ATOM   2020  C  C     . ALA A  1  263 ? 61.047  91.826  37.097  1.00 70.00  ? 263  ALA A C     1 
ATOM   2021  O  O     . ALA A  1  263 ? 62.216  92.162  36.863  1.00 71.14  ? 263  ALA A O     1 
ATOM   2022  C  CB    . ALA A  1  263 ? 59.731  90.794  35.243  1.00 66.94  ? 263  ALA A CB    1 
ATOM   2023  N  N     . ASP A  1  264 ? 60.222  92.560  37.838  1.00 71.17  ? 264  ASP A N     1 
ATOM   2024  C  CA    . ASP A  1  264 ? 60.602  93.858  38.406  1.00 71.22  ? 264  ASP A CA    1 
ATOM   2025  C  C     . ASP A  1  264 ? 61.720  93.890  39.452  1.00 71.57  ? 264  ASP A C     1 
ATOM   2026  O  O     . ASP A  1  264 ? 61.624  93.298  40.532  1.00 70.96  ? 264  ASP A O     1 
ATOM   2027  C  CB    . ASP A  1  264 ? 59.362  94.546  38.997  1.00 71.55  ? 264  ASP A CB    1 
ATOM   2028  C  CG    . ASP A  1  264 ? 59.569  96.037  39.247  1.00 70.89  ? 264  ASP A CG    1 
ATOM   2029  O  OD1   . ASP A  1  264 ? 60.583  96.416  39.862  1.00 69.32  ? 264  ASP A OD1   1 
ATOM   2030  O  OD2   . ASP A  1  264 ? 58.700  96.835  38.832  1.00 72.53  ? 264  ASP A OD2   1 
ATOM   2031  N  N     . PRO A  1  265 ? 62.790  94.622  39.138  1.00 72.13  ? 265  PRO A N     1 
ATOM   2032  C  CA    . PRO A  1  265 ? 64.000  94.843  39.942  1.00 73.75  ? 265  PRO A CA    1 
ATOM   2033  C  C     . PRO A  1  265 ? 63.738  95.397  41.354  1.00 75.30  ? 265  PRO A C     1 
ATOM   2034  O  O     . PRO A  1  265 ? 64.530  95.172  42.276  1.00 77.01  ? 265  PRO A O     1 
ATOM   2035  C  CB    . PRO A  1  265 ? 64.785  95.830  39.096  1.00 72.51  ? 265  PRO A CB    1 
ATOM   2036  C  CG    . PRO A  1  265 ? 64.417  95.409  37.715  1.00 72.54  ? 265  PRO A CG    1 
ATOM   2037  C  CD    . PRO A  1  265 ? 62.945  95.196  37.792  1.00 70.95  ? 265  PRO A CD    1 
ATOM   2038  N  N     . ASP A  1  266 ? 62.646  96.140  41.518  1.00 75.26  ? 266  ASP A N     1 
ATOM   2039  C  CA    . ASP A  1  266 ? 62.313  96.701  42.818  1.00 74.22  ? 266  ASP A CA    1 
ATOM   2040  C  C     . ASP A  1  266 ? 62.231  95.576  43.846  1.00 73.87  ? 266  ASP A C     1 
ATOM   2041  O  O     . ASP A  1  266 ? 62.600  95.774  45.005  1.00 72.78  ? 266  ASP A O     1 
ATOM   2042  C  CB    . ASP A  1  266 ? 60.966  97.444  42.767  1.00 75.63  ? 266  ASP A CB    1 
ATOM   2043  C  CG    . ASP A  1  266 ? 61.031  98.741  41.974  1.00 75.47  ? 266  ASP A CG    1 
ATOM   2044  O  OD1   . ASP A  1  266 ? 62.046  99.446  42.104  1.00 76.36  ? 266  ASP A OD1   1 
ATOM   2045  O  OD2   . ASP A  1  266 ? 60.068  99.069  41.243  1.00 74.51  ? 266  ASP A OD2   1 
ATOM   2046  N  N     . ASN A  1  267 ? 61.753  94.402  43.416  1.00 72.60  ? 267  ASN A N     1 
ATOM   2047  C  CA    . ASN A  1  267 ? 61.611  93.258  44.310  1.00 72.33  ? 267  ASN A CA    1 
ATOM   2048  C  C     . ASN A  1  267 ? 62.819  93.124  45.221  1.00 72.14  ? 267  ASN A C     1 
ATOM   2049  O  O     . ASN A  1  267 ? 62.686  92.822  46.414  1.00 72.21  ? 267  ASN A O     1 
ATOM   2050  C  CB    . ASN A  1  267 ? 61.419  91.969  43.514  1.00 73.84  ? 267  ASN A CB    1 
ATOM   2051  C  CG    . ASN A  1  267 ? 59.969  91.740  43.101  1.00 77.01  ? 267  ASN A CG    1 
ATOM   2052  O  OD1   . ASN A  1  267 ? 59.094  91.504  43.942  1.00 79.32  ? 267  ASN A OD1   1 
ATOM   2053  N  ND2   . ASN A  1  267 ? 59.708  91.805  41.799  1.00 76.67  ? 267  ASN A ND2   1 
ATOM   2054  N  N     . VAL A  1  268 ? 64.000  93.360  44.657  1.00 71.59  ? 268  VAL A N     1 
ATOM   2055  C  CA    . VAL A  1  268 ? 65.237  93.274  45.428  1.00 69.72  ? 268  VAL A CA    1 
ATOM   2056  C  C     . VAL A  1  268 ? 65.120  94.230  46.590  1.00 68.50  ? 268  VAL A C     1 
ATOM   2057  O  O     . VAL A  1  268 ? 65.321  93.848  47.739  1.00 68.12  ? 268  VAL A O     1 
ATOM   2058  C  CB    . VAL A  1  268 ? 66.459  93.684  44.600  1.00 69.22  ? 268  VAL A CB    1 
ATOM   2059  C  CG1   . VAL A  1  268 ? 67.711  93.593  45.460  1.00 66.62  ? 268  VAL A CG1   1 
ATOM   2060  C  CG2   . VAL A  1  268 ? 66.566  92.796  43.369  1.00 68.60  ? 268  VAL A CG2   1 
ATOM   2061  N  N     . VAL A  1  269 ? 64.782  95.475  46.268  1.00 67.24  ? 269  VAL A N     1 
ATOM   2062  C  CA    . VAL A  1  269 ? 64.620  96.515  47.270  1.00 66.09  ? 269  VAL A CA    1 
ATOM   2063  C  C     . VAL A  1  269 ? 63.520  96.124  48.253  1.00 67.11  ? 269  VAL A C     1 
ATOM   2064  O  O     . VAL A  1  269 ? 63.653  96.332  49.461  1.00 66.94  ? 269  VAL A O     1 
ATOM   2065  C  CB    . VAL A  1  269 ? 64.243  97.873  46.630  1.00 64.04  ? 269  VAL A CB    1 
ATOM   2066  C  CG1   . VAL A  1  269 ? 64.056  98.907  47.719  1.00 62.33  ? 269  VAL A CG1   1 
ATOM   2067  C  CG2   . VAL A  1  269 ? 65.314  98.323  45.654  1.00 61.00  ? 269  VAL A CG2   1 
ATOM   2068  N  N     . LEU A  1  270 ? 62.431  95.556  47.742  1.00 67.54  ? 270  LEU A N     1 
ATOM   2069  C  CA    . LEU A  1  270 ? 61.341  95.161  48.616  1.00 67.66  ? 270  LEU A CA    1 
ATOM   2070  C  C     . LEU A  1  270 ? 61.866  94.165  49.638  1.00 68.82  ? 270  LEU A C     1 
ATOM   2071  O  O     . LEU A  1  270 ? 61.597  94.288  50.833  1.00 69.87  ? 270  LEU A O     1 
ATOM   2072  C  CB    . LEU A  1  270 ? 60.185  94.569  47.805  1.00 66.26  ? 270  LEU A CB    1 
ATOM   2073  C  CG    . LEU A  1  270 ? 59.378  95.577  46.968  1.00 64.13  ? 270  LEU A CG    1 
ATOM   2074  C  CD1   . LEU A  1  270 ? 58.208  94.871  46.305  1.00 62.75  ? 270  LEU A CD1   1 
ATOM   2075  C  CD2   . LEU A  1  270 ? 58.881  96.702  47.855  1.00 62.53  ? 270  LEU A CD2   1 
ATOM   2076  N  N     . HIS A  1  271 ? 62.643  93.193  49.180  1.00 70.04  ? 271  HIS A N     1 
ATOM   2077  C  CA    . HIS A  1  271 ? 63.207  92.202  50.092  1.00 71.08  ? 271  HIS A CA    1 
ATOM   2078  C  C     . HIS A  1  271 ? 64.138  92.797  51.144  1.00 70.77  ? 271  HIS A C     1 
ATOM   2079  O  O     . HIS A  1  271 ? 64.127  92.383  52.303  1.00 70.42  ? 271  HIS A O     1 
ATOM   2080  C  CB    . HIS A  1  271 ? 63.935  91.133  49.299  1.00 70.99  ? 271  HIS A CB    1 
ATOM   2081  C  CG    . HIS A  1  271 ? 63.010  90.211  48.578  1.00 72.30  ? 271  HIS A CG    1 
ATOM   2082  N  ND1   . HIS A  1  271 ? 62.838  90.247  47.212  1.00 72.90  ? 271  HIS A ND1   1 
ATOM   2083  C  CD2   . HIS A  1  271 ? 62.178  89.247  49.039  1.00 72.52  ? 271  HIS A CD2   1 
ATOM   2084  C  CE1   . HIS A  1  271 ? 61.941  89.342  46.861  1.00 73.14  ? 271  HIS A CE1   1 
ATOM   2085  N  NE2   . HIS A  1  271 ? 61.525  88.722  47.951  1.00 72.43  ? 271  HIS A NE2   1 
ATOM   2086  N  N     . VAL A  1  272 ? 64.951  93.756  50.729  1.00 70.75  ? 272  VAL A N     1 
ATOM   2087  C  CA    . VAL A  1  272 ? 65.858  94.420  51.646  1.00 71.82  ? 272  VAL A CA    1 
ATOM   2088  C  C     . VAL A  1  272 ? 65.004  95.111  52.723  1.00 72.19  ? 272  VAL A C     1 
ATOM   2089  O  O     . VAL A  1  272 ? 65.363  95.131  53.913  1.00 72.14  ? 272  VAL A O     1 
ATOM   2090  C  CB    . VAL A  1  272 ? 66.727  95.474  50.893  1.00 72.29  ? 272  VAL A CB    1 
ATOM   2091  C  CG1   . VAL A  1  272 ? 67.587  96.263  51.868  1.00 72.71  ? 272  VAL A CG1   1 
ATOM   2092  C  CG2   . VAL A  1  272 ? 67.607  94.780  49.881  1.00 71.76  ? 272  VAL A CG2   1 
ATOM   2093  N  N     . ALA A  1  273 ? 63.868  95.665  52.305  1.00 71.03  ? 273  ALA A N     1 
ATOM   2094  C  CA    . ALA A  1  273 ? 62.982  96.342  53.244  1.00 70.25  ? 273  ALA A CA    1 
ATOM   2095  C  C     . ALA A  1  273 ? 62.368  95.328  54.199  1.00 69.51  ? 273  ALA A C     1 
ATOM   2096  O  O     . ALA A  1  273 ? 62.440  95.493  55.412  1.00 69.82  ? 273  ALA A O     1 
ATOM   2097  C  CB    . ALA A  1  273 ? 61.895  97.085  52.497  1.00 71.40  ? 273  ALA A CB    1 
ATOM   2098  N  N     . ASN A  1  274 ? 61.764  94.277  53.658  1.00 67.66  ? 274  ASN A N     1 
ATOM   2099  C  CA    . ASN A  1  274 ? 61.178  93.265  54.508  1.00 67.59  ? 274  ASN A CA    1 
ATOM   2100  C  C     . ASN A  1  274 ? 62.255  92.728  55.436  1.00 68.00  ? 274  ASN A C     1 
ATOM   2101  O  O     . ASN A  1  274 ? 61.960  92.163  56.489  1.00 68.93  ? 274  ASN A O     1 
ATOM   2102  C  CB    . ASN A  1  274 ? 60.605  92.129  53.668  1.00 68.16  ? 274  ASN A CB    1 
ATOM   2103  C  CG    . ASN A  1  274 ? 59.133  92.323  53.345  1.00 69.68  ? 274  ASN A CG    1 
ATOM   2104  O  OD1   . ASN A  1  274 ? 58.519  91.488  52.676  1.00 69.45  ? 274  ASN A OD1   1 
ATOM   2105  N  ND2   . ASN A  1  274 ? 58.556  93.424  53.821  1.00 71.31  ? 274  ASN A ND2   1 
ATOM   2106  N  N     . ALA A  1  275 ? 63.510  92.920  55.042  1.00 68.13  ? 275  ALA A N     1 
ATOM   2107  C  CA    . ALA A  1  275 ? 64.654  92.450  55.819  1.00 67.92  ? 275  ALA A CA    1 
ATOM   2108  C  C     . ALA A  1  275 ? 64.871  93.267  57.086  1.00 67.13  ? 275  ALA A C     1 
ATOM   2109  O  O     . ALA A  1  275 ? 65.414  92.761  58.083  1.00 67.64  ? 275  ALA A O     1 
ATOM   2110  C  CB    . ALA A  1  275 ? 65.906  92.486  54.963  1.00 68.89  ? 275  ALA A CB    1 
ATOM   2111  N  N     . ILE A  1  276 ? 64.453  94.530  57.029  1.00 65.05  ? 276  ILE A N     1 
ATOM   2112  C  CA    . ILE A  1  276 ? 64.571  95.449  58.156  1.00 62.34  ? 276  ILE A CA    1 
ATOM   2113  C  C     . ILE A  1  276 ? 63.547  95.082  59.230  1.00 63.99  ? 276  ILE A C     1 
ATOM   2114  O  O     . ILE A  1  276 ? 63.900  94.831  60.378  1.00 65.20  ? 276  ILE A O     1 
ATOM   2115  C  CB    . ILE A  1  276 ? 64.313  96.883  57.717  1.00 57.89  ? 276  ILE A CB    1 
ATOM   2116  C  CG1   . ILE A  1  276 ? 65.040  97.165  56.411  1.00 55.94  ? 276  ILE A CG1   1 
ATOM   2117  C  CG2   . ILE A  1  276 ? 64.794  97.822  58.768  1.00 55.61  ? 276  ILE A CG2   1 
ATOM   2118  C  CD1   . ILE A  1  276 ? 64.860  98.569  55.925  1.00 55.34  ? 276  ILE A CD1   1 
ATOM   2119  N  N     . ILE A  1  277 ? 62.275  95.048  58.842  1.00 65.02  ? 277  ILE A N     1 
ATOM   2120  C  CA    . ILE A  1  277 ? 61.194  94.706  59.756  1.00 64.92  ? 277  ILE A CA    1 
ATOM   2121  C  C     . ILE A  1  277 ? 61.318  93.245  60.176  1.00 66.21  ? 277  ILE A C     1 
ATOM   2122  O  O     . ILE A  1  277 ? 60.879  92.859  61.259  1.00 65.91  ? 277  ILE A O     1 
ATOM   2123  C  CB    . ILE A  1  277 ? 59.839  94.952  59.081  1.00 63.33  ? 277  ILE A CB    1 
ATOM   2124  C  CG1   . ILE A  1  277 ? 59.696  96.451  58.798  1.00 62.64  ? 277  ILE A CG1   1 
ATOM   2125  C  CG2   . ILE A  1  277 ? 58.723  94.431  59.949  1.00 61.42  ? 277  ILE A CG2   1 
ATOM   2126  C  CD1   . ILE A  1  277 ? 58.437  96.841  58.103  1.00 61.45  ? 277  ILE A CD1   1 
ATOM   2127  N  N     . GLY A  1  278 ? 61.921  92.442  59.306  1.00 66.75  ? 278  GLY A N     1 
ATOM   2128  C  CA    . GLY A  1  278 ? 62.125  91.032  59.590  1.00 69.20  ? 278  GLY A CA    1 
ATOM   2129  C  C     . GLY A  1  278 ? 60.914  90.236  60.037  1.00 70.61  ? 278  GLY A C     1 
ATOM   2130  O  O     . GLY A  1  278 ? 59.809  90.413  59.529  1.00 72.12  ? 278  GLY A O     1 
ATOM   2131  N  N     . ARG A  1  279 ? 61.131  89.331  60.982  1.00 71.46  ? 279  ARG A N     1 
ATOM   2132  C  CA    . ARG A  1  279 ? 60.057  88.505  61.503  1.00 71.97  ? 279  ARG A CA    1 
ATOM   2133  C  C     . ARG A  1  279 ? 60.406  88.128  62.929  1.00 71.34  ? 279  ARG A C     1 
ATOM   2134  O  O     . ARG A  1  279 ? 61.559  88.237  63.333  1.00 72.18  ? 279  ARG A O     1 
ATOM   2135  C  CB    . ARG A  1  279 ? 59.870  87.263  60.634  1.00 73.96  ? 279  ARG A CB    1 
ATOM   2136  C  CG    . ARG A  1  279 ? 61.047  86.315  60.578  1.00 77.19  ? 279  ARG A CG    1 
ATOM   2137  C  CD    . ARG A  1  279 ? 60.886  85.375  59.377  1.00 81.96  ? 279  ARG A CD    1 
ATOM   2138  N  NE    . ARG A  1  279 ? 61.648  84.129  59.499  1.00 86.28  ? 279  ARG A NE    1 
ATOM   2139  C  CZ    . ARG A  1  279 ? 61.288  83.086  60.251  1.00 88.15  ? 279  ARG A CZ    1 
ATOM   2140  N  NH1   . ARG A  1  279 ? 60.163  83.121  60.964  1.00 89.18  ? 279  ARG A NH1   1 
ATOM   2141  N  NH2   . ARG A  1  279 ? 62.052  81.998  60.288  1.00 88.29  ? 279  ARG A NH2   1 
ATOM   2142  N  N     . TYR A  1  280 ? 59.413  87.693  63.693  1.00 70.12  ? 280  TYR A N     1 
ATOM   2143  C  CA    . TYR A  1  280 ? 59.624  87.348  65.090  1.00 67.92  ? 280  TYR A CA    1 
ATOM   2144  C  C     . TYR A  1  280 ? 58.754  86.191  65.550  1.00 66.66  ? 280  TYR A C     1 
ATOM   2145  O  O     . TYR A  1  280 ? 57.825  85.770  64.867  1.00 65.61  ? 280  TYR A O     1 
ATOM   2146  C  CB    . TYR A  1  280 ? 59.345  88.577  65.961  1.00 68.43  ? 280  TYR A CB    1 
ATOM   2147  C  CG    . TYR A  1  280 ? 59.274  88.289  67.444  1.00 69.39  ? 280  TYR A CG    1 
ATOM   2148  C  CD1   . TYR A  1  280 ? 60.423  88.221  68.220  1.00 69.35  ? 280  TYR A CD1   1 
ATOM   2149  C  CD2   . TYR A  1  280 ? 58.051  88.032  68.066  1.00 69.20  ? 280  TYR A CD2   1 
ATOM   2150  C  CE1   . TYR A  1  280 ? 60.355  87.899  69.578  1.00 68.94  ? 280  TYR A CE1   1 
ATOM   2151  C  CE2   . TYR A  1  280 ? 57.981  87.707  69.418  1.00 68.38  ? 280  TYR A CE2   1 
ATOM   2152  C  CZ    . TYR A  1  280 ? 59.134  87.641  70.163  1.00 67.90  ? 280  TYR A CZ    1 
ATOM   2153  O  OH    . TYR A  1  280 ? 59.072  87.291  71.486  1.00 67.48  ? 280  TYR A OH    1 
ATOM   2154  N  N     . ASP A  1  281 ? 59.068  85.685  66.730  1.00 66.56  ? 281  ASP A N     1 
ATOM   2155  C  CA    . ASP A  1  281 ? 58.329  84.587  67.300  1.00 67.65  ? 281  ASP A CA    1 
ATOM   2156  C  C     . ASP A  1  281 ? 58.799  84.375  68.736  1.00 68.15  ? 281  ASP A C     1 
ATOM   2157  O  O     . ASP A  1  281 ? 59.966  84.532  69.039  1.00 68.80  ? 281  ASP A O     1 
ATOM   2158  C  CB    . ASP A  1  281 ? 58.539  83.347  66.431  1.00 69.33  ? 281  ASP A CB    1 
ATOM   2159  C  CG    . ASP A  1  281 ? 58.814  82.112  67.234  1.00 71.71  ? 281  ASP A CG    1 
ATOM   2160  O  OD1   . ASP A  1  281 ? 57.914  81.690  67.992  1.00 74.87  ? 281  ASP A OD1   1 
ATOM   2161  O  OD2   . ASP A  1  281 ? 59.929  81.565  67.106  1.00 71.98  ? 281  ASP A OD2   1 
ATOM   2162  N  N     . ARG A  1  282 ? 57.859  84.037  69.607  1.00 69.18  ? 282  ARG A N     1 
ATOM   2163  C  CA    . ARG A  1  282 ? 58.087  83.800  71.029  1.00 69.99  ? 282  ARG A CA    1 
ATOM   2164  C  C     . ARG A  1  282 ? 59.280  82.944  71.459  1.00 69.97  ? 282  ARG A C     1 
ATOM   2165  O  O     . ARG A  1  282 ? 59.560  82.848  72.659  1.00 69.65  ? 282  ARG A O     1 
ATOM   2166  C  CB    . ARG A  1  282 ? 56.813  83.204  71.637  1.00 72.92  ? 282  ARG A CB    1 
ATOM   2167  C  CG    . ARG A  1  282 ? 55.665  84.199  71.758  1.00 77.57  ? 282  ARG A CG    1 
ATOM   2168  C  CD    . ARG A  1  282 ? 55.625  84.859  73.129  1.00 79.04  ? 282  ARG A CD    1 
ATOM   2169  N  NE    . ARG A  1  282 ? 55.003  83.978  74.116  1.00 81.26  ? 282  ARG A NE    1 
ATOM   2170  C  CZ    . ARG A  1  282 ? 55.065  84.157  75.436  1.00 83.48  ? 282  ARG A CZ    1 
ATOM   2171  N  NH1   . ARG A  1  282 ? 55.732  85.192  75.950  1.00 83.72  ? 282  ARG A NH1   1 
ATOM   2172  N  NH2   . ARG A  1  282 ? 54.449  83.300  76.249  1.00 83.80  ? 282  ARG A NH2   1 
ATOM   2173  N  N     . THR A  1  283 ? 59.972  82.299  70.520  1.00 69.20  ? 283  THR A N     1 
ATOM   2174  C  CA    . THR A  1  283 ? 61.128  81.487  70.897  1.00 67.52  ? 283  THR A CA    1 
ATOM   2175  C  C     . THR A  1  283 ? 62.425  82.037  70.307  1.00 68.10  ? 283  THR A C     1 
ATOM   2176  O  O     . THR A  1  283 ? 63.406  81.309  70.174  1.00 69.82  ? 283  THR A O     1 
ATOM   2177  C  CB    . THR A  1  283 ? 60.991  80.014  70.450  1.00 65.39  ? 283  THR A CB    1 
ATOM   2178  O  OG1   . THR A  1  283 ? 61.048  79.943  69.025  1.00 66.72  ? 283  THR A OG1   1 
ATOM   2179  C  CG2   . THR A  1  283 ? 59.701  79.420  70.926  1.00 61.15  ? 283  THR A CG2   1 
ATOM   2180  N  N     . PHE A  1  284 ? 62.424  83.309  69.932  1.00 67.42  ? 284  PHE A N     1 
ATOM   2181  C  CA    . PHE A  1  284 ? 63.619  83.934  69.385  1.00 67.52  ? 284  PHE A CA    1 
ATOM   2182  C  C     . PHE A  1  284 ? 64.467  84.378  70.556  1.00 68.39  ? 284  PHE A C     1 
ATOM   2183  O  O     . PHE A  1  284 ? 64.142  85.368  71.193  1.00 71.21  ? 284  PHE A O     1 
ATOM   2184  C  CB    . PHE A  1  284 ? 63.256  85.156  68.547  1.00 66.03  ? 284  PHE A CB    1 
ATOM   2185  C  CG    . PHE A  1  284 ? 62.837  84.830  67.152  1.00 65.40  ? 284  PHE A CG    1 
ATOM   2186  C  CD1   . PHE A  1  284 ? 61.973  83.772  66.901  1.00 63.79  ? 284  PHE A CD1   1 
ATOM   2187  C  CD2   . PHE A  1  284 ? 63.284  85.608  66.080  1.00 65.02  ? 284  PHE A CD2   1 
ATOM   2188  C  CE1   . PHE A  1  284 ? 61.555  83.494  65.595  1.00 65.20  ? 284  PHE A CE1   1 
ATOM   2189  C  CE2   . PHE A  1  284 ? 62.873  85.340  64.773  1.00 63.91  ? 284  PHE A CE2   1 
ATOM   2190  C  CZ    . PHE A  1  284 ? 62.006  84.282  64.526  1.00 63.75  ? 284  PHE A CZ    1 
ATOM   2191  N  N     . GLY A  1  285 ? 65.553  83.658  70.832  1.00 68.19  ? 285  GLY A N     1 
ATOM   2192  C  CA    . GLY A  1  285 ? 66.422  84.003  71.949  1.00 66.12  ? 285  GLY A CA    1 
ATOM   2193  C  C     . GLY A  1  285 ? 66.755  85.480  72.054  1.00 64.49  ? 285  GLY A C     1 
ATOM   2194  O  O     . GLY A  1  285 ? 66.809  86.042  73.143  1.00 62.20  ? 285  GLY A O     1 
ATOM   2195  N  N     . GLY A  1  286 ? 66.974  86.108  70.911  1.00 64.99  ? 286  GLY A N     1 
ATOM   2196  C  CA    . GLY A  1  286 ? 67.313  87.515  70.896  1.00 68.15  ? 286  GLY A CA    1 
ATOM   2197  C  C     . GLY A  1  286 ? 66.666  88.307  72.006  1.00 69.96  ? 286  GLY A C     1 
ATOM   2198  O  O     . GLY A  1  286 ? 67.359  88.899  72.830  1.00 72.13  ? 286  GLY A O     1 
ATOM   2199  N  N     . GLY A  1  287 ? 65.337  88.318  72.032  1.00 71.26  ? 287  GLY A N     1 
ATOM   2200  C  CA    . GLY A  1  287 ? 64.616  89.053  73.057  1.00 72.34  ? 287  GLY A CA    1 
ATOM   2201  C  C     . GLY A  1  287 ? 64.563  90.553  72.818  1.00 73.82  ? 287  GLY A C     1 
ATOM   2202  O  O     . GLY A  1  287 ? 64.694  91.038  71.694  1.00 73.54  ? 287  GLY A O     1 
ATOM   2203  N  N     . LYS A  1  288 ? 64.370  91.288  73.902  1.00 75.35  ? 288  LYS A N     1 
ATOM   2204  C  CA    . LYS A  1  288 ? 64.287  92.745  73.873  1.00 77.27  ? 288  LYS A CA    1 
ATOM   2205  C  C     . LYS A  1  288 ? 65.379  93.435  73.064  1.00 77.32  ? 288  LYS A C     1 
ATOM   2206  O  O     . LYS A  1  288 ? 65.260  94.612  72.717  1.00 77.84  ? 288  LYS A O     1 
ATOM   2207  C  CB    . LYS A  1  288 ? 64.337  93.275  75.305  1.00 79.13  ? 288  LYS A CB    1 
ATOM   2208  C  CG    . LYS A  1  288 ? 65.438  92.610  76.119  1.00 83.51  ? 288  LYS A CG    1 
ATOM   2209  C  CD    . LYS A  1  288 ? 65.655  93.221  77.501  1.00 87.02  ? 288  LYS A CD    1 
ATOM   2210  C  CE    . LYS A  1  288 ? 66.804  92.485  78.206  1.00 89.44  ? 288  LYS A CE    1 
ATOM   2211  N  NZ    . LYS A  1  288 ? 67.237  93.094  79.499  1.00 92.54  ? 288  LYS A NZ    1 
ATOM   2212  N  N     . HIS A  1  289 ? 66.450  92.719  72.761  1.00 77.42  ? 289  HIS A N     1 
ATOM   2213  C  CA    . HIS A  1  289 ? 67.541  93.342  72.031  1.00 78.09  ? 289  HIS A CA    1 
ATOM   2214  C  C     . HIS A  1  289 ? 67.494  93.120  70.523  1.00 77.36  ? 289  HIS A C     1 
ATOM   2215  O  O     . HIS A  1  289 ? 68.301  93.686  69.782  1.00 77.37  ? 289  HIS A O     1 
ATOM   2216  C  CB    . HIS A  1  289 ? 68.873  92.871  72.625  1.00 79.99  ? 289  HIS A CB    1 
ATOM   2217  C  CG    . HIS A  1  289 ? 68.990  93.121  74.102  1.00 82.78  ? 289  HIS A CG    1 
ATOM   2218  N  ND1   . HIS A  1  289 ? 69.081  94.389  74.643  1.00 83.12  ? 289  HIS A ND1   1 
ATOM   2219  C  CD2   . HIS A  1  289 ? 68.985  92.266  75.155  1.00 83.44  ? 289  HIS A CD2   1 
ATOM   2220  C  CE1   . HIS A  1  289 ? 69.125  94.305  75.961  1.00 82.81  ? 289  HIS A CE1   1 
ATOM   2221  N  NE2   . HIS A  1  289 ? 69.068  93.027  76.298  1.00 83.91  ? 289  HIS A NE2   1 
ATOM   2222  N  N     . LEU A  1  290 ? 66.542  92.304  70.071  1.00 75.25  ? 290  LEU A N     1 
ATOM   2223  C  CA    . LEU A  1  290 ? 66.391  92.034  68.651  1.00 72.36  ? 290  LEU A CA    1 
ATOM   2224  C  C     . LEU A  1  290 ? 66.468  93.349  67.899  1.00 72.47  ? 290  LEU A C     1 
ATOM   2225  O  O     . LEU A  1  290 ? 66.020  94.383  68.386  1.00 72.07  ? 290  LEU A O     1 
ATOM   2226  C  CB    . LEU A  1  290 ? 65.065  91.337  68.397  1.00 69.55  ? 290  LEU A CB    1 
ATOM   2227  C  CG    . LEU A  1  290 ? 65.071  89.888  68.882  1.00 68.25  ? 290  LEU A CG    1 
ATOM   2228  C  CD1   . LEU A  1  290 ? 63.668  89.342  68.913  1.00 68.87  ? 290  LEU A CD1   1 
ATOM   2229  C  CD2   . LEU A  1  290 ? 65.929  89.047  67.962  1.00 67.65  ? 290  LEU A CD2   1 
ATOM   2230  N  N     . SER A  1  291 ? 67.055  93.309  66.714  1.00 73.61  ? 291  SER A N     1 
ATOM   2231  C  CA    . SER A  1  291 ? 67.228  94.509  65.909  1.00 74.90  ? 291  SER A CA    1 
ATOM   2232  C  C     . SER A  1  291 ? 65.947  95.103  65.328  1.00 76.97  ? 291  SER A C     1 
ATOM   2233  O  O     . SER A  1  291 ? 65.805  96.326  65.261  1.00 75.94  ? 291  SER A O     1 
ATOM   2234  C  CB    . SER A  1  291 ? 68.222  94.224  64.786  1.00 74.10  ? 291  SER A CB    1 
ATOM   2235  O  OG    . SER A  1  291 ? 69.468  93.805  65.315  1.00 73.28  ? 291  SER A OG    1 
ATOM   2236  N  N     . SER A  1  292 ? 65.016  94.248  64.902  1.00 79.59  ? 292  SER A N     1 
ATOM   2237  C  CA    . SER A  1  292 ? 63.759  94.740  64.329  1.00 80.86  ? 292  SER A CA    1 
ATOM   2238  C  C     . SER A  1  292 ? 62.888  95.426  65.373  1.00 80.20  ? 292  SER A C     1 
ATOM   2239  O  O     . SER A  1  292 ? 62.393  94.784  66.308  1.00 79.70  ? 292  SER A O     1 
ATOM   2240  C  CB    . SER A  1  292 ? 62.951  93.602  63.693  1.00 82.91  ? 292  SER A CB    1 
ATOM   2241  O  OG    . SER A  1  292 ? 61.743  94.100  63.119  1.00 84.71  ? 292  SER A OG    1 
ATOM   2242  N  N     . ARG A  1  293 ? 62.696  96.729  65.195  1.00 78.94  ? 293  ARG A N     1 
ATOM   2243  C  CA    . ARG A  1  293 ? 61.881  97.522  66.113  1.00 77.95  ? 293  ARG A CA    1 
ATOM   2244  C  C     . ARG A  1  293 ? 60.550  96.836  66.426  1.00 75.74  ? 293  ARG A C     1 
ATOM   2245  O  O     . ARG A  1  293 ? 60.172  96.709  67.592  1.00 74.17  ? 293  ARG A O     1 
ATOM   2246  C  CB    . ARG A  1  293 ? 61.639  98.905  65.509  1.00 79.44  ? 293  ARG A CB    1 
ATOM   2247  C  CG    . ARG A  1  293 ? 62.927  99.683  65.224  1.00 82.69  ? 293  ARG A CG    1 
ATOM   2248  C  CD    . ARG A  1  293 ? 62.741  100.750 64.137  1.00 85.12  ? 293  ARG A CD    1 
ATOM   2249  N  NE    . ARG A  1  293 ? 61.546  101.552 64.380  1.00 87.37  ? 293  ARG A NE    1 
ATOM   2250  C  CZ    . ARG A  1  293 ? 61.396  102.367 65.419  1.00 88.38  ? 293  ARG A CZ    1 
ATOM   2251  N  NH1   . ARG A  1  293 ? 62.381  102.496 66.301  1.00 89.31  ? 293  ARG A NH1   1 
ATOM   2252  N  NH2   . ARG A  1  293 ? 60.247  103.014 65.602  1.00 87.18  ? 293  ARG A NH2   1 
ATOM   2253  N  N     . LEU A  1  294 ? 59.852  96.388  65.381  1.00 73.74  ? 294  LEU A N     1 
ATOM   2254  C  CA    . LEU A  1  294 ? 58.573  95.706  65.552  1.00 71.53  ? 294  LEU A CA    1 
ATOM   2255  C  C     . LEU A  1  294 ? 58.772  94.519  66.476  1.00 70.36  ? 294  LEU A C     1 
ATOM   2256  O  O     . LEU A  1  294 ? 58.034  94.343  67.446  1.00 69.29  ? 294  LEU A O     1 
ATOM   2257  C  CB    . LEU A  1  294 ? 58.024  95.220  64.207  1.00 71.67  ? 294  LEU A CB    1 
ATOM   2258  C  CG    . LEU A  1  294 ? 56.629  94.576  64.264  1.00 71.44  ? 294  LEU A CG    1 
ATOM   2259  C  CD1   . LEU A  1  294 ? 55.620  95.589  64.754  1.00 70.92  ? 294  LEU A CD1   1 
ATOM   2260  C  CD2   . LEU A  1  294 ? 56.211  94.068  62.900  1.00 69.62  ? 294  LEU A CD2   1 
ATOM   2261  N  N     . ALA A  1  295 ? 59.776  93.703  66.167  1.00 69.11  ? 295  ALA A N     1 
ATOM   2262  C  CA    . ALA A  1  295 ? 60.085  92.543  66.989  1.00 67.40  ? 295  ALA A CA    1 
ATOM   2263  C  C     . ALA A  1  295 ? 60.314  93.050  68.410  1.00 67.09  ? 295  ALA A C     1 
ATOM   2264  O  O     . ALA A  1  295 ? 59.672  92.593  69.358  1.00 67.11  ? 295  ALA A O     1 
ATOM   2265  C  CB    . ALA A  1  295 ? 61.323  91.857  66.472  1.00 66.02  ? 295  ALA A CB    1 
ATOM   2266  N  N     . ALA A  1  296 ? 61.215  94.022  68.540  1.00 65.93  ? 296  ALA A N     1 
ATOM   2267  C  CA    . ALA A  1  296 ? 61.547  94.610  69.834  1.00 65.02  ? 296  ALA A CA    1 
ATOM   2268  C  C     . ALA A  1  296 ? 60.295  95.094  70.565  1.00 64.59  ? 296  ALA A C     1 
ATOM   2269  O  O     . ALA A  1  296 ? 60.100  94.818  71.761  1.00 64.11  ? 296  ALA A O     1 
ATOM   2270  C  CB    . ALA A  1  296 ? 62.512  95.758  69.635  1.00 63.20  ? 296  ALA A CB    1 
ATOM   2271  N  N     . LEU A  1  297 ? 59.457  95.827  69.839  1.00 62.66  ? 297  LEU A N     1 
ATOM   2272  C  CA    . LEU A  1  297 ? 58.223  96.338  70.400  1.00 60.34  ? 297  LEU A CA    1 
ATOM   2273  C  C     . LEU A  1  297 ? 57.360  95.161  70.780  1.00 59.88  ? 297  LEU A C     1 
ATOM   2274  O  O     . LEU A  1  297 ? 56.781  95.122  71.856  1.00 60.09  ? 297  LEU A O     1 
ATOM   2275  C  CB    . LEU A  1  297 ? 57.489  97.184  69.370  1.00 59.41  ? 297  LEU A CB    1 
ATOM   2276  C  CG    . LEU A  1  297 ? 58.097  98.555  69.122  1.00 58.95  ? 297  LEU A CG    1 
ATOM   2277  C  CD1   . LEU A  1  297 ? 57.392  99.283  67.969  1.00 56.62  ? 297  LEU A CD1   1 
ATOM   2278  C  CD2   . LEU A  1  297 ? 57.993  99.324  70.427  1.00 58.30  ? 297  LEU A CD2   1 
ATOM   2279  N  N     . ALA A  1  298 ? 57.277  94.193  69.881  1.00 59.27  ? 298  ALA A N     1 
ATOM   2280  C  CA    . ALA A  1  298 ? 56.466  93.029  70.140  1.00 60.25  ? 298  ALA A CA    1 
ATOM   2281  C  C     . ALA A  1  298 ? 56.869  92.427  71.472  1.00 61.96  ? 298  ALA A C     1 
ATOM   2282  O  O     . ALA A  1  298 ? 56.014  92.084  72.295  1.00 62.54  ? 298  ALA A O     1 
ATOM   2283  C  CB    . ALA A  1  298 ? 56.642  92.023  69.032  1.00 59.59  ? 298  ALA A CB    1 
ATOM   2284  N  N     . VAL A  1  299 ? 58.178  92.320  71.690  1.00 63.44  ? 299  VAL A N     1 
ATOM   2285  C  CA    . VAL A  1  299 ? 58.716  91.737  72.921  1.00 64.53  ? 299  VAL A CA    1 
ATOM   2286  C  C     . VAL A  1  299 ? 58.423  92.582  74.167  1.00 65.65  ? 299  VAL A C     1 
ATOM   2287  O  O     . VAL A  1  299 ? 58.014  92.066  75.212  1.00 64.55  ? 299  VAL A O     1 
ATOM   2288  C  CB    . VAL A  1  299 ? 60.238  91.529  72.798  1.00 63.19  ? 299  VAL A CB    1 
ATOM   2289  C  CG1   . VAL A  1  299 ? 60.807  91.091  74.122  1.00 61.49  ? 299  VAL A CG1   1 
ATOM   2290  C  CG2   . VAL A  1  299 ? 60.529  90.489  71.730  1.00 62.66  ? 299  VAL A CG2   1 
ATOM   2291  N  N     . GLU A  1  300 ? 58.628  93.887  74.040  1.00 67.26  ? 300  GLU A N     1 
ATOM   2292  C  CA    . GLU A  1  300 ? 58.406  94.808  75.141  1.00 68.96  ? 300  GLU A CA    1 
ATOM   2293  C  C     . GLU A  1  300 ? 56.953  94.923  75.545  1.00 67.94  ? 300  GLU A C     1 
ATOM   2294  O  O     . GLU A  1  300 ? 56.641  95.237  76.683  1.00 68.25  ? 300  GLU A O     1 
ATOM   2295  C  CB    . GLU A  1  300 ? 58.916  96.197  74.771  1.00 71.32  ? 300  GLU A CB    1 
ATOM   2296  C  CG    . GLU A  1  300 ? 58.637  97.246  75.835  1.00 77.29  ? 300  GLU A CG    1 
ATOM   2297  C  CD    . GLU A  1  300 ? 59.114  98.637  75.435  1.00 82.30  ? 300  GLU A CD    1 
ATOM   2298  O  OE1   . GLU A  1  300 ? 58.530  99.218  74.487  1.00 84.98  ? 300  GLU A OE1   1 
ATOM   2299  O  OE2   . GLU A  1  300 ? 60.074  99.151  76.066  1.00 85.13  ? 300  GLU A OE2   1 
ATOM   2300  N  N     . HIS A  1  301 ? 56.053  94.673  74.614  1.00 67.81  ? 301  HIS A N     1 
ATOM   2301  C  CA    . HIS A  1  301 ? 54.652  94.816  74.932  1.00 66.79  ? 301  HIS A CA    1 
ATOM   2302  C  C     . HIS A  1  301 ? 53.837  93.557  74.802  1.00 67.24  ? 301  HIS A C     1 
ATOM   2303  O  O     . HIS A  1  301 ? 52.621  93.616  74.884  1.00 68.41  ? 301  HIS A O     1 
ATOM   2304  C  CB    . HIS A  1  301 ? 54.047  95.912  74.062  1.00 64.33  ? 301  HIS A CB    1 
ATOM   2305  C  CG    . HIS A  1  301 ? 54.755  97.222  74.180  1.00 62.74  ? 301  HIS A CG    1 
ATOM   2306  N  ND1   . HIS A  1  301 ? 54.878  97.896  75.376  1.00 62.60  ? 301  HIS A ND1   1 
ATOM   2307  C  CD2   . HIS A  1  301 ? 55.381  97.985  73.252  1.00 62.66  ? 301  HIS A CD2   1 
ATOM   2308  C  CE1   . HIS A  1  301 ? 55.548  99.019  75.179  1.00 61.81  ? 301  HIS A CE1   1 
ATOM   2309  N  NE2   . HIS A  1  301 ? 55.865  99.097  73.899  1.00 61.34  ? 301  HIS A NE2   1 
ATOM   2310  N  N     . LYS A  1  302 ? 54.485  92.414  74.613  1.00 68.50  ? 302  LYS A N     1 
ATOM   2311  C  CA    . LYS A  1  302 ? 53.733  91.162  74.477  1.00 69.37  ? 302  LYS A CA    1 
ATOM   2312  C  C     . LYS A  1  302 ? 52.622  91.401  73.450  1.00 67.56  ? 302  LYS A C     1 
ATOM   2313  O  O     . LYS A  1  302 ? 51.432  91.202  73.720  1.00 66.33  ? 302  LYS A O     1 
ATOM   2314  C  CB    . LYS A  1  302 ? 53.133  90.762  75.832  1.00 71.81  ? 302  LYS A CB    1 
ATOM   2315  C  CG    . LYS A  1  302 ? 54.107  90.054  76.778  1.00 75.93  ? 302  LYS A CG    1 
ATOM   2316  C  CD    . LYS A  1  302 ? 55.422  90.820  76.950  1.00 81.32  ? 302  LYS A CD    1 
ATOM   2317  C  CE    . LYS A  1  302 ? 56.426  90.064  77.836  1.00 82.68  ? 302  LYS A CE    1 
ATOM   2318  N  NZ    . LYS A  1  302 ? 55.979  89.993  79.263  1.00 85.20  ? 302  LYS A NZ    1 
ATOM   2319  N  N     . LEU A  1  303 ? 53.045  91.833  72.267  1.00 65.14  ? 303  LEU A N     1 
ATOM   2320  C  CA    . LEU A  1  303 ? 52.139  92.158  71.186  1.00 62.24  ? 303  LEU A CA    1 
ATOM   2321  C  C     . LEU A  1  303 ? 51.718  91.003  70.304  1.00 62.00  ? 303  LEU A C     1 
ATOM   2322  O  O     . LEU A  1  303 ? 50.672  91.083  69.667  1.00 63.07  ? 303  LEU A O     1 
ATOM   2323  C  CB    . LEU A  1  303 ? 52.754  93.252  70.306  1.00 59.94  ? 303  LEU A CB    1 
ATOM   2324  C  CG    . LEU A  1  303 ? 53.037  94.608  70.964  1.00 59.33  ? 303  LEU A CG    1 
ATOM   2325  C  CD1   . LEU A  1  303 ? 53.512  95.627  69.926  1.00 57.89  ? 303  LEU A CD1   1 
ATOM   2326  C  CD2   . LEU A  1  303 ? 51.776  95.103  71.627  1.00 57.29  ? 303  LEU A CD2   1 
ATOM   2327  N  N     . CYS A  1  304 ? 52.508  89.935  70.241  1.00 60.91  ? 304  CYS A N     1 
ATOM   2328  C  CA    . CYS A  1  304 ? 52.143  88.819  69.366  1.00 59.53  ? 304  CYS A CA    1 
ATOM   2329  C  C     . CYS A  1  304 ? 52.972  87.580  69.589  1.00 59.36  ? 304  CYS A C     1 
ATOM   2330  O  O     . CYS A  1  304 ? 54.114  87.660  70.002  1.00 61.18  ? 304  CYS A O     1 
ATOM   2331  C  CB    . CYS A  1  304 ? 52.289  89.228  67.901  1.00 58.72  ? 304  CYS A CB    1 
ATOM   2332  S  SG    . CYS A  1  304 ? 53.979  89.670  67.419  1.00 57.59  ? 304  CYS A SG    1 
ATOM   2333  N  N     . HIS A  1  305 ? 52.383  86.429  69.312  1.00 58.77  ? 305  HIS A N     1 
ATOM   2334  C  CA    . HIS A  1  305 ? 53.075  85.165  69.462  1.00 58.53  ? 305  HIS A CA    1 
ATOM   2335  C  C     . HIS A  1  305 ? 54.059  85.043  68.313  1.00 59.50  ? 305  HIS A C     1 
ATOM   2336  O  O     . HIS A  1  305 ? 54.891  84.130  68.296  1.00 60.59  ? 305  HIS A O     1 
ATOM   2337  C  CB    . HIS A  1  305 ? 52.085  84.021  69.360  1.00 58.84  ? 305  HIS A CB    1 
ATOM   2338  C  CG    . HIS A  1  305 ? 51.060  84.009  70.443  1.00 58.35  ? 305  HIS A CG    1 
ATOM   2339  N  ND1   . HIS A  1  305 ? 51.212  83.283  71.601  1.00 60.22  ? 305  HIS A ND1   1 
ATOM   2340  C  CD2   . HIS A  1  305 ? 49.867  84.632  70.545  1.00 59.99  ? 305  HIS A CD2   1 
ATOM   2341  C  CE1   . HIS A  1  305 ? 50.156  83.459  72.372  1.00 58.88  ? 305  HIS A CE1   1 
ATOM   2342  N  NE2   . HIS A  1  305 ? 49.324  84.274  71.755  1.00 59.05  ? 305  HIS A NE2   1 
ATOM   2343  N  N     . SER A  1  306 ? 53.934  85.948  67.343  1.00 59.42  ? 306  SER A N     1 
ATOM   2344  C  CA    . SER A  1  306 ? 54.792  85.953  66.161  1.00 59.52  ? 306  SER A CA    1 
ATOM   2345  C  C     . SER A  1  306 ? 54.250  86.857  65.070  1.00 59.31  ? 306  SER A C     1 
ATOM   2346  O  O     . SER A  1  306 ? 53.061  87.164  65.026  1.00 59.80  ? 306  SER A O     1 
ATOM   2347  C  CB    . SER A  1  306 ? 54.916  84.545  65.575  1.00 60.10  ? 306  SER A CB    1 
ATOM   2348  O  OG    . SER A  1  306 ? 53.673  84.118  65.039  1.00 59.02  ? 306  SER A OG    1 
ATOM   2349  N  N     . PHE A  1  307 ? 55.143  87.261  64.179  1.00 58.73  ? 307  PHE A N     1 
ATOM   2350  C  CA    . PHE A  1  307 ? 54.796  88.105  63.057  1.00 58.81  ? 307  PHE A CA    1 
ATOM   2351  C  C     . PHE A  1  307 ? 55.827  87.819  61.975  1.00 60.33  ? 307  PHE A C     1 
ATOM   2352  O  O     . PHE A  1  307 ? 56.895  87.305  62.265  1.00 62.79  ? 307  PHE A O     1 
ATOM   2353  C  CB    . PHE A  1  307 ? 54.816  89.575  63.477  1.00 57.46  ? 307  PHE A CB    1 
ATOM   2354  C  CG    . PHE A  1  307 ? 56.162  90.243  63.354  1.00 56.53  ? 307  PHE A CG    1 
ATOM   2355  C  CD1   . PHE A  1  307 ? 56.710  90.530  62.099  1.00 54.57  ? 307  PHE A CD1   1 
ATOM   2356  C  CD2   . PHE A  1  307 ? 56.840  90.662  64.488  1.00 55.50  ? 307  PHE A CD2   1 
ATOM   2357  C  CE1   . PHE A  1  307 ? 57.894  91.225  61.977  1.00 52.97  ? 307  PHE A CE1   1 
ATOM   2358  C  CE2   . PHE A  1  307 ? 58.029  91.362  64.374  1.00 55.54  ? 307  PHE A CE2   1 
ATOM   2359  C  CZ    . PHE A  1  307 ? 58.555  91.646  63.109  1.00 55.05  ? 307  PHE A CZ    1 
ATOM   2360  N  N     . GLN A  1  308 ? 55.525  88.150  60.730  1.00 61.44  ? 308  GLN A N     1 
ATOM   2361  C  CA    . GLN A  1  308 ? 56.463  87.881  59.657  1.00 61.65  ? 308  GLN A CA    1 
ATOM   2362  C  C     . GLN A  1  308 ? 56.103  88.711  58.462  1.00 61.70  ? 308  GLN A C     1 
ATOM   2363  O  O     . GLN A  1  308 ? 54.923  88.845  58.151  1.00 62.89  ? 308  GLN A O     1 
ATOM   2364  C  CB    . GLN A  1  308 ? 56.366  86.428  59.247  1.00 63.17  ? 308  GLN A CB    1 
ATOM   2365  C  CG    . GLN A  1  308 ? 54.971  86.051  58.770  1.00 65.59  ? 308  GLN A CG    1 
ATOM   2366  C  CD    . GLN A  1  308 ? 54.923  84.717  58.025  1.00 68.45  ? 308  GLN A CD    1 
ATOM   2367  O  OE1   . GLN A  1  308 ? 53.868  84.098  57.915  1.00 69.36  ? 308  GLN A OE1   1 
ATOM   2368  N  NE2   . GLN A  1  308 ? 56.062  84.280  57.502  1.00 70.65  ? 308  GLN A NE2   1 
ATOM   2369  N  N     . THR A  1  309 ? 57.108  89.263  57.792  1.00 60.80  ? 309  THR A N     1 
ATOM   2370  C  CA    . THR A  1  309 ? 56.844  90.053  56.598  1.00 61.17  ? 309  THR A CA    1 
ATOM   2371  C  C     . THR A  1  309 ? 56.938  89.068  55.446  1.00 61.23  ? 309  THR A C     1 
ATOM   2372  O  O     . THR A  1  309 ? 57.413  87.946  55.633  1.00 61.67  ? 309  THR A O     1 
ATOM   2373  C  CB    . THR A  1  309 ? 57.888  91.160  56.370  1.00 60.98  ? 309  THR A CB    1 
ATOM   2374  O  OG1   . THR A  1  309 ? 59.185  90.567  56.255  1.00 62.45  ? 309  THR A OG1   1 
ATOM   2375  C  CG2   . THR A  1  309 ? 57.880  92.156  57.513  1.00 60.88  ? 309  THR A CG2   1 
ATOM   2376  N  N     . PHE A  1  310 ? 56.477  89.480  54.269  1.00 60.83  ? 310  PHE A N     1 
ATOM   2377  C  CA    . PHE A  1  310 ? 56.530  88.629  53.096  1.00 61.06  ? 310  PHE A CA    1 
ATOM   2378  C  C     . PHE A  1  310 ? 56.347  89.419  51.817  1.00 61.79  ? 310  PHE A C     1 
ATOM   2379  O  O     . PHE A  1  310 ? 55.694  90.463  51.821  1.00 62.99  ? 310  PHE A O     1 
ATOM   2380  C  CB    . PHE A  1  310 ? 55.472  87.509  53.172  1.00 62.46  ? 310  PHE A CB    1 
ATOM   2381  C  CG    . PHE A  1  310 ? 54.041  87.993  53.283  1.00 64.28  ? 310  PHE A CG    1 
ATOM   2382  C  CD1   . PHE A  1  310 ? 53.424  88.113  54.526  1.00 63.94  ? 310  PHE A CD1   1 
ATOM   2383  C  CD2   . PHE A  1  310 ? 53.314  88.328  52.143  1.00 65.22  ? 310  PHE A CD2   1 
ATOM   2384  C  CE1   . PHE A  1  310 ? 52.113  88.560  54.629  1.00 64.27  ? 310  PHE A CE1   1 
ATOM   2385  C  CE2   . PHE A  1  310 ? 52.004  88.777  52.239  1.00 65.22  ? 310  PHE A CE2   1 
ATOM   2386  C  CZ    . PHE A  1  310 ? 51.405  88.893  53.487  1.00 65.05  ? 310  PHE A CZ    1 
ATOM   2387  N  N     . ASN A  1  311 ? 56.949  88.922  50.732  1.00 62.28  ? 311  ASN A N     1 
ATOM   2388  C  CA    . ASN A  1  311 ? 56.851  89.531  49.397  1.00 61.08  ? 311  ASN A CA    1 
ATOM   2389  C  C     . ASN A  1  311 ? 56.598  88.427  48.373  1.00 60.85  ? 311  ASN A C     1 
ATOM   2390  O  O     . ASN A  1  311 ? 57.467  88.096  47.572  1.00 61.77  ? 311  ASN A O     1 
ATOM   2391  C  CB    . ASN A  1  311 ? 58.130  90.278  49.012  1.00 59.19  ? 311  ASN A CB    1 
ATOM   2392  C  CG    . ASN A  1  311 ? 58.032  90.915  47.629  1.00 59.29  ? 311  ASN A CG    1 
ATOM   2393  O  OD1   . ASN A  1  311 ? 56.978  90.885  46.987  1.00 58.74  ? 311  ASN A OD1   1 
ATOM   2394  N  ND2   . ASN A  1  311 ? 59.130  91.498  47.167  1.00 58.57  ? 311  ASN A ND2   1 
ATOM   2395  N  N     . THR A  1  312 ? 55.404  87.854  48.415  1.00 60.40  ? 312  THR A N     1 
ATOM   2396  C  CA    . THR A  1  312 ? 55.024  86.784  47.507  1.00 59.86  ? 312  THR A CA    1 
ATOM   2397  C  C     . THR A  1  312 ? 54.868  87.269  46.072  1.00 60.85  ? 312  THR A C     1 
ATOM   2398  O  O     . THR A  1  312 ? 53.876  87.925  45.730  1.00 61.65  ? 312  THR A O     1 
ATOM   2399  C  CB    . THR A  1  312 ? 53.713  86.145  47.965  1.00 59.63  ? 312  THR A CB    1 
ATOM   2400  O  OG1   . THR A  1  312 ? 53.950  85.413  49.171  1.00 60.18  ? 312  THR A OG1   1 
ATOM   2401  C  CG2   . THR A  1  312 ? 53.144  85.224  46.890  1.00 58.98  ? 312  THR A CG2   1 
ATOM   2402  N  N     . SER A  1  313 ? 55.843  86.927  45.229  1.00 60.63  ? 313  SER A N     1 
ATOM   2403  C  CA    . SER A  1  313 ? 55.824  87.331  43.822  1.00 59.59  ? 313  SER A CA    1 
ATOM   2404  C  C     . SER A  1  313 ? 55.010  86.420  42.907  1.00 57.82  ? 313  SER A C     1 
ATOM   2405  O  O     . SER A  1  313 ? 54.753  85.259  43.220  1.00 57.76  ? 313  SER A O     1 
ATOM   2406  C  CB    . SER A  1  313 ? 57.248  87.409  43.283  1.00 60.41  ? 313  SER A CB    1 
ATOM   2407  O  OG    . SER A  1  313 ? 57.986  88.437  43.917  1.00 64.85  ? 313  SER A OG    1 
ATOM   2408  N  N     . TYR A  1  314 ? 54.596  86.972  41.775  1.00 56.23  ? 314  TYR A N     1 
ATOM   2409  C  CA    . TYR A  1  314 ? 53.855  86.230  40.762  1.00 55.94  ? 314  TYR A CA    1 
ATOM   2410  C  C     . TYR A  1  314 ? 54.297  86.790  39.415  1.00 56.17  ? 314  TYR A C     1 
ATOM   2411  O  O     . TYR A  1  314 ? 55.075  87.746  39.348  1.00 56.16  ? 314  TYR A O     1 
ATOM   2412  C  CB    . TYR A  1  314 ? 52.337  86.397  40.916  1.00 56.46  ? 314  TYR A CB    1 
ATOM   2413  C  CG    . TYR A  1  314 ? 51.719  85.605  42.049  1.00 56.48  ? 314  TYR A CG    1 
ATOM   2414  C  CD1   . TYR A  1  314 ? 51.054  86.244  43.094  1.00 58.29  ? 314  TYR A CD1   1 
ATOM   2415  C  CD2   . TYR A  1  314 ? 51.829  84.226  42.103  1.00 54.97  ? 314  TYR A CD2   1 
ATOM   2416  C  CE1   . TYR A  1  314 ? 50.521  85.515  44.175  1.00 56.13  ? 314  TYR A CE1   1 
ATOM   2417  C  CE2   . TYR A  1  314 ? 51.297  83.495  43.179  1.00 54.74  ? 314  TYR A CE2   1 
ATOM   2418  C  CZ    . TYR A  1  314 ? 50.651  84.147  44.207  1.00 53.81  ? 314  TYR A CZ    1 
ATOM   2419  O  OH    . TYR A  1  314 ? 50.165  83.434  45.274  1.00 52.94  ? 314  TYR A OH    1 
ATOM   2420  N  N     . SER A  1  315 ? 53.804  86.195  38.341  1.00 56.02  ? 315  SER A N     1 
ATOM   2421  C  CA    . SER A  1  315 ? 54.169  86.634  37.012  1.00 56.62  ? 315  SER A CA    1 
ATOM   2422  C  C     . SER A  1  315 ? 53.957  88.108  36.761  1.00 59.30  ? 315  SER A C     1 
ATOM   2423  O  O     . SER A  1  315 ? 54.906  88.856  36.527  1.00 61.26  ? 315  SER A O     1 
ATOM   2424  C  CB    . SER A  1  315 ? 53.389  85.838  35.975  1.00 55.11  ? 315  SER A CB    1 
ATOM   2425  O  OG    . SER A  1  315 ? 52.091  85.545  36.436  1.00 52.99  ? 315  SER A OG    1 
ATOM   2426  N  N     . ASP A  1  316 ? 52.699  88.518  36.826  1.00 61.49  ? 316  ASP A N     1 
ATOM   2427  C  CA    . ASP A  1  316 ? 52.303  89.891  36.557  1.00 63.18  ? 316  ASP A CA    1 
ATOM   2428  C  C     . ASP A  1  316 ? 51.963  90.710  37.799  1.00 64.76  ? 316  ASP A C     1 
ATOM   2429  O  O     . ASP A  1  316 ? 51.894  91.936  37.723  1.00 65.10  ? 316  ASP A O     1 
ATOM   2430  C  CB    . ASP A  1  316 ? 51.081  89.851  35.669  1.00 64.13  ? 316  ASP A CB    1 
ATOM   2431  C  CG    . ASP A  1  316 ? 49.965  89.061  36.302  1.00 66.53  ? 316  ASP A CG    1 
ATOM   2432  O  OD1   . ASP A  1  316 ? 50.198  87.873  36.616  1.00 63.87  ? 316  ASP A OD1   1 
ATOM   2433  O  OD2   . ASP A  1  316 ? 48.868  89.628  36.511  1.00 71.21  ? 316  ASP A OD2   1 
ATOM   2434  N  N     . THR A  1  317 ? 51.731  90.044  38.929  1.00 65.90  ? 317  THR A N     1 
ATOM   2435  C  CA    . THR A  1  317 ? 51.369  90.743  40.163  1.00 66.41  ? 317  THR A CA    1 
ATOM   2436  C  C     . THR A  1  317 ? 52.148  90.252  41.392  1.00 66.02  ? 317  THR A C     1 
ATOM   2437  O  O     . THR A  1  317 ? 53.299  89.866  41.273  1.00 66.84  ? 317  THR A O     1 
ATOM   2438  C  CB    . THR A  1  317 ? 49.829  90.635  40.408  1.00 67.83  ? 317  THR A CB    1 
ATOM   2439  O  OG1   . THR A  1  317 ? 49.462  91.425  41.553  1.00 66.89  ? 317  THR A OG1   1 
ATOM   2440  C  CG2   . THR A  1  317 ? 49.411  89.169  40.592  1.00 66.46  ? 317  THR A CG2   1 
ATOM   2441  N  N     . GLY A  1  318 ? 51.525  90.290  42.567  1.00 66.10  ? 318  GLY A N     1 
ATOM   2442  C  CA    . GLY A  1  318 ? 52.188  89.851  43.787  1.00 64.60  ? 318  GLY A CA    1 
ATOM   2443  C  C     . GLY A  1  318 ? 51.580  90.441  45.058  1.00 63.83  ? 318  GLY A C     1 
ATOM   2444  O  O     . GLY A  1  318 ? 50.749  91.350  45.003  1.00 62.68  ? 318  GLY A O     1 
ATOM   2445  N  N     . LEU A  1  319 ? 51.984  89.914  46.209  1.00 62.41  ? 319  LEU A N     1 
ATOM   2446  C  CA    . LEU A  1  319 ? 51.488  90.399  47.494  1.00 60.48  ? 319  LEU A CA    1 
ATOM   2447  C  C     . LEU A  1  319 ? 52.629  90.759  48.434  1.00 60.77  ? 319  LEU A C     1 
ATOM   2448  O  O     . LEU A  1  319 ? 53.425  89.908  48.803  1.00 61.24  ? 319  LEU A O     1 
ATOM   2449  C  CB    . LEU A  1  319 ? 50.610  89.347  48.167  1.00 57.26  ? 319  LEU A CB    1 
ATOM   2450  C  CG    . LEU A  1  319 ? 49.275  89.070  47.496  1.00 54.98  ? 319  LEU A CG    1 
ATOM   2451  C  CD1   . LEU A  1  319 ? 48.477  88.099  48.336  1.00 54.95  ? 319  LEU A CD1   1 
ATOM   2452  C  CD2   . LEU A  1  319 ? 48.521  90.362  47.358  1.00 54.32  ? 319  LEU A CD2   1 
ATOM   2453  N  N     . PHE A  1  320 ? 52.703  92.029  48.813  1.00 61.42  ? 320  PHE A N     1 
ATOM   2454  C  CA    . PHE A  1  320 ? 53.730  92.516  49.730  1.00 61.55  ? 320  PHE A CA    1 
ATOM   2455  C  C     . PHE A  1  320 ? 53.038  92.864  51.045  1.00 61.45  ? 320  PHE A C     1 
ATOM   2456  O  O     . PHE A  1  320 ? 52.259  93.817  51.106  1.00 61.39  ? 320  PHE A O     1 
ATOM   2457  C  CB    . PHE A  1  320 ? 54.381  93.766  49.157  1.00 62.60  ? 320  PHE A CB    1 
ATOM   2458  C  CG    . PHE A  1  320 ? 55.427  94.374  50.044  1.00 65.60  ? 320  PHE A CG    1 
ATOM   2459  C  CD1   . PHE A  1  320 ? 56.777  94.253  49.733  1.00 67.84  ? 320  PHE A CD1   1 
ATOM   2460  C  CD2   . PHE A  1  320 ? 55.066  95.093  51.176  1.00 66.90  ? 320  PHE A CD2   1 
ATOM   2461  C  CE1   . PHE A  1  320 ? 57.759  94.846  50.539  1.00 69.24  ? 320  PHE A CE1   1 
ATOM   2462  C  CE2   . PHE A  1  320 ? 56.036  95.686  51.989  1.00 69.19  ? 320  PHE A CE2   1 
ATOM   2463  C  CZ    . PHE A  1  320 ? 57.389  95.561  51.667  1.00 69.35  ? 320  PHE A CZ    1 
ATOM   2464  N  N     . GLY A  1  321 ? 53.308  92.102  52.098  1.00 60.19  ? 321  GLY A N     1 
ATOM   2465  C  CA    . GLY A  1  321 ? 52.653  92.407  53.346  1.00 60.59  ? 321  GLY A CA    1 
ATOM   2466  C  C     . GLY A  1  321 ? 53.310  91.834  54.573  1.00 60.42  ? 321  GLY A C     1 
ATOM   2467  O  O     . GLY A  1  321 ? 54.539  91.767  54.652  1.00 60.96  ? 321  GLY A O     1 
ATOM   2468  N  N     . PHE A  1  322 ? 52.475  91.471  55.546  1.00 58.64  ? 322  PHE A N     1 
ATOM   2469  C  CA    . PHE A  1  322 ? 52.926  90.884  56.793  1.00 57.56  ? 322  PHE A CA    1 
ATOM   2470  C  C     . PHE A  1  322 ? 51.776  90.139  57.437  1.00 57.87  ? 322  PHE A C     1 
ATOM   2471  O  O     . PHE A  1  322 ? 50.610  90.368  57.109  1.00 57.47  ? 322  PHE A O     1 
ATOM   2472  C  CB    . PHE A  1  322 ? 53.517  91.939  57.746  1.00 56.30  ? 322  PHE A CB    1 
ATOM   2473  C  CG    . PHE A  1  322 ? 52.542  92.977  58.222  1.00 57.87  ? 322  PHE A CG    1 
ATOM   2474  C  CD1   . PHE A  1  322 ? 51.563  92.662  59.159  1.00 58.72  ? 322  PHE A CD1   1 
ATOM   2475  C  CD2   . PHE A  1  322 ? 52.630  94.290  57.764  1.00 59.22  ? 322  PHE A CD2   1 
ATOM   2476  C  CE1   . PHE A  1  322 ? 50.682  93.641  59.641  1.00 58.97  ? 322  PHE A CE1   1 
ATOM   2477  C  CE2   . PHE A  1  322 ? 51.760  95.276  58.235  1.00 60.63  ? 322  PHE A CE2   1 
ATOM   2478  C  CZ    . PHE A  1  322 ? 50.781  94.948  59.178  1.00 60.77  ? 322  PHE A CZ    1 
ATOM   2479  N  N     . HIS A  1  323 ? 52.121  89.226  58.336  1.00 57.71  ? 323  HIS A N     1 
ATOM   2480  C  CA    . HIS A  1  323 ? 51.141  88.400  59.022  1.00 57.79  ? 323  HIS A CA    1 
ATOM   2481  C  C     . HIS A  1  323 ? 51.552  88.267  60.465  1.00 56.79  ? 323  HIS A C     1 
ATOM   2482  O  O     . HIS A  1  323 ? 52.726  88.155  60.749  1.00 58.63  ? 323  HIS A O     1 
ATOM   2483  C  CB    . HIS A  1  323 ? 51.081  87.015  58.357  1.00 58.36  ? 323  HIS A CB    1 
ATOM   2484  C  CG    . HIS A  1  323 ? 50.506  85.934  59.227  1.00 59.87  ? 323  HIS A CG    1 
ATOM   2485  N  ND1   . HIS A  1  323 ? 51.287  85.105  60.000  1.00 59.31  ? 323  HIS A ND1   1 
ATOM   2486  C  CD2   . HIS A  1  323 ? 49.229  85.525  59.418  1.00 61.77  ? 323  HIS A CD2   1 
ATOM   2487  C  CE1   . HIS A  1  323 ? 50.518  84.228  60.624  1.00 60.28  ? 323  HIS A CE1   1 
ATOM   2488  N  NE2   . HIS A  1  323 ? 49.264  84.460  60.288  1.00 59.95  ? 323  HIS A NE2   1 
ATOM   2489  N  N     . PHE A  1  324 ? 50.590  88.304  61.377  1.00 56.23  ? 324  PHE A N     1 
ATOM   2490  C  CA    . PHE A  1  324 ? 50.889  88.158  62.794  1.00 55.67  ? 324  PHE A CA    1 
ATOM   2491  C  C     . PHE A  1  324 ? 49.806  87.393  63.549  1.00 56.19  ? 324  PHE A C     1 
ATOM   2492  O  O     . PHE A  1  324 ? 48.624  87.405  63.187  1.00 56.80  ? 324  PHE A O     1 
ATOM   2493  C  CB    . PHE A  1  324 ? 51.155  89.526  63.448  1.00 54.85  ? 324  PHE A CB    1 
ATOM   2494  C  CG    . PHE A  1  324 ? 49.944  90.419  63.581  1.00 55.03  ? 324  PHE A CG    1 
ATOM   2495  C  CD1   . PHE A  1  324 ? 48.950  90.142  64.522  1.00 54.99  ? 324  PHE A CD1   1 
ATOM   2496  C  CD2   . PHE A  1  324 ? 49.842  91.591  62.828  1.00 55.48  ? 324  PHE A CD2   1 
ATOM   2497  C  CE1   . PHE A  1  324 ? 47.876  91.017  64.719  1.00 53.44  ? 324  PHE A CE1   1 
ATOM   2498  C  CE2   . PHE A  1  324 ? 48.780  92.472  63.014  1.00 55.85  ? 324  PHE A CE2   1 
ATOM   2499  C  CZ    . PHE A  1  324 ? 47.792  92.182  63.967  1.00 55.35  ? 324  PHE A CZ    1 
ATOM   2500  N  N     . VAL A  1  325 ? 50.226  86.690  64.585  1.00 55.09  ? 325  VAL A N     1 
ATOM   2501  C  CA    . VAL A  1  325 ? 49.304  85.916  65.382  1.00 54.90  ? 325  VAL A CA    1 
ATOM   2502  C  C     . VAL A  1  325 ? 49.361  86.586  66.723  1.00 56.40  ? 325  VAL A C     1 
ATOM   2503  O  O     . VAL A  1  325 ? 50.446  86.856  67.223  1.00 58.26  ? 325  VAL A O     1 
ATOM   2504  C  CB    . VAL A  1  325 ? 49.776  84.480  65.532  1.00 54.24  ? 325  VAL A CB    1 
ATOM   2505  C  CG1   . VAL A  1  325 ? 48.755  83.692  66.312  1.00 52.82  ? 325  VAL A CG1   1 
ATOM   2506  C  CG2   . VAL A  1  325 ? 50.029  83.874  64.161  1.00 51.91  ? 325  VAL A CG2   1 
ATOM   2507  N  N     . ALA A  1  326 ? 48.208  86.866  67.311  1.00 56.99  ? 326  ALA A N     1 
ATOM   2508  C  CA    . ALA A  1  326 ? 48.188  87.549  68.593  1.00 56.81  ? 326  ALA A CA    1 
ATOM   2509  C  C     . ALA A  1  326 ? 47.050  87.087  69.443  1.00 57.52  ? 326  ALA A C     1 
ATOM   2510  O  O     . ALA A  1  326 ? 46.277  86.215  69.057  1.00 58.24  ? 326  ALA A O     1 
ATOM   2511  C  CB    . ALA A  1  326 ? 48.069  89.038  68.381  1.00 55.58  ? 326  ALA A CB    1 
ATOM   2512  N  N     . ASP A  1  327 ? 46.973  87.669  70.629  1.00 58.73  ? 327  ASP A N     1 
ATOM   2513  C  CA    . ASP A  1  327 ? 45.887  87.365  71.537  1.00 59.61  ? 327  ASP A CA    1 
ATOM   2514  C  C     . ASP A  1  327 ? 44.813  88.385  71.225  1.00 59.39  ? 327  ASP A C     1 
ATOM   2515  O  O     . ASP A  1  327 ? 45.094  89.518  70.818  1.00 58.00  ? 327  ASP A O     1 
ATOM   2516  C  CB    . ASP A  1  327 ? 46.310  87.503  72.992  1.00 60.89  ? 327  ASP A CB    1 
ATOM   2517  C  CG    . ASP A  1  327 ? 47.329  86.483  73.382  1.00 62.21  ? 327  ASP A CG    1 
ATOM   2518  O  OD1   . ASP A  1  327 ? 46.994  85.278  73.399  1.00 61.50  ? 327  ASP A OD1   1 
ATOM   2519  O  OD2   . ASP A  1  327 ? 48.472  86.899  73.656  1.00 65.81  ? 327  ASP A OD2   1 
ATOM   2520  N  N     . PRO A  1  328 ? 43.559  87.993  71.418  1.00 59.31  ? 328  PRO A N     1 
ATOM   2521  C  CA    . PRO A  1  328 ? 42.459  88.901  71.136  1.00 59.10  ? 328  PRO A CA    1 
ATOM   2522  C  C     . PRO A  1  328 ? 42.667  90.326  71.612  1.00 58.99  ? 328  PRO A C     1 
ATOM   2523  O  O     . PRO A  1  328 ? 42.264  91.271  70.932  1.00 59.39  ? 328  PRO A O     1 
ATOM   2524  C  CB    . PRO A  1  328 ? 41.284  88.222  71.821  1.00 60.34  ? 328  PRO A CB    1 
ATOM   2525  C  CG    . PRO A  1  328 ? 41.956  87.401  72.922  1.00 60.08  ? 328  PRO A CG    1 
ATOM   2526  C  CD    . PRO A  1  328 ? 43.090  86.822  72.177  1.00 58.52  ? 328  PRO A CD    1 
ATOM   2527  N  N     . LEU A  1  329 ? 43.325  90.491  72.754  1.00 58.73  ? 329  LEU A N     1 
ATOM   2528  C  CA    . LEU A  1  329 ? 43.480  91.830  73.303  1.00 57.94  ? 329  LEU A CA    1 
ATOM   2529  C  C     . LEU A  1  329 ? 44.699  92.647  72.991  1.00 59.14  ? 329  LEU A C     1 
ATOM   2530  O  O     . LEU A  1  329 ? 44.900  93.697  73.602  1.00 59.80  ? 329  LEU A O     1 
ATOM   2531  C  CB    . LEU A  1  329 ? 43.291  91.794  74.810  1.00 54.91  ? 329  LEU A CB    1 
ATOM   2532  C  CG    . LEU A  1  329 ? 41.886  91.372  75.192  1.00 50.64  ? 329  LEU A CG    1 
ATOM   2533  C  CD1   . LEU A  1  329 ? 41.821  91.280  76.668  1.00 51.24  ? 329  LEU A CD1   1 
ATOM   2534  C  CD2   . LEU A  1  329 ? 40.881  92.365  74.662  1.00 49.44  ? 329  LEU A CD2   1 
ATOM   2535  N  N     . SER A  1  330 ? 45.518  92.195  72.053  1.00 59.88  ? 330  SER A N     1 
ATOM   2536  C  CA    . SER A  1  330 ? 46.684  92.984  71.694  1.00 60.89  ? 330  SER A CA    1 
ATOM   2537  C  C     . SER A  1  330 ? 46.777  93.123  70.181  1.00 61.24  ? 330  SER A C     1 
ATOM   2538  O  O     . SER A  1  330 ? 47.800  93.569  69.639  1.00 61.71  ? 330  SER A O     1 
ATOM   2539  C  CB    . SER A  1  330 ? 47.946  92.354  72.276  1.00 60.15  ? 330  SER A CB    1 
ATOM   2540  O  OG    . SER A  1  330 ? 47.955  90.965  72.053  1.00 61.84  ? 330  SER A OG    1 
ATOM   2541  N  N     . ILE A  1  331 ? 45.687  92.759  69.506  1.00 61.19  ? 331  ILE A N     1 
ATOM   2542  C  CA    . ILE A  1  331 ? 45.639  92.839  68.057  1.00 60.61  ? 331  ILE A CA    1 
ATOM   2543  C  C     . ILE A  1  331 ? 45.805  94.269  67.601  1.00 62.15  ? 331  ILE A C     1 
ATOM   2544  O  O     . ILE A  1  331 ? 46.532  94.536  66.641  1.00 62.81  ? 331  ILE A O     1 
ATOM   2545  C  CB    . ILE A  1  331 ? 44.322  92.343  67.489  1.00 57.71  ? 331  ILE A CB    1 
ATOM   2546  C  CG1   . ILE A  1  331 ? 43.958  91.004  68.088  1.00 57.95  ? 331  ILE A CG1   1 
ATOM   2547  C  CG2   . ILE A  1  331 ? 44.474  92.124  66.017  1.00 58.64  ? 331  ILE A CG2   1 
ATOM   2548  C  CD1   . ILE A  1  331 ? 42.737  90.390  67.455  1.00 58.33  ? 331  ILE A CD1   1 
ATOM   2549  N  N     . ASP A  1  332 ? 45.145  95.198  68.286  1.00 63.82  ? 332  ASP A N     1 
ATOM   2550  C  CA    . ASP A  1  332 ? 45.248  96.590  67.877  1.00 66.24  ? 332  ASP A CA    1 
ATOM   2551  C  C     . ASP A  1  332 ? 46.640  97.190  68.057  1.00 65.97  ? 332  ASP A C     1 
ATOM   2552  O  O     . ASP A  1  332 ? 47.213  97.760  67.118  1.00 63.95  ? 332  ASP A O     1 
ATOM   2553  C  CB    . ASP A  1  332 ? 44.229  97.460  68.602  1.00 67.65  ? 332  ASP A CB    1 
ATOM   2554  C  CG    . ASP A  1  332 ? 44.048  98.797  67.913  1.00 70.54  ? 332  ASP A CG    1 
ATOM   2555  O  OD1   . ASP A  1  332 ? 43.643  98.778  66.720  1.00 73.05  ? 332  ASP A OD1   1 
ATOM   2556  O  OD2   . ASP A  1  332 ? 44.325  99.851  68.537  1.00 69.27  ? 332  ASP A OD2   1 
ATOM   2557  N  N     . ASP A  1  333 ? 47.182  97.071  69.265  1.00 66.59  ? 333  ASP A N     1 
ATOM   2558  C  CA    . ASP A  1  333 ? 48.509  97.606  69.519  1.00 66.41  ? 333  ASP A CA    1 
ATOM   2559  C  C     . ASP A  1  333 ? 49.488  97.049  68.498  1.00 64.87  ? 333  ASP A C     1 
ATOM   2560  O  O     . ASP A  1  333 ? 50.313  97.789  67.958  1.00 64.63  ? 333  ASP A O     1 
ATOM   2561  C  CB    . ASP A  1  333 ? 48.984  97.250  70.928  1.00 68.11  ? 333  ASP A CB    1 
ATOM   2562  C  CG    . ASP A  1  333 ? 48.398  98.162  71.991  1.00 68.12  ? 333  ASP A CG    1 
ATOM   2563  O  OD1   . ASP A  1  333 ? 47.938  99.276  71.635  1.00 67.88  ? 333  ASP A OD1   1 
ATOM   2564  O  OD2   . ASP A  1  333 ? 48.416  97.768  73.180  1.00 67.62  ? 333  ASP A OD2   1 
ATOM   2565  N  N     . MET A  1  334 ? 49.383  95.748  68.237  1.00 61.73  ? 334  MET A N     1 
ATOM   2566  C  CA    . MET A  1  334 ? 50.259  95.100  67.280  1.00 61.37  ? 334  MET A CA    1 
ATOM   2567  C  C     . MET A  1  334 ? 50.090  95.689  65.875  1.00 62.34  ? 334  MET A C     1 
ATOM   2568  O  O     . MET A  1  334 ? 51.075  96.112  65.243  1.00 63.34  ? 334  MET A O     1 
ATOM   2569  C  CB    . MET A  1  334 ? 49.986  93.597  67.269  1.00 60.16  ? 334  MET A CB    1 
ATOM   2570  C  CG    . MET A  1  334 ? 50.826  92.793  66.275  1.00 59.73  ? 334  MET A CG    1 
ATOM   2571  S  SD    . MET A  1  334 ? 52.584  92.764  66.631  1.00 57.59  ? 334  MET A SD    1 
ATOM   2572  C  CE    . MET A  1  334 ? 53.256  93.116  65.042  1.00 57.77  ? 334  MET A CE    1 
ATOM   2573  N  N     . MET A  1  335 ? 48.846  95.730  65.392  1.00 62.36  ? 335  MET A N     1 
ATOM   2574  C  CA    . MET A  1  335 ? 48.565  96.265  64.060  1.00 60.96  ? 335  MET A CA    1 
ATOM   2575  C  C     . MET A  1  335 ? 49.102  97.689  63.968  1.00 59.75  ? 335  MET A C     1 
ATOM   2576  O  O     . MET A  1  335 ? 49.746  98.076  62.992  1.00 58.93  ? 335  MET A O     1 
ATOM   2577  C  CB    . MET A  1  335 ? 47.065  96.249  63.783  1.00 59.28  ? 335  MET A CB    1 
ATOM   2578  C  CG    . MET A  1  335 ? 46.679  96.891  62.452  1.00 61.67  ? 335  MET A CG    1 
ATOM   2579  S  SD    . MET A  1  335 ? 47.357  96.091  60.972  1.00 63.70  ? 335  MET A SD    1 
ATOM   2580  C  CE    . MET A  1  335 ? 46.074  94.861  60.626  1.00 62.55  ? 335  MET A CE    1 
ATOM   2581  N  N     . PHE A  1  336 ? 48.842  98.459  65.011  1.00 59.38  ? 336  PHE A N     1 
ATOM   2582  C  CA    . PHE A  1  336 ? 49.295  99.837  65.077  1.00 59.45  ? 336  PHE A CA    1 
ATOM   2583  C  C     . PHE A  1  336 ? 50.801  99.931  64.832  1.00 59.86  ? 336  PHE A C     1 
ATOM   2584  O  O     . PHE A  1  336 ? 51.263  100.635 63.923  1.00 58.69  ? 336  PHE A O     1 
ATOM   2585  C  CB    . PHE A  1  336 ? 48.977  100.397 66.453  1.00 58.94  ? 336  PHE A CB    1 
ATOM   2586  C  CG    . PHE A  1  336 ? 49.536  101.759 66.687  1.00 59.35  ? 336  PHE A CG    1 
ATOM   2587  C  CD1   . PHE A  1  336 ? 48.934  102.881 66.130  1.00 59.06  ? 336  PHE A CD1   1 
ATOM   2588  C  CD2   . PHE A  1  336 ? 50.659  101.933 67.485  1.00 59.14  ? 336  PHE A CD2   1 
ATOM   2589  C  CE1   . PHE A  1  336 ? 49.443  104.163 66.372  1.00 56.85  ? 336  PHE A CE1   1 
ATOM   2590  C  CE2   . PHE A  1  336 ? 51.171  103.212 67.726  1.00 57.86  ? 336  PHE A CE2   1 
ATOM   2591  C  CZ    . PHE A  1  336 ? 50.560  104.325 67.169  1.00 55.16  ? 336  PHE A CZ    1 
ATOM   2592  N  N     . CYS A  1  337 ? 51.551  99.210  65.667  1.00 59.87  ? 337  CYS A N     1 
ATOM   2593  C  CA    . CYS A  1  337 ? 53.001  99.178  65.607  1.00 57.77  ? 337  CYS A CA    1 
ATOM   2594  C  C     . CYS A  1  337 ? 53.484  98.699  64.265  1.00 57.35  ? 337  CYS A C     1 
ATOM   2595  O  O     . CYS A  1  337 ? 54.447  99.237  63.736  1.00 57.87  ? 337  CYS A O     1 
ATOM   2596  C  CB    . CYS A  1  337 ? 53.546  98.259  66.684  1.00 57.69  ? 337  CYS A CB    1 
ATOM   2597  S  SG    . CYS A  1  337 ? 53.210  98.809  68.338  1.00 59.45  ? 337  CYS A SG    1 
ATOM   2598  N  N     . ALA A  1  338 ? 52.823  97.686  63.719  1.00 56.91  ? 338  ALA A N     1 
ATOM   2599  C  CA    . ALA A  1  338 ? 53.213  97.145  62.424  1.00 58.18  ? 338  ALA A CA    1 
ATOM   2600  C  C     . ALA A  1  338 ? 53.136  98.211  61.333  1.00 59.64  ? 338  ALA A C     1 
ATOM   2601  O  O     . ALA A  1  338 ? 54.112  98.469  60.620  1.00 58.74  ? 338  ALA A O     1 
ATOM   2602  C  CB    . ALA A  1  338 ? 52.329  95.973  62.070  1.00 57.89  ? 338  ALA A CB    1 
ATOM   2603  N  N     . GLN A  1  339 ? 51.972  98.834  61.197  1.00 61.74  ? 339  GLN A N     1 
ATOM   2604  C  CA    . GLN A  1  339 ? 51.805  99.873  60.192  1.00 62.86  ? 339  GLN A CA    1 
ATOM   2605  C  C     . GLN A  1  339 ? 52.791  100.970 60.527  1.00 63.42  ? 339  GLN A C     1 
ATOM   2606  O  O     . GLN A  1  339 ? 53.306  101.660 59.645  1.00 64.91  ? 339  GLN A O     1 
ATOM   2607  C  CB    . GLN A  1  339 ? 50.383  100.425 60.214  1.00 63.11  ? 339  GLN A CB    1 
ATOM   2608  C  CG    . GLN A  1  339 ? 49.320  99.349  60.077  1.00 64.52  ? 339  GLN A CG    1 
ATOM   2609  C  CD    . GLN A  1  339 ? 47.965  99.910  59.698  1.00 64.74  ? 339  GLN A CD    1 
ATOM   2610  O  OE1   . GLN A  1  339 ? 47.774  100.416 58.587  1.00 64.06  ? 339  GLN A OE1   1 
ATOM   2611  N  NE2   . GLN A  1  339 ? 47.015  99.829  60.622  1.00 65.38  ? 339  GLN A NE2   1 
ATOM   2612  N  N     . GLY A  1  340 ? 53.054  101.129 61.814  1.00 62.77  ? 340  GLY A N     1 
ATOM   2613  C  CA    . GLY A  1  340 ? 54.008  102.134 62.217  1.00 63.29  ? 340  GLY A CA    1 
ATOM   2614  C  C     . GLY A  1  340 ? 55.316  101.931 61.475  1.00 63.51  ? 340  GLY A C     1 
ATOM   2615  O  O     . GLY A  1  340 ? 55.815  102.846 60.811  1.00 64.16  ? 340  GLY A O     1 
ATOM   2616  N  N     . GLU A  1  341 ? 55.864  100.722 61.564  1.00 63.24  ? 341  GLU A N     1 
ATOM   2617  C  CA    . GLU A  1  341 ? 57.130  100.421 60.912  1.00 62.73  ? 341  GLU A CA    1 
ATOM   2618  C  C     . GLU A  1  341 ? 57.033  100.550 59.409  1.00 62.37  ? 341  GLU A C     1 
ATOM   2619  O  O     . GLU A  1  341 ? 57.978  100.993 58.757  1.00 61.67  ? 341  GLU A O     1 
ATOM   2620  C  CB    . GLU A  1  341 ? 57.623  99.032  61.314  1.00 63.33  ? 341  GLU A CB    1 
ATOM   2621  C  CG    . GLU A  1  341 ? 57.766  98.888  62.824  1.00 65.83  ? 341  GLU A CG    1 
ATOM   2622  C  CD    . GLU A  1  341 ? 58.395  100.122 63.462  1.00 67.36  ? 341  GLU A CD    1 
ATOM   2623  O  OE1   . GLU A  1  341 ? 59.521  100.466 63.046  1.00 67.83  ? 341  GLU A OE1   1 
ATOM   2624  O  OE2   . GLU A  1  341 ? 57.771  100.745 64.365  1.00 67.16  ? 341  GLU A OE2   1 
ATOM   2625  N  N     . TRP A  1  342 ? 55.893  100.181 58.847  1.00 62.48  ? 342  TRP A N     1 
ATOM   2626  C  CA    . TRP A  1  342 ? 55.737  100.328 57.406  1.00 64.16  ? 342  TRP A CA    1 
ATOM   2627  C  C     . TRP A  1  342 ? 55.882  101.816 57.070  1.00 64.96  ? 342  TRP A C     1 
ATOM   2628  O  O     . TRP A  1  342 ? 56.650  102.205 56.194  1.00 64.98  ? 342  TRP A O     1 
ATOM   2629  C  CB    . TRP A  1  342 ? 54.364  99.830  56.959  1.00 63.80  ? 342  TRP A CB    1 
ATOM   2630  C  CG    . TRP A  1  342 ? 54.380  98.527  56.255  1.00 61.94  ? 342  TRP A CG    1 
ATOM   2631  C  CD1   . TRP A  1  342 ? 55.391  97.625  56.227  1.00 60.92  ? 342  TRP A CD1   1 
ATOM   2632  C  CD2   . TRP A  1  342 ? 53.300  97.945  55.535  1.00 63.10  ? 342  TRP A CD2   1 
ATOM   2633  N  NE1   . TRP A  1  342 ? 55.011  96.505  55.538  1.00 61.71  ? 342  TRP A NE1   1 
ATOM   2634  C  CE2   . TRP A  1  342 ? 53.726  96.674  55.101  1.00 63.54  ? 342  TRP A CE2   1 
ATOM   2635  C  CE3   . TRP A  1  342 ? 52.005  98.374  55.216  1.00 63.69  ? 342  TRP A CE3   1 
ATOM   2636  C  CZ2   . TRP A  1  342 ? 52.905  95.817  54.362  1.00 65.49  ? 342  TRP A CZ2   1 
ATOM   2637  C  CZ3   . TRP A  1  342 ? 51.186  97.528  54.481  1.00 64.91  ? 342  TRP A CZ3   1 
ATOM   2638  C  CH2   . TRP A  1  342 ? 51.641  96.257  54.060  1.00 66.08  ? 342  TRP A CH2   1 
ATOM   2639  N  N     . MET A  1  343 ? 55.142  102.655 57.776  1.00 65.74  ? 343  MET A N     1 
ATOM   2640  C  CA    . MET A  1  343 ? 55.238  104.070 57.514  1.00 67.61  ? 343  MET A CA    1 
ATOM   2641  C  C     . MET A  1  343 ? 56.661  104.562 57.723  1.00 69.35  ? 343  MET A C     1 
ATOM   2642  O  O     . MET A  1  343 ? 57.124  105.469 57.028  1.00 68.80  ? 343  MET A O     1 
ATOM   2643  C  CB    . MET A  1  343 ? 54.268  104.834 58.406  1.00 66.61  ? 343  MET A CB    1 
ATOM   2644  C  CG    . MET A  1  343 ? 52.855  104.788 57.896  1.00 66.50  ? 343  MET A CG    1 
ATOM   2645  S  SD    . MET A  1  343 ? 52.764  105.377 56.184  1.00 66.57  ? 343  MET A SD    1 
ATOM   2646  C  CE    . MET A  1  343 ? 52.635  103.819 55.320  1.00 67.83  ? 343  MET A CE    1 
ATOM   2647  N  N     . ARG A  1  344 ? 57.361  103.958 58.675  1.00 71.81  ? 344  ARG A N     1 
ATOM   2648  C  CA    . ARG A  1  344 ? 58.729  104.364 58.947  1.00 73.74  ? 344  ARG A CA    1 
ATOM   2649  C  C     . ARG A  1  344 ? 59.607  103.976 57.759  1.00 72.73  ? 344  ARG A C     1 
ATOM   2650  O  O     . ARG A  1  344 ? 60.527  104.710 57.395  1.00 71.33  ? 344  ARG A O     1 
ATOM   2651  C  CB    . ARG A  1  344 ? 59.220  103.708 60.232  1.00 77.45  ? 344  ARG A CB    1 
ATOM   2652  C  CG    . ARG A  1  344 ? 60.489  104.322 60.803  1.00 84.37  ? 344  ARG A CG    1 
ATOM   2653  C  CD    . ARG A  1  344 ? 60.702  103.848 62.235  1.00 90.22  ? 344  ARG A CD    1 
ATOM   2654  N  NE    . ARG A  1  344 ? 59.515  104.094 63.069  1.00 95.68  ? 344  ARG A NE    1 
ATOM   2655  C  CZ    . ARG A  1  344 ? 59.117  105.296 63.501  1.00 97.34  ? 344  ARG A CZ    1 
ATOM   2656  N  NH1   . ARG A  1  344 ? 59.813  106.388 63.185  1.00 96.93  ? 344  ARG A NH1   1 
ATOM   2657  N  NH2   . ARG A  1  344 ? 58.017  105.408 64.249  1.00 96.46  ? 344  ARG A NH2   1 
ATOM   2658  N  N     . LEU A  1  345 ? 59.306  102.830 57.151  1.00 71.61  ? 345  LEU A N     1 
ATOM   2659  C  CA    . LEU A  1  345 ? 60.053  102.358 55.985  1.00 71.94  ? 345  LEU A CA    1 
ATOM   2660  C  C     . LEU A  1  345 ? 59.974  103.369 54.849  1.00 72.88  ? 345  LEU A C     1 
ATOM   2661  O  O     . LEU A  1  345 ? 60.959  103.643 54.176  1.00 73.92  ? 345  LEU A O     1 
ATOM   2662  C  CB    . LEU A  1  345 ? 59.486  101.035 55.468  1.00 71.44  ? 345  LEU A CB    1 
ATOM   2663  C  CG    . LEU A  1  345 ? 59.978  99.681  55.971  1.00 70.40  ? 345  LEU A CG    1 
ATOM   2664  C  CD1   . LEU A  1  345 ? 59.134  98.594  55.359  1.00 69.05  ? 345  LEU A CD1   1 
ATOM   2665  C  CD2   . LEU A  1  345 ? 61.414  99.483  55.578  1.00 70.76  ? 345  LEU A CD2   1 
ATOM   2666  N  N     . CYS A  1  346 ? 58.787  103.916 54.629  1.00 73.88  ? 346  CYS A N     1 
ATOM   2667  C  CA    . CYS A  1  346 ? 58.591  104.875 53.556  1.00 74.21  ? 346  CYS A CA    1 
ATOM   2668  C  C     . CYS A  1  346 ? 59.172  106.242 53.863  1.00 75.96  ? 346  CYS A C     1 
ATOM   2669  O  O     . CYS A  1  346 ? 59.608  106.942 52.952  1.00 77.23  ? 346  CYS A O     1 
ATOM   2670  C  CB    . CYS A  1  346 ? 57.100  105.054 53.259  1.00 72.27  ? 346  CYS A CB    1 
ATOM   2671  S  SG    . CYS A  1  346 ? 56.184  103.547 52.957  1.00 69.02  ? 346  CYS A SG    1 
ATOM   2672  N  N     . THR A  1  347 ? 59.194  106.620 55.138  1.00 77.43  ? 347  THR A N     1 
ATOM   2673  C  CA    . THR A  1  347 ? 59.653  107.952 55.504  1.00 78.80  ? 347  THR A CA    1 
ATOM   2674  C  C     . THR A  1  347 ? 61.016  108.123 56.131  1.00 79.82  ? 347  THR A C     1 
ATOM   2675  O  O     . THR A  1  347 ? 61.676  109.120 55.873  1.00 79.22  ? 347  THR A O     1 
ATOM   2676  C  CB    . THR A  1  347 ? 58.652  108.638 56.463  1.00 79.84  ? 347  THR A CB    1 
ATOM   2677  O  OG1   . THR A  1  347 ? 58.891  108.197 57.805  1.00 80.35  ? 347  THR A OG1   1 
ATOM   2678  C  CG2   . THR A  1  347 ? 57.214  108.286 56.089  1.00 80.65  ? 347  THR A CG2   1 
ATOM   2679  N  N     . SER A  1  348 ? 61.450  107.173 56.951  1.00 82.18  ? 348  SER A N     1 
ATOM   2680  C  CA    . SER A  1  348 ? 62.731  107.354 57.623  1.00 84.65  ? 348  SER A CA    1 
ATOM   2681  C  C     . SER A  1  348 ? 63.722  106.196 57.714  1.00 86.33  ? 348  SER A C     1 
ATOM   2682  O  O     . SER A  1  348 ? 64.430  106.083 58.719  1.00 86.70  ? 348  SER A O     1 
ATOM   2683  C  CB    . SER A  1  348 ? 62.473  107.883 59.038  1.00 84.41  ? 348  SER A CB    1 
ATOM   2684  O  OG    . SER A  1  348 ? 61.653  106.993 59.774  1.00 85.43  ? 348  SER A OG    1 
ATOM   2685  N  N     . THR A  1  349 ? 63.798  105.351 56.688  1.00 87.81  ? 349  THR A N     1 
ATOM   2686  C  CA    . THR A  1  349 ? 64.741  104.234 56.727  1.00 88.74  ? 349  THR A CA    1 
ATOM   2687  C  C     . THR A  1  349 ? 66.139  104.827 56.831  1.00 89.12  ? 349  THR A C     1 
ATOM   2688  O  O     . THR A  1  349 ? 66.441  105.811 56.160  1.00 89.02  ? 349  THR A O     1 
ATOM   2689  C  CB    . THR A  1  349 ? 64.649  103.378 55.456  1.00 89.05  ? 349  THR A CB    1 
ATOM   2690  O  OG1   . THR A  1  349 ? 63.296  102.959 55.272  1.00 91.07  ? 349  THR A OG1   1 
ATOM   2691  C  CG2   . THR A  1  349 ? 65.521  102.141 55.575  1.00 89.07  ? 349  THR A CG2   1 
ATOM   2692  N  N     . THR A  1  350 ? 66.977  104.236 57.681  1.00 89.77  ? 350  THR A N     1 
ATOM   2693  C  CA    . THR A  1  350 ? 68.350  104.710 57.892  1.00 90.56  ? 350  THR A CA    1 
ATOM   2694  C  C     . THR A  1  350 ? 69.370  103.835 57.168  1.00 91.00  ? 350  THR A C     1 
ATOM   2695  O  O     . THR A  1  350 ? 69.136  102.641 56.948  1.00 92.14  ? 350  THR A O     1 
ATOM   2696  C  CB    . THR A  1  350 ? 68.727  104.697 59.384  1.00 90.98  ? 350  THR A CB    1 
ATOM   2697  O  OG1   . THR A  1  350 ? 69.030  103.355 59.795  1.00 90.55  ? 350  THR A OG1   1 
ATOM   2698  C  CG2   . THR A  1  350 ? 67.577  105.211 60.221  1.00 91.94  ? 350  THR A CG2   1 
ATOM   2699  N  N     . GLU A  1  351 ? 70.510  104.419 56.809  1.00 90.41  ? 351  GLU A N     1 
ATOM   2700  C  CA    . GLU A  1  351 ? 71.535  103.647 56.122  1.00 89.11  ? 351  GLU A CA    1 
ATOM   2701  C  C     . GLU A  1  351 ? 71.917  102.433 56.964  1.00 88.14  ? 351  GLU A C     1 
ATOM   2702  O  O     . GLU A  1  351 ? 72.073  101.335 56.433  1.00 88.38  ? 351  GLU A O     1 
ATOM   2703  C  CB    . GLU A  1  351 ? 72.774  104.503 55.835  1.00 88.89  ? 351  GLU A CB    1 
ATOM   2704  C  CG    . GLU A  1  351 ? 72.609  105.512 54.703  1.00 88.40  ? 351  GLU A CG    1 
ATOM   2705  C  CD    . GLU A  1  351 ? 72.076  104.884 53.416  1.00 89.81  ? 351  GLU A CD    1 
ATOM   2706  O  OE1   . GLU A  1  351 ? 72.245  103.661 53.222  1.00 89.14  ? 351  GLU A OE1   1 
ATOM   2707  O  OE2   . GLU A  1  351 ? 71.495  105.618 52.585  1.00 90.38  ? 351  GLU A OE2   1 
ATOM   2708  N  N     . SER A  1  352 ? 72.049  102.624 58.274  1.00 86.67  ? 352  SER A N     1 
ATOM   2709  C  CA    . SER A  1  352 ? 72.411  101.522 59.161  1.00 86.04  ? 352  SER A CA    1 
ATOM   2710  C  C     . SER A  1  352 ? 71.446  100.363 59.044  1.00 85.76  ? 352  SER A C     1 
ATOM   2711  O  O     . SER A  1  352 ? 71.847  99.201  59.120  1.00 86.24  ? 352  SER A O     1 
ATOM   2712  C  CB    . SER A  1  352 ? 72.455  101.976 60.617  1.00 86.12  ? 352  SER A CB    1 
ATOM   2713  O  OG    . SER A  1  352 ? 73.611  102.747 60.872  1.00 86.92  ? 352  SER A OG    1 
ATOM   2714  N  N     . GLU A  1  353 ? 70.170  100.679 58.865  1.00 85.59  ? 353  GLU A N     1 
ATOM   2715  C  CA    . GLU A  1  353 ? 69.152  99.647  58.739  1.00 85.82  ? 353  GLU A CA    1 
ATOM   2716  C  C     . GLU A  1  353 ? 69.364  98.807  57.493  1.00 85.78  ? 353  GLU A C     1 
ATOM   2717  O  O     . GLU A  1  353 ? 69.444  97.575  57.570  1.00 84.77  ? 353  GLU A O     1 
ATOM   2718  C  CB    . GLU A  1  353 ? 67.761  100.269 58.674  1.00 85.47  ? 353  GLU A CB    1 
ATOM   2719  C  CG    . GLU A  1  353 ? 67.350  101.022 59.908  1.00 85.17  ? 353  GLU A CG    1 
ATOM   2720  C  CD    . GLU A  1  353 ? 65.929  101.511 59.810  1.00 85.87  ? 353  GLU A CD    1 
ATOM   2721  O  OE1   . GLU A  1  353 ? 65.633  102.279 58.868  1.00 84.47  ? 353  GLU A OE1   1 
ATOM   2722  O  OE2   . GLU A  1  353 ? 65.105  101.123 60.670  1.00 87.61  ? 353  GLU A OE2   1 
ATOM   2723  N  N     . VAL A  1  354 ? 69.447  99.480  56.346  1.00 85.94  ? 354  VAL A N     1 
ATOM   2724  C  CA    . VAL A  1  354 ? 69.638  98.788  55.077  1.00 87.32  ? 354  VAL A CA    1 
ATOM   2725  C  C     . VAL A  1  354 ? 70.932  97.985  55.073  1.00 87.53  ? 354  VAL A C     1 
ATOM   2726  O  O     . VAL A  1  354 ? 71.001  96.939  54.431  1.00 87.60  ? 354  VAL A O     1 
ATOM   2727  C  CB    . VAL A  1  354 ? 69.648  99.768  53.878  1.00 87.39  ? 354  VAL A CB    1 
ATOM   2728  C  CG1   . VAL A  1  354 ? 68.443  100.682 53.947  1.00 87.99  ? 354  VAL A CG1   1 
ATOM   2729  C  CG2   . VAL A  1  354 ? 70.920  100.575 53.872  1.00 88.77  ? 354  VAL A CG2   1 
ATOM   2730  N  N     . LYS A  1  355 ? 71.952  98.467  55.787  1.00 87.62  ? 355  LYS A N     1 
ATOM   2731  C  CA    . LYS A  1  355 ? 73.224  97.755  55.854  1.00 87.12  ? 355  LYS A CA    1 
ATOM   2732  C  C     . LYS A  1  355 ? 72.981  96.400  56.485  1.00 86.72  ? 355  LYS A C     1 
ATOM   2733  O  O     . LYS A  1  355 ? 73.378  95.373  55.942  1.00 88.05  ? 355  LYS A O     1 
ATOM   2734  C  CB    . LYS A  1  355 ? 74.257  98.516  56.684  1.00 87.35  ? 355  LYS A CB    1 
ATOM   2735  C  CG    . LYS A  1  355 ? 75.556  97.742  56.822  1.00 89.54  ? 355  LYS A CG    1 
ATOM   2736  C  CD    . LYS A  1  355 ? 76.680  98.545  57.449  1.00 91.07  ? 355  LYS A CD    1 
ATOM   2737  C  CE    . LYS A  1  355 ? 77.937  97.680  57.597  1.00 91.96  ? 355  LYS A CE    1 
ATOM   2738  N  NZ    . LYS A  1  355 ? 79.024  98.344  58.381  1.00 92.34  ? 355  LYS A NZ    1 
ATOM   2739  N  N     . ARG A  1  356 ? 72.323  96.400  57.636  1.00 86.11  ? 356  ARG A N     1 
ATOM   2740  C  CA    . ARG A  1  356 ? 72.009  95.159  58.331  1.00 85.57  ? 356  ARG A CA    1 
ATOM   2741  C  C     . ARG A  1  356 ? 71.099  94.308  57.456  1.00 85.15  ? 356  ARG A C     1 
ATOM   2742  O  O     . ARG A  1  356 ? 71.324  93.113  57.258  1.00 84.83  ? 356  ARG A O     1 
ATOM   2743  C  CB    . ARG A  1  356 ? 71.295  95.468  59.636  1.00 85.52  ? 356  ARG A CB    1 
ATOM   2744  C  CG    . ARG A  1  356 ? 71.066  94.263  60.494  1.00 86.73  ? 356  ARG A CG    1 
ATOM   2745  C  CD    . ARG A  1  356 ? 70.228  94.631  61.694  1.00 89.37  ? 356  ARG A CD    1 
ATOM   2746  N  NE    . ARG A  1  356 ? 68.801  94.690  61.376  1.00 92.53  ? 356  ARG A NE    1 
ATOM   2747  C  CZ    . ARG A  1  356 ? 68.037  95.776  61.501  1.00 93.57  ? 356  ARG A CZ    1 
ATOM   2748  N  NH1   . ARG A  1  356 ? 68.557  96.922  61.938  1.00 92.22  ? 356  ARG A NH1   1 
ATOM   2749  N  NH2   . ARG A  1  356 ? 66.741  95.707  61.204  1.00 93.41  ? 356  ARG A NH2   1 
ATOM   2750  N  N     . ALA A  1  357 ? 70.061  94.951  56.937  1.00 85.20  ? 357  ALA A N     1 
ATOM   2751  C  CA    . ALA A  1  357 ? 69.084  94.298  56.080  1.00 85.17  ? 357  ALA A CA    1 
ATOM   2752  C  C     . ALA A  1  357 ? 69.731  93.572  54.904  1.00 84.81  ? 357  ALA A C     1 
ATOM   2753  O  O     . ALA A  1  357 ? 69.412  92.417  54.628  1.00 84.66  ? 357  ALA A O     1 
ATOM   2754  C  CB    . ALA A  1  357 ? 68.074  95.332  55.572  1.00 85.65  ? 357  ALA A CB    1 
ATOM   2755  N  N     . LYS A  1  358 ? 70.634  94.255  54.210  1.00 84.65  ? 358  LYS A N     1 
ATOM   2756  C  CA    . LYS A  1  358 ? 71.316  93.661  53.072  1.00 84.62  ? 358  LYS A CA    1 
ATOM   2757  C  C     . LYS A  1  358 ? 72.098  92.427  53.505  1.00 84.60  ? 358  LYS A C     1 
ATOM   2758  O  O     . LYS A  1  358 ? 72.018  91.388  52.851  1.00 83.97  ? 358  LYS A O     1 
ATOM   2759  C  CB    . LYS A  1  358 ? 72.234  94.693  52.416  1.00 85.12  ? 358  LYS A CB    1 
ATOM   2760  C  CG    . LYS A  1  358 ? 71.454  95.824  51.769  1.00 86.84  ? 358  LYS A CG    1 
ATOM   2761  C  CD    . LYS A  1  358 ? 72.269  97.097  51.570  1.00 87.70  ? 358  LYS A CD    1 
ATOM   2762  C  CE    . LYS A  1  358 ? 73.285  96.977  50.448  1.00 88.03  ? 358  LYS A CE    1 
ATOM   2763  N  NZ    . LYS A  1  358 ? 73.879  98.311  50.129  1.00 87.60  ? 358  LYS A NZ    1 
ATOM   2764  N  N     . ASN A  1  359 ? 72.840  92.525  54.606  1.00 84.52  ? 359  ASN A N     1 
ATOM   2765  C  CA    . ASN A  1  359 ? 73.598  91.373  55.078  1.00 86.01  ? 359  ASN A CA    1 
ATOM   2766  C  C     . ASN A  1  359 ? 72.666  90.218  55.379  1.00 86.03  ? 359  ASN A C     1 
ATOM   2767  O  O     . ASN A  1  359 ? 72.859  89.102  54.897  1.00 86.79  ? 359  ASN A O     1 
ATOM   2768  C  CB    . ASN A  1  359 ? 74.387  91.699  56.340  1.00 87.46  ? 359  ASN A CB    1 
ATOM   2769  C  CG    . ASN A  1  359 ? 75.579  92.565  56.061  1.00 90.03  ? 359  ASN A CG    1 
ATOM   2770  O  OD1   . ASN A  1  359 ? 76.161  92.510  54.972  1.00 91.48  ? 359  ASN A OD1   1 
ATOM   2771  N  ND2   . ASN A  1  359 ? 75.972  93.363  57.050  1.00 91.24  ? 359  ASN A ND2   1 
ATOM   2772  N  N     . HIS A  1  360 ? 71.650  90.485  56.187  1.00 85.34  ? 360  HIS A N     1 
ATOM   2773  C  CA    . HIS A  1  360 ? 70.700  89.446  56.536  1.00 84.11  ? 360  HIS A CA    1 
ATOM   2774  C  C     . HIS A  1  360 ? 70.146  88.809  55.260  1.00 82.71  ? 360  HIS A C     1 
ATOM   2775  O  O     . HIS A  1  360 ? 70.066  87.582  55.157  1.00 81.91  ? 360  HIS A O     1 
ATOM   2776  C  CB    . HIS A  1  360 ? 69.573  90.036  57.401  1.00 84.60  ? 360  HIS A CB    1 
ATOM   2777  C  CG    . HIS A  1  360 ? 68.482  89.061  57.723  1.00 85.17  ? 360  HIS A CG    1 
ATOM   2778  N  ND1   . HIS A  1  360 ? 68.722  87.844  58.322  1.00 85.80  ? 360  HIS A ND1   1 
ATOM   2779  C  CD2   . HIS A  1  360 ? 67.147  89.113  57.503  1.00 85.79  ? 360  HIS A CD2   1 
ATOM   2780  C  CE1   . HIS A  1  360 ? 67.585  87.186  58.453  1.00 85.54  ? 360  HIS A CE1   1 
ATOM   2781  N  NE2   . HIS A  1  360 ? 66.613  87.934  57.963  1.00 86.00  ? 360  HIS A NE2   1 
ATOM   2782  N  N     . LEU A  1  361 ? 69.798  89.646  54.282  1.00 81.44  ? 361  LEU A N     1 
ATOM   2783  C  CA    . LEU A  1  361 ? 69.241  89.163  53.016  1.00 80.34  ? 361  LEU A CA    1 
ATOM   2784  C  C     . LEU A  1  361 ? 70.176  88.205  52.295  1.00 81.16  ? 361  LEU A C     1 
ATOM   2785  O  O     . LEU A  1  361 ? 69.774  87.092  51.937  1.00 80.14  ? 361  LEU A O     1 
ATOM   2786  C  CB    . LEU A  1  361 ? 68.894  90.338  52.094  1.00 77.42  ? 361  LEU A CB    1 
ATOM   2787  C  CG    . LEU A  1  361 ? 68.280  89.964  50.744  1.00 74.89  ? 361  LEU A CG    1 
ATOM   2788  C  CD1   . LEU A  1  361 ? 67.211  88.912  50.939  1.00 73.70  ? 361  LEU A CD1   1 
ATOM   2789  C  CD2   . LEU A  1  361 ? 67.701  91.199  50.083  1.00 74.18  ? 361  LEU A CD2   1 
ATOM   2790  N  N     . ARG A  1  362 ? 71.420  88.638  52.083  1.00 82.20  ? 362  ARG A N     1 
ATOM   2791  C  CA    . ARG A  1  362 ? 72.417  87.809  51.406  1.00 82.67  ? 362  ARG A CA    1 
ATOM   2792  C  C     . ARG A  1  362 ? 72.471  86.436  52.068  1.00 82.85  ? 362  ARG A C     1 
ATOM   2793  O  O     . ARG A  1  362 ? 72.502  85.413  51.385  1.00 82.86  ? 362  ARG A O     1 
ATOM   2794  C  CB    . ARG A  1  362 ? 73.816  88.446  51.469  1.00 82.80  ? 362  ARG A CB    1 
ATOM   2795  C  CG    . ARG A  1  362 ? 73.981  89.790  50.760  1.00 82.59  ? 362  ARG A CG    1 
ATOM   2796  C  CD    . ARG A  1  362 ? 75.460  90.184  50.683  1.00 81.85  ? 362  ARG A CD    1 
ATOM   2797  N  NE    . ARG A  1  362 ? 75.682  91.528  50.144  1.00 82.12  ? 362  ARG A NE    1 
ATOM   2798  C  CZ    . ARG A  1  362 ? 75.749  92.640  50.879  1.00 82.40  ? 362  ARG A CZ    1 
ATOM   2799  N  NH1   . ARG A  1  362 ? 75.617  92.570  52.199  1.00 81.68  ? 362  ARG A NH1   1 
ATOM   2800  N  NH2   . ARG A  1  362 ? 75.937  93.826  50.294  1.00 81.28  ? 362  ARG A NH2   1 
ATOM   2801  N  N     . SER A  1  363 ? 72.476  86.430  53.401  1.00 82.87  ? 363  SER A N     1 
ATOM   2802  C  CA    . SER A  1  363 ? 72.533  85.196  54.182  1.00 83.78  ? 363  SER A CA    1 
ATOM   2803  C  C     . SER A  1  363 ? 71.366  84.261  53.886  1.00 83.79  ? 363  SER A C     1 
ATOM   2804  O  O     . SER A  1  363 ? 71.529  83.037  53.832  1.00 83.03  ? 363  SER A O     1 
ATOM   2805  C  CB    . SER A  1  363 ? 72.555  85.523  55.676  1.00 84.89  ? 363  SER A CB    1 
ATOM   2806  O  OG    . SER A  1  363 ? 73.745  86.197  56.046  1.00 87.16  ? 363  SER A OG    1 
ATOM   2807  N  N     . ALA A  1  364 ? 70.185  84.848  53.715  1.00 84.15  ? 364  ALA A N     1 
ATOM   2808  C  CA    . ALA A  1  364 ? 68.986  84.082  53.411  1.00 84.04  ? 364  ALA A CA    1 
ATOM   2809  C  C     . ALA A  1  364 ? 69.116  83.590  51.978  1.00 83.57  ? 364  ALA A C     1 
ATOM   2810  O  O     . ALA A  1  364 ? 68.785  82.450  51.667  1.00 83.63  ? 364  ALA A O     1 
ATOM   2811  C  CB    . ALA A  1  364 ? 67.761  84.960  53.554  1.00 84.63  ? 364  ALA A CB    1 
ATOM   2812  N  N     . MET A  1  365 ? 69.610  84.474  51.118  1.00 82.78  ? 365  MET A N     1 
ATOM   2813  C  CA    . MET A  1  365 ? 69.827  84.184  49.707  1.00 82.34  ? 365  MET A CA    1 
ATOM   2814  C  C     . MET A  1  365 ? 70.699  82.943  49.544  1.00 82.08  ? 365  MET A C     1 
ATOM   2815  O  O     . MET A  1  365 ? 70.454  82.093  48.690  1.00 81.70  ? 365  MET A O     1 
ATOM   2816  C  CB    . MET A  1  365 ? 70.500  85.387  49.069  1.00 83.09  ? 365  MET A CB    1 
ATOM   2817  C  CG    . MET A  1  365 ? 71.084  85.153  47.711  1.00 85.56  ? 365  MET A CG    1 
ATOM   2818  S  SD    . MET A  1  365 ? 71.820  86.700  47.142  1.00 90.31  ? 365  MET A SD    1 
ATOM   2819  C  CE    . MET A  1  365 ? 73.398  86.707  48.035  1.00 90.67  ? 365  MET A CE    1 
ATOM   2820  N  N     . VAL A  1  366 ? 71.726  82.855  50.377  1.00 81.69  ? 366  VAL A N     1 
ATOM   2821  C  CA    . VAL A  1  366 ? 72.639  81.731  50.362  1.00 81.03  ? 366  VAL A CA    1 
ATOM   2822  C  C     . VAL A  1  366 ? 71.942  80.477  50.876  1.00 81.22  ? 366  VAL A C     1 
ATOM   2823  O  O     . VAL A  1  366 ? 72.094  79.402  50.307  1.00 82.25  ? 366  VAL A O     1 
ATOM   2824  C  CB    . VAL A  1  366 ? 73.875  82.034  51.232  1.00 81.03  ? 366  VAL A CB    1 
ATOM   2825  C  CG1   . VAL A  1  366 ? 74.655  80.769  51.510  1.00 79.93  ? 366  VAL A CG1   1 
ATOM   2826  C  CG2   . VAL A  1  366 ? 74.750  83.054  50.524  1.00 81.38  ? 366  VAL A CG2   1 
ATOM   2827  N  N     . ALA A  1  367 ? 71.171  80.606  51.948  1.00 80.91  ? 367  ALA A N     1 
ATOM   2828  C  CA    . ALA A  1  367 ? 70.481  79.444  52.494  1.00 81.33  ? 367  ALA A CA    1 
ATOM   2829  C  C     . ALA A  1  367 ? 69.469  78.876  51.502  1.00 81.86  ? 367  ALA A C     1 
ATOM   2830  O  O     . ALA A  1  367 ? 68.973  77.760  51.668  1.00 81.26  ? 367  ALA A O     1 
ATOM   2831  C  CB    . ALA A  1  367 ? 69.794  79.809  53.790  1.00 81.13  ? 367  ALA A CB    1 
ATOM   2832  N  N     . GLN A  1  368 ? 69.168  79.646  50.464  1.00 83.10  ? 368  GLN A N     1 
ATOM   2833  C  CA    . GLN A  1  368 ? 68.216  79.212  49.450  1.00 84.93  ? 368  GLN A CA    1 
ATOM   2834  C  C     . GLN A  1  368 ? 68.869  78.162  48.560  1.00 85.86  ? 368  GLN A C     1 
ATOM   2835  O  O     . GLN A  1  368 ? 68.210  77.497  47.759  1.00 86.36  ? 368  GLN A O     1 
ATOM   2836  C  CB    . GLN A  1  368 ? 67.772  80.410  48.605  1.00 85.94  ? 368  GLN A CB    1 
ATOM   2837  C  CG    . GLN A  1  368 ? 67.062  81.516  49.399  1.00 87.91  ? 368  GLN A CG    1 
ATOM   2838  C  CD    . GLN A  1  368 ? 65.561  81.266  49.595  1.00 88.18  ? 368  GLN A CD    1 
ATOM   2839  O  OE1   . GLN A  1  368 ? 64.748  81.560  48.710  1.00 86.04  ? 368  GLN A OE1   1 
ATOM   2840  N  NE2   . GLN A  1  368 ? 65.193  80.716  50.757  1.00 87.94  ? 368  GLN A NE2   1 
ATOM   2841  N  N     . LEU A  1  369 ? 70.179  78.017  48.708  1.00 86.20  ? 369  LEU A N     1 
ATOM   2842  C  CA    . LEU A  1  369 ? 70.934  77.058  47.918  1.00 85.39  ? 369  LEU A CA    1 
ATOM   2843  C  C     . LEU A  1  369 ? 71.747  76.167  48.851  1.00 85.16  ? 369  LEU A C     1 
ATOM   2844  O  O     . LEU A  1  369 ? 72.956  76.022  48.703  1.00 86.14  ? 369  LEU A O     1 
ATOM   2845  C  CB    . LEU A  1  369 ? 71.850  77.813  46.959  1.00 85.42  ? 369  LEU A CB    1 
ATOM   2846  C  CG    . LEU A  1  369 ? 71.139  78.889  46.135  1.00 84.65  ? 369  LEU A CG    1 
ATOM   2847  C  CD1   . LEU A  1  369 ? 72.131  79.605  45.239  1.00 84.89  ? 369  LEU A CD1   1 
ATOM   2848  C  CD2   . LEU A  1  369 ? 70.048  78.237  45.312  1.00 84.34  ? 369  LEU A CD2   1 
ATOM   2849  N  N     . ASP A  1  370 ? 71.060  75.568  49.814  1.00 84.70  ? 370  ASP A N     1 
ATOM   2850  C  CA    . ASP A  1  370 ? 71.698  74.707  50.793  1.00 83.30  ? 370  ASP A CA    1 
ATOM   2851  C  C     . ASP A  1  370 ? 71.355  73.257  50.511  1.00 82.37  ? 370  ASP A C     1 
ATOM   2852  O  O     . ASP A  1  370 ? 70.685  72.591  51.309  1.00 82.50  ? 370  ASP A O     1 
ATOM   2853  C  CB    . ASP A  1  370 ? 71.226  75.091  52.192  1.00 84.00  ? 370  ASP A CB    1 
ATOM   2854  C  CG    . ASP A  1  370 ? 72.165  74.630  53.263  1.00 84.37  ? 370  ASP A CG    1 
ATOM   2855  O  OD1   . ASP A  1  370 ? 73.368  74.945  53.146  1.00 86.09  ? 370  ASP A OD1   1 
ATOM   2856  O  OD2   . ASP A  1  370 ? 71.704  73.968  54.216  1.00 84.17  ? 370  ASP A OD2   1 
ATOM   2857  N  N     . GLY A  1  371 ? 71.813  72.772  49.364  1.00 80.99  ? 371  GLY A N     1 
ATOM   2858  C  CA    . GLY A  1  371 ? 71.545  71.394  49.000  1.00 80.19  ? 371  GLY A CA    1 
ATOM   2859  C  C     . GLY A  1  371 ? 71.096  71.251  47.565  1.00 78.61  ? 371  GLY A C     1 
ATOM   2860  O  O     . GLY A  1  371 ? 70.610  72.203  46.965  1.00 77.42  ? 371  GLY A O     1 
ATOM   2861  N  N     . THR A  1  372 ? 71.257  70.059  47.006  1.00 78.20  ? 372  THR A N     1 
ATOM   2862  C  CA    . THR A  1  372 ? 70.857  69.848  45.628  1.00 78.68  ? 372  THR A CA    1 
ATOM   2863  C  C     . THR A  1  372 ? 69.397  70.218  45.423  1.00 78.83  ? 372  THR A C     1 
ATOM   2864  O  O     . THR A  1  372 ? 69.063  70.940  44.482  1.00 80.05  ? 372  THR A O     1 
ATOM   2865  C  CB    . THR A  1  372 ? 71.077  68.391  45.190  1.00 78.22  ? 372  THR A CB    1 
ATOM   2866  O  OG1   . THR A  1  372 ? 70.339  67.509  46.040  1.00 77.12  ? 372  THR A OG1   1 
ATOM   2867  C  CG2   . THR A  1  372 ? 72.539  68.048  45.269  1.00 79.17  ? 372  THR A CG2   1 
ATOM   2868  N  N     . THR A  1  373 ? 68.524  69.752  46.309  1.00 77.71  ? 373  THR A N     1 
ATOM   2869  C  CA    . THR A  1  373 ? 67.107  70.063  46.160  1.00 76.91  ? 373  THR A CA    1 
ATOM   2870  C  C     . THR A  1  373 ? 66.833  71.578  46.111  1.00 75.87  ? 373  THR A C     1 
ATOM   2871  O  O     . THR A  1  373 ? 66.294  72.079  45.124  1.00 75.29  ? 373  THR A O     1 
ATOM   2872  C  CB    . THR A  1  373 ? 66.278  69.399  47.271  1.00 76.23  ? 373  THR A CB    1 
ATOM   2873  O  OG1   . THR A  1  373 ? 66.742  68.057  47.454  1.00 77.15  ? 373  THR A OG1   1 
ATOM   2874  C  CG2   . THR A  1  373 ? 64.808  69.335  46.873  1.00 74.40  ? 373  THR A CG2   1 
ATOM   2875  N  N     . PRO A  1  374 ? 67.210  72.329  47.160  1.00 75.09  ? 374  PRO A N     1 
ATOM   2876  C  CA    . PRO A  1  374 ? 66.948  73.772  47.103  1.00 74.96  ? 374  PRO A CA    1 
ATOM   2877  C  C     . PRO A  1  374 ? 67.561  74.424  45.861  1.00 75.22  ? 374  PRO A C     1 
ATOM   2878  O  O     . PRO A  1  374 ? 66.926  75.236  45.195  1.00 75.11  ? 374  PRO A O     1 
ATOM   2879  C  CB    . PRO A  1  374 ? 67.575  74.295  48.399  1.00 74.36  ? 374  PRO A CB    1 
ATOM   2880  C  CG    . PRO A  1  374 ? 67.432  73.143  49.330  1.00 75.39  ? 374  PRO A CG    1 
ATOM   2881  C  CD    . PRO A  1  374 ? 67.799  71.954  48.457  1.00 75.49  ? 374  PRO A CD    1 
ATOM   2882  N  N     . VAL A  1  375 ? 68.799  74.064  45.550  1.00 76.22  ? 375  VAL A N     1 
ATOM   2883  C  CA    . VAL A  1  375 ? 69.472  74.634  44.392  1.00 77.26  ? 375  VAL A CA    1 
ATOM   2884  C  C     . VAL A  1  375 ? 68.651  74.363  43.151  1.00 77.31  ? 375  VAL A C     1 
ATOM   2885  O  O     . VAL A  1  375 ? 68.404  75.257  42.336  1.00 76.93  ? 375  VAL A O     1 
ATOM   2886  C  CB    . VAL A  1  375 ? 70.858  74.018  44.186  1.00 77.32  ? 375  VAL A CB    1 
ATOM   2887  C  CG1   . VAL A  1  375 ? 71.497  74.600  42.936  1.00 77.65  ? 375  VAL A CG1   1 
ATOM   2888  C  CG2   . VAL A  1  375 ? 71.725  74.284  45.396  1.00 78.75  ? 375  VAL A CG2   1 
ATOM   2889  N  N     . CYS A  1  376 ? 68.239  73.110  43.022  1.00 77.52  ? 376  CYS A N     1 
ATOM   2890  C  CA    . CYS A  1  376 ? 67.440  72.662  41.897  1.00 78.81  ? 376  CYS A CA    1 
ATOM   2891  C  C     . CYS A  1  376 ? 66.196  73.541  41.801  1.00 79.66  ? 376  CYS A C     1 
ATOM   2892  O  O     . CYS A  1  376 ? 65.889  74.106  40.746  1.00 80.13  ? 376  CYS A O     1 
ATOM   2893  C  CB    . CYS A  1  376 ? 67.041  71.209  42.119  1.00 78.78  ? 376  CYS A CB    1 
ATOM   2894  S  SG    . CYS A  1  376 ? 66.826  70.279  40.608  1.00 82.77  ? 376  CYS A SG    1 
ATOM   2895  N  N     . GLU A  1  377 ? 65.490  73.646  42.925  1.00 80.16  ? 377  GLU A N     1 
ATOM   2896  C  CA    . GLU A  1  377 ? 64.276  74.455  43.045  1.00 79.43  ? 377  GLU A CA    1 
ATOM   2897  C  C     . GLU A  1  377 ? 64.495  75.897  42.561  1.00 78.50  ? 377  GLU A C     1 
ATOM   2898  O  O     . GLU A  1  377 ? 63.582  76.526  42.028  1.00 78.42  ? 377  GLU A O     1 
ATOM   2899  C  CB    . GLU A  1  377 ? 63.815  74.456  44.512  1.00 79.26  ? 377  GLU A CB    1 
ATOM   2900  C  CG    . GLU A  1  377 ? 62.685  75.411  44.835  1.00 79.55  ? 377  GLU A CG    1 
ATOM   2901  C  CD    . GLU A  1  377 ? 61.378  74.992  44.205  1.00 81.10  ? 377  GLU A CD    1 
ATOM   2902  O  OE1   . GLU A  1  377 ? 60.924  73.865  44.500  1.00 81.42  ? 377  GLU A OE1   1 
ATOM   2903  O  OE2   . GLU A  1  377 ? 60.806  75.786  43.421  1.00 80.76  ? 377  GLU A OE2   1 
ATOM   2904  N  N     . THR A  1  378 ? 65.702  76.417  42.745  1.00 77.13  ? 378  THR A N     1 
ATOM   2905  C  CA    . THR A  1  378 ? 65.996  77.774  42.322  1.00 76.73  ? 378  THR A CA    1 
ATOM   2906  C  C     . THR A  1  378 ? 66.126  77.849  40.813  1.00 77.40  ? 378  THR A C     1 
ATOM   2907  O  O     . THR A  1  378 ? 65.706  78.825  40.184  1.00 77.37  ? 378  THR A O     1 
ATOM   2908  C  CB    . THR A  1  378 ? 67.283  78.273  42.958  1.00 76.13  ? 378  THR A CB    1 
ATOM   2909  O  OG1   . THR A  1  378 ? 67.113  78.327  44.378  1.00 76.80  ? 378  THR A OG1   1 
ATOM   2910  C  CG2   . THR A  1  378 ? 67.622  79.654  42.443  1.00 75.44  ? 378  THR A CG2   1 
ATOM   2911  N  N     . ILE A  1  379 ? 66.716  76.810  40.236  1.00 78.04  ? 379  ILE A N     1 
ATOM   2912  C  CA    . ILE A  1  379 ? 66.902  76.737  38.790  1.00 78.82  ? 379  ILE A CA    1 
ATOM   2913  C  C     . ILE A  1  379 ? 65.526  76.643  38.134  1.00 78.87  ? 379  ILE A C     1 
ATOM   2914  O  O     . ILE A  1  379 ? 65.121  77.517  37.346  1.00 77.94  ? 379  ILE A O     1 
ATOM   2915  C  CB    . ILE A  1  379 ? 67.760  75.481  38.397  1.00 79.20  ? 379  ILE A CB    1 
ATOM   2916  C  CG1   . ILE A  1  379 ? 69.202  75.655  38.910  1.00 79.12  ? 379  ILE A CG1   1 
ATOM   2917  C  CG2   . ILE A  1  379 ? 67.726  75.258  36.878  1.00 76.69  ? 379  ILE A CG2   1 
ATOM   2918  C  CD1   . ILE A  1  379 ? 70.010  74.373  38.945  1.00 77.04  ? 379  ILE A CD1   1 
ATOM   2919  N  N     . GLY A  1  380 ? 64.809  75.578  38.484  1.00 78.51  ? 380  GLY A N     1 
ATOM   2920  C  CA    . GLY A  1  380 ? 63.489  75.360  37.926  1.00 78.15  ? 380  GLY A CA    1 
ATOM   2921  C  C     . GLY A  1  380 ? 62.652  76.619  37.962  1.00 77.17  ? 380  GLY A C     1 
ATOM   2922  O  O     . GLY A  1  380 ? 61.987  76.977  36.985  1.00 77.43  ? 380  GLY A O     1 
ATOM   2923  N  N     . SER A  1  381 ? 62.706  77.307  39.095  1.00 75.59  ? 381  SER A N     1 
ATOM   2924  C  CA    . SER A  1  381 ? 61.935  78.512  39.279  1.00 73.06  ? 381  SER A CA    1 
ATOM   2925  C  C     . SER A  1  381 ? 62.519  79.688  38.548  1.00 73.30  ? 381  SER A C     1 
ATOM   2926  O  O     . SER A  1  381 ? 61.793  80.432  37.903  1.00 72.91  ? 381  SER A O     1 
ATOM   2927  C  CB    . SER A  1  381 ? 61.810  78.812  40.760  1.00 71.94  ? 381  SER A CB    1 
ATOM   2928  O  OG    . SER A  1  381 ? 61.053  77.796  41.391  1.00 72.55  ? 381  SER A OG    1 
ATOM   2929  N  N     . HIS A  1  382 ? 63.827  79.876  38.630  1.00 74.49  ? 382  HIS A N     1 
ATOM   2930  C  CA    . HIS A  1  382 ? 64.404  81.003  37.923  1.00 76.19  ? 382  HIS A CA    1 
ATOM   2931  C  C     . HIS A  1  382 ? 64.024  80.965  36.442  1.00 76.69  ? 382  HIS A C     1 
ATOM   2932  O  O     . HIS A  1  382 ? 63.411  81.898  35.927  1.00 76.68  ? 382  HIS A O     1 
ATOM   2933  C  CB    . HIS A  1  382 ? 65.920  81.020  38.067  1.00 77.11  ? 382  HIS A CB    1 
ATOM   2934  C  CG    . HIS A  1  382 ? 66.400  81.706  39.304  1.00 78.64  ? 382  HIS A CG    1 
ATOM   2935  N  ND1   . HIS A  1  382 ? 67.603  82.376  39.360  1.00 80.94  ? 382  HIS A ND1   1 
ATOM   2936  C  CD2   . HIS A  1  382 ? 65.846  81.824  40.532  1.00 78.96  ? 382  HIS A CD2   1 
ATOM   2937  C  CE1   . HIS A  1  382 ? 67.769  82.881  40.570  1.00 81.11  ? 382  HIS A CE1   1 
ATOM   2938  N  NE2   . HIS A  1  382 ? 66.717  82.560  41.301  1.00 80.57  ? 382  HIS A NE2   1 
ATOM   2939  N  N     . LEU A  1  383 ? 64.379  79.883  35.759  1.00 76.78  ? 383  LEU A N     1 
ATOM   2940  C  CA    . LEU A  1  383 ? 64.065  79.766  34.341  1.00 77.27  ? 383  LEU A CA    1 
ATOM   2941  C  C     . LEU A  1  383 ? 62.601  80.046  34.108  1.00 76.77  ? 383  LEU A C     1 
ATOM   2942  O  O     . LEU A  1  383 ? 62.230  80.846  33.253  1.00 77.01  ? 383  LEU A O     1 
ATOM   2943  C  CB    . LEU A  1  383 ? 64.372  78.359  33.841  1.00 77.61  ? 383  LEU A CB    1 
ATOM   2944  C  CG    . LEU A  1  383 ? 65.829  77.938  33.947  1.00 77.35  ? 383  LEU A CG    1 
ATOM   2945  C  CD1   . LEU A  1  383 ? 65.948  76.591  33.285  1.00 78.28  ? 383  LEU A CD1   1 
ATOM   2946  C  CD2   . LEU A  1  383 ? 66.759  78.964  33.286  1.00 74.58  ? 383  LEU A CD2   1 
ATOM   2947  N  N     . LEU A  1  384 ? 61.781  79.355  34.886  1.00 76.38  ? 384  LEU A N     1 
ATOM   2948  C  CA    . LEU A  1  384 ? 60.340  79.469  34.812  1.00 75.55  ? 384  LEU A CA    1 
ATOM   2949  C  C     . LEU A  1  384 ? 59.876  80.920  35.011  1.00 75.83  ? 384  LEU A C     1 
ATOM   2950  O  O     . LEU A  1  384 ? 59.089  81.433  34.220  1.00 75.16  ? 384  LEU A O     1 
ATOM   2951  C  CB    . LEU A  1  384 ? 59.726  78.540  35.868  1.00 74.78  ? 384  LEU A CB    1 
ATOM   2952  C  CG    . LEU A  1  384 ? 58.413  77.814  35.546  1.00 76.48  ? 384  LEU A CG    1 
ATOM   2953  C  CD1   . LEU A  1  384 ? 58.500  77.184  34.157  1.00 77.08  ? 384  LEU A CD1   1 
ATOM   2954  C  CD2   . LEU A  1  384 ? 58.122  76.743  36.607  1.00 75.27  ? 384  LEU A CD2   1 
ATOM   2955  N  N     . ASN A  1  385 ? 60.393  81.583  36.048  1.00 76.44  ? 385  ASN A N     1 
ATOM   2956  C  CA    . ASN A  1  385 ? 60.008  82.959  36.375  1.00 76.36  ? 385  ASN A CA    1 
ATOM   2957  C  C     . ASN A  1  385 ? 60.820  84.053  35.717  1.00 76.27  ? 385  ASN A C     1 
ATOM   2958  O  O     . ASN A  1  385 ? 60.279  84.849  34.963  1.00 75.37  ? 385  ASN A O     1 
ATOM   2959  C  CB    . ASN A  1  385 ? 60.036  83.174  37.895  1.00 76.96  ? 385  ASN A CB    1 
ATOM   2960  C  CG    . ASN A  1  385 ? 58.842  82.538  38.593  1.00 79.41  ? 385  ASN A CG    1 
ATOM   2961  O  OD1   . ASN A  1  385 ? 57.691  82.749  38.196  1.00 81.21  ? 385  ASN A OD1   1 
ATOM   2962  N  ND2   . ASN A  1  385 ? 59.106  81.762  39.640  1.00 79.83  ? 385  ASN A ND2   1 
ATOM   2963  N  N     . TYR A  1  386 ? 62.112  84.101  36.028  1.00 77.21  ? 386  TYR A N     1 
ATOM   2964  C  CA    . TYR A  1  386 ? 63.012  85.106  35.474  1.00 76.53  ? 386  TYR A CA    1 
ATOM   2965  C  C     . TYR A  1  386 ? 63.500  84.800  34.066  1.00 76.72  ? 386  TYR A C     1 
ATOM   2966  O  O     . TYR A  1  386 ? 64.211  85.603  33.482  1.00 76.62  ? 386  TYR A O     1 
ATOM   2967  C  CB    . TYR A  1  386 ? 64.217  85.283  36.388  1.00 76.66  ? 386  TYR A CB    1 
ATOM   2968  C  CG    . TYR A  1  386 ? 63.852  85.820  37.739  1.00 78.80  ? 386  TYR A CG    1 
ATOM   2969  C  CD1   . TYR A  1  386 ? 63.081  86.967  37.850  1.00 79.89  ? 386  TYR A CD1   1 
ATOM   2970  C  CD2   . TYR A  1  386 ? 64.282  85.193  38.913  1.00 79.96  ? 386  TYR A CD2   1 
ATOM   2971  C  CE1   . TYR A  1  386 ? 62.739  87.490  39.095  1.00 82.71  ? 386  TYR A CE1   1 
ATOM   2972  C  CE2   . TYR A  1  386 ? 63.947  85.707  40.174  1.00 80.47  ? 386  TYR A CE2   1 
ATOM   2973  C  CZ    . TYR A  1  386 ? 63.170  86.860  40.252  1.00 82.71  ? 386  TYR A CZ    1 
ATOM   2974  O  OH    . TYR A  1  386 ? 62.793  87.402  41.465  1.00 84.55  ? 386  TYR A OH    1 
ATOM   2975  N  N     . GLY A  1  387 ? 63.135  83.644  33.522  1.00 77.28  ? 387  GLY A N     1 
ATOM   2976  C  CA    . GLY A  1  387 ? 63.570  83.304  32.175  1.00 78.55  ? 387  GLY A CA    1 
ATOM   2977  C  C     . GLY A  1  387 ? 64.920  82.607  32.106  1.00 79.25  ? 387  GLY A C     1 
ATOM   2978  O  O     . GLY A  1  387 ? 65.080  81.609  31.399  1.00 78.91  ? 387  GLY A O     1 
ATOM   2979  N  N     . ARG A  1  388 ? 65.893  83.143  32.838  1.00 79.06  ? 388  ARG A N     1 
ATOM   2980  C  CA    . ARG A  1  388 ? 67.238  82.585  32.884  1.00 78.16  ? 388  ARG A CA    1 
ATOM   2981  C  C     . ARG A  1  388 ? 67.576  82.301  34.340  1.00 78.28  ? 388  ARG A C     1 
ATOM   2982  O  O     . ARG A  1  388 ? 66.693  82.298  35.188  1.00 78.79  ? 388  ARG A O     1 
ATOM   2983  C  CB    . ARG A  1  388 ? 68.239  83.593  32.345  1.00 77.83  ? 388  ARG A CB    1 
ATOM   2984  C  CG    . ARG A  1  388 ? 68.487  84.746  33.304  1.00 75.99  ? 388  ARG A CG    1 
ATOM   2985  C  CD    . ARG A  1  388 ? 67.957  86.063  32.755  1.00 75.38  ? 388  ARG A CD    1 
ATOM   2986  N  NE    . ARG A  1  388 ? 68.108  87.167  33.706  1.00 76.31  ? 388  ARG A NE    1 
ATOM   2987  C  CZ    . ARG A  1  388 ? 69.237  87.460  34.350  1.00 76.55  ? 388  ARG A CZ    1 
ATOM   2988  N  NH1   . ARG A  1  388 ? 69.282  88.483  35.196  1.00 74.69  ? 388  ARG A NH1   1 
ATOM   2989  N  NH2   . ARG A  1  388 ? 70.324  86.721  34.158  1.00 77.90  ? 388  ARG A NH2   1 
ATOM   2990  N  N     . ARG A  1  389 ? 68.855  82.069  34.627  1.00 78.30  ? 389  ARG A N     1 
ATOM   2991  C  CA    . ARG A  1  389 ? 69.301  81.812  35.995  1.00 77.35  ? 389  ARG A CA    1 
ATOM   2992  C  C     . ARG A  1  389 ? 69.921  83.065  36.549  1.00 76.73  ? 389  ARG A C     1 
ATOM   2993  O  O     . ARG A  1  389 ? 70.548  83.824  35.817  1.00 77.00  ? 389  ARG A O     1 
ATOM   2994  C  CB    . ARG A  1  389 ? 70.351  80.716  36.052  1.00 77.51  ? 389  ARG A CB    1 
ATOM   2995  C  CG    . ARG A  1  389 ? 71.016  80.596  37.418  1.00 79.40  ? 389  ARG A CG    1 
ATOM   2996  C  CD    . ARG A  1  389 ? 69.989  80.306  38.510  1.00 82.30  ? 389  ARG A CD    1 
ATOM   2997  N  NE    . ARG A  1  389 ? 70.416  79.274  39.466  1.00 84.40  ? 389  ARG A NE    1 
ATOM   2998  C  CZ    . ARG A  1  389 ? 71.285  79.467  40.459  1.00 84.97  ? 389  ARG A CZ    1 
ATOM   2999  N  NH1   . ARG A  1  389 ? 71.835  80.663  40.641  1.00 85.82  ? 389  ARG A NH1   1 
ATOM   3000  N  NH2   . ARG A  1  389 ? 71.598  78.467  41.276  1.00 83.58  ? 389  ARG A NH2   1 
ATOM   3001  N  N     . ILE A  1  390 ? 69.754  83.281  37.844  1.00 76.12  ? 390  ILE A N     1 
ATOM   3002  C  CA    . ILE A  1  390 ? 70.315  84.464  38.457  1.00 76.36  ? 390  ILE A CA    1 
ATOM   3003  C  C     . ILE A  1  390 ? 71.258  84.033  39.552  1.00 77.95  ? 390  ILE A C     1 
ATOM   3004  O  O     . ILE A  1  390 ? 70.862  83.469  40.571  1.00 77.79  ? 390  ILE A O     1 
ATOM   3005  C  CB    . ILE A  1  390 ? 69.206  85.402  38.987  1.00 75.26  ? 390  ILE A CB    1 
ATOM   3006  C  CG1   . ILE A  1  390 ? 68.344  85.874  37.797  1.00 74.31  ? 390  ILE A CG1   1 
ATOM   3007  C  CG2   . ILE A  1  390 ? 69.831  86.587  39.722  1.00 73.16  ? 390  ILE A CG2   1 
ATOM   3008  C  CD1   . ILE A  1  390 ? 67.123  86.690  38.143  1.00 71.92  ? 390  ILE A CD1   1 
ATOM   3009  N  N     . SER A  1  391 ? 72.533  84.295  39.301  1.00 79.97  ? 391  SER A N     1 
ATOM   3010  C  CA    . SER A  1  391 ? 73.609  83.931  40.205  1.00 81.05  ? 391  SER A CA    1 
ATOM   3011  C  C     . SER A  1  391 ? 73.674  84.805  41.437  1.00 81.74  ? 391  SER A C     1 
ATOM   3012  O  O     . SER A  1  391 ? 73.366  85.999  41.386  1.00 81.44  ? 391  SER A O     1 
ATOM   3013  C  CB    . SER A  1  391 ? 74.934  84.051  39.476  1.00 80.54  ? 391  SER A CB    1 
ATOM   3014  O  OG    . SER A  1  391 ? 75.107  85.398  39.091  1.00 81.49  ? 391  SER A OG    1 
ATOM   3015  N  N     . LEU A  1  392 ? 74.110  84.200  42.538  1.00 82.65  ? 392  LEU A N     1 
ATOM   3016  C  CA    . LEU A  1  392 ? 74.262  84.917  43.791  1.00 83.29  ? 392  LEU A CA    1 
ATOM   3017  C  C     . LEU A  1  392 ? 75.160  86.122  43.535  1.00 83.78  ? 392  LEU A C     1 
ATOM   3018  O  O     . LEU A  1  392 ? 74.962  87.183  44.119  1.00 84.27  ? 392  LEU A O     1 
ATOM   3019  C  CB    . LEU A  1  392 ? 74.883  84.012  44.860  1.00 83.07  ? 392  LEU A CB    1 
ATOM   3020  C  CG    . LEU A  1  392 ? 74.150  82.695  45.161  1.00 83.74  ? 392  LEU A CG    1 
ATOM   3021  C  CD1   . LEU A  1  392 ? 74.742  82.056  46.408  1.00 84.52  ? 392  LEU A CD1   1 
ATOM   3022  C  CD2   . LEU A  1  392 ? 72.671  82.947  45.378  1.00 84.37  ? 392  LEU A CD2   1 
ATOM   3023  N  N     . GLU A  1  393 ? 76.141  85.962  42.649  1.00 84.43  ? 393  GLU A N     1 
ATOM   3024  C  CA    . GLU A  1  393 ? 77.040  87.063  42.328  1.00 84.67  ? 393  GLU A CA    1 
ATOM   3025  C  C     . GLU A  1  393 ? 76.237  88.220  41.767  1.00 83.81  ? 393  GLU A C     1 
ATOM   3026  O  O     . GLU A  1  393 ? 76.556  89.387  42.009  1.00 83.84  ? 393  GLU A O     1 
ATOM   3027  C  CB    . GLU A  1  393 ? 78.097  86.636  41.308  1.00 86.15  ? 393  GLU A CB    1 
ATOM   3028  C  CG    . GLU A  1  393 ? 78.896  87.814  40.742  1.00 89.14  ? 393  GLU A CG    1 
ATOM   3029  C  CD    . GLU A  1  393 ? 80.136  87.382  39.974  1.00 90.69  ? 393  GLU A CD    1 
ATOM   3030  O  OE1   . GLU A  1  393 ? 80.031  86.464  39.134  1.00 91.84  ? 393  GLU A OE1   1 
ATOM   3031  O  OE2   . GLU A  1  393 ? 81.217  87.964  40.204  1.00 91.51  ? 393  GLU A OE2   1 
ATOM   3032  N  N     . GLU A  1  394 ? 75.195  87.896  41.008  1.00 82.68  ? 394  GLU A N     1 
ATOM   3033  C  CA    . GLU A  1  394 ? 74.349  88.931  40.437  1.00 82.11  ? 394  GLU A CA    1 
ATOM   3034  C  C     . GLU A  1  394 ? 73.463  89.499  41.541  1.00 82.07  ? 394  GLU A C     1 
ATOM   3035  O  O     . GLU A  1  394 ? 73.502  90.701  41.814  1.00 82.63  ? 394  GLU A O     1 
ATOM   3036  C  CB    . GLU A  1  394 ? 73.492  88.368  39.317  1.00 80.51  ? 394  GLU A CB    1 
ATOM   3037  C  CG    . GLU A  1  394 ? 72.527  89.381  38.768  1.00 81.75  ? 394  GLU A CG    1 
ATOM   3038  C  CD    . GLU A  1  394 ? 71.793  88.853  37.568  1.00 84.57  ? 394  GLU A CD    1 
ATOM   3039  O  OE1   . GLU A  1  394 ? 71.676  87.611  37.466  1.00 86.99  ? 394  GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A  1  394 ? 71.325  89.663  36.735  1.00 83.82  ? 394  GLU A OE2   1 
ATOM   3041  N  N     . TRP A  1  395 ? 72.671  88.631  42.173  1.00 80.83  ? 395  TRP A N     1 
ATOM   3042  C  CA    . TRP A  1  395 ? 71.795  89.041  43.269  1.00 78.53  ? 395  TRP A CA    1 
ATOM   3043  C  C     . TRP A  1  395 ? 72.596  89.933  44.196  1.00 78.15  ? 395  TRP A C     1 
ATOM   3044  O  O     . TRP A  1  395 ? 72.214  91.071  44.457  1.00 79.03  ? 395  TRP A O     1 
ATOM   3045  C  CB    . TRP A  1  395 ? 71.301  87.828  44.062  1.00 77.47  ? 395  TRP A CB    1 
ATOM   3046  C  CG    . TRP A  1  395 ? 70.081  87.148  43.504  1.00 77.34  ? 395  TRP A CG    1 
ATOM   3047  C  CD1   . TRP A  1  395 ? 69.819  85.805  43.512  1.00 77.58  ? 395  TRP A CD1   1 
ATOM   3048  C  CD2   . TRP A  1  395 ? 68.953  87.770  42.871  1.00 77.47  ? 395  TRP A CD2   1 
ATOM   3049  N  NE1   . TRP A  1  395 ? 68.601  85.549  42.919  1.00 76.59  ? 395  TRP A NE1   1 
ATOM   3050  C  CE2   . TRP A  1  395 ? 68.049  86.736  42.518  1.00 77.28  ? 395  TRP A CE2   1 
ATOM   3051  C  CE3   . TRP A  1  395 ? 68.616  89.099  42.567  1.00 76.28  ? 395  TRP A CE3   1 
ATOM   3052  C  CZ2   . TRP A  1  395 ? 66.831  86.991  41.874  1.00 76.79  ? 395  TRP A CZ2   1 
ATOM   3053  C  CZ3   . TRP A  1  395 ? 67.406  89.352  41.928  1.00 75.28  ? 395  TRP A CZ3   1 
ATOM   3054  C  CH2   . TRP A  1  395 ? 66.528  88.300  41.588  1.00 75.86  ? 395  TRP A CH2   1 
ATOM   3055  N  N     . ASP A  1  396 ? 73.717  89.408  44.683  1.00 77.00  ? 396  ASP A N     1 
ATOM   3056  C  CA    . ASP A  1  396 ? 74.580  90.153  45.587  1.00 75.62  ? 396  ASP A CA    1 
ATOM   3057  C  C     . ASP A  1  396 ? 74.905  91.523  45.027  1.00 74.91  ? 396  ASP A C     1 
ATOM   3058  O  O     . ASP A  1  396 ? 74.951  92.515  45.754  1.00 74.06  ? 396  ASP A O     1 
ATOM   3059  C  CB    . ASP A  1  396 ? 75.878  89.407  45.837  1.00 74.82  ? 396  ASP A CB    1 
ATOM   3060  C  CG    . ASP A  1  396 ? 76.765  90.138  46.801  1.00 74.96  ? 396  ASP A CG    1 
ATOM   3061  O  OD1   . ASP A  1  396 ? 77.247  91.245  46.456  1.00 74.37  ? 396  ASP A OD1   1 
ATOM   3062  O  OD2   . ASP A  1  396 ? 76.961  89.610  47.914  1.00 74.02  ? 396  ASP A OD2   1 
ATOM   3063  N  N     . SER A  1  397 ? 75.153  91.573  43.728  1.00 75.34  ? 397  SER A N     1 
ATOM   3064  C  CA    . SER A  1  397 ? 75.447  92.842  43.095  1.00 76.67  ? 397  SER A CA    1 
ATOM   3065  C  C     . SER A  1  397 ? 74.251  93.761  43.316  1.00 76.76  ? 397  SER A C     1 
ATOM   3066  O  O     . SER A  1  397 ? 74.350  94.794  43.991  1.00 76.96  ? 397  SER A O     1 
ATOM   3067  C  CB    . SER A  1  397 ? 75.669  92.648  41.599  1.00 76.77  ? 397  SER A CB    1 
ATOM   3068  O  OG    . SER A  1  397 ? 75.681  93.904  40.941  1.00 79.63  ? 397  SER A OG    1 
ATOM   3069  N  N     . ARG A  1  398 ? 73.122  93.356  42.739  1.00 76.06  ? 398  ARG A N     1 
ATOM   3070  C  CA    . ARG A  1  398 ? 71.873  94.088  42.828  1.00 74.55  ? 398  ARG A CA    1 
ATOM   3071  C  C     . ARG A  1  398 ? 71.606  94.579  44.241  1.00 74.55  ? 398  ARG A C     1 
ATOM   3072  O  O     . ARG A  1  398 ? 71.333  95.762  44.450  1.00 74.43  ? 398  ARG A O     1 
ATOM   3073  C  CB    . ARG A  1  398 ? 70.743  93.189  42.356  1.00 73.47  ? 398  ARG A CB    1 
ATOM   3074  C  CG    . ARG A  1  398 ? 70.921  92.747  40.928  1.00 74.13  ? 398  ARG A CG    1 
ATOM   3075  C  CD    . ARG A  1  398 ? 69.864  91.748  40.498  1.00 76.47  ? 398  ARG A CD    1 
ATOM   3076  N  NE    . ARG A  1  398 ? 69.725  91.700  39.041  1.00 77.45  ? 398  ARG A NE    1 
ATOM   3077  C  CZ    . ARG A  1  398 ? 69.331  92.733  38.295  1.00 79.11  ? 398  ARG A CZ    1 
ATOM   3078  N  NH1   . ARG A  1  398 ? 69.032  93.905  38.861  1.00 79.72  ? 398  ARG A NH1   1 
ATOM   3079  N  NH2   . ARG A  1  398 ? 69.233  92.600  36.980  1.00 77.66  ? 398  ARG A NH2   1 
ATOM   3080  N  N     . ILE A  1  399 ? 71.697  93.666  45.205  1.00 74.60  ? 399  ILE A N     1 
ATOM   3081  C  CA    . ILE A  1  399 ? 71.471  93.987  46.614  1.00 75.08  ? 399  ILE A CA    1 
ATOM   3082  C  C     . ILE A  1  399 ? 72.348  95.131  47.108  1.00 77.29  ? 399  ILE A C     1 
ATOM   3083  O  O     . ILE A  1  399 ? 71.873  96.038  47.793  1.00 78.00  ? 399  ILE A O     1 
ATOM   3084  C  CB    . ILE A  1  399 ? 71.729  92.761  47.510  1.00 73.05  ? 399  ILE A CB    1 
ATOM   3085  C  CG1   . ILE A  1  399 ? 70.633  91.723  47.274  1.00 72.48  ? 399  ILE A CG1   1 
ATOM   3086  C  CG2   . ILE A  1  399 ? 71.800  93.180  48.973  1.00 70.81  ? 399  ILE A CG2   1 
ATOM   3087  C  CD1   . ILE A  1  399 ? 70.898  90.393  47.929  1.00 72.95  ? 399  ILE A CD1   1 
ATOM   3088  N  N     . SER A  1  400 ? 73.629  95.086  46.762  1.00 78.58  ? 400  SER A N     1 
ATOM   3089  C  CA    . SER A  1  400 ? 74.556  96.114  47.189  1.00 79.55  ? 400  SER A CA    1 
ATOM   3090  C  C     . SER A  1  400 ? 74.159  97.507  46.708  1.00 80.10  ? 400  SER A C     1 
ATOM   3091  O  O     . SER A  1  400 ? 74.407  98.504  47.391  1.00 80.13  ? 400  SER A O     1 
ATOM   3092  C  CB    . SER A  1  400 ? 75.949  95.752  46.700  1.00 80.26  ? 400  SER A CB    1 
ATOM   3093  O  OG    . SER A  1  400 ? 76.318  94.496  47.247  1.00 82.46  ? 400  SER A OG    1 
ATOM   3094  N  N     . ALA A  1  401 ? 73.524  97.573  45.542  1.00 80.89  ? 401  ALA A N     1 
ATOM   3095  C  CA    . ALA A  1  401 ? 73.108  98.852  44.972  1.00 81.89  ? 401  ALA A CA    1 
ATOM   3096  C  C     . ALA A  1  401 ? 72.088  99.568  45.839  1.00 83.40  ? 401  ALA A C     1 
ATOM   3097  O  O     . ALA A  1  401 ? 72.038  100.798 45.860  1.00 83.06  ? 401  ALA A O     1 
ATOM   3098  C  CB    . ALA A  1  401 ? 72.535  98.640  43.587  1.00 80.87  ? 401  ALA A CB    1 
ATOM   3099  N  N     . VAL A  1  402 ? 71.280  98.781  46.551  1.00 85.31  ? 402  VAL A N     1 
ATOM   3100  C  CA    . VAL A  1  402 ? 70.218  99.286  47.428  1.00 85.11  ? 402  VAL A CA    1 
ATOM   3101  C  C     . VAL A  1  402 ? 70.730  100.125 48.592  1.00 85.70  ? 402  VAL A C     1 
ATOM   3102  O  O     . VAL A  1  402 ? 71.726  99.775  49.232  1.00 85.92  ? 402  VAL A O     1 
ATOM   3103  C  CB    . VAL A  1  402 ? 69.397  98.126  48.018  1.00 83.90  ? 402  VAL A CB    1 
ATOM   3104  C  CG1   . VAL A  1  402 ? 68.221  98.668  48.790  1.00 84.84  ? 402  VAL A CG1   1 
ATOM   3105  C  CG2   . VAL A  1  402 ? 68.933  97.206  46.919  1.00 82.85  ? 402  VAL A CG2   1 
ATOM   3106  N  N     . ASP A  1  403 ? 70.035  101.226 48.863  1.00 85.97  ? 403  ASP A N     1 
ATOM   3107  C  CA    . ASP A  1  403 ? 70.399  102.120 49.955  1.00 87.45  ? 403  ASP A CA    1 
ATOM   3108  C  C     . ASP A  1  403 ? 69.145  102.753 50.551  1.00 88.28  ? 403  ASP A C     1 
ATOM   3109  O  O     . ASP A  1  403 ? 68.083  102.734 49.927  1.00 88.90  ? 403  ASP A O     1 
ATOM   3110  C  CB    . ASP A  1  403 ? 71.372  103.207 49.459  1.00 87.45  ? 403  ASP A CB    1 
ATOM   3111  C  CG    . ASP A  1  403 ? 70.704  104.267 48.590  1.00 87.70  ? 403  ASP A CG    1 
ATOM   3112  O  OD1   . ASP A  1  403 ? 69.893  103.926 47.699  1.00 87.74  ? 403  ASP A OD1   1 
ATOM   3113  O  OD2   . ASP A  1  403 ? 71.016  105.456 48.794  1.00 88.05  ? 403  ASP A OD2   1 
ATOM   3114  N  N     . ALA A  1  404 ? 69.264  103.306 51.758  1.00 88.21  ? 404  ALA A N     1 
ATOM   3115  C  CA    . ALA A  1  404 ? 68.128  103.942 52.422  1.00 86.77  ? 404  ALA A CA    1 
ATOM   3116  C  C     . ALA A  1  404 ? 67.210  104.644 51.426  1.00 86.06  ? 404  ALA A C     1 
ATOM   3117  O  O     . ALA A  1  404 ? 66.072  104.226 51.234  1.00 85.68  ? 404  ALA A O     1 
ATOM   3118  C  CB    . ALA A  1  404 ? 68.617  104.932 53.464  1.00 85.28  ? 404  ALA A CB    1 
ATOM   3119  N  N     . ARG A  1  405 ? 67.711  105.694 50.781  1.00 86.12  ? 405  ARG A N     1 
ATOM   3120  C  CA    . ARG A  1  405 ? 66.916  106.450 49.816  1.00 86.87  ? 405  ARG A CA    1 
ATOM   3121  C  C     . ARG A  1  405 ? 66.090  105.538 48.930  1.00 85.21  ? 405  ARG A C     1 
ATOM   3122  O  O     . ARG A  1  405 ? 64.880  105.710 48.808  1.00 84.82  ? 405  ARG A O     1 
ATOM   3123  C  CB    . ARG A  1  405 ? 67.820  107.323 48.941  1.00 90.24  ? 405  ARG A CB    1 
ATOM   3124  C  CG    . ARG A  1  405 ? 67.100  108.105 47.832  1.00 94.95  ? 405  ARG A CG    1 
ATOM   3125  C  CD    . ARG A  1  405 ? 66.384  109.368 48.333  1.00 99.43  ? 405  ARG A CD    1 
ATOM   3126  N  NE    . ARG A  1  405 ? 65.200  109.087 49.153  1.00 104.02 ? 405  ARG A NE    1 
ATOM   3127  C  CZ    . ARG A  1  405 ? 64.325  110.010 49.563  1.00 105.59 ? 405  ARG A CZ    1 
ATOM   3128  N  NH1   . ARG A  1  405 ? 64.489  111.289 49.231  1.00 106.39 ? 405  ARG A NH1   1 
ATOM   3129  N  NH2   . ARG A  1  405 ? 63.281  109.656 50.308  1.00 105.98 ? 405  ARG A NH2   1 
ATOM   3130  N  N     . MET A  1  406 ? 66.752  104.563 48.322  1.00 84.39  ? 406  MET A N     1 
ATOM   3131  C  CA    . MET A  1  406 ? 66.095  103.610 47.430  1.00 83.71  ? 406  MET A CA    1 
ATOM   3132  C  C     . MET A  1  406 ? 64.971  102.853 48.139  1.00 83.18  ? 406  MET A C     1 
ATOM   3133  O  O     . MET A  1  406 ? 63.872  102.722 47.597  1.00 82.50  ? 406  MET A O     1 
ATOM   3134  C  CB    . MET A  1  406 ? 67.133  102.628 46.887  1.00 83.58  ? 406  MET A CB    1 
ATOM   3135  C  CG    . MET A  1  406 ? 66.687  101.818 45.688  1.00 83.38  ? 406  MET A CG    1 
ATOM   3136  S  SD    . MET A  1  406 ? 68.064  100.864 44.995  1.00 82.62  ? 406  MET A SD    1 
ATOM   3137  C  CE    . MET A  1  406 ? 69.119  102.171 44.527  1.00 82.18  ? 406  MET A CE    1 
ATOM   3138  N  N     . VAL A  1  407 ? 65.243  102.359 49.346  1.00 82.62  ? 407  VAL A N     1 
ATOM   3139  C  CA    . VAL A  1  407 ? 64.230  101.639 50.108  1.00 82.25  ? 407  VAL A CA    1 
ATOM   3140  C  C     . VAL A  1  407 ? 63.009  102.533 50.310  1.00 82.72  ? 407  VAL A C     1 
ATOM   3141  O  O     . VAL A  1  407 ? 61.882  102.119 50.025  1.00 83.42  ? 407  VAL A O     1 
ATOM   3142  C  CB    . VAL A  1  407 ? 64.762  101.184 51.486  1.00 81.79  ? 407  VAL A CB    1 
ATOM   3143  C  CG1   . VAL A  1  407 ? 63.611  100.809 52.393  1.00 81.02  ? 407  VAL A CG1   1 
ATOM   3144  C  CG2   . VAL A  1  407 ? 65.671  99.973  51.313  1.00 81.77  ? 407  VAL A CG2   1 
ATOM   3145  N  N     . ARG A  1  408 ? 63.233  103.759 50.786  1.00 82.24  ? 408  ARG A N     1 
ATOM   3146  C  CA    . ARG A  1  408 ? 62.140  104.705 51.004  1.00 80.81  ? 408  ARG A CA    1 
ATOM   3147  C  C     . ARG A  1  408 ? 61.358  104.959 49.726  1.00 80.41  ? 408  ARG A C     1 
ATOM   3148  O  O     . ARG A  1  408 ? 60.140  104.818 49.706  1.00 81.53  ? 408  ARG A O     1 
ATOM   3149  C  CB    . ARG A  1  408 ? 62.665  106.028 51.555  1.00 80.02  ? 408  ARG A CB    1 
ATOM   3150  C  CG    . ARG A  1  408 ? 63.180  105.932 52.979  1.00 81.51  ? 408  ARG A CG    1 
ATOM   3151  C  CD    . ARG A  1  408 ? 63.271  107.307 53.631  1.00 84.01  ? 408  ARG A CD    1 
ATOM   3152  N  NE    . ARG A  1  408 ? 64.234  108.185 52.973  1.00 86.11  ? 408  ARG A NE    1 
ATOM   3153  C  CZ    . ARG A  1  408 ? 65.552  108.050 53.071  1.00 88.27  ? 408  ARG A CZ    1 
ATOM   3154  N  NH1   . ARG A  1  408 ? 66.071  107.072 53.809  1.00 89.24  ? 408  ARG A NH1   1 
ATOM   3155  N  NH2   . ARG A  1  408 ? 66.356  108.883 52.422  1.00 88.54  ? 408  ARG A NH2   1 
ATOM   3156  N  N     . ASP A  1  409 ? 62.043  105.327 48.653  1.00 79.89  ? 409  ASP A N     1 
ATOM   3157  C  CA    . ASP A  1  409 ? 61.342  105.573 47.404  1.00 80.37  ? 409  ASP A CA    1 
ATOM   3158  C  C     . ASP A  1  409 ? 60.500  104.388 46.973  1.00 79.96  ? 409  ASP A C     1 
ATOM   3159  O  O     . ASP A  1  409 ? 59.307  104.539 46.705  1.00 80.28  ? 409  ASP A O     1 
ATOM   3160  C  CB    . ASP A  1  409 ? 62.318  105.907 46.287  1.00 82.59  ? 409  ASP A CB    1 
ATOM   3161  C  CG    . ASP A  1  409 ? 63.036  107.204 46.524  1.00 85.21  ? 409  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A  1  409 ? 62.399  108.125 47.077  1.00 85.80  ? 409  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A  1  409 ? 64.228  107.305 46.150  1.00 87.87  ? 409  ASP A OD2   1 
ATOM   3164  N  N     . VAL A  1  410 ? 61.115  103.209 46.904  1.00 79.10  ? 410  VAL A N     1 
ATOM   3165  C  CA    . VAL A  1  410 ? 60.395  102.007 46.483  1.00 78.15  ? 410  VAL A CA    1 
ATOM   3166  C  C     . VAL A  1  410 ? 59.240  101.661 47.414  1.00 77.39  ? 410  VAL A C     1 
ATOM   3167  O  O     . VAL A  1  410 ? 58.137  101.369 46.957  1.00 77.60  ? 410  VAL A O     1 
ATOM   3168  C  CB    . VAL A  1  410 ? 61.336  100.788 46.371  1.00 78.29  ? 410  VAL A CB    1 
ATOM   3169  C  CG1   . VAL A  1  410 ? 60.548  99.543  45.965  1.00 77.55  ? 410  VAL A CG1   1 
ATOM   3170  C  CG2   . VAL A  1  410 ? 62.407  101.069 45.338  1.00 79.38  ? 410  VAL A CG2   1 
ATOM   3171  N  N     . CYS A  1  411 ? 59.487  101.688 48.719  1.00 75.96  ? 411  CYS A N     1 
ATOM   3172  C  CA    . CYS A  1  411 ? 58.433  101.388 49.679  1.00 73.61  ? 411  CYS A CA    1 
ATOM   3173  C  C     . CYS A  1  411 ? 57.312  102.416 49.574  1.00 71.30  ? 411  CYS A C     1 
ATOM   3174  O  O     . CYS A  1  411 ? 56.147  102.054 49.545  1.00 70.98  ? 411  CYS A O     1 
ATOM   3175  C  CB    . CYS A  1  411 ? 58.997  101.365 51.096  1.00 75.04  ? 411  CYS A CB    1 
ATOM   3176  S  SG    . CYS A  1  411 ? 60.020  99.927  51.426  1.00 78.30  ? 411  CYS A SG    1 
ATOM   3177  N  N     . SER A  1  412 ? 57.659  103.696 49.531  1.00 68.25  ? 412  SER A N     1 
ATOM   3178  C  CA    . SER A  1  412 ? 56.642  104.714 49.391  1.00 67.10  ? 412  SER A CA    1 
ATOM   3179  C  C     . SER A  1  412 ? 55.822  104.301 48.183  1.00 68.28  ? 412  SER A C     1 
ATOM   3180  O  O     . SER A  1  412 ? 54.597  104.202 48.246  1.00 70.55  ? 412  SER A O     1 
ATOM   3181  C  CB    . SER A  1  412 ? 57.266  106.072 49.099  1.00 64.96  ? 412  SER A CB    1 
ATOM   3182  O  OG    . SER A  1  412 ? 58.057  106.514 50.174  1.00 64.18  ? 412  SER A OG    1 
ATOM   3183  N  N     . LYS A  1  413 ? 56.522  104.056 47.082  1.00 67.87  ? 413  LYS A N     1 
ATOM   3184  C  CA    . LYS A  1  413 ? 55.913  103.672 45.814  1.00 67.22  ? 413  LYS A CA    1 
ATOM   3185  C  C     . LYS A  1  413 ? 54.827  102.599 45.912  1.00 66.72  ? 413  LYS A C     1 
ATOM   3186  O  O     . LYS A  1  413 ? 53.750  102.749 45.325  1.00 66.96  ? 413  LYS A O     1 
ATOM   3187  C  CB    . LYS A  1  413 ? 57.013  103.210 44.862  1.00 67.83  ? 413  LYS A CB    1 
ATOM   3188  C  CG    . LYS A  1  413 ? 56.546  102.760 43.484  1.00 70.77  ? 413  LYS A CG    1 
ATOM   3189  C  CD    . LYS A  1  413 ? 57.758  102.410 42.619  1.00 73.71  ? 413  LYS A CD    1 
ATOM   3190  C  CE    . LYS A  1  413 ? 57.407  102.044 41.177  1.00 74.33  ? 413  LYS A CE    1 
ATOM   3191  N  NZ    . LYS A  1  413 ? 58.646  101.717 40.394  1.00 76.40  ? 413  LYS A NZ    1 
ATOM   3192  N  N     . TYR A  1  414 ? 55.113  101.532 46.662  1.00 65.39  ? 414  TYR A N     1 
ATOM   3193  C  CA    . TYR A  1  414 ? 54.195  100.399 46.823  1.00 63.65  ? 414  TYR A CA    1 
ATOM   3194  C  C     . TYR A  1  414 ? 53.316  100.390 48.070  1.00 62.74  ? 414  TYR A C     1 
ATOM   3195  O  O     . TYR A  1  414 ? 52.319  99.678  48.111  1.00 63.31  ? 414  TYR A O     1 
ATOM   3196  C  CB    . TYR A  1  414 ? 54.980  99.080  46.786  1.00 62.84  ? 414  TYR A CB    1 
ATOM   3197  C  CG    . TYR A  1  414 ? 55.580  98.754  45.439  1.00 63.99  ? 414  TYR A CG    1 
ATOM   3198  C  CD1   . TYR A  1  414 ? 56.716  99.418  44.981  1.00 65.24  ? 414  TYR A CD1   1 
ATOM   3199  C  CD2   . TYR A  1  414 ? 54.970  97.833  44.589  1.00 64.39  ? 414  TYR A CD2   1 
ATOM   3200  C  CE1   . TYR A  1  414 ? 57.228  99.181  43.708  1.00 66.14  ? 414  TYR A CE1   1 
ATOM   3201  C  CE2   . TYR A  1  414 ? 55.471  97.587  43.314  1.00 66.07  ? 414  TYR A CE2   1 
ATOM   3202  C  CZ    . TYR A  1  414 ? 56.598  98.266  42.878  1.00 67.27  ? 414  TYR A CZ    1 
ATOM   3203  O  OH    . TYR A  1  414 ? 57.077  98.047  41.604  1.00 69.27  ? 414  TYR A OH    1 
ATOM   3204  N  N     . ILE A  1  415 ? 53.683  101.176 49.074  1.00 62.19  ? 415  ILE A N     1 
ATOM   3205  C  CA    . ILE A  1  415 ? 52.944  101.234 50.339  1.00 61.00  ? 415  ILE A CA    1 
ATOM   3206  C  C     . ILE A  1  415 ? 52.148  102.507 50.644  1.00 60.54  ? 415  ILE A C     1 
ATOM   3207  O  O     . ILE A  1  415 ? 50.937  102.478 50.818  1.00 60.48  ? 415  ILE A O     1 
ATOM   3208  C  CB    . ILE A  1  415 ? 53.892  101.061 51.534  1.00 60.42  ? 415  ILE A CB    1 
ATOM   3209  C  CG1   . ILE A  1  415 ? 54.740  99.807  51.350  1.00 61.49  ? 415  ILE A CG1   1 
ATOM   3210  C  CG2   . ILE A  1  415 ? 53.082  101.022 52.824  1.00 60.44  ? 415  ILE A CG2   1 
ATOM   3211  C  CD1   . ILE A  1  415 ? 55.750  99.582  52.453  1.00 62.47  ? 415  ILE A CD1   1 
ATOM   3212  N  N     . TYR A  1  416 ? 52.852  103.624 50.736  1.00 60.32  ? 416  TYR A N     1 
ATOM   3213  C  CA    . TYR A  1  416 ? 52.234  104.883 51.089  1.00 59.54  ? 416  TYR A CA    1 
ATOM   3214  C  C     . TYR A  1  416 ? 50.936  105.222 50.384  1.00 59.83  ? 416  TYR A C     1 
ATOM   3215  O  O     . TYR A  1  416 ? 50.852  105.233 49.155  1.00 61.09  ? 416  TYR A O     1 
ATOM   3216  C  CB    . TYR A  1  416 ? 53.216  106.020 50.908  1.00 57.72  ? 416  TYR A CB    1 
ATOM   3217  C  CG    . TYR A  1  416 ? 52.842  107.199 51.755  1.00 58.48  ? 416  TYR A CG    1 
ATOM   3218  C  CD1   . TYR A  1  416 ? 53.130  107.219 53.120  1.00 58.66  ? 416  TYR A CD1   1 
ATOM   3219  C  CD2   . TYR A  1  416 ? 52.172  108.290 51.201  1.00 58.97  ? 416  TYR A CD2   1 
ATOM   3220  C  CE1   . TYR A  1  416 ? 52.761  108.310 53.914  1.00 60.18  ? 416  TYR A CE1   1 
ATOM   3221  C  CE2   . TYR A  1  416 ? 51.795  109.380 51.977  1.00 59.12  ? 416  TYR A CE2   1 
ATOM   3222  C  CZ    . TYR A  1  416 ? 52.088  109.390 53.333  1.00 60.99  ? 416  TYR A CZ    1 
ATOM   3223  O  OH    . TYR A  1  416 ? 51.686  110.472 54.105  1.00 64.56  ? 416  TYR A OH    1 
ATOM   3224  N  N     . ASP A  1  417 ? 49.938  105.532 51.204  1.00 59.17  ? 417  ASP A N     1 
ATOM   3225  C  CA    . ASP A  1  417 ? 48.600  105.875 50.756  1.00 59.38  ? 417  ASP A CA    1 
ATOM   3226  C  C     . ASP A  1  417 ? 48.064  104.882 49.738  1.00 58.94  ? 417  ASP A C     1 
ATOM   3227  O  O     . ASP A  1  417 ? 47.653  105.256 48.638  1.00 59.51  ? 417  ASP A O     1 
ATOM   3228  C  CB    . ASP A  1  417 ? 48.543  107.281 50.155  1.00 59.04  ? 417  ASP A CB    1 
ATOM   3229  C  CG    . ASP A  1  417 ? 47.107  107.830 50.097  1.00 59.54  ? 417  ASP A CG    1 
ATOM   3230  O  OD1   . ASP A  1  417 ? 46.857  108.806 49.355  1.00 58.94  ? 417  ASP A OD1   1 
ATOM   3231  O  OD2   . ASP A  1  417 ? 46.230  107.286 50.811  1.00 58.50  ? 417  ASP A OD2   1 
ATOM   3232  N  N     . LYS A  1  418 ? 48.077  103.611 50.111  1.00 57.61  ? 418  LYS A N     1 
ATOM   3233  C  CA    . LYS A  1  418 ? 47.574  102.557 49.247  1.00 56.60  ? 418  LYS A CA    1 
ATOM   3234  C  C     . LYS A  1  418 ? 46.432  101.886 49.977  1.00 55.83  ? 418  LYS A C     1 
ATOM   3235  O  O     . LYS A  1  418 ? 46.415  101.841 51.207  1.00 56.79  ? 418  LYS A O     1 
ATOM   3236  C  CB    . LYS A  1  418 ? 48.661  101.517 48.976  1.00 56.61  ? 418  LYS A CB    1 
ATOM   3237  C  CG    . LYS A  1  418 ? 49.759  101.969 48.022  1.00 57.97  ? 418  LYS A CG    1 
ATOM   3238  C  CD    . LYS A  1  418 ? 49.241  102.033 46.599  1.00 57.65  ? 418  LYS A CD    1 
ATOM   3239  C  CE    . LYS A  1  418 ? 50.324  102.380 45.612  1.00 57.76  ? 418  LYS A CE    1 
ATOM   3240  N  NZ    . LYS A  1  418 ? 49.748  102.395 44.238  1.00 58.22  ? 418  LYS A NZ    1 
ATOM   3241  N  N     . CYS A  1  419 ? 45.472  101.371 49.231  1.00 53.26  ? 419  CYS A N     1 
ATOM   3242  C  CA    . CYS A  1  419 ? 44.373  100.690 49.863  1.00 51.71  ? 419  CYS A CA    1 
ATOM   3243  C  C     . CYS A  1  419 ? 44.860  99.258  49.997  1.00 50.85  ? 419  CYS A C     1 
ATOM   3244  O  O     . CYS A  1  419 ? 45.061  98.573  48.999  1.00 50.29  ? 419  CYS A O     1 
ATOM   3245  C  CB    . CYS A  1  419 ? 43.141  100.780 48.978  1.00 53.28  ? 419  CYS A CB    1 
ATOM   3246  S  SG    . CYS A  1  419 ? 42.680  102.473 48.631  1.00 52.90  ? 419  CYS A SG    1 
ATOM   3247  N  N     . PRO A  1  420 ? 45.078  98.795  51.236  1.00 49.57  ? 420  PRO A N     1 
ATOM   3248  C  CA    . PRO A  1  420 ? 45.554  97.441  51.504  1.00 49.76  ? 420  PRO A CA    1 
ATOM   3249  C  C     . PRO A  1  420 ? 44.485  96.352  51.429  1.00 50.71  ? 420  PRO A C     1 
ATOM   3250  O  O     . PRO A  1  420 ? 43.293  96.632  51.291  1.00 50.91  ? 420  PRO A O     1 
ATOM   3251  C  CB    . PRO A  1  420 ? 46.131  97.574  52.902  1.00 49.61  ? 420  PRO A CB    1 
ATOM   3252  C  CG    . PRO A  1  420 ? 45.153  98.463  53.547  1.00 47.88  ? 420  PRO A CG    1 
ATOM   3253  C  CD    . PRO A  1  420 ? 44.959  99.547  52.496  1.00 48.85  ? 420  PRO A CD    1 
ATOM   3254  N  N     . ALA A  1  421 ? 44.936  95.104  51.507  1.00 51.02  ? 421  ALA A N     1 
ATOM   3255  C  CA    . ALA A  1  421 ? 44.048  93.950  51.484  1.00 51.79  ? 421  ALA A CA    1 
ATOM   3256  C  C     . ALA A  1  421 ? 44.199  93.365  52.869  1.00 52.89  ? 421  ALA A C     1 
ATOM   3257  O  O     . ALA A  1  421 ? 45.311  93.191  53.365  1.00 54.52  ? 421  ALA A O     1 
ATOM   3258  C  CB    . ALA A  1  421 ? 44.490  92.937  50.430  1.00 51.60  ? 421  ALA A CB    1 
ATOM   3259  N  N     . LEU A  1  422 ? 43.085  93.058  53.504  1.00 52.46  ? 422  LEU A N     1 
ATOM   3260  C  CA    . LEU A  1  422 ? 43.155  92.533  54.844  1.00 51.60  ? 422  LEU A CA    1 
ATOM   3261  C  C     . LEU A  1  422 ? 42.406  91.238  54.978  1.00 50.79  ? 422  LEU A C     1 
ATOM   3262  O  O     . LEU A  1  422 ? 41.397  91.011  54.308  1.00 51.37  ? 422  LEU A O     1 
ATOM   3263  C  CB    . LEU A  1  422 ? 42.575  93.555  55.819  1.00 53.36  ? 422  LEU A CB    1 
ATOM   3264  C  CG    . LEU A  1  422 ? 42.420  93.145  57.282  1.00 53.69  ? 422  LEU A CG    1 
ATOM   3265  C  CD1   . LEU A  1  422 ? 43.747  93.263  57.977  1.00 54.97  ? 422  LEU A CD1   1 
ATOM   3266  C  CD2   . LEU A  1  422 ? 41.389  94.047  57.957  1.00 55.15  ? 422  LEU A CD2   1 
ATOM   3267  N  N     . ALA A  1  423 ? 42.917  90.394  55.860  1.00 49.91  ? 423  ALA A N     1 
ATOM   3268  C  CA    . ALA A  1  423 ? 42.316  89.103  56.161  1.00 48.76  ? 423  ALA A CA    1 
ATOM   3269  C  C     . ALA A  1  423 ? 42.548  88.933  57.647  1.00 48.44  ? 423  ALA A C     1 
ATOM   3270  O  O     . ALA A  1  423 ? 43.670  89.111  58.140  1.00 48.77  ? 423  ALA A O     1 
ATOM   3271  C  CB    . ALA A  1  423 ? 43.003  87.980  55.378  1.00 47.40  ? 423  ALA A CB    1 
ATOM   3272  N  N     . ALA A  1  424 ? 41.482  88.629  58.368  1.00 46.47  ? 424  ALA A N     1 
ATOM   3273  C  CA    . ALA A  1  424 ? 41.591  88.445  59.801  1.00 45.90  ? 424  ALA A CA    1 
ATOM   3274  C  C     . ALA A  1  424 ? 40.772  87.217  60.185  1.00 46.09  ? 424  ALA A C     1 
ATOM   3275  O  O     . ALA A  1  424 ? 39.678  86.995  59.663  1.00 45.68  ? 424  ALA A O     1 
ATOM   3276  C  CB    . ALA A  1  424 ? 41.093  89.698  60.537  1.00 44.75  ? 424  ALA A CB    1 
ATOM   3277  N  N     . VAL A  1  425 ? 41.312  86.412  61.088  1.00 46.02  ? 425  VAL A N     1 
ATOM   3278  C  CA    . VAL A  1  425 ? 40.630  85.206  61.515  1.00 47.13  ? 425  VAL A CA    1 
ATOM   3279  C  C     . VAL A  1  425 ? 40.699  85.024  63.033  1.00 49.46  ? 425  VAL A C     1 
ATOM   3280  O  O     . VAL A  1  425 ? 41.670  85.419  63.671  1.00 50.77  ? 425  VAL A O     1 
ATOM   3281  C  CB    . VAL A  1  425 ? 41.244  83.971  60.824  1.00 45.61  ? 425  VAL A CB    1 
ATOM   3282  C  CG1   . VAL A  1  425 ? 40.536  82.722  61.274  1.00 45.92  ? 425  VAL A CG1   1 
ATOM   3283  C  CG2   . VAL A  1  425 ? 41.137  84.106  59.323  1.00 43.18  ? 425  VAL A CG2   1 
ATOM   3284  N  N     . GLY A  1  426 ? 39.655  84.440  63.613  1.00 51.39  ? 426  GLY A N     1 
ATOM   3285  C  CA    . GLY A  1  426 ? 39.651  84.211  65.046  1.00 54.07  ? 426  GLY A CA    1 
ATOM   3286  C  C     . GLY A  1  426 ? 38.880  85.228  65.864  1.00 56.01  ? 426  GLY A C     1 
ATOM   3287  O  O     . GLY A  1  426 ? 37.863  85.761  65.391  1.00 56.43  ? 426  GLY A O     1 
ATOM   3288  N  N     . PRO A  1  427 ? 39.333  85.504  67.112  1.00 56.11  ? 427  PRO A N     1 
ATOM   3289  C  CA    . PRO A  1  427 ? 38.735  86.455  68.064  1.00 55.83  ? 427  PRO A CA    1 
ATOM   3290  C  C     . PRO A  1  427 ? 39.209  87.862  67.731  1.00 55.70  ? 427  PRO A C     1 
ATOM   3291  O  O     . PRO A  1  427 ? 39.827  88.537  68.560  1.00 56.48  ? 427  PRO A O     1 
ATOM   3292  C  CB    . PRO A  1  427 ? 39.276  85.970  69.398  1.00 54.03  ? 427  PRO A CB    1 
ATOM   3293  C  CG    . PRO A  1  427 ? 40.642  85.578  69.036  1.00 52.67  ? 427  PRO A CG    1 
ATOM   3294  C  CD    . PRO A  1  427 ? 40.462  84.801  67.745  1.00 53.03  ? 427  PRO A CD    1 
ATOM   3295  N  N     . ILE A  1  428 ? 38.893  88.294  66.514  1.00 54.54  ? 428  ILE A N     1 
ATOM   3296  C  CA    . ILE A  1  428 ? 39.320  89.587  66.001  1.00 52.98  ? 428  ILE A CA    1 
ATOM   3297  C  C     . ILE A  1  428 ? 38.494  90.847  66.318  1.00 52.53  ? 428  ILE A C     1 
ATOM   3298  O  O     . ILE A  1  428 ? 38.584  91.839  65.603  1.00 52.49  ? 428  ILE A O     1 
ATOM   3299  C  CB    . ILE A  1  428 ? 39.500  89.477  64.486  1.00 51.15  ? 428  ILE A CB    1 
ATOM   3300  C  CG1   . ILE A  1  428 ? 38.181  89.073  63.825  1.00 50.71  ? 428  ILE A CG1   1 
ATOM   3301  C  CG2   . ILE A  1  428 ? 40.532  88.426  64.189  1.00 50.76  ? 428  ILE A CG2   1 
ATOM   3302  C  CD1   . ILE A  1  428 ? 38.231  89.084  62.324  1.00 49.28  ? 428  ILE A CD1   1 
ATOM   3303  N  N     . GLU A  1  429 ? 37.720  90.838  67.391  1.00 51.88  ? 429  GLU A N     1 
ATOM   3304  C  CA    . GLU A  1  429 ? 36.932  92.016  67.703  1.00 51.93  ? 429  GLU A CA    1 
ATOM   3305  C  C     . GLU A  1  429 ? 37.744  93.262  67.975  1.00 52.20  ? 429  GLU A C     1 
ATOM   3306  O  O     . GLU A  1  429 ? 37.354  94.345  67.560  1.00 53.05  ? 429  GLU A O     1 
ATOM   3307  C  CB    . GLU A  1  429 ? 36.032  91.773  68.902  1.00 52.03  ? 429  GLU A CB    1 
ATOM   3308  C  CG    . GLU A  1  429 ? 35.198  92.974  69.251  1.00 52.10  ? 429  GLU A CG    1 
ATOM   3309  C  CD    . GLU A  1  429 ? 34.303  92.722  70.430  1.00 54.54  ? 429  GLU A CD    1 
ATOM   3310  O  OE1   . GLU A  1  429 ? 34.646  93.210  71.522  1.00 56.98  ? 429  GLU A OE1   1 
ATOM   3311  O  OE2   . GLU A  1  429 ? 33.264  92.035  70.276  1.00 54.92  ? 429  GLU A OE2   1 
ATOM   3312  N  N     . GLN A  1  430 ? 38.866  93.131  68.667  1.00 53.70  ? 430  GLN A N     1 
ATOM   3313  C  CA    . GLN A  1  430 ? 39.649  94.318  68.985  1.00 56.00  ? 430  GLN A CA    1 
ATOM   3314  C  C     . GLN A  1  430 ? 40.188  95.039  67.755  1.00 57.24  ? 430  GLN A C     1 
ATOM   3315  O  O     . GLN A  1  430 ? 40.033  96.238  67.636  1.00 56.96  ? 430  GLN A O     1 
ATOM   3316  C  CB    . GLN A  1  430 ? 40.801  93.980  69.936  1.00 56.70  ? 430  GLN A CB    1 
ATOM   3317  C  CG    . GLN A  1  430 ? 41.412  95.217  70.601  1.00 58.94  ? 430  GLN A CG    1 
ATOM   3318  C  CD    . GLN A  1  430 ? 42.736  94.946  71.340  1.00 59.85  ? 430  GLN A CD    1 
ATOM   3319  O  OE1   . GLN A  1  430 ? 43.846  95.070  70.775  1.00 58.85  ? 430  GLN A OE1   1 
ATOM   3320  N  NE2   . GLN A  1  430 ? 42.618  94.581  72.609  1.00 59.33  ? 430  GLN A NE2   1 
ATOM   3321  N  N     . LEU A  1  431 ? 40.842  94.322  66.846  1.00 60.39  ? 431  LEU A N     1 
ATOM   3322  C  CA    . LEU A  1  431 ? 41.370  94.961  65.636  1.00 62.20  ? 431  LEU A CA    1 
ATOM   3323  C  C     . LEU A  1  431 ? 40.137  95.405  64.939  1.00 63.90  ? 431  LEU A C     1 
ATOM   3324  O  O     . LEU A  1  431 ? 39.171  94.658  64.959  1.00 66.36  ? 431  LEU A O     1 
ATOM   3325  C  CB    . LEU A  1  431 ? 42.047  93.950  64.706  1.00 59.78  ? 431  LEU A CB    1 
ATOM   3326  C  CG    . LEU A  1  431 ? 41.925  94.342  63.221  1.00 58.27  ? 431  LEU A CG    1 
ATOM   3327  C  CD1   . LEU A  1  431 ? 43.286  94.620  62.619  1.00 57.47  ? 431  LEU A CD1   1 
ATOM   3328  C  CD2   . LEU A  1  431 ? 41.224  93.248  62.459  1.00 55.29  ? 431  LEU A CD2   1 
ATOM   3329  N  N     . LEU A  1  432 ? 40.124  96.578  64.316  1.00 64.94  ? 432  LEU A N     1 
ATOM   3330  C  CA    . LEU A  1  432 ? 38.901  96.912  63.616  1.00 65.62  ? 432  LEU A CA    1 
ATOM   3331  C  C     . LEU A  1  432 ? 38.918  98.096  62.695  1.00 65.28  ? 432  LEU A C     1 
ATOM   3332  O  O     . LEU A  1  432 ? 39.874  98.860  62.635  1.00 63.74  ? 432  LEU A O     1 
ATOM   3333  C  CB    . LEU A  1  432 ? 37.721  97.039  64.615  1.00 67.33  ? 432  LEU A CB    1 
ATOM   3334  C  CG    . LEU A  1  432 ? 36.302  96.569  64.184  1.00 65.85  ? 432  LEU A CG    1 
ATOM   3335  C  CD1   . LEU A  1  432 ? 35.617  95.749  65.310  1.00 63.09  ? 432  LEU A CD1   1 
ATOM   3336  C  CD2   . LEU A  1  432 ? 35.461  97.788  63.795  1.00 65.31  ? 432  LEU A CD2   1 
ATOM   3337  N  N     . ASP A  1  433 ? 37.806  98.181  61.968  1.00 66.15  ? 433  ASP A N     1 
ATOM   3338  C  CA    . ASP A  1  433 ? 37.492  99.196  60.990  1.00 64.44  ? 433  ASP A CA    1 
ATOM   3339  C  C     . ASP A  1  433 ? 38.524  99.385  59.889  1.00 63.70  ? 433  ASP A C     1 
ATOM   3340  O  O     . ASP A  1  433 ? 39.648  99.847  60.131  1.00 63.90  ? 433  ASP A O     1 
ATOM   3341  C  CB    . ASP A  1  433 ? 37.232  100.510 61.685  1.00 64.32  ? 433  ASP A CB    1 
ATOM   3342  C  CG    . ASP A  1  433 ? 36.749  101.547 60.738  1.00 66.90  ? 433  ASP A CG    1 
ATOM   3343  O  OD1   . ASP A  1  433 ? 36.338  102.624 61.189  1.00 73.29  ? 433  ASP A OD1   1 
ATOM   3344  O  OD2   . ASP A  1  433 ? 36.776  101.299 59.525  1.00 67.40  ? 433  ASP A OD2   1 
ATOM   3345  N  N     . TYR A  1  434 ? 38.123  99.028  58.669  1.00 61.17  ? 434  TYR A N     1 
ATOM   3346  C  CA    . TYR A  1  434 ? 38.983  99.170  57.502  1.00 57.54  ? 434  TYR A CA    1 
ATOM   3347  C  C     . TYR A  1  434 ? 39.514  100.577 57.418  1.00 56.60  ? 434  TYR A C     1 
ATOM   3348  O  O     . TYR A  1  434 ? 40.686  100.769 57.162  1.00 56.90  ? 434  TYR A O     1 
ATOM   3349  C  CB    . TYR A  1  434 ? 38.226  98.890  56.219  1.00 55.13  ? 434  TYR A CB    1 
ATOM   3350  C  CG    . TYR A  1  434 ? 39.142  98.867  55.033  1.00 51.79  ? 434  TYR A CG    1 
ATOM   3351  C  CD1   . TYR A  1  434 ? 39.881  97.728  54.722  1.00 48.04  ? 434  TYR A CD1   1 
ATOM   3352  C  CD2   . TYR A  1  434 ? 39.335  100.012 54.269  1.00 50.87  ? 434  TYR A CD2   1 
ATOM   3353  C  CE1   . TYR A  1  434 ? 40.791  97.736  53.689  1.00 47.87  ? 434  TYR A CE1   1 
ATOM   3354  C  CE2   . TYR A  1  434 ? 40.246  100.034 53.234  1.00 50.30  ? 434  TYR A CE2   1 
ATOM   3355  C  CZ    . TYR A  1  434 ? 40.975  98.901  52.951  1.00 49.94  ? 434  TYR A CZ    1 
ATOM   3356  O  OH    . TYR A  1  434 ? 41.928  98.975  51.966  1.00 50.94  ? 434  TYR A OH    1 
ATOM   3357  N  N     . ASN A  1  435 ? 38.633  101.553 57.616  1.00 56.72  ? 435  ASN A N     1 
ATOM   3358  C  CA    . ASN A  1  435 ? 39.003  102.963 57.581  1.00 57.14  ? 435  ASN A CA    1 
ATOM   3359  C  C     . ASN A  1  435 ? 40.144  103.282 58.519  1.00 58.30  ? 435  ASN A C     1 
ATOM   3360  O  O     . ASN A  1  435 ? 41.154  103.848 58.110  1.00 59.87  ? 435  ASN A O     1 
ATOM   3361  C  CB    . ASN A  1  435 ? 37.823  103.839 57.954  1.00 57.76  ? 435  ASN A CB    1 
ATOM   3362  C  CG    . ASN A  1  435 ? 36.941  104.145 56.782  1.00 58.98  ? 435  ASN A CG    1 
ATOM   3363  O  OD1   . ASN A  1  435 ? 37.418  104.558 55.721  1.00 58.84  ? 435  ASN A OD1   1 
ATOM   3364  N  ND2   . ASN A  1  435 ? 35.639  103.964 56.965  1.00 59.17  ? 435  ASN A ND2   1 
ATOM   3365  N  N     . ARG A  1  436 ? 39.984  102.939 59.790  1.00 59.11  ? 436  ARG A N     1 
ATOM   3366  C  CA    . ARG A  1  436 ? 41.046  103.196 60.754  1.00 59.10  ? 436  ARG A CA    1 
ATOM   3367  C  C     . ARG A  1  436 ? 42.362  102.581 60.263  1.00 58.63  ? 436  ARG A C     1 
ATOM   3368  O  O     . ARG A  1  436 ? 43.439  103.157 60.437  1.00 58.04  ? 436  ARG A O     1 
ATOM   3369  C  CB    . ARG A  1  436 ? 40.654  102.631 62.117  1.00 57.77  ? 436  ARG A CB    1 
ATOM   3370  C  CG    . ARG A  1  436 ? 39.555  103.420 62.760  1.00 58.71  ? 436  ARG A CG    1 
ATOM   3371  C  CD    . ARG A  1  436 ? 40.008  104.855 63.024  1.00 58.58  ? 436  ARG A CD    1 
ATOM   3372  N  NE    . ARG A  1  436 ? 40.851  104.949 64.212  1.00 59.35  ? 436  ARG A NE    1 
ATOM   3373  C  CZ    . ARG A  1  436 ? 40.406  105.260 65.429  1.00 61.20  ? 436  ARG A CZ    1 
ATOM   3374  N  NH1   . ARG A  1  436 ? 39.118  105.514 65.627  1.00 63.27  ? 436  ARG A NH1   1 
ATOM   3375  N  NH2   . ARG A  1  436 ? 41.246  105.315 66.453  1.00 61.00  ? 436  ARG A NH2   1 
ATOM   3376  N  N     . ILE A  1  437 ? 42.265  101.417 59.634  1.00 57.53  ? 437  ILE A N     1 
ATOM   3377  C  CA    . ILE A  1  437 ? 43.447  100.760 59.114  1.00 58.47  ? 437  ILE A CA    1 
ATOM   3378  C  C     . ILE A  1  437 ? 43.936  101.449 57.842  1.00 58.98  ? 437  ILE A C     1 
ATOM   3379  O  O     . ILE A  1  437 ? 45.135  101.540 57.598  1.00 59.44  ? 437  ILE A O     1 
ATOM   3380  C  CB    . ILE A  1  437 ? 43.167  99.266  58.819  1.00 58.83  ? 437  ILE A CB    1 
ATOM   3381  C  CG1   . ILE A  1  437 ? 42.724  98.570  60.113  1.00 60.57  ? 437  ILE A CG1   1 
ATOM   3382  C  CG2   . ILE A  1  437 ? 44.419  98.595  58.255  1.00 56.50  ? 437  ILE A CG2   1 
ATOM   3383  C  CD1   . ILE A  1  437 ? 42.423  97.095  59.979  1.00 60.21  ? 437  ILE A CD1   1 
ATOM   3384  N  N     . ARG A  1  438 ? 43.010  101.946 57.035  1.00 59.32  ? 438  ARG A N     1 
ATOM   3385  C  CA    . ARG A  1  438 ? 43.386  102.603 55.799  1.00 60.39  ? 438  ARG A CA    1 
ATOM   3386  C  C     . ARG A  1  438 ? 44.182  103.862 56.079  1.00 62.44  ? 438  ARG A C     1 
ATOM   3387  O  O     . ARG A  1  438 ? 45.083  104.211 55.321  1.00 62.65  ? 438  ARG A O     1 
ATOM   3388  C  CB    . ARG A  1  438 ? 42.144  102.948 54.980  1.00 60.04  ? 438  ARG A CB    1 
ATOM   3389  C  CG    . ARG A  1  438 ? 42.438  103.738 53.711  1.00 59.89  ? 438  ARG A CG    1 
ATOM   3390  C  CD    . ARG A  1  438 ? 43.205  102.920 52.684  1.00 58.89  ? 438  ARG A CD    1 
ATOM   3391  N  NE    . ARG A  1  438 ? 43.534  103.711 51.500  1.00 58.29  ? 438  ARG A NE    1 
ATOM   3392  C  CZ    . ARG A  1  438 ? 44.309  104.792 51.510  1.00 58.82  ? 438  ARG A CZ    1 
ATOM   3393  N  NH1   . ARG A  1  438 ? 44.850  105.230 52.643  1.00 57.89  ? 438  ARG A NH1   1 
ATOM   3394  N  NH2   . ARG A  1  438 ? 44.551  105.436 50.378  1.00 59.32  ? 438  ARG A NH2   1 
ATOM   3395  N  N     . SER A  1  439 ? 43.850  104.541 57.171  1.00 64.75  ? 439  SER A N     1 
ATOM   3396  C  CA    . SER A  1  439 ? 44.540  105.771 57.540  1.00 67.15  ? 439  SER A CA    1 
ATOM   3397  C  C     . SER A  1  439 ? 45.906  105.489 58.105  1.00 67.57  ? 439  SER A C     1 
ATOM   3398  O  O     . SER A  1  439 ? 46.715  106.400 58.260  1.00 68.26  ? 439  SER A O     1 
ATOM   3399  C  CB    . SER A  1  439 ? 43.736  106.551 58.565  1.00 69.44  ? 439  SER A CB    1 
ATOM   3400  O  OG    . SER A  1  439 ? 42.539  107.034 57.984  1.00 75.05  ? 439  SER A OG    1 
ATOM   3401  N  N     . GLY A  1  440 ? 46.151  104.224 58.427  1.00 68.30  ? 440  GLY A N     1 
ATOM   3402  C  CA    . GLY A  1  440 ? 47.443  103.838 58.958  1.00 69.76  ? 440  GLY A CA    1 
ATOM   3403  C  C     . GLY A  1  440 ? 48.444  103.751 57.824  1.00 70.27  ? 440  GLY A C     1 
ATOM   3404  O  O     . GLY A  1  440 ? 49.642  103.525 58.039  1.00 70.57  ? 440  GLY A O     1 
ATOM   3405  N  N     . MET A  1  441 ? 47.931  103.940 56.611  1.00 70.14  ? 441  MET A N     1 
ATOM   3406  C  CA    . MET A  1  441 ? 48.731  103.887 55.399  1.00 69.36  ? 441  MET A CA    1 
ATOM   3407  C  C     . MET A  1  441 ? 49.404  105.205 55.075  1.00 69.07  ? 441  MET A C     1 
ATOM   3408  O  O     . MET A  1  441 ? 50.065  105.315 54.047  1.00 67.38  ? 441  MET A O     1 
ATOM   3409  C  CB    . MET A  1  441 ? 47.868  103.470 54.208  1.00 69.08  ? 441  MET A CB    1 
ATOM   3410  C  CG    . MET A  1  441 ? 47.229  102.115 54.363  1.00 69.66  ? 441  MET A CG    1 
ATOM   3411  S  SD    . MET A  1  441 ? 48.426  100.868 54.809  1.00 69.15  ? 441  MET A SD    1 
ATOM   3412  C  CE    . MET A  1  441 ? 49.077  100.473 53.216  1.00 70.65  ? 441  MET A CE    1 
ATOM   3413  N  N     . TYR A  1  442 ? 49.236  106.214 55.923  1.00 69.96  ? 442  TYR A N     1 
ATOM   3414  C  CA    . TYR A  1  442 ? 49.897  107.467 55.619  1.00 73.77  ? 442  TYR A CA    1 
ATOM   3415  C  C     . TYR A  1  442 ? 50.321  108.335 56.797  1.00 76.39  ? 442  TYR A C     1 
ATOM   3416  O  O     . TYR A  1  442 ? 49.674  108.341 57.851  1.00 76.70  ? 442  TYR A O     1 
ATOM   3417  C  CB    . TYR A  1  442 ? 49.068  108.269 54.621  1.00 73.16  ? 442  TYR A CB    1 
ATOM   3418  C  CG    . TYR A  1  442 ? 47.754  108.726 55.139  1.00 74.37  ? 442  TYR A CG    1 
ATOM   3419  C  CD1   . TYR A  1  442 ? 47.660  109.859 55.933  1.00 75.48  ? 442  TYR A CD1   1 
ATOM   3420  C  CD2   . TYR A  1  442 ? 46.598  108.019 54.852  1.00 75.48  ? 442  TYR A CD2   1 
ATOM   3421  C  CE1   . TYR A  1  442 ? 46.438  110.281 56.435  1.00 77.78  ? 442  TYR A CE1   1 
ATOM   3422  C  CE2   . TYR A  1  442 ? 45.369  108.425 55.348  1.00 78.14  ? 442  TYR A CE2   1 
ATOM   3423  C  CZ    . TYR A  1  442 ? 45.290  109.557 56.141  1.00 78.15  ? 442  TYR A CZ    1 
ATOM   3424  O  OH    . TYR A  1  442 ? 44.069  109.947 56.656  1.00 79.02  ? 442  TYR A OH    1 
ATOM   3425  N  N     . TRP A  1  443 ? 51.445  109.035 56.582  1.00 78.83  ? 443  TRP A N     1 
ATOM   3426  C  CA    . TRP A  1  443 ? 52.101  109.934 57.534  1.00 80.35  ? 443  TRP A CA    1 
ATOM   3427  C  C     . TRP A  1  443 ? 52.751  109.147 58.703  1.00 82.24  ? 443  TRP A C     1 
ATOM   3428  O  O     . TRP A  1  443 ? 52.037  108.661 59.583  1.00 83.75  ? 443  TRP A O     1 
ATOM   3429  C  CB    . TRP A  1  443 ? 51.092  110.960 58.055  1.00 79.31  ? 443  TRP A CB    1 
ATOM   3430  C  CG    . TRP A  1  443 ? 51.694  112.226 58.568  1.00 80.86  ? 443  TRP A CG    1 
ATOM   3431  C  CD1   . TRP A  1  443 ? 51.061  113.190 59.304  1.00 81.03  ? 443  TRP A CD1   1 
ATOM   3432  C  CD2   . TRP A  1  443 ? 53.046  112.682 58.393  1.00 82.40  ? 443  TRP A CD2   1 
ATOM   3433  N  NE1   . TRP A  1  443 ? 51.932  114.212 59.600  1.00 80.37  ? 443  TRP A NE1   1 
ATOM   3434  C  CE2   . TRP A  1  443 ? 53.156  113.926 59.055  1.00 82.10  ? 443  TRP A CE2   1 
ATOM   3435  C  CE3   . TRP A  1  443 ? 54.177  112.160 57.744  1.00 84.04  ? 443  TRP A CE3   1 
ATOM   3436  C  CZ2   . TRP A  1  443 ? 54.355  114.657 59.087  1.00 82.53  ? 443  TRP A CZ2   1 
ATOM   3437  C  CZ3   . TRP A  1  443 ? 55.375  112.890 57.777  1.00 83.69  ? 443  TRP A CZ3   1 
ATOM   3438  C  CH2   . TRP A  1  443 ? 55.448  114.123 58.444  1.00 83.29  ? 443  TRP A CH2   1 
ATOM   3439  N  N     . ILE A  1  444 ? 54.090  109.011 58.696  1.00 82.95  ? 444  ILE A N     1 
ATOM   3440  C  CA    . ILE A  1  444 ? 54.839  108.295 59.747  1.00 79.68  ? 444  ILE A CA    1 
ATOM   3441  N  N     . PRO B  2  21  ? 88.569  77.253  43.235  1.00 122.08 ? 19   PRO B N     1 
ATOM   3442  C  CA    . PRO B  2  21  ? 89.606  76.187  43.315  1.00 121.94 ? 19   PRO B CA    1 
ATOM   3443  C  C     . PRO B  2  21  ? 89.110  74.864  43.920  1.00 121.17 ? 19   PRO B C     1 
ATOM   3444  O  O     . PRO B  2  21  ? 89.042  74.705  45.141  1.00 121.43 ? 19   PRO B O     1 
ATOM   3445  C  CB    . PRO B  2  21  ? 90.761  76.768  44.120  1.00 122.48 ? 19   PRO B CB    1 
ATOM   3446  C  CG    . PRO B  2  21  ? 90.629  78.270  43.758  1.00 122.74 ? 19   PRO B CG    1 
ATOM   3447  C  CD    . PRO B  2  21  ? 89.110  78.529  43.746  1.00 121.75 ? 19   PRO B CD    1 
ATOM   3448  N  N     . GLY B  2  22  ? 88.773  73.930  43.031  1.00 120.08 ? 20   GLY B N     1 
ATOM   3449  C  CA    . GLY B  2  22  ? 88.279  72.605  43.389  1.00 118.14 ? 20   GLY B CA    1 
ATOM   3450  C  C     . GLY B  2  22  ? 87.996  72.207  44.828  1.00 116.62 ? 20   GLY B C     1 
ATOM   3451  O  O     . GLY B  2  22  ? 87.459  72.979  45.627  1.00 115.74 ? 20   GLY B O     1 
ATOM   3452  N  N     . ALA B  2  23  ? 88.349  70.965  45.144  1.00 115.70 ? 21   ALA B N     1 
ATOM   3453  C  CA    . ALA B  2  23  ? 88.142  70.420  46.478  1.00 114.85 ? 21   ALA B CA    1 
ATOM   3454  C  C     . ALA B  2  23  ? 89.459  70.181  47.228  1.00 113.96 ? 21   ALA B C     1 
ATOM   3455  O  O     . ALA B  2  23  ? 90.359  69.476  46.746  1.00 113.12 ? 21   ALA B O     1 
ATOM   3456  C  CB    . ALA B  2  23  ? 87.343  69.121  46.389  1.00 114.74 ? 21   ALA B CB    1 
ATOM   3457  N  N     . GLU B  2  24  ? 89.552  70.785  48.413  1.00 112.25 ? 22   GLU B N     1 
ATOM   3458  C  CA    . GLU B  2  24  ? 90.724  70.667  49.273  1.00 109.54 ? 22   GLU B CA    1 
ATOM   3459  C  C     . GLU B  2  24  ? 90.652  69.395  50.090  1.00 109.01 ? 22   GLU B C     1 
ATOM   3460  O  O     . GLU B  2  24  ? 90.307  68.328  49.584  1.00 108.10 ? 22   GLU B O     1 
ATOM   3461  C  CB    . GLU B  2  24  ? 90.798  71.830  50.249  1.00 106.96 ? 22   GLU B CB    1 
ATOM   3462  C  CG    . GLU B  2  24  ? 90.781  73.178  49.623  1.00 104.88 ? 22   GLU B CG    1 
ATOM   3463  C  CD    . GLU B  2  24  ? 91.445  74.182  50.520  1.00 104.77 ? 22   GLU B CD    1 
ATOM   3464  O  OE1   . GLU B  2  24  ? 91.527  73.911  51.739  1.00 104.08 ? 22   GLU B OE1   1 
ATOM   3465  O  OE2   . GLU B  2  24  ? 91.884  75.234  50.016  1.00 104.19 ? 22   GLU B OE2   1 
ATOM   3466  N  N     . ASP B  2  25  ? 90.981  69.526  51.370  1.00 108.74 ? 23   ASP B N     1 
ATOM   3467  C  CA    . ASP B  2  25  ? 90.947  68.394  52.269  1.00 109.15 ? 23   ASP B CA    1 
ATOM   3468  C  C     . ASP B  2  25  ? 90.533  68.763  53.672  1.00 108.74 ? 23   ASP B C     1 
ATOM   3469  O  O     . ASP B  2  25  ? 90.750  69.881  54.139  1.00 108.39 ? 23   ASP B O     1 
ATOM   3470  C  CB    . ASP B  2  25  ? 92.297  67.679  52.300  1.00 110.82 ? 23   ASP B CB    1 
ATOM   3471  C  CG    . ASP B  2  25  ? 92.315  66.445  51.415  1.00 112.01 ? 23   ASP B CG    1 
ATOM   3472  O  OD1   . ASP B  2  25  ? 91.422  65.584  51.594  1.00 112.16 ? 23   ASP B OD1   1 
ATOM   3473  O  OD2   . ASP B  2  25  ? 93.214  66.334  50.550  1.00 112.44 ? 23   ASP B OD2   1 
ATOM   3474  N  N     . LEU B  2  26  ? 89.936  67.782  54.330  1.00 108.52 ? 24   LEU B N     1 
ATOM   3475  C  CA    . LEU B  2  26  ? 89.425  67.904  55.683  1.00 108.71 ? 24   LEU B CA    1 
ATOM   3476  C  C     . LEU B  2  26  ? 90.483  67.646  56.750  1.00 108.81 ? 24   LEU B C     1 
ATOM   3477  O  O     . LEU B  2  26  ? 90.731  66.496  57.112  1.00 109.26 ? 24   LEU B O     1 
ATOM   3478  C  CB    . LEU B  2  26  ? 88.272  66.918  55.856  1.00 107.74 ? 24   LEU B CB    1 
ATOM   3479  C  CG    . LEU B  2  26  ? 87.770  66.644  57.270  1.00 106.78 ? 24   LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  2  26  ? 87.260  67.907  57.910  1.00 107.13 ? 24   LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  2  26  ? 86.677  65.639  57.198  1.00 105.27 ? 24   LEU B CD2   1 
ATOM   3482  N  N     . GLU B  2  27  ? 91.091  68.716  57.259  1.00 108.44 ? 25   GLU B N     1 
ATOM   3483  C  CA    . GLU B  2  27  ? 92.118  68.597  58.291  1.00 107.91 ? 25   GLU B CA    1 
ATOM   3484  C  C     . GLU B  2  27  ? 91.482  68.358  59.654  1.00 107.14 ? 25   GLU B C     1 
ATOM   3485  O  O     . GLU B  2  27  ? 90.259  68.318  59.769  1.00 107.62 ? 25   GLU B O     1 
ATOM   3486  C  CB    . GLU B  2  27  ? 92.975  69.855  58.305  1.00 107.95 ? 25   GLU B CB    1 
ATOM   3487  C  CG    . GLU B  2  27  ? 93.591  70.129  56.950  1.00 108.59 ? 25   GLU B CG    1 
ATOM   3488  C  CD    . GLU B  2  27  ? 94.208  71.501  56.850  1.00 109.40 ? 25   GLU B CD    1 
ATOM   3489  O  OE1   . GLU B  2  27  ? 95.194  71.770  57.573  1.00 110.24 ? 25   GLU B OE1   1 
ATOM   3490  O  OE2   . GLU B  2  27  ? 93.701  72.313  56.046  1.00 109.56 ? 25   GLU B OE2   1 
ATOM   3491  N  N     . ILE B  2  28  ? 92.300  68.191  60.686  1.00 106.05 ? 26   ILE B N     1 
ATOM   3492  C  CA    . ILE B  2  28  ? 91.755  67.929  62.009  1.00 105.23 ? 26   ILE B CA    1 
ATOM   3493  C  C     . ILE B  2  28  ? 92.828  67.837  63.094  1.00 105.28 ? 26   ILE B C     1 
ATOM   3494  O  O     . ILE B  2  28  ? 93.180  66.752  63.551  1.00 105.43 ? 26   ILE B O     1 
ATOM   3495  C  CB    . ILE B  2  28  ? 90.880  66.633  61.971  1.00 104.58 ? 26   ILE B CB    1 
ATOM   3496  C  CG1   . ILE B  2  28  ? 90.539  66.156  63.382  1.00 104.99 ? 26   ILE B CG1   1 
ATOM   3497  C  CG2   . ILE B  2  28  ? 91.583  65.553  61.178  1.00 104.90 ? 26   ILE B CG2   1 
ATOM   3498  C  CD1   . ILE B  2  28  ? 89.757  64.844  63.407  1.00 104.48 ? 26   ILE B CD1   1 
ATOM   3499  N  N     . THR B  2  29  ? 93.348  68.997  63.494  1.00 105.56 ? 27   THR B N     1 
ATOM   3500  C  CA    . THR B  2  29  ? 94.370  69.090  64.538  1.00 105.77 ? 27   THR B CA    1 
ATOM   3501  C  C     . THR B  2  29  ? 93.779  68.611  65.864  1.00 105.94 ? 27   THR B C     1 
ATOM   3502  O  O     . THR B  2  29  ? 92.565  68.665  66.055  1.00 106.92 ? 27   THR B O     1 
ATOM   3503  C  CB    . THR B  2  29  ? 94.874  70.539  64.675  1.00 105.76 ? 27   THR B CB    1 
ATOM   3504  O  OG1   . THR B  2  29  ? 95.627  70.885  63.504  1.00 105.89 ? 27   THR B OG1   1 
ATOM   3505  C  CG2   . THR B  2  29  ? 95.740  70.701  65.918  1.00 105.83 ? 27   THR B CG2   1 
ATOM   3506  N  N     . LYS B  2  30  ? 94.627  68.145  66.779  1.00 105.51 ? 28   LYS B N     1 
ATOM   3507  C  CA    . LYS B  2  30  ? 94.129  67.617  68.043  1.00 104.35 ? 28   LYS B CA    1 
ATOM   3508  C  C     . LYS B  2  30  ? 94.798  68.138  69.313  1.00 104.21 ? 28   LYS B C     1 
ATOM   3509  O  O     . LYS B  2  30  ? 94.985  67.381  70.262  1.00 103.35 ? 28   LYS B O     1 
ATOM   3510  C  CB    . LYS B  2  30  ? 94.210  66.090  68.000  1.00 103.27 ? 28   LYS B CB    1 
ATOM   3511  C  CG    . LYS B  2  30  ? 93.452  65.396  69.101  1.00 102.98 ? 28   LYS B CG    1 
ATOM   3512  C  CD    . LYS B  2  30  ? 93.406  63.898  68.863  1.00 103.50 ? 28   LYS B CD    1 
ATOM   3513  C  CE    . LYS B  2  30  ? 92.633  63.202  69.969  1.00 103.12 ? 28   LYS B CE    1 
ATOM   3514  N  NZ    . LYS B  2  30  ? 93.195  63.551  71.304  1.00 102.21 ? 28   LYS B NZ    1 
ATOM   3515  N  N     . LEU B  2  31  ? 95.131  69.430  69.321  1.00 104.67 ? 29   LEU B N     1 
ATOM   3516  C  CA    . LEU B  2  31  ? 95.771  70.118  70.455  1.00 106.04 ? 29   LEU B CA    1 
ATOM   3517  C  C     . LEU B  2  31  ? 95.970  69.359  71.788  1.00 107.06 ? 29   LEU B C     1 
ATOM   3518  O  O     . LEU B  2  31  ? 95.183  68.475  72.153  1.00 106.96 ? 29   LEU B O     1 
ATOM   3519  C  CB    . LEU B  2  31  ? 95.024  71.430  70.747  1.00 105.40 ? 29   LEU B CB    1 
ATOM   3520  C  CG    . LEU B  2  31  ? 95.315  72.653  69.868  1.00 105.35 ? 29   LEU B CG    1 
ATOM   3521  C  CD1   . LEU B  2  31  ? 94.298  73.733  70.179  1.00 105.37 ? 29   LEU B CD1   1 
ATOM   3522  C  CD2   . LEU B  2  31  ? 96.730  73.173  70.108  1.00 104.81 ? 29   LEU B CD2   1 
ATOM   3523  N  N     . PRO B  2  32  ? 97.020  69.738  72.552  1.00 107.39 ? 30   PRO B N     1 
ATOM   3524  C  CA    . PRO B  2  32  ? 97.365  69.133  73.842  1.00 107.11 ? 30   PRO B CA    1 
ATOM   3525  C  C     . PRO B  2  32  ? 96.197  68.784  74.765  1.00 107.43 ? 30   PRO B C     1 
ATOM   3526  O  O     . PRO B  2  32  ? 95.756  67.634  74.805  1.00 107.34 ? 30   PRO B O     1 
ATOM   3527  C  CB    . PRO B  2  32  ? 98.309  70.169  74.468  1.00 106.90 ? 30   PRO B CB    1 
ATOM   3528  C  CG    . PRO B  2  32  ? 97.963  71.455  73.768  1.00 106.62 ? 30   PRO B CG    1 
ATOM   3529  C  CD    . PRO B  2  32  ? 97.805  70.971  72.357  1.00 107.36 ? 30   PRO B CD    1 
ATOM   3530  N  N     . ASN B  2  33  ? 95.715  69.783  75.504  1.00 108.14 ? 31   ASN B N     1 
ATOM   3531  C  CA    . ASN B  2  33  ? 94.616  69.619  76.462  1.00 108.71 ? 31   ASN B CA    1 
ATOM   3532  C  C     . ASN B  2  33  ? 93.513  68.649  76.054  1.00 109.15 ? 31   ASN B C     1 
ATOM   3533  O  O     . ASN B  2  33  ? 92.862  68.050  76.915  1.00 108.65 ? 31   ASN B O     1 
ATOM   3534  C  CB    . ASN B  2  33  ? 94.006  70.985  76.794  1.00 108.18 ? 31   ASN B CB    1 
ATOM   3535  C  CG    . ASN B  2  33  ? 93.613  71.769  75.558  1.00 108.06 ? 31   ASN B CG    1 
ATOM   3536  O  OD1   . ASN B  2  33  ? 93.554  73.000  75.590  1.00 107.26 ? 31   ASN B OD1   1 
ATOM   3537  N  ND2   . ASN B  2  33  ? 93.330  71.064  74.467  1.00 107.32 ? 31   ASN B ND2   1 
ATOM   3538  N  N     . GLY B  2  34  ? 93.305  68.493  74.749  1.00 109.72 ? 32   GLY B N     1 
ATOM   3539  C  CA    . GLY B  2  34  ? 92.283  67.574  74.276  1.00 109.68 ? 32   GLY B CA    1 
ATOM   3540  C  C     . GLY B  2  34  ? 91.238  68.191  73.363  1.00 109.34 ? 32   GLY B C     1 
ATOM   3541  O  O     . GLY B  2  34  ? 90.362  67.489  72.843  1.00 108.99 ? 32   GLY B O     1 
ATOM   3542  N  N     . LEU B  2  35  ? 91.316  69.505  73.173  1.00 108.43 ? 33   LEU B N     1 
ATOM   3543  C  CA    . LEU B  2  35  ? 90.366  70.194  72.307  1.00 107.46 ? 33   LEU B CA    1 
ATOM   3544  C  C     . LEU B  2  35  ? 90.577  69.803  70.852  1.00 105.70 ? 33   LEU B C     1 
ATOM   3545  O  O     . LEU B  2  35  ? 91.637  70.068  70.285  1.00 106.35 ? 33   LEU B O     1 
ATOM   3546  C  CB    . LEU B  2  35  ? 90.521  71.708  72.423  1.00 108.51 ? 33   LEU B CB    1 
ATOM   3547  C  CG    . LEU B  2  35  ? 89.727  72.444  71.337  1.00 108.81 ? 33   LEU B CG    1 
ATOM   3548  C  CD1   . LEU B  2  35  ? 88.240  72.384  71.658  1.00 108.40 ? 33   LEU B CD1   1 
ATOM   3549  C  CD2   . LEU B  2  35  ? 90.201  73.876  71.242  1.00 109.38 ? 33   LEU B CD2   1 
ATOM   3550  N  N     . ILE B  2  36  ? 89.566  69.198  70.242  1.00 102.29 ? 34   ILE B N     1 
ATOM   3551  C  CA    . ILE B  2  36  ? 89.687  68.790  68.857  1.00 99.02  ? 34   ILE B CA    1 
ATOM   3552  C  C     . ILE B  2  36  ? 89.300  69.929  67.932  1.00 98.30  ? 34   ILE B C     1 
ATOM   3553  O  O     . ILE B  2  36  ? 88.477  70.766  68.288  1.00 98.52  ? 34   ILE B O     1 
ATOM   3554  C  CB    . ILE B  2  36  ? 88.824  67.566  68.591  1.00 97.67  ? 34   ILE B CB    1 
ATOM   3555  C  CG1   . ILE B  2  36  ? 89.201  66.478  69.598  1.00 97.71  ? 34   ILE B CG1   1 
ATOM   3556  C  CG2   . ILE B  2  36  ? 89.020  67.090  67.162  1.00 96.88  ? 34   ILE B CG2   1 
ATOM   3557  C  CD1   . ILE B  2  36  ? 88.475  65.169  69.437  1.00 97.59  ? 34   ILE B CD1   1 
ATOM   3558  N  N     . ILE B  2  37  ? 89.915  69.964  66.755  1.00 97.59  ? 35   ILE B N     1 
ATOM   3559  C  CA    . ILE B  2  37  ? 89.659  71.001  65.757  1.00 96.71  ? 35   ILE B CA    1 
ATOM   3560  C  C     . ILE B  2  37  ? 89.585  70.374  64.375  1.00 97.13  ? 35   ILE B C     1 
ATOM   3561  O  O     . ILE B  2  37  ? 90.589  69.884  63.871  1.00 97.69  ? 35   ILE B O     1 
ATOM   3562  C  CB    . ILE B  2  37  ? 90.799  72.041  65.709  1.00 95.67  ? 35   ILE B CB    1 
ATOM   3563  C  CG1   . ILE B  2  37  ? 91.107  72.551  67.112  1.00 95.00  ? 35   ILE B CG1   1 
ATOM   3564  C  CG2   . ILE B  2  37  ? 90.413  73.195  64.796  1.00 94.81  ? 35   ILE B CG2   1 
ATOM   3565  C  CD1   . ILE B  2  37  ? 92.257  73.514  67.139  1.00 96.09  ? 35   ILE B CD1   1 
ATOM   3566  N  N     . ALA B  2  38  ? 88.407  70.387  63.760  1.00 97.47  ? 36   ALA B N     1 
ATOM   3567  C  CA    . ALA B  2  38  ? 88.244  69.824  62.419  1.00 97.59  ? 36   ALA B CA    1 
ATOM   3568  C  C     . ALA B  2  38  ? 87.582  70.858  61.508  1.00 97.73  ? 36   ALA B C     1 
ATOM   3569  O  O     . ALA B  2  38  ? 86.489  71.332  61.810  1.00 98.97  ? 36   ALA B O     1 
ATOM   3570  C  CB    . ALA B  2  38  ? 87.401  68.560  62.479  1.00 96.78  ? 36   ALA B CB    1 
ATOM   3571  N  N     . SER B  2  39  ? 88.246  71.217  60.409  1.00 97.40  ? 37   SER B N     1 
ATOM   3572  C  CA    . SER B  2  39  ? 87.706  72.205  59.468  1.00 96.79  ? 37   SER B CA    1 
ATOM   3573  C  C     . SER B  2  39  ? 87.590  71.633  58.061  1.00 96.29  ? 37   SER B C     1 
ATOM   3574  O  O     . SER B  2  39  ? 87.923  70.479  57.822  1.00 96.17  ? 37   SER B O     1 
ATOM   3575  C  CB    . SER B  2  39  ? 88.589  73.461  59.423  1.00 96.63  ? 37   SER B CB    1 
ATOM   3576  O  OG    . SER B  2  39  ? 89.757  73.246  58.651  1.00 96.47  ? 37   SER B OG    1 
ATOM   3577  N  N     . LEU B  2  40  ? 87.118  72.449  57.128  1.00 95.59  ? 38   LEU B N     1 
ATOM   3578  C  CA    . LEU B  2  40  ? 86.966  72.006  55.753  1.00 95.18  ? 38   LEU B CA    1 
ATOM   3579  C  C     . LEU B  2  40  ? 86.525  73.128  54.858  1.00 95.91  ? 38   LEU B C     1 
ATOM   3580  O  O     . LEU B  2  40  ? 85.357  73.477  54.835  1.00 97.33  ? 38   LEU B O     1 
ATOM   3581  C  CB    . LEU B  2  40  ? 85.941  70.879  55.643  1.00 93.73  ? 38   LEU B CB    1 
ATOM   3582  C  CG    . LEU B  2  40  ? 85.395  70.675  54.222  1.00 92.58  ? 38   LEU B CG    1 
ATOM   3583  C  CD1   . LEU B  2  40  ? 86.530  70.576  53.233  1.00 91.71  ? 38   LEU B CD1   1 
ATOM   3584  C  CD2   . LEU B  2  40  ? 84.533  69.428  54.178  1.00 92.32  ? 38   LEU B CD2   1 
ATOM   3585  N  N     . GLU B  2  41  ? 87.462  73.686  54.111  1.00 96.84  ? 39   GLU B N     1 
ATOM   3586  C  CA    . GLU B  2  41  ? 87.146  74.760  53.188  1.00 97.35  ? 39   GLU B CA    1 
ATOM   3587  C  C     . GLU B  2  41  ? 86.428  74.150  51.992  1.00 97.76  ? 39   GLU B C     1 
ATOM   3588  O  O     . GLU B  2  41  ? 86.978  73.310  51.286  1.00 97.95  ? 39   GLU B O     1 
ATOM   3589  C  CB    . GLU B  2  41  ? 88.429  75.440  52.731  1.00 98.15  ? 39   GLU B CB    1 
ATOM   3590  C  CG    . GLU B  2  41  ? 88.243  76.488  51.669  1.00 99.33  ? 39   GLU B CG    1 
ATOM   3591  C  CD    . GLU B  2  41  ? 87.389  77.633  52.144  1.00 101.23 ? 39   GLU B CD    1 
ATOM   3592  O  OE1   . GLU B  2  41  ? 86.147  77.520  52.073  1.00 102.09 ? 39   GLU B OE1   1 
ATOM   3593  O  OE2   . GLU B  2  41  ? 87.965  78.644  52.600  1.00 102.55 ? 39   GLU B OE2   1 
ATOM   3594  N  N     . ASN B  2  42  ? 85.186  74.558  51.780  1.00 98.83  ? 40   ASN B N     1 
ATOM   3595  C  CA    . ASN B  2  42  ? 84.402  74.052  50.662  1.00 99.12  ? 40   ASN B CA    1 
ATOM   3596  C  C     . ASN B  2  42  ? 84.043  75.252  49.801  1.00 98.87  ? 40   ASN B C     1 
ATOM   3597  O  O     . ASN B  2  42  ? 83.173  75.190  48.936  1.00 97.99  ? 40   ASN B O     1 
ATOM   3598  C  CB    . ASN B  2  42  ? 83.148  73.323  51.174  1.00 99.48  ? 40   ASN B CB    1 
ATOM   3599  C  CG    . ASN B  2  42  ? 82.139  74.255  51.834  1.00 99.34  ? 40   ASN B CG    1 
ATOM   3600  O  OD1   . ASN B  2  42  ? 82.500  75.252  52.471  1.00 97.94  ? 40   ASN B OD1   1 
ATOM   3601  N  ND2   . ASN B  2  42  ? 80.861  73.917  51.698  1.00 99.20  ? 40   ASN B ND2   1 
ATOM   3602  N  N     . PHE B  2  43  ? 84.754  76.343  50.066  1.00 99.57  ? 41   PHE B N     1 
ATOM   3603  C  CA    . PHE B  2  43  ? 84.600  77.602  49.355  1.00 101.27 ? 41   PHE B CA    1 
ATOM   3604  C  C     . PHE B  2  43  ? 83.166  78.106  49.228  1.00 101.58 ? 41   PHE B C     1 
ATOM   3605  O  O     . PHE B  2  43  ? 82.873  78.996  48.417  1.00 101.31 ? 41   PHE B O     1 
ATOM   3606  C  CB    . PHE B  2  43  ? 85.262  77.507  47.973  1.00 103.48 ? 41   PHE B CB    1 
ATOM   3607  C  CG    . PHE B  2  43  ? 86.766  77.339  48.030  1.00 105.96 ? 41   PHE B CG    1 
ATOM   3608  C  CD1   . PHE B  2  43  ? 87.351  76.076  47.903  1.00 106.25 ? 41   PHE B CD1   1 
ATOM   3609  C  CD2   . PHE B  2  43  ? 87.592  78.441  48.258  1.00 106.29 ? 41   PHE B CD2   1 
ATOM   3610  C  CE1   . PHE B  2  43  ? 88.730  75.913  48.005  1.00 106.14 ? 41   PHE B CE1   1 
ATOM   3611  C  CE2   . PHE B  2  43  ? 88.970  78.289  48.363  1.00 106.62 ? 41   PHE B CE2   1 
ATOM   3612  C  CZ    . PHE B  2  43  ? 89.541  77.020  48.237  1.00 106.74 ? 41   PHE B CZ    1 
ATOM   3613  N  N     . SER B  2  44  ? 82.269  77.533  50.027  1.00 101.26 ? 42   SER B N     1 
ATOM   3614  C  CA    . SER B  2  44  ? 80.879  77.973  50.027  1.00 99.61  ? 42   SER B CA    1 
ATOM   3615  C  C     . SER B  2  44  ? 80.932  79.445  50.419  1.00 97.95  ? 42   SER B C     1 
ATOM   3616  O  O     . SER B  2  44  ? 81.764  79.850  51.228  1.00 98.34  ? 42   SER B O     1 
ATOM   3617  C  CB    . SER B  2  44  ? 80.068  77.196  51.063  1.00 100.01 ? 42   SER B CB    1 
ATOM   3618  O  OG    . SER B  2  44  ? 78.821  77.824  51.297  1.00 99.94  ? 42   SER B OG    1 
ATOM   3619  N  N     . PRO B  2  45  ? 80.052  80.266  49.853  1.00 95.87  ? 43   PRO B N     1 
ATOM   3620  C  CA    . PRO B  2  45  ? 80.095  81.680  50.217  1.00 95.00  ? 43   PRO B CA    1 
ATOM   3621  C  C     . PRO B  2  45  ? 79.733  81.940  51.677  1.00 93.77  ? 43   PRO B C     1 
ATOM   3622  O  O     . PRO B  2  45  ? 79.775  83.080  52.148  1.00 93.00  ? 43   PRO B O     1 
ATOM   3623  C  CB    . PRO B  2  45  ? 79.113  82.309  49.232  1.00 95.50  ? 43   PRO B CB    1 
ATOM   3624  C  CG    . PRO B  2  45  ? 78.116  81.222  49.021  1.00 95.29  ? 43   PRO B CG    1 
ATOM   3625  C  CD    . PRO B  2  45  ? 78.970  79.993  48.895  1.00 95.50  ? 43   PRO B CD    1 
ATOM   3626  N  N     . ALA B  2  46  ? 79.402  80.878  52.400  1.00 92.65  ? 44   ALA B N     1 
ATOM   3627  C  CA    . ALA B  2  46  ? 79.020  81.024  53.795  1.00 91.99  ? 44   ALA B CA    1 
ATOM   3628  C  C     . ALA B  2  46  ? 79.681  80.001  54.700  1.00 91.25  ? 44   ALA B C     1 
ATOM   3629  O  O     . ALA B  2  46  ? 79.751  78.815  54.376  1.00 89.99  ? 44   ALA B O     1 
ATOM   3630  C  CB    . ALA B  2  46  ? 77.514  80.925  53.920  1.00 93.39  ? 44   ALA B CB    1 
ATOM   3631  N  N     . SER B  2  47  ? 80.145  80.478  55.849  1.00 90.70  ? 45   SER B N     1 
ATOM   3632  C  CA    . SER B  2  47  ? 80.812  79.634  56.830  1.00 90.71  ? 45   SER B CA    1 
ATOM   3633  C  C     . SER B  2  47  ? 79.857  79.241  57.940  1.00 91.12  ? 45   SER B C     1 
ATOM   3634  O  O     . SER B  2  47  ? 78.855  79.916  58.180  1.00 91.60  ? 45   SER B O     1 
ATOM   3635  C  CB    . SER B  2  47  ? 81.989  80.382  57.444  1.00 90.08  ? 45   SER B CB    1 
ATOM   3636  O  OG    . SER B  2  47  ? 82.714  81.066  56.443  1.00 91.58  ? 45   SER B OG    1 
ATOM   3637  N  N     . ARG B  2  48  ? 80.181  78.158  58.632  1.00 91.00  ? 46   ARG B N     1 
ATOM   3638  C  CA    . ARG B  2  48  ? 79.345  77.691  59.719  1.00 90.95  ? 46   ARG B CA    1 
ATOM   3639  C  C     . ARG B  2  48  ? 80.196  76.992  60.770  1.00 90.97  ? 46   ARG B C     1 
ATOM   3640  O  O     . ARG B  2  48  ? 80.464  75.794  60.671  1.00 91.59  ? 46   ARG B O     1 
ATOM   3641  C  CB    . ARG B  2  48  ? 78.285  76.741  59.174  1.00 91.54  ? 46   ARG B CB    1 
ATOM   3642  C  CG    . ARG B  2  48  ? 77.306  76.215  60.209  1.00 93.59  ? 46   ARG B CG    1 
ATOM   3643  C  CD    . ARG B  2  48  ? 76.311  75.281  59.534  1.00 94.32  ? 46   ARG B CD    1 
ATOM   3644  N  NE    . ARG B  2  48  ? 75.478  74.545  60.478  1.00 95.25  ? 46   ARG B NE    1 
ATOM   3645  C  CZ    . ARG B  2  48  ? 74.613  75.108  61.314  1.00 96.19  ? 46   ARG B CZ    1 
ATOM   3646  N  NH1   . ARG B  2  48  ? 74.463  76.429  61.329  1.00 95.88  ? 46   ARG B NH1   1 
ATOM   3647  N  NH2   . ARG B  2  48  ? 73.892  74.342  62.126  1.00 96.25  ? 46   ARG B NH2   1 
ATOM   3648  N  N     . ILE B  2  49  ? 80.618  77.758  61.773  1.00 90.18  ? 47   ILE B N     1 
ATOM   3649  C  CA    . ILE B  2  49  ? 81.446  77.259  62.868  1.00 88.31  ? 47   ILE B CA    1 
ATOM   3650  C  C     . ILE B  2  49  ? 80.573  76.656  63.971  1.00 87.68  ? 47   ILE B C     1 
ATOM   3651  O  O     . ILE B  2  49  ? 79.369  76.891  64.002  1.00 88.21  ? 47   ILE B O     1 
ATOM   3652  C  CB    . ILE B  2  49  ? 82.300  78.407  63.441  1.00 86.97  ? 47   ILE B CB    1 
ATOM   3653  C  CG1   . ILE B  2  49  ? 83.360  78.813  62.422  1.00 86.47  ? 47   ILE B CG1   1 
ATOM   3654  C  CG2   . ILE B  2  49  ? 82.966  77.980  64.721  1.00 87.72  ? 47   ILE B CG2   1 
ATOM   3655  C  CD1   . ILE B  2  49  ? 82.815  79.373  61.135  1.00 85.63  ? 47   ILE B CD1   1 
ATOM   3656  N  N     . GLY B  2  50  ? 81.171  75.875  64.867  1.00 86.81  ? 48   GLY B N     1 
ATOM   3657  C  CA    . GLY B  2  50  ? 80.394  75.271  65.933  1.00 85.99  ? 48   GLY B CA    1 
ATOM   3658  C  C     . GLY B  2  50  ? 81.153  74.459  66.972  1.00 85.54  ? 48   GLY B C     1 
ATOM   3659  O  O     . GLY B  2  50  ? 81.936  73.574  66.638  1.00 86.06  ? 48   GLY B O     1 
ATOM   3660  N  N     . VAL B  2  51  ? 80.893  74.761  68.243  1.00 84.61  ? 49   VAL B N     1 
ATOM   3661  C  CA    . VAL B  2  51  ? 81.510  74.092  69.385  1.00 82.78  ? 49   VAL B CA    1 
ATOM   3662  C  C     . VAL B  2  51  ? 80.693  72.880  69.826  1.00 84.06  ? 49   VAL B C     1 
ATOM   3663  O  O     . VAL B  2  51  ? 79.708  73.028  70.543  1.00 85.47  ? 49   VAL B O     1 
ATOM   3664  C  CB    . VAL B  2  51  ? 81.598  75.054  70.583  1.00 81.06  ? 49   VAL B CB    1 
ATOM   3665  C  CG1   . VAL B  2  51  ? 82.151  74.342  71.787  1.00 79.56  ? 49   VAL B CG1   1 
ATOM   3666  C  CG2   . VAL B  2  51  ? 82.440  76.248  70.222  1.00 79.27  ? 49   VAL B CG2   1 
ATOM   3667  N  N     . PHE B  2  52  ? 81.083  71.682  69.402  1.00 85.17  ? 50   PHE B N     1 
ATOM   3668  C  CA    . PHE B  2  52  ? 80.348  70.477  69.807  1.00 86.05  ? 50   PHE B CA    1 
ATOM   3669  C  C     . PHE B  2  52  ? 80.838  70.085  71.190  1.00 86.45  ? 50   PHE B C     1 
ATOM   3670  O  O     . PHE B  2  52  ? 82.035  70.030  71.422  1.00 88.79  ? 50   PHE B O     1 
ATOM   3671  C  CB    . PHE B  2  52  ? 80.594  69.332  68.824  1.00 85.18  ? 50   PHE B CB    1 
ATOM   3672  C  CG    . PHE B  2  52  ? 80.122  69.619  67.430  1.00 85.72  ? 50   PHE B CG    1 
ATOM   3673  C  CD1   . PHE B  2  52  ? 80.692  70.648  66.680  1.00 86.07  ? 50   PHE B CD1   1 
ATOM   3674  C  CD2   . PHE B  2  52  ? 79.103  68.856  66.860  1.00 86.21  ? 50   PHE B CD2   1 
ATOM   3675  C  CE1   . PHE B  2  52  ? 80.252  70.913  65.378  1.00 86.79  ? 50   PHE B CE1   1 
ATOM   3676  C  CE2   . PHE B  2  52  ? 78.651  69.106  65.558  1.00 85.46  ? 50   PHE B CE2   1 
ATOM   3677  C  CZ    . PHE B  2  52  ? 79.226  70.136  64.815  1.00 86.47  ? 50   PHE B CZ    1 
ATOM   3678  N  N     . ILE B  2  53  ? 79.926  69.816  72.111  1.00 86.43  ? 51   ILE B N     1 
ATOM   3679  C  CA    . ILE B  2  53  ? 80.331  69.465  73.464  1.00 87.80  ? 51   ILE B CA    1 
ATOM   3680  C  C     . ILE B  2  53  ? 79.741  68.136  73.910  1.00 90.16  ? 51   ILE B C     1 
ATOM   3681  O  O     . ILE B  2  53  ? 78.684  67.722  73.432  1.00 90.21  ? 51   ILE B O     1 
ATOM   3682  C  CB    . ILE B  2  53  ? 79.889  70.553  74.472  1.00 87.28  ? 51   ILE B CB    1 
ATOM   3683  C  CG1   . ILE B  2  53  ? 80.458  71.913  74.057  1.00 86.05  ? 51   ILE B CG1   1 
ATOM   3684  C  CG2   . ILE B  2  53  ? 80.327  70.174  75.882  1.00 87.05  ? 51   ILE B CG2   1 
ATOM   3685  C  CD1   . ILE B  2  53  ? 79.956  73.069  74.891  1.00 83.47  ? 51   ILE B CD1   1 
ATOM   3686  N  N     . LYS B  2  54  ? 80.431  67.468  74.830  1.00 92.53  ? 52   LYS B N     1 
ATOM   3687  C  CA    . LYS B  2  54  ? 79.957  66.194  75.354  1.00 94.43  ? 52   LYS B CA    1 
ATOM   3688  C  C     . LYS B  2  54  ? 79.076  66.469  76.568  1.00 95.15  ? 52   LYS B C     1 
ATOM   3689  O  O     . LYS B  2  54  ? 79.199  65.808  77.597  1.00 96.33  ? 52   LYS B O     1 
ATOM   3690  C  CB    . LYS B  2  54  ? 81.138  65.296  75.755  1.00 94.71  ? 52   LYS B CB    1 
ATOM   3691  C  CG    . LYS B  2  54  ? 81.944  64.751  74.579  1.00 95.45  ? 52   LYS B CG    1 
ATOM   3692  C  CD    . LYS B  2  54  ? 82.963  63.714  75.049  1.00 96.60  ? 52   LYS B CD    1 
ATOM   3693  C  CE    . LYS B  2  54  ? 83.666  63.019  73.885  1.00 95.92  ? 52   LYS B CE    1 
ATOM   3694  N  NZ    . LYS B  2  54  ? 84.641  61.999  74.360  1.00 95.14  ? 52   LYS B NZ    1 
ATOM   3695  N  N     . ALA B  2  55  ? 78.189  67.453  76.441  1.00 95.45  ? 53   ALA B N     1 
ATOM   3696  C  CA    . ALA B  2  55  ? 77.289  67.826  77.532  1.00 94.86  ? 53   ALA B CA    1 
ATOM   3697  C  C     . ALA B  2  55  ? 75.896  67.260  77.290  1.00 94.17  ? 53   ALA B C     1 
ATOM   3698  O  O     . ALA B  2  55  ? 75.639  66.672  76.236  1.00 94.75  ? 53   ALA B O     1 
ATOM   3699  C  CB    . ALA B  2  55  ? 77.227  69.343  77.657  1.00 93.70  ? 53   ALA B CB    1 
ATOM   3700  N  N     . GLY B  2  56  ? 75.001  67.429  78.261  1.00 92.96  ? 54   GLY B N     1 
ATOM   3701  C  CA    . GLY B  2  56  ? 73.657  66.911  78.089  1.00 92.01  ? 54   GLY B CA    1 
ATOM   3702  C  C     . GLY B  2  56  ? 72.863  66.593  79.342  1.00 91.14  ? 54   GLY B C     1 
ATOM   3703  O  O     . GLY B  2  56  ? 73.390  66.546  80.448  1.00 89.91  ? 54   GLY B O     1 
ATOM   3704  N  N     . SER B  2  57  ? 71.573  66.354  79.142  1.00 91.35  ? 55   SER B N     1 
ATOM   3705  C  CA    . SER B  2  57  ? 70.652  66.052  80.223  1.00 92.10  ? 55   SER B CA    1 
ATOM   3706  C  C     . SER B  2  57  ? 70.975  64.780  81.004  1.00 92.18  ? 55   SER B C     1 
ATOM   3707  O  O     . SER B  2  57  ? 70.472  64.591  82.112  1.00 92.42  ? 55   SER B O     1 
ATOM   3708  C  CB    . SER B  2  57  ? 69.233  65.930  79.671  1.00 92.83  ? 55   SER B CB    1 
ATOM   3709  O  OG    . SER B  2  57  ? 69.060  64.681  79.016  1.00 94.52  ? 55   SER B OG    1 
ATOM   3710  N  N     . ARG B  2  58  ? 71.791  63.896  80.440  1.00 91.75  ? 56   ARG B N     1 
ATOM   3711  C  CA    . ARG B  2  58  ? 72.109  62.660  81.147  1.00 91.85  ? 56   ARG B CA    1 
ATOM   3712  C  C     . ARG B  2  58  ? 73.061  62.872  82.332  1.00 92.35  ? 56   ARG B C     1 
ATOM   3713  O  O     . ARG B  2  58  ? 73.098  62.064  83.271  1.00 91.83  ? 56   ARG B O     1 
ATOM   3714  C  CB    . ARG B  2  58  ? 72.690  61.632  80.179  1.00 91.55  ? 56   ARG B CB    1 
ATOM   3715  C  CG    . ARG B  2  58  ? 73.984  62.053  79.496  1.00 92.73  ? 56   ARG B CG    1 
ATOM   3716  C  CD    . ARG B  2  58  ? 74.636  60.840  78.844  1.00 92.61  ? 56   ARG B CD    1 
ATOM   3717  N  NE    . ARG B  2  58  ? 74.787  59.764  79.822  1.00 92.92  ? 56   ARG B NE    1 
ATOM   3718  C  CZ    . ARG B  2  58  ? 74.887  58.475  79.520  1.00 92.17  ? 56   ARG B CZ    1 
ATOM   3719  N  NH1   . ARG B  2  58  ? 74.856  58.082  78.252  1.00 91.94  ? 56   ARG B NH1   1 
ATOM   3720  N  NH2   . ARG B  2  58  ? 74.997  57.577  80.490  1.00 91.14  ? 56   ARG B NH2   1 
ATOM   3721  N  N     . TYR B  2  59  ? 73.823  63.964  82.286  1.00 91.92  ? 57   TYR B N     1 
ATOM   3722  C  CA    . TYR B  2  59  ? 74.763  64.283  83.351  1.00 91.57  ? 57   TYR B CA    1 
ATOM   3723  C  C     . TYR B  2  59  ? 74.033  64.934  84.520  1.00 90.71  ? 57   TYR B C     1 
ATOM   3724  O  O     . TYR B  2  59  ? 74.620  65.230  85.563  1.00 90.87  ? 57   TYR B O     1 
ATOM   3725  C  CB    . TYR B  2  59  ? 75.854  65.221  82.828  1.00 92.97  ? 57   TYR B CB    1 
ATOM   3726  C  CG    . TYR B  2  59  ? 76.681  64.625  81.714  1.00 94.92  ? 57   TYR B CG    1 
ATOM   3727  C  CD1   . TYR B  2  59  ? 76.159  64.486  80.432  1.00 96.43  ? 57   TYR B CD1   1 
ATOM   3728  C  CD2   . TYR B  2  59  ? 77.983  64.178  81.946  1.00 96.00  ? 57   TYR B CD2   1 
ATOM   3729  C  CE1   . TYR B  2  59  ? 76.911  63.916  79.405  1.00 97.14  ? 57   TYR B CE1   1 
ATOM   3730  C  CE2   . TYR B  2  59  ? 78.743  63.605  80.930  1.00 96.45  ? 57   TYR B CE2   1 
ATOM   3731  C  CZ    . TYR B  2  59  ? 78.201  63.479  79.664  1.00 97.11  ? 57   TYR B CZ    1 
ATOM   3732  O  OH    . TYR B  2  59  ? 78.947  62.918  78.656  1.00 98.19  ? 57   TYR B OH    1 
ATOM   3733  N  N     . GLU B  2  60  ? 72.742  65.157  84.341  1.00 89.42  ? 58   GLU B N     1 
ATOM   3734  C  CA    . GLU B  2  60  ? 71.950  65.775  85.383  1.00 87.70  ? 58   GLU B CA    1 
ATOM   3735  C  C     . GLU B  2  60  ? 71.635  64.777  86.471  1.00 85.86  ? 58   GLU B C     1 
ATOM   3736  O  O     . GLU B  2  60  ? 71.684  63.574  86.259  1.00 84.07  ? 58   GLU B O     1 
ATOM   3737  C  CB    . GLU B  2  60  ? 70.634  66.314  84.816  1.00 88.46  ? 58   GLU B CB    1 
ATOM   3738  C  CG    . GLU B  2  60  ? 70.713  67.639  84.060  1.00 87.30  ? 58   GLU B CG    1 
ATOM   3739  C  CD    . GLU B  2  60  ? 69.349  68.067  83.554  1.00 87.12  ? 58   GLU B CD    1 
ATOM   3740  O  OE1   . GLU B  2  60  ? 68.351  67.631  84.167  1.00 87.19  ? 58   GLU B OE1   1 
ATOM   3741  O  OE2   . GLU B  2  60  ? 69.266  68.830  82.565  1.00 86.29  ? 58   GLU B OE2   1 
ATOM   3742  N  N     . THR B  2  61  ? 71.309  65.305  87.639  1.00 85.94  ? 59   THR B N     1 
ATOM   3743  C  CA    . THR B  2  61  ? 70.943  64.497  88.789  1.00 86.92  ? 59   THR B CA    1 
ATOM   3744  C  C     . THR B  2  61  ? 69.590  65.003  89.235  1.00 86.40  ? 59   THR B C     1 
ATOM   3745  O  O     . THR B  2  61  ? 69.149  66.076  88.824  1.00 85.94  ? 59   THR B O     1 
ATOM   3746  C  CB    . THR B  2  61  ? 71.879  64.721  89.975  1.00 87.68  ? 59   THR B CB    1 
ATOM   3747  O  OG1   . THR B  2  61  ? 73.234  64.657  89.528  1.00 90.24  ? 59   THR B OG1   1 
ATOM   3748  C  CG2   . THR B  2  61  ? 71.622  63.673  91.061  1.00 85.98  ? 59   THR B CG2   1 
ATOM   3749  N  N     . THR B  2  62  ? 68.943  64.237  90.098  1.00 85.89  ? 60   THR B N     1 
ATOM   3750  C  CA    . THR B  2  62  ? 67.655  64.637  90.624  1.00 85.28  ? 60   THR B CA    1 
ATOM   3751  C  C     . THR B  2  62  ? 67.813  66.087  91.110  1.00 85.18  ? 60   THR B C     1 
ATOM   3752  O  O     . THR B  2  62  ? 66.915  66.921  90.965  1.00 84.77  ? 60   THR B O     1 
ATOM   3753  C  CB    . THR B  2  62  ? 67.266  63.730  91.807  1.00 85.28  ? 60   THR B CB    1 
ATOM   3754  O  OG1   . THR B  2  62  ? 65.841  63.696  91.938  1.00 84.19  ? 60   THR B OG1   1 
ATOM   3755  C  CG2   . THR B  2  62  ? 67.902  64.247  93.116  1.00 84.80  ? 60   THR B CG2   1 
ATOM   3756  N  N     . ALA B  2  63  ? 68.990  66.372  91.659  1.00 84.52  ? 61   ALA B N     1 
ATOM   3757  C  CA    . ALA B  2  63  ? 69.327  67.683  92.199  1.00 83.48  ? 61   ALA B CA    1 
ATOM   3758  C  C     . ALA B  2  63  ? 69.251  68.890  91.261  1.00 82.28  ? 61   ALA B C     1 
ATOM   3759  O  O     . ALA B  2  63  ? 68.760  69.944  91.663  1.00 81.81  ? 61   ALA B O     1 
ATOM   3760  C  CB    . ALA B  2  63  ? 70.705  67.624  92.815  1.00 84.08  ? 61   ALA B CB    1 
ATOM   3761  N  N     . ASN B  2  64  ? 69.749  68.757  90.034  1.00 80.77  ? 62   ASN B N     1 
ATOM   3762  C  CA    . ASN B  2  64  ? 69.735  69.882  89.096  1.00 79.94  ? 62   ASN B CA    1 
ATOM   3763  C  C     . ASN B  2  64  ? 68.924  69.634  87.820  1.00 79.15  ? 62   ASN B C     1 
ATOM   3764  O  O     . ASN B  2  64  ? 69.123  70.307  86.804  1.00 78.52  ? 62   ASN B O     1 
ATOM   3765  C  CB    . ASN B  2  64  ? 71.174  70.280  88.736  1.00 79.70  ? 62   ASN B CB    1 
ATOM   3766  C  CG    . ASN B  2  64  ? 71.943  69.155  88.068  1.00 80.20  ? 62   ASN B CG    1 
ATOM   3767  O  OD1   . ASN B  2  64  ? 71.567  67.982  88.162  1.00 82.02  ? 62   ASN B OD1   1 
ATOM   3768  N  ND2   . ASN B  2  64  ? 73.037  69.502  87.403  1.00 79.52  ? 62   ASN B ND2   1 
ATOM   3769  N  N     . LEU B  2  65  ? 68.004  68.672  87.887  1.00 77.32  ? 63   LEU B N     1 
ATOM   3770  C  CA    . LEU B  2  65  ? 67.147  68.332  86.754  1.00 75.27  ? 63   LEU B CA    1 
ATOM   3771  C  C     . LEU B  2  65  ? 66.730  69.551  85.936  1.00 75.90  ? 63   LEU B C     1 
ATOM   3772  O  O     . LEU B  2  65  ? 66.234  70.539  86.484  1.00 76.87  ? 63   LEU B O     1 
ATOM   3773  C  CB    . LEU B  2  65  ? 65.896  67.621  87.252  1.00 71.87  ? 63   LEU B CB    1 
ATOM   3774  C  CG    . LEU B  2  65  ? 66.095  66.187  87.707  1.00 70.85  ? 63   LEU B CG    1 
ATOM   3775  C  CD1   . LEU B  2  65  ? 64.794  65.660  88.305  1.00 70.52  ? 63   LEU B CD1   1 
ATOM   3776  C  CD2   . LEU B  2  65  ? 66.543  65.342  86.518  1.00 68.75  ? 63   LEU B CD2   1 
ATOM   3777  N  N     . GLY B  2  66  ? 66.939  69.475  84.623  1.00 75.82  ? 64   GLY B N     1 
ATOM   3778  C  CA    . GLY B  2  66  ? 66.568  70.560  83.732  1.00 74.45  ? 64   GLY B CA    1 
ATOM   3779  C  C     . GLY B  2  66  ? 67.604  71.643  83.505  1.00 73.65  ? 64   GLY B C     1 
ATOM   3780  O  O     . GLY B  2  66  ? 67.519  72.381  82.531  1.00 73.13  ? 64   GLY B O     1 
ATOM   3781  N  N     . THR B  2  67  ? 68.582  71.756  84.393  1.00 73.88  ? 65   THR B N     1 
ATOM   3782  C  CA    . THR B  2  67  ? 69.597  72.788  84.226  1.00 74.66  ? 65   THR B CA    1 
ATOM   3783  C  C     . THR B  2  67  ? 70.152  72.768  82.800  1.00 74.73  ? 65   THR B C     1 
ATOM   3784  O  O     . THR B  2  67  ? 70.397  73.825  82.213  1.00 74.10  ? 65   THR B O     1 
ATOM   3785  C  CB    . THR B  2  67  ? 70.734  72.617  85.263  1.00 74.58  ? 65   THR B CB    1 
ATOM   3786  O  OG1   . THR B  2  67  ? 71.845  73.461  84.926  1.00 72.46  ? 65   THR B OG1   1 
ATOM   3787  C  CG2   . THR B  2  67  ? 71.171  71.185  85.314  1.00 77.03  ? 65   THR B CG2   1 
ATOM   3788  N  N     . ALA B  2  68  ? 70.315  71.569  82.239  1.00 75.06  ? 66   ALA B N     1 
ATOM   3789  C  CA    . ALA B  2  68  ? 70.824  71.409  80.875  1.00 75.85  ? 66   ALA B CA    1 
ATOM   3790  C  C     . ALA B  2  68  ? 69.957  72.166  79.856  1.00 76.90  ? 66   ALA B C     1 
ATOM   3791  O  O     . ALA B  2  68  ? 70.471  72.832  78.940  1.00 76.58  ? 66   ALA B O     1 
ATOM   3792  C  CB    . ALA B  2  68  ? 70.871  69.942  80.520  1.00 75.47  ? 66   ALA B CB    1 
ATOM   3793  N  N     . HIS B  2  69  ? 68.640  72.045  80.025  1.00 76.60  ? 67   HIS B N     1 
ATOM   3794  C  CA    . HIS B  2  69  ? 67.659  72.712  79.169  1.00 74.94  ? 67   HIS B CA    1 
ATOM   3795  C  C     . HIS B  2  69  ? 67.818  74.234  79.266  1.00 73.53  ? 67   HIS B C     1 
ATOM   3796  O  O     . HIS B  2  69  ? 67.990  74.912  78.254  1.00 72.19  ? 67   HIS B O     1 
ATOM   3797  C  CB    . HIS B  2  69  ? 66.246  72.298  79.612  1.00 75.84  ? 67   HIS B CB    1 
ATOM   3798  C  CG    . HIS B  2  69  ? 65.138  72.927  78.820  1.00 76.43  ? 67   HIS B CG    1 
ATOM   3799  N  ND1   . HIS B  2  69  ? 63.812  72.607  79.023  1.00 75.27  ? 67   HIS B ND1   1 
ATOM   3800  C  CD2   . HIS B  2  69  ? 65.155  73.847  77.823  1.00 76.33  ? 67   HIS B CD2   1 
ATOM   3801  C  CE1   . HIS B  2  69  ? 63.062  73.302  78.183  1.00 75.57  ? 67   HIS B CE1   1 
ATOM   3802  N  NE2   . HIS B  2  69  ? 63.851  74.061  77.444  1.00 74.31  ? 67   HIS B NE2   1 
ATOM   3803  N  N     . LEU B  2  70  ? 67.764  74.750  80.492  1.00 72.38  ? 68   LEU B N     1 
ATOM   3804  C  CA    . LEU B  2  70  ? 67.888  76.179  80.750  1.00 72.43  ? 68   LEU B CA    1 
ATOM   3805  C  C     . LEU B  2  70  ? 69.213  76.739  80.278  1.00 73.47  ? 68   LEU B C     1 
ATOM   3806  O  O     . LEU B  2  70  ? 69.317  77.919  79.955  1.00 73.45  ? 68   LEU B O     1 
ATOM   3807  C  CB    . LEU B  2  70  ? 67.747  76.460  82.238  1.00 72.23  ? 68   LEU B CB    1 
ATOM   3808  C  CG    . LEU B  2  70  ? 67.836  77.932  82.638  1.00 71.88  ? 68   LEU B CG    1 
ATOM   3809  C  CD1   . LEU B  2  70  ? 66.649  78.686  82.098  1.00 72.00  ? 68   LEU B CD1   1 
ATOM   3810  C  CD2   . LEU B  2  70  ? 67.858  78.035  84.148  1.00 73.82  ? 68   LEU B CD2   1 
ATOM   3811  N  N     . LEU B  2  71  ? 70.239  75.900  80.268  1.00 74.75  ? 69   LEU B N     1 
ATOM   3812  C  CA    . LEU B  2  71  ? 71.539  76.347  79.814  1.00 75.53  ? 69   LEU B CA    1 
ATOM   3813  C  C     . LEU B  2  71  ? 71.426  76.574  78.312  1.00 76.09  ? 69   LEU B C     1 
ATOM   3814  O  O     . LEU B  2  71  ? 72.013  77.512  77.758  1.00 76.45  ? 69   LEU B O     1 
ATOM   3815  C  CB    . LEU B  2  71  ? 72.590  75.283  80.109  1.00 76.21  ? 69   LEU B CB    1 
ATOM   3816  C  CG    . LEU B  2  71  ? 73.990  75.544  79.541  1.00 77.56  ? 69   LEU B CG    1 
ATOM   3817  C  CD1   . LEU B  2  71  ? 74.569  76.842  80.094  1.00 76.29  ? 69   LEU B CD1   1 
ATOM   3818  C  CD2   . LEU B  2  71  ? 74.882  74.364  79.888  1.00 77.50  ? 69   LEU B CD2   1 
ATOM   3819  N  N     . ARG B  2  72  ? 70.647  75.710  77.665  1.00 75.96  ? 70   ARG B N     1 
ATOM   3820  C  CA    . ARG B  2  72  ? 70.430  75.779  76.224  1.00 75.52  ? 70   ARG B CA    1 
ATOM   3821  C  C     . ARG B  2  72  ? 69.801  77.106  75.799  1.00 76.28  ? 70   ARG B C     1 
ATOM   3822  O  O     . ARG B  2  72  ? 70.104  77.637  74.734  1.00 76.78  ? 70   ARG B O     1 
ATOM   3823  C  CB    . ARG B  2  72  ? 69.549  74.608  75.794  1.00 74.17  ? 70   ARG B CB    1 
ATOM   3824  C  CG    . ARG B  2  72  ? 69.192  74.617  74.341  1.00 72.24  ? 70   ARG B CG    1 
ATOM   3825  C  CD    . ARG B  2  72  ? 68.676  73.267  73.892  1.00 71.97  ? 70   ARG B CD    1 
ATOM   3826  N  NE    . ARG B  2  72  ? 67.323  72.921  74.331  1.00 70.92  ? 70   ARG B NE    1 
ATOM   3827  C  CZ    . ARG B  2  72  ? 67.044  71.958  75.207  1.00 72.33  ? 70   ARG B CZ    1 
ATOM   3828  N  NH1   . ARG B  2  72  ? 68.016  71.245  75.768  1.00 72.99  ? 70   ARG B NH1   1 
ATOM   3829  N  NH2   . ARG B  2  72  ? 65.784  71.662  75.479  1.00 73.03  ? 70   ARG B NH2   1 
ATOM   3830  N  N     . LEU B  2  73  ? 68.930  77.644  76.644  1.00 77.30  ? 71   LEU B N     1 
ATOM   3831  C  CA    . LEU B  2  73  ? 68.254  78.908  76.360  1.00 77.15  ? 71   LEU B CA    1 
ATOM   3832  C  C     . LEU B  2  73  ? 69.008  80.089  76.956  1.00 77.23  ? 71   LEU B C     1 
ATOM   3833  O  O     . LEU B  2  73  ? 68.523  81.215  76.901  1.00 77.99  ? 71   LEU B O     1 
ATOM   3834  C  CB    . LEU B  2  73  ? 66.841  78.914  76.957  1.00 76.46  ? 71   LEU B CB    1 
ATOM   3835  C  CG    . LEU B  2  73  ? 65.901  77.724  76.755  1.00 75.51  ? 71   LEU B CG    1 
ATOM   3836  C  CD1   . LEU B  2  73  ? 64.583  78.002  77.472  1.00 75.79  ? 71   LEU B CD1   1 
ATOM   3837  C  CD2   . LEU B  2  73  ? 65.673  77.488  75.285  1.00 73.89  ? 71   LEU B CD2   1 
ATOM   3838  N  N     . ALA B  2  74  ? 70.174  79.837  77.545  1.00 76.95  ? 72   ALA B N     1 
ATOM   3839  C  CA    . ALA B  2  74  ? 70.948  80.913  78.159  1.00 76.11  ? 72   ALA B CA    1 
ATOM   3840  C  C     . ALA B  2  74  ? 71.890  81.528  77.152  1.00 75.59  ? 72   ALA B C     1 
ATOM   3841  O  O     . ALA B  2  74  ? 72.455  82.583  77.390  1.00 75.11  ? 72   ALA B O     1 
ATOM   3842  C  CB    . ALA B  2  74  ? 71.724  80.387  79.342  1.00 75.19  ? 72   ALA B CB    1 
ATOM   3843  N  N     . SER B  2  75  ? 72.036  80.858  76.016  1.00 76.65  ? 73   SER B N     1 
ATOM   3844  C  CA    . SER B  2  75  ? 72.911  81.309  74.942  1.00 77.52  ? 73   SER B CA    1 
ATOM   3845  C  C     . SER B  2  75  ? 72.945  82.811  74.710  1.00 78.59  ? 73   SER B C     1 
ATOM   3846  O  O     . SER B  2  75  ? 73.994  83.368  74.402  1.00 79.50  ? 73   SER B O     1 
ATOM   3847  C  CB    . SER B  2  75  ? 72.540  80.603  73.630  1.00 76.77  ? 73   SER B CB    1 
ATOM   3848  O  OG    . SER B  2  75  ? 71.133  80.447  73.511  1.00 78.07  ? 73   SER B OG    1 
ATOM   3849  N  N     . PRO B  2  76  ? 71.804  83.497  74.862  1.00 80.25  ? 74   PRO B N     1 
ATOM   3850  C  CA    . PRO B  2  76  ? 71.862  84.942  74.622  1.00 80.47  ? 74   PRO B CA    1 
ATOM   3851  C  C     . PRO B  2  76  ? 72.120  85.835  75.818  1.00 80.21  ? 74   PRO B C     1 
ATOM   3852  O  O     . PRO B  2  76  ? 72.072  87.053  75.676  1.00 80.00  ? 74   PRO B O     1 
ATOM   3853  C  CB    . PRO B  2  76  ? 70.518  85.231  73.968  1.00 81.18  ? 74   PRO B CB    1 
ATOM   3854  C  CG    . PRO B  2  76  ? 69.602  84.286  74.703  1.00 81.42  ? 74   PRO B CG    1 
ATOM   3855  C  CD    . PRO B  2  76  ? 70.411  83.007  74.832  1.00 81.09  ? 74   PRO B CD    1 
ATOM   3856  N  N     . LEU B  2  77  ? 72.387  85.245  76.983  1.00 80.90  ? 75   LEU B N     1 
ATOM   3857  C  CA    . LEU B  2  77  ? 72.662  86.037  78.187  1.00 82.56  ? 75   LEU B CA    1 
ATOM   3858  C  C     . LEU B  2  77  ? 74.093  86.567  78.147  1.00 85.67  ? 75   LEU B C     1 
ATOM   3859  O  O     . LEU B  2  77  ? 74.945  86.000  77.450  1.00 86.98  ? 75   LEU B O     1 
ATOM   3860  C  CB    . LEU B  2  77  ? 72.482  85.202  79.448  1.00 79.87  ? 75   LEU B CB    1 
ATOM   3861  C  CG    . LEU B  2  77  ? 71.182  84.441  79.625  1.00 77.95  ? 75   LEU B CG    1 
ATOM   3862  C  CD1   . LEU B  2  77  ? 71.020  84.060  81.082  1.00 77.84  ? 75   LEU B CD1   1 
ATOM   3863  C  CD2   . LEU B  2  77  ? 70.046  85.306  79.204  1.00 79.19  ? 75   LEU B CD2   1 
ATOM   3864  N  N     . THR B  2  78  ? 74.359  87.638  78.902  1.00 87.75  ? 76   THR B N     1 
ATOM   3865  C  CA    . THR B  2  78  ? 75.691  88.256  78.927  1.00 89.45  ? 76   THR B CA    1 
ATOM   3866  C  C     . THR B  2  78  ? 76.821  87.294  79.282  1.00 91.08  ? 76   THR B C     1 
ATOM   3867  O  O     . THR B  2  78  ? 76.644  86.347  80.061  1.00 90.53  ? 76   THR B O     1 
ATOM   3868  C  CB    . THR B  2  78  ? 75.783  89.444  79.925  1.00 88.76  ? 76   THR B CB    1 
ATOM   3869  O  OG1   . THR B  2  78  ? 75.421  88.991  81.232  1.00 89.64  ? 76   THR B OG1   1 
ATOM   3870  C  CG2   . THR B  2  78  ? 74.880  90.589  79.513  1.00 87.77  ? 76   THR B CG2   1 
ATOM   3871  N  N     . THR B  2  79  ? 77.985  87.572  78.695  1.00 93.00  ? 77   THR B N     1 
ATOM   3872  C  CA    . THR B  2  79  ? 79.209  86.801  78.900  1.00 94.97  ? 77   THR B CA    1 
ATOM   3873  C  C     . THR B  2  79  ? 80.282  87.774  79.378  1.00 95.86  ? 77   THR B C     1 
ATOM   3874  O  O     . THR B  2  79  ? 80.135  88.986  79.224  1.00 96.43  ? 77   THR B O     1 
ATOM   3875  C  CB    . THR B  2  79  ? 79.711  86.176  77.591  1.00 95.18  ? 77   THR B CB    1 
ATOM   3876  O  OG1   . THR B  2  79  ? 80.024  87.222  76.662  1.00 93.88  ? 77   THR B OG1   1 
ATOM   3877  C  CG2   . THR B  2  79  ? 78.655  85.253  76.996  1.00 95.57  ? 77   THR B CG2   1 
ATOM   3878  N  N     . LYS B  2  80  ? 81.368  87.246  79.936  1.00 96.58  ? 78   LYS B N     1 
ATOM   3879  C  CA    . LYS B  2  80  ? 82.446  88.091  80.436  1.00 96.70  ? 78   LYS B CA    1 
ATOM   3880  C  C     . LYS B  2  80  ? 82.992  89.073  79.404  1.00 95.78  ? 78   LYS B C     1 
ATOM   3881  O  O     . LYS B  2  80  ? 83.696  90.011  79.766  1.00 96.15  ? 78   LYS B O     1 
ATOM   3882  C  CB    . LYS B  2  80  ? 83.602  87.236  80.975  1.00 98.13  ? 78   LYS B CB    1 
ATOM   3883  C  CG    . LYS B  2  80  ? 83.306  86.518  82.283  1.00 100.72 ? 78   LYS B CG    1 
ATOM   3884  C  CD    . LYS B  2  80  ? 84.587  85.985  82.911  1.00 103.52 ? 78   LYS B CD    1 
ATOM   3885  C  CE    . LYS B  2  80  ? 84.322  85.243  84.218  1.00 105.52 ? 78   LYS B CE    1 
ATOM   3886  N  NZ    . LYS B  2  80  ? 83.540  83.987  84.015  1.00 106.75 ? 78   LYS B NZ    1 
ATOM   3887  N  N     . GLY B  2  81  ? 82.667  88.878  78.128  1.00 94.26  ? 79   GLY B N     1 
ATOM   3888  C  CA    . GLY B  2  81  ? 83.192  89.779  77.118  1.00 92.58  ? 79   GLY B CA    1 
ATOM   3889  C  C     . GLY B  2  81  ? 82.182  90.395  76.182  1.00 91.91  ? 79   GLY B C     1 
ATOM   3890  O  O     . GLY B  2  81  ? 82.515  91.287  75.407  1.00 90.98  ? 79   GLY B O     1 
ATOM   3891  N  N     . ALA B  2  82  ? 80.947  89.918  76.243  1.00 92.35  ? 80   ALA B N     1 
ATOM   3892  C  CA    . ALA B  2  82  ? 79.893  90.436  75.385  1.00 92.77  ? 80   ALA B CA    1 
ATOM   3893  C  C     . ALA B  2  82  ? 78.577  90.514  76.149  1.00 93.16  ? 80   ALA B C     1 
ATOM   3894  O  O     . ALA B  2  82  ? 78.139  89.534  76.756  1.00 94.34  ? 80   ALA B O     1 
ATOM   3895  C  CB    . ALA B  2  82  ? 79.732  89.543  74.153  1.00 91.68  ? 80   ALA B CB    1 
ATOM   3896  N  N     . SER B  2  83  ? 77.946  91.679  76.120  1.00 92.33  ? 81   SER B N     1 
ATOM   3897  C  CA    . SER B  2  83  ? 76.682  91.847  76.808  1.00 91.61  ? 81   SER B CA    1 
ATOM   3898  C  C     . SER B  2  83  ? 75.563  91.161  76.041  1.00 91.73  ? 81   SER B C     1 
ATOM   3899  O  O     . SER B  2  83  ? 75.651  90.943  74.825  1.00 91.19  ? 81   SER B O     1 
ATOM   3900  C  CB    . SER B  2  83  ? 76.346  93.327  76.944  1.00 92.30  ? 81   SER B CB    1 
ATOM   3901  O  OG    . SER B  2  83  ? 76.250  93.936  75.667  1.00 92.38  ? 81   SER B OG    1 
ATOM   3902  N  N     . SER B  2  84  ? 74.508  90.825  76.773  1.00 91.44  ? 82   SER B N     1 
ATOM   3903  C  CA    . SER B  2  84  ? 73.325  90.194  76.208  1.00 89.37  ? 82   SER B CA    1 
ATOM   3904  C  C     . SER B  2  84  ? 72.991  90.987  74.948  1.00 87.41  ? 82   SER B C     1 
ATOM   3905  O  O     . SER B  2  84  ? 72.810  90.426  73.866  1.00 85.77  ? 82   SER B O     1 
ATOM   3906  C  CB    . SER B  2  84  ? 72.184  90.288  77.228  1.00 89.28  ? 82   SER B CB    1 
ATOM   3907  O  OG    . SER B  2  84  ? 70.990  89.698  76.755  1.00 91.35  ? 82   SER B OG    1 
ATOM   3908  N  N     . PHE B  2  85  ? 72.950  92.306  75.121  1.00 86.07  ? 83   PHE B N     1 
ATOM   3909  C  CA    . PHE B  2  85  ? 72.657  93.259  74.058  1.00 85.59  ? 83   PHE B CA    1 
ATOM   3910  C  C     . PHE B  2  85  ? 73.579  93.114  72.854  1.00 86.93  ? 83   PHE B C     1 
ATOM   3911  O  O     . PHE B  2  85  ? 73.130  92.840  71.738  1.00 88.66  ? 83   PHE B O     1 
ATOM   3912  C  CB    . PHE B  2  85  ? 72.782  94.681  74.601  1.00 82.92  ? 83   PHE B CB    1 
ATOM   3913  C  CG    . PHE B  2  85  ? 72.581  95.745  73.569  1.00 80.59  ? 83   PHE B CG    1 
ATOM   3914  C  CD1   . PHE B  2  85  ? 71.309  96.110  73.166  1.00 81.00  ? 83   PHE B CD1   1 
ATOM   3915  C  CD2   . PHE B  2  85  ? 73.665  96.385  72.998  1.00 79.95  ? 83   PHE B CD2   1 
ATOM   3916  C  CE1   . PHE B  2  85  ? 71.121  97.103  72.203  1.00 80.71  ? 83   PHE B CE1   1 
ATOM   3917  C  CE2   . PHE B  2  85  ? 73.489  97.379  72.035  1.00 79.80  ? 83   PHE B CE2   1 
ATOM   3918  C  CZ    . PHE B  2  85  ? 72.216  97.737  71.638  1.00 79.57  ? 83   PHE B CZ    1 
ATOM   3919  N  N     . ARG B  2  86  ? 74.873  93.304  73.079  1.00 87.17  ? 84   ARG B N     1 
ATOM   3920  C  CA    . ARG B  2  86  ? 75.848  93.215  72.000  1.00 86.18  ? 84   ARG B CA    1 
ATOM   3921  C  C     . ARG B  2  86  ? 75.877  91.857  71.304  1.00 84.17  ? 84   ARG B C     1 
ATOM   3922  O  O     . ARG B  2  86  ? 76.147  91.783  70.106  1.00 82.83  ? 84   ARG B O     1 
ATOM   3923  C  CB    . ARG B  2  86  ? 77.239  93.586  72.527  1.00 88.00  ? 84   ARG B CB    1 
ATOM   3924  C  CG    . ARG B  2  86  ? 78.351  93.544  71.490  1.00 89.36  ? 84   ARG B CG    1 
ATOM   3925  C  CD    . ARG B  2  86  ? 79.544  94.373  71.949  1.00 90.21  ? 84   ARG B CD    1 
ATOM   3926  N  NE    . ARG B  2  86  ? 80.819  93.814  71.507  1.00 90.63  ? 84   ARG B NE    1 
ATOM   3927  C  CZ    . ARG B  2  86  ? 81.396  92.750  72.055  1.00 90.33  ? 84   ARG B CZ    1 
ATOM   3928  N  NH1   . ARG B  2  86  ? 80.815  92.128  73.069  1.00 90.51  ? 84   ARG B NH1   1 
ATOM   3929  N  NH2   . ARG B  2  86  ? 82.558  92.313  71.595  1.00 90.53  ? 84   ARG B NH2   1 
ATOM   3930  N  N     . ILE B  2  87  ? 75.595  90.787  72.037  1.00 82.72  ? 85   ILE B N     1 
ATOM   3931  C  CA    . ILE B  2  87  ? 75.597  89.466  71.417  1.00 83.15  ? 85   ILE B CA    1 
ATOM   3932  C  C     . ILE B  2  87  ? 74.576  89.415  70.294  1.00 82.83  ? 85   ILE B C     1 
ATOM   3933  O  O     . ILE B  2  87  ? 74.898  89.055  69.162  1.00 84.19  ? 85   ILE B O     1 
ATOM   3934  C  CB    . ILE B  2  87  ? 75.242  88.340  72.411  1.00 83.70  ? 85   ILE B CB    1 
ATOM   3935  C  CG1   . ILE B  2  87  ? 76.356  88.187  73.448  1.00 84.17  ? 85   ILE B CG1   1 
ATOM   3936  C  CG2   . ILE B  2  87  ? 75.030  87.026  71.654  1.00 82.40  ? 85   ILE B CG2   1 
ATOM   3937  C  CD1   . ILE B  2  87  ? 76.071  87.135  74.508  1.00 83.42  ? 85   ILE B CD1   1 
ATOM   3938  N  N     . THR B  2  88  ? 73.338  89.772  70.617  1.00 81.62  ? 86   THR B N     1 
ATOM   3939  C  CA    . THR B  2  88  ? 72.272  89.755  69.629  1.00 79.39  ? 86   THR B CA    1 
ATOM   3940  C  C     . THR B  2  88  ? 72.455  90.860  68.592  1.00 77.84  ? 86   THR B C     1 
ATOM   3941  O  O     . THR B  2  88  ? 72.326  90.615  67.397  1.00 77.75  ? 86   THR B O     1 
ATOM   3942  C  CB    . THR B  2  88  ? 70.885  89.881  70.300  1.00 79.20  ? 86   THR B CB    1 
ATOM   3943  O  OG1   . THR B  2  88  ? 70.683  88.782  71.201  1.00 78.36  ? 86   THR B OG1   1 
ATOM   3944  C  CG2   . THR B  2  88  ? 69.786  89.859  69.258  1.00 79.13  ? 86   THR B CG2   1 
ATOM   3945  N  N     . ARG B  2  89  ? 72.768  92.071  69.026  1.00 76.42  ? 87   ARG B N     1 
ATOM   3946  C  CA    . ARG B  2  89  ? 72.954  93.131  68.051  1.00 77.50  ? 87   ARG B CA    1 
ATOM   3947  C  C     . ARG B  2  89  ? 74.140  92.851  67.147  1.00 78.96  ? 87   ARG B C     1 
ATOM   3948  O  O     . ARG B  2  89  ? 74.061  93.054  65.932  1.00 79.34  ? 87   ARG B O     1 
ATOM   3949  C  CB    . ARG B  2  89  ? 73.154  94.468  68.741  1.00 76.54  ? 87   ARG B CB    1 
ATOM   3950  C  CG    . ARG B  2  89  ? 71.900  94.987  69.378  1.00 77.44  ? 87   ARG B CG    1 
ATOM   3951  C  CD    . ARG B  2  89  ? 70.739  94.946  68.398  1.00 76.88  ? 87   ARG B CD    1 
ATOM   3952  N  NE    . ARG B  2  89  ? 69.544  95.521  68.995  1.00 75.21  ? 87   ARG B NE    1 
ATOM   3953  C  CZ    . ARG B  2  89  ? 69.395  96.812  69.249  1.00 74.18  ? 87   ARG B CZ    1 
ATOM   3954  N  NH1   . ARG B  2  89  ? 70.364  97.664  68.948  1.00 72.39  ? 87   ARG B NH1   1 
ATOM   3955  N  NH2   . ARG B  2  89  ? 68.284  97.244  69.826  1.00 75.81  ? 87   ARG B NH2   1 
ATOM   3956  N  N     . GLY B  2  90  ? 75.234  92.380  67.752  1.00 79.94  ? 88   GLY B N     1 
ATOM   3957  C  CA    . GLY B  2  90  ? 76.451  92.073  67.014  1.00 78.69  ? 88   GLY B CA    1 
ATOM   3958  C  C     . GLY B  2  90  ? 76.250  91.087  65.875  1.00 77.36  ? 88   GLY B C     1 
ATOM   3959  O  O     . GLY B  2  90  ? 76.613  91.360  64.722  1.00 77.23  ? 88   GLY B O     1 
ATOM   3960  N  N     . ILE B  2  91  ? 75.672  89.937  66.203  1.00 75.08  ? 89   ILE B N     1 
ATOM   3961  C  CA    . ILE B  2  91  ? 75.406  88.899  65.218  1.00 74.03  ? 89   ILE B CA    1 
ATOM   3962  C  C     . ILE B  2  91  ? 74.456  89.363  64.107  1.00 75.37  ? 89   ILE B C     1 
ATOM   3963  O  O     . ILE B  2  91  ? 74.719  89.162  62.914  1.00 75.03  ? 89   ILE B O     1 
ATOM   3964  C  CB    . ILE B  2  91  ? 74.791  87.682  65.888  1.00 71.66  ? 89   ILE B CB    1 
ATOM   3965  C  CG1   . ILE B  2  91  ? 75.793  87.090  66.867  1.00 70.85  ? 89   ILE B CG1   1 
ATOM   3966  C  CG2   . ILE B  2  91  ? 74.353  86.684  64.842  1.00 70.16  ? 89   ILE B CG2   1 
ATOM   3967  C  CD1   . ILE B  2  91  ? 75.282  85.892  67.631  1.00 73.08  ? 89   ILE B CD1   1 
ATOM   3968  N  N     . GLU B  2  92  ? 73.347  89.977  64.513  1.00 75.69  ? 90   GLU B N     1 
ATOM   3969  C  CA    . GLU B  2  92  ? 72.348  90.462  63.574  1.00 74.90  ? 90   GLU B CA    1 
ATOM   3970  C  C     . GLU B  2  92  ? 72.909  91.532  62.659  1.00 75.27  ? 90   GLU B C     1 
ATOM   3971  O  O     . GLU B  2  92  ? 72.453  91.684  61.523  1.00 75.36  ? 90   GLU B O     1 
ATOM   3972  C  CB    . GLU B  2  92  ? 71.142  91.022  64.327  1.00 74.13  ? 90   GLU B CB    1 
ATOM   3973  C  CG    . GLU B  2  92  ? 70.479  90.018  65.238  1.00 74.23  ? 90   GLU B CG    1 
ATOM   3974  C  CD    . GLU B  2  92  ? 68.993  90.254  65.383  1.00 74.80  ? 90   GLU B CD    1 
ATOM   3975  O  OE1   . GLU B  2  92  ? 68.600  91.306  65.942  1.00 73.66  ? 90   GLU B OE1   1 
ATOM   3976  O  OE2   . GLU B  2  92  ? 68.224  89.375  64.927  1.00 76.25  ? 90   GLU B OE2   1 
ATOM   3977  N  N     . ALA B  2  93  ? 73.896  92.272  63.160  1.00 75.46  ? 91   ALA B N     1 
ATOM   3978  C  CA    . ALA B  2  93  ? 74.525  93.348  62.398  1.00 75.18  ? 91   ALA B CA    1 
ATOM   3979  C  C     . ALA B  2  93  ? 75.131  92.846  61.090  1.00 75.83  ? 91   ALA B C     1 
ATOM   3980  O  O     . ALA B  2  93  ? 75.176  93.571  60.101  1.00 74.59  ? 91   ALA B O     1 
ATOM   3981  C  CB    . ALA B  2  93  ? 75.594  94.010  63.241  1.00 75.05  ? 91   ALA B CB    1 
ATOM   3982  N  N     . VAL B  2  94  ? 75.581  91.596  61.088  1.00 77.27  ? 92   VAL B N     1 
ATOM   3983  C  CA    . VAL B  2  94  ? 76.206  91.005  59.913  1.00 78.74  ? 92   VAL B CA    1 
ATOM   3984  C  C     . VAL B  2  94  ? 75.341  89.958  59.222  1.00 80.52  ? 92   VAL B C     1 
ATOM   3985  O  O     . VAL B  2  94  ? 75.778  89.313  58.266  1.00 82.24  ? 92   VAL B O     1 
ATOM   3986  C  CB    . VAL B  2  94  ? 77.528  90.325  60.293  1.00 78.94  ? 92   VAL B CB    1 
ATOM   3987  C  CG1   . VAL B  2  94  ? 78.518  91.347  60.812  1.00 79.12  ? 92   VAL B CG1   1 
ATOM   3988  C  CG2   . VAL B  2  94  ? 77.270  89.270  61.347  1.00 78.21  ? 92   VAL B CG2   1 
ATOM   3989  N  N     . GLY B  2  95  ? 74.120  89.768  59.707  1.00 81.17  ? 93   GLY B N     1 
ATOM   3990  C  CA    . GLY B  2  95  ? 73.251  88.778  59.093  1.00 79.26  ? 93   GLY B CA    1 
ATOM   3991  C  C     . GLY B  2  95  ? 73.664  87.398  59.541  1.00 77.94  ? 93   GLY B C     1 
ATOM   3992  O  O     . GLY B  2  95  ? 73.532  86.423  58.806  1.00 76.76  ? 93   GLY B O     1 
ATOM   3993  N  N     . GLY B  2  96  ? 74.175  87.325  60.764  1.00 78.05  ? 94   GLY B N     1 
ATOM   3994  C  CA    . GLY B  2  96  ? 74.613  86.053  61.302  1.00 78.61  ? 94   GLY B CA    1 
ATOM   3995  C  C     . GLY B  2  96  ? 73.539  85.405  62.147  1.00 78.41  ? 94   GLY B C     1 
ATOM   3996  O  O     . GLY B  2  96  ? 72.487  85.995  62.364  1.00 80.00  ? 94   GLY B O     1 
ATOM   3997  N  N     . SER B  2  97  ? 73.800  84.192  62.620  1.00 76.98  ? 95   SER B N     1 
ATOM   3998  C  CA    . SER B  2  97  ? 72.849  83.480  63.453  1.00 75.91  ? 95   SER B CA    1 
ATOM   3999  C  C     . SER B  2  97  ? 73.570  82.720  64.545  1.00 75.62  ? 95   SER B C     1 
ATOM   4000  O  O     . SER B  2  97  ? 74.758  82.448  64.437  1.00 76.62  ? 95   SER B O     1 
ATOM   4001  C  CB    . SER B  2  97  ? 72.028  82.505  62.616  1.00 75.35  ? 95   SER B CB    1 
ATOM   4002  O  OG    . SER B  2  97  ? 72.861  81.572  61.955  1.00 75.94  ? 95   SER B OG    1 
ATOM   4003  N  N     . LEU B  2  98  ? 72.843  82.384  65.600  1.00 75.15  ? 96   LEU B N     1 
ATOM   4004  C  CA    . LEU B  2  98  ? 73.400  81.649  66.719  1.00 74.42  ? 96   LEU B CA    1 
ATOM   4005  C  C     . LEU B  2  98  ? 72.331  80.684  67.168  1.00 74.31  ? 96   LEU B C     1 
ATOM   4006  O  O     . LEU B  2  98  ? 71.199  81.079  67.418  1.00 75.32  ? 96   LEU B O     1 
ATOM   4007  C  CB    . LEU B  2  98  ? 73.771  82.603  67.856  1.00 73.85  ? 96   LEU B CB    1 
ATOM   4008  C  CG    . LEU B  2  98  ? 74.234  81.986  69.179  1.00 73.52  ? 96   LEU B CG    1 
ATOM   4009  C  CD1   . LEU B  2  98  ? 75.252  80.901  68.935  1.00 72.40  ? 96   LEU B CD1   1 
ATOM   4010  C  CD2   . LEU B  2  98  ? 74.821  83.085  70.057  1.00 72.90  ? 96   LEU B CD2   1 
ATOM   4011  N  N     . SER B  2  99  ? 72.688  79.414  67.251  1.00 74.33  ? 97   SER B N     1 
ATOM   4012  C  CA    . SER B  2  99  ? 71.739  78.390  67.649  1.00 74.99  ? 97   SER B CA    1 
ATOM   4013  C  C     . SER B  2  99  ? 72.419  77.384  68.546  1.00 74.80  ? 97   SER B C     1 
ATOM   4014  O  O     . SER B  2  99  ? 73.637  77.269  68.552  1.00 75.06  ? 97   SER B O     1 
ATOM   4015  C  CB    . SER B  2  99  ? 71.203  77.654  66.419  1.00 76.10  ? 97   SER B CB    1 
ATOM   4016  O  OG    . SER B  2  99  ? 70.730  78.563  65.447  1.00 78.59  ? 97   SER B OG    1 
ATOM   4017  N  N     . VAL B  2  100 ? 71.616  76.642  69.289  1.00 74.41  ? 98   VAL B N     1 
ATOM   4018  C  CA    . VAL B  2  100 ? 72.121  75.620  70.183  1.00 74.40  ? 98   VAL B CA    1 
ATOM   4019  C  C     . VAL B  2  100 ? 71.218  74.396  70.048  1.00 76.30  ? 98   VAL B C     1 
ATOM   4020  O  O     . VAL B  2  100 ? 70.023  74.474  70.311  1.00 77.72  ? 98   VAL B O     1 
ATOM   4021  C  CB    . VAL B  2  100 ? 72.103  76.110  71.655  1.00 72.38  ? 98   VAL B CB    1 
ATOM   4022  C  CG1   . VAL B  2  100 ? 72.624  75.024  72.583  1.00 72.54  ? 98   VAL B CG1   1 
ATOM   4023  C  CG2   . VAL B  2  100 ? 72.932  77.359  71.790  1.00 70.28  ? 98   VAL B CG2   1 
ATOM   4024  N  N     . TYR B  2  101 ? 71.761  73.270  69.604  1.00 77.83  ? 99   TYR B N     1 
ATOM   4025  C  CA    . TYR B  2  101 ? 70.934  72.073  69.502  1.00 79.20  ? 99   TYR B CA    1 
ATOM   4026  C  C     . TYR B  2  101 ? 71.514  71.125  70.538  1.00 79.36  ? 99   TYR B C     1 
ATOM   4027  O  O     . TYR B  2  101 ? 72.701  71.212  70.852  1.00 79.94  ? 99   TYR B O     1 
ATOM   4028  C  CB    . TYR B  2  101 ? 71.019  71.439  68.106  1.00 79.69  ? 99   TYR B CB    1 
ATOM   4029  C  CG    . TYR B  2  101 ? 71.015  72.424  66.959  1.00 81.34  ? 99   TYR B CG    1 
ATOM   4030  C  CD1   . TYR B  2  101 ? 72.129  73.227  66.715  1.00 82.02  ? 99   TYR B CD1   1 
ATOM   4031  C  CD2   . TYR B  2  101 ? 69.899  72.560  66.121  1.00 80.99  ? 99   TYR B CD2   1 
ATOM   4032  C  CE1   . TYR B  2  101 ? 72.139  74.143  65.676  1.00 82.88  ? 99   TYR B CE1   1 
ATOM   4033  C  CE2   . TYR B  2  101 ? 69.900  73.476  65.071  1.00 81.39  ? 99   TYR B CE2   1 
ATOM   4034  C  CZ    . TYR B  2  101 ? 71.027  74.265  64.861  1.00 82.99  ? 99   TYR B CZ    1 
ATOM   4035  O  OH    . TYR B  2  101 ? 71.054  75.199  63.856  1.00 84.73  ? 99   TYR B OH    1 
ATOM   4036  N  N     . SER B  2  102 ? 70.688  70.244  71.090  1.00 79.06  ? 100  SER B N     1 
ATOM   4037  C  CA    . SER B  2  102 ? 71.180  69.295  72.074  1.00 79.52  ? 100  SER B CA    1 
ATOM   4038  C  C     . SER B  2  102 ? 70.314  68.062  72.269  1.00 79.95  ? 100  SER B C     1 
ATOM   4039  O  O     . SER B  2  102 ? 69.093  68.144  72.346  1.00 80.57  ? 100  SER B O     1 
ATOM   4040  C  CB    . SER B  2  102 ? 71.415  69.987  73.421  1.00 79.68  ? 100  SER B CB    1 
ATOM   4041  O  OG    . SER B  2  102 ? 70.301  70.742  73.839  1.00 80.05  ? 100  SER B OG    1 
ATOM   4042  N  N     . THR B  2  103 ? 70.978  66.912  72.331  1.00 80.76  ? 101  THR B N     1 
ATOM   4043  C  CA    . THR B  2  103 ? 70.332  65.620  72.526  1.00 81.83  ? 101  THR B CA    1 
ATOM   4044  C  C     . THR B  2  103 ? 70.517  65.270  73.998  1.00 82.58  ? 101  THR B C     1 
ATOM   4045  O  O     . THR B  2  103 ? 71.088  66.069  74.748  1.00 82.41  ? 101  THR B O     1 
ATOM   4046  C  CB    . THR B  2  103 ? 71.008  64.553  71.683  1.00 81.31  ? 101  THR B CB    1 
ATOM   4047  O  OG1   . THR B  2  103 ? 72.336  64.359  72.168  1.00 84.03  ? 101  THR B OG1   1 
ATOM   4048  C  CG2   . THR B  2  103 ? 71.102  64.995  70.242  1.00 81.70  ? 101  THR B CG2   1 
ATOM   4049  N  N     . ARG B  2  104 ? 70.049  64.094  74.420  1.00 83.19  ? 102  ARG B N     1 
ATOM   4050  C  CA    . ARG B  2  104 ? 70.200  63.715  75.824  1.00 84.31  ? 102  ARG B CA    1 
ATOM   4051  C  C     . ARG B  2  104 ? 71.658  63.731  76.278  1.00 85.10  ? 102  ARG B C     1 
ATOM   4052  O  O     . ARG B  2  104 ? 71.938  63.833  77.479  1.00 84.87  ? 102  ARG B O     1 
ATOM   4053  C  CB    . ARG B  2  104 ? 69.622  62.324  76.097  1.00 84.21  ? 102  ARG B CB    1 
ATOM   4054  C  CG    . ARG B  2  104 ? 68.175  62.317  76.477  1.00 85.30  ? 102  ARG B CG    1 
ATOM   4055  C  CD    . ARG B  2  104 ? 67.318  61.941  75.291  1.00 88.86  ? 102  ARG B CD    1 
ATOM   4056  N  NE    . ARG B  2  104 ? 65.903  62.181  75.553  1.00 91.61  ? 102  ARG B NE    1 
ATOM   4057  C  CZ    . ARG B  2  104 ? 65.268  61.769  76.644  1.00 93.03  ? 102  ARG B CZ    1 
ATOM   4058  N  NH1   . ARG B  2  104 ? 65.931  61.093  77.575  1.00 93.80  ? 102  ARG B NH1   1 
ATOM   4059  N  NH2   . ARG B  2  104 ? 63.977  62.036  76.807  1.00 93.59  ? 102  ARG B NH2   1 
ATOM   4060  N  N     . GLU B  2  105 ? 72.586  63.648  75.325  1.00 85.74  ? 103  GLU B N     1 
ATOM   4061  C  CA    . GLU B  2  105 ? 74.006  63.614  75.663  1.00 85.77  ? 103  GLU B CA    1 
ATOM   4062  C  C     . GLU B  2  105 ? 74.929  64.358  74.699  1.00 85.52  ? 103  GLU B C     1 
ATOM   4063  O  O     . GLU B  2  105 ? 76.097  64.006  74.564  1.00 85.84  ? 103  GLU B O     1 
ATOM   4064  C  CB    . GLU B  2  105 ? 74.461  62.148  75.774  1.00 85.72  ? 103  GLU B CB    1 
ATOM   4065  C  CG    . GLU B  2  105 ? 74.479  61.375  74.454  1.00 86.13  ? 103  GLU B CG    1 
ATOM   4066  C  CD    . GLU B  2  105 ? 74.855  59.910  74.630  1.00 86.92  ? 103  GLU B CD    1 
ATOM   4067  O  OE1   . GLU B  2  105 ? 75.174  59.241  73.619  1.00 85.92  ? 103  GLU B OE1   1 
ATOM   4068  O  OE2   . GLU B  2  105 ? 74.820  59.427  75.782  1.00 87.93  ? 103  GLU B OE2   1 
ATOM   4069  N  N     . LYS B  2  106 ? 74.432  65.399  74.048  1.00 85.45  ? 104  LYS B N     1 
ATOM   4070  C  CA    . LYS B  2  106 ? 75.270  66.119  73.099  1.00 86.36  ? 104  LYS B CA    1 
ATOM   4071  C  C     . LYS B  2  106 ? 74.771  67.544  72.921  1.00 86.96  ? 104  LYS B C     1 
ATOM   4072  O  O     . LYS B  2  106 ? 73.610  67.758  72.612  1.00 88.33  ? 104  LYS B O     1 
ATOM   4073  C  CB    . LYS B  2  106 ? 75.252  65.368  71.762  1.00 86.00  ? 104  LYS B CB    1 
ATOM   4074  C  CG    . LYS B  2  106 ? 76.235  65.842  70.704  1.00 88.01  ? 104  LYS B CG    1 
ATOM   4075  C  CD    . LYS B  2  106 ? 76.216  64.880  69.503  1.00 89.22  ? 104  LYS B CD    1 
ATOM   4076  C  CE    . LYS B  2  106 ? 77.141  65.327  68.365  1.00 90.81  ? 104  LYS B CE    1 
ATOM   4077  N  NZ    . LYS B  2  106 ? 76.662  66.542  67.629  1.00 90.59  ? 104  LYS B NZ    1 
ATOM   4078  N  N     . MET B  2  107 ? 75.639  68.523  73.135  1.00 87.68  ? 105  MET B N     1 
ATOM   4079  C  CA    . MET B  2  107 ? 75.245  69.916  72.973  1.00 88.86  ? 105  MET B CA    1 
ATOM   4080  C  C     . MET B  2  107 ? 76.063  70.554  71.875  1.00 89.65  ? 105  MET B C     1 
ATOM   4081  O  O     . MET B  2  107 ? 77.290  70.489  71.890  1.00 90.79  ? 105  MET B O     1 
ATOM   4082  C  CB    . MET B  2  107 ? 75.457  70.700  74.258  1.00 89.83  ? 105  MET B CB    1 
ATOM   4083  C  CG    . MET B  2  107 ? 74.581  70.260  75.392  1.00 92.42  ? 105  MET B CG    1 
ATOM   4084  S  SD    . MET B  2  107 ? 74.417  71.582  76.588  1.00 96.81  ? 105  MET B SD    1 
ATOM   4085  C  CE    . MET B  2  107 ? 72.641  71.935  76.494  1.00 96.74  ? 105  MET B CE    1 
ATOM   4086  N  N     . THR B  2  108 ? 75.392  71.189  70.924  1.00 89.99  ? 106  THR B N     1 
ATOM   4087  C  CA    . THR B  2  108 ? 76.109  71.807  69.821  1.00 89.09  ? 106  THR B CA    1 
ATOM   4088  C  C     . THR B  2  108 ? 75.815  73.288  69.636  1.00 88.64  ? 106  THR B C     1 
ATOM   4089  O  O     . THR B  2  108 ? 74.783  73.653  69.076  1.00 88.49  ? 106  THR B O     1 
ATOM   4090  C  CB    . THR B  2  108 ? 75.801  71.098  68.479  1.00 88.70  ? 106  THR B CB    1 
ATOM   4091  O  OG1   . THR B  2  108 ? 75.751  69.676  68.667  1.00 87.33  ? 106  THR B OG1   1 
ATOM   4092  C  CG2   . THR B  2  108 ? 76.881  71.425  67.468  1.00 87.88  ? 106  THR B CG2   1 
ATOM   4093  N  N     . TYR B  2  109 ? 76.716  74.136  70.123  1.00 87.46  ? 107  TYR B N     1 
ATOM   4094  C  CA    . TYR B  2  109 ? 76.573  75.574  69.947  1.00 87.16  ? 107  TYR B CA    1 
ATOM   4095  C  C     . TYR B  2  109 ? 77.162  75.813  68.568  1.00 87.80  ? 107  TYR B C     1 
ATOM   4096  O  O     . TYR B  2  109 ? 78.051  75.075  68.165  1.00 89.29  ? 107  TYR B O     1 
ATOM   4097  C  CB    . TYR B  2  109 ? 77.398  76.335  70.982  1.00 85.46  ? 107  TYR B CB    1 
ATOM   4098  C  CG    . TYR B  2  109 ? 76.779  76.383  72.351  1.00 84.97  ? 107  TYR B CG    1 
ATOM   4099  C  CD1   . TYR B  2  109 ? 76.517  75.215  73.070  1.00 84.62  ? 107  TYR B CD1   1 
ATOM   4100  C  CD2   . TYR B  2  109 ? 76.459  77.603  72.937  1.00 84.75  ? 107  TYR B CD2   1 
ATOM   4101  C  CE1   . TYR B  2  109 ? 75.944  75.270  74.355  1.00 84.41  ? 107  TYR B CE1   1 
ATOM   4102  C  CE2   . TYR B  2  109 ? 75.891  77.670  74.215  1.00 84.49  ? 107  TYR B CE2   1 
ATOM   4103  C  CZ    . TYR B  2  109 ? 75.635  76.506  74.920  1.00 84.01  ? 107  TYR B CZ    1 
ATOM   4104  O  OH    . TYR B  2  109 ? 75.076  76.594  76.183  1.00 82.31  ? 107  TYR B OH    1 
ATOM   4105  N  N     . CYS B  2  110 ? 76.676  76.808  67.830  1.00 88.11  ? 108  CYS B N     1 
ATOM   4106  C  CA    . CYS B  2  110 ? 77.232  77.082  66.505  1.00 87.65  ? 108  CYS B CA    1 
ATOM   4107  C  C     . CYS B  2  110 ? 76.605  78.260  65.794  1.00 87.14  ? 108  CYS B C     1 
ATOM   4108  O  O     . CYS B  2  110 ? 75.384  78.396  65.749  1.00 86.33  ? 108  CYS B O     1 
ATOM   4109  C  CB    . CYS B  2  110 ? 77.128  75.850  65.597  1.00 88.39  ? 108  CYS B CB    1 
ATOM   4110  S  SG    . CYS B  2  110 ? 75.475  75.402  65.077  1.00 87.58  ? 108  CYS B SG    1 
ATOM   4111  N  N     . VAL B  2  111 ? 77.467  79.099  65.228  1.00 86.92  ? 109  VAL B N     1 
ATOM   4112  C  CA    . VAL B  2  111 ? 77.048  80.281  64.495  1.00 86.36  ? 109  VAL B CA    1 
ATOM   4113  C  C     . VAL B  2  111 ? 77.119  79.988  63.001  1.00 87.04  ? 109  VAL B C     1 
ATOM   4114  O  O     . VAL B  2  111 ? 77.567  78.919  62.594  1.00 87.29  ? 109  VAL B O     1 
ATOM   4115  C  CB    . VAL B  2  111 ? 77.955  81.472  64.826  1.00 85.46  ? 109  VAL B CB    1 
ATOM   4116  C  CG1   . VAL B  2  111 ? 78.088  81.600  66.328  1.00 84.06  ? 109  VAL B CG1   1 
ATOM   4117  C  CG2   . VAL B  2  111 ? 79.314  81.292  64.185  1.00 85.12  ? 109  VAL B CG2   1 
ATOM   4118  N  N     . GLU B  2  112 ? 76.672  80.934  62.187  1.00 87.77  ? 110  GLU B N     1 
ATOM   4119  C  CA    . GLU B  2  112 ? 76.687  80.754  60.746  1.00 89.60  ? 110  GLU B CA    1 
ATOM   4120  C  C     . GLU B  2  112 ? 76.530  82.128  60.152  1.00 89.51  ? 110  GLU B C     1 
ATOM   4121  O  O     . GLU B  2  112 ? 75.689  82.895  60.596  1.00 89.13  ? 110  GLU B O     1 
ATOM   4122  C  CB    . GLU B  2  112 ? 75.524  79.862  60.319  1.00 92.23  ? 110  GLU B CB    1 
ATOM   4123  C  CG    . GLU B  2  112 ? 75.518  79.480  58.842  1.00 97.11  ? 110  GLU B CG    1 
ATOM   4124  C  CD    . GLU B  2  112 ? 74.380  78.520  58.489  1.00 99.99  ? 110  GLU B CD    1 
ATOM   4125  O  OE1   . GLU B  2  112 ? 73.201  78.903  58.689  1.00 103.04 ? 110  GLU B OE1   1 
ATOM   4126  O  OE2   . GLU B  2  112 ? 74.663  77.390  58.016  1.00 99.60  ? 110  GLU B OE2   1 
ATOM   4127  N  N     . CYS B  2  113 ? 77.341  82.443  59.154  1.00 90.57  ? 111  CYS B N     1 
ATOM   4128  C  CA    . CYS B  2  113 ? 77.280  83.758  58.528  1.00 92.65  ? 111  CYS B CA    1 
ATOM   4129  C  C     . CYS B  2  113 ? 78.058  83.788  57.224  1.00 93.86  ? 111  CYS B C     1 
ATOM   4130  O  O     . CYS B  2  113 ? 78.779  82.846  56.896  1.00 94.71  ? 111  CYS B O     1 
ATOM   4131  C  CB    . CYS B  2  113 ? 77.866  84.815  59.469  1.00 93.27  ? 111  CYS B CB    1 
ATOM   4132  S  SG    . CYS B  2  113 ? 79.658  84.699  59.715  1.00 93.21  ? 111  CYS B SG    1 
ATOM   4133  N  N     . LEU B  2  114 ? 77.911  84.868  56.470  1.00 94.55  ? 112  LEU B N     1 
ATOM   4134  C  CA    . LEU B  2  114 ? 78.657  84.975  55.235  1.00 96.14  ? 112  LEU B CA    1 
ATOM   4135  C  C     . LEU B  2  114 ? 80.121  84.901  55.650  1.00 97.82  ? 112  LEU B C     1 
ATOM   4136  O  O     . LEU B  2  114 ? 80.477  85.342  56.748  1.00 98.42  ? 112  LEU B O     1 
ATOM   4137  C  CB    . LEU B  2  114 ? 78.382  86.311  54.561  1.00 95.76  ? 112  LEU B CB    1 
ATOM   4138  C  CG    . LEU B  2  114 ? 76.920  86.565  54.224  1.00 96.21  ? 112  LEU B CG    1 
ATOM   4139  C  CD1   . LEU B  2  114 ? 76.779  87.950  53.582  1.00 96.04  ? 112  LEU B CD1   1 
ATOM   4140  C  CD2   . LEU B  2  114 ? 76.418  85.461  53.297  1.00 95.29  ? 112  LEU B CD2   1 
ATOM   4141  N  N     . ARG B  2  115 ? 80.958  84.339  54.780  1.00 98.73  ? 113  ARG B N     1 
ATOM   4142  C  CA    . ARG B  2  115 ? 82.393  84.196  55.037  1.00 98.00  ? 113  ARG B CA    1 
ATOM   4143  C  C     . ARG B  2  115 ? 83.029  85.416  55.687  1.00 97.38  ? 113  ARG B C     1 
ATOM   4144  O  O     . ARG B  2  115 ? 83.544  85.345  56.799  1.00 97.13  ? 113  ARG B O     1 
ATOM   4145  C  CB    . ARG B  2  115 ? 83.135  83.930  53.734  1.00 98.45  ? 113  ARG B CB    1 
ATOM   4146  C  CG    . ARG B  2  115 ? 82.584  82.792  52.912  1.00 99.74  ? 113  ARG B CG    1 
ATOM   4147  C  CD    . ARG B  2  115 ? 83.422  82.622  51.660  1.00 99.96  ? 113  ARG B CD    1 
ATOM   4148  N  NE    . ARG B  2  115 ? 84.811  82.338  52.003  1.00 99.97  ? 113  ARG B NE    1 
ATOM   4149  C  CZ    . ARG B  2  115 ? 85.251  81.171  52.467  1.00 99.29  ? 113  ARG B CZ    1 
ATOM   4150  N  NH1   . ARG B  2  115 ? 84.416  80.156  52.641  1.00 98.07  ? 113  ARG B NH1   1 
ATOM   4151  N  NH2   . ARG B  2  115 ? 86.530  81.027  52.776  1.00 99.56  ? 113  ARG B NH2   1 
ATOM   4152  N  N     . ASP B  2  116 ? 82.989  86.536  54.976  1.00 96.96  ? 114  ASP B N     1 
ATOM   4153  C  CA    . ASP B  2  116 ? 83.590  87.780  55.441  1.00 97.51  ? 114  ASP B CA    1 
ATOM   4154  C  C     . ASP B  2  116 ? 83.268  88.248  56.860  1.00 97.07  ? 114  ASP B C     1 
ATOM   4155  O  O     . ASP B  2  116 ? 83.674  89.342  57.249  1.00 97.38  ? 114  ASP B O     1 
ATOM   4156  C  CB    . ASP B  2  116 ? 83.248  88.923  54.475  1.00 99.47  ? 114  ASP B CB    1 
ATOM   4157  C  CG    . ASP B  2  116 ? 83.681  88.642  53.044  1.00 102.26 ? 114  ASP B CG    1 
ATOM   4158  O  OD1   . ASP B  2  116 ? 84.637  87.861  52.846  1.00 105.56 ? 114  ASP B OD1   1 
ATOM   4159  O  OD2   . ASP B  2  116 ? 83.075  89.217  52.112  1.00 102.79 ? 114  ASP B OD2   1 
ATOM   4160  N  N     . HIS B  2  117 ? 82.567  87.451  57.653  1.00 96.32  ? 115  HIS B N     1 
ATOM   4161  C  CA    . HIS B  2  117 ? 82.232  87.922  58.989  1.00 96.31  ? 115  HIS B CA    1 
ATOM   4162  C  C     . HIS B  2  117 ? 82.559  86.964  60.118  1.00 96.76  ? 115  HIS B C     1 
ATOM   4163  O  O     . HIS B  2  117 ? 82.354  87.288  61.289  1.00 95.51  ? 115  HIS B O     1 
ATOM   4164  C  CB    . HIS B  2  117 ? 80.744  88.267  59.042  1.00 96.35  ? 115  HIS B CB    1 
ATOM   4165  C  CG    . HIS B  2  117 ? 80.317  89.288  58.030  1.00 95.44  ? 115  HIS B CG    1 
ATOM   4166  N  ND1   . HIS B  2  117 ? 80.831  90.567  57.995  1.00 94.94  ? 115  HIS B ND1   1 
ATOM   4167  C  CD2   . HIS B  2  117 ? 79.408  89.221  57.026  1.00 94.31  ? 115  HIS B CD2   1 
ATOM   4168  C  CE1   . HIS B  2  117 ? 80.259  91.244  57.016  1.00 94.44  ? 115  HIS B CE1   1 
ATOM   4169  N  NE2   . HIS B  2  117 ? 79.391  90.450  56.413  1.00 94.49  ? 115  HIS B NE2   1 
ATOM   4170  N  N     . VAL B  2  118 ? 83.080  85.794  59.766  1.00 98.05  ? 116  VAL B N     1 
ATOM   4171  C  CA    . VAL B  2  118 ? 83.401  84.763  60.744  1.00 99.72  ? 116  VAL B CA    1 
ATOM   4172  C  C     . VAL B  2  118 ? 84.127  85.234  62.004  1.00 101.09 ? 116  VAL B C     1 
ATOM   4173  O  O     . VAL B  2  118 ? 83.940  84.655  63.081  1.00 101.22 ? 116  VAL B O     1 
ATOM   4174  C  CB    . VAL B  2  118 ? 84.217  83.634  60.103  1.00 99.69  ? 116  VAL B CB    1 
ATOM   4175  C  CG1   . VAL B  2  118 ? 84.309  82.459  61.062  1.00 100.33 ? 116  VAL B CG1   1 
ATOM   4176  C  CG2   . VAL B  2  118 ? 83.562  83.195  58.809  1.00 100.33 ? 116  VAL B CG2   1 
ATOM   4177  N  N     . ASP B  2  119 ? 84.959  86.266  61.884  1.00 102.25 ? 117  ASP B N     1 
ATOM   4178  C  CA    . ASP B  2  119 ? 85.673  86.781  63.053  1.00 102.58 ? 117  ASP B CA    1 
ATOM   4179  C  C     . ASP B  2  119 ? 84.633  87.317  64.005  1.00 101.91 ? 117  ASP B C     1 
ATOM   4180  O  O     . ASP B  2  119 ? 84.504  86.866  65.146  1.00 101.70 ? 117  ASP B O     1 
ATOM   4181  C  CB    . ASP B  2  119 ? 86.607  87.920  62.664  1.00 104.57 ? 117  ASP B CB    1 
ATOM   4182  C  CG    . ASP B  2  119 ? 87.730  87.461  61.774  1.00 107.84 ? 117  ASP B CG    1 
ATOM   4183  O  OD1   . ASP B  2  119 ? 88.485  86.554  62.198  1.00 109.36 ? 117  ASP B OD1   1 
ATOM   4184  O  OD2   . ASP B  2  119 ? 87.856  88.000  60.651  1.00 109.72 ? 117  ASP B OD2   1 
ATOM   4185  N  N     . THR B  2  120 ? 83.887  88.289  63.498  1.00 100.97 ? 118  THR B N     1 
ATOM   4186  C  CA    . THR B  2  120 ? 82.826  88.945  64.240  1.00 99.31  ? 118  THR B CA    1 
ATOM   4187  C  C     . THR B  2  120 ? 82.014  87.945  65.072  1.00 97.58  ? 118  THR B C     1 
ATOM   4188  O  O     . THR B  2  120 ? 82.028  87.995  66.308  1.00 97.43  ? 118  THR B O     1 
ATOM   4189  C  CB    . THR B  2  120 ? 81.892  89.673  63.263  1.00 99.58  ? 118  THR B CB    1 
ATOM   4190  O  OG1   . THR B  2  120 ? 82.659  90.178  62.160  1.00 98.48  ? 118  THR B OG1   1 
ATOM   4191  C  CG2   . THR B  2  120 ? 81.194  90.834  63.964  1.00 100.43 ? 118  THR B CG2   1 
ATOM   4192  N  N     . VAL B  2  121 ? 81.331  87.030  64.384  1.00 94.43  ? 119  VAL B N     1 
ATOM   4193  C  CA    . VAL B  2  121 ? 80.493  86.024  65.029  1.00 91.77  ? 119  VAL B CA    1 
ATOM   4194  C  C     . VAL B  2  121 ? 81.244  85.056  65.940  1.00 91.01  ? 119  VAL B C     1 
ATOM   4195  O  O     . VAL B  2  121 ? 80.662  84.450  66.840  1.00 89.88  ? 119  VAL B O     1 
ATOM   4196  C  CB    . VAL B  2  121 ? 79.716  85.194  63.975  1.00 90.86  ? 119  VAL B CB    1 
ATOM   4197  C  CG1   . VAL B  2  121 ? 79.114  86.115  62.943  1.00 90.89  ? 119  VAL B CG1   1 
ATOM   4198  C  CG2   . VAL B  2  121 ? 80.621  84.180  63.317  1.00 89.54  ? 119  VAL B CG2   1 
ATOM   4199  N  N     . MET B  2  122 ? 82.542  84.917  65.715  1.00 90.57  ? 120  MET B N     1 
ATOM   4200  C  CA    . MET B  2  122 ? 83.339  83.992  66.506  1.00 90.33  ? 120  MET B CA    1 
ATOM   4201  C  C     . MET B  2  122 ? 83.423  84.388  67.978  1.00 89.37  ? 120  MET B C     1 
ATOM   4202  O  O     . MET B  2  122 ? 83.232  83.555  68.873  1.00 87.66  ? 120  MET B O     1 
ATOM   4203  C  CB    . MET B  2  122 ? 84.742  83.881  65.907  1.00 91.09  ? 120  MET B CB    1 
ATOM   4204  C  CG    . MET B  2  122 ? 85.415  82.553  66.206  1.00 93.04  ? 120  MET B CG    1 
ATOM   4205  S  SD    . MET B  2  122 ? 84.355  81.145  65.735  1.00 95.08  ? 120  MET B SD    1 
ATOM   4206  C  CE    . MET B  2  122 ? 84.568  81.159  63.977  1.00 93.48  ? 120  MET B CE    1 
ATOM   4207  N  N     . GLU B  2  123 ? 83.713  85.666  68.215  1.00 88.97  ? 121  GLU B N     1 
ATOM   4208  C  CA    . GLU B  2  123 ? 83.823  86.207  69.567  1.00 87.69  ? 121  GLU B CA    1 
ATOM   4209  C  C     . GLU B  2  123 ? 82.609  85.827  70.385  1.00 87.37  ? 121  GLU B C     1 
ATOM   4210  O  O     . GLU B  2  123 ? 82.715  85.383  71.528  1.00 86.88  ? 121  GLU B O     1 
ATOM   4211  C  CB    . GLU B  2  123 ? 83.922  87.728  69.516  1.00 86.36  ? 121  GLU B CB    1 
ATOM   4212  C  CG    . GLU B  2  123 ? 83.575  88.398  70.827  1.00 87.33  ? 121  GLU B CG    1 
ATOM   4213  C  CD    . GLU B  2  123 ? 83.856  89.892  70.813  1.00 89.64  ? 121  GLU B CD    1 
ATOM   4214  O  OE1   . GLU B  2  123 ? 83.534  90.562  69.805  1.00 89.49  ? 121  GLU B OE1   1 
ATOM   4215  O  OE2   . GLU B  2  123 ? 84.394  90.401  71.820  1.00 90.64  ? 121  GLU B OE2   1 
ATOM   4216  N  N     . TYR B  2  124 ? 81.446  86.014  69.777  1.00 87.31  ? 122  TYR B N     1 
ATOM   4217  C  CA    . TYR B  2  124 ? 80.190  85.712  70.429  1.00 85.22  ? 122  TYR B CA    1 
ATOM   4218  C  C     . TYR B  2  124 ? 80.057  84.212  70.664  1.00 85.17  ? 122  TYR B C     1 
ATOM   4219  O  O     . TYR B  2  124 ? 79.719  83.790  71.773  1.00 84.03  ? 122  TYR B O     1 
ATOM   4220  C  CB    . TYR B  2  124 ? 79.043  86.287  69.588  1.00 82.27  ? 122  TYR B CB    1 
ATOM   4221  C  CG    . TYR B  2  124 ? 79.151  87.793  69.450  1.00 78.63  ? 122  TYR B CG    1 
ATOM   4222  C  CD1   . TYR B  2  124 ? 79.138  88.404  68.203  1.00 77.63  ? 122  TYR B CD1   1 
ATOM   4223  C  CD2   . TYR B  2  124 ? 79.323  88.603  70.576  1.00 78.33  ? 122  TYR B CD2   1 
ATOM   4224  C  CE1   . TYR B  2  124 ? 79.300  89.786  68.072  1.00 78.27  ? 122  TYR B CE1   1 
ATOM   4225  C  CE2   . TYR B  2  124 ? 79.491  89.986  70.463  1.00 77.70  ? 122  TYR B CE2   1 
ATOM   4226  C  CZ    . TYR B  2  124 ? 79.478  90.572  69.206  1.00 79.01  ? 122  TYR B CZ    1 
ATOM   4227  O  OH    . TYR B  2  124 ? 79.646  91.937  69.077  1.00 79.44  ? 122  TYR B OH    1 
ATOM   4228  N  N     . LEU B  2  125 ? 80.353  83.408  69.645  1.00 85.68  ? 123  LEU B N     1 
ATOM   4229  C  CA    . LEU B  2  125 ? 80.255  81.963  69.810  1.00 87.30  ? 123  LEU B CA    1 
ATOM   4230  C  C     . LEU B  2  125 ? 81.174  81.546  70.942  1.00 88.22  ? 123  LEU B C     1 
ATOM   4231  O  O     . LEU B  2  125 ? 80.799  80.764  71.817  1.00 87.80  ? 123  LEU B O     1 
ATOM   4232  C  CB    . LEU B  2  125 ? 80.658  81.230  68.531  1.00 87.31  ? 123  LEU B CB    1 
ATOM   4233  C  CG    . LEU B  2  125 ? 80.712  79.701  68.674  1.00 87.87  ? 123  LEU B CG    1 
ATOM   4234  C  CD1   . LEU B  2  125 ? 79.432  79.161  69.297  1.00 86.74  ? 123  LEU B CD1   1 
ATOM   4235  C  CD2   . LEU B  2  125 ? 80.937  79.082  67.304  1.00 89.41  ? 123  LEU B CD2   1 
ATOM   4236  N  N     . LEU B  2  126 ? 82.385  82.084  70.917  1.00 89.36  ? 124  LEU B N     1 
ATOM   4237  C  CA    . LEU B  2  126 ? 83.368  81.783  71.942  1.00 89.98  ? 124  LEU B CA    1 
ATOM   4238  C  C     . LEU B  2  126 ? 82.878  82.250  73.319  1.00 88.15  ? 124  LEU B C     1 
ATOM   4239  O  O     . LEU B  2  126 ? 82.695  81.446  74.238  1.00 87.48  ? 124  LEU B O     1 
ATOM   4240  C  CB    . LEU B  2  126 ? 84.701  82.453  71.578  1.00 92.72  ? 124  LEU B CB    1 
ATOM   4241  C  CG    . LEU B  2  126 ? 85.736  82.641  72.693  1.00 95.08  ? 124  LEU B CG    1 
ATOM   4242  C  CD1   . LEU B  2  126 ? 85.995  81.319  73.424  1.00 94.85  ? 124  LEU B CD1   1 
ATOM   4243  C  CD2   . LEU B  2  126 ? 87.014  83.207  72.086  1.00 95.39  ? 124  LEU B CD2   1 
ATOM   4244  N  N     . ASN B  2  127 ? 82.666  83.555  73.443  1.00 85.89  ? 125  ASN B N     1 
ATOM   4245  C  CA    . ASN B  2  127 ? 82.210  84.158  74.683  1.00 83.85  ? 125  ASN B CA    1 
ATOM   4246  C  C     . ASN B  2  127 ? 81.058  83.385  75.291  1.00 84.21  ? 125  ASN B C     1 
ATOM   4247  O  O     . ASN B  2  127 ? 80.995  83.183  76.501  1.00 83.50  ? 125  ASN B O     1 
ATOM   4248  C  CB    . ASN B  2  127 ? 81.772  85.590  74.411  1.00 81.54  ? 125  ASN B CB    1 
ATOM   4249  C  CG    . ASN B  2  127 ? 82.792  86.611  74.865  1.00 79.33  ? 125  ASN B CG    1 
ATOM   4250  O  OD1   . ASN B  2  127 ? 83.064  86.732  76.056  1.00 79.71  ? 125  ASN B OD1   1 
ATOM   4251  N  ND2   . ASN B  2  127 ? 83.355  87.359  73.919  1.00 76.75  ? 125  ASN B ND2   1 
ATOM   4252  N  N     . VAL B  2  128 ? 80.145  82.952  74.435  1.00 85.46  ? 126  VAL B N     1 
ATOM   4253  C  CA    . VAL B  2  128 ? 78.974  82.209  74.876  1.00 86.95  ? 126  VAL B CA    1 
ATOM   4254  C  C     . VAL B  2  128 ? 79.276  80.854  75.509  1.00 88.00  ? 126  VAL B C     1 
ATOM   4255  O  O     . VAL B  2  128 ? 78.749  80.541  76.578  1.00 87.39  ? 126  VAL B O     1 
ATOM   4256  C  CB    . VAL B  2  128 ? 77.987  81.996  73.702  1.00 86.61  ? 126  VAL B CB    1 
ATOM   4257  C  CG1   . VAL B  2  128 ? 76.980  80.915  74.055  1.00 85.92  ? 126  VAL B CG1   1 
ATOM   4258  C  CG2   . VAL B  2  128 ? 77.269  83.302  73.382  1.00 85.31  ? 126  VAL B CG2   1 
ATOM   4259  N  N     . THR B  2  129 ? 80.119  80.058  74.849  1.00 89.91  ? 127  THR B N     1 
ATOM   4260  C  CA    . THR B  2  129 ? 80.467  78.713  75.332  1.00 91.67  ? 127  THR B CA    1 
ATOM   4261  C  C     . THR B  2  129 ? 81.544  78.659  76.414  1.00 91.69  ? 127  THR B C     1 
ATOM   4262  O  O     . THR B  2  129 ? 81.691  77.642  77.095  1.00 91.60  ? 127  THR B O     1 
ATOM   4263  C  CB    . THR B  2  129 ? 80.965  77.805  74.187  1.00 91.85  ? 127  THR B CB    1 
ATOM   4264  O  OG1   . THR B  2  129 ? 82.160  78.368  73.633  1.00 92.44  ? 127  THR B OG1   1 
ATOM   4265  C  CG2   . THR B  2  129 ? 79.913  77.669  73.099  1.00 92.53  ? 127  THR B CG2   1 
ATOM   4266  N  N     . THR B  2  130 ? 82.289  79.744  76.583  1.00 91.55  ? 128  THR B N     1 
ATOM   4267  C  CA    . THR B  2  130 ? 83.355  79.740  77.563  1.00 91.12  ? 128  THR B CA    1 
ATOM   4268  C  C     . THR B  2  130 ? 83.335  80.889  78.552  1.00 91.52  ? 128  THR B C     1 
ATOM   4269  O  O     . THR B  2  130 ? 83.918  80.779  79.624  1.00 91.60  ? 128  THR B O     1 
ATOM   4270  C  CB    . THR B  2  130 ? 84.702  79.734  76.849  1.00 91.49  ? 128  THR B CB    1 
ATOM   4271  O  OG1   . THR B  2  130 ? 84.850  80.945  76.094  1.00 90.09  ? 128  THR B OG1   1 
ATOM   4272  C  CG2   . THR B  2  130 ? 84.772  78.552  75.894  1.00 92.85  ? 128  THR B CG2   1 
ATOM   4273  N  N     . ALA B  2  131 ? 82.657  81.981  78.208  1.00 92.02  ? 129  ALA B N     1 
ATOM   4274  C  CA    . ALA B  2  131 ? 82.607  83.146  79.089  1.00 91.67  ? 129  ALA B CA    1 
ATOM   4275  C  C     . ALA B  2  131 ? 81.239  83.505  79.682  1.00 91.15  ? 129  ALA B C     1 
ATOM   4276  O  O     . ALA B  2  131 ? 80.963  84.671  79.942  1.00 90.71  ? 129  ALA B O     1 
ATOM   4277  C  CB    . ALA B  2  131 ? 83.188  84.363  78.357  1.00 90.88  ? 129  ALA B CB    1 
ATOM   4278  N  N     . PRO B  2  132 ? 80.363  82.518  79.908  1.00 90.98  ? 130  PRO B N     1 
ATOM   4279  C  CA    . PRO B  2  132 ? 79.069  82.903  80.481  1.00 91.21  ? 130  PRO B CA    1 
ATOM   4280  C  C     . PRO B  2  132 ? 79.181  83.501  81.883  1.00 90.67  ? 130  PRO B C     1 
ATOM   4281  O  O     . PRO B  2  132 ? 80.111  83.186  82.624  1.00 90.56  ? 130  PRO B O     1 
ATOM   4282  C  CB    . PRO B  2  132 ? 78.274  81.589  80.466  1.00 91.39  ? 130  PRO B CB    1 
ATOM   4283  C  CG    . PRO B  2  132 ? 79.325  80.543  80.531  1.00 91.03  ? 130  PRO B CG    1 
ATOM   4284  C  CD    . PRO B  2  132 ? 80.387  81.080  79.597  1.00 91.12  ? 130  PRO B CD    1 
ATOM   4285  N  N     . GLU B  2  133 ? 78.239  84.373  82.237  1.00 90.55  ? 131  GLU B N     1 
ATOM   4286  C  CA    . GLU B  2  133 ? 78.234  84.992  83.559  1.00 90.22  ? 131  GLU B CA    1 
ATOM   4287  C  C     . GLU B  2  133 ? 77.039  84.544  84.379  1.00 90.19  ? 131  GLU B C     1 
ATOM   4288  O  O     . GLU B  2  133 ? 77.094  84.545  85.608  1.00 91.00  ? 131  GLU B O     1 
ATOM   4289  C  CB    . GLU B  2  133 ? 78.220  86.512  83.459  1.00 88.94  ? 131  GLU B CB    1 
ATOM   4290  C  CG    . GLU B  2  133 ? 79.388  87.075  82.695  1.00 90.07  ? 131  GLU B CG    1 
ATOM   4291  C  CD    . GLU B  2  133 ? 79.738  88.474  83.144  1.00 90.92  ? 131  GLU B CD    1 
ATOM   4292  O  OE1   . GLU B  2  133 ? 78.803  89.273  83.342  1.00 92.54  ? 131  GLU B OE1   1 
ATOM   4293  O  OE2   . GLU B  2  133 ? 80.943  88.780  83.294  1.00 91.76  ? 131  GLU B OE2   1 
ATOM   4294  N  N     . PHE B  2  134 ? 75.959  84.166  83.700  1.00 89.09  ? 132  PHE B N     1 
ATOM   4295  C  CA    . PHE B  2  134 ? 74.759  83.708  84.387  1.00 88.21  ? 132  PHE B CA    1 
ATOM   4296  C  C     . PHE B  2  134 ? 74.360  84.637  85.536  1.00 86.74  ? 132  PHE B C     1 
ATOM   4297  O  O     . PHE B  2  134 ? 74.233  84.195  86.682  1.00 86.61  ? 132  PHE B O     1 
ATOM   4298  C  CB    . PHE B  2  134 ? 74.988  82.300  84.925  1.00 90.16  ? 132  PHE B CB    1 
ATOM   4299  C  CG    . PHE B  2  134 ? 75.283  81.286  83.859  1.00 94.42  ? 132  PHE B CG    1 
ATOM   4300  C  CD1   . PHE B  2  134 ? 76.085  80.182  84.136  1.00 96.26  ? 132  PHE B CD1   1 
ATOM   4301  C  CD2   . PHE B  2  134 ? 74.749  81.419  82.581  1.00 96.69  ? 132  PHE B CD2   1 
ATOM   4302  C  CE1   . PHE B  2  134 ? 76.351  79.225  83.160  1.00 97.62  ? 132  PHE B CE1   1 
ATOM   4303  C  CE2   . PHE B  2  134 ? 75.008  80.464  81.592  1.00 98.21  ? 132  PHE B CE2   1 
ATOM   4304  C  CZ    . PHE B  2  134 ? 75.811  79.366  81.884  1.00 98.34  ? 132  PHE B CZ    1 
ATOM   4305  N  N     . ARG B  2  135 ? 74.164  85.918  85.223  1.00 83.88  ? 133  ARG B N     1 
ATOM   4306  C  CA    . ARG B  2  135 ? 73.781  86.901  86.226  1.00 81.36  ? 133  ARG B CA    1 
ATOM   4307  C  C     . ARG B  2  135 ? 72.427  86.519  86.776  1.00 80.62  ? 133  ARG B C     1 
ATOM   4308  O  O     . ARG B  2  135 ? 71.485  86.357  86.018  1.00 80.60  ? 133  ARG B O     1 
ATOM   4309  C  CB    . ARG B  2  135 ? 73.709  88.285  85.603  1.00 80.50  ? 133  ARG B CB    1 
ATOM   4310  C  CG    . ARG B  2  135 ? 74.987  88.732  84.945  1.00 79.02  ? 133  ARG B CG    1 
ATOM   4311  C  CD    . ARG B  2  135 ? 74.797  90.104  84.366  1.00 79.92  ? 133  ARG B CD    1 
ATOM   4312  N  NE    . ARG B  2  135 ? 76.040  90.676  83.874  1.00 82.39  ? 133  ARG B NE    1 
ATOM   4313  C  CZ    . ARG B  2  135 ? 76.127  91.869  83.297  1.00 84.70  ? 133  ARG B CZ    1 
ATOM   4314  N  NH1   . ARG B  2  135 ? 75.035  92.611  83.140  1.00 86.27  ? 133  ARG B NH1   1 
ATOM   4315  N  NH2   . ARG B  2  135 ? 77.305  92.325  82.886  1.00 85.93  ? 133  ARG B NH2   1 
ATOM   4316  N  N     . PRO B  2  136 ? 72.308  86.396  88.108  1.00 80.70  ? 134  PRO B N     1 
ATOM   4317  C  CA    . PRO B  2  136 ? 71.084  86.025  88.828  1.00 81.77  ? 134  PRO B CA    1 
ATOM   4318  C  C     . PRO B  2  136 ? 69.791  86.553  88.214  1.00 83.47  ? 134  PRO B C     1 
ATOM   4319  O  O     . PRO B  2  136 ? 68.869  85.778  87.933  1.00 83.21  ? 134  PRO B O     1 
ATOM   4320  C  CB    . PRO B  2  136 ? 71.325  86.586  90.226  1.00 79.70  ? 134  PRO B CB    1 
ATOM   4321  C  CG    . PRO B  2  136 ? 72.755  86.436  90.379  1.00 79.35  ? 134  PRO B CG    1 
ATOM   4322  C  CD    . PRO B  2  136 ? 73.289  86.938  89.057  1.00 80.12  ? 134  PRO B CD    1 
ATOM   4323  N  N     . TRP B  2  137 ? 69.726  87.871  88.019  1.00 85.17  ? 135  TRP B N     1 
ATOM   4324  C  CA    . TRP B  2  137 ? 68.543  88.489  87.435  1.00 85.40  ? 135  TRP B CA    1 
ATOM   4325  C  C     . TRP B  2  137 ? 68.327  87.987  86.015  1.00 84.25  ? 135  TRP B C     1 
ATOM   4326  O  O     . TRP B  2  137 ? 67.281  87.399  85.726  1.00 84.07  ? 135  TRP B O     1 
ATOM   4327  C  CB    . TRP B  2  137 ? 68.652  90.020  87.475  1.00 88.24  ? 135  TRP B CB    1 
ATOM   4328  C  CG    . TRP B  2  137 ? 69.905  90.606  86.887  1.00 91.75  ? 135  TRP B CG    1 
ATOM   4329  C  CD1   . TRP B  2  137 ? 70.074  91.088  85.619  1.00 93.48  ? 135  TRP B CD1   1 
ATOM   4330  C  CD2   . TRP B  2  137 ? 71.151  90.813  87.561  1.00 93.03  ? 135  TRP B CD2   1 
ATOM   4331  N  NE1   . TRP B  2  137 ? 71.347  91.591  85.464  1.00 93.77  ? 135  TRP B NE1   1 
ATOM   4332  C  CE2   . TRP B  2  137 ? 72.028  91.432  86.641  1.00 93.83  ? 135  TRP B CE2   1 
ATOM   4333  C  CE3   . TRP B  2  137 ? 71.612  90.536  88.853  1.00 92.71  ? 135  TRP B CE3   1 
ATOM   4334  C  CZ2   . TRP B  2  137 ? 73.338  91.778  86.975  1.00 93.70  ? 135  TRP B CZ2   1 
ATOM   4335  C  CZ3   . TRP B  2  137 ? 72.911  90.880  89.183  1.00 92.58  ? 135  TRP B CZ3   1 
ATOM   4336  C  CH2   . TRP B  2  137 ? 73.760  91.496  88.247  1.00 92.99  ? 135  TRP B CH2   1 
ATOM   4337  N  N     . GLU B  2  138 ? 69.311  88.186  85.139  1.00 82.53  ? 136  GLU B N     1 
ATOM   4338  C  CA    . GLU B  2  138 ? 69.181  87.719  83.762  1.00 81.39  ? 136  GLU B CA    1 
ATOM   4339  C  C     . GLU B  2  138 ? 68.683  86.274  83.729  1.00 81.38  ? 136  GLU B C     1 
ATOM   4340  O  O     . GLU B  2  138 ? 67.914  85.896  82.843  1.00 80.86  ? 136  GLU B O     1 
ATOM   4341  C  CB    . GLU B  2  138 ? 70.518  87.819  83.025  1.00 79.79  ? 136  GLU B CB    1 
ATOM   4342  C  CG    . GLU B  2  138 ? 70.998  89.240  82.803  1.00 76.11  ? 136  GLU B CG    1 
ATOM   4343  C  CD    . GLU B  2  138 ? 72.148  89.326  81.813  1.00 75.42  ? 136  GLU B CD    1 
ATOM   4344  O  OE1   . GLU B  2  138 ? 72.663  90.452  81.626  1.00 74.50  ? 136  GLU B OE1   1 
ATOM   4345  O  OE2   . GLU B  2  138 ? 72.529  88.278  81.227  1.00 74.00  ? 136  GLU B OE2   1 
ATOM   4346  N  N     . VAL B  2  139 ? 69.112  85.479  84.706  1.00 81.74  ? 137  VAL B N     1 
ATOM   4347  C  CA    . VAL B  2  139 ? 68.710  84.077  84.792  1.00 82.33  ? 137  VAL B CA    1 
ATOM   4348  C  C     . VAL B  2  139 ? 67.264  83.922  85.228  1.00 83.32  ? 137  VAL B C     1 
ATOM   4349  O  O     . VAL B  2  139 ? 66.432  83.429  84.464  1.00 84.52  ? 137  VAL B O     1 
ATOM   4350  C  CB    . VAL B  2  139 ? 69.596  83.268  85.779  1.00 81.01  ? 137  VAL B CB    1 
ATOM   4351  C  CG1   . VAL B  2  139 ? 68.942  81.933  86.109  1.00 78.81  ? 137  VAL B CG1   1 
ATOM   4352  C  CG2   . VAL B  2  139 ? 70.948  83.023  85.162  1.00 80.61  ? 137  VAL B CG2   1 
ATOM   4353  N  N     . THR B  2  140 ? 66.955  84.330  86.452  1.00 83.20  ? 138  THR B N     1 
ATOM   4354  C  CA    . THR B  2  140 ? 65.592  84.188  86.919  1.00 82.86  ? 138  THR B CA    1 
ATOM   4355  C  C     . THR B  2  140 ? 64.620  84.828  85.931  1.00 82.49  ? 138  THR B C     1 
ATOM   4356  O  O     . THR B  2  140 ? 63.496  84.346  85.767  1.00 83.70  ? 138  THR B O     1 
ATOM   4357  C  CB    . THR B  2  140 ? 65.424  84.771  88.321  1.00 82.18  ? 138  THR B CB    1 
ATOM   4358  O  OG1   . THR B  2  140 ? 65.909  86.114  88.336  1.00 81.69  ? 138  THR B OG1   1 
ATOM   4359  C  CG2   . THR B  2  140 ? 66.201  83.922  89.334  1.00 81.94  ? 138  THR B CG2   1 
ATOM   4360  N  N     . ASP B  2  141 ? 65.051  85.887  85.249  1.00 80.85  ? 139  ASP B N     1 
ATOM   4361  C  CA    . ASP B  2  141 ? 64.192  86.526  84.253  1.00 80.08  ? 139  ASP B CA    1 
ATOM   4362  C  C     . ASP B  2  141 ? 63.894  85.575  83.106  1.00 78.82  ? 139  ASP B C     1 
ATOM   4363  O  O     . ASP B  2  141 ? 62.823  85.617  82.513  1.00 80.28  ? 139  ASP B O     1 
ATOM   4364  C  CB    . ASP B  2  141 ? 64.854  87.759  83.658  1.00 81.39  ? 139  ASP B CB    1 
ATOM   4365  C  CG    . ASP B  2  141 ? 64.544  89.000  84.428  1.00 84.52  ? 139  ASP B CG    1 
ATOM   4366  O  OD1   . ASP B  2  141 ? 63.351  89.204  84.740  1.00 86.48  ? 139  ASP B OD1   1 
ATOM   4367  O  OD2   . ASP B  2  141 ? 65.482  89.776  84.717  1.00 87.64  ? 139  ASP B OD2   1 
ATOM   4368  N  N     . LEU B  2  142 ? 64.862  84.721  82.803  1.00 76.22  ? 140  LEU B N     1 
ATOM   4369  C  CA    . LEU B  2  142 ? 64.766  83.771  81.710  1.00 73.11  ? 140  LEU B CA    1 
ATOM   4370  C  C     . LEU B  2  142 ? 63.973  82.492  81.967  1.00 71.99  ? 140  LEU B C     1 
ATOM   4371  O  O     . LEU B  2  142 ? 63.228  82.027  81.109  1.00 70.33  ? 140  LEU B O     1 
ATOM   4372  C  CB    . LEU B  2  142 ? 66.181  83.409  81.269  1.00 72.04  ? 140  LEU B CB    1 
ATOM   4373  C  CG    . LEU B  2  142 ? 66.329  82.301  80.235  1.00 72.96  ? 140  LEU B CG    1 
ATOM   4374  C  CD1   . LEU B  2  142 ? 65.539  82.666  78.995  1.00 74.06  ? 140  LEU B CD1   1 
ATOM   4375  C  CD2   . LEU B  2  142 ? 67.796  82.092  79.893  1.00 73.06  ? 140  LEU B CD2   1 
ATOM   4376  N  N     . GLN B  2  143 ? 64.120  81.925  83.150  1.00 71.85  ? 141  GLN B N     1 
ATOM   4377  C  CA    . GLN B  2  143 ? 63.446  80.680  83.452  1.00 72.82  ? 141  GLN B CA    1 
ATOM   4378  C  C     . GLN B  2  143 ? 61.995  80.539  83.028  1.00 73.43  ? 141  GLN B C     1 
ATOM   4379  O  O     . GLN B  2  143 ? 61.509  79.426  82.820  1.00 73.32  ? 141  GLN B O     1 
ATOM   4380  C  CB    . GLN B  2  143 ? 63.601  80.364  84.928  1.00 74.09  ? 141  GLN B CB    1 
ATOM   4381  C  CG    . GLN B  2  143 ? 65.044  80.074  85.270  1.00 75.30  ? 141  GLN B CG    1 
ATOM   4382  C  CD    . GLN B  2  143 ? 65.208  79.427  86.614  1.00 75.06  ? 141  GLN B CD    1 
ATOM   4383  O  OE1   . GLN B  2  143 ? 64.831  78.273  86.808  1.00 73.46  ? 141  GLN B OE1   1 
ATOM   4384  N  NE2   . GLN B  2  143 ? 65.773  80.173  87.562  1.00 76.31  ? 141  GLN B NE2   1 
ATOM   4385  N  N     . PRO B  2  144 ? 61.267  81.651  82.904  1.00 74.65  ? 142  PRO B N     1 
ATOM   4386  C  CA    . PRO B  2  144 ? 59.878  81.419  82.483  1.00 74.40  ? 142  PRO B CA    1 
ATOM   4387  C  C     . PRO B  2  144 ? 59.806  80.926  81.036  1.00 73.71  ? 142  PRO B C     1 
ATOM   4388  O  O     . PRO B  2  144 ? 58.795  80.372  80.609  1.00 74.12  ? 142  PRO B O     1 
ATOM   4389  C  CB    . PRO B  2  144 ? 59.226  82.785  82.668  1.00 73.86  ? 142  PRO B CB    1 
ATOM   4390  C  CG    . PRO B  2  144 ? 59.978  83.345  83.831  1.00 75.53  ? 142  PRO B CG    1 
ATOM   4391  C  CD    . PRO B  2  144 ? 61.420  82.986  83.509  1.00 74.52  ? 142  PRO B CD    1 
ATOM   4392  N  N     . GLN B  2  145 ? 60.890  81.125  80.292  1.00 72.20  ? 143  GLN B N     1 
ATOM   4393  C  CA    . GLN B  2  145 ? 60.944  80.703  78.905  1.00 71.41  ? 143  GLN B CA    1 
ATOM   4394  C  C     . GLN B  2  145 ? 60.874  79.182  78.823  1.00 71.57  ? 143  GLN B C     1 
ATOM   4395  O  O     . GLN B  2  145 ? 60.459  78.618  77.811  1.00 70.92  ? 143  GLN B O     1 
ATOM   4396  C  CB    . GLN B  2  145 ? 62.230  81.207  78.261  1.00 70.92  ? 143  GLN B CB    1 
ATOM   4397  C  CG    . GLN B  2  145 ? 62.273  81.076  76.748  1.00 71.85  ? 143  GLN B CG    1 
ATOM   4398  C  CD    . GLN B  2  145 ? 61.297  81.998  76.040  1.00 72.76  ? 143  GLN B CD    1 
ATOM   4399  O  OE1   . GLN B  2  145 ? 60.079  81.812  76.105  1.00 74.57  ? 143  GLN B OE1   1 
ATOM   4400  N  NE2   . GLN B  2  145 ? 61.831  83.004  75.359  1.00 72.18  ? 143  GLN B NE2   1 
ATOM   4401  N  N     . LEU B  2  146 ? 61.294  78.519  79.892  1.00 72.35  ? 144  LEU B N     1 
ATOM   4402  C  CA    . LEU B  2  146 ? 61.244  77.063  79.936  1.00 73.08  ? 144  LEU B CA    1 
ATOM   4403  C  C     . LEU B  2  146 ? 59.786  76.721  79.760  1.00 72.88  ? 144  LEU B C     1 
ATOM   4404  O  O     . LEU B  2  146 ? 59.419  75.889  78.929  1.00 72.39  ? 144  LEU B O     1 
ATOM   4405  C  CB    . LEU B  2  146 ? 61.719  76.533  81.292  1.00 73.31  ? 144  LEU B CB    1 
ATOM   4406  C  CG    . LEU B  2  146 ? 63.155  76.831  81.717  1.00 73.53  ? 144  LEU B CG    1 
ATOM   4407  C  CD1   . LEU B  2  146 ? 63.407  76.254  83.110  1.00 72.53  ? 144  LEU B CD1   1 
ATOM   4408  C  CD2   . LEU B  2  146 ? 64.117  76.252  80.689  1.00 73.56  ? 144  LEU B CD2   1 
ATOM   4409  N  N     . LYS B  2  147 ? 58.962  77.389  80.563  1.00 73.44  ? 145  LYS B N     1 
ATOM   4410  C  CA    . LYS B  2  147 ? 57.515  77.206  80.526  1.00 73.45  ? 145  LYS B CA    1 
ATOM   4411  C  C     . LYS B  2  147 ? 57.081  77.161  79.051  1.00 72.44  ? 145  LYS B C     1 
ATOM   4412  O  O     . LYS B  2  147 ? 56.552  76.148  78.567  1.00 70.14  ? 145  LYS B O     1 
ATOM   4413  C  CB    . LYS B  2  147 ? 56.838  78.384  81.247  1.00 74.67  ? 145  LYS B CB    1 
ATOM   4414  C  CG    . LYS B  2  147 ? 55.668  78.011  82.144  1.00 77.51  ? 145  LYS B CG    1 
ATOM   4415  C  CD    . LYS B  2  147 ? 56.141  77.302  83.396  1.00 82.11  ? 145  LYS B CD    1 
ATOM   4416  C  CE    . LYS B  2  147 ? 54.986  76.613  84.127  1.00 86.10  ? 145  LYS B CE    1 
ATOM   4417  N  NZ    . LYS B  2  147 ? 55.453  75.615  85.160  1.00 88.29  ? 145  LYS B NZ    1 
ATOM   4418  N  N     . VAL B  2  148 ? 57.343  78.268  78.351  1.00 71.46  ? 146  VAL B N     1 
ATOM   4419  C  CA    . VAL B  2  148 ? 57.012  78.435  76.936  1.00 70.40  ? 146  VAL B CA    1 
ATOM   4420  C  C     . VAL B  2  148 ? 57.697  77.445  76.008  1.00 70.00  ? 146  VAL B C     1 
ATOM   4421  O  O     . VAL B  2  148 ? 57.039  76.640  75.351  1.00 69.35  ? 146  VAL B O     1 
ATOM   4422  C  CB    . VAL B  2  148 ? 57.358  79.869  76.460  1.00 70.23  ? 146  VAL B CB    1 
ATOM   4423  C  CG1   . VAL B  2  148 ? 57.504  79.912  74.946  1.00 68.40  ? 146  VAL B CG1   1 
ATOM   4424  C  CG2   . VAL B  2  148 ? 56.265  80.824  76.900  1.00 71.48  ? 146  VAL B CG2   1 
ATOM   4425  N  N     . ASP B  2  149 ? 59.021  77.519  75.947  1.00 69.90  ? 147  ASP B N     1 
ATOM   4426  C  CA    . ASP B  2  149 ? 59.782  76.632  75.090  1.00 68.84  ? 147  ASP B CA    1 
ATOM   4427  C  C     . ASP B  2  149 ? 59.255  75.201  75.119  1.00 68.16  ? 147  ASP B C     1 
ATOM   4428  O  O     . ASP B  2  149 ? 59.137  74.546  74.083  1.00 67.01  ? 147  ASP B O     1 
ATOM   4429  C  CB    . ASP B  2  149 ? 61.239  76.635  75.499  1.00 68.78  ? 147  ASP B CB    1 
ATOM   4430  C  CG    . ASP B  2  149 ? 62.073  75.794  74.585  1.00 71.81  ? 147  ASP B CG    1 
ATOM   4431  O  OD1   . ASP B  2  149 ? 62.017  76.040  73.360  1.00 71.28  ? 147  ASP B OD1   1 
ATOM   4432  O  OD2   . ASP B  2  149 ? 62.773  74.880  75.083  1.00 75.34  ? 147  ASP B OD2   1 
ATOM   4433  N  N     . LYS B  2  150 ? 58.927  74.731  76.316  1.00 67.76  ? 148  LYS B N     1 
ATOM   4434  C  CA    . LYS B  2  150 ? 58.427  73.377  76.494  1.00 68.15  ? 148  LYS B CA    1 
ATOM   4435  C  C     . LYS B  2  150 ? 57.051  73.209  75.852  1.00 69.16  ? 148  LYS B C     1 
ATOM   4436  O  O     . LYS B  2  150 ? 56.814  72.254  75.106  1.00 68.58  ? 148  LYS B O     1 
ATOM   4437  C  CB    . LYS B  2  150 ? 58.361  73.040  77.994  1.00 66.85  ? 148  LYS B CB    1 
ATOM   4438  C  CG    . LYS B  2  150 ? 58.407  71.545  78.330  1.00 63.93  ? 148  LYS B CG    1 
ATOM   4439  C  CD    . LYS B  2  150 ? 58.297  71.321  79.828  1.00 62.86  ? 148  LYS B CD    1 
ATOM   4440  C  CE    . LYS B  2  150 ? 58.226  69.845  80.172  1.00 62.55  ? 148  LYS B CE    1 
ATOM   4441  N  NZ    . LYS B  2  150 ? 57.898  69.593  81.608  1.00 61.56  ? 148  LYS B NZ    1 
ATOM   4442  N  N     . ALA B  2  151 ? 56.152  74.146  76.143  1.00 70.52  ? 149  ALA B N     1 
ATOM   4443  C  CA    . ALA B  2  151 ? 54.791  74.106  75.614  1.00 70.51  ? 149  ALA B CA    1 
ATOM   4444  C  C     . ALA B  2  151 ? 54.734  73.938  74.097  1.00 70.81  ? 149  ALA B C     1 
ATOM   4445  O  O     . ALA B  2  151 ? 53.917  73.160  73.593  1.00 70.23  ? 149  ALA B O     1 
ATOM   4446  C  CB    . ALA B  2  151 ? 54.037  75.360  76.029  1.00 69.84  ? 149  ALA B CB    1 
ATOM   4447  N  N     . VAL B  2  152 ? 55.588  74.661  73.371  1.00 70.62  ? 150  VAL B N     1 
ATOM   4448  C  CA    . VAL B  2  152 ? 55.592  74.549  71.916  1.00 71.78  ? 150  VAL B CA    1 
ATOM   4449  C  C     . VAL B  2  152 ? 56.131  73.197  71.483  1.00 72.70  ? 150  VAL B C     1 
ATOM   4450  O  O     . VAL B  2  152 ? 55.503  72.493  70.694  1.00 73.98  ? 150  VAL B O     1 
ATOM   4451  C  CB    . VAL B  2  152 ? 56.439  75.647  71.235  1.00 71.78  ? 150  VAL B CB    1 
ATOM   4452  C  CG1   . VAL B  2  152 ? 55.919  77.002  71.630  1.00 71.79  ? 150  VAL B CG1   1 
ATOM   4453  C  CG2   . VAL B  2  152 ? 57.919  75.500  71.602  1.00 73.12  ? 150  VAL B CG2   1 
ATOM   4454  N  N     . ALA B  2  153 ? 57.298  72.827  71.996  1.00 72.67  ? 151  ALA B N     1 
ATOM   4455  C  CA    . ALA B  2  153 ? 57.884  71.549  71.634  1.00 71.30  ? 151  ALA B CA    1 
ATOM   4456  C  C     . ALA B  2  153 ? 56.828  70.461  71.811  1.00 70.43  ? 151  ALA B C     1 
ATOM   4457  O  O     . ALA B  2  153 ? 56.555  69.686  70.893  1.00 69.02  ? 151  ALA B O     1 
ATOM   4458  C  CB    . ALA B  2  153 ? 59.095  71.268  72.509  1.00 71.40  ? 151  ALA B CB    1 
ATOM   4459  N  N     . PHE B  2  154 ? 56.215  70.439  72.989  1.00 70.20  ? 152  PHE B N     1 
ATOM   4460  C  CA    . PHE B  2  154 ? 55.205  69.448  73.306  1.00 71.28  ? 152  PHE B CA    1 
ATOM   4461  C  C     . PHE B  2  154 ? 53.941  69.463  72.463  1.00 72.19  ? 152  PHE B C     1 
ATOM   4462  O  O     . PHE B  2  154 ? 53.030  68.661  72.689  1.00 72.10  ? 152  PHE B O     1 
ATOM   4463  C  CB    . PHE B  2  154 ? 54.850  69.533  74.787  1.00 70.78  ? 152  PHE B CB    1 
ATOM   4464  C  CG    . PHE B  2  154 ? 55.741  68.711  75.650  1.00 70.10  ? 152  PHE B CG    1 
ATOM   4465  C  CD1   . PHE B  2  154 ? 57.101  68.985  75.715  1.00 69.70  ? 152  PHE B CD1   1 
ATOM   4466  C  CD2   . PHE B  2  154 ? 55.238  67.611  76.338  1.00 69.49  ? 152  PHE B CD2   1 
ATOM   4467  C  CE1   . PHE B  2  154 ? 57.955  68.167  76.451  1.00 70.33  ? 152  PHE B CE1   1 
ATOM   4468  C  CE2   . PHE B  2  154 ? 56.077  66.789  77.074  1.00 69.05  ? 152  PHE B CE2   1 
ATOM   4469  C  CZ    . PHE B  2  154 ? 57.442  67.065  77.130  1.00 69.58  ? 152  PHE B CZ    1 
ATOM   4470  N  N     . GLN B  2  155 ? 53.884  70.358  71.486  1.00 73.23  ? 153  GLN B N     1 
ATOM   4471  C  CA    . GLN B  2  155 ? 52.719  70.422  70.610  1.00 74.44  ? 153  GLN B CA    1 
ATOM   4472  C  C     . GLN B  2  155 ? 52.621  69.160  69.756  1.00 74.31  ? 153  GLN B C     1 
ATOM   4473  O  O     . GLN B  2  155 ? 51.538  68.786  69.311  1.00 75.18  ? 153  GLN B O     1 
ATOM   4474  C  CB    . GLN B  2  155 ? 52.797  71.646  69.698  1.00 75.82  ? 153  GLN B CB    1 
ATOM   4475  C  CG    . GLN B  2  155 ? 52.217  72.908  70.298  1.00 77.10  ? 153  GLN B CG    1 
ATOM   4476  C  CD    . GLN B  2  155 ? 52.569  74.145  69.498  1.00 79.39  ? 153  GLN B CD    1 
ATOM   4477  O  OE1   . GLN B  2  155 ? 51.961  75.196  69.683  1.00 82.00  ? 153  GLN B OE1   1 
ATOM   4478  N  NE2   . GLN B  2  155 ? 53.564  74.034  68.612  1.00 79.61  ? 153  GLN B NE2   1 
ATOM   4479  N  N     . SER B  2  156 ? 53.755  68.507  69.531  1.00 73.98  ? 154  SER B N     1 
ATOM   4480  C  CA    . SER B  2  156 ? 53.796  67.294  68.726  1.00 73.18  ? 154  SER B CA    1 
ATOM   4481  C  C     . SER B  2  156 ? 53.897  66.087  69.636  1.00 73.74  ? 154  SER B C     1 
ATOM   4482  O  O     . SER B  2  156 ? 54.917  65.892  70.279  1.00 75.12  ? 154  SER B O     1 
ATOM   4483  C  CB    . SER B  2  156 ? 55.004  67.341  67.792  1.00 72.00  ? 154  SER B CB    1 
ATOM   4484  O  OG    . SER B  2  156 ? 55.777  68.510  68.036  1.00 71.58  ? 154  SER B OG    1 
ATOM   4485  N  N     . PRO B  2  157 ? 52.838  65.258  69.708  1.00 74.34  ? 155  PRO B N     1 
ATOM   4486  C  CA    . PRO B  2  157 ? 52.831  64.056  70.560  1.00 74.69  ? 155  PRO B CA    1 
ATOM   4487  C  C     . PRO B  2  157 ? 54.129  63.278  70.398  1.00 74.93  ? 155  PRO B C     1 
ATOM   4488  O  O     . PRO B  2  157 ? 54.635  62.660  71.334  1.00 73.66  ? 155  PRO B O     1 
ATOM   4489  C  CB    . PRO B  2  157 ? 51.623  63.285  70.047  1.00 74.02  ? 155  PRO B CB    1 
ATOM   4490  C  CG    . PRO B  2  157 ? 50.682  64.391  69.664  1.00 73.83  ? 155  PRO B CG    1 
ATOM   4491  C  CD    . PRO B  2  157 ? 51.592  65.347  68.927  1.00 73.46  ? 155  PRO B CD    1 
ATOM   4492  N  N     . GLN B  2  158 ? 54.643  63.324  69.176  1.00 76.26  ? 156  GLN B N     1 
ATOM   4493  C  CA    . GLN B  2  158 ? 55.886  62.690  68.818  1.00 77.51  ? 156  GLN B CA    1 
ATOM   4494  C  C     . GLN B  2  158 ? 56.861  62.833  70.012  1.00 78.95  ? 156  GLN B C     1 
ATOM   4495  O  O     . GLN B  2  158 ? 57.377  61.847  70.525  1.00 78.84  ? 156  GLN B O     1 
ATOM   4496  C  CB    . GLN B  2  158 ? 56.412  63.395  67.560  1.00 77.95  ? 156  GLN B CB    1 
ATOM   4497  C  CG    . GLN B  2  158 ? 57.804  62.978  67.098  1.00 80.95  ? 156  GLN B CG    1 
ATOM   4498  C  CD    . GLN B  2  158 ? 58.510  64.045  66.237  1.00 81.70  ? 156  GLN B CD    1 
ATOM   4499  O  OE1   . GLN B  2  158 ? 57.919  64.605  65.304  1.00 82.91  ? 156  GLN B OE1   1 
ATOM   4500  N  NE2   . GLN B  2  158 ? 59.782  64.314  66.547  1.00 79.22  ? 156  GLN B NE2   1 
ATOM   4501  N  N     . VAL B  2  159 ? 57.066  64.063  70.479  1.00 80.82  ? 157  VAL B N     1 
ATOM   4502  C  CA    . VAL B  2  159 ? 57.988  64.357  71.587  1.00 82.13  ? 157  VAL B CA    1 
ATOM   4503  C  C     . VAL B  2  159 ? 57.562  63.907  72.991  1.00 82.86  ? 157  VAL B C     1 
ATOM   4504  O  O     . VAL B  2  159 ? 58.387  63.450  73.783  1.00 83.06  ? 157  VAL B O     1 
ATOM   4505  C  CB    . VAL B  2  159 ? 58.295  65.885  71.659  1.00 82.01  ? 157  VAL B CB    1 
ATOM   4506  C  CG1   . VAL B  2  159 ? 57.027  66.655  71.976  1.00 82.89  ? 157  VAL B CG1   1 
ATOM   4507  C  CG2   . VAL B  2  159 ? 59.353  66.166  72.726  1.00 82.45  ? 157  VAL B CG2   1 
ATOM   4508  N  N     . GLY B  2  160 ? 56.285  64.062  73.312  1.00 83.59  ? 158  GLY B N     1 
ATOM   4509  C  CA    . GLY B  2  160 ? 55.821  63.671  74.629  1.00 83.02  ? 158  GLY B CA    1 
ATOM   4510  C  C     . GLY B  2  160 ? 56.139  62.232  74.967  1.00 82.00  ? 158  GLY B C     1 
ATOM   4511  O  O     . GLY B  2  160 ? 56.730  61.963  76.012  1.00 80.51  ? 158  GLY B O     1 
ATOM   4512  N  N     . VAL B  2  161 ? 55.758  61.315  74.078  1.00 82.49  ? 159  VAL B N     1 
ATOM   4513  C  CA    . VAL B  2  161 ? 55.978  59.890  74.302  1.00 83.11  ? 159  VAL B CA    1 
ATOM   4514  C  C     . VAL B  2  161 ? 57.444  59.539  74.388  1.00 83.03  ? 159  VAL B C     1 
ATOM   4515  O  O     . VAL B  2  161 ? 57.832  58.750  75.243  1.00 84.11  ? 159  VAL B O     1 
ATOM   4516  C  CB    . VAL B  2  161 ? 55.338  59.000  73.205  1.00 83.52  ? 159  VAL B CB    1 
ATOM   4517  C  CG1   . VAL B  2  161 ? 53.849  59.281  73.099  1.00 84.17  ? 159  VAL B CG1   1 
ATOM   4518  C  CG2   . VAL B  2  161 ? 56.032  59.220  71.886  1.00 84.49  ? 159  VAL B CG2   1 
ATOM   4519  N  N     . LEU B  2  162 ? 58.263  60.111  73.512  1.00 82.80  ? 160  LEU B N     1 
ATOM   4520  C  CA    . LEU B  2  162 ? 59.698  59.822  73.553  1.00 83.17  ? 160  LEU B CA    1 
ATOM   4521  C  C     . LEU B  2  162 ? 60.328  60.181  74.907  1.00 83.11  ? 160  LEU B C     1 
ATOM   4522  O  O     . LEU B  2  162 ? 61.250  59.506  75.364  1.00 83.65  ? 160  LEU B O     1 
ATOM   4523  C  CB    . LEU B  2  162 ? 60.437  60.560  72.431  1.00 82.95  ? 160  LEU B CB    1 
ATOM   4524  C  CG    . LEU B  2  162 ? 60.110  60.083  71.017  1.00 82.44  ? 160  LEU B CG    1 
ATOM   4525  C  CD1   . LEU B  2  162 ? 61.070  60.736  70.049  1.00 81.75  ? 160  LEU B CD1   1 
ATOM   4526  C  CD2   . LEU B  2  162 ? 60.215  58.568  70.933  1.00 81.26  ? 160  LEU B CD2   1 
ATOM   4527  N  N     . GLU B  2  163 ? 59.839  61.244  75.542  1.00 82.56  ? 161  GLU B N     1 
ATOM   4528  C  CA    . GLU B  2  163 ? 60.349  61.645  76.845  1.00 80.87  ? 161  GLU B CA    1 
ATOM   4529  C  C     . GLU B  2  163 ? 60.054  60.498  77.790  1.00 79.47  ? 161  GLU B C     1 
ATOM   4530  O  O     . GLU B  2  163 ? 60.935  60.036  78.506  1.00 78.48  ? 161  GLU B O     1 
ATOM   4531  C  CB    . GLU B  2  163 ? 59.632  62.895  77.343  1.00 82.35  ? 161  GLU B CB    1 
ATOM   4532  C  CG    . GLU B  2  163 ? 59.993  64.177  76.622  1.00 84.27  ? 161  GLU B CG    1 
ATOM   4533  C  CD    . GLU B  2  163 ? 61.388  64.660  76.955  1.00 85.58  ? 161  GLU B CD    1 
ATOM   4534  O  OE1   . GLU B  2  163 ? 62.356  64.147  76.348  1.00 85.95  ? 161  GLU B OE1   1 
ATOM   4535  O  OE2   . GLU B  2  163 ? 61.511  65.549  77.832  1.00 86.18  ? 161  GLU B OE2   1 
ATOM   4536  N  N     . ASN B  2  164 ? 58.801  60.051  77.773  1.00 78.32  ? 162  ASN B N     1 
ATOM   4537  C  CA    . ASN B  2  164 ? 58.346  58.952  78.612  1.00 78.42  ? 162  ASN B CA    1 
ATOM   4538  C  C     . ASN B  2  164 ? 59.048  57.650  78.261  1.00 79.19  ? 162  ASN B C     1 
ATOM   4539  O  O     . ASN B  2  164 ? 59.350  56.846  79.147  1.00 81.00  ? 162  ASN B O     1 
ATOM   4540  C  CB    . ASN B  2  164 ? 56.842  58.747  78.459  1.00 77.76  ? 162  ASN B CB    1 
ATOM   4541  C  CG    . ASN B  2  164 ? 56.041  59.818  79.129  1.00 77.22  ? 162  ASN B CG    1 
ATOM   4542  O  OD1   . ASN B  2  164 ? 55.948  59.865  80.350  1.00 78.31  ? 162  ASN B OD1   1 
ATOM   4543  N  ND2   . ASN B  2  164 ? 55.457  60.698  78.336  1.00 78.93  ? 162  ASN B ND2   1 
ATOM   4544  N  N     . LEU B  2  165 ? 59.293  57.420  76.973  1.00 78.38  ? 163  LEU B N     1 
ATOM   4545  C  CA    . LEU B  2  165 ? 59.966  56.192  76.575  1.00 77.51  ? 163  LEU B CA    1 
ATOM   4546  C  C     . LEU B  2  165 ? 61.240  56.126  77.387  1.00 77.37  ? 163  LEU B C     1 
ATOM   4547  O  O     . LEU B  2  165 ? 61.369  55.267  78.254  1.00 77.22  ? 163  LEU B O     1 
ATOM   4548  C  CB    . LEU B  2  165 ? 60.309  56.194  75.088  1.00 77.44  ? 163  LEU B CB    1 
ATOM   4549  C  CG    . LEU B  2  165 ? 60.606  54.800  74.521  1.00 76.87  ? 163  LEU B CG    1 
ATOM   4550  C  CD1   . LEU B  2  165 ? 59.366  53.919  74.659  1.00 74.84  ? 163  LEU B CD1   1 
ATOM   4551  C  CD2   . LEU B  2  165 ? 61.018  54.910  73.063  1.00 76.35  ? 163  LEU B CD2   1 
ATOM   4552  N  N     . HIS B  2  166 ? 62.162  57.052  77.118  1.00 77.10  ? 164  HIS B N     1 
ATOM   4553  C  CA    . HIS B  2  166 ? 63.432  57.122  77.839  1.00 77.27  ? 164  HIS B CA    1 
ATOM   4554  C  C     . HIS B  2  166 ? 63.265  56.938  79.346  1.00 77.98  ? 164  HIS B C     1 
ATOM   4555  O  O     . HIS B  2  166 ? 64.108  56.332  79.998  1.00 80.41  ? 164  HIS B O     1 
ATOM   4556  C  CB    . HIS B  2  166 ? 64.129  58.457  77.583  1.00 76.28  ? 164  HIS B CB    1 
ATOM   4557  C  CG    . HIS B  2  166 ? 64.829  58.538  76.262  1.00 77.56  ? 164  HIS B CG    1 
ATOM   4558  N  ND1   . HIS B  2  166 ? 64.187  58.308  75.065  1.00 78.80  ? 164  HIS B ND1   1 
ATOM   4559  C  CD2   . HIS B  2  166 ? 66.106  58.865  75.947  1.00 77.01  ? 164  HIS B CD2   1 
ATOM   4560  C  CE1   . HIS B  2  166 ? 65.038  58.496  74.069  1.00 78.66  ? 164  HIS B CE1   1 
ATOM   4561  N  NE2   . HIS B  2  166 ? 66.208  58.836  74.578  1.00 76.72  ? 164  HIS B NE2   1 
ATOM   4562  N  N     . ALA B  2  167 ? 62.183  57.465  79.903  1.00 77.69  ? 165  ALA B N     1 
ATOM   4563  C  CA    . ALA B  2  167 ? 61.924  57.341  81.332  1.00 77.45  ? 165  ALA B CA    1 
ATOM   4564  C  C     . ALA B  2  167 ? 61.703  55.889  81.719  1.00 77.82  ? 165  ALA B C     1 
ATOM   4565  O  O     . ALA B  2  167 ? 62.081  55.462  82.809  1.00 77.09  ? 165  ALA B O     1 
ATOM   4566  C  CB    . ALA B  2  167 ? 60.706  58.149  81.699  1.00 78.39  ? 165  ALA B CB    1 
ATOM   4567  N  N     . ALA B  2  168 ? 61.073  55.145  80.814  1.00 78.85  ? 166  ALA B N     1 
ATOM   4568  C  CA    . ALA B  2  168 ? 60.765  53.729  81.012  1.00 80.67  ? 166  ALA B CA    1 
ATOM   4569  C  C     . ALA B  2  168 ? 61.925  52.831  80.579  1.00 81.28  ? 166  ALA B C     1 
ATOM   4570  O  O     . ALA B  2  168 ? 62.273  51.859  81.247  1.00 80.62  ? 166  ALA B O     1 
ATOM   4571  C  CB    . ALA B  2  168 ? 59.507  53.363  80.223  1.00 80.85  ? 166  ALA B CB    1 
ATOM   4572  N  N     . ALA B  2  169 ? 62.518  53.163  79.445  1.00 82.56  ? 167  ALA B N     1 
ATOM   4573  C  CA    . ALA B  2  169 ? 63.627  52.390  78.930  1.00 83.97  ? 167  ALA B CA    1 
ATOM   4574  C  C     . ALA B  2  169 ? 64.807  52.390  79.888  1.00 85.70  ? 167  ALA B C     1 
ATOM   4575  O  O     . ALA B  2  169 ? 65.527  51.400  79.970  1.00 87.34  ? 167  ALA B O     1 
ATOM   4576  C  CB    . ALA B  2  169 ? 64.058  52.938  77.591  1.00 84.28  ? 167  ALA B CB    1 
ATOM   4577  N  N     . TYR B  2  170 ? 65.015  53.484  80.615  1.00 85.97  ? 168  TYR B N     1 
ATOM   4578  C  CA    . TYR B  2  170 ? 66.144  53.550  81.536  1.00 86.12  ? 168  TYR B CA    1 
ATOM   4579  C  C     . TYR B  2  170 ? 65.799  53.816  82.992  1.00 86.33  ? 168  TYR B C     1 
ATOM   4580  O  O     . TYR B  2  170 ? 64.635  54.019  83.340  1.00 86.97  ? 168  TYR B O     1 
ATOM   4581  C  CB    . TYR B  2  170 ? 67.142  54.600  81.063  1.00 86.33  ? 168  TYR B CB    1 
ATOM   4582  C  CG    . TYR B  2  170 ? 67.696  54.317  79.692  1.00 88.21  ? 168  TYR B CG    1 
ATOM   4583  C  CD1   . TYR B  2  170 ? 66.951  54.580  78.549  1.00 89.25  ? 168  TYR B CD1   1 
ATOM   4584  C  CD2   . TYR B  2  170 ? 68.965  53.773  79.534  1.00 89.80  ? 168  TYR B CD2   1 
ATOM   4585  C  CE1   . TYR B  2  170 ? 67.459  54.309  77.280  1.00 90.14  ? 168  TYR B CE1   1 
ATOM   4586  C  CE2   . TYR B  2  170 ? 69.481  53.495  78.269  1.00 89.94  ? 168  TYR B CE2   1 
ATOM   4587  C  CZ    . TYR B  2  170 ? 68.723  53.765  77.151  1.00 89.74  ? 168  TYR B CZ    1 
ATOM   4588  O  OH    . TYR B  2  170 ? 69.222  53.478  75.907  1.00 89.98  ? 168  TYR B OH    1 
ATOM   4589  N  N     . LYS B  2  171 ? 66.837  53.797  83.831  1.00 86.01  ? 169  LYS B N     1 
ATOM   4590  C  CA    . LYS B  2  171 ? 66.728  54.031  85.271  1.00 84.79  ? 169  LYS B CA    1 
ATOM   4591  C  C     . LYS B  2  171 ? 67.499  55.285  85.644  1.00 85.26  ? 169  LYS B C     1 
ATOM   4592  O  O     . LYS B  2  171 ? 67.257  55.880  86.691  1.00 84.23  ? 169  LYS B O     1 
ATOM   4593  C  CB    . LYS B  2  171 ? 67.310  52.849  86.061  1.00 82.77  ? 169  LYS B CB    1 
ATOM   4594  C  CG    . LYS B  2  171 ? 66.316  51.766  86.420  1.00 80.85  ? 169  LYS B CG    1 
ATOM   4595  C  CD    . LYS B  2  171 ? 66.991  50.576  87.076  1.00 80.36  ? 169  LYS B CD    1 
ATOM   4596  C  CE    . LYS B  2  171 ? 65.970  49.494  87.414  1.00 80.90  ? 169  LYS B CE    1 
ATOM   4597  N  NZ    . LYS B  2  171 ? 66.567  48.162  87.748  1.00 80.98  ? 169  LYS B NZ    1 
ATOM   4598  N  N     . THR B  2  172 ? 68.425  55.687  84.780  1.00 86.55  ? 170  THR B N     1 
ATOM   4599  C  CA    . THR B  2  172 ? 69.252  56.855  85.056  1.00 88.47  ? 170  THR B CA    1 
ATOM   4600  C  C     . THR B  2  172 ? 69.796  57.501  83.793  1.00 88.29  ? 170  THR B C     1 
ATOM   4601  O  O     . THR B  2  172 ? 69.506  57.046  82.692  1.00 88.67  ? 170  THR B O     1 
ATOM   4602  C  CB    . THR B  2  172 ? 70.448  56.453  85.915  1.00 90.41  ? 170  THR B CB    1 
ATOM   4603  O  OG1   . THR B  2  172 ? 71.168  55.404  85.247  1.00 92.84  ? 170  THR B OG1   1 
ATOM   4604  C  CG2   . THR B  2  172 ? 69.986  55.956  87.288  1.00 90.82  ? 170  THR B CG2   1 
ATOM   4605  N  N     . ALA B  2  173 ? 70.593  58.555  83.982  1.00 88.76  ? 171  ALA B N     1 
ATOM   4606  C  CA    . ALA B  2  173 ? 71.249  59.320  82.906  1.00 89.62  ? 171  ALA B CA    1 
ATOM   4607  C  C     . ALA B  2  173 ? 70.421  59.595  81.647  1.00 89.58  ? 171  ALA B C     1 
ATOM   4608  O  O     . ALA B  2  173 ? 70.045  60.736  81.379  1.00 89.57  ? 171  ALA B O     1 
ATOM   4609  C  CB    . ALA B  2  173 ? 72.559  58.638  82.515  1.00 90.85  ? 171  ALA B CB    1 
ATOM   4610  N  N     . LEU B  2  174 ? 70.179  58.552  80.860  1.00 89.23  ? 172  LEU B N     1 
ATOM   4611  C  CA    . LEU B  2  174 ? 69.386  58.673  79.650  1.00 88.45  ? 172  LEU B CA    1 
ATOM   4612  C  C     . LEU B  2  174 ? 67.901  58.684  80.007  1.00 88.54  ? 172  LEU B C     1 
ATOM   4613  O  O     . LEU B  2  174 ? 67.050  58.945  79.156  1.00 89.88  ? 172  LEU B O     1 
ATOM   4614  C  CB    . LEU B  2  174 ? 69.673  57.509  78.706  1.00 87.74  ? 172  LEU B CB    1 
ATOM   4615  C  CG    . LEU B  2  174 ? 71.071  57.443  78.109  1.00 87.35  ? 172  LEU B CG    1 
ATOM   4616  C  CD1   . LEU B  2  174 ? 71.092  56.330  77.075  1.00 87.93  ? 172  LEU B CD1   1 
ATOM   4617  C  CD2   . LEU B  2  174 ? 71.437  58.770  77.466  1.00 86.28  ? 172  LEU B CD2   1 
ATOM   4618  N  N     . ALA B  2  175 ? 67.585  58.394  81.264  1.00 87.51  ? 173  ALA B N     1 
ATOM   4619  C  CA    . ALA B  2  175 ? 66.195  58.393  81.690  1.00 86.60  ? 173  ALA B CA    1 
ATOM   4620  C  C     . ALA B  2  175 ? 65.767  59.826  81.990  1.00 85.94  ? 173  ALA B C     1 
ATOM   4621  O  O     . ALA B  2  175 ? 64.583  60.107  82.165  1.00 86.87  ? 173  ALA B O     1 
ATOM   4622  C  CB    . ALA B  2  175 ? 66.016  57.505  82.919  1.00 86.61  ? 173  ALA B CB    1 
ATOM   4623  N  N     . ASN B  2  176 ? 66.735  60.732  82.042  1.00 84.35  ? 174  ASN B N     1 
ATOM   4624  C  CA    . ASN B  2  176 ? 66.436  62.132  82.300  1.00 83.93  ? 174  ASN B CA    1 
ATOM   4625  C  C     . ASN B  2  176 ? 65.729  62.750  81.096  1.00 83.97  ? 174  ASN B C     1 
ATOM   4626  O  O     . ASN B  2  176 ? 66.083  62.453  79.956  1.00 84.99  ? 174  ASN B O     1 
ATOM   4627  C  CB    . ASN B  2  176 ? 67.720  62.924  82.555  1.00 83.14  ? 174  ASN B CB    1 
ATOM   4628  C  CG    . ASN B  2  176 ? 68.461  62.455  83.774  1.00 82.08  ? 174  ASN B CG    1 
ATOM   4629  O  OD1   . ASN B  2  176 ? 67.861  61.964  84.728  1.00 81.35  ? 174  ASN B OD1   1 
ATOM   4630  N  ND2   . ASN B  2  176 ? 69.776  62.622  83.764  1.00 81.75  ? 174  ASN B ND2   1 
ATOM   4631  N  N     . PRO B  2  177 ? 64.718  63.614  81.335  1.00 83.24  ? 175  PRO B N     1 
ATOM   4632  C  CA    . PRO B  2  177 ? 63.971  64.279  80.260  1.00 82.10  ? 175  PRO B CA    1 
ATOM   4633  C  C     . PRO B  2  177 ? 64.841  65.319  79.549  1.00 81.27  ? 175  PRO B C     1 
ATOM   4634  O  O     . PRO B  2  177 ? 65.760  65.880  80.149  1.00 81.71  ? 175  PRO B O     1 
ATOM   4635  C  CB    . PRO B  2  177 ? 62.805  64.919  81.001  1.00 82.26  ? 175  PRO B CB    1 
ATOM   4636  C  CG    . PRO B  2  177 ? 63.395  65.227  82.333  1.00 82.46  ? 175  PRO B CG    1 
ATOM   4637  C  CD    . PRO B  2  177 ? 64.137  63.957  82.645  1.00 82.69  ? 175  PRO B CD    1 
ATOM   4638  N  N     . LEU B  2  178 ? 64.549  65.577  78.278  1.00 79.85  ? 176  LEU B N     1 
ATOM   4639  C  CA    . LEU B  2  178 ? 65.325  66.537  77.503  1.00 78.30  ? 176  LEU B CA    1 
ATOM   4640  C  C     . LEU B  2  178 ? 64.861  67.963  77.782  1.00 78.33  ? 176  LEU B C     1 
ATOM   4641  O  O     . LEU B  2  178 ? 65.606  68.924  77.542  1.00 77.67  ? 176  LEU B O     1 
ATOM   4642  C  CB    . LEU B  2  178 ? 65.206  66.215  76.009  1.00 77.16  ? 176  LEU B CB    1 
ATOM   4643  C  CG    . LEU B  2  178 ? 66.160  66.967  75.076  1.00 76.26  ? 176  LEU B CG    1 
ATOM   4644  C  CD1   . LEU B  2  178 ? 67.591  66.739  75.523  1.00 77.21  ? 176  LEU B CD1   1 
ATOM   4645  C  CD2   . LEU B  2  178 ? 65.969  66.505  73.640  1.00 73.66  ? 176  LEU B CD2   1 
ATOM   4646  N  N     . TYR B  2  179 ? 63.623  68.080  78.281  1.00 78.20  ? 177  TYR B N     1 
ATOM   4647  C  CA    . TYR B  2  179 ? 63.008  69.369  78.632  1.00 77.07  ? 177  TYR B CA    1 
ATOM   4648  C  C     . TYR B  2  179 ? 62.826  69.444  80.146  1.00 76.94  ? 177  TYR B C     1 
ATOM   4649  O  O     . TYR B  2  179 ? 62.244  68.531  80.753  1.00 75.93  ? 177  TYR B O     1 
ATOM   4650  C  CB    . TYR B  2  179 ? 61.642  69.540  77.942  1.00 75.26  ? 177  TYR B CB    1 
ATOM   4651  C  CG    . TYR B  2  179 ? 61.748  69.692  76.450  1.00 72.49  ? 177  TYR B CG    1 
ATOM   4652  C  CD1   . TYR B  2  179 ? 61.663  68.586  75.612  1.00 71.76  ? 177  TYR B CD1   1 
ATOM   4653  C  CD2   . TYR B  2  179 ? 62.026  70.930  75.881  1.00 72.25  ? 177  TYR B CD2   1 
ATOM   4654  C  CE1   . TYR B  2  179 ? 61.859  68.706  74.234  1.00 72.30  ? 177  TYR B CE1   1 
ATOM   4655  C  CE2   . TYR B  2  179 ? 62.230  71.065  74.509  1.00 72.47  ? 177  TYR B CE2   1 
ATOM   4656  C  CZ    . TYR B  2  179 ? 62.147  69.947  73.688  1.00 72.49  ? 177  TYR B CZ    1 
ATOM   4657  O  OH    . TYR B  2  179 ? 62.365  70.064  72.330  1.00 71.70  ? 177  TYR B OH    1 
ATOM   4658  N  N     . CYS B  2  180 ? 63.323  70.529  80.744  1.00 76.16  ? 178  CYS B N     1 
ATOM   4659  C  CA    . CYS B  2  180 ? 63.237  70.711  82.189  1.00 76.51  ? 178  CYS B CA    1 
ATOM   4660  C  C     . CYS B  2  180 ? 61.894  70.319  82.764  1.00 76.78  ? 178  CYS B C     1 
ATOM   4661  O  O     . CYS B  2  180 ? 60.860  70.801  82.319  1.00 77.25  ? 178  CYS B O     1 
ATOM   4662  C  CB    . CYS B  2  180 ? 63.509  72.160  82.576  1.00 76.70  ? 178  CYS B CB    1 
ATOM   4663  S  SG    . CYS B  2  180 ? 63.120  72.484  84.323  1.00 79.36  ? 178  CYS B SG    1 
ATOM   4664  N  N     . PRO B  2  181 ? 61.887  69.435  83.767  1.00 77.42  ? 179  PRO B N     1 
ATOM   4665  C  CA    . PRO B  2  181 ? 60.614  69.027  84.366  1.00 77.57  ? 179  PRO B CA    1 
ATOM   4666  C  C     . PRO B  2  181 ? 59.918  70.265  84.919  1.00 77.29  ? 179  PRO B C     1 
ATOM   4667  O  O     . PRO B  2  181 ? 60.579  71.225  85.343  1.00 76.93  ? 179  PRO B O     1 
ATOM   4668  C  CB    . PRO B  2  181 ? 61.041  68.051  85.458  1.00 77.47  ? 179  PRO B CB    1 
ATOM   4669  C  CG    . PRO B  2  181 ? 62.372  68.573  85.856  1.00 78.12  ? 179  PRO B CG    1 
ATOM   4670  C  CD    . PRO B  2  181 ? 63.018  68.873  84.517  1.00 77.82  ? 179  PRO B CD    1 
ATOM   4671  N  N     . ASP B  2  182 ? 58.589  70.238  84.909  1.00 76.61  ? 180  ASP B N     1 
ATOM   4672  C  CA    . ASP B  2  182 ? 57.799  71.373  85.373  1.00 75.80  ? 180  ASP B CA    1 
ATOM   4673  C  C     . ASP B  2  182 ? 58.127  71.894  86.759  1.00 75.28  ? 180  ASP B C     1 
ATOM   4674  O  O     . ASP B  2  182 ? 58.404  73.080  86.922  1.00 75.14  ? 180  ASP B O     1 
ATOM   4675  C  CB    . ASP B  2  182 ? 56.308  71.043  85.327  1.00 75.51  ? 180  ASP B CB    1 
ATOM   4676  C  CG    . ASP B  2  182 ? 55.776  70.927  83.919  1.00 74.01  ? 180  ASP B CG    1 
ATOM   4677  O  OD1   . ASP B  2  182 ? 56.448  71.390  82.973  1.00 74.02  ? 180  ASP B OD1   1 
ATOM   4678  O  OD2   . ASP B  2  182 ? 54.668  70.381  83.768  1.00 72.55  ? 180  ASP B OD2   1 
ATOM   4679  N  N     . TYR B  2  183 ? 58.083  71.013  87.755  1.00 75.15  ? 181  TYR B N     1 
ATOM   4680  C  CA    . TYR B  2  183 ? 58.348  71.408  89.133  1.00 74.77  ? 181  TYR B CA    1 
ATOM   4681  C  C     . TYR B  2  183 ? 59.666  72.154  89.286  1.00 73.32  ? 181  TYR B C     1 
ATOM   4682  O  O     . TYR B  2  183 ? 59.863  72.890  90.250  1.00 72.41  ? 181  TYR B O     1 
ATOM   4683  C  CB    . TYR B  2  183 ? 58.321  70.181  90.055  1.00 76.83  ? 181  TYR B CB    1 
ATOM   4684  C  CG    . TYR B  2  183 ? 59.626  69.413  90.164  1.00 80.60  ? 181  TYR B CG    1 
ATOM   4685  C  CD1   . TYR B  2  183 ? 60.594  69.762  91.108  1.00 80.87  ? 181  TYR B CD1   1 
ATOM   4686  C  CD2   . TYR B  2  183 ? 59.887  68.322  89.333  1.00 82.91  ? 181  TYR B CD2   1 
ATOM   4687  C  CE1   . TYR B  2  183 ? 61.782  69.045  91.223  1.00 81.91  ? 181  TYR B CE1   1 
ATOM   4688  C  CE2   . TYR B  2  183 ? 61.074  67.601  89.440  1.00 84.00  ? 181  TYR B CE2   1 
ATOM   4689  C  CZ    . TYR B  2  183 ? 62.016  67.967  90.387  1.00 83.83  ? 181  TYR B CZ    1 
ATOM   4690  O  OH    . TYR B  2  183 ? 63.184  67.244  90.488  1.00 86.13  ? 181  TYR B OH    1 
ATOM   4691  N  N     . ARG B  2  184 ? 60.565  71.989  88.329  1.00 72.13  ? 182  ARG B N     1 
ATOM   4692  C  CA    . ARG B  2  184 ? 61.828  72.669  88.444  1.00 71.85  ? 182  ARG B CA    1 
ATOM   4693  C  C     . ARG B  2  184 ? 61.965  73.916  87.617  1.00 72.26  ? 182  ARG B C     1 
ATOM   4694  O  O     . ARG B  2  184 ? 63.006  74.567  87.657  1.00 73.20  ? 182  ARG B O     1 
ATOM   4695  C  CB    . ARG B  2  184 ? 62.983  71.708  88.172  1.00 72.88  ? 182  ARG B CB    1 
ATOM   4696  C  CG    . ARG B  2  184 ? 63.390  70.924  89.429  1.00 71.30  ? 182  ARG B CG    1 
ATOM   4697  C  CD    . ARG B  2  184 ? 64.697  70.217  89.255  1.00 69.85  ? 182  ARG B CD    1 
ATOM   4698  N  NE    . ARG B  2  184 ? 65.785  71.146  88.939  1.00 70.75  ? 182  ARG B NE    1 
ATOM   4699  C  CZ    . ARG B  2  184 ? 66.278  72.054  89.778  1.00 71.03  ? 182  ARG B CZ    1 
ATOM   4700  N  NH1   . ARG B  2  184 ? 65.780  72.178  91.007  1.00 70.77  ? 182  ARG B NH1   1 
ATOM   4701  N  NH2   . ARG B  2  184 ? 67.291  72.822  89.397  1.00 70.25  ? 182  ARG B NH2   1 
ATOM   4702  N  N     . ILE B  2  185 ? 60.927  74.264  86.864  1.00 72.59  ? 183  ILE B N     1 
ATOM   4703  C  CA    . ILE B  2  185 ? 60.984  75.500  86.086  1.00 72.41  ? 183  ILE B CA    1 
ATOM   4704  C  C     . ILE B  2  185 ? 61.070  76.587  87.158  1.00 73.07  ? 183  ILE B C     1 
ATOM   4705  O  O     . ILE B  2  185 ? 60.212  76.663  88.048  1.00 72.69  ? 183  ILE B O     1 
ATOM   4706  C  CB    . ILE B  2  185 ? 59.699  75.752  85.247  1.00 71.84  ? 183  ILE B CB    1 
ATOM   4707  C  CG1   . ILE B  2  185 ? 59.408  74.565  84.334  1.00 72.32  ? 183  ILE B CG1   1 
ATOM   4708  C  CG2   . ILE B  2  185 ? 59.886  76.983  84.374  1.00 69.65  ? 183  ILE B CG2   1 
ATOM   4709  C  CD1   . ILE B  2  185 ? 60.424  74.399  83.242  1.00 74.77  ? 183  ILE B CD1   1 
ATOM   4710  N  N     . GLY B  2  186 ? 62.124  77.396  87.098  1.00 73.24  ? 184  GLY B N     1 
ATOM   4711  C  CA    . GLY B  2  186 ? 62.283  78.465  88.067  1.00 73.91  ? 184  GLY B CA    1 
ATOM   4712  C  C     . GLY B  2  186 ? 63.083  78.164  89.325  1.00 75.38  ? 184  GLY B C     1 
ATOM   4713  O  O     . GLY B  2  186 ? 63.294  79.064  90.139  1.00 75.37  ? 184  GLY B O     1 
ATOM   4714  N  N     . LYS B  2  187 ? 63.524  76.920  89.505  1.00 76.15  ? 185  LYS B N     1 
ATOM   4715  C  CA    . LYS B  2  187 ? 64.308  76.565  90.679  1.00 75.97  ? 185  LYS B CA    1 
ATOM   4716  C  C     . LYS B  2  187 ? 65.772  76.264  90.320  1.00 77.66  ? 185  LYS B C     1 
ATOM   4717  O  O     . LYS B  2  187 ? 66.562  75.836  91.165  1.00 79.53  ? 185  LYS B O     1 
ATOM   4718  C  CB    . LYS B  2  187 ? 63.677  75.368  91.377  1.00 74.67  ? 185  LYS B CB    1 
ATOM   4719  C  CG    . LYS B  2  187 ? 62.257  75.597  91.794  1.00 73.67  ? 185  LYS B CG    1 
ATOM   4720  C  CD    . LYS B  2  187 ? 61.809  74.545  92.787  1.00 74.36  ? 185  LYS B CD    1 
ATOM   4721  C  CE    . LYS B  2  187 ? 60.334  74.717  93.127  1.00 76.57  ? 185  LYS B CE    1 
ATOM   4722  N  NZ    . LYS B  2  187 ? 59.979  76.135  93.484  1.00 76.48  ? 185  LYS B NZ    1 
ATOM   4723  N  N     . ILE B  2  188 ? 66.127  76.496  89.060  1.00 78.07  ? 186  ILE B N     1 
ATOM   4724  C  CA    . ILE B  2  188 ? 67.485  76.276  88.570  1.00 78.46  ? 186  ILE B CA    1 
ATOM   4725  C  C     . ILE B  2  188 ? 68.305  77.516  88.905  1.00 80.44  ? 186  ILE B C     1 
ATOM   4726  O  O     . ILE B  2  188 ? 68.044  78.584  88.366  1.00 81.50  ? 186  ILE B O     1 
ATOM   4727  C  CB    . ILE B  2  188 ? 67.474  76.080  87.045  1.00 77.36  ? 186  ILE B CB    1 
ATOM   4728  C  CG1   . ILE B  2  188 ? 66.551  74.909  86.691  1.00 78.28  ? 186  ILE B CG1   1 
ATOM   4729  C  CG2   . ILE B  2  188 ? 68.881  75.858  86.535  1.00 75.66  ? 186  ILE B CG2   1 
ATOM   4730  C  CD1   . ILE B  2  188 ? 66.306  74.714  85.202  1.00 77.26  ? 186  ILE B CD1   1 
ATOM   4731  N  N     . THR B  2  189 ? 69.298  77.374  89.782  1.00 82.75  ? 187  THR B N     1 
ATOM   4732  C  CA    . THR B  2  189 ? 70.148  78.498  90.217  1.00 84.15  ? 187  THR B CA    1 
ATOM   4733  C  C     . THR B  2  189 ? 71.323  78.810  89.278  1.00 85.24  ? 187  THR B C     1 
ATOM   4734  O  O     . THR B  2  189 ? 71.640  78.027  88.381  1.00 85.60  ? 187  THR B O     1 
ATOM   4735  C  CB    . THR B  2  189 ? 70.732  78.217  91.614  1.00 83.81  ? 187  THR B CB    1 
ATOM   4736  O  OG1   . THR B  2  189 ? 71.932  77.442  91.480  1.00 84.73  ? 187  THR B OG1   1 
ATOM   4737  C  CG2   . THR B  2  189 ? 69.733  77.418  92.455  1.00 83.63  ? 187  THR B CG2   1 
ATOM   4738  N  N     . SER B  2  190 ? 71.969  79.957  89.490  1.00 86.55  ? 188  SER B N     1 
ATOM   4739  C  CA    . SER B  2  190 ? 73.122  80.340  88.669  1.00 88.81  ? 188  SER B CA    1 
ATOM   4740  C  C     . SER B  2  190 ? 74.269  79.385  88.935  1.00 90.01  ? 188  SER B C     1 
ATOM   4741  O  O     . SER B  2  190 ? 75.034  79.046  88.030  1.00 89.93  ? 188  SER B O     1 
ATOM   4742  C  CB    . SER B  2  190 ? 73.597  81.760  88.990  1.00 88.67  ? 188  SER B CB    1 
ATOM   4743  O  OG    . SER B  2  190 ? 72.801  82.736  88.347  1.00 90.86  ? 188  SER B OG    1 
ATOM   4744  N  N     . GLU B  2  191 ? 74.390  78.972  90.193  1.00 91.51  ? 189  GLU B N     1 
ATOM   4745  C  CA    . GLU B  2  191 ? 75.434  78.043  90.596  1.00 92.51  ? 189  GLU B CA    1 
ATOM   4746  C  C     . GLU B  2  191 ? 75.299  76.804  89.746  1.00 91.30  ? 189  GLU B C     1 
ATOM   4747  O  O     . GLU B  2  191 ? 76.252  76.375  89.102  1.00 91.77  ? 189  GLU B O     1 
ATOM   4748  C  CB    . GLU B  2  191 ? 75.286  77.651  92.069  1.00 95.29  ? 189  GLU B CB    1 
ATOM   4749  C  CG    . GLU B  2  191 ? 75.510  78.791  93.060  1.00 99.49  ? 189  GLU B CG    1 
ATOM   4750  C  CD    . GLU B  2  191 ? 74.352  79.790  93.112  1.00 100.79 ? 189  GLU B CD    1 
ATOM   4751  O  OE1   . GLU B  2  191 ? 73.230  79.392  93.509  1.00 101.53 ? 189  GLU B OE1   1 
ATOM   4752  O  OE2   . GLU B  2  191 ? 74.572  80.973  92.761  1.00 101.18 ? 189  GLU B OE2   1 
ATOM   4753  N  N     . GLN B  2  192 ? 74.102  76.237  89.740  1.00 89.63  ? 190  GLN B N     1 
ATOM   4754  C  CA    . GLN B  2  192 ? 73.853  75.042  88.968  1.00 89.35  ? 190  GLN B CA    1 
ATOM   4755  C  C     . GLN B  2  192 ? 74.271  75.206  87.514  1.00 89.76  ? 190  GLN B C     1 
ATOM   4756  O  O     . GLN B  2  192 ? 74.800  74.272  86.908  1.00 89.82  ? 190  GLN B O     1 
ATOM   4757  C  CB    . GLN B  2  192 ? 72.385  74.666  89.079  1.00 88.31  ? 190  GLN B CB    1 
ATOM   4758  C  CG    . GLN B  2  192 ? 72.003  74.353  90.500  1.00 87.40  ? 190  GLN B CG    1 
ATOM   4759  C  CD    . GLN B  2  192 ? 70.632  73.745  90.619  1.00 88.18  ? 190  GLN B CD    1 
ATOM   4760  O  OE1   . GLN B  2  192 ? 69.621  74.441  90.560  1.00 88.97  ? 190  GLN B OE1   1 
ATOM   4761  N  NE2   . GLN B  2  192 ? 70.586  72.428  90.782  1.00 88.89  ? 190  GLN B NE2   1 
ATOM   4762  N  N     . LEU B  2  193 ? 74.049  76.390  86.952  1.00 90.70  ? 191  LEU B N     1 
ATOM   4763  C  CA    . LEU B  2  193 ? 74.440  76.629  85.567  1.00 91.74  ? 191  LEU B CA    1 
ATOM   4764  C  C     . LEU B  2  193 ? 75.957  76.624  85.452  1.00 91.92  ? 191  LEU B C     1 
ATOM   4765  O  O     . LEU B  2  193 ? 76.517  75.933  84.601  1.00 92.38  ? 191  LEU B O     1 
ATOM   4766  C  CB    . LEU B  2  193 ? 73.875  77.959  85.044  1.00 92.00  ? 191  LEU B CB    1 
ATOM   4767  C  CG    . LEU B  2  193 ? 72.367  78.046  84.751  1.00 91.49  ? 191  LEU B CG    1 
ATOM   4768  C  CD1   . LEU B  2  193 ? 72.126  79.265  83.884  1.00 90.14  ? 191  LEU B CD1   1 
ATOM   4769  C  CD2   . LEU B  2  193 ? 71.866  76.801  84.023  1.00 90.37  ? 191  LEU B CD2   1 
ATOM   4770  N  N     . HIS B  2  194 ? 76.624  77.383  86.317  1.00 92.42  ? 192  HIS B N     1 
ATOM   4771  C  CA    . HIS B  2  194 ? 78.085  77.432  86.305  1.00 92.20  ? 192  HIS B CA    1 
ATOM   4772  C  C     . HIS B  2  194 ? 78.686  76.054  86.478  1.00 91.88  ? 192  HIS B C     1 
ATOM   4773  O  O     . HIS B  2  194 ? 79.396  75.562  85.609  1.00 91.47  ? 192  HIS B O     1 
ATOM   4774  C  CB    . HIS B  2  194 ? 78.617  78.323  87.422  1.00 92.08  ? 192  HIS B CB    1 
ATOM   4775  C  CG    . HIS B  2  194 ? 78.648  79.773  87.071  1.00 92.54  ? 192  HIS B CG    1 
ATOM   4776  N  ND1   . HIS B  2  194 ? 77.681  80.662  87.489  1.00 92.52  ? 192  HIS B ND1   1 
ATOM   4777  C  CD2   . HIS B  2  194 ? 79.510  80.483  86.306  1.00 92.81  ? 192  HIS B CD2   1 
ATOM   4778  C  CE1   . HIS B  2  194 ? 77.945  81.858  86.994  1.00 92.31  ? 192  HIS B CE1   1 
ATOM   4779  N  NE2   . HIS B  2  194 ? 79.048  81.777  86.272  1.00 92.54  ? 192  HIS B NE2   1 
ATOM   4780  N  N     . HIS B  2  195 ? 78.401  75.437  87.614  1.00 92.42  ? 193  HIS B N     1 
ATOM   4781  C  CA    . HIS B  2  195 ? 78.936  74.120  87.893  1.00 94.72  ? 193  HIS B CA    1 
ATOM   4782  C  C     . HIS B  2  195 ? 78.701  73.178  86.726  1.00 94.88  ? 193  HIS B C     1 
ATOM   4783  O  O     . HIS B  2  195 ? 79.564  72.369  86.398  1.00 95.71  ? 193  HIS B O     1 
ATOM   4784  C  CB    . HIS B  2  195 ? 78.334  73.562  89.188  1.00 96.87  ? 193  HIS B CB    1 
ATOM   4785  C  CG    . HIS B  2  195 ? 78.592  74.433  90.383  1.00 100.31 ? 193  HIS B CG    1 
ATOM   4786  N  ND1   . HIS B  2  195 ? 79.819  75.016  90.629  1.00 101.22 ? 193  HIS B ND1   1 
ATOM   4787  C  CD2   . HIS B  2  195 ? 77.774  74.846  91.382  1.00 101.60 ? 193  HIS B CD2   1 
ATOM   4788  C  CE1   . HIS B  2  195 ? 79.745  75.754  91.723  1.00 101.25 ? 193  HIS B CE1   1 
ATOM   4789  N  NE2   . HIS B  2  195 ? 78.515  75.669  92.199  1.00 102.09 ? 193  HIS B NE2   1 
ATOM   4790  N  N     . PHE B  2  196 ? 77.550  73.289  86.075  1.00 94.92  ? 194  PHE B N     1 
ATOM   4791  C  CA    . PHE B  2  196 ? 77.294  72.417  84.943  1.00 94.02  ? 194  PHE B CA    1 
ATOM   4792  C  C     . PHE B  2  196 ? 78.332  72.692  83.857  1.00 94.94  ? 194  PHE B C     1 
ATOM   4793  O  O     . PHE B  2  196 ? 78.948  71.765  83.345  1.00 95.01  ? 194  PHE B O     1 
ATOM   4794  C  CB    . PHE B  2  196 ? 75.898  72.629  84.380  1.00 91.24  ? 194  PHE B CB    1 
ATOM   4795  C  CG    . PHE B  2  196 ? 75.470  71.546  83.443  1.00 89.01  ? 194  PHE B CG    1 
ATOM   4796  C  CD1   . PHE B  2  196 ? 74.944  70.356  83.934  1.00 87.73  ? 194  PHE B CD1   1 
ATOM   4797  C  CD2   . PHE B  2  196 ? 75.629  71.694  82.067  1.00 88.89  ? 194  PHE B CD2   1 
ATOM   4798  C  CE1   . PHE B  2  196 ? 74.580  69.321  83.065  1.00 87.69  ? 194  PHE B CE1   1 
ATOM   4799  C  CE2   . PHE B  2  196 ? 75.269  70.667  81.183  1.00 88.21  ? 194  PHE B CE2   1 
ATOM   4800  C  CZ    . PHE B  2  196 ? 74.743  69.479  81.683  1.00 88.08  ? 194  PHE B CZ    1 
ATOM   4801  N  N     . VAL B  2  197 ? 78.538  73.962  83.517  1.00 96.37  ? 195  VAL B N     1 
ATOM   4802  C  CA    . VAL B  2  197 ? 79.525  74.322  82.495  1.00 98.58  ? 195  VAL B CA    1 
ATOM   4803  C  C     . VAL B  2  197 ? 80.947  73.912  82.888  1.00 100.95 ? 195  VAL B C     1 
ATOM   4804  O  O     . VAL B  2  197 ? 81.674  73.290  82.106  1.00 101.54 ? 195  VAL B O     1 
ATOM   4805  C  CB    . VAL B  2  197 ? 79.546  75.831  82.235  1.00 97.17  ? 195  VAL B CB    1 
ATOM   4806  C  CG1   . VAL B  2  197 ? 80.611  76.158  81.200  1.00 96.70  ? 195  VAL B CG1   1 
ATOM   4807  C  CG2   . VAL B  2  197 ? 78.192  76.286  81.767  1.00 96.70  ? 195  VAL B CG2   1 
ATOM   4808  N  N     . GLN B  2  198 ? 81.339  74.275  84.105  1.00 102.84 ? 196  GLN B N     1 
ATOM   4809  C  CA    . GLN B  2  198 ? 82.670  73.962  84.612  1.00 103.80 ? 196  GLN B CA    1 
ATOM   4810  C  C     . GLN B  2  198 ? 82.934  72.452  84.590  1.00 103.86 ? 196  GLN B C     1 
ATOM   4811  O  O     . GLN B  2  198 ? 84.000  72.013  84.162  1.00 103.86 ? 196  GLN B O     1 
ATOM   4812  C  CB    . GLN B  2  198 ? 82.828  74.497  86.048  1.00 104.63 ? 196  GLN B CB    1 
ATOM   4813  C  CG    . GLN B  2  198 ? 82.342  75.939  86.256  1.00 104.91 ? 196  GLN B CG    1 
ATOM   4814  C  CD    . GLN B  2  198 ? 82.435  76.406  87.708  1.00 105.00 ? 196  GLN B CD    1 
ATOM   4815  O  OE1   . GLN B  2  198 ? 82.218  75.631  88.644  1.00 105.73 ? 196  GLN B OE1   1 
ATOM   4816  N  NE2   . GLN B  2  198 ? 82.734  77.686  87.896  1.00 103.64 ? 196  GLN B NE2   1 
ATOM   4817  N  N     . ASN B  2  199 ? 81.955  71.667  85.036  1.00 103.77 ? 197  ASN B N     1 
ATOM   4818  C  CA    . ASN B  2  199 ? 82.103  70.216  85.098  1.00 105.01 ? 197  ASN B CA    1 
ATOM   4819  C  C     . ASN B  2  199 ? 81.855  69.452  83.803  1.00 105.37 ? 197  ASN B C     1 
ATOM   4820  O  O     . ASN B  2  199 ? 82.035  68.230  83.768  1.00 106.37 ? 197  ASN B O     1 
ATOM   4821  C  CB    . ASN B  2  199 ? 81.183  69.620  86.167  1.00 106.19 ? 197  ASN B CB    1 
ATOM   4822  C  CG    . ASN B  2  199 ? 81.370  70.255  87.522  1.00 107.83 ? 197  ASN B CG    1 
ATOM   4823  O  OD1   . ASN B  2  199 ? 82.488  70.587  87.917  1.00 108.96 ? 197  ASN B OD1   1 
ATOM   4824  N  ND2   . ASN B  2  199 ? 80.270  70.413  88.256  1.00 109.22 ? 197  ASN B ND2   1 
ATOM   4825  N  N     . ASN B  2  200 ? 81.443  70.137  82.741  1.00 104.33 ? 198  ASN B N     1 
ATOM   4826  C  CA    . ASN B  2  200 ? 81.176  69.429  81.494  1.00 102.96 ? 198  ASN B CA    1 
ATOM   4827  C  C     . ASN B  2  200 ? 81.749  70.087  80.240  1.00 103.06 ? 198  ASN B C     1 
ATOM   4828  O  O     . ASN B  2  200 ? 82.151  69.397  79.308  1.00 102.97 ? 198  ASN B O     1 
ATOM   4829  C  CB    . ASN B  2  200 ? 79.665  69.211  81.339  1.00 101.86 ? 198  ASN B CB    1 
ATOM   4830  C  CG    . ASN B  2  200 ? 79.078  68.359  82.455  1.00 100.55 ? 198  ASN B CG    1 
ATOM   4831  O  OD1   . ASN B  2  200 ? 79.490  67.230  82.656  1.00 101.60 ? 198  ASN B OD1   1 
ATOM   4832  N  ND2   . ASN B  2  200 ? 78.115  68.902  83.182  1.00 100.02 ? 198  ASN B ND2   1 
ATOM   4833  N  N     . PHE B  2  201 ? 81.791  71.412  80.208  1.00 103.54 ? 199  PHE B N     1 
ATOM   4834  C  CA    . PHE B  2  201 ? 82.332  72.112  79.045  1.00 104.68 ? 199  PHE B CA    1 
ATOM   4835  C  C     . PHE B  2  201 ? 83.848  72.178  79.173  1.00 105.29 ? 199  PHE B C     1 
ATOM   4836  O  O     . PHE B  2  201 ? 84.433  73.263  79.221  1.00 105.84 ? 199  PHE B O     1 
ATOM   4837  C  CB    . PHE B  2  201 ? 81.745  73.525  78.962  1.00 105.69 ? 199  PHE B CB    1 
ATOM   4838  C  CG    . PHE B  2  201 ? 80.299  73.562  78.537  1.00 105.94 ? 199  PHE B CG    1 
ATOM   4839  C  CD1   . PHE B  2  201 ? 79.440  72.509  78.841  1.00 106.01 ? 199  PHE B CD1   1 
ATOM   4840  C  CD2   . PHE B  2  201 ? 79.798  74.652  77.837  1.00 105.55 ? 199  PHE B CD2   1 
ATOM   4841  C  CE1   . PHE B  2  201 ? 78.108  72.536  78.455  1.00 105.89 ? 199  PHE B CE1   1 
ATOM   4842  C  CE2   . PHE B  2  201 ? 78.466  74.690  77.447  1.00 106.03 ? 199  PHE B CE2   1 
ATOM   4843  C  CZ    . PHE B  2  201 ? 77.618  73.629  77.756  1.00 106.20 ? 199  PHE B CZ    1 
ATOM   4844  N  N     . THR B  2  202 ? 84.472  71.001  79.229  1.00 105.50 ? 200  THR B N     1 
ATOM   4845  C  CA    . THR B  2  202 ? 85.924  70.870  79.375  1.00 104.71 ? 200  THR B CA    1 
ATOM   4846  C  C     . THR B  2  202 ? 86.619  70.626  78.034  1.00 104.77 ? 200  THR B C     1 
ATOM   4847  O  O     . THR B  2  202 ? 86.132  69.856  77.203  1.00 104.43 ? 200  THR B O     1 
ATOM   4848  C  CB    . THR B  2  202 ? 86.269  69.699  80.292  1.00 104.24 ? 200  THR B CB    1 
ATOM   4849  O  OG1   . THR B  2  202 ? 86.086  68.474  79.573  1.00 103.72 ? 200  THR B OG1   1 
ATOM   4850  C  CG2   . THR B  2  202 ? 85.367  69.700  81.521  1.00 103.85 ? 200  THR B CG2   1 
ATOM   4851  N  N     . SER B  2  203 ? 87.773  71.261  77.844  1.00 104.47 ? 201  SER B N     1 
ATOM   4852  C  CA    . SER B  2  203 ? 88.527  71.143  76.598  1.00 104.15 ? 201  SER B CA    1 
ATOM   4853  C  C     . SER B  2  203 ? 88.636  69.731  76.030  1.00 103.40 ? 201  SER B C     1 
ATOM   4854  O  O     . SER B  2  203 ? 88.710  69.556  74.818  1.00 102.95 ? 201  SER B O     1 
ATOM   4855  C  CB    . SER B  2  203 ? 89.935  71.724  76.767  1.00 104.39 ? 201  SER B CB    1 
ATOM   4856  O  OG    . SER B  2  203 ? 90.764  70.878  77.538  1.00 104.78 ? 201  SER B OG    1 
ATOM   4857  N  N     . ALA B  2  204 ? 88.642  68.726  76.896  1.00 103.16 ? 202  ALA B N     1 
ATOM   4858  C  CA    . ALA B  2  204 ? 88.762  67.345  76.442  1.00 103.31 ? 202  ALA B CA    1 
ATOM   4859  C  C     . ALA B  2  204 ? 87.427  66.741  76.003  1.00 103.88 ? 202  ALA B C     1 
ATOM   4860  O  O     . ALA B  2  204 ? 87.388  65.658  75.408  1.00 103.51 ? 202  ALA B O     1 
ATOM   4861  C  CB    . ALA B  2  204 ? 89.382  66.501  77.537  1.00 102.88 ? 202  ALA B CB    1 
ATOM   4862  N  N     . ARG B  2  205 ? 86.335  67.438  76.310  1.00 104.02 ? 203  ARG B N     1 
ATOM   4863  C  CA    . ARG B  2  205 ? 84.992  66.988  75.939  1.00 103.22 ? 203  ARG B CA    1 
ATOM   4864  C  C     . ARG B  2  205 ? 84.453  67.888  74.840  1.00 102.49 ? 203  ARG B C     1 
ATOM   4865  O  O     . ARG B  2  205 ? 83.318  67.731  74.394  1.00 102.93 ? 203  ARG B O     1 
ATOM   4866  C  CB    . ARG B  2  205 ? 84.048  67.058  77.139  1.00 102.49 ? 203  ARG B CB    1 
ATOM   4867  C  CG    . ARG B  2  205 ? 84.254  65.972  78.154  1.00 103.03 ? 203  ARG B CG    1 
ATOM   4868  C  CD    . ARG B  2  205 ? 83.851  66.463  79.521  1.00 103.35 ? 203  ARG B CD    1 
ATOM   4869  N  NE    . ARG B  2  205 ? 82.438  66.799  79.608  1.00 103.90 ? 203  ARG B NE    1 
ATOM   4870  C  CZ    . ARG B  2  205 ? 81.492  65.961  80.015  1.00 104.00 ? 203  ARG B CZ    1 
ATOM   4871  N  NH1   . ARG B  2  205 ? 81.808  64.723  80.374  1.00 104.24 ? 203  ARG B NH1   1 
ATOM   4872  N  NH2   . ARG B  2  205 ? 80.230  66.367  80.075  1.00 104.40 ? 203  ARG B NH2   1 
ATOM   4873  N  N     . MET B  2  206 ? 85.281  68.828  74.402  1.00 101.14 ? 204  MET B N     1 
ATOM   4874  C  CA    . MET B  2  206 ? 84.881  69.769  73.373  1.00 100.26 ? 204  MET B CA    1 
ATOM   4875  C  C     . MET B  2  206 ? 85.566  69.576  72.022  1.00 99.72  ? 204  MET B C     1 
ATOM   4876  O  O     . MET B  2  206 ? 86.657  69.011  71.925  1.00 100.60 ? 204  MET B O     1 
ATOM   4877  C  CB    . MET B  2  206 ? 85.105  71.193  73.887  1.00 99.81  ? 204  MET B CB    1 
ATOM   4878  C  CG    . MET B  2  206 ? 84.142  71.580  75.001  1.00 100.51 ? 204  MET B CG    1 
ATOM   4879  S  SD    . MET B  2  206 ? 84.573  73.091  75.914  1.00 101.72 ? 204  MET B SD    1 
ATOM   4880  C  CE    . MET B  2  206 ? 84.486  74.318  74.625  1.00 100.26 ? 204  MET B CE    1 
ATOM   4881  N  N     . ALA B  2  207 ? 84.901  70.053  70.977  1.00 98.47  ? 205  ALA B N     1 
ATOM   4882  C  CA    . ALA B  2  207 ? 85.409  69.960  69.621  1.00 97.72  ? 205  ALA B CA    1 
ATOM   4883  C  C     . ALA B  2  207 ? 84.988  71.201  68.839  1.00 97.19  ? 205  ALA B C     1 
ATOM   4884  O  O     . ALA B  2  207 ? 83.801  71.503  68.730  1.00 98.17  ? 205  ALA B O     1 
ATOM   4885  C  CB    . ALA B  2  207 ? 84.863  68.706  68.951  1.00 97.39  ? 205  ALA B CB    1 
ATOM   4886  N  N     . LEU B  2  208 ? 85.961  71.928  68.307  1.00 95.82  ? 206  LEU B N     1 
ATOM   4887  C  CA    . LEU B  2  208 ? 85.661  73.122  67.539  1.00 95.16  ? 206  LEU B CA    1 
ATOM   4888  C  C     . LEU B  2  208 ? 85.665  72.810  66.045  1.00 95.64  ? 206  LEU B C     1 
ATOM   4889  O  O     . LEU B  2  208 ? 86.697  72.905  65.380  1.00 97.04  ? 206  LEU B O     1 
ATOM   4890  C  CB    . LEU B  2  208 ? 86.680  74.215  67.847  1.00 94.08  ? 206  LEU B CB    1 
ATOM   4891  C  CG    . LEU B  2  208 ? 86.565  75.424  66.927  1.00 93.12  ? 206  LEU B CG    1 
ATOM   4892  C  CD1   . LEU B  2  208 ? 85.148  75.955  67.002  1.00 94.40  ? 206  LEU B CD1   1 
ATOM   4893  C  CD2   . LEU B  2  208 ? 87.580  76.480  67.321  1.00 92.16  ? 206  LEU B CD2   1 
ATOM   4894  N  N     . VAL B  2  209 ? 84.499  72.446  65.522  1.00 95.03  ? 207  VAL B N     1 
ATOM   4895  C  CA    . VAL B  2  209 ? 84.345  72.099  64.112  1.00 94.25  ? 207  VAL B CA    1 
ATOM   4896  C  C     . VAL B  2  209 ? 83.986  73.328  63.279  1.00 94.07  ? 207  VAL B C     1 
ATOM   4897  O  O     . VAL B  2  209 ? 83.504  74.317  63.823  1.00 94.93  ? 207  VAL B O     1 
ATOM   4898  C  CB    . VAL B  2  209 ? 83.257  71.033  63.964  1.00 94.22  ? 207  VAL B CB    1 
ATOM   4899  C  CG1   . VAL B  2  209 ? 83.179  70.551  62.538  1.00 94.71  ? 207  VAL B CG1   1 
ATOM   4900  C  CG2   . VAL B  2  209 ? 83.557  69.875  64.903  1.00 94.35  ? 207  VAL B CG2   1 
ATOM   4901  N  N     . GLY B  2  210 ? 84.228  73.273  61.971  1.00 93.43  ? 208  GLY B N     1 
ATOM   4902  C  CA    . GLY B  2  210 ? 83.921  74.411  61.119  1.00 94.16  ? 208  GLY B CA    1 
ATOM   4903  C  C     . GLY B  2  210 ? 83.835  74.076  59.643  1.00 95.03  ? 208  GLY B C     1 
ATOM   4904  O  O     . GLY B  2  210 ? 84.345  73.055  59.209  1.00 94.47  ? 208  GLY B O     1 
ATOM   4905  N  N     . ILE B  2  211 ? 83.178  74.936  58.870  1.00 96.82  ? 209  ILE B N     1 
ATOM   4906  C  CA    . ILE B  2  211 ? 83.025  74.737  57.427  1.00 97.95  ? 209  ILE B CA    1 
ATOM   4907  C  C     . ILE B  2  211 ? 83.175  76.066  56.687  1.00 99.11  ? 209  ILE B C     1 
ATOM   4908  O  O     . ILE B  2  211 ? 82.816  77.119  57.213  1.00 99.74  ? 209  ILE B O     1 
ATOM   4909  C  CB    . ILE B  2  211 ? 81.651  74.141  57.083  1.00 97.49  ? 209  ILE B CB    1 
ATOM   4910  C  CG1   . ILE B  2  211 ? 81.504  72.772  57.732  1.00 98.29  ? 209  ILE B CG1   1 
ATOM   4911  C  CG2   . ILE B  2  211 ? 81.501  74.005  55.580  1.00 96.95  ? 209  ILE B CG2   1 
ATOM   4912  C  CD1   . ILE B  2  211 ? 80.191  72.097  57.420  1.00 99.68  ? 209  ILE B CD1   1 
ATOM   4913  N  N     . GLY B  2  212 ? 83.689  76.014  55.462  1.00 99.71  ? 210  GLY B N     1 
ATOM   4914  C  CA    . GLY B  2  212 ? 83.889  77.231  54.701  1.00 101.30 ? 210  GLY B CA    1 
ATOM   4915  C  C     . GLY B  2  212 ? 84.996  78.041  55.352  1.00 103.05 ? 210  GLY B C     1 
ATOM   4916  O  O     . GLY B  2  212 ? 84.994  79.270  55.310  1.00 102.37 ? 210  GLY B O     1 
ATOM   4917  N  N     . VAL B  2  213 ? 85.949  77.336  55.958  1.00 105.37 ? 211  VAL B N     1 
ATOM   4918  C  CA    . VAL B  2  213 ? 87.079  77.961  56.641  1.00 107.09 ? 211  VAL B CA    1 
ATOM   4919  C  C     . VAL B  2  213 ? 88.365  77.139  56.476  1.00 108.42 ? 211  VAL B C     1 
ATOM   4920  O  O     . VAL B  2  213 ? 88.319  75.947  56.152  1.00 108.20 ? 211  VAL B O     1 
ATOM   4921  C  CB    . VAL B  2  213 ? 86.788  78.118  58.156  1.00 106.67 ? 211  VAL B CB    1 
ATOM   4922  C  CG1   . VAL B  2  213 ? 85.613  79.052  58.363  1.00 106.51 ? 211  VAL B CG1   1 
ATOM   4923  C  CG2   . VAL B  2  213 ? 86.498  76.750  58.784  1.00 105.81 ? 211  VAL B CG2   1 
ATOM   4924  N  N     . LYS B  2  214 ? 89.511  77.776  56.699  1.00 109.55 ? 212  LYS B N     1 
ATOM   4925  C  CA    . LYS B  2  214 ? 90.787  77.085  56.591  1.00 110.79 ? 212  LYS B CA    1 
ATOM   4926  C  C     . LYS B  2  214 ? 91.214  76.657  57.999  1.00 111.65 ? 212  LYS B C     1 
ATOM   4927  O  O     . LYS B  2  214 ? 91.103  77.431  58.956  1.00 111.57 ? 212  LYS B O     1 
ATOM   4928  C  CB    . LYS B  2  214 ? 91.842  78.006  55.964  1.00 111.61 ? 212  LYS B CB    1 
ATOM   4929  C  CG    . LYS B  2  214 ? 93.035  77.272  55.345  1.00 112.72 ? 212  LYS B CG    1 
ATOM   4930  C  CD    . LYS B  2  214 ? 93.767  76.430  56.382  1.00 113.46 ? 212  LYS B CD    1 
ATOM   4931  C  CE    . LYS B  2  214 ? 94.851  75.565  55.778  1.00 113.39 ? 212  LYS B CE    1 
ATOM   4932  N  NZ    . LYS B  2  214 ? 95.453  74.695  56.823  1.00 112.85 ? 212  LYS B NZ    1 
ATOM   4933  N  N     . HIS B  2  215 ? 91.696  75.420  58.109  1.00 112.28 ? 213  HIS B N     1 
ATOM   4934  C  CA    . HIS B  2  215 ? 92.134  74.837  59.376  1.00 112.55 ? 213  HIS B CA    1 
ATOM   4935  C  C     . HIS B  2  215 ? 93.092  75.715  60.171  1.00 113.32 ? 213  HIS B C     1 
ATOM   4936  O  O     . HIS B  2  215 ? 93.036  75.758  61.400  1.00 112.77 ? 213  HIS B O     1 
ATOM   4937  C  CB    . HIS B  2  215 ? 92.808  73.503  59.111  1.00 112.82 ? 213  HIS B CB    1 
ATOM   4938  C  CG    . HIS B  2  215 ? 92.789  72.582  60.284  1.00 113.90 ? 213  HIS B CG    1 
ATOM   4939  N  ND1   . HIS B  2  215 ? 91.650  71.919  60.683  1.00 114.10 ? 213  HIS B ND1   1 
ATOM   4940  C  CD2   . HIS B  2  215 ? 93.763  72.214  61.149  1.00 114.76 ? 213  HIS B CD2   1 
ATOM   4941  C  CE1   . HIS B  2  215 ? 91.923  71.180  61.743  1.00 114.48 ? 213  HIS B CE1   1 
ATOM   4942  N  NE2   . HIS B  2  215 ? 93.198  71.341  62.047  1.00 115.19 ? 213  HIS B NE2   1 
ATOM   4943  N  N     . SER B  2  216 ? 93.985  76.397  59.460  1.00 114.66 ? 214  SER B N     1 
ATOM   4944  C  CA    . SER B  2  216 ? 94.967  77.280  60.081  1.00 115.55 ? 214  SER B CA    1 
ATOM   4945  C  C     . SER B  2  216 ? 94.306  78.389  60.896  1.00 116.93 ? 214  SER B C     1 
ATOM   4946  O  O     . SER B  2  216 ? 94.797  78.767  61.961  1.00 116.74 ? 214  SER B O     1 
ATOM   4947  C  CB    . SER B  2  216 ? 95.872  77.886  59.003  1.00 114.68 ? 214  SER B CB    1 
ATOM   4948  O  OG    . SER B  2  216 ? 95.117  78.410  57.925  1.00 113.75 ? 214  SER B OG    1 
ATOM   4949  N  N     . ASP B  2  217 ? 93.188  78.900  60.387  1.00 118.91 ? 215  ASP B N     1 
ATOM   4950  C  CA    . ASP B  2  217 ? 92.446  79.965  61.053  1.00 120.22 ? 215  ASP B CA    1 
ATOM   4951  C  C     . ASP B  2  217 ? 91.668  79.410  62.236  1.00 121.72 ? 215  ASP B C     1 
ATOM   4952  O  O     . ASP B  2  217 ? 91.820  79.881  63.362  1.00 121.90 ? 215  ASP B O     1 
ATOM   4953  C  CB    . ASP B  2  217 ? 91.471  80.625  60.078  1.00 119.50 ? 215  ASP B CB    1 
ATOM   4954  C  CG    . ASP B  2  217 ? 92.138  81.064  58.794  1.00 119.01 ? 215  ASP B CG    1 
ATOM   4955  O  OD1   . ASP B  2  217 ? 93.108  81.846  58.863  1.00 118.66 ? 215  ASP B OD1   1 
ATOM   4956  O  OD2   . ASP B  2  217 ? 91.688  80.628  57.714  1.00 118.48 ? 215  ASP B OD2   1 
ATOM   4957  N  N     . LEU B  2  218 ? 90.836  78.404  61.973  1.00 123.37 ? 216  LEU B N     1 
ATOM   4958  C  CA    . LEU B  2  218 ? 90.023  77.790  63.020  1.00 125.37 ? 216  LEU B CA    1 
ATOM   4959  C  C     . LEU B  2  218 ? 90.893  77.309  64.170  1.00 126.84 ? 216  LEU B C     1 
ATOM   4960  O  O     . LEU B  2  218 ? 90.501  77.391  65.337  1.00 126.71 ? 216  LEU B O     1 
ATOM   4961  C  CB    . LEU B  2  218 ? 89.201  76.621  62.448  1.00 125.18 ? 216  LEU B CB    1 
ATOM   4962  C  CG    . LEU B  2  218 ? 88.197  75.912  63.373  1.00 124.94 ? 216  LEU B CG    1 
ATOM   4963  C  CD1   . LEU B  2  218 ? 87.382  76.934  64.148  1.00 124.91 ? 216  LEU B CD1   1 
ATOM   4964  C  CD2   . LEU B  2  218 ? 87.284  75.023  62.549  1.00 123.48 ? 216  LEU B CD2   1 
ATOM   4965  N  N     . LYS B  2  219 ? 92.079  76.812  63.838  1.00 128.86 ? 217  LYS B N     1 
ATOM   4966  C  CA    . LYS B  2  219 ? 92.997  76.334  64.857  1.00 130.86 ? 217  LYS B CA    1 
ATOM   4967  C  C     . LYS B  2  219 ? 93.485  77.516  65.683  1.00 131.00 ? 217  LYS B C     1 
ATOM   4968  O  O     . LYS B  2  219 ? 93.389  77.518  66.909  1.00 130.56 ? 217  LYS B O     1 
ATOM   4969  C  CB    . LYS B  2  219 ? 94.201  75.634  64.220  1.00 132.47 ? 217  LYS B CB    1 
ATOM   4970  C  CG    . LYS B  2  219 ? 95.212  75.130  65.254  1.00 134.91 ? 217  LYS B CG    1 
ATOM   4971  C  CD    . LYS B  2  219 ? 96.560  74.762  64.640  1.00 135.56 ? 217  LYS B CD    1 
ATOM   4972  C  CE    . LYS B  2  219 ? 97.581  74.455  65.732  1.00 135.95 ? 217  LYS B CE    1 
ATOM   4973  N  NZ    . LYS B  2  219 ? 98.964  74.332  65.199  1.00 136.02 ? 217  LYS B NZ    1 
ATOM   4974  N  N     . GLN B  2  220 ? 94.012  78.521  64.996  1.00 131.69 ? 218  GLN B N     1 
ATOM   4975  C  CA    . GLN B  2  220 ? 94.520  79.701  65.665  1.00 133.17 ? 218  GLN B CA    1 
ATOM   4976  C  C     . GLN B  2  220 ? 93.606  80.129  66.803  1.00 133.59 ? 218  GLN B C     1 
ATOM   4977  O  O     . GLN B  2  220 ? 94.037  80.227  67.950  1.00 133.72 ? 218  GLN B O     1 
ATOM   4978  C  CB    . GLN B  2  220 ? 94.669  80.845  64.665  1.00 134.35 ? 218  GLN B CB    1 
ATOM   4979  C  CG    . GLN B  2  220 ? 94.891  82.197  65.322  1.00 137.24 ? 218  GLN B CG    1 
ATOM   4980  C  CD    . GLN B  2  220 ? 94.973  83.336  64.322  1.00 138.91 ? 218  GLN B CD    1 
ATOM   4981  O  OE1   . GLN B  2  220 ? 94.133  83.451  63.425  1.00 140.03 ? 218  GLN B OE1   1 
ATOM   4982  N  NE2   . GLN B  2  220 ? 95.983  84.194  64.476  1.00 139.66 ? 218  GLN B NE2   1 
ATOM   4983  N  N     . VAL B  2  221 ? 92.338  80.364  66.481  1.00 134.40 ? 219  VAL B N     1 
ATOM   4984  C  CA    . VAL B  2  221 ? 91.358  80.805  67.469  1.00 134.96 ? 219  VAL B CA    1 
ATOM   4985  C  C     . VAL B  2  221 ? 91.266  79.849  68.648  1.00 135.17 ? 219  VAL B C     1 
ATOM   4986  O  O     . VAL B  2  221 ? 91.386  80.253  69.804  1.00 134.28 ? 219  VAL B O     1 
ATOM   4987  C  CB    . VAL B  2  221 ? 89.951  80.950  66.836  1.00 135.24 ? 219  VAL B CB    1 
ATOM   4988  C  CG1   . VAL B  2  221 ? 88.953  81.394  67.890  1.00 135.14 ? 219  VAL B CG1   1 
ATOM   4989  C  CG2   . VAL B  2  221 ? 89.989  81.959  65.693  1.00 134.82 ? 219  VAL B CG2   1 
ATOM   4990  N  N     . ALA B  2  222 ? 91.052  78.576  68.345  1.00 136.28 ? 220  ALA B N     1 
ATOM   4991  C  CA    . ALA B  2  222 ? 90.934  77.559  69.379  1.00 137.77 ? 220  ALA B CA    1 
ATOM   4992  C  C     . ALA B  2  222 ? 92.002  77.688  70.464  1.00 138.33 ? 220  ALA B C     1 
ATOM   4993  O  O     . ALA B  2  222 ? 91.685  77.709  71.655  1.00 138.49 ? 220  ALA B O     1 
ATOM   4994  C  CB    . ALA B  2  222 ? 90.999  76.172  68.748  1.00 138.15 ? 220  ALA B CB    1 
ATOM   4995  N  N     . GLU B  2  223 ? 93.264  77.783  70.054  1.00 138.78 ? 221  GLU B N     1 
ATOM   4996  C  CA    . GLU B  2  223 ? 94.364  77.880  71.011  1.00 138.49 ? 221  GLU B CA    1 
ATOM   4997  C  C     . GLU B  2  223 ? 94.613  79.280  71.557  1.00 137.39 ? 221  GLU B C     1 
ATOM   4998  O  O     . GLU B  2  223 ? 95.033  79.443  72.705  1.00 137.02 ? 221  GLU B O     1 
ATOM   4999  C  CB    . GLU B  2  223 ? 95.658  77.329  70.390  1.00 139.65 ? 221  GLU B CB    1 
ATOM   5000  C  CG    . GLU B  2  223 ? 96.164  78.067  69.154  1.00 140.49 ? 221  GLU B CG    1 
ATOM   5001  C  CD    . GLU B  2  223 ? 97.443  77.449  68.601  1.00 141.16 ? 221  GLU B CD    1 
ATOM   5002  O  OE1   . GLU B  2  223 ? 97.403  76.275  68.167  1.00 141.21 ? 221  GLU B OE1   1 
ATOM   5003  O  OE2   . GLU B  2  223 ? 98.489  78.134  68.607  1.00 141.33 ? 221  GLU B OE2   1 
ATOM   5004  N  N     . GLN B  2  224 ? 94.346  80.291  70.743  1.00 136.14 ? 222  GLN B N     1 
ATOM   5005  C  CA    . GLN B  2  224 ? 94.565  81.663  71.167  1.00 134.78 ? 222  GLN B CA    1 
ATOM   5006  C  C     . GLN B  2  224 ? 93.418  82.279  71.961  1.00 133.81 ? 222  GLN B C     1 
ATOM   5007  O  O     . GLN B  2  224 ? 93.572  83.373  72.503  1.00 133.81 ? 222  GLN B O     1 
ATOM   5008  C  CB    . GLN B  2  224 ? 94.877  82.536  69.950  1.00 134.89 ? 222  GLN B CB    1 
ATOM   5009  C  CG    . GLN B  2  224 ? 96.271  82.322  69.389  1.00 134.96 ? 222  GLN B CG    1 
ATOM   5010  C  CD    . GLN B  2  224 ? 96.494  83.063  68.089  1.00 135.06 ? 222  GLN B CD    1 
ATOM   5011  O  OE1   . GLN B  2  224 ? 96.026  84.190  67.913  1.00 134.38 ? 222  GLN B OE1   1 
ATOM   5012  N  NE2   . GLN B  2  224 ? 97.226  82.438  67.172  1.00 134.97 ? 222  GLN B NE2   1 
ATOM   5013  N  N     . PHE B  2  225 ? 92.278  81.591  72.045  1.00 132.54 ? 223  PHE B N     1 
ATOM   5014  C  CA    . PHE B  2  225 ? 91.136  82.134  72.782  1.00 130.57 ? 223  PHE B CA    1 
ATOM   5015  C  C     . PHE B  2  225 ? 90.482  81.215  73.806  1.00 129.48 ? 223  PHE B C     1 
ATOM   5016  O  O     . PHE B  2  225 ? 89.820  81.692  74.721  1.00 128.40 ? 223  PHE B O     1 
ATOM   5017  C  CB    . PHE B  2  225 ? 90.066  82.639  71.813  1.00 129.77 ? 223  PHE B CB    1 
ATOM   5018  C  CG    . PHE B  2  225 ? 90.410  83.948  71.153  1.00 129.25 ? 223  PHE B CG    1 
ATOM   5019  C  CD1   . PHE B  2  225 ? 91.390  84.016  70.166  1.00 129.03 ? 223  PHE B CD1   1 
ATOM   5020  C  CD2   . PHE B  2  225 ? 89.752  85.118  71.519  1.00 129.13 ? 223  PHE B CD2   1 
ATOM   5021  C  CE1   . PHE B  2  225 ? 91.709  85.230  69.550  1.00 128.50 ? 223  PHE B CE1   1 
ATOM   5022  C  CE2   . PHE B  2  225 ? 90.064  86.337  70.909  1.00 128.93 ? 223  PHE B CE2   1 
ATOM   5023  C  CZ    . PHE B  2  225 ? 91.044  86.391  69.922  1.00 128.29 ? 223  PHE B CZ    1 
ATOM   5024  N  N     . LEU B  2  226 ? 90.654  79.908  73.661  1.00 129.34 ? 224  LEU B N     1 
ATOM   5025  C  CA    . LEU B  2  226 ? 90.060  78.977  74.615  1.00 130.00 ? 224  LEU B CA    1 
ATOM   5026  C  C     . LEU B  2  226 ? 90.939  78.803  75.863  1.00 131.06 ? 224  LEU B C     1 
ATOM   5027  O  O     . LEU B  2  226 ? 92.167  78.810  75.772  1.00 131.09 ? 224  LEU B O     1 
ATOM   5028  C  CB    . LEU B  2  226 ? 89.788  77.626  73.934  1.00 128.40 ? 224  LEU B CB    1 
ATOM   5029  C  CG    . LEU B  2  226 ? 88.601  77.646  72.961  1.00 126.66 ? 224  LEU B CG    1 
ATOM   5030  C  CD1   . LEU B  2  226 ? 88.487  76.343  72.224  1.00 125.40 ? 224  LEU B CD1   1 
ATOM   5031  C  CD2   . LEU B  2  226 ? 87.330  77.904  73.730  1.00 126.00 ? 224  LEU B CD2   1 
ATOM   5032  N  N     . ASN B  2  227 ? 90.298  78.657  77.026  1.00 132.52 ? 225  ASN B N     1 
ATOM   5033  C  CA    . ASN B  2  227 ? 91.003  78.511  78.307  1.00 133.29 ? 225  ASN B CA    1 
ATOM   5034  C  C     . ASN B  2  227 ? 90.559  77.346  79.227  1.00 133.74 ? 225  ASN B C     1 
ATOM   5035  O  O     . ASN B  2  227 ? 91.410  76.681  79.823  1.00 134.11 ? 225  ASN B O     1 
ATOM   5036  C  CB    . ASN B  2  227 ? 90.920  79.835  79.084  1.00 133.04 ? 225  ASN B CB    1 
ATOM   5037  C  CG    . ASN B  2  227 ? 91.696  80.961  78.411  1.00 133.35 ? 225  ASN B CG    1 
ATOM   5038  O  OD1   . ASN B  2  227 ? 91.593  81.169  77.202  1.00 133.21 ? 225  ASN B OD1   1 
ATOM   5039  N  ND2   . ASN B  2  227 ? 92.469  81.698  79.200  1.00 133.47 ? 225  ASN B ND2   1 
ATOM   5040  N  N     . ILE B  2  228 ? 89.248  77.107  79.344  1.00 133.75 ? 226  ILE B N     1 
ATOM   5041  C  CA    . ILE B  2  228 ? 88.692  76.034  80.197  1.00 133.53 ? 226  ILE B CA    1 
ATOM   5042  C  C     . ILE B  2  228 ? 89.584  74.788  80.311  1.00 133.43 ? 226  ILE B C     1 
ATOM   5043  O  O     . ILE B  2  228 ? 90.276  74.421  79.360  1.00 133.80 ? 226  ILE B O     1 
ATOM   5044  C  CB    . ILE B  2  228 ? 87.277  75.584  79.695  1.00 133.32 ? 226  ILE B CB    1 
ATOM   5045  C  CG1   . ILE B  2  228 ? 86.727  74.450  80.575  1.00 132.65 ? 226  ILE B CG1   1 
ATOM   5046  C  CG2   . ILE B  2  228 ? 87.356  75.128  78.242  1.00 132.74 ? 226  ILE B CG2   1 
ATOM   5047  C  CD1   . ILE B  2  228 ? 86.394  74.858  81.997  1.00 131.65 ? 226  ILE B CD1   1 
ATOM   5048  N  N     . ARG B  2  229 ? 89.567  74.135  81.472  1.00 132.61 ? 227  ARG B N     1 
ATOM   5049  C  CA    . ARG B  2  229 ? 90.389  72.946  81.656  1.00 131.78 ? 227  ARG B CA    1 
ATOM   5050  C  C     . ARG B  2  229 ? 89.818  71.791  80.859  1.00 130.46 ? 227  ARG B C     1 
ATOM   5051  O  O     . ARG B  2  229 ? 88.785  71.932  80.205  1.00 130.41 ? 227  ARG B O     1 
ATOM   5052  C  CB    . ARG B  2  229 ? 90.469  72.543  83.130  1.00 132.88 ? 227  ARG B CB    1 
ATOM   5053  C  CG    . ARG B  2  229 ? 91.893  72.249  83.631  1.00 134.90 ? 227  ARG B CG    1 
ATOM   5054  C  CD    . ARG B  2  229 ? 92.723  71.405  82.648  1.00 136.76 ? 227  ARG B CD    1 
ATOM   5055  N  NE    . ARG B  2  229 ? 93.059  72.141  81.424  1.00 138.39 ? 227  ARG B NE    1 
ATOM   5056  C  CZ    . ARG B  2  229 ? 93.806  71.668  80.426  1.00 138.58 ? 227  ARG B CZ    1 
ATOM   5057  N  NH1   . ARG B  2  229 ? 94.316  70.444  80.487  1.00 139.07 ? 227  ARG B NH1   1 
ATOM   5058  N  NH2   . ARG B  2  229 ? 94.040  72.423  79.359  1.00 138.61 ? 227  ARG B NH2   1 
ATOM   5059  N  N     . SER B  2  230 ? 90.501  70.651  80.912  1.00 129.03 ? 228  SER B N     1 
ATOM   5060  C  CA    . SER B  2  230 ? 90.062  69.457  80.202  1.00 127.76 ? 228  SER B CA    1 
ATOM   5061  C  C     . SER B  2  230 ? 89.611  68.405  81.202  1.00 126.76 ? 228  SER B C     1 
ATOM   5062  O  O     . SER B  2  230 ? 89.390  68.708  82.376  1.00 126.63 ? 228  SER B O     1 
ATOM   5063  C  CB    . SER B  2  230 ? 91.193  68.893  79.330  1.00 127.65 ? 228  SER B CB    1 
ATOM   5064  O  OG    . SER B  2  230 ? 92.332  68.547  80.096  1.00 127.04 ? 228  SER B OG    1 
ATOM   5065  N  N     . GLY B  2  231 ? 89.474  67.171  80.732  1.00 125.74 ? 229  GLY B N     1 
ATOM   5066  C  CA    . GLY B  2  231 ? 89.052  66.097  81.606  1.00 124.90 ? 229  GLY B CA    1 
ATOM   5067  C  C     . GLY B  2  231 ? 87.553  66.113  81.762  1.00 124.43 ? 229  GLY B C     1 
ATOM   5068  O  O     . GLY B  2  231 ? 86.972  67.147  82.083  1.00 124.21 ? 229  GLY B O     1 
ATOM   5069  N  N     . ALA B  2  232 ? 86.934  64.957  81.540  1.00 124.48 ? 230  ALA B N     1 
ATOM   5070  C  CA    . ALA B  2  232 ? 85.484  64.802  81.630  1.00 124.35 ? 230  ALA B CA    1 
ATOM   5071  C  C     . ALA B  2  232 ? 84.847  65.381  82.888  1.00 123.96 ? 230  ALA B C     1 
ATOM   5072  O  O     . ALA B  2  232 ? 83.682  65.085  83.174  1.00 123.96 ? 230  ALA B O     1 
ATOM   5073  C  CB    . ALA B  2  232 ? 85.103  63.315  81.495  1.00 123.90 ? 230  ALA B CB    1 
ATOM   5074  N  N     . GLY B  2  233 ? 85.589  66.206  83.629  1.00 123.23 ? 231  GLY B N     1 
ATOM   5075  C  CA    . GLY B  2  233 ? 85.036  66.775  84.842  1.00 122.64 ? 231  GLY B CA    1 
ATOM   5076  C  C     . GLY B  2  233 ? 84.199  65.690  85.487  1.00 122.36 ? 231  GLY B C     1 
ATOM   5077  O  O     . GLY B  2  233 ? 84.732  64.660  85.900  1.00 123.09 ? 231  GLY B O     1 
ATOM   5078  N  N     . THR B  2  234 ? 82.888  65.897  85.556  1.00 121.19 ? 232  THR B N     1 
ATOM   5079  C  CA    . THR B  2  234 ? 82.014  64.888  86.133  1.00 119.55 ? 232  THR B CA    1 
ATOM   5080  C  C     . THR B  2  234 ? 81.585  63.954  85.009  1.00 118.05 ? 232  THR B C     1 
ATOM   5081  O  O     . THR B  2  234 ? 81.178  64.402  83.940  1.00 117.33 ? 232  THR B O     1 
ATOM   5082  C  CB    . THR B  2  234 ? 80.765  65.517  86.780  1.00 120.04 ? 232  THR B CB    1 
ATOM   5083  O  OG1   . THR B  2  234 ? 81.170  66.400  87.836  1.00 119.38 ? 232  THR B OG1   1 
ATOM   5084  C  CG2   . THR B  2  234 ? 79.852  64.427  87.349  1.00 119.46 ? 232  THR B CG2   1 
ATOM   5085  N  N     . SER B  2  235 ? 81.704  62.656  85.252  1.00 116.38 ? 233  SER B N     1 
ATOM   5086  C  CA    . SER B  2  235 ? 81.328  61.663  84.263  1.00 115.04 ? 233  SER B CA    1 
ATOM   5087  C  C     . SER B  2  235 ? 79.902  61.226  84.573  1.00 114.35 ? 233  SER B C     1 
ATOM   5088  O  O     . SER B  2  235 ? 79.415  61.448  85.680  1.00 114.48 ? 233  SER B O     1 
ATOM   5089  C  CB    . SER B  2  235 ? 82.285  60.475  84.337  1.00 115.03 ? 233  SER B CB    1 
ATOM   5090  O  OG    . SER B  2  235 ? 83.629  60.898  84.172  1.00 114.09 ? 233  SER B OG    1 
ATOM   5091  N  N     . SER B  2  236 ? 79.234  60.611  83.602  1.00 113.17 ? 234  SER B N     1 
ATOM   5092  C  CA    . SER B  2  236 ? 77.856  60.173  83.794  1.00 112.16 ? 234  SER B CA    1 
ATOM   5093  C  C     . SER B  2  236 ? 77.729  58.748  84.314  1.00 111.37 ? 234  SER B C     1 
ATOM   5094  O  O     . SER B  2  236 ? 78.414  57.841  83.846  1.00 111.13 ? 234  SER B O     1 
ATOM   5095  C  CB    . SER B  2  236 ? 77.075  60.303  82.483  1.00 112.66 ? 234  SER B CB    1 
ATOM   5096  O  OG    . SER B  2  236 ? 75.775  59.749  82.603  1.00 112.28 ? 234  SER B OG    1 
ATOM   5097  N  N     . ALA B  2  237 ? 76.836  58.562  85.280  1.00 110.81 ? 235  ALA B N     1 
ATOM   5098  C  CA    . ALA B  2  237 ? 76.598  57.251  85.869  1.00 110.94 ? 235  ALA B CA    1 
ATOM   5099  C  C     . ALA B  2  237 ? 75.911  56.335  84.864  1.00 110.89 ? 235  ALA B C     1 
ATOM   5100  O  O     . ALA B  2  237 ? 74.679  56.284  84.809  1.00 110.63 ? 235  ALA B O     1 
ATOM   5101  C  CB    . ALA B  2  237 ? 75.734  57.389  87.120  1.00 111.28 ? 235  ALA B CB    1 
ATOM   5102  N  N     . LYS B  2  238 ? 76.720  55.614  84.085  1.00 110.73 ? 236  LYS B N     1 
ATOM   5103  C  CA    . LYS B  2  238 ? 76.241  54.687  83.056  1.00 110.63 ? 236  LYS B CA    1 
ATOM   5104  C  C     . LYS B  2  238 ? 74.755  54.329  83.144  1.00 109.96 ? 236  LYS B C     1 
ATOM   5105  O  O     . LYS B  2  238 ? 74.242  53.978  84.211  1.00 109.80 ? 236  LYS B O     1 
ATOM   5106  C  CB    . LYS B  2  238 ? 77.076  53.410  83.078  1.00 111.29 ? 236  LYS B CB    1 
ATOM   5107  C  CG    . LYS B  2  238 ? 78.543  53.637  82.762  1.00 113.50 ? 236  LYS B CG    1 
ATOM   5108  C  CD    . LYS B  2  238 ? 79.302  52.314  82.694  1.00 115.78 ? 236  LYS B CD    1 
ATOM   5109  C  CE    . LYS B  2  238 ? 79.204  51.541  84.009  1.00 116.97 ? 236  LYS B CE    1 
ATOM   5110  N  NZ    . LYS B  2  238 ? 79.843  50.196  83.928  1.00 116.75 ? 236  LYS B NZ    1 
ATOM   5111  N  N     . ALA B  2  239 ? 74.078  54.412  82.001  1.00 108.43 ? 237  ALA B N     1 
ATOM   5112  C  CA    . ALA B  2  239 ? 72.651  54.134  81.915  1.00 106.05 ? 237  ALA B CA    1 
ATOM   5113  C  C     . ALA B  2  239 ? 72.267  52.697  82.239  1.00 104.40 ? 237  ALA B C     1 
ATOM   5114  O  O     . ALA B  2  239 ? 72.683  51.756  81.562  1.00 103.76 ? 237  ALA B O     1 
ATOM   5115  C  CB    . ALA B  2  239 ? 72.146  54.506  80.528  1.00 106.23 ? 237  ALA B CB    1 
ATOM   5116  N  N     . THR B  2  240 ? 71.472  52.535  83.286  1.00 102.71 ? 238  THR B N     1 
ATOM   5117  C  CA    . THR B  2  240 ? 71.006  51.212  83.674  1.00 101.86 ? 238  THR B CA    1 
ATOM   5118  C  C     . THR B  2  240 ? 69.706  51.022  82.917  1.00 101.03 ? 238  THR B C     1 
ATOM   5119  O  O     . THR B  2  240 ? 68.941  51.974  82.779  1.00 101.59 ? 238  THR B O     1 
ATOM   5120  C  CB    . THR B  2  240 ? 70.699  51.136  85.187  1.00 102.11 ? 238  THR B CB    1 
ATOM   5121  O  OG1   . THR B  2  240 ? 71.886  51.432  85.935  1.00 101.63 ? 238  THR B OG1   1 
ATOM   5122  C  CG2   . THR B  2  240 ? 70.181  49.742  85.562  1.00 100.26 ? 238  THR B CG2   1 
ATOM   5123  N  N     . TYR B  2  241 ? 69.451  49.815  82.419  1.00 99.70  ? 239  TYR B N     1 
ATOM   5124  C  CA    . TYR B  2  241 ? 68.211  49.564  81.688  1.00 98.58  ? 239  TYR B CA    1 
ATOM   5125  C  C     . TYR B  2  241 ? 67.101  49.129  82.652  1.00 98.04  ? 239  TYR B C     1 
ATOM   5126  O  O     . TYR B  2  241 ? 67.330  48.361  83.586  1.00 97.33  ? 239  TYR B O     1 
ATOM   5127  C  CB    . TYR B  2  241 ? 68.434  48.501  80.613  1.00 97.64  ? 239  TYR B CB    1 
ATOM   5128  C  CG    . TYR B  2  241 ? 67.299  48.359  79.618  1.00 97.09  ? 239  TYR B CG    1 
ATOM   5129  C  CD1   . TYR B  2  241 ? 67.470  48.711  78.280  1.00 97.08  ? 239  TYR B CD1   1 
ATOM   5130  C  CD2   . TYR B  2  241 ? 66.072  47.827  80.001  1.00 97.21  ? 239  TYR B CD2   1 
ATOM   5131  C  CE1   . TYR B  2  241 ? 66.449  48.530  77.345  1.00 96.98  ? 239  TYR B CE1   1 
ATOM   5132  C  CE2   . TYR B  2  241 ? 65.043  47.642  79.072  1.00 98.04  ? 239  TYR B CE2   1 
ATOM   5133  C  CZ    . TYR B  2  241 ? 65.242  47.993  77.747  1.00 98.03  ? 239  TYR B CZ    1 
ATOM   5134  O  OH    . TYR B  2  241 ? 64.241  47.786  76.827  1.00 98.77  ? 239  TYR B OH    1 
ATOM   5135  N  N     . TRP B  2  242 ? 65.897  49.639  82.422  1.00 98.10  ? 240  TRP B N     1 
ATOM   5136  C  CA    . TRP B  2  242 ? 64.754  49.323  83.269  1.00 98.56  ? 240  TRP B CA    1 
ATOM   5137  C  C     . TRP B  2  242 ? 63.734  48.451  82.554  1.00 98.66  ? 240  TRP B C     1 
ATOM   5138  O  O     . TRP B  2  242 ? 63.430  47.347  83.009  1.00 99.49  ? 240  TRP B O     1 
ATOM   5139  C  CB    . TRP B  2  242 ? 64.081  50.619  83.755  1.00 98.84  ? 240  TRP B CB    1 
ATOM   5140  C  CG    . TRP B  2  242 ? 62.834  50.416  84.599  1.00 98.58  ? 240  TRP B CG    1 
ATOM   5141  C  CD1   . TRP B  2  242 ? 62.547  49.347  85.401  1.00 98.15  ? 240  TRP B CD1   1 
ATOM   5142  C  CD2   . TRP B  2  242 ? 61.741  51.336  84.755  1.00 98.97  ? 240  TRP B CD2   1 
ATOM   5143  N  NE1   . TRP B  2  242 ? 61.347  49.542  86.045  1.00 98.60  ? 240  TRP B NE1   1 
ATOM   5144  C  CE2   . TRP B  2  242 ? 60.830  50.754  85.669  1.00 98.83  ? 240  TRP B CE2   1 
ATOM   5145  C  CE3   . TRP B  2  242 ? 61.443  52.596  84.212  1.00 99.29  ? 240  TRP B CE3   1 
ATOM   5146  C  CZ2   . TRP B  2  242 ? 59.638  51.388  86.053  1.00 98.47  ? 240  TRP B CZ2   1 
ATOM   5147  C  CZ3   . TRP B  2  242 ? 60.255  53.228  84.594  1.00 98.63  ? 240  TRP B CZ3   1 
ATOM   5148  C  CH2   . TRP B  2  242 ? 59.369  52.620  85.507  1.00 98.55  ? 240  TRP B CH2   1 
ATOM   5149  N  N     . GLY B  2  243 ? 63.212  48.942  81.433  1.00 97.94  ? 241  GLY B N     1 
ATOM   5150  C  CA    . GLY B  2  243 ? 62.215  48.187  80.694  1.00 96.29  ? 241  GLY B CA    1 
ATOM   5151  C  C     . GLY B  2  243 ? 60.854  48.565  81.243  1.00 95.05  ? 241  GLY B C     1 
ATOM   5152  O  O     . GLY B  2  243 ? 60.017  47.702  81.523  1.00 94.50  ? 241  GLY B O     1 
ATOM   5153  N  N     . GLY B  2  244 ? 60.652  49.873  81.398  1.00 93.45  ? 242  GLY B N     1 
ATOM   5154  C  CA    . GLY B  2  244 ? 59.410  50.395  81.930  1.00 91.39  ? 242  GLY B CA    1 
ATOM   5155  C  C     . GLY B  2  244 ? 58.239  50.373  80.972  1.00 90.26  ? 242  GLY B C     1 
ATOM   5156  O  O     . GLY B  2  244 ? 58.342  49.876  79.851  1.00 90.08  ? 242  GLY B O     1 
ATOM   5157  N  N     . GLU B  2  245 ? 57.124  50.939  81.423  1.00 89.36  ? 243  GLU B N     1 
ATOM   5158  C  CA    . GLU B  2  245 ? 55.889  50.987  80.649  1.00 87.67  ? 243  GLU B CA    1 
ATOM   5159  C  C     . GLU B  2  245 ? 55.087  52.205  81.121  1.00 86.02  ? 243  GLU B C     1 
ATOM   5160  O  O     . GLU B  2  245 ? 54.397  52.139  82.141  1.00 86.23  ? 243  GLU B O     1 
ATOM   5161  C  CB    . GLU B  2  245 ? 55.094  49.699  80.914  1.00 89.48  ? 243  GLU B CB    1 
ATOM   5162  C  CG    . GLU B  2  245 ? 54.156  49.228  79.810  1.00 91.89  ? 243  GLU B CG    1 
ATOM   5163  C  CD    . GLU B  2  245 ? 53.272  48.046  80.247  1.00 94.22  ? 243  GLU B CD    1 
ATOM   5164  O  OE1   . GLU B  2  245 ? 53.807  47.025  80.740  1.00 94.44  ? 243  GLU B OE1   1 
ATOM   5165  O  OE2   . GLU B  2  245 ? 52.034  48.137  80.090  1.00 95.21  ? 243  GLU B OE2   1 
ATOM   5166  N  N     . ILE B  2  246 ? 55.187  53.317  80.396  1.00 83.95  ? 244  ILE B N     1 
ATOM   5167  C  CA    . ILE B  2  246 ? 54.446  54.535  80.755  1.00 82.05  ? 244  ILE B CA    1 
ATOM   5168  C  C     . ILE B  2  246 ? 53.260  54.792  79.817  1.00 81.99  ? 244  ILE B C     1 
ATOM   5169  O  O     . ILE B  2  246 ? 53.427  54.889  78.598  1.00 81.34  ? 244  ILE B O     1 
ATOM   5170  C  CB    . ILE B  2  246 ? 55.336  55.772  80.705  1.00 79.88  ? 244  ILE B CB    1 
ATOM   5171  C  CG1   . ILE B  2  246 ? 56.502  55.624  81.675  1.00 77.92  ? 244  ILE B CG1   1 
ATOM   5172  C  CG2   . ILE B  2  246 ? 54.512  56.988  81.033  1.00 79.77  ? 244  ILE B CG2   1 
ATOM   5173  C  CD1   . ILE B  2  246 ? 57.531  56.735  81.556  1.00 76.08  ? 244  ILE B CD1   1 
ATOM   5174  N  N     . ARG B  2  247 ? 52.066  54.920  80.391  1.00 81.85  ? 245  ARG B N     1 
ATOM   5175  C  CA    . ARG B  2  247 ? 50.849  55.148  79.608  1.00 80.90  ? 245  ARG B CA    1 
ATOM   5176  C  C     . ARG B  2  247 ? 50.191  56.485  79.967  1.00 80.08  ? 245  ARG B C     1 
ATOM   5177  O  O     . ARG B  2  247 ? 49.900  56.756  81.135  1.00 79.77  ? 245  ARG B O     1 
ATOM   5178  C  CB    . ARG B  2  247 ? 49.863  54.001  79.847  1.00 79.64  ? 245  ARG B CB    1 
ATOM   5179  C  CG    . ARG B  2  247 ? 50.442  52.633  79.547  1.00 80.00  ? 245  ARG B CG    1 
ATOM   5180  C  CD    . ARG B  2  247 ? 49.562  51.528  80.101  1.00 81.79  ? 245  ARG B CD    1 
ATOM   5181  N  NE    . ARG B  2  247 ? 48.288  51.414  79.399  1.00 83.31  ? 245  ARG B NE    1 
ATOM   5182  C  CZ    . ARG B  2  247 ? 48.153  50.930  78.169  1.00 83.31  ? 245  ARG B CZ    1 
ATOM   5183  N  NH1   . ARG B  2  247 ? 49.223  50.508  77.496  1.00 83.72  ? 245  ARG B NH1   1 
ATOM   5184  N  NH2   . ARG B  2  247 ? 46.947  50.870  77.618  1.00 82.22  ? 245  ARG B NH2   1 
ATOM   5185  N  N     . GLU B  2  248 ? 49.947  57.315  78.956  1.00 78.93  ? 246  GLU B N     1 
ATOM   5186  C  CA    . GLU B  2  248 ? 49.346  58.623  79.183  1.00 76.69  ? 246  GLU B CA    1 
ATOM   5187  C  C     . GLU B  2  248 ? 47.985  58.778  78.533  1.00 75.06  ? 246  GLU B C     1 
ATOM   5188  O  O     . GLU B  2  248 ? 47.883  59.117  77.359  1.00 73.29  ? 246  GLU B O     1 
ATOM   5189  C  CB    . GLU B  2  248 ? 50.274  59.706  78.665  1.00 77.77  ? 246  GLU B CB    1 
ATOM   5190  C  CG    . GLU B  2  248 ? 49.854  61.088  79.067  1.00 81.47  ? 246  GLU B CG    1 
ATOM   5191  C  CD    . GLU B  2  248 ? 50.682  62.161  78.391  1.00 83.84  ? 246  GLU B CD    1 
ATOM   5192  O  OE1   . GLU B  2  248 ? 51.927  62.146  78.558  1.00 82.61  ? 246  GLU B OE1   1 
ATOM   5193  O  OE2   . GLU B  2  248 ? 50.078  63.016  77.694  1.00 85.70  ? 246  GLU B OE2   1 
ATOM   5194  N  N     . GLN B  2  249 ? 46.942  58.527  79.314  1.00 74.70  ? 247  GLN B N     1 
ATOM   5195  C  CA    . GLN B  2  249 ? 45.570  58.632  78.844  1.00 74.79  ? 247  GLN B CA    1 
ATOM   5196  C  C     . GLN B  2  249 ? 45.259  60.110  78.727  1.00 77.06  ? 247  GLN B C     1 
ATOM   5197  O  O     . GLN B  2  249 ? 45.435  60.850  79.695  1.00 77.92  ? 247  GLN B O     1 
ATOM   5198  C  CB    . GLN B  2  249 ? 44.641  57.984  79.859  1.00 72.46  ? 247  GLN B CB    1 
ATOM   5199  C  CG    . GLN B  2  249 ? 43.170  58.108  79.550  1.00 71.14  ? 247  GLN B CG    1 
ATOM   5200  C  CD    . GLN B  2  249 ? 42.778  57.504  78.219  1.00 69.96  ? 247  GLN B CD    1 
ATOM   5201  O  OE1   . GLN B  2  249 ? 43.155  56.380  77.891  1.00 69.11  ? 247  GLN B OE1   1 
ATOM   5202  N  NE2   . GLN B  2  249 ? 42.000  58.250  77.449  1.00 70.79  ? 247  GLN B NE2   1 
ATOM   5203  N  N     . ASN B  2  250 ? 44.804  60.557  77.559  1.00 78.13  ? 248  ASN B N     1 
ATOM   5204  C  CA    . ASN B  2  250 ? 44.514  61.972  77.416  1.00 79.38  ? 248  ASN B CA    1 
ATOM   5205  C  C     . ASN B  2  250 ? 43.379  62.334  76.465  1.00 82.70  ? 248  ASN B C     1 
ATOM   5206  O  O     . ASN B  2  250 ? 43.144  63.518  76.193  1.00 83.97  ? 248  ASN B O     1 
ATOM   5207  C  CB    . ASN B  2  250 ? 45.798  62.718  77.033  1.00 75.76  ? 248  ASN B CB    1 
ATOM   5208  C  CG    . ASN B  2  250 ? 46.242  62.437  75.620  1.00 72.98  ? 248  ASN B CG    1 
ATOM   5209  O  OD1   . ASN B  2  250 ? 47.381  62.729  75.246  1.00 70.77  ? 248  ASN B OD1   1 
ATOM   5210  N  ND2   . ASN B  2  250 ? 45.343  61.886  74.817  1.00 71.27  ? 248  ASN B ND2   1 
ATOM   5211  N  N     . GLY B  2  251 ? 42.668  61.330  75.964  1.00 85.20  ? 249  GLY B N     1 
ATOM   5212  C  CA    . GLY B  2  251 ? 41.558  61.614  75.069  1.00 89.50  ? 249  GLY B CA    1 
ATOM   5213  C  C     . GLY B  2  251 ? 41.922  61.785  73.604  1.00 92.57  ? 249  GLY B C     1 
ATOM   5214  O  O     . GLY B  2  251 ? 41.253  61.204  72.748  1.00 94.21  ? 249  GLY B O     1 
ATOM   5215  N  N     . HIS B  2  252 ? 42.952  62.587  73.314  1.00 94.44  ? 250  HIS B N     1 
ATOM   5216  C  CA    . HIS B  2  252 ? 43.438  62.833  71.944  1.00 95.41  ? 250  HIS B CA    1 
ATOM   5217  C  C     . HIS B  2  252 ? 43.191  61.582  71.064  1.00 94.40  ? 250  HIS B C     1 
ATOM   5218  O  O     . HIS B  2  252 ? 43.777  60.525  71.295  1.00 94.57  ? 250  HIS B O     1 
ATOM   5219  C  CB    . HIS B  2  252 ? 44.936  63.179  72.022  1.00 98.82  ? 250  HIS B CB    1 
ATOM   5220  C  CG    . HIS B  2  252 ? 45.589  63.456  70.698  1.00 104.10 ? 250  HIS B CG    1 
ATOM   5221  N  ND1   . HIS B  2  252 ? 45.507  62.595  69.622  1.00 105.39 ? 250  HIS B ND1   1 
ATOM   5222  C  CD2   . HIS B  2  252 ? 46.403  64.467  70.304  1.00 105.91 ? 250  HIS B CD2   1 
ATOM   5223  C  CE1   . HIS B  2  252 ? 46.243  63.062  68.626  1.00 105.82 ? 250  HIS B CE1   1 
ATOM   5224  N  NE2   . HIS B  2  252 ? 46.798  64.196  69.015  1.00 106.14 ? 250  HIS B NE2   1 
ATOM   5225  N  N     . SER B  2  253 ? 42.313  61.708  70.068  1.00 92.89  ? 251  SER B N     1 
ATOM   5226  C  CA    . SER B  2  253 ? 41.948  60.593  69.172  1.00 89.99  ? 251  SER B CA    1 
ATOM   5227  C  C     . SER B  2  253 ? 43.091  59.696  68.665  1.00 86.81  ? 251  SER B C     1 
ATOM   5228  O  O     . SER B  2  253 ? 43.000  58.472  68.718  1.00 86.18  ? 251  SER B O     1 
ATOM   5229  C  CB    . SER B  2  253 ? 41.143  61.125  67.967  1.00 90.98  ? 251  SER B CB    1 
ATOM   5230  O  OG    . SER B  2  253 ? 41.889  62.054  67.189  1.00 92.55  ? 251  SER B OG    1 
ATOM   5231  N  N     . LEU B  2  254 ? 44.160  60.291  68.161  1.00 82.88  ? 252  LEU B N     1 
ATOM   5232  C  CA    . LEU B  2  254 ? 45.263  59.489  67.672  1.00 79.87  ? 252  LEU B CA    1 
ATOM   5233  C  C     . LEU B  2  254 ? 46.131  58.936  68.803  1.00 79.28  ? 252  LEU B C     1 
ATOM   5234  O  O     . LEU B  2  254 ? 46.560  59.666  69.703  1.00 80.14  ? 252  LEU B O     1 
ATOM   5235  C  CB    . LEU B  2  254 ? 46.130  60.311  66.722  1.00 78.96  ? 252  LEU B CB    1 
ATOM   5236  C  CG    . LEU B  2  254 ? 45.557  60.671  65.357  1.00 75.73  ? 252  LEU B CG    1 
ATOM   5237  C  CD1   . LEU B  2  254 ? 46.596  61.425  64.563  1.00 74.66  ? 252  LEU B CD1   1 
ATOM   5238  C  CD2   . LEU B  2  254 ? 45.160  59.408  64.637  1.00 74.89  ? 252  LEU B CD2   1 
ATOM   5239  N  N     . VAL B  2  255 ? 46.398  57.639  68.739  1.00 77.29  ? 253  VAL B N     1 
ATOM   5240  C  CA    . VAL B  2  255 ? 47.218  56.965  69.734  1.00 74.80  ? 253  VAL B CA    1 
ATOM   5241  C  C     . VAL B  2  255 ? 48.660  56.799  69.271  1.00 73.87  ? 253  VAL B C     1 
ATOM   5242  O  O     . VAL B  2  255 ? 48.927  56.090  68.298  1.00 73.63  ? 253  VAL B O     1 
ATOM   5243  C  CB    . VAL B  2  255 ? 46.663  55.560  70.035  1.00 74.39  ? 253  VAL B CB    1 
ATOM   5244  C  CG1   . VAL B  2  255 ? 47.660  54.761  70.851  1.00 72.83  ? 253  VAL B CG1   1 
ATOM   5245  C  CG2   . VAL B  2  255 ? 45.353  55.674  70.765  1.00 74.25  ? 253  VAL B CG2   1 
ATOM   5246  N  N     . HIS B  2  256 ? 49.589  57.454  69.956  1.00 72.48  ? 254  HIS B N     1 
ATOM   5247  C  CA    . HIS B  2  256 ? 50.998  57.302  69.622  1.00 72.03  ? 254  HIS B CA    1 
ATOM   5248  C  C     . HIS B  2  256 ? 51.569  56.237  70.538  1.00 72.35  ? 254  HIS B C     1 
ATOM   5249  O  O     . HIS B  2  256 ? 51.262  56.205  71.728  1.00 71.54  ? 254  HIS B O     1 
ATOM   5250  C  CB    . HIS B  2  256 ? 51.755  58.597  69.828  1.00 71.91  ? 254  HIS B CB    1 
ATOM   5251  C  CG    . HIS B  2  256 ? 51.474  59.628  68.785  1.00 72.03  ? 254  HIS B CG    1 
ATOM   5252  N  ND1   . HIS B  2  256 ? 52.417  60.032  67.865  1.00 71.19  ? 254  HIS B ND1   1 
ATOM   5253  C  CD2   . HIS B  2  256 ? 50.357  60.343  68.518  1.00 72.68  ? 254  HIS B CD2   1 
ATOM   5254  C  CE1   . HIS B  2  256 ? 51.896  60.954  67.078  1.00 70.97  ? 254  HIS B CE1   1 
ATOM   5255  N  NE2   . HIS B  2  256 ? 50.647  61.162  67.453  1.00 73.19  ? 254  HIS B NE2   1 
ATOM   5256  N  N     . ALA B  2  257 ? 52.392  55.360  69.975  1.00 73.41  ? 255  ALA B N     1 
ATOM   5257  C  CA    . ALA B  2  257 ? 52.991  54.271  70.735  1.00 74.21  ? 255  ALA B CA    1 
ATOM   5258  C  C     . ALA B  2  257 ? 54.395  53.975  70.238  1.00 75.06  ? 255  ALA B C     1 
ATOM   5259  O  O     . ALA B  2  257 ? 54.719  54.172  69.067  1.00 75.48  ? 255  ALA B O     1 
ATOM   5260  C  CB    . ALA B  2  257 ? 52.126  53.025  70.621  1.00 72.28  ? 255  ALA B CB    1 
ATOM   5261  N  N     . ALA B  2  258 ? 55.237  53.507  71.140  1.00 76.00  ? 256  ALA B N     1 
ATOM   5262  C  CA    . ALA B  2  258 ? 56.596  53.181  70.771  1.00 78.75  ? 256  ALA B CA    1 
ATOM   5263  C  C     . ALA B  2  258 ? 57.084  52.033  71.642  1.00 81.07  ? 256  ALA B C     1 
ATOM   5264  O  O     . ALA B  2  258 ? 57.139  52.155  72.866  1.00 82.18  ? 256  ALA B O     1 
ATOM   5265  C  CB    . ALA B  2  258 ? 57.483  54.392  70.947  1.00 78.17  ? 256  ALA B CB    1 
ATOM   5266  N  N     . VAL B  2  259 ? 57.414  50.910  71.006  1.00 83.16  ? 257  VAL B N     1 
ATOM   5267  C  CA    . VAL B  2  259 ? 57.907  49.739  71.719  1.00 83.92  ? 257  VAL B CA    1 
ATOM   5268  C  C     . VAL B  2  259 ? 59.362  49.516  71.335  1.00 85.01  ? 257  VAL B C     1 
ATOM   5269  O  O     . VAL B  2  259 ? 59.692  49.451  70.154  1.00 85.14  ? 257  VAL B O     1 
ATOM   5270  C  CB    . VAL B  2  259 ? 57.085  48.494  71.373  1.00 83.00  ? 257  VAL B CB    1 
ATOM   5271  C  CG1   . VAL B  2  259 ? 57.678  47.287  72.056  1.00 83.68  ? 257  VAL B CG1   1 
ATOM   5272  C  CG2   . VAL B  2  259 ? 55.649  48.686  71.825  1.00 82.72  ? 257  VAL B CG2   1 
ATOM   5273  N  N     . VAL B  2  260 ? 60.232  49.410  72.334  1.00 86.44  ? 258  VAL B N     1 
ATOM   5274  C  CA    . VAL B  2  260 ? 61.647  49.220  72.069  1.00 87.83  ? 258  VAL B CA    1 
ATOM   5275  C  C     . VAL B  2  260 ? 62.321  48.251  73.022  1.00 89.64  ? 258  VAL B C     1 
ATOM   5276  O  O     . VAL B  2  260 ? 61.716  47.752  73.971  1.00 88.64  ? 258  VAL B O     1 
ATOM   5277  C  CB    . VAL B  2  260 ? 62.411  50.561  72.144  1.00 87.01  ? 258  VAL B CB    1 
ATOM   5278  C  CG1   . VAL B  2  260 ? 61.810  51.557  71.176  1.00 86.56  ? 258  VAL B CG1   1 
ATOM   5279  C  CG2   . VAL B  2  260 ? 62.368  51.103  73.557  1.00 85.75  ? 258  VAL B CG2   1 
ATOM   5280  N  N     . THR B  2  261 ? 63.592  47.995  72.735  1.00 92.62  ? 259  THR B N     1 
ATOM   5281  C  CA    . THR B  2  261 ? 64.441  47.117  73.530  1.00 95.57  ? 259  THR B CA    1 
ATOM   5282  C  C     . THR B  2  261 ? 65.807  47.782  73.517  1.00 96.77  ? 259  THR B C     1 
ATOM   5283  O  O     . THR B  2  261 ? 66.041  48.712  72.735  1.00 96.76  ? 259  THR B O     1 
ATOM   5284  C  CB    . THR B  2  261 ? 64.592  45.718  72.895  1.00 95.88  ? 259  THR B CB    1 
ATOM   5285  O  OG1   . THR B  2  261 ? 63.310  45.091  72.787  1.00 96.80  ? 259  THR B OG1   1 
ATOM   5286  C  CG2   . THR B  2  261 ? 65.492  44.847  73.753  1.00 97.07  ? 259  THR B CG2   1 
ATOM   5287  N  N     . GLU B  2  262 ? 66.708  47.327  74.378  1.00 98.01  ? 260  GLU B N     1 
ATOM   5288  C  CA    . GLU B  2  262 ? 68.038  47.907  74.391  1.00 99.61  ? 260  GLU B CA    1 
ATOM   5289  C  C     . GLU B  2  262 ? 68.624  47.627  73.018  1.00 99.95  ? 260  GLU B C     1 
ATOM   5290  O  O     . GLU B  2  262 ? 68.361  46.578  72.424  1.00 99.37  ? 260  GLU B O     1 
ATOM   5291  C  CB    . GLU B  2  262 ? 68.890  47.265  75.478  1.00 100.94 ? 260  GLU B CB    1 
ATOM   5292  C  CG    . GLU B  2  262 ? 70.151  48.041  75.805  1.00 102.27 ? 260  GLU B CG    1 
ATOM   5293  C  CD    . GLU B  2  262 ? 70.554  47.859  77.252  1.00 103.76 ? 260  GLU B CD    1 
ATOM   5294  O  OE1   . GLU B  2  262 ? 70.775  46.695  77.659  1.00 104.19 ? 260  GLU B OE1   1 
ATOM   5295  O  OE2   . GLU B  2  262 ? 70.636  48.877  77.983  1.00 103.87 ? 260  GLU B OE2   1 
ATOM   5296  N  N     . GLY B  2  263 ? 69.411  48.564  72.506  1.00 100.50 ? 261  GLY B N     1 
ATOM   5297  C  CA    . GLY B  2  263 ? 69.979  48.376  71.184  1.00 100.73 ? 261  GLY B CA    1 
ATOM   5298  C  C     . GLY B  2  263 ? 71.485  48.337  71.132  1.00 100.55 ? 261  GLY B C     1 
ATOM   5299  O  O     . GLY B  2  263 ? 72.116  47.619  71.898  1.00 100.56 ? 261  GLY B O     1 
ATOM   5300  N  N     . ALA B  2  264 ? 72.059  49.120  70.226  1.00 101.26 ? 262  ALA B N     1 
ATOM   5301  C  CA    . ALA B  2  264 ? 73.506  49.163  70.051  1.00 102.06 ? 262  ALA B CA    1 
ATOM   5302  C  C     . ALA B  2  264 ? 74.083  50.522  70.382  1.00 102.05 ? 262  ALA B C     1 
ATOM   5303  O  O     . ALA B  2  264 ? 73.470  51.545  70.101  1.00 102.78 ? 262  ALA B O     1 
ATOM   5304  C  CB    . ALA B  2  264 ? 73.859  48.795  68.622  1.00 102.64 ? 262  ALA B CB    1 
ATOM   5305  N  N     . ALA B  2  265 ? 75.270  50.534  70.968  1.00 102.17 ? 263  ALA B N     1 
ATOM   5306  C  CA    . ALA B  2  265 ? 75.899  51.792  71.321  1.00 103.11 ? 263  ALA B CA    1 
ATOM   5307  C  C     . ALA B  2  265 ? 76.546  52.420  70.102  1.00 103.98 ? 263  ALA B C     1 
ATOM   5308  O  O     . ALA B  2  265 ? 76.436  51.906  68.992  1.00 102.88 ? 263  ALA B O     1 
ATOM   5309  C  CB    . ALA B  2  265 ? 76.938  51.571  72.404  1.00 102.94 ? 263  ALA B CB    1 
ATOM   5310  N  N     . VAL B  2  266 ? 77.213  53.545  70.324  1.00 106.11 ? 264  VAL B N     1 
ATOM   5311  C  CA    . VAL B  2  266 ? 77.905  54.255  69.261  1.00 109.12 ? 264  VAL B CA    1 
ATOM   5312  C  C     . VAL B  2  266 ? 79.072  53.377  68.806  1.00 111.17 ? 264  VAL B C     1 
ATOM   5313  O  O     . VAL B  2  266 ? 79.529  52.509  69.556  1.00 112.64 ? 264  VAL B O     1 
ATOM   5314  C  CB    . VAL B  2  266 ? 78.460  55.606  69.777  1.00 109.09 ? 264  VAL B CB    1 
ATOM   5315  C  CG1   . VAL B  2  266 ? 79.101  56.388  68.635  1.00 108.71 ? 264  VAL B CG1   1 
ATOM   5316  C  CG2   . VAL B  2  266 ? 77.344  56.410  70.426  1.00 108.70 ? 264  VAL B CG2   1 
ATOM   5317  N  N     . GLY B  2  267 ? 79.549  53.593  67.582  1.00 112.27 ? 265  GLY B N     1 
ATOM   5318  C  CA    . GLY B  2  267 ? 80.663  52.806  67.078  1.00 113.16 ? 265  GLY B CA    1 
ATOM   5319  C  C     . GLY B  2  267 ? 80.295  51.360  66.802  1.00 113.87 ? 265  GLY B C     1 
ATOM   5320  O  O     . GLY B  2  267 ? 80.425  50.899  65.666  1.00 113.84 ? 265  GLY B O     1 
ATOM   5321  N  N     . SER B  2  268 ? 79.843  50.653  67.841  1.00 114.17 ? 266  SER B N     1 
ATOM   5322  C  CA    . SER B  2  268 ? 79.437  49.249  67.743  1.00 114.72 ? 266  SER B CA    1 
ATOM   5323  C  C     . SER B  2  268 ? 79.035  48.834  66.339  1.00 115.94 ? 266  SER B C     1 
ATOM   5324  O  O     . SER B  2  268 ? 78.122  49.417  65.750  1.00 116.59 ? 266  SER B O     1 
ATOM   5325  C  CB    . SER B  2  268 ? 78.257  48.964  68.671  1.00 113.63 ? 266  SER B CB    1 
ATOM   5326  O  OG    . SER B  2  268 ? 77.636  47.734  68.322  1.00 111.53 ? 266  SER B OG    1 
ATOM   5327  N  N     . ALA B  2  269 ? 79.711  47.825  65.803  1.00 116.85 ? 267  ALA B N     1 
ATOM   5328  C  CA    . ALA B  2  269 ? 79.380  47.351  64.466  1.00 117.34 ? 267  ALA B CA    1 
ATOM   5329  C  C     . ALA B  2  269 ? 77.960  46.796  64.517  1.00 117.52 ? 267  ALA B C     1 
ATOM   5330  O  O     . ALA B  2  269 ? 77.205  46.913  63.547  1.00 118.35 ? 267  ALA B O     1 
ATOM   5331  C  CB    . ALA B  2  269 ? 80.363  46.276  64.020  1.00 117.36 ? 267  ALA B CB    1 
ATOM   5332  N  N     . GLU B  2  270 ? 77.599  46.208  65.659  1.00 116.53 ? 268  GLU B N     1 
ATOM   5333  C  CA    . GLU B  2  270 ? 76.264  45.650  65.854  1.00 115.40 ? 268  GLU B CA    1 
ATOM   5334  C  C     . GLU B  2  270 ? 75.189  46.686  65.515  1.00 114.93 ? 268  GLU B C     1 
ATOM   5335  O  O     . GLU B  2  270 ? 74.092  46.342  65.063  1.00 114.75 ? 268  GLU B O     1 
ATOM   5336  C  CB    . GLU B  2  270 ? 76.088  45.199  67.303  1.00 115.16 ? 268  GLU B CB    1 
ATOM   5337  C  CG    . GLU B  2  270 ? 74.632  45.025  67.697  1.00 115.77 ? 268  GLU B CG    1 
ATOM   5338  C  CD    . GLU B  2  270 ? 74.462  44.662  69.154  1.00 116.89 ? 268  GLU B CD    1 
ATOM   5339  O  OE1   . GLU B  2  270 ? 75.236  45.191  69.988  1.00 117.35 ? 268  GLU B OE1   1 
ATOM   5340  O  OE2   . GLU B  2  270 ? 73.549  43.861  69.464  1.00 116.60 ? 268  GLU B OE2   1 
ATOM   5341  N  N     . ALA B  2  271 ? 75.517  47.956  65.747  1.00 113.68 ? 269  ALA B N     1 
ATOM   5342  C  CA    . ALA B  2  271 ? 74.605  49.057  65.475  1.00 111.58 ? 269  ALA B CA    1 
ATOM   5343  C  C     . ALA B  2  271 ? 74.278  49.117  63.995  1.00 110.46 ? 269  ALA B C     1 
ATOM   5344  O  O     . ALA B  2  271 ? 73.148  49.434  63.625  1.00 111.00 ? 269  ALA B O     1 
ATOM   5345  C  CB    . ALA B  2  271 ? 75.224  50.364  65.923  1.00 111.38 ? 269  ALA B CB    1 
ATOM   5346  N  N     . ASN B  2  272 ? 75.274  48.814  63.160  1.00 108.13 ? 270  ASN B N     1 
ATOM   5347  C  CA    . ASN B  2  272 ? 75.112  48.818  61.707  1.00 106.17 ? 270  ASN B CA    1 
ATOM   5348  C  C     . ASN B  2  272 ? 74.057  47.816  61.251  1.00 105.24 ? 270  ASN B C     1 
ATOM   5349  O  O     . ASN B  2  272 ? 73.414  47.999  60.215  1.00 104.51 ? 270  ASN B O     1 
ATOM   5350  C  CB    . ASN B  2  272 ? 76.440  48.493  61.025  1.00 105.67 ? 270  ASN B CB    1 
ATOM   5351  C  CG    . ASN B  2  272 ? 77.345  49.697  60.908  1.00 104.82 ? 270  ASN B CG    1 
ATOM   5352  O  OD1   . ASN B  2  272 ? 77.092  50.600  60.115  1.00 103.64 ? 270  ASN B OD1   1 
ATOM   5353  N  ND2   . ASN B  2  272 ? 78.406  49.717  61.701  1.00 104.72 ? 270  ASN B ND2   1 
ATOM   5354  N  N     . ALA B  2  273 ? 73.892  46.746  62.020  1.00 104.44 ? 271  ALA B N     1 
ATOM   5355  C  CA    . ALA B  2  273 ? 72.900  45.733  61.693  1.00 104.90 ? 271  ALA B CA    1 
ATOM   5356  C  C     . ALA B  2  273 ? 71.525  46.367  61.823  1.00 104.96 ? 271  ALA B C     1 
ATOM   5357  O  O     . ALA B  2  273 ? 70.714  46.331  60.900  1.00 104.60 ? 271  ALA B O     1 
ATOM   5358  C  CB    . ALA B  2  273 ? 73.021  44.557  62.647  1.00 105.33 ? 271  ALA B CB    1 
ATOM   5359  N  N     . PHE B  2  274 ? 71.280  46.952  62.989  1.00 105.20 ? 272  PHE B N     1 
ATOM   5360  C  CA    . PHE B  2  274 ? 70.017  47.612  63.273  1.00 104.74 ? 272  PHE B CA    1 
ATOM   5361  C  C     . PHE B  2  274 ? 69.652  48.681  62.242  1.00 104.27 ? 272  PHE B C     1 
ATOM   5362  O  O     . PHE B  2  274 ? 68.489  48.796  61.850  1.00 103.87 ? 272  PHE B O     1 
ATOM   5363  C  CB    . PHE B  2  274 ? 70.068  48.224  64.669  1.00 104.47 ? 272  PHE B CB    1 
ATOM   5364  C  CG    . PHE B  2  274 ? 69.892  47.223  65.767  1.00 103.76 ? 272  PHE B CG    1 
ATOM   5365  C  CD1   . PHE B  2  274 ? 70.955  46.880  66.594  1.00 103.52 ? 272  PHE B CD1   1 
ATOM   5366  C  CD2   . PHE B  2  274 ? 68.647  46.636  65.987  1.00 102.91 ? 272  PHE B CD2   1 
ATOM   5367  C  CE1   . PHE B  2  274 ? 70.776  45.968  67.632  1.00 103.88 ? 272  PHE B CE1   1 
ATOM   5368  C  CE2   . PHE B  2  274 ? 68.456  45.727  67.017  1.00 102.38 ? 272  PHE B CE2   1 
ATOM   5369  C  CZ    . PHE B  2  274 ? 69.519  45.391  67.844  1.00 103.24 ? 272  PHE B CZ    1 
ATOM   5370  N  N     . SER B  2  275 ? 70.642  49.464  61.814  1.00 103.55 ? 273  SER B N     1 
ATOM   5371  C  CA    . SER B  2  275 ? 70.418  50.510  60.816  1.00 102.55 ? 273  SER B CA    1 
ATOM   5372  C  C     . SER B  2  275 ? 69.842  49.841  59.577  1.00 101.27 ? 273  SER B C     1 
ATOM   5373  O  O     . SER B  2  275 ? 68.904  50.347  58.958  1.00 101.60 ? 273  SER B O     1 
ATOM   5374  C  CB    . SER B  2  275 ? 71.734  51.208  60.449  1.00 102.83 ? 273  SER B CB    1 
ATOM   5375  O  OG    . SER B  2  275 ? 72.399  51.715  61.597  1.00 104.04 ? 273  SER B OG    1 
ATOM   5376  N  N     . VAL B  2  276 ? 70.418  48.696  59.225  1.00 99.78  ? 274  VAL B N     1 
ATOM   5377  C  CA    . VAL B  2  276 ? 69.967  47.931  58.072  1.00 98.03  ? 274  VAL B CA    1 
ATOM   5378  C  C     . VAL B  2  276 ? 68.588  47.316  58.361  1.00 97.41  ? 274  VAL B C     1 
ATOM   5379  O  O     . VAL B  2  276 ? 67.673  47.430  57.545  1.00 97.65  ? 274  VAL B O     1 
ATOM   5380  C  CB    . VAL B  2  276 ? 70.998  46.829  57.710  1.00 96.92  ? 274  VAL B CB    1 
ATOM   5381  C  CG1   . VAL B  2  276 ? 70.454  45.925  56.615  1.00 95.20  ? 274  VAL B CG1   1 
ATOM   5382  C  CG2   . VAL B  2  276 ? 72.291  47.479  57.256  1.00 95.33  ? 274  VAL B CG2   1 
ATOM   5383  N  N     . LEU B  2  277 ? 68.435  46.679  59.522  1.00 95.62  ? 275  LEU B N     1 
ATOM   5384  C  CA    . LEU B  2  277 ? 67.155  46.081  59.887  1.00 93.76  ? 275  LEU B CA    1 
ATOM   5385  C  C     . LEU B  2  277 ? 66.102  47.175  59.869  1.00 92.94  ? 275  LEU B C     1 
ATOM   5386  O  O     . LEU B  2  277 ? 64.948  46.949  59.501  1.00 92.48  ? 275  LEU B O     1 
ATOM   5387  C  CB    . LEU B  2  277 ? 67.234  45.458  61.282  1.00 93.92  ? 275  LEU B CB    1 
ATOM   5388  C  CG    . LEU B  2  277 ? 65.912  45.011  61.927  1.00 94.00  ? 275  LEU B CG    1 
ATOM   5389  C  CD1   . LEU B  2  277 ? 65.118  44.088  61.007  1.00 92.66  ? 275  LEU B CD1   1 
ATOM   5390  C  CD2   . LEU B  2  277 ? 66.228  44.315  63.235  1.00 94.71  ? 275  LEU B CD2   1 
ATOM   5391  N  N     . GLN B  2  278 ? 66.523  48.367  60.275  1.00 92.10  ? 276  GLN B N     1 
ATOM   5392  C  CA    . GLN B  2  278 ? 65.654  49.534  60.305  1.00 90.65  ? 276  GLN B CA    1 
ATOM   5393  C  C     . GLN B  2  278 ? 65.059  49.703  58.920  1.00 90.13  ? 276  GLN B C     1 
ATOM   5394  O  O     . GLN B  2  278 ? 63.872  49.466  58.721  1.00 89.86  ? 276  GLN B O     1 
ATOM   5395  C  CB    . GLN B  2  278 ? 66.467  50.778  60.668  1.00 90.44  ? 276  GLN B CB    1 
ATOM   5396  C  CG    . GLN B  2  278 ? 65.646  52.028  60.921  1.00 88.67  ? 276  GLN B CG    1 
ATOM   5397  C  CD    . GLN B  2  278 ? 66.502  53.219  61.335  1.00 88.47  ? 276  GLN B CD    1 
ATOM   5398  O  OE1   . GLN B  2  278 ? 65.983  54.216  61.844  1.00 87.64  ? 276  GLN B OE1   1 
ATOM   5399  N  NE2   . GLN B  2  278 ? 67.817  53.124  61.113  1.00 87.25  ? 276  GLN B NE2   1 
ATOM   5400  N  N     . HIS B  2  279 ? 65.900  50.095  57.964  1.00 89.44  ? 277  HIS B N     1 
ATOM   5401  C  CA    . HIS B  2  279 ? 65.474  50.308  56.585  1.00 89.08  ? 277  HIS B CA    1 
ATOM   5402  C  C     . HIS B  2  279 ? 64.800  49.093  55.962  1.00 88.47  ? 277  HIS B C     1 
ATOM   5403  O  O     . HIS B  2  279 ? 64.086  49.210  54.971  1.00 86.89  ? 277  HIS B O     1 
ATOM   5404  C  CB    . HIS B  2  279 ? 66.668  50.711  55.729  1.00 90.71  ? 277  HIS B CB    1 
ATOM   5405  C  CG    . HIS B  2  279 ? 67.303  51.999  56.148  1.00 92.55  ? 277  HIS B CG    1 
ATOM   5406  N  ND1   . HIS B  2  279 ? 66.598  53.179  56.247  1.00 93.08  ? 277  HIS B ND1   1 
ATOM   5407  C  CD2   . HIS B  2  279 ? 68.585  52.299  56.463  1.00 93.22  ? 277  HIS B CD2   1 
ATOM   5408  C  CE1   . HIS B  2  279 ? 67.418  54.152  56.605  1.00 93.23  ? 277  HIS B CE1   1 
ATOM   5409  N  NE2   . HIS B  2  279 ? 68.629  53.645  56.741  1.00 94.08  ? 277  HIS B NE2   1 
ATOM   5410  N  N     . VAL B  2  280 ? 65.041  47.922  56.530  1.00 89.21  ? 278  VAL B N     1 
ATOM   5411  C  CA    . VAL B  2  280 ? 64.431  46.712  56.007  1.00 90.21  ? 278  VAL B CA    1 
ATOM   5412  C  C     . VAL B  2  280 ? 62.968  46.708  56.393  1.00 90.89  ? 278  VAL B C     1 
ATOM   5413  O  O     . VAL B  2  280 ? 62.096  46.459  55.563  1.00 91.21  ? 278  VAL B O     1 
ATOM   5414  C  CB    . VAL B  2  280 ? 65.098  45.447  56.577  1.00 90.59  ? 278  VAL B CB    1 
ATOM   5415  C  CG1   . VAL B  2  280 ? 64.255  44.215  56.247  1.00 89.64  ? 278  VAL B CG1   1 
ATOM   5416  C  CG2   . VAL B  2  280 ? 66.497  45.300  55.988  1.00 90.68  ? 278  VAL B CG2   1 
ATOM   5417  N  N     . LEU B  2  281 ? 62.710  46.986  57.666  1.00 91.65  ? 279  LEU B N     1 
ATOM   5418  C  CA    . LEU B  2  281 ? 61.348  47.031  58.195  1.00 91.70  ? 279  LEU B CA    1 
ATOM   5419  C  C     . LEU B  2  281 ? 60.594  48.253  57.664  1.00 91.93  ? 279  LEU B C     1 
ATOM   5420  O  O     . LEU B  2  281 ? 59.366  48.239  57.568  1.00 90.34  ? 279  LEU B O     1 
ATOM   5421  C  CB    . LEU B  2  281 ? 61.397  47.070  59.726  1.00 91.08  ? 279  LEU B CB    1 
ATOM   5422  C  CG    . LEU B  2  281 ? 61.839  45.784  60.428  1.00 89.33  ? 279  LEU B CG    1 
ATOM   5423  C  CD1   . LEU B  2  281 ? 62.285  46.086  61.848  1.00 88.55  ? 279  LEU B CD1   1 
ATOM   5424  C  CD2   . LEU B  2  281 ? 60.689  44.793  60.412  1.00 88.16  ? 279  LEU B CD2   1 
ATOM   5425  N  N     . GLY B  2  282 ? 61.353  49.299  57.327  1.00 93.11  ? 280  GLY B N     1 
ATOM   5426  C  CA    . GLY B  2  282 ? 60.789  50.533  56.804  1.00 93.91  ? 280  GLY B CA    1 
ATOM   5427  C  C     . GLY B  2  282 ? 60.935  51.714  57.750  1.00 94.80  ? 280  GLY B C     1 
ATOM   5428  O  O     . GLY B  2  282 ? 60.429  51.675  58.869  1.00 94.43  ? 280  GLY B O     1 
ATOM   5429  N  N     . ALA B  2  283 ? 61.620  52.768  57.313  1.00 96.48  ? 281  ALA B N     1 
ATOM   5430  C  CA    . ALA B  2  283 ? 61.797  53.951  58.158  1.00 99.16  ? 281  ALA B CA    1 
ATOM   5431  C  C     . ALA B  2  283 ? 61.174  55.224  57.563  1.00 101.09 ? 281  ALA B C     1 
ATOM   5432  O  O     . ALA B  2  283 ? 61.887  56.181  57.246  1.00 100.69 ? 281  ALA B O     1 
ATOM   5433  C  CB    . ALA B  2  283 ? 63.274  54.176  58.432  1.00 97.73  ? 281  ALA B CB    1 
ATOM   5434  N  N     . GLY B  2  284 ? 59.847  55.223  57.410  1.00 103.00 ? 282  GLY B N     1 
ATOM   5435  C  CA    . GLY B  2  284 ? 59.135  56.379  56.877  1.00 105.84 ? 282  GLY B CA    1 
ATOM   5436  C  C     . GLY B  2  284 ? 59.199  56.615  55.370  1.00 107.38 ? 282  GLY B C     1 
ATOM   5437  O  O     . GLY B  2  284 ? 60.274  56.926  54.849  1.00 107.98 ? 282  GLY B O     1 
ATOM   5438  N  N     . PRO B  2  285 ? 58.053  56.516  54.650  1.00 108.20 ? 283  PRO B N     1 
ATOM   5439  C  CA    . PRO B  2  285 ? 57.904  56.700  53.195  1.00 106.72 ? 283  PRO B CA    1 
ATOM   5440  C  C     . PRO B  2  285 ? 58.942  57.558  52.463  1.00 104.70 ? 283  PRO B C     1 
ATOM   5441  O  O     . PRO B  2  285 ? 59.519  58.491  53.034  1.00 103.91 ? 283  PRO B O     1 
ATOM   5442  C  CB    . PRO B  2  285 ? 56.471  57.251  53.045  1.00 107.93 ? 283  PRO B CB    1 
ATOM   5443  C  CG    . PRO B  2  285 ? 55.919  57.375  54.494  1.00 109.02 ? 283  PRO B CG    1 
ATOM   5444  C  CD    . PRO B  2  285 ? 56.724  56.379  55.277  1.00 109.29 ? 283  PRO B CD    1 
ATOM   5445  N  N     . LEU B  2  286 ? 59.164  57.222  51.190  1.00 102.41 ? 284  LEU B N     1 
ATOM   5446  C  CA    . LEU B  2  286 ? 60.133  57.915  50.333  1.00 99.90  ? 284  LEU B CA    1 
ATOM   5447  C  C     . LEU B  2  286 ? 59.455  58.591  49.146  1.00 97.66  ? 284  LEU B C     1 
ATOM   5448  O  O     . LEU B  2  286 ? 60.093  59.337  48.398  1.00 97.21  ? 284  LEU B O     1 
ATOM   5449  C  CB    . LEU B  2  286 ? 61.168  56.930  49.780  1.00 100.78 ? 284  LEU B CB    1 
ATOM   5450  C  CG    . LEU B  2  286 ? 61.877  55.933  50.694  1.00 100.67 ? 284  LEU B CG    1 
ATOM   5451  C  CD1   . LEU B  2  286 ? 62.809  55.073  49.847  1.00 100.86 ? 284  LEU B CD1   1 
ATOM   5452  C  CD2   . LEU B  2  286 ? 62.651  56.672  51.776  1.00 101.44 ? 284  LEU B CD2   1 
ATOM   5453  N  N     . ILE B  2  287 ? 58.171  58.301  48.968  1.00 94.84  ? 285  ILE B N     1 
ATOM   5454  C  CA    . ILE B  2  287 ? 57.376  58.866  47.882  1.00 92.61  ? 285  ILE B CA    1 
ATOM   5455  C  C     . ILE B  2  287 ? 56.201  59.646  48.487  1.00 90.50  ? 285  ILE B C     1 
ATOM   5456  O  O     . ILE B  2  287 ? 55.452  59.110  49.302  1.00 90.19  ? 285  ILE B O     1 
ATOM   5457  C  CB    . ILE B  2  287 ? 56.857  57.739  46.956  1.00 92.85  ? 285  ILE B CB    1 
ATOM   5458  C  CG1   . ILE B  2  287 ? 56.472  56.520  47.805  1.00 95.31  ? 285  ILE B CG1   1 
ATOM   5459  C  CG2   . ILE B  2  287 ? 57.919  57.362  45.947  1.00 91.35  ? 285  ILE B CG2   1 
ATOM   5460  C  CD1   . ILE B  2  287 ? 56.232  55.237  47.026  1.00 94.87  ? 285  ILE B CD1   1 
ATOM   5461  N  N     . LYS B  2  288 ? 56.052  60.911  48.098  1.00 87.78  ? 286  LYS B N     1 
ATOM   5462  C  CA    . LYS B  2  288 ? 54.982  61.755  48.626  1.00 85.00  ? 286  LYS B CA    1 
ATOM   5463  C  C     . LYS B  2  288 ? 53.625  61.060  48.662  1.00 84.26  ? 286  LYS B C     1 
ATOM   5464  O  O     . LYS B  2  288 ? 53.073  60.701  47.625  1.00 82.61  ? 286  LYS B O     1 
ATOM   5465  C  CB    . LYS B  2  288 ? 54.871  63.048  47.815  1.00 82.86  ? 286  LYS B CB    1 
ATOM   5466  C  CG    . LYS B  2  288 ? 53.995  64.098  48.475  1.00 79.00  ? 286  LYS B CG    1 
ATOM   5467  C  CD    . LYS B  2  288 ? 53.996  65.397  47.703  1.00 77.11  ? 286  LYS B CD    1 
ATOM   5468  C  CE    . LYS B  2  288 ? 53.242  66.463  48.457  1.00 75.31  ? 286  LYS B CE    1 
ATOM   5469  N  NZ    . LYS B  2  288 ? 52.990  67.660  47.629  1.00 76.49  ? 286  LYS B NZ    1 
ATOM   5470  N  N     . ARG B  2  289 ? 53.090  60.897  49.869  1.00 84.79  ? 287  ARG B N     1 
ATOM   5471  C  CA    . ARG B  2  289 ? 51.807  60.235  50.071  1.00 86.51  ? 287  ARG B CA    1 
ATOM   5472  C  C     . ARG B  2  289 ? 51.928  58.815  49.525  1.00 88.69  ? 287  ARG B C     1 
ATOM   5473  O  O     . ARG B  2  289 ? 50.939  58.217  49.078  1.00 89.18  ? 287  ARG B O     1 
ATOM   5474  C  CB    . ARG B  2  289 ? 50.684  60.967  49.321  1.00 86.15  ? 287  ARG B CB    1 
ATOM   5475  C  CG    . ARG B  2  289 ? 50.502  62.438  49.660  1.00 84.09  ? 287  ARG B CG    1 
ATOM   5476  C  CD    . ARG B  2  289 ? 49.151  62.951  49.165  1.00 82.24  ? 287  ARG B CD    1 
ATOM   5477  N  NE    . ARG B  2  289 ? 49.044  64.404  49.270  1.00 81.22  ? 287  ARG B NE    1 
ATOM   5478  C  CZ    . ARG B  2  289 ? 49.637  65.259  48.442  1.00 79.45  ? 287  ARG B CZ    1 
ATOM   5479  N  NH1   . ARG B  2  289 ? 50.379  64.816  47.438  1.00 78.69  ? 287  ARG B NH1   1 
ATOM   5480  N  NH2   . ARG B  2  289 ? 49.497  66.562  48.622  1.00 77.93  ? 287  ARG B NH2   1 
ATOM   5481  N  N     . GLY B  2  290 ? 53.147  58.282  49.573  1.00 90.16  ? 288  GLY B N     1 
ATOM   5482  C  CA    . GLY B  2  290 ? 53.420  56.949  49.058  1.00 91.73  ? 288  GLY B CA    1 
ATOM   5483  C  C     . GLY B  2  290 ? 52.688  55.789  49.705  1.00 92.62  ? 288  GLY B C     1 
ATOM   5484  O  O     . GLY B  2  290 ? 51.657  55.972  50.357  1.00 93.76  ? 288  GLY B O     1 
ATOM   5485  N  N     . SER B  2  291 ? 53.219  54.584  49.506  1.00 92.51  ? 289  SER B N     1 
ATOM   5486  C  CA    . SER B  2  291 ? 52.627  53.379  50.072  1.00 91.87  ? 289  SER B CA    1 
ATOM   5487  C  C     . SER B  2  291 ? 53.696  52.605  50.822  1.00 92.11  ? 289  SER B C     1 
ATOM   5488  O  O     . SER B  2  291 ? 53.396  51.803  51.705  1.00 93.28  ? 289  SER B O     1 
ATOM   5489  C  CB    . SER B  2  291 ? 52.029  52.503  48.971  1.00 91.15  ? 289  SER B CB    1 
ATOM   5490  O  OG    . SER B  2  291 ? 51.541  51.283  49.502  1.00 92.23  ? 289  SER B OG    1 
ATOM   5491  N  N     . SER B  2  292 ? 54.951  52.849  50.468  1.00 91.87  ? 290  SER B N     1 
ATOM   5492  C  CA    . SER B  2  292 ? 56.054  52.172  51.129  1.00 92.70  ? 290  SER B CA    1 
ATOM   5493  C  C     . SER B  2  292 ? 55.933  50.647  51.035  1.00 93.34  ? 290  SER B C     1 
ATOM   5494  O  O     . SER B  2  292 ? 55.623  49.976  52.022  1.00 93.88  ? 290  SER B O     1 
ATOM   5495  C  CB    . SER B  2  292 ? 56.118  52.599  52.601  1.00 92.27  ? 290  SER B CB    1 
ATOM   5496  O  OG    . SER B  2  292 ? 56.264  54.005  52.731  1.00 92.05  ? 290  SER B OG    1 
ATOM   5497  N  N     . VAL B  2  293 ? 56.180  50.105  49.845  1.00 93.67  ? 291  VAL B N     1 
ATOM   5498  C  CA    . VAL B  2  293 ? 56.115  48.661  49.623  1.00 93.70  ? 291  VAL B CA    1 
ATOM   5499  C  C     . VAL B  2  293 ? 57.424  48.039  50.153  1.00 94.42  ? 291  VAL B C     1 
ATOM   5500  O  O     . VAL B  2  293 ? 57.441  46.952  50.742  1.00 92.98  ? 291  VAL B O     1 
ATOM   5501  C  CB    . VAL B  2  293 ? 55.964  48.359  48.117  1.00 93.10  ? 291  VAL B CB    1 
ATOM   5502  C  CG1   . VAL B  2  293 ? 55.182  47.071  47.916  1.00 93.05  ? 291  VAL B CG1   1 
ATOM   5503  C  CG2   . VAL B  2  293 ? 55.282  49.517  47.424  1.00 91.67  ? 291  VAL B CG2   1 
ATOM   5504  N  N     . THR B  2  294 ? 58.514  48.769  49.940  1.00 95.40  ? 292  THR B N     1 
ATOM   5505  C  CA    . THR B  2  294 ? 59.848  48.381  50.375  1.00 96.56  ? 292  THR B CA    1 
ATOM   5506  C  C     . THR B  2  294 ? 59.920  48.420  51.899  1.00 96.47  ? 292  THR B C     1 
ATOM   5507  O  O     . THR B  2  294 ? 60.983  48.231  52.496  1.00 96.88  ? 292  THR B O     1 
ATOM   5508  C  CB    . THR B  2  294 ? 60.899  49.368  49.818  1.00 98.50  ? 292  THR B CB    1 
ATOM   5509  O  OG1   . THR B  2  294 ? 60.806  49.405  48.386  1.00 99.15  ? 292  THR B OG1   1 
ATOM   5510  C  CG2   . THR B  2  294 ? 62.318  48.961  50.245  1.00 99.82  ? 292  THR B CG2   1 
ATOM   5511  N  N     . SER B  2  295 ? 58.783  48.687  52.523  1.00 96.15  ? 293  SER B N     1 
ATOM   5512  C  CA    . SER B  2  295 ? 58.714  48.764  53.968  1.00 95.20  ? 293  SER B CA    1 
ATOM   5513  C  C     . SER B  2  295 ? 57.921  47.580  54.509  1.00 94.95  ? 293  SER B C     1 
ATOM   5514  O  O     . SER B  2  295 ? 56.690  47.549  54.422  1.00 94.15  ? 293  SER B O     1 
ATOM   5515  C  CB    . SER B  2  295 ? 58.061  50.076  54.373  1.00 94.84  ? 293  SER B CB    1 
ATOM   5516  O  OG    . SER B  2  295 ? 57.960  50.168  55.777  1.00 96.67  ? 293  SER B OG    1 
ATOM   5517  N  N     . LYS B  2  296 ? 58.646  46.605  55.055  1.00 94.85  ? 294  LYS B N     1 
ATOM   5518  C  CA    . LYS B  2  296 ? 58.053  45.391  55.616  1.00 94.56  ? 294  LYS B CA    1 
ATOM   5519  C  C     . LYS B  2  296 ? 56.998  45.737  56.654  1.00 93.87  ? 294  LYS B C     1 
ATOM   5520  O  O     . LYS B  2  296 ? 55.845  45.305  56.564  1.00 93.23  ? 294  LYS B O     1 
ATOM   5521  C  CB    . LYS B  2  296 ? 59.135  44.536  56.287  1.00 95.26  ? 294  LYS B CB    1 
ATOM   5522  C  CG    . LYS B  2  296 ? 60.216  43.977  55.359  1.00 95.69  ? 294  LYS B CG    1 
ATOM   5523  C  CD    . LYS B  2  296 ? 59.810  42.646  54.740  1.00 94.77  ? 294  LYS B CD    1 
ATOM   5524  C  CE    . LYS B  2  296 ? 60.933  42.097  53.887  1.00 94.72  ? 294  LYS B CE    1 
ATOM   5525  N  NZ    . LYS B  2  296 ? 60.592  40.786  53.272  1.00 94.41  ? 294  LYS B NZ    1 
ATOM   5526  N  N     . LEU B  2  297 ? 57.421  46.523  57.642  1.00 93.21  ? 295  LEU B N     1 
ATOM   5527  C  CA    . LEU B  2  297 ? 56.561  46.950  58.738  1.00 91.83  ? 295  LEU B CA    1 
ATOM   5528  C  C     . LEU B  2  297 ? 55.281  47.627  58.261  1.00 90.91  ? 295  LEU B C     1 
ATOM   5529  O  O     . LEU B  2  297 ? 54.179  47.129  58.500  1.00 88.94  ? 295  LEU B O     1 
ATOM   5530  C  CB    . LEU B  2  297 ? 57.341  47.890  59.658  1.00 90.81  ? 295  LEU B CB    1 
ATOM   5531  C  CG    . LEU B  2  297 ? 56.647  48.271  60.965  1.00 90.97  ? 295  LEU B CG    1 
ATOM   5532  C  CD1   . LEU B  2  297 ? 56.131  47.035  61.710  1.00 90.20  ? 295  LEU B CD1   1 
ATOM   5533  C  CD2   . LEU B  2  297 ? 57.636  49.038  61.816  1.00 91.80  ? 295  LEU B CD2   1 
ATOM   5534  N  N     . TYR B  2  298 ? 55.438  48.766  57.595  1.00 91.39  ? 296  TYR B N     1 
ATOM   5535  C  CA    . TYR B  2  298 ? 54.301  49.514  57.073  1.00 92.46  ? 296  TYR B CA    1 
ATOM   5536  C  C     . TYR B  2  298 ? 53.355  48.512  56.437  1.00 91.89  ? 296  TYR B C     1 
ATOM   5537  O  O     . TYR B  2  298 ? 52.253  48.268  56.928  1.00 91.51  ? 296  TYR B O     1 
ATOM   5538  C  CB    . TYR B  2  298 ? 54.763  50.513  56.005  1.00 94.84  ? 296  TYR B CB    1 
ATOM   5539  C  CG    . TYR B  2  298 ? 53.837  51.695  55.790  1.00 98.61  ? 296  TYR B CG    1 
ATOM   5540  C  CD1   . TYR B  2  298 ? 52.454  51.527  55.723  1.00 100.15 ? 296  TYR B CD1   1 
ATOM   5541  C  CD2   . TYR B  2  298 ? 54.352  52.994  55.673  1.00 101.52 ? 296  TYR B CD2   1 
ATOM   5542  C  CE1   . TYR B  2  298 ? 51.606  52.624  55.556  1.00 103.24 ? 296  TYR B CE1   1 
ATOM   5543  C  CE2   . TYR B  2  298 ? 53.518  54.100  55.502  1.00 103.41 ? 296  TYR B CE2   1 
ATOM   5544  C  CZ    . TYR B  2  298 ? 52.146  53.908  55.449  1.00 104.72 ? 296  TYR B CZ    1 
ATOM   5545  O  OH    . TYR B  2  298 ? 51.318  55.005  55.318  1.00 107.18 ? 296  TYR B OH    1 
ATOM   5546  N  N     . GLN B  2  299 ? 53.820  47.928  55.338  1.00 91.41  ? 297  GLN B N     1 
ATOM   5547  C  CA    . GLN B  2  299 ? 53.065  46.948  54.581  1.00 90.79  ? 297  GLN B CA    1 
ATOM   5548  C  C     . GLN B  2  299 ? 52.352  45.938  55.468  1.00 91.00  ? 297  GLN B C     1 
ATOM   5549  O  O     . GLN B  2  299 ? 51.192  45.603  55.230  1.00 91.16  ? 297  GLN B O     1 
ATOM   5550  C  CB    . GLN B  2  299 ? 54.004  46.226  53.626  1.00 90.94  ? 297  GLN B CB    1 
ATOM   5551  C  CG    . GLN B  2  299 ? 54.477  47.072  52.461  1.00 90.17  ? 297  GLN B CG    1 
ATOM   5552  C  CD    . GLN B  2  299 ? 53.366  47.349  51.478  1.00 89.86  ? 297  GLN B CD    1 
ATOM   5553  O  OE1   . GLN B  2  299 ? 52.523  46.486  51.224  1.00 89.06  ? 297  GLN B OE1   1 
ATOM   5554  N  NE2   . GLN B  2  299 ? 53.363  48.547  50.904  1.00 89.86  ? 297  GLN B NE2   1 
ATOM   5555  N  N     . GLY B  2  300 ? 53.049  45.453  56.489  1.00 90.63  ? 298  GLY B N     1 
ATOM   5556  C  CA    . GLY B  2  300 ? 52.446  44.485  57.382  1.00 89.78  ? 298  GLY B CA    1 
ATOM   5557  C  C     . GLY B  2  300 ? 51.240  45.031  58.125  1.00 89.44  ? 298  GLY B C     1 
ATOM   5558  O  O     . GLY B  2  300 ? 50.197  44.387  58.189  1.00 88.12  ? 298  GLY B O     1 
ATOM   5559  N  N     . VAL B  2  301 ? 51.378  46.227  58.685  1.00 90.36  ? 299  VAL B N     1 
ATOM   5560  C  CA    . VAL B  2  301 ? 50.292  46.846  59.442  1.00 91.33  ? 299  VAL B CA    1 
ATOM   5561  C  C     . VAL B  2  301 ? 49.062  47.169  58.593  1.00 91.99  ? 299  VAL B C     1 
ATOM   5562  O  O     . VAL B  2  301 ? 47.926  47.091  59.069  1.00 90.32  ? 299  VAL B O     1 
ATOM   5563  C  CB    . VAL B  2  301 ? 50.776  48.138  60.129  1.00 90.40  ? 299  VAL B CB    1 
ATOM   5564  C  CG1   . VAL B  2  301 ? 49.666  48.718  60.987  1.00 89.85  ? 299  VAL B CG1   1 
ATOM   5565  C  CG2   . VAL B  2  301 ? 52.003  47.838  60.969  1.00 90.10  ? 299  VAL B CG2   1 
ATOM   5566  N  N     . ALA B  2  302 ? 49.300  47.539  57.339  1.00 93.60  ? 300  ALA B N     1 
ATOM   5567  C  CA    . ALA B  2  302 ? 48.223  47.873  56.422  1.00 95.14  ? 300  ALA B CA    1 
ATOM   5568  C  C     . ALA B  2  302 ? 47.338  46.658  56.275  1.00 96.63  ? 300  ALA B C     1 
ATOM   5569  O  O     . ALA B  2  302 ? 46.126  46.729  56.447  1.00 97.03  ? 300  ALA B O     1 
ATOM   5570  C  CB    . ALA B  2  302 ? 48.790  48.269  55.072  1.00 94.74  ? 300  ALA B CB    1 
ATOM   5571  N  N     . LYS B  2  303 ? 47.965  45.533  55.965  1.00 99.29  ? 301  LYS B N     1 
ATOM   5572  C  CA    . LYS B  2  303 ? 47.255  44.274  55.783  1.00 101.88 ? 301  LYS B CA    1 
ATOM   5573  C  C     . LYS B  2  303 ? 46.559  43.867  57.077  1.00 102.48 ? 301  LYS B C     1 
ATOM   5574  O  O     . LYS B  2  303 ? 45.966  42.795  57.157  1.00 102.76 ? 301  LYS B O     1 
ATOM   5575  C  CB    . LYS B  2  303 ? 48.242  43.172  55.374  1.00 103.36 ? 301  LYS B CB    1 
ATOM   5576  C  CG    . LYS B  2  303 ? 49.207  43.555  54.245  1.00 106.08 ? 301  LYS B CG    1 
ATOM   5577  C  CD    . LYS B  2  303 ? 50.291  42.485  54.055  1.00 107.69 ? 301  LYS B CD    1 
ATOM   5578  C  CE    . LYS B  2  303 ? 51.359  42.904  53.040  1.00 108.67 ? 301  LYS B CE    1 
ATOM   5579  N  NZ    . LYS B  2  303 ? 50.834  43.030  51.648  1.00 109.58 ? 301  LYS B NZ    1 
ATOM   5580  N  N     . ALA B  2  304 ? 46.627  44.726  58.087  1.00 103.90 ? 302  ALA B N     1 
ATOM   5581  C  CA    . ALA B  2  304 ? 46.027  44.420  59.379  1.00 105.03 ? 302  ALA B CA    1 
ATOM   5582  C  C     . ALA B  2  304 ? 44.903  45.353  59.792  1.00 105.48 ? 302  ALA B C     1 
ATOM   5583  O  O     . ALA B  2  304 ? 43.934  44.921  60.412  1.00 105.22 ? 302  ALA B O     1 
ATOM   5584  C  CB    . ALA B  2  304 ? 47.105  44.416  60.453  1.00 106.00 ? 302  ALA B CB    1 
ATOM   5585  N  N     . THR B  2  305 ? 45.037  46.633  59.470  1.00 106.21 ? 303  THR B N     1 
ATOM   5586  C  CA    . THR B  2  305 ? 44.014  47.600  59.838  1.00 107.11 ? 303  THR B CA    1 
ATOM   5587  C  C     . THR B  2  305 ? 43.247  48.117  58.624  1.00 107.68 ? 303  THR B C     1 
ATOM   5588  O  O     . THR B  2  305 ? 43.599  47.827  57.478  1.00 107.74 ? 303  THR B O     1 
ATOM   5589  C  CB    . THR B  2  305 ? 44.628  48.796  60.604  1.00 106.93 ? 303  THR B CB    1 
ATOM   5590  O  OG1   . THR B  2  305 ? 43.581  49.657  61.070  1.00 106.91 ? 303  THR B OG1   1 
ATOM   5591  C  CG2   . THR B  2  305 ? 45.566  49.585  59.704  1.00 106.90 ? 303  THR B CG2   1 
ATOM   5592  N  N     . THR B  2  306 ? 42.198  48.888  58.889  1.00 108.27 ? 304  THR B N     1 
ATOM   5593  C  CA    . THR B  2  306 ? 41.360  49.443  57.832  1.00 108.47 ? 304  THR B CA    1 
ATOM   5594  C  C     . THR B  2  306 ? 41.566  50.953  57.664  1.00 107.58 ? 304  THR B C     1 
ATOM   5595  O  O     . THR B  2  306 ? 41.677  51.460  56.547  1.00 107.32 ? 304  THR B O     1 
ATOM   5596  C  CB    . THR B  2  306 ? 39.861  49.183  58.135  1.00 109.24 ? 304  THR B CB    1 
ATOM   5597  O  OG1   . THR B  2  306 ? 39.373  50.177  59.051  1.00 110.21 ? 304  THR B OG1   1 
ATOM   5598  C  CG2   . THR B  2  306 ? 39.681  47.800  58.771  1.00 108.75 ? 304  THR B CG2   1 
ATOM   5599  N  N     . GLN B  2  307 ? 41.625  51.657  58.788  1.00 106.46 ? 305  GLN B N     1 
ATOM   5600  C  CA    . GLN B  2  307 ? 41.780  53.102  58.797  1.00 105.99 ? 305  GLN B CA    1 
ATOM   5601  C  C     . GLN B  2  307 ? 43.211  53.591  58.630  1.00 104.98 ? 305  GLN B C     1 
ATOM   5602  O  O     . GLN B  2  307 ? 44.151  52.805  58.646  1.00 105.55 ? 305  GLN B O     1 
ATOM   5603  C  CB    . GLN B  2  307 ? 41.208  53.661  60.098  1.00 107.48 ? 305  GLN B CB    1 
ATOM   5604  C  CG    . GLN B  2  307 ? 39.714  53.438  60.272  1.00 109.36 ? 305  GLN B CG    1 
ATOM   5605  C  CD    . GLN B  2  307 ? 38.903  54.003  59.121  1.00 110.63 ? 305  GLN B CD    1 
ATOM   5606  O  OE1   . GLN B  2  307 ? 39.155  55.124  58.660  1.00 110.53 ? 305  GLN B OE1   1 
ATOM   5607  N  NE2   . GLN B  2  307 ? 37.913  53.234  58.654  1.00 109.87 ? 305  GLN B NE2   1 
ATOM   5608  N  N     . PRO B  2  308 ? 43.386  54.912  58.458  1.00 103.87 ? 306  PRO B N     1 
ATOM   5609  C  CA    . PRO B  2  308 ? 44.690  55.555  58.287  1.00 102.61 ? 306  PRO B CA    1 
ATOM   5610  C  C     . PRO B  2  308 ? 45.604  55.315  59.472  1.00 101.54 ? 306  PRO B C     1 
ATOM   5611  O  O     . PRO B  2  308 ? 45.148  55.153  60.602  1.00 101.39 ? 306  PRO B O     1 
ATOM   5612  C  CB    . PRO B  2  308 ? 44.332  57.026  58.152  1.00 102.89 ? 306  PRO B CB    1 
ATOM   5613  C  CG    . PRO B  2  308 ? 43.025  56.969  57.453  1.00 104.36 ? 306  PRO B CG    1 
ATOM   5614  C  CD    . PRO B  2  308 ? 42.305  55.880  58.211  1.00 104.23 ? 306  PRO B CD    1 
ATOM   5615  N  N     . PHE B  2  309 ? 46.903  55.312  59.211  1.00 100.64 ? 307  PHE B N     1 
ATOM   5616  C  CA    . PHE B  2  309 ? 47.869  55.081  60.267  1.00 99.20  ? 307  PHE B CA    1 
ATOM   5617  C  C     . PHE B  2  309 ? 49.285  55.344  59.770  1.00 97.89  ? 307  PHE B C     1 
ATOM   5618  O  O     . PHE B  2  309 ? 49.506  55.716  58.613  1.00 96.65  ? 307  PHE B O     1 
ATOM   5619  C  CB    . PHE B  2  309 ? 47.765  53.627  60.740  1.00 99.67  ? 307  PHE B CB    1 
ATOM   5620  C  CG    . PHE B  2  309 ? 48.431  52.637  59.808  1.00 100.47 ? 307  PHE B CG    1 
ATOM   5621  C  CD1   . PHE B  2  309 ? 49.799  52.369  59.907  1.00 100.61 ? 307  PHE B CD1   1 
ATOM   5622  C  CD2   . PHE B  2  309 ? 47.706  52.013  58.804  1.00 100.28 ? 307  PHE B CD2   1 
ATOM   5623  C  CE1   . PHE B  2  309 ? 50.430  51.499  59.019  1.00 99.36  ? 307  PHE B CE1   1 
ATOM   5624  C  CE2   . PHE B  2  309 ? 48.333  51.141  57.912  1.00 99.92  ? 307  PHE B CE2   1 
ATOM   5625  C  CZ    . PHE B  2  309 ? 49.696  50.887  58.022  1.00 99.23  ? 307  PHE B CZ    1 
ATOM   5626  N  N     . ASP B  2  310 ? 50.237  55.141  60.671  1.00 97.07  ? 308  ASP B N     1 
ATOM   5627  C  CA    . ASP B  2  310 ? 51.643  55.286  60.360  1.00 97.19  ? 308  ASP B CA    1 
ATOM   5628  C  C     . ASP B  2  310 ? 52.422  54.486  61.385  1.00 97.61  ? 308  ASP B C     1 
ATOM   5629  O  O     . ASP B  2  310 ? 52.142  54.553  62.580  1.00 97.70  ? 308  ASP B O     1 
ATOM   5630  C  CB    . ASP B  2  310 ? 52.077  56.744  60.394  1.00 97.20  ? 308  ASP B CB    1 
ATOM   5631  C  CG    . ASP B  2  310 ? 53.466  56.942  59.824  1.00 97.10  ? 308  ASP B CG    1 
ATOM   5632  O  OD1   . ASP B  2  310 ? 53.731  56.447  58.708  1.00 99.17  ? 308  ASP B OD1   1 
ATOM   5633  O  OD2   . ASP B  2  310 ? 54.293  57.592  60.487  1.00 97.33  ? 308  ASP B OD2   1 
ATOM   5634  N  N     . ALA B  2  311 ? 53.390  53.715  60.899  1.00 97.95  ? 309  ALA B N     1 
ATOM   5635  C  CA    . ALA B  2  311 ? 54.223  52.871  61.748  1.00 97.34  ? 309  ALA B CA    1 
ATOM   5636  C  C     . ALA B  2  311 ? 55.630  52.814  61.161  1.00 96.13  ? 309  ALA B C     1 
ATOM   5637  O  O     . ALA B  2  311 ? 55.786  52.593  59.964  1.00 95.94  ? 309  ALA B O     1 
ATOM   5638  C  CB    . ALA B  2  311 ? 53.621  51.468  61.825  1.00 96.85  ? 309  ALA B CB    1 
ATOM   5639  N  N     . SER B  2  312 ? 56.646  53.009  61.998  1.00 95.32  ? 310  SER B N     1 
ATOM   5640  C  CA    . SER B  2  312 ? 58.026  52.991  61.523  1.00 94.73  ? 310  SER B CA    1 
ATOM   5641  C  C     . SER B  2  312 ? 59.019  52.269  62.420  1.00 94.36  ? 310  SER B C     1 
ATOM   5642  O  O     . SER B  2  312 ? 58.692  51.836  63.522  1.00 94.68  ? 310  SER B O     1 
ATOM   5643  C  CB    . SER B  2  312 ? 58.511  54.416  61.295  1.00 94.66  ? 310  SER B CB    1 
ATOM   5644  O  OG    . SER B  2  312 ? 57.686  55.073  60.349  1.00 96.59  ? 310  SER B OG    1 
ATOM   5645  N  N     . ALA B  2  313 ? 60.245  52.142  61.929  1.00 93.82  ? 311  ALA B N     1 
ATOM   5646  C  CA    . ALA B  2  313 ? 61.292  51.474  62.679  1.00 93.25  ? 311  ALA B CA    1 
ATOM   5647  C  C     . ALA B  2  313 ? 62.063  52.515  63.466  1.00 92.81  ? 311  ALA B C     1 
ATOM   5648  O  O     . ALA B  2  313 ? 62.716  53.388  62.893  1.00 92.92  ? 311  ALA B O     1 
ATOM   5649  C  CB    . ALA B  2  313 ? 62.224  50.730  61.734  1.00 94.18  ? 311  ALA B CB    1 
ATOM   5650  N  N     . PHE B  2  314 ? 61.978  52.411  64.785  1.00 92.44  ? 312  PHE B N     1 
ATOM   5651  C  CA    . PHE B  2  314 ? 62.649  53.339  65.682  1.00 92.56  ? 312  PHE B CA    1 
ATOM   5652  C  C     . PHE B  2  314 ? 64.065  52.891  66.008  1.00 92.19  ? 312  PHE B C     1 
ATOM   5653  O  O     . PHE B  2  314 ? 64.297  51.719  66.294  1.00 91.54  ? 312  PHE B O     1 
ATOM   5654  C  CB    . PHE B  2  314 ? 61.851  53.460  66.973  1.00 93.13  ? 312  PHE B CB    1 
ATOM   5655  C  CG    . PHE B  2  314 ? 62.410  54.460  67.920  1.00 93.47  ? 312  PHE B CG    1 
ATOM   5656  C  CD1   . PHE B  2  314 ? 62.404  55.811  67.601  1.00 93.13  ? 312  PHE B CD1   1 
ATOM   5657  C  CD2   . PHE B  2  314 ? 62.957  54.054  69.125  1.00 94.15  ? 312  PHE B CD2   1 
ATOM   5658  C  CE1   . PHE B  2  314 ? 62.933  56.747  68.465  1.00 93.98  ? 312  PHE B CE1   1 
ATOM   5659  C  CE2   . PHE B  2  314 ? 63.490  54.981  70.002  1.00 95.04  ? 312  PHE B CE2   1 
ATOM   5660  C  CZ    . PHE B  2  314 ? 63.478  56.335  69.671  1.00 95.32  ? 312  PHE B CZ    1 
ATOM   5661  N  N     . ASN B  2  315 ? 65.009  53.823  65.999  1.00 92.14  ? 313  ASN B N     1 
ATOM   5662  C  CA    . ASN B  2  315 ? 66.387  53.451  66.279  1.00 93.54  ? 313  ASN B CA    1 
ATOM   5663  C  C     . ASN B  2  315 ? 67.315  54.592  66.700  1.00 93.75  ? 313  ASN B C     1 
ATOM   5664  O  O     . ASN B  2  315 ? 67.589  55.514  65.929  1.00 93.66  ? 313  ASN B O     1 
ATOM   5665  C  CB    . ASN B  2  315 ? 66.967  52.733  65.051  1.00 94.53  ? 313  ASN B CB    1 
ATOM   5666  C  CG    . ASN B  2  315 ? 68.446  52.389  65.201  1.00 95.16  ? 313  ASN B CG    1 
ATOM   5667  O  OD1   . ASN B  2  315 ? 68.834  51.600  66.070  1.00 94.97  ? 313  ASN B OD1   1 
ATOM   5668  N  ND2   . ASN B  2  315 ? 69.279  52.982  64.346  1.00 94.85  ? 313  ASN B ND2   1 
ATOM   5669  N  N     . VAL B  2  316 ? 67.806  54.507  67.933  1.00 93.76  ? 314  VAL B N     1 
ATOM   5670  C  CA    . VAL B  2  316 ? 68.726  55.498  68.473  1.00 93.41  ? 314  VAL B CA    1 
ATOM   5671  C  C     . VAL B  2  316 ? 69.969  54.790  68.964  1.00 93.53  ? 314  VAL B C     1 
ATOM   5672  O  O     . VAL B  2  316 ? 69.898  53.676  69.494  1.00 94.67  ? 314  VAL B O     1 
ATOM   5673  C  CB    . VAL B  2  316 ? 68.152  56.213  69.687  1.00 93.94  ? 314  VAL B CB    1 
ATOM   5674  C  CG1   . VAL B  2  316 ? 69.002  57.437  70.005  1.00 93.34  ? 314  VAL B CG1   1 
ATOM   5675  C  CG2   . VAL B  2  316 ? 66.709  56.566  69.445  1.00 95.00  ? 314  VAL B CG2   1 
ATOM   5676  N  N     . ASN B  2  317 ? 71.108  55.440  68.805  1.00 92.82  ? 315  ASN B N     1 
ATOM   5677  C  CA    . ASN B  2  317 ? 72.351  54.853  69.258  1.00 93.20  ? 315  ASN B CA    1 
ATOM   5678  C  C     . ASN B  2  317 ? 73.064  55.865  70.149  1.00 93.55  ? 315  ASN B C     1 
ATOM   5679  O  O     . ASN B  2  317 ? 73.562  56.889  69.672  1.00 92.63  ? 315  ASN B O     1 
ATOM   5680  C  CB    . ASN B  2  317 ? 73.233  54.456  68.054  1.00 93.77  ? 315  ASN B CB    1 
ATOM   5681  C  CG    . ASN B  2  317 ? 72.577  53.385  67.151  1.00 93.88  ? 315  ASN B CG    1 
ATOM   5682  O  OD1   . ASN B  2  317 ? 72.019  52.393  67.632  1.00 93.64  ? 315  ASN B OD1   1 
ATOM   5683  N  ND2   . ASN B  2  317 ? 72.666  53.583  65.841  1.00 93.18  ? 315  ASN B ND2   1 
ATOM   5684  N  N     . TYR B  2  318 ? 73.089  55.583  71.451  1.00 94.43  ? 316  TYR B N     1 
ATOM   5685  C  CA    . TYR B  2  318 ? 73.742  56.462  72.428  1.00 95.24  ? 316  TYR B CA    1 
ATOM   5686  C  C     . TYR B  2  318 ? 75.096  55.892  72.844  1.00 94.13  ? 316  TYR B C     1 
ATOM   5687  O  O     . TYR B  2  318 ? 75.397  54.734  72.571  1.00 94.83  ? 316  TYR B O     1 
ATOM   5688  C  CB    . TYR B  2  318 ? 72.855  56.634  73.673  1.00 97.51  ? 316  TYR B CB    1 
ATOM   5689  C  CG    . TYR B  2  318 ? 71.580  57.432  73.448  1.00 98.97  ? 316  TYR B CG    1 
ATOM   5690  C  CD1   . TYR B  2  318 ? 70.356  56.974  73.931  1.00 99.24  ? 316  TYR B CD1   1 
ATOM   5691  C  CD2   . TYR B  2  318 ? 71.605  58.657  72.772  1.00 99.35  ? 316  TYR B CD2   1 
ATOM   5692  C  CE1   . TYR B  2  318 ? 69.185  57.717  73.749  1.00 100.84 ? 316  TYR B CE1   1 
ATOM   5693  C  CE2   . TYR B  2  318 ? 70.442  59.409  72.584  1.00 99.96  ? 316  TYR B CE2   1 
ATOM   5694  C  CZ    . TYR B  2  318 ? 69.234  58.937  73.078  1.00 101.13 ? 316  TYR B CZ    1 
ATOM   5695  O  OH    . TYR B  2  318 ? 68.084  59.695  72.929  1.00 101.96 ? 316  TYR B OH    1 
ATOM   5696  N  N     . SER B  2  319 ? 75.902  56.704  73.520  1.00 92.80  ? 317  SER B N     1 
ATOM   5697  C  CA    . SER B  2  319 ? 77.234  56.285  73.961  1.00 91.38  ? 317  SER B CA    1 
ATOM   5698  C  C     . SER B  2  319 ? 77.326  54.899  74.622  1.00 89.96  ? 317  SER B C     1 
ATOM   5699  O  O     . SER B  2  319 ? 77.942  53.984  74.072  1.00 90.08  ? 317  SER B O     1 
ATOM   5700  C  CB    . SER B  2  319 ? 77.822  57.332  74.913  1.00 91.14  ? 317  SER B CB    1 
ATOM   5701  O  OG    . SER B  2  319 ? 77.168  57.310  76.172  1.00 90.57  ? 317  SER B OG    1 
ATOM   5702  N  N     . ASP B  2  320 ? 76.722  54.741  75.796  1.00 87.59  ? 318  ASP B N     1 
ATOM   5703  C  CA    . ASP B  2  320 ? 76.797  53.469  76.498  1.00 86.32  ? 318  ASP B CA    1 
ATOM   5704  C  C     . ASP B  2  320 ? 75.541  52.614  76.438  1.00 85.56  ? 318  ASP B C     1 
ATOM   5705  O  O     . ASP B  2  320 ? 75.270  51.827  77.353  1.00 84.96  ? 318  ASP B O     1 
ATOM   5706  C  CB    . ASP B  2  320 ? 77.199  53.697  77.963  1.00 87.58  ? 318  ASP B CB    1 
ATOM   5707  C  CG    . ASP B  2  320 ? 76.163  54.489  78.754  1.00 88.28  ? 318  ASP B CG    1 
ATOM   5708  O  OD1   . ASP B  2  320 ? 75.081  53.941  79.069  1.00 88.05  ? 318  ASP B OD1   1 
ATOM   5709  O  OD2   . ASP B  2  320 ? 76.442  55.666  79.068  1.00 88.73  ? 318  ASP B OD2   1 
ATOM   5710  N  N     . SER B  2  321 ? 74.783  52.759  75.357  1.00 84.40  ? 319  SER B N     1 
ATOM   5711  C  CA    . SER B  2  321 ? 73.559  51.982  75.171  1.00 83.15  ? 319  SER B CA    1 
ATOM   5712  C  C     . SER B  2  321 ? 72.765  52.479  73.970  1.00 82.33  ? 319  SER B C     1 
ATOM   5713  O  O     . SER B  2  321 ? 73.193  53.389  73.258  1.00 81.64  ? 319  SER B O     1 
ATOM   5714  C  CB    . SER B  2  321 ? 72.683  52.047  76.428  1.00 83.04  ? 319  SER B CB    1 
ATOM   5715  O  OG    . SER B  2  321 ? 71.496  51.289  76.262  1.00 83.28  ? 319  SER B OG    1 
ATOM   5716  N  N     . GLY B  2  322 ? 71.606  51.872  73.748  1.00 81.97  ? 320  GLY B N     1 
ATOM   5717  C  CA    . GLY B  2  322 ? 70.772  52.277  72.636  1.00 82.67  ? 320  GLY B CA    1 
ATOM   5718  C  C     . GLY B  2  322 ? 69.365  51.736  72.774  1.00 83.33  ? 320  GLY B C     1 
ATOM   5719  O  O     . GLY B  2  322 ? 69.082  50.927  73.672  1.00 82.89  ? 320  GLY B O     1 
ATOM   5720  N  N     . LEU B  2  323 ? 68.482  52.192  71.887  1.00 83.10  ? 321  LEU B N     1 
ATOM   5721  C  CA    . LEU B  2  323 ? 67.087  51.755  71.878  1.00 82.29  ? 321  LEU B CA    1 
ATOM   5722  C  C     . LEU B  2  323 ? 66.674  51.416  70.450  1.00 81.05  ? 321  LEU B C     1 
ATOM   5723  O  O     . LEU B  2  323 ? 67.104  52.069  69.496  1.00 80.78  ? 321  LEU B O     1 
ATOM   5724  C  CB    . LEU B  2  323 ? 66.165  52.854  72.435  1.00 82.68  ? 321  LEU B CB    1 
ATOM   5725  C  CG    . LEU B  2  323 ? 66.184  53.171  73.939  1.00 82.20  ? 321  LEU B CG    1 
ATOM   5726  C  CD1   . LEU B  2  323 ? 65.185  54.286  74.245  1.00 81.01  ? 321  LEU B CD1   1 
ATOM   5727  C  CD2   . LEU B  2  323 ? 65.845  51.915  74.739  1.00 81.07  ? 321  LEU B CD2   1 
ATOM   5728  N  N     . PHE B  2  324 ? 65.843  50.393  70.310  1.00 78.98  ? 322  PHE B N     1 
ATOM   5729  C  CA    . PHE B  2  324 ? 65.382  49.978  69.000  1.00 78.26  ? 322  PHE B CA    1 
ATOM   5730  C  C     . PHE B  2  324 ? 64.023  49.324  69.097  1.00 78.39  ? 322  PHE B C     1 
ATOM   5731  O  O     . PHE B  2  324 ? 63.753  48.540  70.008  1.00 77.56  ? 322  PHE B O     1 
ATOM   5732  C  CB    . PHE B  2  324 ? 66.359  48.987  68.375  1.00 78.29  ? 322  PHE B CB    1 
ATOM   5733  C  CG    . PHE B  2  324 ? 65.899  48.432  67.050  1.00 78.20  ? 322  PHE B CG    1 
ATOM   5734  C  CD1   . PHE B  2  324 ? 66.307  49.023  65.853  1.00 78.26  ? 322  PHE B CD1   1 
ATOM   5735  C  CD2   . PHE B  2  324 ? 65.043  47.328  66.999  1.00 77.07  ? 322  PHE B CD2   1 
ATOM   5736  C  CE1   . PHE B  2  324 ? 65.869  48.520  64.621  1.00 78.07  ? 322  PHE B CE1   1 
ATOM   5737  C  CE2   . PHE B  2  324 ? 64.598  46.818  65.777  1.00 76.55  ? 322  PHE B CE2   1 
ATOM   5738  C  CZ    . PHE B  2  324 ? 65.011  47.415  64.586  1.00 77.38  ? 322  PHE B CZ    1 
ATOM   5739  N  N     . GLY B  2  325 ? 63.176  49.639  68.126  1.00 78.65  ? 323  GLY B N     1 
ATOM   5740  C  CA    . GLY B  2  325 ? 61.840  49.085  68.092  1.00 78.36  ? 323  GLY B CA    1 
ATOM   5741  C  C     . GLY B  2  325 ? 61.026  49.809  67.044  1.00 78.78  ? 323  GLY B C     1 
ATOM   5742  O  O     . GLY B  2  325 ? 61.563  50.273  66.041  1.00 79.01  ? 323  GLY B O     1 
ATOM   5743  N  N     . PHE B  2  326 ? 59.729  49.937  67.285  1.00 79.18  ? 324  PHE B N     1 
ATOM   5744  C  CA    . PHE B  2  326 ? 58.851  50.592  66.331  1.00 78.57  ? 324  PHE B CA    1 
ATOM   5745  C  C     . PHE B  2  326 ? 57.928  51.604  66.992  1.00 78.96  ? 324  PHE B C     1 
ATOM   5746  O  O     . PHE B  2  326 ? 57.501  51.413  68.129  1.00 79.72  ? 324  PHE B O     1 
ATOM   5747  C  CB    . PHE B  2  326 ? 58.018  49.530  65.632  1.00 78.13  ? 324  PHE B CB    1 
ATOM   5748  C  CG    . PHE B  2  326 ? 57.197  48.703  66.573  1.00 77.56  ? 324  PHE B CG    1 
ATOM   5749  C  CD1   . PHE B  2  326 ? 55.901  49.066  66.883  1.00 77.75  ? 324  PHE B CD1   1 
ATOM   5750  C  CD2   . PHE B  2  326 ? 57.721  47.561  67.149  1.00 78.84  ? 324  PHE B CD2   1 
ATOM   5751  C  CE1   . PHE B  2  326 ? 55.133  48.305  67.750  1.00 79.34  ? 324  PHE B CE1   1 
ATOM   5752  C  CE2   . PHE B  2  326 ? 56.962  46.790  68.021  1.00 79.64  ? 324  PHE B CE2   1 
ATOM   5753  C  CZ    . PHE B  2  326 ? 55.662  47.165  68.320  1.00 79.94  ? 324  PHE B CZ    1 
ATOM   5754  N  N     . TYR B  2  327 ? 57.614  52.669  66.257  1.00 78.74  ? 325  TYR B N     1 
ATOM   5755  C  CA    . TYR B  2  327 ? 56.729  53.729  66.722  1.00 77.29  ? 325  TYR B CA    1 
ATOM   5756  C  C     . TYR B  2  327 ? 55.515  53.754  65.798  1.00 77.08  ? 325  TYR B C     1 
ATOM   5757  O  O     . TYR B  2  327 ? 55.647  53.790  64.580  1.00 76.12  ? 325  TYR B O     1 
ATOM   5758  C  CB    . TYR B  2  327 ? 57.459  55.075  66.667  1.00 77.17  ? 325  TYR B CB    1 
ATOM   5759  C  CG    . TYR B  2  327 ? 56.715  56.239  67.296  1.00 79.07  ? 325  TYR B CG    1 
ATOM   5760  C  CD1   . TYR B  2  327 ? 57.380  57.136  68.126  1.00 79.32  ? 325  TYR B CD1   1 
ATOM   5761  C  CD2   . TYR B  2  327 ? 55.356  56.461  67.048  1.00 79.25  ? 325  TYR B CD2   1 
ATOM   5762  C  CE1   . TYR B  2  327 ? 56.732  58.221  68.694  1.00 79.46  ? 325  TYR B CE1   1 
ATOM   5763  C  CE2   . TYR B  2  327 ? 54.690  57.548  67.616  1.00 79.48  ? 325  TYR B CE2   1 
ATOM   5764  C  CZ    . TYR B  2  327 ? 55.391  58.426  68.443  1.00 80.03  ? 325  TYR B CZ    1 
ATOM   5765  O  OH    . TYR B  2  327 ? 54.767  59.501  69.038  1.00 79.70  ? 325  TYR B OH    1 
ATOM   5766  N  N     . THR B  2  328 ? 54.327  53.734  66.378  1.00 78.07  ? 326  THR B N     1 
ATOM   5767  C  CA    . THR B  2  328 ? 53.117  53.765  65.576  1.00 79.59  ? 326  THR B CA    1 
ATOM   5768  C  C     . THR B  2  328 ? 52.186  54.912  65.958  1.00 80.24  ? 326  THR B C     1 
ATOM   5769  O  O     . THR B  2  328 ? 52.210  55.409  67.083  1.00 81.73  ? 326  THR B O     1 
ATOM   5770  C  CB    . THR B  2  328 ? 52.301  52.477  65.729  1.00 80.04  ? 326  THR B CB    1 
ATOM   5771  O  OG1   . THR B  2  328 ? 51.805  52.393  67.074  1.00 80.56  ? 326  THR B OG1   1 
ATOM   5772  C  CG2   . THR B  2  328 ? 53.148  51.269  65.406  1.00 79.30  ? 326  THR B CG2   1 
ATOM   5773  N  N     . ILE B  2  329 ? 51.363  55.312  64.997  1.00 79.71  ? 327  ILE B N     1 
ATOM   5774  C  CA    . ILE B  2  329 ? 50.363  56.353  65.172  1.00 78.11  ? 327  ILE B CA    1 
ATOM   5775  C  C     . ILE B  2  329 ? 49.144  55.786  64.467  1.00 78.45  ? 327  ILE B C     1 
ATOM   5776  O  O     . ILE B  2  329 ? 49.229  55.399  63.301  1.00 79.80  ? 327  ILE B O     1 
ATOM   5777  C  CB    . ILE B  2  329 ? 50.739  57.636  64.450  1.00 76.28  ? 327  ILE B CB    1 
ATOM   5778  C  CG1   . ILE B  2  329 ? 52.100  58.128  64.910  1.00 75.34  ? 327  ILE B CG1   1 
ATOM   5779  C  CG2   . ILE B  2  329 ? 49.699  58.685  64.722  1.00 76.66  ? 327  ILE B CG2   1 
ATOM   5780  C  CD1   . ILE B  2  329 ? 52.553  59.355  64.163  1.00 74.75  ? 327  ILE B CD1   1 
ATOM   5781  N  N     . SER B  2  330 ? 48.015  55.721  65.154  1.00 77.97  ? 328  SER B N     1 
ATOM   5782  C  CA    . SER B  2  330 ? 46.816  55.178  64.529  1.00 77.68  ? 328  SER B CA    1 
ATOM   5783  C  C     . SER B  2  330 ? 45.572  55.643  65.258  1.00 78.04  ? 328  SER B C     1 
ATOM   5784  O  O     . SER B  2  330 ? 45.643  56.341  66.267  1.00 77.14  ? 328  SER B O     1 
ATOM   5785  C  CB    . SER B  2  330 ? 46.846  53.650  64.549  1.00 76.24  ? 328  SER B CB    1 
ATOM   5786  O  OG    . SER B  2  330 ? 46.629  53.175  65.865  1.00 73.33  ? 328  SER B OG    1 
ATOM   5787  N  N     . GLN B  2  331 ? 44.421  55.256  64.738  1.00 79.06  ? 329  GLN B N     1 
ATOM   5788  C  CA    . GLN B  2  331 ? 43.198  55.634  65.390  1.00 80.34  ? 329  GLN B CA    1 
ATOM   5789  C  C     . GLN B  2  331 ? 43.172  54.869  66.699  1.00 80.02  ? 329  GLN B C     1 
ATOM   5790  O  O     . GLN B  2  331 ? 43.775  53.807  66.831  1.00 79.38  ? 329  GLN B O     1 
ATOM   5791  C  CB    . GLN B  2  331 ? 42.006  55.292  64.508  1.00 82.75  ? 329  GLN B CB    1 
ATOM   5792  C  CG    . GLN B  2  331 ? 42.085  55.992  63.166  1.00 86.74  ? 329  GLN B CG    1 
ATOM   5793  C  CD    . GLN B  2  331 ? 40.748  56.071  62.453  1.00 89.47  ? 329  GLN B CD    1 
ATOM   5794  O  OE1   . GLN B  2  331 ? 40.666  56.572  61.326  1.00 90.75  ? 329  GLN B OE1   1 
ATOM   5795  N  NE2   . GLN B  2  331 ? 39.691  55.583  63.104  1.00 89.61  ? 329  GLN B NE2   1 
ATOM   5796  N  N     . ALA B  2  332 ? 42.489  55.433  67.675  1.00 80.02  ? 330  ALA B N     1 
ATOM   5797  C  CA    . ALA B  2  332 ? 42.399  54.827  68.982  1.00 80.31  ? 330  ALA B CA    1 
ATOM   5798  C  C     . ALA B  2  332 ? 41.914  53.383  68.952  1.00 80.74  ? 330  ALA B C     1 
ATOM   5799  O  O     . ALA B  2  332 ? 42.523  52.498  69.553  1.00 80.90  ? 330  ALA B O     1 
ATOM   5800  C  CB    . ALA B  2  332 ? 41.485  55.662  69.848  1.00 80.74  ? 330  ALA B CB    1 
ATOM   5801  N  N     . ALA B  2  333 ? 40.808  53.154  68.261  1.00 80.99  ? 331  ALA B N     1 
ATOM   5802  C  CA    . ALA B  2  333 ? 40.223  51.826  68.178  1.00 82.37  ? 331  ALA B CA    1 
ATOM   5803  C  C     . ALA B  2  333 ? 41.130  50.782  67.543  1.00 83.44  ? 331  ALA B C     1 
ATOM   5804  O  O     . ALA B  2  333 ? 41.192  49.640  68.004  1.00 84.00  ? 331  ALA B O     1 
ATOM   5805  C  CB    . ALA B  2  333 ? 38.918  51.893  67.415  1.00 82.19  ? 331  ALA B CB    1 
ATOM   5806  N  N     . HIS B  2  334 ? 41.830  51.168  66.483  1.00 83.61  ? 332  HIS B N     1 
ATOM   5807  C  CA    . HIS B  2  334 ? 42.697  50.237  65.787  1.00 83.44  ? 332  HIS B CA    1 
ATOM   5808  C  C     . HIS B  2  334 ? 44.084  50.211  66.393  1.00 84.37  ? 332  HIS B C     1 
ATOM   5809  O  O     . HIS B  2  334 ? 45.033  49.760  65.760  1.00 86.25  ? 332  HIS B O     1 
ATOM   5810  C  CB    . HIS B  2  334 ? 42.754  50.608  64.305  1.00 82.54  ? 332  HIS B CB    1 
ATOM   5811  C  CG    . HIS B  2  334 ? 41.403  50.858  63.706  1.00 83.15  ? 332  HIS B CG    1 
ATOM   5812  N  ND1   . HIS B  2  334 ? 40.347  49.981  63.854  1.00 82.16  ? 332  HIS B ND1   1 
ATOM   5813  C  CD2   . HIS B  2  334 ? 40.920  51.907  62.998  1.00 83.15  ? 332  HIS B CD2   1 
ATOM   5814  C  CE1   . HIS B  2  334 ? 39.273  50.479  63.267  1.00 81.36  ? 332  HIS B CE1   1 
ATOM   5815  N  NE2   . HIS B  2  334 ? 39.593  51.647  62.740  1.00 82.97  ? 332  HIS B NE2   1 
ATOM   5816  N  N     . ALA B  2  335 ? 44.200  50.683  67.631  1.00 85.19  ? 333  ALA B N     1 
ATOM   5817  C  CA    . ALA B  2  335 ? 45.489  50.709  68.323  1.00 85.45  ? 333  ALA B CA    1 
ATOM   5818  C  C     . ALA B  2  335 ? 45.985  49.286  68.574  1.00 85.80  ? 333  ALA B C     1 
ATOM   5819  O  O     . ALA B  2  335 ? 47.162  48.971  68.352  1.00 83.99  ? 333  ALA B O     1 
ATOM   5820  C  CB    . ALA B  2  335 ? 45.361  51.472  69.647  1.00 85.24  ? 333  ALA B CB    1 
ATOM   5821  N  N     . GLY B  2  336 ? 45.073  48.432  69.034  1.00 86.89  ? 334  GLY B N     1 
ATOM   5822  C  CA    . GLY B  2  336 ? 45.418  47.050  69.308  1.00 88.29  ? 334  GLY B CA    1 
ATOM   5823  C  C     . GLY B  2  336 ? 45.984  46.349  68.086  1.00 88.70  ? 334  GLY B C     1 
ATOM   5824  O  O     . GLY B  2  336 ? 47.090  45.801  68.134  1.00 88.97  ? 334  GLY B O     1 
ATOM   5825  N  N     . GLU B  2  337 ? 45.237  46.367  66.984  1.00 88.03  ? 335  GLU B N     1 
ATOM   5826  C  CA    . GLU B  2  337 ? 45.705  45.713  65.778  1.00 87.97  ? 335  GLU B CA    1 
ATOM   5827  C  C     . GLU B  2  337 ? 46.992  46.314  65.218  1.00 88.08  ? 335  GLU B C     1 
ATOM   5828  O  O     . GLU B  2  337 ? 47.957  45.584  64.987  1.00 89.55  ? 335  GLU B O     1 
ATOM   5829  C  CB    . GLU B  2  337 ? 44.602  45.680  64.715  1.00 88.26  ? 335  GLU B CB    1 
ATOM   5830  C  CG    . GLU B  2  337 ? 43.861  46.973  64.478  1.00 90.01  ? 335  GLU B CG    1 
ATOM   5831  C  CD    . GLU B  2  337 ? 42.626  46.778  63.593  1.00 90.94  ? 335  GLU B CD    1 
ATOM   5832  O  OE1   . GLU B  2  337 ? 41.731  45.997  63.994  1.00 90.45  ? 335  GLU B OE1   1 
ATOM   5833  O  OE2   . GLU B  2  337 ? 42.550  47.403  62.504  1.00 90.78  ? 335  GLU B OE2   1 
ATOM   5834  N  N     . VAL B  2  338 ? 47.029  47.627  65.015  1.00 86.63  ? 336  VAL B N     1 
ATOM   5835  C  CA    . VAL B  2  338 ? 48.234  48.258  64.492  1.00 85.97  ? 336  VAL B CA    1 
ATOM   5836  C  C     . VAL B  2  338 ? 49.475  47.901  65.311  1.00 87.80  ? 336  VAL B C     1 
ATOM   5837  O  O     . VAL B  2  338 ? 50.515  47.571  64.749  1.00 88.30  ? 336  VAL B O     1 
ATOM   5838  C  CB    . VAL B  2  338 ? 48.100  49.783  64.462  1.00 83.95  ? 336  VAL B CB    1 
ATOM   5839  C  CG1   . VAL B  2  338 ? 49.437  50.429  64.096  1.00 82.64  ? 336  VAL B CG1   1 
ATOM   5840  C  CG2   . VAL B  2  338 ? 47.043  50.169  63.473  1.00 82.70  ? 336  VAL B CG2   1 
ATOM   5841  N  N     . ILE B  2  339 ? 49.372  47.965  66.636  1.00 89.53  ? 337  ILE B N     1 
ATOM   5842  C  CA    . ILE B  2  339 ? 50.513  47.651  67.496  1.00 91.18  ? 337  ILE B CA    1 
ATOM   5843  C  C     . ILE B  2  339 ? 50.955  46.191  67.419  1.00 91.72  ? 337  ILE B C     1 
ATOM   5844  O  O     . ILE B  2  339 ? 52.143  45.917  67.222  1.00 92.13  ? 337  ILE B O     1 
ATOM   5845  C  CB    . ILE B  2  339 ? 50.222  48.004  68.974  1.00 92.19  ? 337  ILE B CB    1 
ATOM   5846  C  CG1   . ILE B  2  339 ? 50.022  49.512  69.104  1.00 92.15  ? 337  ILE B CG1   1 
ATOM   5847  C  CG2   . ILE B  2  339 ? 51.383  47.554  69.872  1.00 91.75  ? 337  ILE B CG2   1 
ATOM   5848  C  CD1   . ILE B  2  339 ? 49.734  49.960  70.505  1.00 93.33  ? 337  ILE B CD1   1 
ATOM   5849  N  N     . ARG B  2  340 ? 50.013  45.259  67.583  1.00 91.65  ? 338  ARG B N     1 
ATOM   5850  C  CA    . ARG B  2  340 ? 50.338  43.834  67.516  1.00 91.89  ? 338  ARG B CA    1 
ATOM   5851  C  C     . ARG B  2  340 ? 50.834  43.440  66.125  1.00 92.32  ? 338  ARG B C     1 
ATOM   5852  O  O     . ARG B  2  340 ? 51.828  42.726  65.992  1.00 92.49  ? 338  ARG B O     1 
ATOM   5853  C  CB    . ARG B  2  340 ? 49.128  42.979  67.899  1.00 91.50  ? 338  ARG B CB    1 
ATOM   5854  C  CG    . ARG B  2  340 ? 48.838  42.941  69.391  1.00 91.98  ? 338  ARG B CG    1 
ATOM   5855  C  CD    . ARG B  2  340 ? 47.756  41.925  69.717  1.00 91.86  ? 338  ARG B CD    1 
ATOM   5856  N  NE    . ARG B  2  340 ? 46.509  42.190  68.995  1.00 93.66  ? 338  ARG B NE    1 
ATOM   5857  C  CZ    . ARG B  2  340 ? 45.563  43.047  69.381  1.00 93.92  ? 338  ARG B CZ    1 
ATOM   5858  N  NH1   . ARG B  2  340 ? 45.703  43.743  70.501  1.00 94.56  ? 338  ARG B NH1   1 
ATOM   5859  N  NH2   . ARG B  2  340 ? 44.471  43.210  68.641  1.00 93.22  ? 338  ARG B NH2   1 
ATOM   5860  N  N     . ALA B  2  341 ? 50.144  43.906  65.089  1.00 92.41  ? 339  ALA B N     1 
ATOM   5861  C  CA    . ALA B  2  341 ? 50.547  43.610  63.722  1.00 92.94  ? 339  ALA B CA    1 
ATOM   5862  C  C     . ALA B  2  341 ? 51.993  44.065  63.496  1.00 93.56  ? 339  ALA B C     1 
ATOM   5863  O  O     . ALA B  2  341 ? 52.686  43.553  62.616  1.00 94.41  ? 339  ALA B O     1 
ATOM   5864  C  CB    . ALA B  2  341 ? 49.620  44.309  62.745  1.00 92.68  ? 339  ALA B CB    1 
ATOM   5865  N  N     . ALA B  2  342 ? 52.442  45.025  64.298  1.00 93.75  ? 340  ALA B N     1 
ATOM   5866  C  CA    . ALA B  2  342 ? 53.799  45.543  64.192  1.00 94.26  ? 340  ALA B CA    1 
ATOM   5867  C  C     . ALA B  2  342 ? 54.767  44.629  64.930  1.00 95.43  ? 340  ALA B C     1 
ATOM   5868  O  O     . ALA B  2  342 ? 55.966  44.625  64.642  1.00 96.13  ? 340  ALA B O     1 
ATOM   5869  C  CB    . ALA B  2  342 ? 53.867  46.944  64.768  1.00 94.16  ? 340  ALA B CB    1 
ATOM   5870  N  N     . MET B  2  343 ? 54.251  43.865  65.892  1.00 96.11  ? 341  MET B N     1 
ATOM   5871  C  CA    . MET B  2  343 ? 55.083  42.932  66.655  1.00 96.76  ? 341  MET B CA    1 
ATOM   5872  C  C     . MET B  2  343 ? 55.387  41.718  65.796  1.00 97.93  ? 341  MET B C     1 
ATOM   5873  O  O     . MET B  2  343 ? 56.553  41.376  65.577  1.00 97.63  ? 341  MET B O     1 
ATOM   5874  C  CB    . MET B  2  343 ? 54.374  42.466  67.934  1.00 95.17  ? 341  MET B CB    1 
ATOM   5875  C  CG    . MET B  2  343 ? 54.584  43.355  69.146  1.00 93.61  ? 341  MET B CG    1 
ATOM   5876  S  SD    . MET B  2  343 ? 56.316  43.571  69.581  1.00 92.47  ? 341  MET B SD    1 
ATOM   5877  C  CE    . MET B  2  343 ? 56.640  42.105  70.479  1.00 92.60  ? 341  MET B CE    1 
ATOM   5878  N  N     . ASN B  2  344 ? 54.320  41.076  65.318  1.00 99.50  ? 342  ASN B N     1 
ATOM   5879  C  CA    . ASN B  2  344 ? 54.423  39.889  64.473  1.00 100.91 ? 342  ASN B CA    1 
ATOM   5880  C  C     . ASN B  2  344 ? 55.281  40.223  63.275  1.00 100.61 ? 342  ASN B C     1 
ATOM   5881  O  O     . ASN B  2  344 ? 56.054  39.398  62.794  1.00 101.36 ? 342  ASN B O     1 
ATOM   5882  C  CB    . ASN B  2  344 ? 53.042  39.444  63.978  1.00 102.19 ? 342  ASN B CB    1 
ATOM   5883  C  CG    . ASN B  2  344 ? 51.997  39.431  65.082  1.00 104.19 ? 342  ASN B CG    1 
ATOM   5884  O  OD1   . ASN B  2  344 ? 52.214  38.876  66.166  1.00 105.07 ? 342  ASN B OD1   1 
ATOM   5885  N  ND2   . ASN B  2  344 ? 50.848  40.039  64.807  1.00 104.98 ? 342  ASN B ND2   1 
ATOM   5886  N  N     . GLN B  2  345 ? 55.135  41.446  62.789  1.00 99.97  ? 343  GLN B N     1 
ATOM   5887  C  CA    . GLN B  2  345 ? 55.906  41.881  61.645  1.00 99.44  ? 343  GLN B CA    1 
ATOM   5888  C  C     . GLN B  2  345 ? 57.384  41.902  62.006  1.00 98.11  ? 343  GLN B C     1 
ATOM   5889  O  O     . GLN B  2  345 ? 58.243  41.787  61.134  1.00 97.59  ? 343  GLN B O     1 
ATOM   5890  C  CB    . GLN B  2  345 ? 55.455  43.272  61.209  1.00 101.06 ? 343  GLN B CB    1 
ATOM   5891  C  CG    . GLN B  2  345 ? 56.018  43.692  59.872  1.00 101.69 ? 343  GLN B CG    1 
ATOM   5892  C  CD    . GLN B  2  345 ? 55.691  42.690  58.789  1.00 102.24 ? 343  GLN B CD    1 
ATOM   5893  O  OE1   . GLN B  2  345 ? 54.535  42.315  58.602  1.00 101.99 ? 343  GLN B OE1   1 
ATOM   5894  N  NE2   . GLN B  2  345 ? 56.710  42.251  58.067  1.00 103.21 ? 343  GLN B NE2   1 
ATOM   5895  N  N     . LEU B  2  346 ? 57.679  42.044  63.295  1.00 96.77  ? 344  LEU B N     1 
ATOM   5896  C  CA    . LEU B  2  346 ? 59.064  42.082  63.736  1.00 95.97  ? 344  LEU B CA    1 
ATOM   5897  C  C     . LEU B  2  346 ? 59.591  40.696  64.072  1.00 96.26  ? 344  LEU B C     1 
ATOM   5898  O  O     . LEU B  2  346 ? 60.793  40.447  64.014  1.00 95.89  ? 344  LEU B O     1 
ATOM   5899  C  CB    . LEU B  2  346 ? 59.224  42.996  64.947  1.00 94.53  ? 344  LEU B CB    1 
ATOM   5900  C  CG    . LEU B  2  346 ? 60.419  43.919  64.716  1.00 92.77  ? 344  LEU B CG    1 
ATOM   5901  C  CD1   . LEU B  2  346 ? 59.945  45.144  63.970  1.00 92.22  ? 344  LEU B CD1   1 
ATOM   5902  C  CD2   . LEU B  2  346 ? 61.054  44.311  66.018  1.00 91.70  ? 344  LEU B CD2   1 
ATOM   5903  N  N     . LYS B  2  347 ? 58.688  39.795  64.440  1.00 97.04  ? 345  LYS B N     1 
ATOM   5904  C  CA    . LYS B  2  347 ? 59.074  38.427  64.759  1.00 96.89  ? 345  LYS B CA    1 
ATOM   5905  C  C     . LYS B  2  347 ? 59.313  37.675  63.457  1.00 96.41  ? 345  LYS B C     1 
ATOM   5906  O  O     . LYS B  2  347 ? 60.294  36.952  63.330  1.00 96.85  ? 345  LYS B O     1 
ATOM   5907  C  CB    . LYS B  2  347 ? 57.979  37.719  65.570  1.00 97.05  ? 345  LYS B CB    1 
ATOM   5908  C  CG    . LYS B  2  347 ? 57.745  38.306  66.953  1.00 97.99  ? 345  LYS B CG    1 
ATOM   5909  C  CD    . LYS B  2  347 ? 57.019  37.322  67.868  1.00 98.99  ? 345  LYS B CD    1 
ATOM   5910  C  CE    . LYS B  2  347 ? 55.587  37.050  67.414  1.00 99.55  ? 345  LYS B CE    1 
ATOM   5911  N  NZ    . LYS B  2  347 ? 54.690  38.234  67.562  1.00 98.46  ? 345  LYS B NZ    1 
ATOM   5912  N  N     . ALA B  2  348 ? 58.413  37.856  62.494  1.00 96.07  ? 346  ALA B N     1 
ATOM   5913  C  CA    . ALA B  2  348 ? 58.524  37.196  61.200  1.00 95.82  ? 346  ALA B CA    1 
ATOM   5914  C  C     . ALA B  2  348 ? 59.886  37.478  60.577  1.00 96.15  ? 346  ALA B C     1 
ATOM   5915  O  O     . ALA B  2  348 ? 60.402  36.674  59.800  1.00 96.40  ? 346  ALA B O     1 
ATOM   5916  C  CB    . ALA B  2  348 ? 57.409  37.666  60.273  1.00 94.96  ? 346  ALA B CB    1 
ATOM   5917  N  N     . ALA B  2  349 ? 60.469  38.621  60.924  1.00 96.49  ? 347  ALA B N     1 
ATOM   5918  C  CA    . ALA B  2  349 ? 61.777  38.995  60.402  1.00 97.36  ? 347  ALA B CA    1 
ATOM   5919  C  C     . ALA B  2  349 ? 62.848  38.318  61.236  1.00 97.98  ? 347  ALA B C     1 
ATOM   5920  O  O     . ALA B  2  349 ? 63.949  38.056  60.761  1.00 98.06  ? 347  ALA B O     1 
ATOM   5921  C  CB    . ALA B  2  349 ? 61.950  40.498  60.456  1.00 97.58  ? 347  ALA B CB    1 
ATOM   5922  N  N     . ALA B  2  350 ? 62.507  38.053  62.492  1.00 99.61  ? 348  ALA B N     1 
ATOM   5923  C  CA    . ALA B  2  350 ? 63.408  37.391  63.428  1.00 101.06 ? 348  ALA B CA    1 
ATOM   5924  C  C     . ALA B  2  350 ? 63.437  35.897  63.096  1.00 101.74 ? 348  ALA B C     1 
ATOM   5925  O  O     . ALA B  2  350 ? 64.351  35.170  63.492  1.00 101.94 ? 348  ALA B O     1 
ATOM   5926  C  CB    . ALA B  2  350 ? 62.921  37.611  64.866  1.00 101.09 ? 348  ALA B CB    1 
ATOM   5927  N  N     . GLN B  2  351 ? 62.423  35.455  62.357  1.00 102.09 ? 349  GLN B N     1 
ATOM   5928  C  CA    . GLN B  2  351 ? 62.308  34.065  61.942  1.00 101.76 ? 349  GLN B CA    1 
ATOM   5929  C  C     . GLN B  2  351 ? 62.552  33.951  60.443  1.00 102.29 ? 349  GLN B C     1 
ATOM   5930  O  O     . GLN B  2  351 ? 61.661  33.562  59.687  1.00 101.64 ? 349  GLN B O     1 
ATOM   5931  C  CB    . GLN B  2  351 ? 60.920  33.534  62.271  1.00 101.38 ? 349  GLN B CB    1 
ATOM   5932  C  CG    . GLN B  2  351 ? 60.533  33.721  63.718  1.00 102.89 ? 349  GLN B CG    1 
ATOM   5933  C  CD    . GLN B  2  351 ? 59.145  33.190  64.012  1.00 103.75 ? 349  GLN B CD    1 
ATOM   5934  O  OE1   . GLN B  2  351 ? 58.170  33.564  63.355  1.00 104.47 ? 349  GLN B OE1   1 
ATOM   5935  N  NE2   . GLN B  2  351 ? 59.047  32.315  65.005  1.00 104.55 ? 349  GLN B NE2   1 
ATOM   5936  N  N     . GLY B  2  352 ? 63.764  34.320  60.030  1.00 103.24 ? 350  GLY B N     1 
ATOM   5937  C  CA    . GLY B  2  352 ? 64.165  34.250  58.634  1.00 103.95 ? 350  GLY B CA    1 
ATOM   5938  C  C     . GLY B  2  352 ? 63.349  35.031  57.619  1.00 104.74 ? 350  GLY B C     1 
ATOM   5939  O  O     . GLY B  2  352 ? 63.518  34.833  56.412  1.00 105.53 ? 350  GLY B O     1 
ATOM   5940  N  N     . GLY B  2  353 ? 62.476  35.919  58.082  1.00 104.42 ? 351  GLY B N     1 
ATOM   5941  C  CA    . GLY B  2  353 ? 61.663  36.686  57.154  1.00 103.74 ? 351  GLY B CA    1 
ATOM   5942  C  C     . GLY B  2  353 ? 62.416  37.791  56.435  1.00 103.18 ? 351  GLY B C     1 
ATOM   5943  O  O     . GLY B  2  353 ? 61.839  38.825  56.113  1.00 103.55 ? 351  GLY B O     1 
ATOM   5944  N  N     . VAL B  2  354 ? 63.700  37.576  56.175  1.00 102.63 ? 352  VAL B N     1 
ATOM   5945  C  CA    . VAL B  2  354 ? 64.517  38.573  55.496  1.00 101.94 ? 352  VAL B CA    1 
ATOM   5946  C  C     . VAL B  2  354 ? 65.162  37.994  54.242  1.00 102.73 ? 352  VAL B C     1 
ATOM   5947  O  O     . VAL B  2  354 ? 65.830  36.962  54.298  1.00 102.99 ? 352  VAL B O     1 
ATOM   5948  C  CB    . VAL B  2  354 ? 65.645  39.087  56.413  1.00 101.08 ? 352  VAL B CB    1 
ATOM   5949  C  CG1   . VAL B  2  354 ? 66.353  40.262  55.756  1.00 99.94  ? 352  VAL B CG1   1 
ATOM   5950  C  CG2   . VAL B  2  354 ? 65.084  39.465  57.773  1.00 100.24 ? 352  VAL B CG2   1 
ATOM   5951  N  N     . THR B  2  355 ? 64.964  38.661  53.112  1.00 103.22 ? 353  THR B N     1 
ATOM   5952  C  CA    . THR B  2  355 ? 65.550  38.216  51.854  1.00 103.29 ? 353  THR B CA    1 
ATOM   5953  C  C     . THR B  2  355 ? 66.903  38.867  51.678  1.00 103.90 ? 353  THR B C     1 
ATOM   5954  O  O     . THR B  2  355 ? 67.149  39.950  52.201  1.00 103.16 ? 353  THR B O     1 
ATOM   5955  C  CB    . THR B  2  355 ? 64.672  38.601  50.661  1.00 102.96 ? 353  THR B CB    1 
ATOM   5956  O  OG1   . THR B  2  355 ? 63.456  37.853  50.732  1.00 103.05 ? 353  THR B OG1   1 
ATOM   5957  C  CG2   . THR B  2  355 ? 65.386  38.319  49.330  1.00 101.25 ? 353  THR B CG2   1 
ATOM   5958  N  N     . GLU B  2  356 ? 67.782  38.197  50.944  1.00 105.52 ? 354  GLU B N     1 
ATOM   5959  C  CA    . GLU B  2  356 ? 69.112  38.724  50.698  1.00 106.91 ? 354  GLU B CA    1 
ATOM   5960  C  C     . GLU B  2  356 ? 68.941  39.973  49.838  1.00 108.03 ? 354  GLU B C     1 
ATOM   5961  O  O     . GLU B  2  356 ? 69.815  40.847  49.793  1.00 106.77 ? 354  GLU B O     1 
ATOM   5962  C  CB    . GLU B  2  356 ? 69.960  37.681  49.968  1.00 106.21 ? 354  GLU B CB    1 
ATOM   5963  C  CG    . GLU B  2  356 ? 71.446  37.734  50.299  1.00 106.12 ? 354  GLU B CG    1 
ATOM   5964  C  CD    . GLU B  2  356 ? 71.734  37.337  51.735  1.00 106.65 ? 354  GLU B CD    1 
ATOM   5965  O  OE1   . GLU B  2  356 ? 71.060  36.402  52.231  1.00 106.02 ? 354  GLU B OE1   1 
ATOM   5966  O  OE2   . GLU B  2  356 ? 72.637  37.946  52.358  1.00 106.66 ? 354  GLU B OE2   1 
ATOM   5967  N  N     . GLU B  2  357 ? 67.794  40.045  49.166  1.00 110.02 ? 355  GLU B N     1 
ATOM   5968  C  CA    . GLU B  2  357 ? 67.470  41.173  48.304  1.00 111.99 ? 355  GLU B CA    1 
ATOM   5969  C  C     . GLU B  2  357 ? 66.949  42.326  49.146  1.00 111.96 ? 355  GLU B C     1 
ATOM   5970  O  O     . GLU B  2  357 ? 67.140  43.494  48.799  1.00 111.66 ? 355  GLU B O     1 
ATOM   5971  C  CB    . GLU B  2  357 ? 66.412  40.770  47.288  1.00 114.63 ? 355  GLU B CB    1 
ATOM   5972  C  CG    . GLU B  2  357 ? 66.124  41.840  46.250  1.00 118.02 ? 355  GLU B CG    1 
ATOM   5973  C  CD    . GLU B  2  357 ? 64.978  41.447  45.330  1.00 120.40 ? 355  GLU B CD    1 
ATOM   5974  O  OE1   . GLU B  2  357 ? 63.810  41.463  45.787  1.00 121.67 ? 355  GLU B OE1   1 
ATOM   5975  O  OE2   . GLU B  2  357 ? 65.247  41.109  44.155  1.00 121.39 ? 355  GLU B OE2   1 
ATOM   5976  N  N     . ASP B  2  358 ? 66.269  41.988  50.242  1.00 111.45 ? 356  ASP B N     1 
ATOM   5977  C  CA    . ASP B  2  358 ? 65.753  42.998  51.154  1.00 110.90 ? 356  ASP B CA    1 
ATOM   5978  C  C     . ASP B  2  358 ? 66.967  43.682  51.748  1.00 110.91 ? 356  ASP B C     1 
ATOM   5979  O  O     . ASP B  2  358 ? 67.068  44.907  51.764  1.00 111.37 ? 356  ASP B O     1 
ATOM   5980  C  CB    . ASP B  2  358 ? 64.951  42.357  52.284  1.00 110.36 ? 356  ASP B CB    1 
ATOM   5981  C  CG    . ASP B  2  358 ? 63.775  41.564  51.781  1.00 110.41 ? 356  ASP B CG    1 
ATOM   5982  O  OD1   . ASP B  2  358 ? 63.441  41.701  50.587  1.00 110.96 ? 356  ASP B OD1   1 
ATOM   5983  O  OD2   . ASP B  2  358 ? 63.179  40.811  52.579  1.00 109.98 ? 356  ASP B OD2   1 
ATOM   5984  N  N     . VAL B  2  359 ? 67.894  42.862  52.227  1.00 110.66 ? 357  VAL B N     1 
ATOM   5985  C  CA    . VAL B  2  359 ? 69.121  43.342  52.835  1.00 110.38 ? 357  VAL B CA    1 
ATOM   5986  C  C     . VAL B  2  359 ? 69.948  44.204  51.887  1.00 110.53 ? 357  VAL B C     1 
ATOM   5987  O  O     . VAL B  2  359 ? 70.669  45.097  52.326  1.00 110.79 ? 357  VAL B O     1 
ATOM   5988  C  CB    . VAL B  2  359 ? 69.985  42.164  53.323  1.00 110.25 ? 357  VAL B CB    1 
ATOM   5989  C  CG1   . VAL B  2  359 ? 71.232  42.684  54.027  1.00 110.00 ? 357  VAL B CG1   1 
ATOM   5990  C  CG2   . VAL B  2  359 ? 69.168  41.282  54.257  1.00 110.19 ? 357  VAL B CG2   1 
ATOM   5991  N  N     . THR B  2  360 ? 69.856  43.946  50.588  1.00 110.48 ? 358  THR B N     1 
ATOM   5992  C  CA    . THR B  2  360 ? 70.620  44.746  49.645  1.00 110.70 ? 358  THR B CA    1 
ATOM   5993  C  C     . THR B  2  360 ? 69.957  46.105  49.397  1.00 111.00 ? 358  THR B C     1 
ATOM   5994  O  O     . THR B  2  360 ? 70.645  47.127  49.303  1.00 111.14 ? 358  THR B O     1 
ATOM   5995  C  CB    . THR B  2  360 ? 70.841  43.988  48.310  1.00 110.84 ? 358  THR B CB    1 
ATOM   5996  O  OG1   . THR B  2  360 ? 69.717  43.139  48.042  1.00 111.64 ? 358  THR B OG1   1 
ATOM   5997  C  CG2   . THR B  2  360 ? 72.114  43.152  48.381  1.00 110.00 ? 358  THR B CG2   1 
ATOM   5998  N  N     . LYS B  2  361 ? 68.626  46.127  49.310  1.00 111.03 ? 359  LYS B N     1 
ATOM   5999  C  CA    . LYS B  2  361 ? 67.901  47.384  49.097  1.00 110.26 ? 359  LYS B CA    1 
ATOM   6000  C  C     . LYS B  2  361 ? 68.148  48.324  50.276  1.00 109.44 ? 359  LYS B C     1 
ATOM   6001  O  O     . LYS B  2  361 ? 68.571  49.467  50.096  1.00 108.76 ? 359  LYS B O     1 
ATOM   6002  C  CB    . LYS B  2  361 ? 66.397  47.124  48.952  1.00 110.39 ? 359  LYS B CB    1 
ATOM   6003  C  CG    . LYS B  2  361 ? 66.017  46.392  47.677  1.00 111.53 ? 359  LYS B CG    1 
ATOM   6004  C  CD    . LYS B  2  361 ? 64.517  46.179  47.587  1.00 112.35 ? 359  LYS B CD    1 
ATOM   6005  C  CE    . LYS B  2  361 ? 64.146  45.407  46.330  1.00 112.80 ? 359  LYS B CE    1 
ATOM   6006  N  NZ    . LYS B  2  361 ? 62.695  45.068  46.288  1.00 112.64 ? 359  LYS B NZ    1 
ATOM   6007  N  N     . ALA B  2  362 ? 67.886  47.826  51.482  1.00 108.67 ? 360  ALA B N     1 
ATOM   6008  C  CA    . ALA B  2  362 ? 68.083  48.598  52.700  1.00 107.91 ? 360  ALA B CA    1 
ATOM   6009  C  C     . ALA B  2  362 ? 69.478  49.199  52.707  1.00 107.91 ? 360  ALA B C     1 
ATOM   6010  O  O     . ALA B  2  362 ? 69.667  50.343  53.116  1.00 108.37 ? 360  ALA B O     1 
ATOM   6011  C  CB    . ALA B  2  362 ? 67.891  47.708  53.918  1.00 107.41 ? 360  ALA B CB    1 
ATOM   6012  N  N     . LYS B  2  363 ? 70.456  48.425  52.248  1.00 107.73 ? 361  LYS B N     1 
ATOM   6013  C  CA    . LYS B  2  363 ? 71.833  48.897  52.205  1.00 107.54 ? 361  LYS B CA    1 
ATOM   6014  C  C     . LYS B  2  363 ? 71.990  50.104  51.281  1.00 107.91 ? 361  LYS B C     1 
ATOM   6015  O  O     . LYS B  2  363 ? 72.933  50.885  51.426  1.00 107.93 ? 361  LYS B O     1 
ATOM   6016  C  CB    . LYS B  2  363 ? 72.770  47.770  51.765  1.00 106.24 ? 361  LYS B CB    1 
ATOM   6017  C  CG    . LYS B  2  363 ? 72.973  46.689  52.817  1.00 103.87 ? 361  LYS B CG    1 
ATOM   6018  C  CD    . LYS B  2  363 ? 73.978  45.654  52.345  1.00 101.53 ? 361  LYS B CD    1 
ATOM   6019  C  CE    . LYS B  2  363 ? 74.175  44.554  53.365  1.00 98.50  ? 361  LYS B CE    1 
ATOM   6020  N  NZ    . LYS B  2  363 ? 75.228  43.621  52.910  1.00 96.94  ? 361  LYS B NZ    1 
ATOM   6021  N  N     . ASN B  2  364 ? 71.074  50.254  50.328  1.00 107.90 ? 362  ASN B N     1 
ATOM   6022  C  CA    . ASN B  2  364 ? 71.131  51.395  49.422  1.00 108.13 ? 362  ASN B CA    1 
ATOM   6023  C  C     . ASN B  2  364 ? 70.437  52.551  50.107  1.00 107.14 ? 362  ASN B C     1 
ATOM   6024  O  O     . ASN B  2  364 ? 71.012  53.626  50.262  1.00 107.81 ? 362  ASN B O     1 
ATOM   6025  C  CB    . ASN B  2  364 ? 70.415  51.104  48.108  1.00 109.98 ? 362  ASN B CB    1 
ATOM   6026  C  CG    . ASN B  2  364 ? 71.001  49.930  47.385  1.00 112.05 ? 362  ASN B CG    1 
ATOM   6027  O  OD1   . ASN B  2  364 ? 72.210  49.883  47.130  1.00 113.14 ? 362  ASN B OD1   1 
ATOM   6028  N  ND2   . ASN B  2  364 ? 70.151  48.965  47.044  1.00 111.76 ? 362  ASN B ND2   1 
ATOM   6029  N  N     . GLN B  2  365 ? 69.191  52.325  50.512  1.00 105.09 ? 363  GLN B N     1 
ATOM   6030  C  CA    . GLN B  2  365 ? 68.431  53.354  51.196  1.00 102.88 ? 363  GLN B CA    1 
ATOM   6031  C  C     . GLN B  2  365 ? 69.343  53.960  52.254  1.00 102.19 ? 363  GLN B C     1 
ATOM   6032  O  O     . GLN B  2  365 ? 69.463  55.181  52.370  1.00 102.44 ? 363  GLN B O     1 
ATOM   6033  C  CB    . GLN B  2  365 ? 67.198  52.741  51.843  1.00 101.77 ? 363  GLN B CB    1 
ATOM   6034  C  CG    . GLN B  2  365 ? 66.212  52.197  50.846  1.00 102.15 ? 363  GLN B CG    1 
ATOM   6035  C  CD    . GLN B  2  365 ? 65.047  51.522  51.520  1.00 103.38 ? 363  GLN B CD    1 
ATOM   6036  O  OE1   . GLN B  2  365 ? 64.466  52.068  52.454  1.00 105.21 ? 363  GLN B OE1   1 
ATOM   6037  N  NE2   . GLN B  2  365 ? 64.693  50.332  51.054  1.00 103.35 ? 363  GLN B NE2   1 
ATOM   6038  N  N     . LEU B  2  366 ? 70.012  53.094  53.004  1.00 100.96 ? 364  LEU B N     1 
ATOM   6039  C  CA    . LEU B  2  366 ? 70.922  53.534  54.048  1.00 99.82  ? 364  LEU B CA    1 
ATOM   6040  C  C     . LEU B  2  366 ? 72.034  54.402  53.457  1.00 98.91  ? 364  LEU B C     1 
ATOM   6041  O  O     . LEU B  2  366 ? 72.284  55.513  53.934  1.00 98.41  ? 364  LEU B O     1 
ATOM   6042  C  CB    . LEU B  2  366 ? 71.500  52.310  54.764  1.00 100.04 ? 364  LEU B CB    1 
ATOM   6043  C  CG    . LEU B  2  366 ? 72.250  52.504  56.084  1.00 100.22 ? 364  LEU B CG    1 
ATOM   6044  C  CD1   . LEU B  2  366 ? 71.795  53.772  56.792  1.00 100.12 ? 364  LEU B CD1   1 
ATOM   6045  C  CD2   . LEU B  2  366 ? 72.014  51.277  56.956  1.00 99.85  ? 364  LEU B CD2   1 
ATOM   6046  N  N     . LYS B  2  367 ? 72.693  53.896  52.417  1.00 97.87  ? 365  LYS B N     1 
ATOM   6047  C  CA    . LYS B  2  367 ? 73.763  54.641  51.755  1.00 97.06  ? 365  LYS B CA    1 
ATOM   6048  C  C     . LYS B  2  367 ? 73.216  55.961  51.204  1.00 97.42  ? 365  LYS B C     1 
ATOM   6049  O  O     . LYS B  2  367 ? 73.896  56.991  51.236  1.00 97.47  ? 365  LYS B O     1 
ATOM   6050  C  CB    . LYS B  2  367 ? 74.356  53.834  50.595  1.00 95.78  ? 365  LYS B CB    1 
ATOM   6051  C  CG    . LYS B  2  367 ? 75.102  52.569  50.966  1.00 93.67  ? 365  LYS B CG    1 
ATOM   6052  C  CD    . LYS B  2  367 ? 75.504  51.846  49.689  1.00 93.36  ? 365  LYS B CD    1 
ATOM   6053  C  CE    . LYS B  2  367 ? 76.197  50.526  49.951  1.00 93.17  ? 365  LYS B CE    1 
ATOM   6054  N  NZ    . LYS B  2  367 ? 76.582  49.841  48.682  1.00 91.03  ? 365  LYS B NZ    1 
ATOM   6055  N  N     . ALA B  2  368 ? 71.988  55.920  50.687  1.00 97.16  ? 366  ALA B N     1 
ATOM   6056  C  CA    . ALA B  2  368 ? 71.343  57.103  50.125  1.00 96.35  ? 366  ALA B CA    1 
ATOM   6057  C  C     . ALA B  2  368 ? 71.106  58.112  51.242  1.00 95.99  ? 366  ALA B C     1 
ATOM   6058  O  O     . ALA B  2  368 ? 71.719  59.184  51.261  1.00 95.91  ? 366  ALA B O     1 
ATOM   6059  C  CB    . ALA B  2  368 ? 70.020  56.715  49.463  1.00 96.34  ? 366  ALA B CB    1 
ATOM   6060  N  N     . THR B  2  369 ? 70.216  57.756  52.167  1.00 95.18  ? 367  THR B N     1 
ATOM   6061  C  CA    . THR B  2  369 ? 69.898  58.600  53.310  1.00 94.91  ? 367  THR B CA    1 
ATOM   6062  C  C     . THR B  2  369 ? 71.156  59.299  53.814  1.00 95.31  ? 367  THR B C     1 
ATOM   6063  O  O     . THR B  2  369 ? 71.266  60.522  53.737  1.00 95.73  ? 367  THR B O     1 
ATOM   6064  C  CB    . THR B  2  369 ? 69.312  57.765  54.461  1.00 94.95  ? 367  THR B CB    1 
ATOM   6065  O  OG1   . THR B  2  369 ? 67.935  57.476  54.196  1.00 94.43  ? 367  THR B OG1   1 
ATOM   6066  C  CG2   . THR B  2  369 ? 69.440  58.507  55.779  1.00 94.63  ? 367  THR B CG2   1 
ATOM   6067  N  N     . TYR B  2  370 ? 72.101  58.516  54.327  1.00 95.14  ? 368  TYR B N     1 
ATOM   6068  C  CA    . TYR B  2  370 ? 73.348  59.069  54.834  1.00 95.22  ? 368  TYR B CA    1 
ATOM   6069  C  C     . TYR B  2  370 ? 73.905  60.122  53.874  1.00 94.82  ? 368  TYR B C     1 
ATOM   6070  O  O     . TYR B  2  370 ? 74.025  61.296  54.221  1.00 94.38  ? 368  TYR B O     1 
ATOM   6071  C  CB    . TYR B  2  370 ? 74.379  57.949  55.034  1.00 96.50  ? 368  TYR B CB    1 
ATOM   6072  C  CG    . TYR B  2  370 ? 75.795  58.451  55.288  1.00 99.16  ? 368  TYR B CG    1 
ATOM   6073  C  CD1   . TYR B  2  370 ? 76.178  58.953  56.544  1.00 99.55  ? 368  TYR B CD1   1 
ATOM   6074  C  CD2   . TYR B  2  370 ? 76.740  58.483  54.250  1.00 99.77  ? 368  TYR B CD2   1 
ATOM   6075  C  CE1   . TYR B  2  370 ? 77.471  59.483  56.756  1.00 99.66  ? 368  TYR B CE1   1 
ATOM   6076  C  CE2   . TYR B  2  370 ? 78.032  59.008  54.448  1.00 99.69  ? 368  TYR B CE2   1 
ATOM   6077  C  CZ    . TYR B  2  370 ? 78.390  59.510  55.699  1.00 100.05 ? 368  TYR B CZ    1 
ATOM   6078  O  OH    . TYR B  2  370 ? 79.644  60.063  55.877  1.00 98.82  ? 368  TYR B OH    1 
ATOM   6079  N  N     . LEU B  2  371 ? 74.233  59.692  52.661  1.00 94.82  ? 369  LEU B N     1 
ATOM   6080  C  CA    . LEU B  2  371 ? 74.796  60.577  51.647  1.00 94.84  ? 369  LEU B CA    1 
ATOM   6081  C  C     . LEU B  2  371 ? 74.048  61.872  51.430  1.00 93.79  ? 369  LEU B C     1 
ATOM   6082  O  O     . LEU B  2  371 ? 74.662  62.923  51.232  1.00 93.66  ? 369  LEU B O     1 
ATOM   6083  C  CB    . LEU B  2  371 ? 74.889  59.853  50.311  1.00 96.49  ? 369  LEU B CB    1 
ATOM   6084  C  CG    . LEU B  2  371 ? 76.157  59.043  50.079  1.00 97.19  ? 369  LEU B CG    1 
ATOM   6085  C  CD1   . LEU B  2  371 ? 76.051  58.353  48.724  1.00 98.24  ? 369  LEU B CD1   1 
ATOM   6086  C  CD2   . LEU B  2  371 ? 77.379  59.964  50.138  1.00 96.25  ? 369  LEU B CD2   1 
ATOM   6087  N  N     . MET B  2  372 ? 72.723  61.787  51.435  1.00 92.49  ? 370  MET B N     1 
ATOM   6088  C  CA    . MET B  2  372 ? 71.898  62.966  51.232  1.00 91.05  ? 370  MET B CA    1 
ATOM   6089  C  C     . MET B  2  372 ? 71.996  63.880  52.451  1.00 90.25  ? 370  MET B C     1 
ATOM   6090  O  O     . MET B  2  372 ? 72.305  65.065  52.319  1.00 89.36  ? 370  MET B O     1 
ATOM   6091  C  CB    . MET B  2  372 ? 70.441  62.552  50.968  1.00 90.23  ? 370  MET B CB    1 
ATOM   6092  C  CG    . MET B  2  372 ? 70.284  61.634  49.753  1.00 90.91  ? 370  MET B CG    1 
ATOM   6093  S  SD    . MET B  2  372 ? 68.587  61.305  49.156  1.00 93.62  ? 370  MET B SD    1 
ATOM   6094  C  CE    . MET B  2  372 ? 68.114  59.899  50.136  1.00 92.27  ? 370  MET B CE    1 
ATOM   6095  N  N     . SER B  2  373 ? 71.773  63.305  53.634  1.00 89.78  ? 371  SER B N     1 
ATOM   6096  C  CA    . SER B  2  373 ? 71.803  64.033  54.909  1.00 88.91  ? 371  SER B CA    1 
ATOM   6097  C  C     . SER B  2  373 ? 72.953  65.011  55.071  1.00 88.85  ? 371  SER B C     1 
ATOM   6098  O  O     . SER B  2  373 ? 72.923  65.866  55.947  1.00 87.27  ? 371  SER B O     1 
ATOM   6099  C  CB    . SER B  2  373 ? 71.851  63.053  56.079  1.00 88.10  ? 371  SER B CB    1 
ATOM   6100  O  OG    . SER B  2  373 ? 73.184  62.645  56.326  1.00 88.23  ? 371  SER B OG    1 
ATOM   6101  N  N     . VAL B  2  374 ? 73.973  64.890  54.238  1.00 90.33  ? 372  VAL B N     1 
ATOM   6102  C  CA    . VAL B  2  374 ? 75.106  65.785  54.364  1.00 92.32  ? 372  VAL B CA    1 
ATOM   6103  C  C     . VAL B  2  374 ? 75.191  66.848  53.282  1.00 92.83  ? 372  VAL B C     1 
ATOM   6104  O  O     . VAL B  2  374 ? 76.242  67.468  53.104  1.00 93.66  ? 372  VAL B O     1 
ATOM   6105  C  CB    . VAL B  2  374 ? 76.409  64.993  54.387  1.00 92.95  ? 372  VAL B CB    1 
ATOM   6106  C  CG1   . VAL B  2  374 ? 76.412  64.077  55.597  1.00 93.34  ? 372  VAL B CG1   1 
ATOM   6107  C  CG2   . VAL B  2  374 ? 76.556  64.194  53.092  1.00 92.68  ? 372  VAL B CG2   1 
ATOM   6108  N  N     . GLU B  2  375 ? 74.093  67.063  52.562  1.00 92.81  ? 373  GLU B N     1 
ATOM   6109  C  CA    . GLU B  2  375 ? 74.075  68.077  51.513  1.00 92.60  ? 373  GLU B CA    1 
ATOM   6110  C  C     . GLU B  2  375 ? 73.928  69.464  52.143  1.00 93.76  ? 373  GLU B C     1 
ATOM   6111  O  O     . GLU B  2  375 ? 74.571  70.422  51.719  1.00 94.63  ? 373  GLU B O     1 
ATOM   6112  C  CB    . GLU B  2  375 ? 72.921  67.831  50.539  1.00 90.48  ? 373  GLU B CB    1 
ATOM   6113  C  CG    . GLU B  2  375 ? 72.917  66.468  49.891  1.00 88.84  ? 373  GLU B CG    1 
ATOM   6114  C  CD    . GLU B  2  375 ? 71.745  66.294  48.957  1.00 89.04  ? 373  GLU B CD    1 
ATOM   6115  O  OE1   . GLU B  2  375 ? 71.506  65.160  48.496  1.00 89.03  ? 373  GLU B OE1   1 
ATOM   6116  O  OE2   . GLU B  2  375 ? 71.059  67.297  48.675  1.00 89.89  ? 373  GLU B OE2   1 
ATOM   6117  N  N     . THR B  2  376 ? 73.085  69.563  53.165  1.00 94.74  ? 374  THR B N     1 
ATOM   6118  C  CA    . THR B  2  376 ? 72.851  70.829  53.851  1.00 94.65  ? 374  THR B CA    1 
ATOM   6119  C  C     . THR B  2  376 ? 74.016  71.187  54.761  1.00 94.65  ? 374  THR B C     1 
ATOM   6120  O  O     . THR B  2  376 ? 74.569  70.329  55.438  1.00 95.02  ? 374  THR B O     1 
ATOM   6121  C  CB    . THR B  2  376 ? 71.570  70.756  54.690  1.00 94.73  ? 374  THR B CB    1 
ATOM   6122  O  OG1   . THR B  2  376 ? 71.655  69.653  55.599  1.00 93.69  ? 374  THR B OG1   1 
ATOM   6123  C  CG2   . THR B  2  376 ? 70.363  70.570  53.786  1.00 94.54  ? 374  THR B CG2   1 
ATOM   6124  N  N     . ALA B  2  377 ? 74.377  72.462  54.774  1.00 94.91  ? 375  ALA B N     1 
ATOM   6125  C  CA    . ALA B  2  377 ? 75.480  72.947  55.592  1.00 96.08  ? 375  ALA B CA    1 
ATOM   6126  C  C     . ALA B  2  377 ? 75.488  72.370  57.008  1.00 96.88  ? 375  ALA B C     1 
ATOM   6127  O  O     . ALA B  2  377 ? 76.539  72.014  57.536  1.00 96.48  ? 375  ALA B O     1 
ATOM   6128  C  CB    . ALA B  2  377 ? 75.438  74.470  55.656  1.00 96.57  ? 375  ALA B CB    1 
ATOM   6129  N  N     . GLN B  2  378 ? 74.318  72.283  57.625  1.00 98.37  ? 376  GLN B N     1 
ATOM   6130  C  CA    . GLN B  2  378 ? 74.227  71.761  58.980  1.00 99.95  ? 376  GLN B CA    1 
ATOM   6131  C  C     . GLN B  2  378 ? 74.466  70.260  58.997  1.00 99.56  ? 376  GLN B C     1 
ATOM   6132  O  O     . GLN B  2  378 ? 75.178  69.747  59.856  1.00 99.25  ? 376  GLN B O     1 
ATOM   6133  C  CB    . GLN B  2  378 ? 72.851  72.067  59.572  1.00 102.35 ? 376  GLN B CB    1 
ATOM   6134  C  CG    . GLN B  2  378 ? 72.700  71.694  61.044  1.00 104.49 ? 376  GLN B CG    1 
ATOM   6135  C  CD    . GLN B  2  378 ? 71.245  71.711  61.487  1.00 105.87 ? 376  GLN B CD    1 
ATOM   6136  O  OE1   . GLN B  2  378 ? 70.550  72.717  61.334  1.00 106.39 ? 376  GLN B OE1   1 
ATOM   6137  N  NE2   . GLN B  2  378 ? 70.776  70.591  62.036  1.00 106.43 ? 376  GLN B NE2   1 
ATOM   6138  N  N     . GLY B  2  379 ? 73.861  69.560  58.044  1.00 99.80  ? 377  GLY B N     1 
ATOM   6139  C  CA    . GLY B  2  379 ? 74.022  68.115  57.970  1.00 100.82 ? 377  GLY B CA    1 
ATOM   6140  C  C     . GLY B  2  379 ? 75.477  67.689  57.908  1.00 100.71 ? 377  GLY B C     1 
ATOM   6141  O  O     . GLY B  2  379 ? 75.915  66.790  58.624  1.00 101.17 ? 377  GLY B O     1 
ATOM   6142  N  N     . LEU B  2  380 ? 76.227  68.340  57.032  1.00 100.40 ? 378  LEU B N     1 
ATOM   6143  C  CA    . LEU B  2  380 ? 77.639  68.055  56.879  1.00 99.40  ? 378  LEU B CA    1 
ATOM   6144  C  C     . LEU B  2  380 ? 78.392  68.406  58.161  1.00 98.47  ? 378  LEU B C     1 
ATOM   6145  O  O     . LEU B  2  380 ? 79.139  67.583  58.681  1.00 99.02  ? 378  LEU B O     1 
ATOM   6146  C  CB    . LEU B  2  380 ? 78.199  68.862  55.710  1.00 100.13 ? 378  LEU B CB    1 
ATOM   6147  C  CG    . LEU B  2  380 ? 79.715  69.030  55.663  1.00 100.68 ? 378  LEU B CG    1 
ATOM   6148  C  CD1   . LEU B  2  380 ? 80.366  67.664  55.587  1.00 101.38 ? 378  LEU B CD1   1 
ATOM   6149  C  CD2   . LEU B  2  380 ? 80.100  69.894  54.469  1.00 100.85 ? 378  LEU B CD2   1 
ATOM   6150  N  N     . LEU B  2  381 ? 78.189  69.621  58.668  1.00 96.95  ? 379  LEU B N     1 
ATOM   6151  C  CA    . LEU B  2  381 ? 78.867  70.074  59.882  1.00 95.37  ? 379  LEU B CA    1 
ATOM   6152  C  C     . LEU B  2  381 ? 78.558  69.216  61.085  1.00 94.45  ? 379  LEU B C     1 
ATOM   6153  O  O     . LEU B  2  381 ? 79.346  69.148  62.017  1.00 93.64  ? 379  LEU B O     1 
ATOM   6154  C  CB    . LEU B  2  381 ? 78.486  71.508  60.221  1.00 96.16  ? 379  LEU B CB    1 
ATOM   6155  C  CG    . LEU B  2  381 ? 79.182  72.049  61.470  1.00 96.42  ? 379  LEU B CG    1 
ATOM   6156  C  CD1   . LEU B  2  381 ? 80.625  72.368  61.131  1.00 96.93  ? 379  LEU B CD1   1 
ATOM   6157  C  CD2   . LEU B  2  381 ? 78.474  73.298  61.964  1.00 97.23  ? 379  LEU B CD2   1 
ATOM   6158  N  N     . ASN B  2  382 ? 77.398  68.580  61.085  1.00 94.64  ? 380  ASN B N     1 
ATOM   6159  C  CA    . ASN B  2  382 ? 77.045  67.730  62.203  1.00 95.28  ? 380  ASN B CA    1 
ATOM   6160  C  C     . ASN B  2  382 ? 77.722  66.397  62.004  1.00 95.66  ? 380  ASN B C     1 
ATOM   6161  O  O     . ASN B  2  382 ? 78.234  65.811  62.952  1.00 96.49  ? 380  ASN B O     1 
ATOM   6162  C  CB    . ASN B  2  382 ? 75.540  67.522  62.288  1.00 96.37  ? 380  ASN B CB    1 
ATOM   6163  C  CG    . ASN B  2  382 ? 75.147  66.667  63.479  1.00 97.57  ? 380  ASN B CG    1 
ATOM   6164  O  OD1   . ASN B  2  382 ? 75.478  66.988  64.626  1.00 97.79  ? 380  ASN B OD1   1 
ATOM   6165  N  ND2   . ASN B  2  382 ? 74.439  65.569  63.215  1.00 98.14  ? 380  ASN B ND2   1 
ATOM   6166  N  N     . GLU B  2  383 ? 77.725  65.918  60.763  1.00 95.75  ? 381  GLU B N     1 
ATOM   6167  C  CA    . GLU B  2  383 ? 78.361  64.645  60.434  1.00 95.56  ? 381  GLU B CA    1 
ATOM   6168  C  C     . GLU B  2  383 ? 79.841  64.687  60.835  1.00 94.20  ? 381  GLU B C     1 
ATOM   6169  O  O     . GLU B  2  383 ? 80.343  63.778  61.504  1.00 94.16  ? 381  GLU B O     1 
ATOM   6170  C  CB    . GLU B  2  383 ? 78.218  64.368  58.935  1.00 96.96  ? 381  GLU B CB    1 
ATOM   6171  C  CG    . GLU B  2  383 ? 78.719  62.999  58.504  1.00 100.09 ? 381  GLU B CG    1 
ATOM   6172  C  CD    . GLU B  2  383 ? 78.228  61.886  59.414  1.00 102.25 ? 381  GLU B CD    1 
ATOM   6173  O  OE1   . GLU B  2  383 ? 77.228  62.101  60.131  1.00 102.94 ? 381  GLU B OE1   1 
ATOM   6174  O  OE2   . GLU B  2  383 ? 78.837  60.792  59.407  1.00 104.34 ? 381  GLU B OE2   1 
ATOM   6175  N  N     . ILE B  2  384 ? 80.521  65.758  60.426  1.00 91.47  ? 382  ILE B N     1 
ATOM   6176  C  CA    . ILE B  2  384 ? 81.929  65.978  60.739  1.00 88.86  ? 382  ILE B CA    1 
ATOM   6177  C  C     . ILE B  2  384 ? 82.170  66.010  62.246  1.00 88.31  ? 382  ILE B C     1 
ATOM   6178  O  O     . ILE B  2  384 ? 82.694  65.058  62.820  1.00 89.62  ? 382  ILE B O     1 
ATOM   6179  C  CB    . ILE B  2  384 ? 82.417  67.320  60.149  1.00 87.41  ? 382  ILE B CB    1 
ATOM   6180  C  CG1   . ILE B  2  384 ? 82.387  67.251  58.620  1.00 85.76  ? 382  ILE B CG1   1 
ATOM   6181  C  CG2   . ILE B  2  384 ? 83.799  67.659  60.683  1.00 86.26  ? 382  ILE B CG2   1 
ATOM   6182  C  CD1   . ILE B  2  384 ? 82.760  68.543  57.936  1.00 83.74  ? 382  ILE B CD1   1 
ATOM   6183  N  N     . GLY B  2  385 ? 81.787  67.114  62.877  1.00 86.78  ? 383  GLY B N     1 
ATOM   6184  C  CA    . GLY B  2  385 ? 81.972  67.269  64.308  1.00 86.21  ? 383  GLY B CA    1 
ATOM   6185  C  C     . GLY B  2  385 ? 81.470  66.160  65.221  1.00 86.51  ? 383  GLY B C     1 
ATOM   6186  O  O     . GLY B  2  385 ? 81.995  65.975  66.314  1.00 86.69  ? 383  GLY B O     1 
ATOM   6187  N  N     . SER B  2  386 ? 80.453  65.420  64.808  1.00 86.74  ? 384  SER B N     1 
ATOM   6188  C  CA    . SER B  2  386 ? 79.943  64.355  65.659  1.00 87.80  ? 384  SER B CA    1 
ATOM   6189  C  C     . SER B  2  386 ? 81.040  63.342  65.906  1.00 88.63  ? 384  SER B C     1 
ATOM   6190  O  O     . SER B  2  386 ? 81.269  62.889  67.031  1.00 88.55  ? 384  SER B O     1 
ATOM   6191  C  CB    . SER B  2  386 ? 78.759  63.666  64.992  1.00 87.93  ? 384  SER B CB    1 
ATOM   6192  O  OG    . SER B  2  386 ? 77.663  64.550  64.895  1.00 89.00  ? 384  SER B OG    1 
ATOM   6193  N  N     . GLU B  2  387 ? 81.713  62.980  64.826  1.00 89.59  ? 385  GLU B N     1 
ATOM   6194  C  CA    . GLU B  2  387 ? 82.799  62.026  64.893  1.00 89.99  ? 385  GLU B CA    1 
ATOM   6195  C  C     . GLU B  2  387 ? 84.000  62.720  65.520  1.00 89.13  ? 385  GLU B C     1 
ATOM   6196  O  O     . GLU B  2  387 ? 84.547  62.251  66.515  1.00 88.47  ? 385  GLU B O     1 
ATOM   6197  C  CB    . GLU B  2  387 ? 83.130  61.540  63.484  1.00 91.24  ? 385  GLU B CB    1 
ATOM   6198  C  CG    . GLU B  2  387 ? 84.389  60.714  63.371  1.00 94.31  ? 385  GLU B CG    1 
ATOM   6199  C  CD    . GLU B  2  387 ? 84.562  60.135  61.982  1.00 95.83  ? 385  GLU B CD    1 
ATOM   6200  O  OE1   . GLU B  2  387 ? 84.346  60.884  61.002  1.00 97.55  ? 385  GLU B OE1   1 
ATOM   6201  O  OE2   . GLU B  2  387 ? 84.914  58.939  61.872  1.00 95.77  ? 385  GLU B OE2   1 
ATOM   6202  N  N     . ALA B  2  388 ? 84.385  63.855  64.945  1.00 88.13  ? 386  ALA B N     1 
ATOM   6203  C  CA    . ALA B  2  388 ? 85.523  64.607  65.438  1.00 88.60  ? 386  ALA B CA    1 
ATOM   6204  C  C     . ALA B  2  388 ? 85.439  64.826  66.936  1.00 90.09  ? 386  ALA B C     1 
ATOM   6205  O  O     . ALA B  2  388 ? 86.406  65.246  67.553  1.00 90.81  ? 386  ALA B O     1 
ATOM   6206  C  CB    . ALA B  2  388 ? 85.624  65.938  64.718  1.00 87.27  ? 386  ALA B CB    1 
ATOM   6207  N  N     . LEU B  2  389 ? 84.287  64.542  67.527  1.00 92.67  ? 387  LEU B N     1 
ATOM   6208  C  CA    . LEU B  2  389 ? 84.132  64.722  68.964  1.00 95.58  ? 387  LEU B CA    1 
ATOM   6209  C  C     . LEU B  2  389 ? 84.191  63.392  69.682  1.00 97.70  ? 387  LEU B C     1 
ATOM   6210  O  O     . LEU B  2  389 ? 84.756  63.296  70.767  1.00 97.81  ? 387  LEU B O     1 
ATOM   6211  C  CB    . LEU B  2  389 ? 82.803  65.401  69.297  1.00 95.59  ? 387  LEU B CB    1 
ATOM   6212  C  CG    . LEU B  2  389 ? 82.566  65.619  70.799  1.00 95.89  ? 387  LEU B CG    1 
ATOM   6213  C  CD1   . LEU B  2  389 ? 83.510  66.698  71.321  1.00 94.45  ? 387  LEU B CD1   1 
ATOM   6214  C  CD2   . LEU B  2  389 ? 81.114  66.015  71.044  1.00 96.57  ? 387  LEU B CD2   1 
ATOM   6215  N  N     . LEU B  2  390 ? 83.598  62.367  69.081  1.00 100.60 ? 388  LEU B N     1 
ATOM   6216  C  CA    . LEU B  2  390 ? 83.586  61.048  69.695  1.00 104.11 ? 388  LEU B CA    1 
ATOM   6217  C  C     . LEU B  2  390 ? 84.918  60.316  69.606  1.00 106.01 ? 388  LEU B C     1 
ATOM   6218  O  O     . LEU B  2  390 ? 85.282  59.577  70.525  1.00 106.95 ? 388  LEU B O     1 
ATOM   6219  C  CB    . LEU B  2  390 ? 82.494  60.181  69.073  1.00 105.45 ? 388  LEU B CB    1 
ATOM   6220  C  CG    . LEU B  2  390 ? 81.060  60.564  69.440  1.00 107.57 ? 388  LEU B CG    1 
ATOM   6221  C  CD1   . LEU B  2  390 ? 80.112  59.491  68.916  1.00 108.30 ? 388  LEU B CD1   1 
ATOM   6222  C  CD2   . LEU B  2  390 ? 80.919  60.696  70.960  1.00 107.19 ? 388  LEU B CD2   1 
ATOM   6223  N  N     . SER B  2  391 ? 85.644  60.519  68.507  1.00 107.35 ? 389  SER B N     1 
ATOM   6224  C  CA    . SER B  2  391 ? 86.933  59.855  68.308  1.00 106.92 ? 389  SER B CA    1 
ATOM   6225  C  C     . SER B  2  391 ? 87.955  60.677  67.517  1.00 106.49 ? 389  SER B C     1 
ATOM   6226  O  O     . SER B  2  391 ? 88.778  60.118  66.800  1.00 106.39 ? 389  SER B O     1 
ATOM   6227  C  CB    . SER B  2  391 ? 86.714  58.488  67.626  1.00 106.71 ? 389  SER B CB    1 
ATOM   6228  O  OG    . SER B  2  391 ? 85.942  58.595  66.438  1.00 105.81 ? 389  SER B OG    1 
ATOM   6229  N  N     . GLY B  2  392 ? 87.905  61.999  67.662  1.00 106.31 ? 390  GLY B N     1 
ATOM   6230  C  CA    . GLY B  2  392 ? 88.832  62.879  66.964  1.00 106.41 ? 390  GLY B CA    1 
ATOM   6231  C  C     . GLY B  2  392 ? 89.345  62.408  65.613  1.00 106.52 ? 390  GLY B C     1 
ATOM   6232  O  O     . GLY B  2  392 ? 90.449  62.769  65.216  1.00 105.95 ? 390  GLY B O     1 
ATOM   6233  N  N     . THR B  2  393 ? 88.544  61.617  64.903  1.00 107.11 ? 391  THR B N     1 
ATOM   6234  C  CA    . THR B  2  393 ? 88.917  61.082  63.595  1.00 108.17 ? 391  THR B CA    1 
ATOM   6235  C  C     . THR B  2  393 ? 87.957  61.555  62.517  1.00 109.46 ? 391  THR B C     1 
ATOM   6236  O  O     . THR B  2  393 ? 87.257  62.542  62.688  1.00 109.66 ? 391  THR B O     1 
ATOM   6237  C  CB    . THR B  2  393 ? 88.859  59.551  63.594  1.00 107.39 ? 391  THR B CB    1 
ATOM   6238  O  OG1   . THR B  2  393 ? 87.557  59.136  64.020  1.00 106.80 ? 391  THR B OG1   1 
ATOM   6239  C  CG2   . THR B  2  393 ? 89.908  58.963  64.522  1.00 107.68 ? 391  THR B CG2   1 
ATOM   6240  N  N     . HIS B  2  394 ? 87.949  60.847  61.393  1.00 111.79 ? 392  HIS B N     1 
ATOM   6241  C  CA    . HIS B  2  394 ? 87.034  61.150  60.294  1.00 114.28 ? 392  HIS B CA    1 
ATOM   6242  C  C     . HIS B  2  394 ? 86.940  60.079  59.209  1.00 114.80 ? 392  HIS B C     1 
ATOM   6243  O  O     . HIS B  2  394 ? 87.698  60.099  58.236  1.00 115.51 ? 392  HIS B O     1 
ATOM   6244  C  CB    . HIS B  2  394 ? 87.344  62.488  59.610  1.00 114.97 ? 392  HIS B CB    1 
ATOM   6245  C  CG    . HIS B  2  394 ? 86.446  62.762  58.439  1.00 116.57 ? 392  HIS B CG    1 
ATOM   6246  N  ND1   . HIS B  2  394 ? 86.775  62.409  57.147  1.00 117.00 ? 392  HIS B ND1   1 
ATOM   6247  C  CD2   . HIS B  2  394 ? 85.178  63.237  58.384  1.00 117.33 ? 392  HIS B CD2   1 
ATOM   6248  C  CE1   . HIS B  2  394 ? 85.751  62.651  56.347  1.00 117.09 ? 392  HIS B CE1   1 
ATOM   6249  N  NE2   . HIS B  2  394 ? 84.769  63.153  57.074  1.00 117.99 ? 392  HIS B NE2   1 
ATOM   6250  N  N     . THR B  2  395 ? 86.003  59.152  59.373  1.00 114.56 ? 393  THR B N     1 
ATOM   6251  C  CA    . THR B  2  395 ? 85.812  58.113  58.380  1.00 115.36 ? 393  THR B CA    1 
ATOM   6252  C  C     . THR B  2  395 ? 85.450  58.802  57.070  1.00 116.20 ? 393  THR B C     1 
ATOM   6253  O  O     . THR B  2  395 ? 84.782  59.834  57.073  1.00 116.67 ? 393  THR B O     1 
ATOM   6254  C  CB    . THR B  2  395 ? 84.672  57.168  58.783  1.00 115.26 ? 393  THR B CB    1 
ATOM   6255  O  OG1   . THR B  2  395 ? 85.120  56.291  59.823  1.00 116.14 ? 393  THR B OG1   1 
ATOM   6256  C  CG2   . THR B  2  395 ? 84.214  56.354  57.593  1.00 115.53 ? 393  THR B CG2   1 
ATOM   6257  N  N     . ALA B  2  396 ? 85.914  58.254  55.954  1.00 117.30 ? 394  ALA B N     1 
ATOM   6258  C  CA    . ALA B  2  396 ? 85.602  58.830  54.654  1.00 118.41 ? 394  ALA B CA    1 
ATOM   6259  C  C     . ALA B  2  396 ? 84.323  58.144  54.205  1.00 119.58 ? 394  ALA B C     1 
ATOM   6260  O  O     . ALA B  2  396 ? 84.133  56.957  54.469  1.00 119.43 ? 394  ALA B O     1 
ATOM   6261  C  CB    . ALA B  2  396 ? 86.722  58.555  53.670  1.00 118.25 ? 394  ALA B CB    1 
ATOM   6262  N  N     . PRO B  2  397 ? 83.422  58.879  53.529  1.00 120.67 ? 395  PRO B N     1 
ATOM   6263  C  CA    . PRO B  2  397 ? 82.167  58.272  53.070  1.00 121.45 ? 395  PRO B CA    1 
ATOM   6264  C  C     . PRO B  2  397 ? 82.379  56.936  52.365  1.00 122.38 ? 395  PRO B C     1 
ATOM   6265  O  O     . PRO B  2  397 ? 81.433  56.189  52.118  1.00 122.70 ? 395  PRO B O     1 
ATOM   6266  C  CB    . PRO B  2  397 ? 81.570  59.348  52.159  1.00 121.21 ? 395  PRO B CB    1 
ATOM   6267  C  CG    . PRO B  2  397 ? 82.755  60.189  51.756  1.00 120.83 ? 395  PRO B CG    1 
ATOM   6268  C  CD    . PRO B  2  397 ? 83.552  60.256  53.025  1.00 120.69 ? 395  PRO B CD    1 
ATOM   6269  N  N     . SER B  2  398 ? 83.639  56.648  52.060  1.00 123.72 ? 396  SER B N     1 
ATOM   6270  C  CA    . SER B  2  398 ? 84.035  55.409  51.403  1.00 125.04 ? 396  SER B CA    1 
ATOM   6271  C  C     . SER B  2  398 ? 84.001  54.257  52.406  1.00 125.08 ? 396  SER B C     1 
ATOM   6272  O  O     . SER B  2  398 ? 83.371  53.224  52.169  1.00 125.04 ? 396  SER B O     1 
ATOM   6273  C  CB    . SER B  2  398 ? 85.453  55.563  50.839  1.00 125.98 ? 396  SER B CB    1 
ATOM   6274  O  OG    . SER B  2  398 ? 85.954  54.332  50.349  1.00 127.54 ? 396  SER B OG    1 
ATOM   6275  N  N     . VAL B  2  399 ? 84.689  54.455  53.527  1.00 125.15 ? 397  VAL B N     1 
ATOM   6276  C  CA    . VAL B  2  399 ? 84.768  53.464  54.596  1.00 124.55 ? 397  VAL B CA    1 
ATOM   6277  C  C     . VAL B  2  399 ? 83.383  53.181  55.174  1.00 124.45 ? 397  VAL B C     1 
ATOM   6278  O  O     . VAL B  2  399 ? 82.995  52.022  55.342  1.00 124.01 ? 397  VAL B O     1 
ATOM   6279  C  CB    . VAL B  2  399 ? 85.678  53.960  55.749  1.00 124.56 ? 397  VAL B CB    1 
ATOM   6280  C  CG1   . VAL B  2  399 ? 85.980  52.818  56.703  1.00 124.10 ? 397  VAL B CG1   1 
ATOM   6281  C  CG2   . VAL B  2  399 ? 86.956  54.573  55.191  1.00 124.23 ? 397  VAL B CG2   1 
ATOM   6282  N  N     . VAL B  2  400 ? 82.643  54.248  55.479  1.00 124.28 ? 398  VAL B N     1 
ATOM   6283  C  CA    . VAL B  2  400 ? 81.307  54.106  56.046  1.00 123.82 ? 398  VAL B CA    1 
ATOM   6284  C  C     . VAL B  2  400 ? 80.478  53.190  55.163  1.00 124.04 ? 398  VAL B C     1 
ATOM   6285  O  O     . VAL B  2  400 ? 79.751  52.331  55.660  1.00 124.00 ? 398  VAL B O     1 
ATOM   6286  C  CB    . VAL B  2  400 ? 80.591  55.471  56.184  1.00 122.84 ? 398  VAL B CB    1 
ATOM   6287  C  CG1   . VAL B  2  400 ? 80.479  56.138  54.839  1.00 122.34 ? 398  VAL B CG1   1 
ATOM   6288  C  CG2   . VAL B  2  400 ? 79.214  55.272  56.793  1.00 122.33 ? 398  VAL B CG2   1 
ATOM   6289  N  N     . ALA B  2  401 ? 80.610  53.370  53.852  1.00 124.12 ? 399  ALA B N     1 
ATOM   6290  C  CA    . ALA B  2  401 ? 79.886  52.557  52.880  1.00 123.69 ? 399  ALA B CA    1 
ATOM   6291  C  C     . ALA B  2  401 ? 80.213  51.074  53.056  1.00 123.56 ? 399  ALA B C     1 
ATOM   6292  O  O     . ALA B  2  401 ? 79.354  50.218  52.871  1.00 122.89 ? 399  ALA B O     1 
ATOM   6293  C  CB    . ALA B  2  401 ? 80.231  53.007  51.463  1.00 123.34 ? 399  ALA B CB    1 
ATOM   6294  N  N     . GLN B  2  402 ? 81.457  50.772  53.413  1.00 123.96 ? 400  GLN B N     1 
ATOM   6295  C  CA    . GLN B  2  402 ? 81.867  49.388  53.613  1.00 124.47 ? 400  GLN B CA    1 
ATOM   6296  C  C     . GLN B  2  402 ? 81.133  48.813  54.810  1.00 124.15 ? 400  GLN B C     1 
ATOM   6297  O  O     . GLN B  2  402 ? 80.437  47.803  54.704  1.00 124.35 ? 400  GLN B O     1 
ATOM   6298  C  CB    . GLN B  2  402 ? 83.374  49.294  53.873  1.00 125.48 ? 400  GLN B CB    1 
ATOM   6299  C  CG    . GLN B  2  402 ? 84.253  49.882  52.779  1.00 127.80 ? 400  GLN B CG    1 
ATOM   6300  C  CD    . GLN B  2  402 ? 85.743  49.791  53.104  1.00 128.61 ? 400  GLN B CD    1 
ATOM   6301  O  OE1   . GLN B  2  402 ? 86.587  50.298  52.355  1.00 128.16 ? 400  GLN B OE1   1 
ATOM   6302  N  NE2   . GLN B  2  402 ? 86.070  49.142  54.222  1.00 128.82 ? 400  GLN B NE2   1 
ATOM   6303  N  N     . LYS B  2  403 ? 81.295  49.475  55.952  1.00 123.59 ? 401  LYS B N     1 
ATOM   6304  C  CA    . LYS B  2  403 ? 80.680  49.038  57.200  1.00 123.09 ? 401  LYS B CA    1 
ATOM   6305  C  C     . LYS B  2  403 ? 79.212  48.687  57.021  1.00 122.17 ? 401  LYS B C     1 
ATOM   6306  O  O     . LYS B  2  403 ? 78.658  47.879  57.769  1.00 122.01 ? 401  LYS B O     1 
ATOM   6307  C  CB    . LYS B  2  403 ? 80.829  50.126  58.267  1.00 123.99 ? 401  LYS B CB    1 
ATOM   6308  C  CG    . LYS B  2  403 ? 82.255  50.647  58.426  1.00 124.73 ? 401  LYS B CG    1 
ATOM   6309  C  CD    . LYS B  2  403 ? 83.242  49.513  58.692  1.00 125.24 ? 401  LYS B CD    1 
ATOM   6310  C  CE    . LYS B  2  403 ? 84.682  50.007  58.641  1.00 125.67 ? 401  LYS B CE    1 
ATOM   6311  N  NZ    . LYS B  2  403 ? 85.668  48.892  58.739  1.00 125.33 ? 401  LYS B NZ    1 
ATOM   6312  N  N     . ILE B  2  404 ? 78.585  49.295  56.021  1.00 121.23 ? 402  ILE B N     1 
ATOM   6313  C  CA    . ILE B  2  404 ? 77.178  49.035  55.757  1.00 119.92 ? 402  ILE B CA    1 
ATOM   6314  C  C     . ILE B  2  404 ? 77.005  47.662  55.106  1.00 118.54 ? 402  ILE B C     1 
ATOM   6315  O  O     . ILE B  2  404 ? 76.485  46.738  55.735  1.00 118.06 ? 402  ILE B O     1 
ATOM   6316  C  CB    . ILE B  2  404 ? 76.549  50.124  54.831  1.00 120.09 ? 402  ILE B CB    1 
ATOM   6317  C  CG1   . ILE B  2  404 ? 76.773  51.522  55.416  1.00 120.16 ? 402  ILE B CG1   1 
ATOM   6318  C  CG2   . ILE B  2  404 ? 75.049  49.889  54.692  1.00 120.15 ? 402  ILE B CG2   1 
ATOM   6319  C  CD1   . ILE B  2  404 ? 76.203  52.649  54.559  1.00 120.05 ? 402  ILE B CD1   1 
ATOM   6320  N  N     . ASP B  2  405 ? 77.460  47.522  53.859  1.00 117.07 ? 403  ASP B N     1 
ATOM   6321  C  CA    . ASP B  2  405 ? 77.313  46.260  53.137  1.00 114.92 ? 403  ASP B CA    1 
ATOM   6322  C  C     . ASP B  2  405 ? 78.008  45.066  53.772  1.00 113.28 ? 403  ASP B C     1 
ATOM   6323  O  O     . ASP B  2  405 ? 77.865  43.946  53.287  1.00 113.65 ? 403  ASP B O     1 
ATOM   6324  C  CB    . ASP B  2  405 ? 77.751  46.400  51.666  1.00 114.61 ? 403  ASP B CB    1 
ATOM   6325  C  CG    . ASP B  2  405 ? 78.869  47.405  51.472  1.00 114.78 ? 403  ASP B CG    1 
ATOM   6326  O  OD1   . ASP B  2  405 ? 79.781  47.457  52.322  1.00 114.88 ? 403  ASP B OD1   1 
ATOM   6327  O  OD2   . ASP B  2  405 ? 78.838  48.134  50.454  1.00 114.20 ? 403  ASP B OD2   1 
ATOM   6328  N  N     . SER B  2  406 ? 78.751  45.294  54.852  1.00 111.07 ? 404  SER B N     1 
ATOM   6329  C  CA    . SER B  2  406 ? 79.425  44.196  55.542  1.00 108.46 ? 404  SER B CA    1 
ATOM   6330  C  C     . SER B  2  406 ? 78.375  43.502  56.407  1.00 107.30 ? 404  SER B C     1 
ATOM   6331  O  O     . SER B  2  406 ? 78.620  42.463  57.013  1.00 106.99 ? 404  SER B O     1 
ATOM   6332  C  CB    . SER B  2  406 ? 80.557  44.720  56.423  1.00 107.75 ? 404  SER B CB    1 
ATOM   6333  O  OG    . SER B  2  406 ? 80.047  45.337  57.588  1.00 106.83 ? 404  SER B OG    1 
ATOM   6334  N  N     . VAL B  2  407 ? 77.197  44.101  56.466  1.00 106.66 ? 405  VAL B N     1 
ATOM   6335  C  CA    . VAL B  2  407 ? 76.095  43.539  57.225  1.00 105.74 ? 405  VAL B CA    1 
ATOM   6336  C  C     . VAL B  2  407 ? 75.575  42.349  56.433  1.00 105.42 ? 405  VAL B C     1 
ATOM   6337  O  O     . VAL B  2  407 ? 75.309  42.455  55.238  1.00 105.03 ? 405  VAL B O     1 
ATOM   6338  C  CB    . VAL B  2  407 ? 74.965  44.573  57.396  1.00 105.34 ? 405  VAL B CB    1 
ATOM   6339  C  CG1   . VAL B  2  407 ? 73.766  43.938  58.100  1.00 105.01 ? 405  VAL B CG1   1 
ATOM   6340  C  CG2   . VAL B  2  407 ? 75.486  45.773  58.171  1.00 104.75 ? 405  VAL B CG2   1 
ATOM   6341  N  N     . THR B  2  408 ? 75.426  41.215  57.100  1.00 105.30 ? 406  THR B N     1 
ATOM   6342  C  CA    . THR B  2  408 ? 74.953  40.016  56.428  1.00 105.80 ? 406  THR B CA    1 
ATOM   6343  C  C     . THR B  2  408 ? 73.483  39.775  56.673  1.00 105.00 ? 406  THR B C     1 
ATOM   6344  O  O     . THR B  2  408 ? 72.887  40.358  57.573  1.00 104.88 ? 406  THR B O     1 
ATOM   6345  C  CB    . THR B  2  408 ? 75.702  38.779  56.925  1.00 107.22 ? 406  THR B CB    1 
ATOM   6346  O  OG1   . THR B  2  408 ? 75.241  38.441  58.241  1.00 107.77 ? 406  THR B OG1   1 
ATOM   6347  C  CG2   . THR B  2  408 ? 77.200  39.057  56.978  1.00 108.32 ? 406  THR B CG2   1 
ATOM   6348  N  N     . SER B  2  409 ? 72.906  38.895  55.869  1.00 104.80 ? 407  SER B N     1 
ATOM   6349  C  CA    . SER B  2  409 ? 71.505  38.547  56.013  1.00 105.54 ? 407  SER B CA    1 
ATOM   6350  C  C     . SER B  2  409 ? 71.255  38.106  57.449  1.00 106.31 ? 407  SER B C     1 
ATOM   6351  O  O     . SER B  2  409 ? 70.234  38.435  58.050  1.00 105.91 ? 407  SER B O     1 
ATOM   6352  C  CB    . SER B  2  409 ? 71.155  37.404  55.064  1.00 105.08 ? 407  SER B CB    1 
ATOM   6353  O  OG    . SER B  2  409 ? 69.866  36.884  55.344  1.00 105.89 ? 407  SER B OG    1 
ATOM   6354  N  N     . ALA B  2  410 ? 72.209  37.356  57.990  1.00 107.82 ? 408  ALA B N     1 
ATOM   6355  C  CA    . ALA B  2  410 ? 72.119  36.840  59.352  1.00 108.11 ? 408  ALA B CA    1 
ATOM   6356  C  C     . ALA B  2  410 ? 72.069  37.971  60.366  1.00 108.42 ? 408  ALA B C     1 
ATOM   6357  O  O     . ALA B  2  410 ? 71.077  38.114  61.084  1.00 108.15 ? 408  ALA B O     1 
ATOM   6358  C  CB    . ALA B  2  410 ? 73.306  35.932  59.643  1.00 108.23 ? 408  ALA B CB    1 
ATOM   6359  N  N     . ASP B  2  411 ? 73.144  38.760  60.421  1.00 108.57 ? 409  ASP B N     1 
ATOM   6360  C  CA    . ASP B  2  411 ? 73.242  39.898  61.338  1.00 109.50 ? 409  ASP B CA    1 
ATOM   6361  C  C     . ASP B  2  411 ? 71.870  40.537  61.569  1.00 109.85 ? 409  ASP B C     1 
ATOM   6362  O  O     . ASP B  2  411 ? 71.460  40.784  62.713  1.00 110.23 ? 409  ASP B O     1 
ATOM   6363  C  CB    . ASP B  2  411 ? 74.182  40.964  60.768  1.00 109.64 ? 409  ASP B CB    1 
ATOM   6364  C  CG    . ASP B  2  411 ? 75.589  40.461  60.569  1.00 109.69 ? 409  ASP B CG    1 
ATOM   6365  O  OD1   . ASP B  2  411 ? 76.153  39.899  61.528  1.00 109.94 ? 409  ASP B OD1   1 
ATOM   6366  O  OD2   . ASP B  2  411 ? 76.137  40.640  59.460  1.00 109.83 ? 409  ASP B OD2   1 
ATOM   6367  N  N     . VAL B  2  412 ? 71.181  40.804  60.461  1.00 109.03 ? 410  VAL B N     1 
ATOM   6368  C  CA    . VAL B  2  412 ? 69.856  41.407  60.467  1.00 107.43 ? 410  VAL B CA    1 
ATOM   6369  C  C     . VAL B  2  412 ? 68.834  40.578  61.254  1.00 106.87 ? 410  VAL B C     1 
ATOM   6370  O  O     . VAL B  2  412 ? 68.259  41.058  62.231  1.00 106.46 ? 410  VAL B O     1 
ATOM   6371  C  CB    . VAL B  2  412 ? 69.371  41.608  59.020  1.00 107.03 ? 410  VAL B CB    1 
ATOM   6372  C  CG1   . VAL B  2  412 ? 67.917  42.050  59.006  1.00 106.68 ? 410  VAL B CG1   1 
ATOM   6373  C  CG2   . VAL B  2  412 ? 70.264  42.634  58.325  1.00 106.08 ? 410  VAL B CG2   1 
ATOM   6374  N  N     . VAL B  2  413 ? 68.606  39.336  60.839  1.00 106.37 ? 411  VAL B N     1 
ATOM   6375  C  CA    . VAL B  2  413 ? 67.653  38.493  61.546  1.00 105.65 ? 411  VAL B CA    1 
ATOM   6376  C  C     . VAL B  2  413 ? 68.112  38.331  62.989  1.00 105.82 ? 411  VAL B C     1 
ATOM   6377  O  O     . VAL B  2  413 ? 67.306  38.032  63.870  1.00 106.18 ? 411  VAL B O     1 
ATOM   6378  C  CB    . VAL B  2  413 ? 67.517  37.096  60.901  1.00 104.92 ? 411  VAL B CB    1 
ATOM   6379  C  CG1   . VAL B  2  413 ? 66.444  36.297  61.625  1.00 103.12 ? 411  VAL B CG1   1 
ATOM   6380  C  CG2   . VAL B  2  413 ? 67.160  37.232  59.429  1.00 104.98 ? 411  VAL B CG2   1 
ATOM   6381  N  N     . ASN B  2  414 ? 69.410  38.521  63.228  1.00 105.56 ? 412  ASN B N     1 
ATOM   6382  C  CA    . ASN B  2  414 ? 69.954  38.421  64.583  1.00 105.57 ? 412  ASN B CA    1 
ATOM   6383  C  C     . ASN B  2  414 ? 69.367  39.562  65.403  1.00 104.73 ? 412  ASN B C     1 
ATOM   6384  O  O     . ASN B  2  414 ? 68.705  39.336  66.425  1.00 105.08 ? 412  ASN B O     1 
ATOM   6385  C  CB    . ASN B  2  414 ? 71.485  38.534  64.583  1.00 106.56 ? 412  ASN B CB    1 
ATOM   6386  C  CG    . ASN B  2  414 ? 72.168  37.250  64.146  1.00 107.04 ? 412  ASN B CG    1 
ATOM   6387  O  OD1   . ASN B  2  414 ? 71.817  36.158  64.604  1.00 106.46 ? 412  ASN B OD1   1 
ATOM   6388  N  ND2   . ASN B  2  414 ? 73.160  37.375  63.266  1.00 106.91 ? 412  ASN B ND2   1 
ATOM   6389  N  N     . ALA B  2  415 ? 69.623  40.789  64.949  1.00 102.51 ? 413  ALA B N     1 
ATOM   6390  C  CA    . ALA B  2  415 ? 69.100  41.974  65.611  1.00 99.55  ? 413  ALA B CA    1 
ATOM   6391  C  C     . ALA B  2  415 ? 67.617  41.716  65.835  1.00 98.01  ? 413  ALA B C     1 
ATOM   6392  O  O     . ALA B  2  415 ? 67.099  41.897  66.932  1.00 97.14  ? 413  ALA B O     1 
ATOM   6393  C  CB    . ALA B  2  415 ? 69.300  43.194  64.725  1.00 98.37  ? 413  ALA B CB    1 
ATOM   6394  N  N     . ALA B  2  416 ? 66.951  41.261  64.781  1.00 97.20  ? 414  ALA B N     1 
ATOM   6395  C  CA    . ALA B  2  416 ? 65.529  40.955  64.832  1.00 97.40  ? 414  ALA B CA    1 
ATOM   6396  C  C     . ALA B  2  416 ? 65.181  40.077  66.037  1.00 97.68  ? 414  ALA B C     1 
ATOM   6397  O  O     . ALA B  2  416 ? 64.159  40.276  66.701  1.00 98.38  ? 414  ALA B O     1 
ATOM   6398  C  CB    . ALA B  2  416 ? 65.105  40.263  63.538  1.00 97.20  ? 414  ALA B CB    1 
ATOM   6399  N  N     . LYS B  2  417 ? 66.027  39.095  66.318  1.00 97.28  ? 415  LYS B N     1 
ATOM   6400  C  CA    . LYS B  2  417 ? 65.776  38.217  67.446  1.00 96.35  ? 415  LYS B CA    1 
ATOM   6401  C  C     . LYS B  2  417 ? 66.070  38.941  68.746  1.00 96.31  ? 415  LYS B C     1 
ATOM   6402  O  O     . LYS B  2  417 ? 65.251  38.926  69.664  1.00 96.55  ? 415  LYS B O     1 
ATOM   6403  C  CB    . LYS B  2  417 ? 66.633  36.953  67.357  1.00 96.02  ? 415  LYS B CB    1 
ATOM   6404  C  CG    . LYS B  2  417 ? 66.114  35.903  66.388  1.00 94.79  ? 415  LYS B CG    1 
ATOM   6405  C  CD    . LYS B  2  417 ? 66.818  34.570  66.597  1.00 94.05  ? 415  LYS B CD    1 
ATOM   6406  C  CE    . LYS B  2  417 ? 66.218  33.475  65.729  1.00 93.78  ? 415  LYS B CE    1 
ATOM   6407  N  NZ    . LYS B  2  417 ? 66.822  32.130  65.985  1.00 93.09  ? 415  LYS B NZ    1 
ATOM   6408  N  N     . LYS B  2  418 ? 67.234  39.589  68.813  1.00 95.72  ? 416  LYS B N     1 
ATOM   6409  C  CA    . LYS B  2  418 ? 67.640  40.304  70.017  1.00 95.17  ? 416  LYS B CA    1 
ATOM   6410  C  C     . LYS B  2  418 ? 66.510  41.178  70.527  1.00 95.08  ? 416  LYS B C     1 
ATOM   6411  O  O     . LYS B  2  418 ? 66.476  41.534  71.706  1.00 95.12  ? 416  LYS B O     1 
ATOM   6412  C  CB    . LYS B  2  418 ? 68.882  41.158  69.753  1.00 95.01  ? 416  LYS B CB    1 
ATOM   6413  C  CG    . LYS B  2  418 ? 69.390  41.860  71.000  1.00 96.01  ? 416  LYS B CG    1 
ATOM   6414  C  CD    . LYS B  2  418 ? 70.666  42.644  70.751  1.00 96.83  ? 416  LYS B CD    1 
ATOM   6415  C  CE    . LYS B  2  418 ? 71.011  43.490  71.974  1.00 97.89  ? 416  LYS B CE    1 
ATOM   6416  N  NZ    . LYS B  2  418 ? 72.256  44.290  71.795  1.00 98.05  ? 416  LYS B NZ    1 
ATOM   6417  N  N     . PHE B  2  419 ? 65.584  41.511  69.630  1.00 94.95  ? 417  PHE B N     1 
ATOM   6418  C  CA    . PHE B  2  419 ? 64.435  42.332  69.976  1.00 94.83  ? 417  PHE B CA    1 
ATOM   6419  C  C     . PHE B  2  419 ? 63.355  41.473  70.604  1.00 94.95  ? 417  PHE B C     1 
ATOM   6420  O  O     . PHE B  2  419 ? 62.894  41.743  71.716  1.00 95.41  ? 417  PHE B O     1 
ATOM   6421  C  CB    . PHE B  2  419 ? 63.847  43.010  68.735  1.00 95.23  ? 417  PHE B CB    1 
ATOM   6422  C  CG    . PHE B  2  419 ? 62.548  43.741  69.001  1.00 96.07  ? 417  PHE B CG    1 
ATOM   6423  C  CD1   . PHE B  2  419 ? 62.545  45.093  69.344  1.00 95.70  ? 417  PHE B CD1   1 
ATOM   6424  C  CD2   . PHE B  2  419 ? 61.329  43.057  68.968  1.00 95.73  ? 417  PHE B CD2   1 
ATOM   6425  C  CE1   . PHE B  2  419 ? 61.348  45.745  69.655  1.00 95.50  ? 417  PHE B CE1   1 
ATOM   6426  C  CE2   . PHE B  2  419 ? 60.129  43.700  69.278  1.00 94.85  ? 417  PHE B CE2   1 
ATOM   6427  C  CZ    . PHE B  2  419 ? 60.137  45.042  69.623  1.00 94.78  ? 417  PHE B CZ    1 
ATOM   6428  N  N     . VAL B  2  420 ? 62.944  40.436  69.883  1.00 94.89  ? 418  VAL B N     1 
ATOM   6429  C  CA    . VAL B  2  420 ? 61.880  39.567  70.372  1.00 95.50  ? 418  VAL B CA    1 
ATOM   6430  C  C     . VAL B  2  420 ? 62.217  38.915  71.710  1.00 96.70  ? 418  VAL B C     1 
ATOM   6431  O  O     . VAL B  2  420 ? 61.329  38.542  72.479  1.00 96.03  ? 418  VAL B O     1 
ATOM   6432  C  CB    . VAL B  2  420 ? 61.549  38.466  69.347  1.00 93.85  ? 418  VAL B CB    1 
ATOM   6433  C  CG1   . VAL B  2  420 ? 60.121  37.971  69.577  1.00 92.36  ? 418  VAL B CG1   1 
ATOM   6434  C  CG2   . VAL B  2  420 ? 61.747  38.993  67.926  1.00 91.46  ? 418  VAL B CG2   1 
ATOM   6435  N  N     . SER B  2  421 ? 63.512  38.797  71.980  1.00 98.67  ? 419  SER B N     1 
ATOM   6436  C  CA    . SER B  2  421 ? 63.994  38.183  73.209  1.00 100.84 ? 419  SER B CA    1 
ATOM   6437  C  C     . SER B  2  421 ? 64.141  39.191  74.349  1.00 102.18 ? 419  SER B C     1 
ATOM   6438  O  O     . SER B  2  421 ? 63.499  39.052  75.399  1.00 103.17 ? 419  SER B O     1 
ATOM   6439  C  CB    . SER B  2  421 ? 65.343  37.498  72.948  1.00 100.89 ? 419  SER B CB    1 
ATOM   6440  O  OG    . SER B  2  421 ? 66.292  38.414  72.424  1.00 99.87  ? 419  SER B OG    1 
ATOM   6441  N  N     . GLY B  2  422 ? 64.989  40.198  74.132  1.00 102.25 ? 420  GLY B N     1 
ATOM   6442  C  CA    . GLY B  2  422 ? 65.233  41.224  75.135  1.00 101.02 ? 420  GLY B CA    1 
ATOM   6443  C  C     . GLY B  2  422 ? 64.008  41.819  75.815  1.00 100.22 ? 420  GLY B C     1 
ATOM   6444  O  O     . GLY B  2  422 ? 62.883  41.748  75.300  1.00 99.89  ? 420  GLY B O     1 
ATOM   6445  N  N     . LYS B  2  423 ? 64.231  42.404  76.990  1.00 99.36  ? 421  LYS B N     1 
ATOM   6446  C  CA    . LYS B  2  423 ? 63.160  43.032  77.753  1.00 97.98  ? 421  LYS B CA    1 
ATOM   6447  C  C     . LYS B  2  423 ? 62.839  44.338  77.058  1.00 98.74  ? 421  LYS B C     1 
ATOM   6448  O  O     . LYS B  2  423 ? 63.741  45.089  76.656  1.00 99.18  ? 421  LYS B O     1 
ATOM   6449  C  CB    . LYS B  2  423 ? 63.601  43.304  79.188  1.00 95.73  ? 421  LYS B CB    1 
ATOM   6450  C  CG    . LYS B  2  423 ? 62.490  43.787  80.093  1.00 93.47  ? 421  LYS B CG    1 
ATOM   6451  C  CD    . LYS B  2  423 ? 62.979  43.892  81.523  1.00 92.07  ? 421  LYS B CD    1 
ATOM   6452  C  CE    . LYS B  2  423 ? 61.857  44.261  82.467  1.00 90.83  ? 421  LYS B CE    1 
ATOM   6453  N  NZ    . LYS B  2  423 ? 62.363  44.370  83.856  1.00 90.63  ? 421  LYS B NZ    1 
ATOM   6454  N  N     . LYS B  2  424 ? 61.549  44.611  76.924  1.00 98.29  ? 422  LYS B N     1 
ATOM   6455  C  CA    . LYS B  2  424 ? 61.105  45.805  76.238  1.00 97.43  ? 422  LYS B CA    1 
ATOM   6456  C  C     . LYS B  2  424 ? 60.609  46.921  77.150  1.00 97.29  ? 422  LYS B C     1 
ATOM   6457  O  O     . LYS B  2  424 ? 60.376  46.726  78.348  1.00 97.43  ? 422  LYS B O     1 
ATOM   6458  C  CB    . LYS B  2  424 ? 60.017  45.408  75.243  1.00 96.90  ? 422  LYS B CB    1 
ATOM   6459  C  CG    . LYS B  2  424 ? 60.473  44.312  74.290  1.00 98.29  ? 422  LYS B CG    1 
ATOM   6460  C  CD    . LYS B  2  424 ? 59.364  43.337  73.968  1.00 98.33  ? 422  LYS B CD    1 
ATOM   6461  C  CE    . LYS B  2  424 ? 59.898  42.146  73.208  1.00 99.37  ? 422  LYS B CE    1 
ATOM   6462  N  NZ    . LYS B  2  424 ? 58.848  41.095  73.081  1.00 101.01 ? 422  LYS B NZ    1 
ATOM   6463  N  N     . SER B  2  425 ? 60.485  48.103  76.553  1.00 96.66  ? 423  SER B N     1 
ATOM   6464  C  CA    . SER B  2  425 ? 59.987  49.304  77.217  1.00 94.18  ? 423  SER B CA    1 
ATOM   6465  C  C     . SER B  2  425 ? 58.865  49.788  76.297  1.00 91.89  ? 423  SER B C     1 
ATOM   6466  O  O     . SER B  2  425 ? 58.864  49.485  75.101  1.00 91.88  ? 423  SER B O     1 
ATOM   6467  C  CB    . SER B  2  425 ? 61.084  50.373  77.300  1.00 94.58  ? 423  SER B CB    1 
ATOM   6468  O  OG    . SER B  2  425 ? 62.259  49.873  77.912  1.00 95.64  ? 423  SER B OG    1 
ATOM   6469  N  N     . MET B  2  426 ? 57.909  50.532  76.832  1.00 88.61  ? 424  MET B N     1 
ATOM   6470  C  CA    . MET B  2  426 ? 56.825  51.011  75.992  1.00 85.02  ? 424  MET B CA    1 
ATOM   6471  C  C     . MET B  2  426 ? 56.264  52.335  76.489  1.00 84.36  ? 424  MET B C     1 
ATOM   6472  O  O     . MET B  2  426 ? 56.105  52.552  77.694  1.00 85.12  ? 424  MET B O     1 
ATOM   6473  C  CB    . MET B  2  426 ? 55.718  49.965  75.940  1.00 82.22  ? 424  MET B CB    1 
ATOM   6474  C  CG    . MET B  2  426 ? 54.621  50.251  74.947  1.00 77.43  ? 424  MET B CG    1 
ATOM   6475  S  SD    . MET B  2  426 ? 53.192  49.282  75.400  1.00 75.43  ? 424  MET B SD    1 
ATOM   6476  C  CE    . MET B  2  426 ? 52.136  49.579  74.066  1.00 74.66  ? 424  MET B CE    1 
ATOM   6477  N  N     . ALA B  2  427 ? 55.975  53.222  75.547  1.00 82.71  ? 425  ALA B N     1 
ATOM   6478  C  CA    . ALA B  2  427 ? 55.420  54.524  75.863  1.00 81.05  ? 425  ALA B CA    1 
ATOM   6479  C  C     . ALA B  2  427 ? 54.229  54.768  74.937  1.00 80.32  ? 425  ALA B C     1 
ATOM   6480  O  O     . ALA B  2  427 ? 54.286  54.474  73.743  1.00 80.01  ? 425  ALA B O     1 
ATOM   6481  C  CB    . ALA B  2  427 ? 56.487  55.604  75.669  1.00 79.66  ? 425  ALA B CB    1 
ATOM   6482  N  N     . ALA B  2  428 ? 53.144  55.295  75.491  1.00 80.33  ? 426  ALA B N     1 
ATOM   6483  C  CA    . ALA B  2  428 ? 51.955  55.576  74.695  1.00 80.45  ? 426  ALA B CA    1 
ATOM   6484  C  C     . ALA B  2  428 ? 51.208  56.813  75.199  1.00 80.32  ? 426  ALA B C     1 
ATOM   6485  O  O     . ALA B  2  428 ? 51.488  57.318  76.284  1.00 81.30  ? 426  ALA B O     1 
ATOM   6486  C  CB    . ALA B  2  428 ? 51.032  54.371  74.714  1.00 80.30  ? 426  ALA B CB    1 
ATOM   6487  N  N     . SER B  2  429 ? 50.269  57.306  74.397  1.00 79.08  ? 427  SER B N     1 
ATOM   6488  C  CA    . SER B  2  429 ? 49.469  58.457  74.782  1.00 77.60  ? 427  SER B CA    1 
ATOM   6489  C  C     . SER B  2  429 ? 48.280  58.627  73.856  1.00 77.58  ? 427  SER B C     1 
ATOM   6490  O  O     . SER B  2  429 ? 48.357  58.384  72.654  1.00 77.10  ? 427  SER B O     1 
ATOM   6491  C  CB    . SER B  2  429 ? 50.316  59.729  74.801  1.00 76.55  ? 427  SER B CB    1 
ATOM   6492  O  OG    . SER B  2  429 ? 50.811  60.039  73.523  1.00 76.79  ? 427  SER B OG    1 
ATOM   6493  N  N     . GLY B  2  430 ? 47.166  59.038  74.442  1.00 78.59  ? 428  GLY B N     1 
ATOM   6494  C  CA    . GLY B  2  430 ? 45.943  59.230  73.689  1.00 79.02  ? 428  GLY B CA    1 
ATOM   6495  C  C     . GLY B  2  430 ? 44.833  58.495  74.407  1.00 79.23  ? 428  GLY B C     1 
ATOM   6496  O  O     . GLY B  2  430 ? 44.980  58.151  75.579  1.00 79.94  ? 428  GLY B O     1 
ATOM   6497  N  N     . ASP B  2  431 ? 43.713  58.271  73.734  1.00 79.51  ? 429  ASP B N     1 
ATOM   6498  C  CA    . ASP B  2  431 ? 42.634  57.533  74.358  1.00 80.54  ? 429  ASP B CA    1 
ATOM   6499  C  C     . ASP B  2  431 ? 43.127  56.097  74.259  1.00 81.58  ? 429  ASP B C     1 
ATOM   6500  O  O     . ASP B  2  431 ? 42.799  55.384  73.316  1.00 83.43  ? 429  ASP B O     1 
ATOM   6501  C  CB    . ASP B  2  431 ? 41.335  57.713  73.581  1.00 80.14  ? 429  ASP B CB    1 
ATOM   6502  C  CG    . ASP B  2  431 ? 40.170  57.015  74.241  1.00 81.18  ? 429  ASP B CG    1 
ATOM   6503  O  OD1   . ASP B  2  431 ? 40.260  55.782  74.444  1.00 81.75  ? 429  ASP B OD1   1 
ATOM   6504  O  OD2   . ASP B  2  431 ? 39.166  57.694  74.558  1.00 81.65  ? 429  ASP B OD2   1 
ATOM   6505  N  N     . LEU B  2  432 ? 43.933  55.683  75.232  1.00 81.80  ? 430  LEU B N     1 
ATOM   6506  C  CA    . LEU B  2  432 ? 44.518  54.348  75.234  1.00 81.54  ? 430  LEU B CA    1 
ATOM   6507  C  C     . LEU B  2  432 ? 43.531  53.204  75.413  1.00 82.14  ? 430  LEU B C     1 
ATOM   6508  O  O     . LEU B  2  432 ? 43.927  52.068  75.656  1.00 81.52  ? 430  LEU B O     1 
ATOM   6509  C  CB    . LEU B  2  432 ? 45.600  54.278  76.310  1.00 80.45  ? 430  LEU B CB    1 
ATOM   6510  C  CG    . LEU B  2  432 ? 46.699  55.336  76.157  1.00 80.42  ? 430  LEU B CG    1 
ATOM   6511  C  CD1   . LEU B  2  432 ? 47.766  55.131  77.209  1.00 80.69  ? 430  LEU B CD1   1 
ATOM   6512  C  CD2   . LEU B  2  432 ? 47.313  55.250  74.772  1.00 79.93  ? 430  LEU B CD2   1 
ATOM   6513  N  N     . GLY B  2  433 ? 42.247  53.504  75.267  1.00 83.27  ? 431  GLY B N     1 
ATOM   6514  C  CA    . GLY B  2  433 ? 41.218  52.493  75.431  1.00 84.88  ? 431  GLY B CA    1 
ATOM   6515  C  C     . GLY B  2  433 ? 41.487  51.118  74.838  1.00 85.99  ? 431  GLY B C     1 
ATOM   6516  O  O     . GLY B  2  433 ? 41.328  50.103  75.514  1.00 85.43  ? 431  GLY B O     1 
ATOM   6517  N  N     . SER B  2  434 ? 41.894  51.074  73.576  1.00 87.36  ? 432  SER B N     1 
ATOM   6518  C  CA    . SER B  2  434 ? 42.140  49.800  72.916  1.00 88.31  ? 432  SER B CA    1 
ATOM   6519  C  C     . SER B  2  434 ? 43.631  49.540  72.743  1.00 88.96  ? 432  SER B C     1 
ATOM   6520  O  O     . SER B  2  434 ? 44.049  48.803  71.847  1.00 88.72  ? 432  SER B O     1 
ATOM   6521  C  CB    . SER B  2  434 ? 41.450  49.792  71.551  1.00 89.23  ? 432  SER B CB    1 
ATOM   6522  O  OG    . SER B  2  434 ? 40.118  50.267  71.648  1.00 90.11  ? 432  SER B OG    1 
ATOM   6523  N  N     . THR B  2  435 ? 44.436  50.150  73.603  1.00 89.62  ? 433  THR B N     1 
ATOM   6524  C  CA    . THR B  2  435 ? 45.879  49.972  73.528  1.00 90.15  ? 433  THR B CA    1 
ATOM   6525  C  C     . THR B  2  435 ? 46.348  48.864  74.479  1.00 91.57  ? 433  THR B C     1 
ATOM   6526  O  O     . THR B  2  435 ? 45.955  48.815  75.650  1.00 91.60  ? 433  THR B O     1 
ATOM   6527  C  CB    . THR B  2  435 ? 46.600  51.286  73.860  1.00 88.83  ? 433  THR B CB    1 
ATOM   6528  O  OG1   . THR B  2  435 ? 46.041  52.344  73.071  1.00 89.07  ? 433  THR B OG1   1 
ATOM   6529  C  CG2   . THR B  2  435 ? 48.073  51.171  73.553  1.00 87.18  ? 433  THR B CG2   1 
ATOM   6530  N  N     . PRO B  2  436 ? 47.189  47.944  73.979  1.00 92.47  ? 434  PRO B N     1 
ATOM   6531  C  CA    . PRO B  2  436 ? 47.697  46.841  74.804  1.00 92.57  ? 434  PRO B CA    1 
ATOM   6532  C  C     . PRO B  2  436 ? 48.885  47.200  75.703  1.00 92.76  ? 434  PRO B C     1 
ATOM   6533  O  O     . PRO B  2  436 ? 49.658  48.122  75.406  1.00 91.34  ? 434  PRO B O     1 
ATOM   6534  C  CB    . PRO B  2  436 ? 48.069  45.797  73.767  1.00 92.90  ? 434  PRO B CB    1 
ATOM   6535  C  CG    . PRO B  2  436 ? 48.590  46.660  72.632  1.00 92.82  ? 434  PRO B CG    1 
ATOM   6536  C  CD    . PRO B  2  436 ? 47.542  47.747  72.558  1.00 91.99  ? 434  PRO B CD    1 
ATOM   6537  N  N     . PHE B  2  437 ? 49.011  46.458  76.804  1.00 93.18  ? 435  PHE B N     1 
ATOM   6538  C  CA    . PHE B  2  437 ? 50.103  46.641  77.763  1.00 93.91  ? 435  PHE B CA    1 
ATOM   6539  C  C     . PHE B  2  437 ? 51.290  45.804  77.281  1.00 94.76  ? 435  PHE B C     1 
ATOM   6540  O  O     . PHE B  2  437 ? 51.105  44.804  76.582  1.00 94.94  ? 435  PHE B O     1 
ATOM   6541  C  CB    . PHE B  2  437 ? 49.691  46.168  79.167  1.00 92.60  ? 435  PHE B CB    1 
ATOM   6542  C  CG    . PHE B  2  437 ? 48.582  46.975  79.792  1.00 91.61  ? 435  PHE B CG    1 
ATOM   6543  C  CD1   . PHE B  2  437 ? 47.298  46.940  79.273  1.00 90.90  ? 435  PHE B CD1   1 
ATOM   6544  C  CD2   . PHE B  2  437 ? 48.827  47.771  80.906  1.00 91.15  ? 435  PHE B CD2   1 
ATOM   6545  C  CE1   . PHE B  2  437 ? 46.276  47.687  79.856  1.00 90.54  ? 435  PHE B CE1   1 
ATOM   6546  C  CE2   . PHE B  2  437 ? 47.810  48.520  81.491  1.00 89.82  ? 435  PHE B CE2   1 
ATOM   6547  C  CZ    . PHE B  2  437 ? 46.535  48.476  80.966  1.00 89.54  ? 435  PHE B CZ    1 
ATOM   6548  N  N     . LEU B  2  438 ? 52.501  46.204  77.659  1.00 95.10  ? 436  LEU B N     1 
ATOM   6549  C  CA    . LEU B  2  438 ? 53.707  45.490  77.249  1.00 95.29  ? 436  LEU B CA    1 
ATOM   6550  C  C     . LEU B  2  438 ? 53.521  43.976  77.398  1.00 96.33  ? 436  LEU B C     1 
ATOM   6551  O  O     . LEU B  2  438 ? 53.870  43.208  76.505  1.00 96.27  ? 436  LEU B O     1 
ATOM   6552  C  CB    . LEU B  2  438 ? 54.901  45.964  78.085  1.00 94.24  ? 436  LEU B CB    1 
ATOM   6553  C  CG    . LEU B  2  438 ? 56.310  45.807  77.510  1.00 92.91  ? 436  LEU B CG    1 
ATOM   6554  C  CD1   . LEU B  2  438 ? 56.433  46.593  76.227  1.00 92.62  ? 436  LEU B CD1   1 
ATOM   6555  C  CD2   . LEU B  2  438 ? 57.329  46.306  78.509  1.00 92.58  ? 436  LEU B CD2   1 
ATOM   6556  N  N     . ASP B  2  439 ? 52.949  43.548  78.517  1.00 97.49  ? 437  ASP B N     1 
ATOM   6557  C  CA    . ASP B  2  439 ? 52.735  42.126  78.743  1.00 98.78  ? 437  ASP B CA    1 
ATOM   6558  C  C     . ASP B  2  439 ? 51.510  41.604  78.021  1.00 98.91  ? 437  ASP B C     1 
ATOM   6559  O  O     . ASP B  2  439 ? 50.655  40.969  78.625  1.00 98.69  ? 437  ASP B O     1 
ATOM   6560  C  CB    . ASP B  2  439 ? 52.596  41.828  80.238  1.00 100.50 ? 437  ASP B CB    1 
ATOM   6561  C  CG    . ASP B  2  439 ? 51.439  42.568  80.874  1.00 102.01 ? 437  ASP B CG    1 
ATOM   6562  O  OD1   . ASP B  2  439 ? 51.526  43.815  80.955  1.00 103.88 ? 437  ASP B OD1   1 
ATOM   6563  O  OD2   . ASP B  2  439 ? 50.453  41.907  81.283  1.00 101.17 ? 437  ASP B OD2   1 
ATOM   6564  N  N     . GLU B  2  440 ? 51.419  41.883  76.730  1.00 99.79  ? 438  GLU B N     1 
ATOM   6565  C  CA    . GLU B  2  440 ? 50.298  41.406  75.927  1.00 101.45 ? 438  GLU B CA    1 
ATOM   6566  C  C     . GLU B  2  440 ? 50.773  41.341  74.478  1.00 101.66 ? 438  GLU B C     1 
ATOM   6567  O  O     . GLU B  2  440 ? 50.025  40.957  73.575  1.00 100.93 ? 438  GLU B O     1 
ATOM   6568  C  CB    . GLU B  2  440 ? 49.089  42.348  76.045  1.00 102.60 ? 438  GLU B CB    1 
ATOM   6569  C  CG    . GLU B  2  440 ? 48.620  42.644  77.474  1.00 103.79 ? 438  GLU B CG    1 
ATOM   6570  C  CD    . GLU B  2  440 ? 47.289  43.401  77.527  1.00 104.58 ? 438  GLU B CD    1 
ATOM   6571  O  OE1   . GLU B  2  440 ? 47.102  44.351  76.729  1.00 104.78 ? 438  GLU B OE1   1 
ATOM   6572  O  OE2   . GLU B  2  440 ? 46.435  43.052  78.376  1.00 103.73 ? 438  GLU B OE2   1 
ATOM   6573  N  N     . LEU B  2  441 ? 52.031  41.724  74.273  1.00 102.06 ? 439  LEU B N     1 
ATOM   6574  C  CA    . LEU B  2  441 ? 52.639  41.717  72.949  1.00 103.17 ? 439  LEU B CA    1 
ATOM   6575  C  C     . LEU B  2  441 ? 53.527  40.488  72.772  1.00 104.55 ? 439  LEU B C     1 
ATOM   6576  O  O     . LEU B  2  441 ? 54.755  40.665  72.593  1.00 105.02 ? 439  LEU B O     1 
ATOM   6577  C  CB    . LEU B  2  441 ? 53.470  42.981  72.742  1.00 101.38 ? 439  LEU B CB    1 
ATOM   6578  C  CG    . LEU B  2  441 ? 52.706  44.290  72.916  1.00 101.51 ? 439  LEU B CG    1 
ATOM   6579  C  CD1   . LEU B  2  441 ? 53.633  45.460  72.629  1.00 101.18 ? 439  LEU B CD1   1 
ATOM   6580  C  CD2   . LEU B  2  441 ? 51.499  44.310  71.985  1.00 101.81 ? 439  LEU B CD2   1 
ATOM   6581  O  OXT   . LEU B  2  441 ? 52.979  39.360  72.821  1.00 106.16 ? 439  LEU B OXT   1 
ATOM   6582  N  N     . MET C  3  1   ? 54.389  98.782  79.529  1.00 137.16 ? 1    MET C N     1 
ATOM   6583  C  CA    . MET C  3  1   ? 54.262  100.143 78.926  1.00 137.74 ? 1    MET C CA    1 
ATOM   6584  C  C     . MET C  3  1   ? 53.212  100.208 77.813  1.00 136.66 ? 1    MET C C     1 
ATOM   6585  O  O     . MET C  3  1   ? 52.773  99.171  77.304  1.00 136.95 ? 1    MET C O     1 
ATOM   6586  C  CB    . MET C  3  1   ? 55.619  100.601 78.380  1.00 139.43 ? 1    MET C CB    1 
ATOM   6587  C  CG    . MET C  3  1   ? 56.652  100.841 79.458  1.00 141.60 ? 1    MET C CG    1 
ATOM   6588  S  SD    . MET C  3  1   ? 56.017  101.981 80.707  1.00 144.39 ? 1    MET C SD    1 
ATOM   6589  C  CE    . MET C  3  1   ? 55.260  100.827 81.897  1.00 143.69 ? 1    MET C CE    1 
ATOM   6590  N  N     . ALA C  3  2   ? 52.817  101.429 77.443  1.00 134.28 ? 2    ALA C N     1 
ATOM   6591  C  CA    . ALA C  3  2   ? 51.825  101.645 76.389  1.00 131.21 ? 2    ALA C CA    1 
ATOM   6592  C  C     . ALA C  3  2   ? 52.493  102.188 75.127  1.00 128.93 ? 2    ALA C C     1 
ATOM   6593  O  O     . ALA C  3  2   ? 53.102  103.262 75.143  1.00 127.90 ? 2    ALA C O     1 
ATOM   6594  C  CB    . ALA C  3  2   ? 50.751  102.608 76.874  1.00 131.55 ? 2    ALA C CB    1 
ATOM   6595  N  N     . PRO C  3  3   ? 52.377  101.450 74.010  1.00 127.25 ? 3    PRO C N     1 
ATOM   6596  C  CA    . PRO C  3  3   ? 52.976  101.857 72.737  1.00 126.57 ? 3    PRO C CA    1 
ATOM   6597  C  C     . PRO C  3  3   ? 52.624  103.274 72.276  1.00 126.27 ? 3    PRO C C     1 
ATOM   6598  O  O     . PRO C  3  3   ? 53.447  104.186 72.389  1.00 126.38 ? 3    PRO C O     1 
ATOM   6599  C  CB    . PRO C  3  3   ? 52.511  100.764 71.766  1.00 126.07 ? 3    PRO C CB    1 
ATOM   6600  C  CG    . PRO C  3  3   ? 51.267  100.230 72.392  1.00 126.42 ? 3    PRO C CG    1 
ATOM   6601  C  CD    . PRO C  3  3   ? 51.608  100.203 73.851  1.00 126.77 ? 3    PRO C CD    1 
ATOM   6602  N  N     . ASN C  3  4   ? 51.413  103.468 71.760  1.00 125.62 ? 4    ASN C N     1 
ATOM   6603  C  CA    . ASN C  3  4   ? 51.007  104.793 71.296  1.00 124.37 ? 4    ASN C CA    1 
ATOM   6604  C  C     . ASN C  3  4   ? 50.719  105.726 72.459  1.00 123.76 ? 4    ASN C C     1 
ATOM   6605  O  O     . ASN C  3  4   ? 50.344  105.283 73.548  1.00 123.73 ? 4    ASN C O     1 
ATOM   6606  C  CB    . ASN C  3  4   ? 49.772  104.708 70.383  1.00 123.84 ? 4    ASN C CB    1 
ATOM   6607  C  CG    . ASN C  3  4   ? 48.742  103.722 70.881  1.00 122.91 ? 4    ASN C CG    1 
ATOM   6608  O  OD1   . ASN C  3  4   ? 48.486  103.637 72.078  1.00 123.52 ? 4    ASN C OD1   1 
ATOM   6609  N  ND2   . ASN C  3  4   ? 48.135  102.976 69.960  1.00 121.59 ? 4    ASN C ND2   1 
ATOM   6610  N  N     . ILE C  3  5   ? 50.900  107.021 72.215  1.00 123.04 ? 5    ILE C N     1 
ATOM   6611  C  CA    . ILE C  3  5   ? 50.667  108.043 73.229  1.00 122.52 ? 5    ILE C CA    1 
ATOM   6612  C  C     . ILE C  3  5   ? 49.212  108.517 73.216  1.00 121.98 ? 5    ILE C C     1 
ATOM   6613  O  O     . ILE C  3  5   ? 48.862  109.490 73.887  1.00 122.99 ? 5    ILE C O     1 
ATOM   6614  C  CB    . ILE C  3  5   ? 51.594  109.258 73.005  1.00 122.26 ? 5    ILE C CB    1 
ATOM   6615  C  CG1   . ILE C  3  5   ? 53.034  108.773 72.802  1.00 123.32 ? 5    ILE C CG1   1 
ATOM   6616  C  CG2   . ILE C  3  5   ? 51.518  110.206 74.192  1.00 121.01 ? 5    ILE C CG2   1 
ATOM   6617  C  CD1   . ILE C  3  5   ? 53.561  107.865 73.914  1.00 123.80 ? 5    ILE C CD1   1 
ATOM   6618  N  N     . ARG C  3  6   ? 48.370  107.814 72.457  1.00 120.74 ? 6    ARG C N     1 
ATOM   6619  C  CA    . ARG C  3  6   ? 46.947  108.138 72.331  1.00 118.44 ? 6    ARG C CA    1 
ATOM   6620  C  C     . ARG C  3  6   ? 46.126  107.426 73.407  1.00 117.71 ? 6    ARG C C     1 
ATOM   6621  O  O     . ARG C  3  6   ? 45.090  107.934 73.845  1.00 117.54 ? 6    ARG C O     1 
ATOM   6622  C  CB    . ARG C  3  6   ? 46.447  107.716 70.946  1.00 117.91 ? 6    ARG C CB    1 
ATOM   6623  C  CG    . ARG C  3  6   ? 45.002  108.076 70.639  1.00 117.69 ? 6    ARG C CG    1 
ATOM   6624  C  CD    . ARG C  3  6   ? 44.340  106.966 69.819  1.00 117.69 ? 6    ARG C CD    1 
ATOM   6625  N  NE    . ARG C  3  6   ? 45.019  106.694 68.556  1.00 116.43 ? 6    ARG C NE    1 
ATOM   6626  C  CZ    . ARG C  3  6   ? 44.920  105.550 67.884  1.00 116.10 ? 6    ARG C CZ    1 
ATOM   6627  N  NH1   . ARG C  3  6   ? 44.173  104.557 68.352  1.00 114.16 ? 6    ARG C NH1   1 
ATOM   6628  N  NH2   . ARG C  3  6   ? 45.563  105.401 66.735  1.00 116.97 ? 6    ARG C NH2   1 
ATOM   6629  N  N     . LYS C  3  7   ? 46.607  106.254 73.828  1.00 117.04 ? 7    LYS C N     1 
ATOM   6630  C  CA    . LYS C  3  7   ? 45.945  105.425 74.843  1.00 116.09 ? 7    LYS C CA    1 
ATOM   6631  C  C     . LYS C  3  7   ? 46.608  105.494 76.238  1.00 115.62 ? 7    LYS C C     1 
ATOM   6632  O  O     . LYS C  3  7   ? 46.033  105.028 77.228  1.00 115.00 ? 7    LYS C O     1 
ATOM   6633  C  CB    . LYS C  3  7   ? 45.915  103.957 74.376  1.00 115.67 ? 7    LYS C CB    1 
ATOM   6634  C  CG    . LYS C  3  7   ? 45.341  103.714 72.975  1.00 114.55 ? 7    LYS C CG    1 
ATOM   6635  C  CD    . LYS C  3  7   ? 45.741  102.331 72.445  1.00 115.18 ? 7    LYS C CD    1 
ATOM   6636  C  CE    . LYS C  3  7   ? 45.457  102.193 70.945  1.00 116.85 ? 7    LYS C CE    1 
ATOM   6637  N  NZ    . LYS C  3  7   ? 46.220  101.078 70.281  1.00 115.62 ? 7    LYS C NZ    1 
ATOM   6638  N  N     . SER C  3  8   ? 47.809  106.070 76.310  1.00 115.22 ? 8    SER C N     1 
ATOM   6639  C  CA    . SER C  3  8   ? 48.545  106.180 77.574  1.00 114.32 ? 8    SER C CA    1 
ATOM   6640  C  C     . SER C  3  8   ? 48.453  107.547 78.286  1.00 114.20 ? 8    SER C C     1 
ATOM   6641  O  O     . SER C  3  8   ? 48.175  107.607 79.488  1.00 114.28 ? 8    SER C O     1 
ATOM   6642  C  CB    . SER C  3  8   ? 50.022  105.809 77.349  1.00 113.47 ? 8    SER C CB    1 
ATOM   6643  O  OG    . SER C  3  8   ? 50.643  106.633 76.375  1.00 110.74 ? 8    SER C OG    1 
ATOM   6644  N  N     . HIS C  3  9   ? 48.693  108.629 77.543  1.00 113.21 ? 9    HIS C N     1 
ATOM   6645  C  CA    . HIS C  3  9   ? 48.655  110.006 78.065  1.00 112.43 ? 9    HIS C CA    1 
ATOM   6646  C  C     . HIS C  3  9   ? 47.410  110.286 78.930  1.00 112.11 ? 9    HIS C C     1 
ATOM   6647  O  O     . HIS C  3  9   ? 46.281  110.117 78.463  1.00 113.25 ? 9    HIS C O     1 
ATOM   6648  C  CB    . HIS C  3  9   ? 48.697  110.980 76.878  1.00 111.57 ? 9    HIS C CB    1 
ATOM   6649  C  CG    . HIS C  3  9   ? 48.839  112.418 77.266  1.00 110.24 ? 9    HIS C CG    1 
ATOM   6650  N  ND1   . HIS C  3  9   ? 47.968  113.047 78.128  1.00 109.67 ? 9    HIS C ND1   1 
ATOM   6651  C  CD2   . HIS C  3  9   ? 49.728  113.360 76.875  1.00 109.45 ? 9    HIS C CD2   1 
ATOM   6652  C  CE1   . HIS C  3  9   ? 48.314  114.315 78.250  1.00 109.41 ? 9    HIS C CE1   1 
ATOM   6653  N  NE2   . HIS C  3  9   ? 49.378  114.531 77.500  1.00 109.54 ? 9    HIS C NE2   1 
ATOM   6654  N  N     . PRO C  3  10  ? 47.599  110.738 80.194  1.00 110.46 ? 10   PRO C N     1 
ATOM   6655  C  CA    . PRO C  3  10  ? 46.477  111.032 81.106  1.00 107.73 ? 10   PRO C CA    1 
ATOM   6656  C  C     . PRO C  3  10  ? 45.336  111.874 80.521  1.00 105.15 ? 10   PRO C C     1 
ATOM   6657  O  O     . PRO C  3  10  ? 44.182  111.724 80.931  1.00 104.55 ? 10   PRO C O     1 
ATOM   6658  C  CB    . PRO C  3  10  ? 47.160  111.725 82.281  1.00 107.77 ? 10   PRO C CB    1 
ATOM   6659  C  CG    . PRO C  3  10  ? 48.490  111.042 82.324  1.00 109.04 ? 10   PRO C CG    1 
ATOM   6660  C  CD    . PRO C  3  10  ? 48.888  111.008 80.860  1.00 109.80 ? 10   PRO C CD    1 
ATOM   6661  N  N     . LEU C  3  11  ? 45.653  112.754 79.571  1.00 102.12 ? 11   LEU C N     1 
ATOM   6662  C  CA    . LEU C  3  11  ? 44.633  113.598 78.954  1.00 99.05  ? 11   LEU C CA    1 
ATOM   6663  C  C     . LEU C  3  11  ? 44.125  113.045 77.623  1.00 98.15  ? 11   LEU C C     1 
ATOM   6664  O  O     . LEU C  3  11  ? 42.916  112.892 77.435  1.00 97.58  ? 11   LEU C O     1 
ATOM   6665  C  CB    . LEU C  3  11  ? 45.154  115.028 78.761  1.00 96.82  ? 11   LEU C CB    1 
ATOM   6666  C  CG    . LEU C  3  11  ? 45.538  115.843 80.009  1.00 94.72  ? 11   LEU C CG    1 
ATOM   6667  C  CD1   . LEU C  3  11  ? 45.629  117.311 79.627  1.00 93.29  ? 11   LEU C CD1   1 
ATOM   6668  C  CD2   . LEU C  3  11  ? 44.520  115.666 81.120  1.00 92.31  ? 11   LEU C CD2   1 
ATOM   6669  N  N     . LEU C  3  12  ? 45.032  112.746 76.696  1.00 97.18  ? 12   LEU C N     1 
ATOM   6670  C  CA    . LEU C  3  12  ? 44.612  112.197 75.411  1.00 96.00  ? 12   LEU C CA    1 
ATOM   6671  C  C     . LEU C  3  12  ? 43.841  110.917 75.638  1.00 95.42  ? 12   LEU C C     1 
ATOM   6672  O  O     . LEU C  3  12  ? 42.837  110.668 74.983  1.00 95.59  ? 12   LEU C O     1 
ATOM   6673  C  CB    . LEU C  3  12  ? 45.810  111.906 74.521  1.00 94.51  ? 12   LEU C CB    1 
ATOM   6674  C  CG    . LEU C  3  12  ? 46.640  113.140 74.209  1.00 95.40  ? 12   LEU C CG    1 
ATOM   6675  C  CD1   . LEU C  3  12  ? 47.527  112.812 73.038  1.00 94.95  ? 12   LEU C CD1   1 
ATOM   6676  C  CD2   . LEU C  3  12  ? 45.746  114.332 73.881  1.00 94.05  ? 12   LEU C CD2   1 
ATOM   6677  N  N     . LYS C  3  13  ? 44.322  110.103 76.569  1.00 95.39  ? 13   LYS C N     1 
ATOM   6678  C  CA    . LYS C  3  13  ? 43.660  108.847 76.900  1.00 95.54  ? 13   LYS C CA    1 
ATOM   6679  C  C     . LYS C  3  13  ? 42.168  109.106 77.046  1.00 95.84  ? 13   LYS C C     1 
ATOM   6680  O  O     . LYS C  3  13  ? 41.358  108.194 76.902  1.00 96.21  ? 13   LYS C O     1 
ATOM   6681  C  CB    . LYS C  3  13  ? 44.209  108.277 78.218  1.00 95.00  ? 13   LYS C CB    1 
ATOM   6682  C  CG    . LYS C  3  13  ? 43.354  107.181 78.845  1.00 93.87  ? 13   LYS C CG    1 
ATOM   6683  C  CD    . LYS C  3  13  ? 43.947  106.680 80.153  1.00 94.90  ? 13   LYS C CD    1 
ATOM   6684  C  CE    . LYS C  3  13  ? 45.249  105.917 79.924  1.00 95.73  ? 13   LYS C CE    1 
ATOM   6685  N  NZ    . LYS C  3  13  ? 45.811  105.324 81.173  1.00 95.06  ? 13   LYS C NZ    1 
ATOM   6686  N  N     . MET C  3  14  ? 41.814  110.358 77.331  1.00 95.67  ? 14   MET C N     1 
ATOM   6687  C  CA    . MET C  3  14  ? 40.418  110.740 77.507  1.00 94.73  ? 14   MET C CA    1 
ATOM   6688  C  C     . MET C  3  14  ? 39.739  111.156 76.210  1.00 91.82  ? 14   MET C C     1 
ATOM   6689  O  O     . MET C  3  14  ? 38.617  110.729 75.938  1.00 91.16  ? 14   MET C O     1 
ATOM   6690  C  CB    . MET C  3  14  ? 40.307  111.872 78.524  1.00 98.60  ? 14   MET C CB    1 
ATOM   6691  C  CG    . MET C  3  14  ? 40.664  111.463 79.940  1.00 102.37 ? 14   MET C CG    1 
ATOM   6692  S  SD    . MET C  3  14  ? 40.265  112.768 81.109  1.00 107.41 ? 14   MET C SD    1 
ATOM   6693  C  CE    . MET C  3  14  ? 38.382  112.676 81.110  1.00 104.39 ? 14   MET C CE    1 
ATOM   6694  N  N     . ILE C  3  15  ? 40.403  111.995 75.418  1.00 87.93  ? 15   ILE C N     1 
ATOM   6695  C  CA    . ILE C  3  15  ? 39.825  112.425 74.153  1.00 84.84  ? 15   ILE C CA    1 
ATOM   6696  C  C     . ILE C  3  15  ? 39.670  111.191 73.279  1.00 84.09  ? 15   ILE C C     1 
ATOM   6697  O  O     . ILE C  3  15  ? 38.674  111.031 72.578  1.00 84.25  ? 15   ILE C O     1 
ATOM   6698  C  CB    . ILE C  3  15  ? 40.714  113.460 73.441  1.00 83.14  ? 15   ILE C CB    1 
ATOM   6699  C  CG1   . ILE C  3  15  ? 40.686  114.780 74.200  1.00 82.83  ? 15   ILE C CG1   1 
ATOM   6700  C  CG2   . ILE C  3  15  ? 40.202  113.720 72.053  1.00 80.88  ? 15   ILE C CG2   1 
ATOM   6701  C  CD1   . ILE C  3  15  ? 41.197  114.691 75.625  1.00 85.03  ? 15   ILE C CD1   1 
ATOM   6702  N  N     . ASN C  3  16  ? 40.662  110.314 73.340  1.00 82.78  ? 16   ASN C N     1 
ATOM   6703  C  CA    . ASN C  3  16  ? 40.637  109.078 72.579  1.00 82.47  ? 16   ASN C CA    1 
ATOM   6704  C  C     . ASN C  3  16  ? 39.599  108.113 73.145  1.00 82.91  ? 16   ASN C C     1 
ATOM   6705  O  O     . ASN C  3  16  ? 38.958  107.363 72.408  1.00 83.22  ? 16   ASN C O     1 
ATOM   6706  C  CB    . ASN C  3  16  ? 41.995  108.392 72.628  1.00 80.98  ? 16   ASN C CB    1 
ATOM   6707  C  CG    . ASN C  3  16  ? 41.917  106.957 72.165  1.00 80.13  ? 16   ASN C CG    1 
ATOM   6708  O  OD1   . ASN C  3  16  ? 41.730  106.700 70.981  1.00 79.89  ? 16   ASN C OD1   1 
ATOM   6709  N  ND2   . ASN C  3  16  ? 42.031  106.013 73.099  1.00 77.97  ? 16   ASN C ND2   1 
ATOM   6710  N  N     . ASN C  3  17  ? 39.452  108.137 74.463  1.00 83.74  ? 17   ASN C N     1 
ATOM   6711  C  CA    . ASN C  3  17  ? 38.525  107.263 75.175  1.00 85.23  ? 17   ASN C CA    1 
ATOM   6712  C  C     . ASN C  3  17  ? 37.042  107.634 75.005  1.00 86.16  ? 17   ASN C C     1 
ATOM   6713  O  O     . ASN C  3  17  ? 36.151  106.820 75.302  1.00 86.05  ? 17   ASN C O     1 
ATOM   6714  C  CB    . ASN C  3  17  ? 38.884  107.265 76.669  1.00 85.46  ? 17   ASN C CB    1 
ATOM   6715  C  CG    . ASN C  3  17  ? 39.167  105.872 77.212  1.00 85.90  ? 17   ASN C CG    1 
ATOM   6716  O  OD1   . ASN C  3  17  ? 39.928  105.099 76.619  1.00 86.21  ? 17   ASN C OD1   1 
ATOM   6717  N  ND2   . ASN C  3  17  ? 38.565  105.552 78.357  1.00 85.09  ? 17   ASN C ND2   1 
ATOM   6718  N  N     . SER C  3  18  ? 36.772  108.849 74.524  1.00 86.69  ? 18   SER C N     1 
ATOM   6719  C  CA    . SER C  3  18  ? 35.389  109.307 74.349  1.00 86.16  ? 18   SER C CA    1 
ATOM   6720  C  C     . SER C  3  18  ? 35.038  109.923 72.991  1.00 84.12  ? 18   SER C C     1 
ATOM   6721  O  O     . SER C  3  18  ? 33.870  110.175 72.706  1.00 84.14  ? 18   SER C O     1 
ATOM   6722  C  CB    . SER C  3  18  ? 35.039  110.300 75.457  1.00 86.98  ? 18   SER C CB    1 
ATOM   6723  O  OG    . SER C  3  18  ? 36.018  111.317 75.521  1.00 91.27  ? 18   SER C OG    1 
ATOM   6724  N  N     . LEU C  3  19  ? 36.034  110.167 72.152  1.00 81.51  ? 19   LEU C N     1 
ATOM   6725  C  CA    . LEU C  3  19  ? 35.755  110.741 70.852  1.00 79.16  ? 19   LEU C CA    1 
ATOM   6726  C  C     . LEU C  3  19  ? 36.547  110.114 69.726  1.00 77.89  ? 19   LEU C C     1 
ATOM   6727  O  O     . LEU C  3  19  ? 36.631  110.683 68.644  1.00 78.64  ? 19   LEU C O     1 
ATOM   6728  C  CB    . LEU C  3  19  ? 36.032  112.240 70.860  1.00 78.38  ? 19   LEU C CB    1 
ATOM   6729  C  CG    . LEU C  3  19  ? 34.947  113.167 71.390  1.00 78.58  ? 19   LEU C CG    1 
ATOM   6730  C  CD1   . LEU C  3  19  ? 35.431  114.586 71.218  1.00 79.05  ? 19   LEU C CD1   1 
ATOM   6731  C  CD2   . LEU C  3  19  ? 33.636  112.971 70.637  1.00 78.13  ? 19   LEU C CD2   1 
ATOM   6732  N  N     . ILE C  3  20  ? 37.134  108.951 69.947  1.00 75.11  ? 20   ILE C N     1 
ATOM   6733  C  CA    . ILE C  3  20  ? 37.900  108.379 68.866  1.00 73.10  ? 20   ILE C CA    1 
ATOM   6734  C  C     . ILE C  3  20  ? 37.804  106.887 68.849  1.00 72.95  ? 20   ILE C C     1 
ATOM   6735  O  O     . ILE C  3  20  ? 37.479  106.307 67.819  1.00 73.95  ? 20   ILE C O     1 
ATOM   6736  C  CB    . ILE C  3  20  ? 39.371  108.794 68.953  1.00 72.35  ? 20   ILE C CB    1 
ATOM   6737  C  CG1   . ILE C  3  20  ? 39.478  110.312 68.871  1.00 69.86  ? 20   ILE C CG1   1 
ATOM   6738  C  CG2   . ILE C  3  20  ? 40.162  108.166 67.822  1.00 73.00  ? 20   ILE C CG2   1 
ATOM   6739  C  CD1   . ILE C  3  20  ? 40.883  110.808 68.909  1.00 70.93  ? 20   ILE C CD1   1 
ATOM   6740  N  N     . ASP C  3  21  ? 38.084  106.260 69.984  1.00 72.04  ? 21   ASP C N     1 
ATOM   6741  C  CA    . ASP C  3  21  ? 38.017  104.803 70.063  1.00 72.08  ? 21   ASP C CA    1 
ATOM   6742  C  C     . ASP C  3  21  ? 36.742  104.363 70.752  1.00 69.98  ? 21   ASP C C     1 
ATOM   6743  O  O     . ASP C  3  21  ? 36.526  103.177 71.005  1.00 69.10  ? 21   ASP C O     1 
ATOM   6744  C  CB    . ASP C  3  21  ? 39.224  104.245 70.818  1.00 74.77  ? 21   ASP C CB    1 
ATOM   6745  C  CG    . ASP C  3  21  ? 40.524  104.448 70.065  1.00 76.63  ? 21   ASP C CG    1 
ATOM   6746  O  OD1   . ASP C  3  21  ? 40.465  104.962 68.922  1.00 75.43  ? 21   ASP C OD1   1 
ATOM   6747  O  OD2   . ASP C  3  21  ? 41.594  104.091 70.618  1.00 78.07  ? 21   ASP C OD2   1 
ATOM   6748  N  N     . LEU C  3  22  ? 35.899  105.334 71.062  1.00 67.67  ? 22   LEU C N     1 
ATOM   6749  C  CA    . LEU C  3  22  ? 34.653  105.037 71.715  1.00 65.45  ? 22   LEU C CA    1 
ATOM   6750  C  C     . LEU C  3  22  ? 33.824  104.129 70.813  1.00 65.04  ? 22   LEU C C     1 
ATOM   6751  O  O     . LEU C  3  22  ? 33.584  104.440 69.642  1.00 64.74  ? 22   LEU C O     1 
ATOM   6752  C  CB    . LEU C  3  22  ? 33.916  106.337 72.005  1.00 65.81  ? 22   LEU C CB    1 
ATOM   6753  C  CG    . LEU C  3  22  ? 32.548  106.251 72.672  1.00 66.19  ? 22   LEU C CG    1 
ATOM   6754  C  CD1   . LEU C  3  22  ? 32.590  105.353 73.888  1.00 65.35  ? 22   LEU C CD1   1 
ATOM   6755  C  CD2   . LEU C  3  22  ? 32.122  107.649 73.047  1.00 67.16  ? 22   LEU C CD2   1 
ATOM   6756  N  N     . PRO C  3  23  ? 33.409  102.967 71.339  1.00 64.14  ? 23   PRO C N     1 
ATOM   6757  C  CA    . PRO C  3  23  ? 32.602  102.018 70.574  1.00 63.19  ? 23   PRO C CA    1 
ATOM   6758  C  C     . PRO C  3  23  ? 31.203  102.585 70.403  1.00 62.85  ? 23   PRO C C     1 
ATOM   6759  O  O     . PRO C  3  23  ? 30.589  103.040 71.369  1.00 63.89  ? 23   PRO C O     1 
ATOM   6760  C  CB    . PRO C  3  23  ? 32.599  100.773 71.461  1.00 63.52  ? 23   PRO C CB    1 
ATOM   6761  C  CG    . PRO C  3  23  ? 33.868  100.882 72.225  1.00 63.11  ? 23   PRO C CG    1 
ATOM   6762  C  CD    . PRO C  3  23  ? 33.887  102.344 72.583  1.00 64.46  ? 23   PRO C CD    1 
ATOM   6763  N  N     . ALA C  3  24  ? 30.696  102.573 69.180  1.00 62.31  ? 24   ALA C N     1 
ATOM   6764  C  CA    . ALA C  3  24  ? 29.353  103.087 68.942  1.00 61.06  ? 24   ALA C CA    1 
ATOM   6765  C  C     . ALA C  3  24  ? 28.564  102.138 68.066  1.00 60.32  ? 24   ALA C C     1 
ATOM   6766  O  O     . ALA C  3  24  ? 29.115  101.501 67.172  1.00 60.79  ? 24   ALA C O     1 
ATOM   6767  C  CB    . ALA C  3  24  ? 29.424  104.437 68.286  1.00 60.42  ? 24   ALA C CB    1 
ATOM   6768  N  N     . PRO C  3  25  ? 27.257  102.024 68.316  1.00 59.57  ? 25   PRO C N     1 
ATOM   6769  C  CA    . PRO C  3  25  ? 26.424  101.131 67.510  1.00 58.93  ? 25   PRO C CA    1 
ATOM   6770  C  C     . PRO C  3  25  ? 26.635  101.479 66.040  1.00 57.76  ? 25   PRO C C     1 
ATOM   6771  O  O     . PRO C  3  25  ? 26.823  102.641 65.694  1.00 56.57  ? 25   PRO C O     1 
ATOM   6772  C  CB    . PRO C  3  25  ? 25.013  101.465 67.982  1.00 60.63  ? 25   PRO C CB    1 
ATOM   6773  C  CG    . PRO C  3  25  ? 25.218  101.913 69.397  1.00 59.81  ? 25   PRO C CG    1 
ATOM   6774  C  CD    . PRO C  3  25  ? 26.445  102.771 69.291  1.00 59.27  ? 25   PRO C CD    1 
ATOM   6775  N  N     . SER C  3  26  ? 26.601  100.487 65.169  1.00 56.86  ? 26   SER C N     1 
ATOM   6776  C  CA    . SER C  3  26  ? 26.820  100.781 63.762  1.00 56.11  ? 26   SER C CA    1 
ATOM   6777  C  C     . SER C  3  26  ? 25.610  101.421 63.132  1.00 54.44  ? 26   SER C C     1 
ATOM   6778  O  O     . SER C  3  26  ? 25.718  102.034 62.070  1.00 54.33  ? 26   SER C O     1 
ATOM   6779  C  CB    . SER C  3  26  ? 27.157  99.500  62.982  1.00 57.20  ? 26   SER C CB    1 
ATOM   6780  O  OG    . SER C  3  26  ? 26.058  98.597  62.937  1.00 56.42  ? 26   SER C OG    1 
ATOM   6781  N  N     . ASN C  3  27  ? 24.468  101.311 63.802  1.00 52.86  ? 27   ASN C N     1 
ATOM   6782  C  CA    . ASN C  3  27  ? 23.226  101.802 63.233  1.00 53.04  ? 27   ASN C CA    1 
ATOM   6783  C  C     . ASN C  3  27  ? 22.547  103.058 63.755  1.00 53.32  ? 27   ASN C C     1 
ATOM   6784  O  O     . ASN C  3  27  ? 21.444  103.367 63.301  1.00 54.19  ? 27   ASN C O     1 
ATOM   6785  C  CB    . ASN C  3  27  ? 22.208  100.672 63.255  1.00 52.25  ? 27   ASN C CB    1 
ATOM   6786  C  CG    . ASN C  3  27  ? 21.879  100.243 64.655  1.00 55.43  ? 27   ASN C CG    1 
ATOM   6787  O  OD1   . ASN C  3  27  ? 22.775  100.033 65.469  1.00 57.33  ? 27   ASN C OD1   1 
ATOM   6788  N  ND2   . ASN C  3  27  ? 20.592  100.109 64.953  1.00 56.49  ? 27   ASN C ND2   1 
ATOM   6789  N  N     . ILE C  3  28  ? 23.161  103.794 64.680  1.00 53.29  ? 28   ILE C N     1 
ATOM   6790  C  CA    . ILE C  3  28  ? 22.492  104.996 65.191  1.00 52.10  ? 28   ILE C CA    1 
ATOM   6791  C  C     . ILE C  3  28  ? 22.209  105.970 64.060  1.00 52.26  ? 28   ILE C C     1 
ATOM   6792  O  O     . ILE C  3  28  ? 23.069  106.207 63.218  1.00 52.59  ? 28   ILE C O     1 
ATOM   6793  C  CB    . ILE C  3  28  ? 23.310  105.689 66.300  1.00 50.37  ? 28   ILE C CB    1 
ATOM   6794  C  CG1   . ILE C  3  28  ? 24.745  105.882 65.858  1.00 47.25  ? 28   ILE C CG1   1 
ATOM   6795  C  CG2   . ILE C  3  28  ? 23.257  104.855 67.578  1.00 51.46  ? 28   ILE C CG2   1 
ATOM   6796  C  CD1   . ILE C  3  28  ? 25.610  106.489 66.927  1.00 47.50  ? 28   ILE C CD1   1 
ATOM   6797  N  N     . SER C  3  29  ? 20.996  106.523 64.050  1.00 52.23  ? 29   SER C N     1 
ATOM   6798  C  CA    . SER C  3  29  ? 20.555  107.435 63.000  1.00 53.09  ? 29   SER C CA    1 
ATOM   6799  C  C     . SER C  3  29  ? 20.758  108.893 63.284  1.00 54.15  ? 29   SER C C     1 
ATOM   6800  O  O     . SER C  3  29  ? 21.421  109.262 64.250  1.00 55.27  ? 29   SER C O     1 
ATOM   6801  C  CB    . SER C  3  29  ? 19.080  107.220 62.701  1.00 54.53  ? 29   SER C CB    1 
ATOM   6802  O  OG    . SER C  3  29  ? 18.306  107.363 63.875  1.00 57.77  ? 29   SER C OG    1 
ATOM   6803  N  N     . ALA C  3  30  ? 20.175  109.723 62.422  1.00 54.78  ? 30   ALA C N     1 
ATOM   6804  C  CA    . ALA C  3  30  ? 20.287  111.167 62.551  1.00 54.45  ? 30   ALA C CA    1 
ATOM   6805  C  C     . ALA C  3  30  ? 19.779  111.630 63.908  1.00 55.68  ? 30   ALA C C     1 
ATOM   6806  O  O     . ALA C  3  30  ? 20.258  112.629 64.451  1.00 56.37  ? 30   ALA C O     1 
ATOM   6807  C  CB    . ALA C  3  30  ? 19.513  111.836 61.456  1.00 53.77  ? 30   ALA C CB    1 
ATOM   6808  N  N     . TRP C  3  31  ? 18.818  110.896 64.464  1.00 56.49  ? 31   TRP C N     1 
ATOM   6809  C  CA    . TRP C  3  31  ? 18.257  111.239 65.768  1.00 56.96  ? 31   TRP C CA    1 
ATOM   6810  C  C     . TRP C  3  31  ? 19.279  111.120 66.906  1.00 57.17  ? 31   TRP C C     1 
ATOM   6811  O  O     . TRP C  3  31  ? 18.962  111.312 68.078  1.00 57.57  ? 31   TRP C O     1 
ATOM   6812  C  CB    . TRP C  3  31  ? 17.038  110.362 66.048  1.00 57.18  ? 31   TRP C CB    1 
ATOM   6813  C  CG    . TRP C  3  31  ? 15.957  110.589 65.050  1.00 57.93  ? 31   TRP C CG    1 
ATOM   6814  C  CD1   . TRP C  3  31  ? 15.559  109.733 64.072  1.00 57.99  ? 31   TRP C CD1   1 
ATOM   6815  C  CD2   . TRP C  3  31  ? 15.183  111.785 64.877  1.00 57.87  ? 31   TRP C CD2   1 
ATOM   6816  N  NE1   . TRP C  3  31  ? 14.589  110.320 63.293  1.00 57.64  ? 31   TRP C NE1   1 
ATOM   6817  C  CE2   . TRP C  3  31  ? 14.340  111.579 63.769  1.00 57.58  ? 31   TRP C CE2   1 
ATOM   6818  C  CE3   . TRP C  3  31  ? 15.124  113.010 65.550  1.00 57.95  ? 31   TRP C CE3   1 
ATOM   6819  C  CZ2   . TRP C  3  31  ? 13.446  112.549 63.318  1.00 59.08  ? 31   TRP C CZ2   1 
ATOM   6820  C  CZ3   . TRP C  3  31  ? 14.230  113.979 65.096  1.00 58.83  ? 31   TRP C CZ3   1 
ATOM   6821  C  CH2   . TRP C  3  31  ? 13.406  113.741 63.993  1.00 58.61  ? 31   TRP C CH2   1 
ATOM   6822  N  N     . TRP C  3  32  ? 20.516  110.816 66.548  1.00 56.20  ? 32   TRP C N     1 
ATOM   6823  C  CA    . TRP C  3  32  ? 21.574  110.688 67.525  1.00 53.98  ? 32   TRP C CA    1 
ATOM   6824  C  C     . TRP C  3  32  ? 22.569  111.829 67.343  1.00 52.88  ? 32   TRP C C     1 
ATOM   6825  O  O     . TRP C  3  32  ? 23.580  111.899 68.033  1.00 53.92  ? 32   TRP C O     1 
ATOM   6826  C  CB    . TRP C  3  32  ? 22.256  109.327 67.356  1.00 53.24  ? 32   TRP C CB    1 
ATOM   6827  C  CG    . TRP C  3  32  ? 21.785  108.296 68.337  1.00 52.32  ? 32   TRP C CG    1 
ATOM   6828  C  CD1   . TRP C  3  32  ? 22.376  107.975 69.524  1.00 53.64  ? 32   TRP C CD1   1 
ATOM   6829  C  CD2   . TRP C  3  32  ? 20.592  107.505 68.260  1.00 52.85  ? 32   TRP C CD2   1 
ATOM   6830  N  NE1   . TRP C  3  32  ? 21.625  107.039 70.198  1.00 53.57  ? 32   TRP C NE1   1 
ATOM   6831  C  CE2   . TRP C  3  32  ? 20.524  106.731 69.445  1.00 53.57  ? 32   TRP C CE2   1 
ATOM   6832  C  CE3   . TRP C  3  32  ? 19.573  107.374 67.309  1.00 53.17  ? 32   TRP C CE3   1 
ATOM   6833  C  CZ2   . TRP C  3  32  ? 19.475  105.837 69.704  1.00 53.48  ? 32   TRP C CZ2   1 
ATOM   6834  C  CZ3   . TRP C  3  32  ? 18.525  106.478 67.569  1.00 53.17  ? 32   TRP C CZ3   1 
ATOM   6835  C  CH2   . TRP C  3  32  ? 18.488  105.725 68.755  1.00 52.66  ? 32   TRP C CH2   1 
ATOM   6836  N  N     . ASN C  3  33  ? 22.263  112.740 66.432  1.00 51.21  ? 33   ASN C N     1 
ATOM   6837  C  CA    . ASN C  3  33  ? 23.155  113.857 66.159  1.00 52.33  ? 33   ASN C CA    1 
ATOM   6838  C  C     . ASN C  3  33  ? 22.947  115.042 67.083  1.00 52.20  ? 33   ASN C C     1 
ATOM   6839  O  O     . ASN C  3  33  ? 23.822  115.892 67.210  1.00 54.40  ? 33   ASN C O     1 
ATOM   6840  C  CB    . ASN C  3  33  ? 22.987  114.329 64.709  1.00 54.08  ? 33   ASN C CB    1 
ATOM   6841  C  CG    . ASN C  3  33  ? 23.613  113.380 63.713  1.00 57.74  ? 33   ASN C CG    1 
ATOM   6842  O  OD1   . ASN C  3  33  ? 23.260  112.191 63.637  1.00 60.94  ? 33   ASN C OD1   1 
ATOM   6843  N  ND2   . ASN C  3  33  ? 24.555  113.892 62.943  1.00 58.33  ? 33   ASN C ND2   1 
ATOM   6844  N  N     . PHE C  3  34  ? 21.796  115.103 67.735  1.00 50.65  ? 34   PHE C N     1 
ATOM   6845  C  CA    . PHE C  3  34  ? 21.501  116.223 68.604  1.00 48.71  ? 34   PHE C CA    1 
ATOM   6846  C  C     . PHE C  3  34  ? 22.346  116.315 69.867  1.00 49.81  ? 34   PHE C C     1 
ATOM   6847  O  O     . PHE C  3  34  ? 22.612  117.420 70.374  1.00 50.57  ? 34   PHE C O     1 
ATOM   6848  C  CB    . PHE C  3  34  ? 20.015  116.226 68.881  1.00 46.65  ? 34   PHE C CB    1 
ATOM   6849  C  CG    . PHE C  3  34  ? 19.212  116.421 67.634  1.00 47.18  ? 34   PHE C CG    1 
ATOM   6850  C  CD1   . PHE C  3  34  ? 19.211  117.645 66.983  1.00 47.50  ? 34   PHE C CD1   1 
ATOM   6851  C  CD2   . PHE C  3  34  ? 18.548  115.365 67.042  1.00 47.58  ? 34   PHE C CD2   1 
ATOM   6852  C  CE1   . PHE C  3  34  ? 18.570  117.812 65.762  1.00 46.06  ? 34   PHE C CE1   1 
ATOM   6853  C  CE2   . PHE C  3  34  ? 17.906  115.531 65.818  1.00 47.34  ? 34   PHE C CE2   1 
ATOM   6854  C  CZ    . PHE C  3  34  ? 17.921  116.757 65.180  1.00 45.57  ? 34   PHE C CZ    1 
ATOM   6855  N  N     . GLY C  3  35  ? 22.794  115.173 70.372  1.00 49.04  ? 35   GLY C N     1 
ATOM   6856  C  CA    . GLY C  3  35  ? 23.663  115.213 71.533  1.00 46.87  ? 35   GLY C CA    1 
ATOM   6857  C  C     . GLY C  3  35  ? 24.827  116.178 71.278  1.00 45.03  ? 35   GLY C C     1 
ATOM   6858  O  O     . GLY C  3  35  ? 25.076  117.087 72.063  1.00 44.72  ? 35   GLY C O     1 
ATOM   6859  N  N     . SER C  3  36  ? 25.536  116.007 70.170  1.00 43.15  ? 36   SER C N     1 
ATOM   6860  C  CA    . SER C  3  36  ? 26.650  116.891 69.884  1.00 43.02  ? 36   SER C CA    1 
ATOM   6861  C  C     . SER C  3  36  ? 26.188  118.288 69.494  1.00 43.97  ? 36   SER C C     1 
ATOM   6862  O  O     . SER C  3  36  ? 26.825  119.282 69.855  1.00 44.84  ? 36   SER C O     1 
ATOM   6863  C  CB    . SER C  3  36  ? 27.538  116.310 68.785  1.00 40.79  ? 36   SER C CB    1 
ATOM   6864  O  OG    . SER C  3  36  ? 26.783  116.056 67.627  1.00 38.46  ? 36   SER C OG    1 
ATOM   6865  N  N     . LEU C  3  37  ? 25.094  118.391 68.751  1.00 43.99  ? 37   LEU C N     1 
ATOM   6866  C  CA    . LEU C  3  37  ? 24.634  119.724 68.380  1.00 42.95  ? 37   LEU C CA    1 
ATOM   6867  C  C     . LEU C  3  37  ? 24.378  120.452 69.693  1.00 42.75  ? 37   LEU C C     1 
ATOM   6868  O  O     . LEU C  3  37  ? 24.803  121.605 69.879  1.00 41.61  ? 37   LEU C O     1 
ATOM   6869  C  CB    . LEU C  3  37  ? 23.353  119.653 67.549  1.00 42.97  ? 37   LEU C CB    1 
ATOM   6870  C  CG    . LEU C  3  37  ? 23.510  118.970 66.193  1.00 42.76  ? 37   LEU C CG    1 
ATOM   6871  C  CD1   . LEU C  3  37  ? 22.153  118.878 65.518  1.00 43.48  ? 37   LEU C CD1   1 
ATOM   6872  C  CD2   . LEU C  3  37  ? 24.494  119.744 65.335  1.00 43.03  ? 37   LEU C CD2   1 
ATOM   6873  N  N     . LEU C  3  38  ? 23.701  119.757 70.612  1.00 41.14  ? 38   LEU C N     1 
ATOM   6874  C  CA    . LEU C  3  38  ? 23.399  120.334 71.915  1.00 39.38  ? 38   LEU C CA    1 
ATOM   6875  C  C     . LEU C  3  38  ? 24.689  120.847 72.542  1.00 38.13  ? 38   LEU C C     1 
ATOM   6876  O  O     . LEU C  3  38  ? 24.768  121.978 73.032  1.00 36.50  ? 38   LEU C O     1 
ATOM   6877  C  CB    . LEU C  3  38  ? 22.730  119.292 72.807  1.00 36.49  ? 38   LEU C CB    1 
ATOM   6878  C  CG    . LEU C  3  38  ? 21.214  119.286 72.638  1.00 36.16  ? 38   LEU C CG    1 
ATOM   6879  C  CD1   . LEU C  3  38  ? 20.560  118.188 73.476  1.00 34.41  ? 38   LEU C CD1   1 
ATOM   6880  C  CD2   . LEU C  3  38  ? 20.703  120.668 73.040  1.00 34.29  ? 38   LEU C CD2   1 
ATOM   6881  N  N     . ALA C  3  39  ? 25.711  120.006 72.498  1.00 37.82  ? 39   ALA C N     1 
ATOM   6882  C  CA    . ALA C  3  39  ? 27.002  120.375 73.031  1.00 36.19  ? 39   ALA C CA    1 
ATOM   6883  C  C     . ALA C  3  39  ? 27.523  121.587 72.247  1.00 36.52  ? 39   ALA C C     1 
ATOM   6884  O  O     . ALA C  3  39  ? 27.980  122.558 72.846  1.00 38.85  ? 39   ALA C O     1 
ATOM   6885  C  CB    . ALA C  3  39  ? 27.945  119.212 72.922  1.00 34.30  ? 39   ALA C CB    1 
ATOM   6886  N  N     . VAL C  3  40  ? 27.443  121.563 70.919  1.00 36.18  ? 40   VAL C N     1 
ATOM   6887  C  CA    . VAL C  3  40  ? 27.927  122.712 70.151  1.00 37.11  ? 40   VAL C CA    1 
ATOM   6888  C  C     . VAL C  3  40  ? 27.120  123.962 70.496  1.00 40.03  ? 40   VAL C C     1 
ATOM   6889  O  O     . VAL C  3  40  ? 27.676  125.051 70.581  1.00 39.09  ? 40   VAL C O     1 
ATOM   6890  C  CB    . VAL C  3  40  ? 27.869  122.458 68.645  1.00 35.56  ? 40   VAL C CB    1 
ATOM   6891  C  CG1   . VAL C  3  40  ? 28.358  123.660 67.889  1.00 31.35  ? 40   VAL C CG1   1 
ATOM   6892  C  CG2   . VAL C  3  40  ? 28.731  121.291 68.311  1.00 34.67  ? 40   VAL C CG2   1 
ATOM   6893  N  N     . CYS C  3  41  ? 25.811  123.816 70.690  1.00 43.14  ? 41   CYS C N     1 
ATOM   6894  C  CA    . CYS C  3  41  ? 25.009  124.966 71.088  1.00 47.89  ? 41   CYS C CA    1 
ATOM   6895  C  C     . CYS C  3  41  ? 25.569  125.533 72.401  1.00 49.03  ? 41   CYS C C     1 
ATOM   6896  O  O     . CYS C  3  41  ? 25.812  126.745 72.511  1.00 51.13  ? 41   CYS C O     1 
ATOM   6897  C  CB    . CYS C  3  41  ? 23.557  124.571 71.310  1.00 49.66  ? 41   CYS C CB    1 
ATOM   6898  S  SG    . CYS C  3  41  ? 22.631  124.430 69.801  1.00 58.13  ? 41   CYS C SG    1 
ATOM   6899  N  N     . LEU C  3  42  ? 25.769  124.664 73.394  1.00 46.74  ? 42   LEU C N     1 
ATOM   6900  C  CA    . LEU C  3  42  ? 26.308  125.110 74.664  1.00 44.97  ? 42   LEU C CA    1 
ATOM   6901  C  C     . LEU C  3  42  ? 27.559  125.899 74.442  1.00 45.28  ? 42   LEU C C     1 
ATOM   6902  O  O     . LEU C  3  42  ? 27.688  126.994 74.956  1.00 44.11  ? 42   LEU C O     1 
ATOM   6903  C  CB    . LEU C  3  42  ? 26.650  123.949 75.577  1.00 44.28  ? 42   LEU C CB    1 
ATOM   6904  C  CG    . LEU C  3  42  ? 27.009  124.445 76.979  1.00 43.96  ? 42   LEU C CG    1 
ATOM   6905  C  CD1   . LEU C  3  42  ? 25.905  125.387 77.498  1.00 44.43  ? 42   LEU C CD1   1 
ATOM   6906  C  CD2   . LEU C  3  42  ? 27.145  123.274 77.912  1.00 43.04  ? 42   LEU C CD2   1 
ATOM   6907  N  N     . MET C  3  43  ? 28.488  125.353 73.669  1.00 47.72  ? 43   MET C N     1 
ATOM   6908  C  CA    . MET C  3  43  ? 29.735  126.072 73.416  1.00 52.03  ? 43   MET C CA    1 
ATOM   6909  C  C     . MET C  3  43  ? 29.485  127.418 72.725  1.00 51.40  ? 43   MET C C     1 
ATOM   6910  O  O     . MET C  3  43  ? 29.973  128.457 73.153  1.00 50.36  ? 43   MET C O     1 
ATOM   6911  C  CB    . MET C  3  43  ? 30.696  125.215 72.585  1.00 56.17  ? 43   MET C CB    1 
ATOM   6912  C  CG    . MET C  3  43  ? 31.104  123.893 73.261  1.00 63.91  ? 43   MET C CG    1 
ATOM   6913  S  SD    . MET C  3  43  ? 31.310  124.000 75.101  1.00 74.18  ? 43   MET C SD    1 
ATOM   6914  C  CE    . MET C  3  43  ? 32.518  125.532 75.282  1.00 67.26  ? 43   MET C CE    1 
ATOM   6915  N  N     . THR C  3  44  ? 28.708  127.403 71.660  1.00 51.21  ? 44   THR C N     1 
ATOM   6916  C  CA    . THR C  3  44  ? 28.407  128.627 70.943  1.00 51.82  ? 44   THR C CA    1 
ATOM   6917  C  C     . THR C  3  44  ? 27.754  129.698 71.820  1.00 52.54  ? 44   THR C C     1 
ATOM   6918  O  O     . THR C  3  44  ? 28.077  130.890 71.708  1.00 52.17  ? 44   THR C O     1 
ATOM   6919  C  CB    . THR C  3  44  ? 27.474  128.330 69.792  1.00 52.33  ? 44   THR C CB    1 
ATOM   6920  O  OG1   . THR C  3  44  ? 28.093  127.345 68.971  1.00 53.72  ? 44   THR C OG1   1 
ATOM   6921  C  CG2   . THR C  3  44  ? 27.158  129.602 68.984  1.00 49.67  ? 44   THR C CG2   1 
ATOM   6922  N  N     . GLN C  3  45  ? 26.818  129.284 72.673  1.00 50.85  ? 45   GLN C N     1 
ATOM   6923  C  CA    . GLN C  3  45  ? 26.152  130.243 73.531  1.00 49.26  ? 45   GLN C CA    1 
ATOM   6924  C  C     . GLN C  3  45  ? 27.168  130.874 74.466  1.00 48.43  ? 45   GLN C C     1 
ATOM   6925  O  O     . GLN C  3  45  ? 27.307  132.088 74.512  1.00 49.01  ? 45   GLN C O     1 
ATOM   6926  C  CB    . GLN C  3  45  ? 25.047  129.567 74.320  1.00 49.41  ? 45   GLN C CB    1 
ATOM   6927  C  CG    . GLN C  3  45  ? 23.791  129.314 73.515  1.00 50.70  ? 45   GLN C CG    1 
ATOM   6928  C  CD    . GLN C  3  45  ? 23.209  130.593 72.941  1.00 52.23  ? 45   GLN C CD    1 
ATOM   6929  O  OE1   . GLN C  3  45  ? 23.613  131.045 71.865  1.00 53.39  ? 45   GLN C OE1   1 
ATOM   6930  N  NE2   . GLN C  3  45  ? 22.265  131.194 73.667  1.00 52.02  ? 45   GLN C NE2   1 
ATOM   6931  N  N     . ILE C  3  46  ? 27.900  130.043 75.193  1.00 47.21  ? 46   ILE C N     1 
ATOM   6932  C  CA    . ILE C  3  46  ? 28.922  130.519 76.121  1.00 45.67  ? 46   ILE C CA    1 
ATOM   6933  C  C     . ILE C  3  46  ? 29.871  131.529 75.434  1.00 45.65  ? 46   ILE C C     1 
ATOM   6934  O  O     . ILE C  3  46  ? 30.145  132.636 75.923  1.00 44.35  ? 46   ILE C O     1 
ATOM   6935  C  CB    . ILE C  3  46  ? 29.709  129.302 76.684  1.00 43.42  ? 46   ILE C CB    1 
ATOM   6936  C  CG1   . ILE C  3  46  ? 28.786  128.488 77.590  1.00 45.68  ? 46   ILE C CG1   1 
ATOM   6937  C  CG2   . ILE C  3  46  ? 30.880  129.746 77.487  1.00 42.07  ? 46   ILE C CG2   1 
ATOM   6938  C  CD1   . ILE C  3  46  ? 29.370  127.183 78.096  1.00 46.07  ? 46   ILE C CD1   1 
ATOM   6939  N  N     . LEU C  3  47  ? 30.352  131.147 74.273  1.00 44.92  ? 47   LEU C N     1 
ATOM   6940  C  CA    . LEU C  3  47  ? 31.251  131.998 73.546  1.00 45.53  ? 47   LEU C CA    1 
ATOM   6941  C  C     . LEU C  3  47  ? 30.619  133.347 73.165  1.00 44.41  ? 47   LEU C C     1 
ATOM   6942  O  O     . LEU C  3  47  ? 31.106  134.407 73.565  1.00 43.34  ? 47   LEU C O     1 
ATOM   6943  C  CB    . LEU C  3  47  ? 31.742  131.224 72.323  1.00 47.62  ? 47   LEU C CB    1 
ATOM   6944  C  CG    . LEU C  3  47  ? 32.605  131.877 71.247  1.00 50.20  ? 47   LEU C CG    1 
ATOM   6945  C  CD1   . LEU C  3  47  ? 33.503  132.984 71.814  1.00 49.14  ? 47   LEU C CD1   1 
ATOM   6946  C  CD2   . LEU C  3  47  ? 33.432  130.758 70.618  1.00 52.37  ? 47   LEU C CD2   1 
ATOM   6947  N  N     . THR C  3  48  ? 29.539  133.319 72.394  1.00 43.14  ? 48   THR C N     1 
ATOM   6948  C  CA    . THR C  3  48  ? 28.898  134.565 71.988  1.00 41.32  ? 48   THR C CA    1 
ATOM   6949  C  C     . THR C  3  48  ? 28.481  135.336 73.224  1.00 40.87  ? 48   THR C C     1 
ATOM   6950  O  O     . THR C  3  48  ? 28.515  136.562 73.249  1.00 40.41  ? 48   THR C O     1 
ATOM   6951  C  CB    . THR C  3  48  ? 27.652  134.307 71.105  1.00 41.26  ? 48   THR C CB    1 
ATOM   6952  O  OG1   . THR C  3  48  ? 26.731  133.442 71.783  1.00 40.96  ? 48   THR C OG1   1 
ATOM   6953  C  CG2   . THR C  3  48  ? 28.061  133.665 69.788  1.00 41.84  ? 48   THR C CG2   1 
ATOM   6954  N  N     . GLY C  3  49  ? 28.099  134.588 74.253  1.00 41.12  ? 49   GLY C N     1 
ATOM   6955  C  CA    . GLY C  3  49  ? 27.679  135.175 75.507  1.00 39.33  ? 49   GLY C CA    1 
ATOM   6956  C  C     . GLY C  3  49  ? 28.798  135.976 76.126  1.00 38.93  ? 49   GLY C C     1 
ATOM   6957  O  O     . GLY C  3  49  ? 28.601  137.136 76.445  1.00 38.12  ? 49   GLY C O     1 
ATOM   6958  N  N     . LEU C  3  50  ? 29.969  135.373 76.309  1.00 39.63  ? 50   LEU C N     1 
ATOM   6959  C  CA    . LEU C  3  50  ? 31.087  136.119 76.876  1.00 40.34  ? 50   LEU C CA    1 
ATOM   6960  C  C     . LEU C  3  50  ? 31.296  137.374 76.054  1.00 40.87  ? 50   LEU C C     1 
ATOM   6961  O  O     . LEU C  3  50  ? 31.415  138.465 76.609  1.00 40.08  ? 50   LEU C O     1 
ATOM   6962  C  CB    . LEU C  3  50  ? 32.360  135.287 76.875  1.00 41.21  ? 50   LEU C CB    1 
ATOM   6963  C  CG    . LEU C  3  50  ? 32.359  134.184 77.930  1.00 44.90  ? 50   LEU C CG    1 
ATOM   6964  C  CD1   . LEU C  3  50  ? 33.488  133.227 77.603  1.00 46.44  ? 50   LEU C CD1   1 
ATOM   6965  C  CD2   . LEU C  3  50  ? 32.500  134.767 79.351  1.00 41.68  ? 50   LEU C CD2   1 
ATOM   6966  N  N     . LEU C  3  51  ? 31.334  137.222 74.734  1.00 41.77  ? 51   LEU C N     1 
ATOM   6967  C  CA    . LEU C  3  51  ? 31.489  138.365 73.847  1.00 44.18  ? 51   LEU C CA    1 
ATOM   6968  C  C     . LEU C  3  51  ? 30.458  139.476 74.150  1.00 45.91  ? 51   LEU C C     1 
ATOM   6969  O  O     . LEU C  3  51  ? 30.798  140.665 74.196  1.00 45.66  ? 51   LEU C O     1 
ATOM   6970  C  CB    . LEU C  3  51  ? 31.369  137.903 72.395  1.00 45.40  ? 51   LEU C CB    1 
ATOM   6971  C  CG    . LEU C  3  51  ? 32.703  137.363 71.877  1.00 46.73  ? 51   LEU C CG    1 
ATOM   6972  C  CD1   . LEU C  3  51  ? 32.571  136.771 70.484  1.00 44.79  ? 51   LEU C CD1   1 
ATOM   6973  C  CD2   . LEU C  3  51  ? 33.698  138.515 71.881  1.00 47.75  ? 51   LEU C CD2   1 
ATOM   6974  N  N     . LEU C  3  52  ? 29.198  139.102 74.360  1.00 46.74  ? 52   LEU C N     1 
ATOM   6975  C  CA    . LEU C  3  52  ? 28.184  140.102 74.684  1.00 46.36  ? 52   LEU C CA    1 
ATOM   6976  C  C     . LEU C  3  52  ? 28.386  140.661 76.087  1.00 46.75  ? 52   LEU C C     1 
ATOM   6977  O  O     . LEU C  3  52  ? 28.295  141.863 76.285  1.00 48.41  ? 52   LEU C O     1 
ATOM   6978  C  CB    . LEU C  3  52  ? 26.768  139.522 74.580  1.00 45.30  ? 52   LEU C CB    1 
ATOM   6979  C  CG    . LEU C  3  52  ? 26.247  139.126 73.195  1.00 45.65  ? 52   LEU C CG    1 
ATOM   6980  C  CD1   . LEU C  3  52  ? 24.792  138.792 73.349  1.00 43.55  ? 52   LEU C CD1   1 
ATOM   6981  C  CD2   . LEU C  3  52  ? 26.433  140.252 72.159  1.00 46.20  ? 52   LEU C CD2   1 
ATOM   6982  N  N     . ALA C  3  53  ? 28.651  139.797 77.063  1.00 47.36  ? 53   ALA C N     1 
ATOM   6983  C  CA    . ALA C  3  53  ? 28.856  140.246 78.440  1.00 47.82  ? 53   ALA C CA    1 
ATOM   6984  C  C     . ALA C  3  53  ? 29.956  141.315 78.536  1.00 49.40  ? 53   ALA C C     1 
ATOM   6985  O  O     . ALA C  3  53  ? 29.993  142.110 79.488  1.00 48.59  ? 53   ALA C O     1 
ATOM   6986  C  CB    . ALA C  3  53  ? 29.184  139.059 79.331  1.00 44.73  ? 53   ALA C CB    1 
ATOM   6987  N  N     . MET C  3  54  ? 30.845  141.347 77.544  1.00 51.52  ? 54   MET C N     1 
ATOM   6988  C  CA    . MET C  3  54  ? 31.924  142.337 77.537  1.00 53.33  ? 54   MET C CA    1 
ATOM   6989  C  C     . MET C  3  54  ? 31.427  143.737 77.264  1.00 52.48  ? 54   MET C C     1 
ATOM   6990  O  O     . MET C  3  54  ? 32.161  144.699 77.474  1.00 54.84  ? 54   MET C O     1 
ATOM   6991  C  CB    . MET C  3  54  ? 32.963  142.040 76.479  1.00 55.38  ? 54   MET C CB    1 
ATOM   6992  C  CG    . MET C  3  54  ? 33.436  140.646 76.475  1.00 62.08  ? 54   MET C CG    1 
ATOM   6993  S  SD    . MET C  3  54  ? 35.011  140.556 75.651  1.00 70.61  ? 54   MET C SD    1 
ATOM   6994  C  CE    . MET C  3  54  ? 35.915  139.479 76.981  1.00 65.15  ? 54   MET C CE    1 
ATOM   6995  N  N     . HIS C  3  55  ? 30.201  143.861 76.772  1.00 50.44  ? 55   HIS C N     1 
ATOM   6996  C  CA    . HIS C  3  55  ? 29.656  145.174 76.481  1.00 47.88  ? 55   HIS C CA    1 
ATOM   6997  C  C     . HIS C  3  55  ? 28.335  145.447 77.189  1.00 46.40  ? 55   HIS C C     1 
ATOM   6998  O  O     . HIS C  3  55  ? 27.693  146.468 76.950  1.00 46.79  ? 55   HIS C O     1 
ATOM   6999  C  CB    . HIS C  3  55  ? 29.481  145.354 74.976  1.00 48.02  ? 55   HIS C CB    1 
ATOM   7000  C  CG    . HIS C  3  55  ? 30.739  145.163 74.194  1.00 48.47  ? 55   HIS C CG    1 
ATOM   7001  N  ND1   . HIS C  3  55  ? 31.114  143.944 73.674  1.00 49.87  ? 55   HIS C ND1   1 
ATOM   7002  C  CD2   . HIS C  3  55  ? 31.712  146.036 73.845  1.00 50.84  ? 55   HIS C CD2   1 
ATOM   7003  C  CE1   . HIS C  3  55  ? 32.262  144.071 73.035  1.00 51.70  ? 55   HIS C CE1   1 
ATOM   7004  N  NE2   . HIS C  3  55  ? 32.649  145.332 73.124  1.00 52.70  ? 55   HIS C NE2   1 
ATOM   7005  N  N     . TYR C  3  56  ? 27.941  144.556 78.080  1.00 43.59  ? 56   TYR C N     1 
ATOM   7006  C  CA    . TYR C  3  56  ? 26.692  144.745 78.783  1.00 43.39  ? 56   TYR C CA    1 
ATOM   7007  C  C     . TYR C  3  56  ? 26.899  145.555 80.051  1.00 43.40  ? 56   TYR C C     1 
ATOM   7008  O  O     . TYR C  3  56  ? 28.020  145.731 80.480  1.00 44.15  ? 56   TYR C O     1 
ATOM   7009  C  CB    . TYR C  3  56  ? 26.116  143.389 79.126  1.00 43.70  ? 56   TYR C CB    1 
ATOM   7010  C  CG    . TYR C  3  56  ? 24.792  143.447 79.826  1.00 43.87  ? 56   TYR C CG    1 
ATOM   7011  C  CD1   . TYR C  3  56  ? 23.647  143.860 79.155  1.00 42.74  ? 56   TYR C CD1   1 
ATOM   7012  C  CD2   . TYR C  3  56  ? 24.674  143.045 81.152  1.00 44.38  ? 56   TYR C CD2   1 
ATOM   7013  C  CE1   . TYR C  3  56  ? 22.406  143.861 79.786  1.00 44.04  ? 56   TYR C CE1   1 
ATOM   7014  C  CE2   . TYR C  3  56  ? 23.441  143.047 81.797  1.00 45.63  ? 56   TYR C CE2   1 
ATOM   7015  C  CZ    . TYR C  3  56  ? 22.305  143.452 81.110  1.00 44.94  ? 56   TYR C CZ    1 
ATOM   7016  O  OH    . TYR C  3  56  ? 21.072  143.418 81.740  1.00 44.45  ? 56   TYR C OH    1 
ATOM   7017  N  N     . THR C  3  57  ? 25.814  146.033 80.653  1.00 44.17  ? 57   THR C N     1 
ATOM   7018  C  CA    . THR C  3  57  ? 25.867  146.814 81.891  1.00 44.70  ? 57   THR C CA    1 
ATOM   7019  C  C     . THR C  3  57  ? 24.632  146.499 82.718  1.00 45.73  ? 57   THR C C     1 
ATOM   7020  O  O     . THR C  3  57  ? 23.565  147.001 82.438  1.00 48.31  ? 57   THR C O     1 
ATOM   7021  C  CB    . THR C  3  57  ? 25.867  148.319 81.600  1.00 46.32  ? 57   THR C CB    1 
ATOM   7022  O  OG1   . THR C  3  57  ? 27.085  148.677 80.940  1.00 49.70  ? 57   THR C OG1   1 
ATOM   7023  C  CG2   . THR C  3  57  ? 25.723  149.120 82.885  1.00 45.61  ? 57   THR C CG2   1 
ATOM   7024  N  N     . ALA C  3  58  ? 24.775  145.674 83.745  1.00 47.81  ? 58   ALA C N     1 
ATOM   7025  C  CA    . ALA C  3  58  ? 23.645  145.282 84.583  1.00 47.90  ? 58   ALA C CA    1 
ATOM   7026  C  C     . ALA C  3  58  ? 23.131  146.410 85.443  1.00 49.61  ? 58   ALA C C     1 
ATOM   7027  O  O     . ALA C  3  58  ? 23.495  146.553 86.609  1.00 50.83  ? 58   ALA C O     1 
ATOM   7028  C  CB    . ALA C  3  58  ? 24.020  144.092 85.462  1.00 46.73  ? 58   ALA C CB    1 
ATOM   7029  N  N     . ASP C  3  59  ? 22.279  147.228 84.857  1.00 52.15  ? 59   ASP C N     1 
ATOM   7030  C  CA    . ASP C  3  59  ? 21.684  148.322 85.591  1.00 54.24  ? 59   ASP C CA    1 
ATOM   7031  C  C     . ASP C  3  59  ? 20.444  148.741 84.850  1.00 53.29  ? 59   ASP C C     1 
ATOM   7032  O  O     . ASP C  3  59  ? 20.500  148.995 83.655  1.00 52.89  ? 59   ASP C O     1 
ATOM   7033  C  CB    . ASP C  3  59  ? 22.631  149.505 85.698  1.00 57.49  ? 59   ASP C CB    1 
ATOM   7034  C  CG    . ASP C  3  59  ? 22.139  150.526 86.692  1.00 59.82  ? 59   ASP C CG    1 
ATOM   7035  O  OD1   . ASP C  3  59  ? 22.192  150.219 87.903  1.00 61.38  ? 59   ASP C OD1   1 
ATOM   7036  O  OD2   . ASP C  3  59  ? 21.679  151.609 86.265  1.00 60.37  ? 59   ASP C OD2   1 
ATOM   7037  N  N     . THR C  3  60  ? 19.329  148.808 85.563  1.00 53.37  ? 60   THR C N     1 
ATOM   7038  C  CA    . THR C  3  60  ? 18.060  149.173 84.955  1.00 55.63  ? 60   THR C CA    1 
ATOM   7039  C  C     . THR C  3  60  ? 18.179  150.381 84.041  1.00 56.19  ? 60   THR C C     1 
ATOM   7040  O  O     . THR C  3  60  ? 17.656  150.381 82.914  1.00 57.50  ? 60   THR C O     1 
ATOM   7041  C  CB    . THR C  3  60  ? 16.997  149.459 86.020  1.00 55.33  ? 60   THR C CB    1 
ATOM   7042  O  OG1   . THR C  3  60  ? 17.502  150.421 86.943  1.00 57.11  ? 60   THR C OG1   1 
ATOM   7043  C  CG2   . THR C  3  60  ? 16.648  148.195 86.776  1.00 56.90  ? 60   THR C CG2   1 
ATOM   7044  N  N     . SER C  3  61  ? 18.897  151.393 84.508  1.00 55.16  ? 61   SER C N     1 
ATOM   7045  C  CA    . SER C  3  61  ? 19.058  152.608 83.730  1.00 55.04  ? 61   SER C CA    1 
ATOM   7046  C  C     . SER C  3  61  ? 19.999  152.481 82.540  1.00 55.21  ? 61   SER C C     1 
ATOM   7047  O  O     . SER C  3  61  ? 20.051  153.373 81.708  1.00 57.58  ? 61   SER C O     1 
ATOM   7048  C  CB    . SER C  3  61  ? 19.561  153.739 84.620  1.00 55.32  ? 61   SER C CB    1 
ATOM   7049  O  OG    . SER C  3  61  ? 20.951  153.598 84.878  1.00 54.79  ? 61   SER C OG    1 
ATOM   7050  N  N     . LEU C  3  62  ? 20.735  151.385 82.432  1.00 54.34  ? 62   LEU C N     1 
ATOM   7051  C  CA    . LEU C  3  62  ? 21.672  151.264 81.329  1.00 53.43  ? 62   LEU C CA    1 
ATOM   7052  C  C     . LEU C  3  62  ? 21.592  149.980 80.522  1.00 54.52  ? 62   LEU C C     1 
ATOM   7053  O  O     . LEU C  3  62  ? 22.072  149.914 79.389  1.00 54.77  ? 62   LEU C O     1 
ATOM   7054  C  CB    . LEU C  3  62  ? 23.090  151.407 81.862  1.00 53.16  ? 62   LEU C CB    1 
ATOM   7055  C  CG    . LEU C  3  62  ? 23.496  152.768 82.411  1.00 52.39  ? 62   LEU C CG    1 
ATOM   7056  C  CD1   . LEU C  3  62  ? 24.889  152.686 83.028  1.00 53.16  ? 62   LEU C CD1   1 
ATOM   7057  C  CD2   . LEU C  3  62  ? 23.487  153.761 81.292  1.00 51.94  ? 62   LEU C CD2   1 
ATOM   7058  N  N     . ALA C  3  63  ? 21.004  148.950 81.110  1.00 54.54  ? 63   ALA C N     1 
ATOM   7059  C  CA    . ALA C  3  63  ? 20.909  147.665 80.445  1.00 53.30  ? 63   ALA C CA    1 
ATOM   7060  C  C     . ALA C  3  63  ? 20.392  147.752 78.998  1.00 53.41  ? 63   ALA C C     1 
ATOM   7061  O  O     . ALA C  3  63  ? 21.095  147.405 78.049  1.00 51.07  ? 63   ALA C O     1 
ATOM   7062  C  CB    . ALA C  3  63  ? 20.028  146.738 81.282  1.00 54.28  ? 63   ALA C CB    1 
ATOM   7063  N  N     . PHE C  3  64  ? 19.166  148.235 78.829  1.00 54.72  ? 64   PHE C N     1 
ATOM   7064  C  CA    . PHE C  3  64  ? 18.570  148.319 77.499  1.00 53.45  ? 64   PHE C CA    1 
ATOM   7065  C  C     . PHE C  3  64  ? 19.483  149.019 76.518  1.00 51.49  ? 64   PHE C C     1 
ATOM   7066  O  O     . PHE C  3  64  ? 19.758  148.496 75.444  1.00 53.55  ? 64   PHE C O     1 
ATOM   7067  C  CB    . PHE C  3  64  ? 17.233  149.054 77.559  1.00 54.63  ? 64   PHE C CB    1 
ATOM   7068  C  CG    . PHE C  3  64  ? 16.457  149.028 76.261  1.00 54.69  ? 64   PHE C CG    1 
ATOM   7069  C  CD1   . PHE C  3  64  ? 15.508  148.043 76.022  1.00 56.41  ? 64   PHE C CD1   1 
ATOM   7070  C  CD2   . PHE C  3  64  ? 16.635  150.021 75.302  1.00 54.05  ? 64   PHE C CD2   1 
ATOM   7071  C  CE1   . PHE C  3  64  ? 14.739  148.055 74.849  1.00 54.91  ? 64   PHE C CE1   1 
ATOM   7072  C  CE2   . PHE C  3  64  ? 15.875  150.037 74.135  1.00 52.47  ? 64   PHE C CE2   1 
ATOM   7073  C  CZ    . PHE C  3  64  ? 14.927  149.055 73.913  1.00 52.65  ? 64   PHE C CZ    1 
ATOM   7074  N  N     . SER C  3  65  ? 19.953  150.204 76.880  1.00 47.71  ? 65   SER C N     1 
ATOM   7075  C  CA    . SER C  3  65  ? 20.828  150.938 75.985  1.00 45.72  ? 65   SER C CA    1 
ATOM   7076  C  C     . SER C  3  65  ? 22.207  150.305 75.730  1.00 43.28  ? 65   SER C C     1 
ATOM   7077  O  O     . SER C  3  65  ? 22.772  150.447 74.643  1.00 42.89  ? 65   SER C O     1 
ATOM   7078  C  CB    . SER C  3  65  ? 20.980  152.365 76.491  1.00 45.31  ? 65   SER C CB    1 
ATOM   7079  O  OG    . SER C  3  65  ? 21.059  152.378 77.898  1.00 49.99  ? 65   SER C OG    1 
ATOM   7080  N  N     . SER C  3  66  ? 22.757  149.602 76.714  1.00 41.59  ? 66   SER C N     1 
ATOM   7081  C  CA    . SER C  3  66  ? 24.063  148.984 76.516  1.00 39.73  ? 66   SER C CA    1 
ATOM   7082  C  C     . SER C  3  66  ? 23.958  147.936 75.420  1.00 39.59  ? 66   SER C C     1 
ATOM   7083  O  O     . SER C  3  66  ? 24.853  147.791 74.576  1.00 39.33  ? 66   SER C O     1 
ATOM   7084  C  CB    . SER C  3  66  ? 24.563  148.353 77.807  1.00 37.82  ? 66   SER C CB    1 
ATOM   7085  O  OG    . SER C  3  66  ? 23.813  147.221 78.123  1.00 37.55  ? 66   SER C OG    1 
ATOM   7086  N  N     . VAL C  3  67  ? 22.848  147.213 75.431  1.00 38.73  ? 67   VAL C N     1 
ATOM   7087  C  CA    . VAL C  3  67  ? 22.614  146.212 74.420  1.00 39.55  ? 67   VAL C CA    1 
ATOM   7088  C  C     . VAL C  3  67  ? 22.493  146.931 73.070  1.00 40.91  ? 67   VAL C C     1 
ATOM   7089  O  O     . VAL C  3  67  ? 23.064  146.497 72.071  1.00 40.00  ? 67   VAL C O     1 
ATOM   7090  C  CB    . VAL C  3  67  ? 21.333  145.437 74.725  1.00 38.80  ? 67   VAL C CB    1 
ATOM   7091  C  CG1   . VAL C  3  67  ? 21.205  144.263 73.794  1.00 39.05  ? 67   VAL C CG1   1 
ATOM   7092  C  CG2   . VAL C  3  67  ? 21.354  144.967 76.150  1.00 37.85  ? 67   VAL C CG2   1 
ATOM   7093  N  N     . ALA C  3  68  ? 21.757  148.038 73.047  1.00 42.53  ? 68   ALA C N     1 
ATOM   7094  C  CA    . ALA C  3  68  ? 21.600  148.799 71.817  1.00 45.40  ? 68   ALA C CA    1 
ATOM   7095  C  C     . ALA C  3  68  ? 22.980  149.252 71.339  1.00 47.79  ? 68   ALA C C     1 
ATOM   7096  O  O     . ALA C  3  68  ? 23.296  149.138 70.152  1.00 48.08  ? 68   ALA C O     1 
ATOM   7097  C  CB    . ALA C  3  68  ? 20.705  149.997 72.051  1.00 43.87  ? 68   ALA C CB    1 
ATOM   7098  N  N     . HIS C  3  69  ? 23.800  149.764 72.260  1.00 50.24  ? 69   HIS C N     1 
ATOM   7099  C  CA    . HIS C  3  69  ? 25.144  150.200 71.899  1.00 52.08  ? 69   HIS C CA    1 
ATOM   7100  C  C     . HIS C  3  69  ? 25.932  149.004 71.352  1.00 51.51  ? 69   HIS C C     1 
ATOM   7101  O  O     . HIS C  3  69  ? 26.643  149.136 70.349  1.00 50.81  ? 69   HIS C O     1 
ATOM   7102  C  CB    . HIS C  3  69  ? 25.877  150.814 73.110  1.00 58.43  ? 69   HIS C CB    1 
ATOM   7103  C  CG    . HIS C  3  69  ? 27.389  150.770 73.009  1.00 66.95  ? 69   HIS C CG    1 
ATOM   7104  N  ND1   . HIS C  3  69  ? 28.134  149.642 73.317  1.00 69.25  ? 69   HIS C ND1   1 
ATOM   7105  C  CD2   . HIS C  3  69  ? 28.291  151.716 72.634  1.00 67.09  ? 69   HIS C CD2   1 
ATOM   7106  C  CE1   . HIS C  3  69  ? 29.420  149.896 73.138  1.00 67.93  ? 69   HIS C CE1   1 
ATOM   7107  N  NE2   . HIS C  3  69  ? 29.542  151.147 72.723  1.00 68.40  ? 69   HIS C NE2   1 
ATOM   7108  N  N     . THR C  3  70  ? 25.814  147.843 72.004  1.00 48.18  ? 70   THR C N     1 
ATOM   7109  C  CA    . THR C  3  70  ? 26.533  146.669 71.535  1.00 44.89  ? 70   THR C CA    1 
ATOM   7110  C  C     . THR C  3  70  ? 26.229  146.457 70.073  1.00 45.97  ? 70   THR C C     1 
ATOM   7111  O  O     . THR C  3  70  ? 27.126  146.250 69.268  1.00 47.22  ? 70   THR C O     1 
ATOM   7112  C  CB    . THR C  3  70  ? 26.102  145.389 72.247  1.00 43.00  ? 70   THR C CB    1 
ATOM   7113  O  OG1   . THR C  3  70  ? 26.522  145.430 73.610  1.00 43.26  ? 70   THR C OG1   1 
ATOM   7114  C  CG2   . THR C  3  70  ? 26.714  144.174 71.567  1.00 38.19  ? 70   THR C CG2   1 
ATOM   7115  N  N     . CYS C  3  71  ? 24.946  146.522 69.737  1.00 46.40  ? 71   CYS C N     1 
ATOM   7116  C  CA    . CYS C  3  71  ? 24.495  146.290 68.377  1.00 45.24  ? 71   CYS C CA    1 
ATOM   7117  C  C     . CYS C  3  71  ? 24.833  147.386 67.412  1.00 45.04  ? 71   CYS C C     1 
ATOM   7118  O  O     . CYS C  3  71  ? 25.220  147.116 66.276  1.00 45.80  ? 71   CYS C O     1 
ATOM   7119  C  CB    . CYS C  3  71  ? 22.997  146.048 68.382  1.00 44.50  ? 71   CYS C CB    1 
ATOM   7120  S  SG    . CYS C  3  71  ? 22.547  144.614 69.385  1.00 47.50  ? 71   CYS C SG    1 
ATOM   7121  N  N     . ARG C  3  72  ? 24.716  148.622 67.877  1.00 45.31  ? 72   ARG C N     1 
ATOM   7122  C  CA    . ARG C  3  72  ? 24.982  149.784 67.043  1.00 46.47  ? 72   ARG C CA    1 
ATOM   7123  C  C     . ARG C  3  72  ? 26.426  150.313 66.954  1.00 48.08  ? 72   ARG C C     1 
ATOM   7124  O  O     . ARG C  3  72  ? 26.809  150.915 65.945  1.00 49.31  ? 72   ARG C O     1 
ATOM   7125  C  CB    . ARG C  3  72  ? 24.066  150.909 67.489  1.00 45.33  ? 72   ARG C CB    1 
ATOM   7126  C  CG    . ARG C  3  72  ? 22.613  150.637 67.245  1.00 46.11  ? 72   ARG C CG    1 
ATOM   7127  C  CD    . ARG C  3  72  ? 21.766  151.581 68.069  1.00 48.63  ? 72   ARG C CD    1 
ATOM   7128  N  NE    . ARG C  3  72  ? 20.362  151.574 67.672  1.00 50.09  ? 72   ARG C NE    1 
ATOM   7129  C  CZ    . ARG C  3  72  ? 19.939  151.968 66.478  1.00 51.30  ? 72   ARG C CZ    1 
ATOM   7130  N  NH1   . ARG C  3  72  ? 20.830  152.395 65.586  1.00 50.59  ? 72   ARG C NH1   1 
ATOM   7131  N  NH2   . ARG C  3  72  ? 18.643  151.930 66.174  1.00 50.27  ? 72   ARG C NH2   1 
ATOM   7132  N  N     . ASN C  3  73  ? 27.230  150.103 67.992  1.00 49.45  ? 73   ASN C N     1 
ATOM   7133  C  CA    . ASN C  3  73  ? 28.603  150.610 67.979  1.00 48.94  ? 73   ASN C CA    1 
ATOM   7134  C  C     . ASN C  3  73  ? 29.711  149.551 67.946  1.00 49.14  ? 73   ASN C C     1 
ATOM   7135  O  O     . ASN C  3  73  ? 30.694  149.696 67.225  1.00 48.60  ? 73   ASN C O     1 
ATOM   7136  C  CB    . ASN C  3  73  ? 28.793  151.556 69.164  1.00 49.59  ? 73   ASN C CB    1 
ATOM   7137  C  CG    . ASN C  3  73  ? 27.844  152.743 69.104  1.00 52.52  ? 73   ASN C CG    1 
ATOM   7138  O  OD1   . ASN C  3  73  ? 27.765  153.435 68.077  1.00 52.47  ? 73   ASN C OD1   1 
ATOM   7139  N  ND2   . ASN C  3  73  ? 27.117  152.987 70.195  1.00 52.30  ? 73   ASN C ND2   1 
ATOM   7140  N  N     . VAL C  3  74  ? 29.551  148.485 68.719  1.00 49.55  ? 74   VAL C N     1 
ATOM   7141  C  CA    . VAL C  3  74  ? 30.538  147.419 68.748  1.00 48.82  ? 74   VAL C CA    1 
ATOM   7142  C  C     . VAL C  3  74  ? 30.572  146.688 67.404  1.00 49.63  ? 74   VAL C C     1 
ATOM   7143  O  O     . VAL C  3  74  ? 29.546  146.218 66.927  1.00 50.25  ? 74   VAL C O     1 
ATOM   7144  C  CB    . VAL C  3  74  ? 30.199  146.384 69.830  1.00 48.19  ? 74   VAL C CB    1 
ATOM   7145  C  CG1   . VAL C  3  74  ? 31.321  145.415 69.962  1.00 48.58  ? 74   VAL C CG1   1 
ATOM   7146  C  CG2   . VAL C  3  74  ? 29.905  147.067 71.152  1.00 47.86  ? 74   VAL C CG2   1 
ATOM   7147  N  N     . GLN C  3  75  ? 31.750  146.610 66.796  1.00 50.70  ? 75   GLN C N     1 
ATOM   7148  C  CA    . GLN C  3  75  ? 31.948  145.898 65.532  1.00 52.03  ? 75   GLN C CA    1 
ATOM   7149  C  C     . GLN C  3  75  ? 31.317  144.488 65.573  1.00 52.41  ? 75   GLN C C     1 
ATOM   7150  O  O     . GLN C  3  75  ? 31.681  143.651 66.410  1.00 53.15  ? 75   GLN C O     1 
ATOM   7151  C  CB    . GLN C  3  75  ? 33.437  145.729 65.302  1.00 56.52  ? 75   GLN C CB    1 
ATOM   7152  C  CG    . GLN C  3  75  ? 34.230  146.992 65.383  1.00 61.11  ? 75   GLN C CG    1 
ATOM   7153  C  CD    . GLN C  3  75  ? 34.638  147.443 64.005  1.00 65.22  ? 75   GLN C CD    1 
ATOM   7154  O  OE1   . GLN C  3  75  ? 35.405  146.757 63.315  1.00 66.68  ? 75   GLN C OE1   1 
ATOM   7155  N  NE2   . GLN C  3  75  ? 34.115  148.590 63.579  1.00 67.54  ? 75   GLN C NE2   1 
ATOM   7156  N  N     . TYR C  3  76  ? 30.399  144.199 64.666  1.00 50.99  ? 76   TYR C N     1 
ATOM   7157  C  CA    . TYR C  3  76  ? 29.760  142.884 64.663  1.00 50.42  ? 76   TYR C CA    1 
ATOM   7158  C  C     . TYR C  3  76  ? 28.959  142.565 65.915  1.00 51.26  ? 76   TYR C C     1 
ATOM   7159  O  O     . TYR C  3  76  ? 28.506  141.426 66.109  1.00 51.10  ? 76   TYR C O     1 
ATOM   7160  C  CB    . TYR C  3  76  ? 30.786  141.786 64.418  1.00 49.34  ? 76   TYR C CB    1 
ATOM   7161  C  CG    . TYR C  3  76  ? 31.342  141.900 63.045  1.00 48.39  ? 76   TYR C CG    1 
ATOM   7162  C  CD1   . TYR C  3  76  ? 32.650  142.292 62.839  1.00 48.07  ? 76   TYR C CD1   1 
ATOM   7163  C  CD2   . TYR C  3  76  ? 30.508  141.780 61.944  1.00 47.77  ? 76   TYR C CD2   1 
ATOM   7164  C  CE1   . TYR C  3  76  ? 33.109  142.583 61.565  1.00 47.95  ? 76   TYR C CE1   1 
ATOM   7165  C  CE2   . TYR C  3  76  ? 30.954  142.066 60.675  1.00 46.99  ? 76   TYR C CE2   1 
ATOM   7166  C  CZ    . TYR C  3  76  ? 32.251  142.472 60.486  1.00 46.57  ? 76   TYR C CZ    1 
ATOM   7167  O  OH    . TYR C  3  76  ? 32.672  142.795 59.216  1.00 48.96  ? 76   TYR C OH    1 
ATOM   7168  N  N     . GLY C  3  77  ? 28.782  143.576 66.761  1.00 51.91  ? 77   GLY C N     1 
ATOM   7169  C  CA    . GLY C  3  77  ? 27.979  143.397 67.953  1.00 53.11  ? 77   GLY C CA    1 
ATOM   7170  C  C     . GLY C  3  77  ? 26.579  142.931 67.549  1.00 53.40  ? 77   GLY C C     1 
ATOM   7171  O  O     . GLY C  3  77  ? 25.974  142.089 68.213  1.00 55.75  ? 77   GLY C O     1 
ATOM   7172  N  N     . TRP C  3  78  ? 26.053  143.461 66.450  1.00 51.35  ? 78   TRP C N     1 
ATOM   7173  C  CA    . TRP C  3  78  ? 24.732  143.050 66.011  1.00 49.62  ? 78   TRP C CA    1 
ATOM   7174  C  C     . TRP C  3  78  ? 24.689  141.561 65.685  1.00 48.10  ? 78   TRP C C     1 
ATOM   7175  O  O     . TRP C  3  78  ? 23.740  140.863 66.038  1.00 48.89  ? 78   TRP C O     1 
ATOM   7176  C  CB    . TRP C  3  78  ? 24.285  143.856 64.779  1.00 47.82  ? 78   TRP C CB    1 
ATOM   7177  C  CG    . TRP C  3  78  ? 25.129  143.659 63.590  1.00 45.40  ? 78   TRP C CG    1 
ATOM   7178  C  CD1   . TRP C  3  78  ? 26.253  144.356 63.270  1.00 46.61  ? 78   TRP C CD1   1 
ATOM   7179  C  CD2   . TRP C  3  78  ? 24.979  142.647 62.584  1.00 45.84  ? 78   TRP C CD2   1 
ATOM   7180  N  NE1   . TRP C  3  78  ? 26.822  143.843 62.121  1.00 48.39  ? 78   TRP C NE1   1 
ATOM   7181  C  CE2   . TRP C  3  78  ? 26.062  142.789 61.683  1.00 47.52  ? 78   TRP C CE2   1 
ATOM   7182  C  CE3   . TRP C  3  78  ? 24.046  141.628 62.362  1.00 45.19  ? 78   TRP C CE3   1 
ATOM   7183  C  CZ2   . TRP C  3  78  ? 26.236  141.947 60.578  1.00 46.65  ? 78   TRP C CZ2   1 
ATOM   7184  C  CZ3   . TRP C  3  78  ? 24.220  140.789 61.266  1.00 45.39  ? 78   TRP C CZ3   1 
ATOM   7185  C  CH2   . TRP C  3  78  ? 25.307  140.953 60.389  1.00 47.05  ? 78   TRP C CH2   1 
ATOM   7186  N  N     . LEU C  3  79  ? 25.723  141.079 65.016  1.00 46.68  ? 79   LEU C N     1 
ATOM   7187  C  CA    . LEU C  3  79  ? 25.785  139.682 64.614  1.00 46.67  ? 79   LEU C CA    1 
ATOM   7188  C  C     . LEU C  3  79  ? 25.844  138.758 65.821  1.00 46.87  ? 79   LEU C C     1 
ATOM   7189  O  O     . LEU C  3  79  ? 25.106  137.767 65.907  1.00 44.24  ? 79   LEU C O     1 
ATOM   7190  C  CB    . LEU C  3  79  ? 27.007  139.465 63.726  1.00 45.84  ? 79   LEU C CB    1 
ATOM   7191  C  CG    . LEU C  3  79  ? 27.333  138.022 63.376  1.00 45.02  ? 79   LEU C CG    1 
ATOM   7192  C  CD1   . LEU C  3  79  ? 26.156  137.388 62.708  1.00 44.83  ? 79   LEU C CD1   1 
ATOM   7193  C  CD2   . LEU C  3  79  ? 28.545  137.981 62.476  1.00 46.33  ? 79   LEU C CD2   1 
ATOM   7194  N  N     . ILE C  3  80  ? 26.738  139.101 66.747  1.00 46.72  ? 80   ILE C N     1 
ATOM   7195  C  CA    . ILE C  3  80  ? 26.938  138.340 67.974  1.00 45.92  ? 80   ILE C CA    1 
ATOM   7196  C  C     . ILE C  3  80  ? 25.645  138.274 68.776  1.00 45.47  ? 80   ILE C C     1 
ATOM   7197  O  O     . ILE C  3  80  ? 25.228  137.214 69.223  1.00 43.49  ? 80   ILE C O     1 
ATOM   7198  C  CB    . ILE C  3  80  ? 28.044  138.992 68.805  1.00 46.73  ? 80   ILE C CB    1 
ATOM   7199  C  CG1   . ILE C  3  80  ? 29.366  138.865 68.051  1.00 45.93  ? 80   ILE C CG1   1 
ATOM   7200  C  CG2   . ILE C  3  80  ? 28.126  138.364 70.182  1.00 46.89  ? 80   ILE C CG2   1 
ATOM   7201  C  CD1   . ILE C  3  80  ? 30.527  139.506 68.759  1.00 45.29  ? 80   ILE C CD1   1 
ATOM   7202  N  N     . ARG C  3  81  ? 25.003  139.415 68.952  1.00 46.43  ? 81   ARG C N     1 
ATOM   7203  C  CA    . ARG C  3  81  ? 23.748  139.437 69.674  1.00 48.56  ? 81   ARG C CA    1 
ATOM   7204  C  C     . ARG C  3  81  ? 22.752  138.510 68.952  1.00 48.57  ? 81   ARG C C     1 
ATOM   7205  O  O     . ARG C  3  81  ? 22.094  137.702 69.599  1.00 49.33  ? 81   ARG C O     1 
ATOM   7206  C  CB    . ARG C  3  81  ? 23.218  140.878 69.751  1.00 49.86  ? 81   ARG C CB    1 
ATOM   7207  C  CG    . ARG C  3  81  ? 22.147  141.149 70.807  1.00 51.54  ? 81   ARG C CG    1 
ATOM   7208  C  CD    . ARG C  3  81  ? 20.811  140.584 70.399  1.00 55.62  ? 81   ARG C CD    1 
ATOM   7209  N  NE    . ARG C  3  81  ? 19.717  140.933 71.313  1.00 60.77  ? 81   ARG C NE    1 
ATOM   7210  C  CZ    . ARG C  3  81  ? 19.215  142.159 71.465  1.00 62.21  ? 81   ARG C CZ    1 
ATOM   7211  N  NH1   . ARG C  3  81  ? 19.716  143.168 70.766  1.00 63.11  ? 81   ARG C NH1   1 
ATOM   7212  N  NH2   . ARG C  3  81  ? 18.196  142.374 72.298  1.00 61.35  ? 81   ARG C NH2   1 
ATOM   7213  N  N     . ASN C  3  82  ? 22.662  138.596 67.623  1.00 48.21  ? 82   ASN C N     1 
ATOM   7214  C  CA    . ASN C  3  82  ? 21.725  137.751 66.876  1.00 49.88  ? 82   ASN C CA    1 
ATOM   7215  C  C     . ASN C  3  82  ? 22.026  136.275 67.101  1.00 50.63  ? 82   ASN C C     1 
ATOM   7216  O  O     . ASN C  3  82  ? 21.138  135.482 67.420  1.00 51.67  ? 82   ASN C O     1 
ATOM   7217  C  CB    . ASN C  3  82  ? 21.769  138.045 65.368  1.00 51.31  ? 82   ASN C CB    1 
ATOM   7218  C  CG    . ASN C  3  82  ? 21.178  139.417 65.006  1.00 55.65  ? 82   ASN C CG    1 
ATOM   7219  O  OD1   . ASN C  3  82  ? 20.961  139.727 63.823  1.00 55.05  ? 82   ASN C OD1   1 
ATOM   7220  N  ND2   . ASN C  3  82  ? 20.919  140.245 66.021  1.00 57.45  ? 82   ASN C ND2   1 
ATOM   7221  N  N     . LEU C  3  83  ? 23.285  135.903 66.937  1.00 49.41  ? 83   LEU C N     1 
ATOM   7222  C  CA    . LEU C  3  83  ? 23.671  134.521 67.130  1.00 46.77  ? 83   LEU C CA    1 
ATOM   7223  C  C     . LEU C  3  83  ? 23.346  134.066 68.550  1.00 46.54  ? 83   LEU C C     1 
ATOM   7224  O  O     . LEU C  3  83  ? 22.974  132.910 68.781  1.00 46.29  ? 83   LEU C O     1 
ATOM   7225  C  CB    . LEU C  3  83  ? 25.160  134.384 66.855  1.00 44.14  ? 83   LEU C CB    1 
ATOM   7226  C  CG    . LEU C  3  83  ? 25.448  134.687 65.398  1.00 41.98  ? 83   LEU C CG    1 
ATOM   7227  C  CD1   . LEU C  3  83  ? 26.907  135.027 65.217  1.00 41.85  ? 83   LEU C CD1   1 
ATOM   7228  C  CD2   . LEU C  3  83  ? 25.024  133.485 64.559  1.00 39.82  ? 83   LEU C CD2   1 
ATOM   7229  N  N     . HIS C  3  84  ? 23.475  134.975 69.507  1.00 45.18  ? 84   HIS C N     1 
ATOM   7230  C  CA    . HIS C  3  84  ? 23.202  134.590 70.871  1.00 44.99  ? 84   HIS C CA    1 
ATOM   7231  C  C     . HIS C  3  84  ? 21.721  134.419 71.047  1.00 44.39  ? 84   HIS C C     1 
ATOM   7232  O  O     . HIS C  3  84  ? 21.286  133.477 71.678  1.00 45.27  ? 84   HIS C O     1 
ATOM   7233  C  CB    . HIS C  3  84  ? 23.715  135.630 71.867  1.00 46.28  ? 84   HIS C CB    1 
ATOM   7234  C  CG    . HIS C  3  84  ? 23.823  135.112 73.274  1.00 47.17  ? 84   HIS C CG    1 
ATOM   7235  N  ND1   . HIS C  3  84  ? 24.699  134.114 73.630  1.00 46.45  ? 84   HIS C ND1   1 
ATOM   7236  C  CD2   . HIS C  3  84  ? 23.160  135.449 74.409  1.00 46.66  ? 84   HIS C CD2   1 
ATOM   7237  C  CE1   . HIS C  3  84  ? 24.574  133.860 74.919  1.00 46.31  ? 84   HIS C CE1   1 
ATOM   7238  N  NE2   . HIS C  3  84  ? 23.647  134.656 75.418  1.00 45.61  ? 84   HIS C NE2   1 
ATOM   7239  N  N     . ALA C  3  85  ? 20.940  135.325 70.481  1.00 44.63  ? 85   ALA C N     1 
ATOM   7240  C  CA    . ALA C  3  85  ? 19.487  135.245 70.614  1.00 45.56  ? 85   ALA C CA    1 
ATOM   7241  C  C     . ALA C  3  85  ? 18.904  134.021 69.899  1.00 46.95  ? 85   ALA C C     1 
ATOM   7242  O  O     . ALA C  3  85  ? 18.090  133.270 70.461  1.00 47.83  ? 85   ALA C O     1 
ATOM   7243  C  CB    . ALA C  3  85  ? 18.855  136.509 70.077  1.00 43.37  ? 85   ALA C CB    1 
ATOM   7244  N  N     . ASN C  3  86  ? 19.320  133.819 68.656  1.00 46.76  ? 86   ASN C N     1 
ATOM   7245  C  CA    . ASN C  3  86  ? 18.827  132.693 67.891  1.00 46.28  ? 86   ASN C CA    1 
ATOM   7246  C  C     . ASN C  3  86  ? 19.463  131.379 68.336  1.00 46.45  ? 86   ASN C C     1 
ATOM   7247  O  O     . ASN C  3  86  ? 18.870  130.299 68.171  1.00 46.45  ? 86   ASN C O     1 
ATOM   7248  C  CB    . ASN C  3  86  ? 19.053  132.935 66.401  1.00 46.73  ? 86   ASN C CB    1 
ATOM   7249  C  CG    . ASN C  3  86  ? 18.143  134.016 65.848  1.00 47.91  ? 86   ASN C CG    1 
ATOM   7250  O  OD1   . ASN C  3  86  ? 18.496  135.191 65.829  1.00 47.84  ? 86   ASN C OD1   1 
ATOM   7251  N  ND2   . ASN C  3  86  ? 16.951  133.620 65.410  1.00 50.24  ? 86   ASN C ND2   1 
ATOM   7252  N  N     . GLY C  3  87  ? 20.671  131.466 68.890  1.00 45.48  ? 87   GLY C N     1 
ATOM   7253  C  CA    . GLY C  3  87  ? 21.327  130.269 69.381  1.00 44.50  ? 87   GLY C CA    1 
ATOM   7254  C  C     . GLY C  3  87  ? 20.438  129.674 70.468  1.00 44.09  ? 87   GLY C C     1 
ATOM   7255  O  O     . GLY C  3  87  ? 20.175  128.470 70.502  1.00 42.89  ? 87   GLY C O     1 
ATOM   7256  N  N     . ALA C  3  88  ? 19.955  130.536 71.355  1.00 43.57  ? 88   ALA C N     1 
ATOM   7257  C  CA    . ALA C  3  88  ? 19.077  130.116 72.425  1.00 43.20  ? 88   ALA C CA    1 
ATOM   7258  C  C     . ALA C  3  88  ? 17.977  129.222 71.859  1.00 44.90  ? 88   ALA C C     1 
ATOM   7259  O  O     . ALA C  3  88  ? 17.715  128.137 72.399  1.00 43.73  ? 88   ALA C O     1 
ATOM   7260  C  CB    . ALA C  3  88  ? 18.474  131.326 73.087  1.00 42.80  ? 88   ALA C CB    1 
ATOM   7261  N  N     . SER C  3  89  ? 17.342  129.678 70.773  1.00 46.26  ? 89   SER C N     1 
ATOM   7262  C  CA    . SER C  3  89  ? 16.269  128.916 70.123  1.00 47.54  ? 89   SER C CA    1 
ATOM   7263  C  C     . SER C  3  89  ? 16.757  127.591 69.547  1.00 48.31  ? 89   SER C C     1 
ATOM   7264  O  O     . SER C  3  89  ? 16.178  126.531 69.825  1.00 48.57  ? 89   SER C O     1 
ATOM   7265  C  CB    . SER C  3  89  ? 15.611  129.730 69.012  1.00 47.42  ? 89   SER C CB    1 
ATOM   7266  O  OG    . SER C  3  89  ? 14.819  130.777 69.544  1.00 49.26  ? 89   SER C OG    1 
ATOM   7267  N  N     . PHE C  3  90  ? 17.808  127.623 68.739  1.00 46.94  ? 90   PHE C N     1 
ATOM   7268  C  CA    . PHE C  3  90  ? 18.279  126.364 68.218  1.00 46.56  ? 90   PHE C CA    1 
ATOM   7269  C  C     . PHE C  3  90  ? 18.735  125.448 69.328  1.00 44.99  ? 90   PHE C C     1 
ATOM   7270  O  O     . PHE C  3  90  ? 18.853  124.241 69.130  1.00 44.64  ? 90   PHE C O     1 
ATOM   7271  C  CB    . PHE C  3  90  ? 19.373  126.581 67.201  1.00 49.94  ? 90   PHE C CB    1 
ATOM   7272  C  CG    . PHE C  3  90  ? 18.838  126.924 65.855  1.00 55.34  ? 90   PHE C CG    1 
ATOM   7273  C  CD1   . PHE C  3  90  ? 18.317  128.193 65.608  1.00 56.44  ? 90   PHE C CD1   1 
ATOM   7274  C  CD2   . PHE C  3  90  ? 18.753  125.949 64.859  1.00 56.17  ? 90   PHE C CD2   1 
ATOM   7275  C  CE1   . PHE C  3  90  ? 17.717  128.486 64.396  1.00 57.63  ? 90   PHE C CE1   1 
ATOM   7276  C  CE2   . PHE C  3  90  ? 18.154  126.226 63.645  1.00 57.60  ? 90   PHE C CE2   1 
ATOM   7277  C  CZ    . PHE C  3  90  ? 17.633  127.497 63.411  1.00 59.39  ? 90   PHE C CZ    1 
ATOM   7278  N  N     . PHE C  3  91  ? 18.973  126.024 70.504  1.00 43.17  ? 91   PHE C N     1 
ATOM   7279  C  CA    . PHE C  3  91  ? 19.385  125.235 71.650  1.00 41.53  ? 91   PHE C CA    1 
ATOM   7280  C  C     . PHE C  3  91  ? 18.146  124.457 72.060  1.00 41.79  ? 91   PHE C C     1 
ATOM   7281  O  O     . PHE C  3  91  ? 18.229  123.256 72.314  1.00 41.47  ? 91   PHE C O     1 
ATOM   7282  C  CB    . PHE C  3  91  ? 19.842  126.124 72.812  1.00 40.12  ? 91   PHE C CB    1 
ATOM   7283  C  CG    . PHE C  3  91  ? 20.824  125.448 73.768  1.00 37.99  ? 91   PHE C CG    1 
ATOM   7284  C  CD1   . PHE C  3  91  ? 20.640  124.127 74.182  1.00 35.93  ? 91   PHE C CD1   1 
ATOM   7285  C  CD2   . PHE C  3  91  ? 21.910  126.156 74.284  1.00 36.34  ? 91   PHE C CD2   1 
ATOM   7286  C  CE1   . PHE C  3  91  ? 21.514  123.540 75.086  1.00 33.30  ? 91   PHE C CE1   1 
ATOM   7287  C  CE2   . PHE C  3  91  ? 22.783  125.567 75.184  1.00 34.57  ? 91   PHE C CE2   1 
ATOM   7288  C  CZ    . PHE C  3  91  ? 22.583  124.259 75.584  1.00 32.81  ? 91   PHE C CZ    1 
ATOM   7289  N  N     . PHE C  3  92  ? 16.995  125.135 72.122  1.00 42.57  ? 92   PHE C N     1 
ATOM   7290  C  CA    . PHE C  3  92  ? 15.742  124.454 72.498  1.00 42.16  ? 92   PHE C CA    1 
ATOM   7291  C  C     . PHE C  3  92  ? 15.255  123.547 71.379  1.00 40.38  ? 92   PHE C C     1 
ATOM   7292  O  O     . PHE C  3  92  ? 14.743  122.456 71.648  1.00 38.93  ? 92   PHE C O     1 
ATOM   7293  C  CB    . PHE C  3  92  ? 14.621  125.436 72.882  1.00 41.48  ? 92   PHE C CB    1 
ATOM   7294  C  CG    . PHE C  3  92  ? 14.766  126.019 74.265  1.00 44.50  ? 92   PHE C CG    1 
ATOM   7295  C  CD1   . PHE C  3  92  ? 15.641  127.079 74.514  1.00 45.84  ? 92   PHE C CD1   1 
ATOM   7296  C  CD2   . PHE C  3  92  ? 14.027  125.508 75.322  1.00 45.37  ? 92   PHE C CD2   1 
ATOM   7297  C  CE1   . PHE C  3  92  ? 15.769  127.614 75.796  1.00 47.16  ? 92   PHE C CE1   1 
ATOM   7298  C  CE2   . PHE C  3  92  ? 14.150  126.038 76.612  1.00 46.91  ? 92   PHE C CE2   1 
ATOM   7299  C  CZ    . PHE C  3  92  ? 15.020  127.090 76.847  1.00 48.00  ? 92   PHE C CZ    1 
ATOM   7300  N  N     . ILE C  3  93  ? 15.426  123.979 70.130  1.00 38.05  ? 93   ILE C N     1 
ATOM   7301  C  CA    . ILE C  3  93  ? 14.979  123.144 69.039  1.00 37.97  ? 93   ILE C CA    1 
ATOM   7302  C  C     . ILE C  3  93  ? 15.693  121.833 69.249  1.00 38.69  ? 93   ILE C C     1 
ATOM   7303  O  O     . ILE C  3  93  ? 15.070  120.795 69.458  1.00 39.49  ? 93   ILE C O     1 
ATOM   7304  C  CB    . ILE C  3  93  ? 15.350  123.717 67.658  1.00 37.65  ? 93   ILE C CB    1 
ATOM   7305  C  CG1   . ILE C  3  93  ? 14.563  124.998 67.388  1.00 38.93  ? 93   ILE C CG1   1 
ATOM   7306  C  CG2   . ILE C  3  93  ? 15.025  122.715 66.559  1.00 34.38  ? 93   ILE C CG2   1 
ATOM   7307  C  CD1   . ILE C  3  93  ? 15.047  125.749 66.128  1.00 39.90  ? 93   ILE C CD1   1 
ATOM   7308  N  N     . CYS C  3  94  ? 17.010  121.887 69.237  1.00 38.78  ? 94   CYS C N     1 
ATOM   7309  C  CA    . CYS C  3  94  ? 17.781  120.682 69.414  1.00 40.20  ? 94   CYS C CA    1 
ATOM   7310  C  C     . CYS C  3  94  ? 17.447  119.891 70.689  1.00 40.37  ? 94   CYS C C     1 
ATOM   7311  O  O     . CYS C  3  94  ? 17.284  118.669 70.633  1.00 41.25  ? 94   CYS C O     1 
ATOM   7312  C  CB    . CYS C  3  94  ? 19.274  121.019 69.380  1.00 42.66  ? 94   CYS C CB    1 
ATOM   7313  S  SG    . CYS C  3  94  ? 19.939  121.468 67.749  1.00 44.76  ? 94   CYS C SG    1 
ATOM   7314  N  N     . ILE C  3  95  ? 17.329  120.558 71.834  1.00 38.99  ? 95   ILE C N     1 
ATOM   7315  C  CA    . ILE C  3  95  ? 17.057  119.816 73.069  1.00 38.32  ? 95   ILE C CA    1 
ATOM   7316  C  C     . ILE C  3  95  ? 15.737  119.095 72.984  1.00 38.92  ? 95   ILE C C     1 
ATOM   7317  O  O     . ILE C  3  95  ? 15.612  117.962 73.455  1.00 38.68  ? 95   ILE C O     1 
ATOM   7318  C  CB    . ILE C  3  95  ? 17.035  120.714 74.331  1.00 38.10  ? 95   ILE C CB    1 
ATOM   7319  C  CG1   . ILE C  3  95  ? 17.307  119.853 75.567  1.00 34.82  ? 95   ILE C CG1   1 
ATOM   7320  C  CG2   . ILE C  3  95  ? 15.680  121.409 74.467  1.00 36.04  ? 95   ILE C CG2   1 
ATOM   7321  C  CD1   . ILE C  3  95  ? 17.369  120.635 76.839  1.00 33.88  ? 95   ILE C CD1   1 
ATOM   7322  N  N     . PHE C  3  96  ? 14.744  119.751 72.389  1.00 38.78  ? 96   PHE C N     1 
ATOM   7323  C  CA    . PHE C  3  96  ? 13.439  119.121 72.245  1.00 38.61  ? 96   PHE C CA    1 
ATOM   7324  C  C     . PHE C  3  96  ? 13.527  117.847 71.405  1.00 38.74  ? 96   PHE C C     1 
ATOM   7325  O  O     . PHE C  3  96  ? 13.004  116.812 71.819  1.00 39.72  ? 96   PHE C O     1 
ATOM   7326  C  CB    . PHE C  3  96  ? 12.424  120.085 71.638  1.00 37.26  ? 96   PHE C CB    1 
ATOM   7327  C  CG    . PHE C  3  96  ? 11.956  121.159 72.588  1.00 37.67  ? 96   PHE C CG    1 
ATOM   7328  C  CD1   . PHE C  3  96  ? 11.724  120.871 73.931  1.00 36.20  ? 96   PHE C CD1   1 
ATOM   7329  C  CD2   . PHE C  3  96  ? 11.665  122.450 72.125  1.00 37.14  ? 96   PHE C CD2   1 
ATOM   7330  C  CE1   . PHE C  3  96  ? 11.201  121.851 74.803  1.00 33.83  ? 96   PHE C CE1   1 
ATOM   7331  C  CE2   . PHE C  3  96  ? 11.146  123.419 72.987  1.00 33.99  ? 96   PHE C CE2   1 
ATOM   7332  C  CZ    . PHE C  3  96  ? 10.913  123.114 74.328  1.00 31.24  ? 96   PHE C CZ    1 
ATOM   7333  N  N     . LEU C  3  97  ? 14.188  117.901 70.244  1.00 37.61  ? 97   LEU C N     1 
ATOM   7334  C  CA    . LEU C  3  97  ? 14.314  116.703 69.410  1.00 37.29  ? 97   LEU C CA    1 
ATOM   7335  C  C     . LEU C  3  97  ? 15.127  115.640 70.170  1.00 39.21  ? 97   LEU C C     1 
ATOM   7336  O  O     . LEU C  3  97  ? 14.792  114.459 70.107  1.00 39.74  ? 97   LEU C O     1 
ATOM   7337  C  CB    . LEU C  3  97  ? 14.980  117.035 68.070  1.00 36.41  ? 97   LEU C CB    1 
ATOM   7338  C  CG    . LEU C  3  97  ? 14.284  118.073 67.159  1.00 37.55  ? 97   LEU C CG    1 
ATOM   7339  C  CD1   . LEU C  3  97  ? 15.163  118.444 65.958  1.00 36.43  ? 97   LEU C CD1   1 
ATOM   7340  C  CD2   . LEU C  3  97  ? 12.970  117.530 66.672  1.00 34.65  ? 97   LEU C CD2   1 
ATOM   7341  N  N     . HIS C  3  98  ? 16.173  116.058 70.897  1.00 39.23  ? 98   HIS C N     1 
ATOM   7342  C  CA    . HIS C  3  98  ? 17.007  115.144 71.689  1.00 38.55  ? 98   HIS C CA    1 
ATOM   7343  C  C     . HIS C  3  98  ? 16.044  114.393 72.614  1.00 38.95  ? 98   HIS C C     1 
ATOM   7344  O  O     . HIS C  3  98  ? 16.025  113.166 72.626  1.00 38.45  ? 98   HIS C O     1 
ATOM   7345  C  CB    . HIS C  3  98  ? 18.037  115.954 72.512  1.00 41.22  ? 98   HIS C CB    1 
ATOM   7346  C  CG    . HIS C  3  98  ? 19.084  115.135 73.239  1.00 43.11  ? 98   HIS C CG    1 
ATOM   7347  N  ND1   . HIS C  3  98  ? 20.082  114.439 72.588  1.00 45.64  ? 98   HIS C ND1   1 
ATOM   7348  C  CD2   . HIS C  3  98  ? 19.352  115.004 74.564  1.00 42.39  ? 98   HIS C CD2   1 
ATOM   7349  C  CE1   . HIS C  3  98  ? 20.918  113.924 73.474  1.00 44.27  ? 98   HIS C CE1   1 
ATOM   7350  N  NE2   . HIS C  3  98  ? 20.502  114.253 74.686  1.00 43.23  ? 98   HIS C NE2   1 
ATOM   7351  N  N     . ILE C  3  99  ? 15.228  115.129 73.371  1.00 39.19  ? 99   ILE C N     1 
ATOM   7352  C  CA    . ILE C  3  99  ? 14.272  114.497 74.286  1.00 39.36  ? 99   ILE C CA    1 
ATOM   7353  C  C     . ILE C  3  99  ? 13.345  113.547 73.532  1.00 40.09  ? 99   ILE C C     1 
ATOM   7354  O  O     . ILE C  3  99  ? 13.095  112.429 73.975  1.00 40.01  ? 99   ILE C O     1 
ATOM   7355  C  CB    . ILE C  3  99  ? 13.420  115.548 75.037  1.00 38.72  ? 99   ILE C CB    1 
ATOM   7356  C  CG1   . ILE C  3  99  ? 14.338  116.445 75.861  1.00 37.92  ? 99   ILE C CG1   1 
ATOM   7357  C  CG2   . ILE C  3  99  ? 12.403  114.872 75.945  1.00 33.44  ? 99   ILE C CG2   1 
ATOM   7358  C  CD1   . ILE C  3  99  ? 13.597  117.447 76.699  1.00 39.70  ? 99   ILE C CD1   1 
ATOM   7359  N  N     . GLY C  3  100 ? 12.840  113.993 72.387  1.00 40.22  ? 100  GLY C N     1 
ATOM   7360  C  CA    . GLY C  3  100 ? 11.954  113.149 71.604  1.00 41.77  ? 100  GLY C CA    1 
ATOM   7361  C  C     . GLY C  3  100 ? 12.588  111.797 71.346  1.00 41.96  ? 100  GLY C C     1 
ATOM   7362  O  O     . GLY C  3  100 ? 12.072  110.774 71.785  1.00 42.74  ? 100  GLY C O     1 
ATOM   7363  N  N     . ARG C  3  101 ? 13.706  111.809 70.622  1.00 42.15  ? 101  ARG C N     1 
ATOM   7364  C  CA    . ARG C  3  101 ? 14.460  110.611 70.301  1.00 41.35  ? 101  ARG C CA    1 
ATOM   7365  C  C     . ARG C  3  101 ? 14.512  109.707 71.520  1.00 42.87  ? 101  ARG C C     1 
ATOM   7366  O  O     . ARG C  3  101 ? 14.180  108.527 71.438  1.00 43.29  ? 101  ARG C O     1 
ATOM   7367  C  CB    . ARG C  3  101 ? 15.883  110.985 69.897  1.00 39.82  ? 101  ARG C CB    1 
ATOM   7368  C  CG    . ARG C  3  101 ? 16.852  109.805 69.729  1.00 40.42  ? 101  ARG C CG    1 
ATOM   7369  C  CD    . ARG C  3  101 ? 17.168  109.063 71.029  1.00 41.22  ? 101  ARG C CD    1 
ATOM   7370  N  NE    . ARG C  3  101 ? 18.024  109.824 71.925  1.00 44.87  ? 101  ARG C NE    1 
ATOM   7371  C  CZ    . ARG C  3  101 ? 19.310  110.065 71.695  1.00 47.22  ? 101  ARG C CZ    1 
ATOM   7372  N  NH1   . ARG C  3  101 ? 19.883  109.592 70.599  1.00 48.54  ? 101  ARG C NH1   1 
ATOM   7373  N  NH2   . ARG C  3  101 ? 20.016  110.808 72.541  1.00 47.81  ? 101  ARG C NH2   1 
ATOM   7374  N  N     . GLY C  3  102 ? 14.946  110.261 72.648  1.00 44.07  ? 102  GLY C N     1 
ATOM   7375  C  CA    . GLY C  3  102 ? 15.038  109.475 73.866  1.00 45.92  ? 102  GLY C CA    1 
ATOM   7376  C  C     . GLY C  3  102 ? 13.761  108.713 74.201  1.00 47.24  ? 102  GLY C C     1 
ATOM   7377  O  O     . GLY C  3  102 ? 13.797  107.512 74.522  1.00 45.55  ? 102  GLY C O     1 
ATOM   7378  N  N     . LEU C  3  103 ? 12.627  109.413 74.119  1.00 47.61  ? 103  LEU C N     1 
ATOM   7379  C  CA    . LEU C  3  103 ? 11.338  108.814 74.421  1.00 47.15  ? 103  LEU C CA    1 
ATOM   7380  C  C     . LEU C  3  103 ? 10.968  107.739 73.414  1.00 46.81  ? 103  LEU C C     1 
ATOM   7381  O  O     . LEU C  3  103 ? 10.558  106.652 73.780  1.00 47.43  ? 103  LEU C O     1 
ATOM   7382  C  CB    . LEU C  3  103 ? 10.252  109.881 74.453  1.00 46.18  ? 103  LEU C CB    1 
ATOM   7383  C  CG    . LEU C  3  103 ? 8.898   109.272 74.806  1.00 47.73  ? 103  LEU C CG    1 
ATOM   7384  C  CD1   . LEU C  3  103 ? 8.967   108.583 76.160  1.00 45.25  ? 103  LEU C CD1   1 
ATOM   7385  C  CD2   . LEU C  3  103 ? 7.855   110.359 74.813  1.00 48.65  ? 103  LEU C CD2   1 
ATOM   7386  N  N     . TYR C  3  104 ? 11.126  108.040 72.138  1.00 47.02  ? 104  TYR C N     1 
ATOM   7387  C  CA    . TYR C  3  104 ? 10.788  107.077 71.109  1.00 48.66  ? 104  TYR C CA    1 
ATOM   7388  C  C     . TYR C  3  104 ? 11.624  105.808 71.156  1.00 49.59  ? 104  TYR C C     1 
ATOM   7389  O  O     . TYR C  3  104 ? 11.091  104.712 70.979  1.00 50.18  ? 104  TYR C O     1 
ATOM   7390  C  CB    . TYR C  3  104 ? 10.953  107.702 69.734  1.00 49.53  ? 104  TYR C CB    1 
ATOM   7391  C  CG    . TYR C  3  104 ? 10.387  106.879 68.595  1.00 49.32  ? 104  TYR C CG    1 
ATOM   7392  C  CD1   . TYR C  3  104 ? 9.049   107.008 68.223  1.00 47.85  ? 104  TYR C CD1   1 
ATOM   7393  C  CD2   . TYR C  3  104 ? 11.203  106.017 67.855  1.00 48.57  ? 104  TYR C CD2   1 
ATOM   7394  C  CE1   . TYR C  3  104 ? 8.534   106.312 67.136  1.00 50.48  ? 104  TYR C CE1   1 
ATOM   7395  C  CE2   . TYR C  3  104 ? 10.695  105.313 66.761  1.00 51.20  ? 104  TYR C CE2   1 
ATOM   7396  C  CZ    . TYR C  3  104 ? 9.354   105.469 66.405  1.00 50.90  ? 104  TYR C CZ    1 
ATOM   7397  O  OH    . TYR C  3  104 ? 8.830   104.807 65.321  1.00 48.65  ? 104  TYR C OH    1 
ATOM   7398  N  N     . TYR C  3  105 ? 12.929  105.945 71.382  1.00 49.47  ? 105  TYR C N     1 
ATOM   7399  C  CA    . TYR C  3  105 ? 13.794  104.779 71.403  1.00 48.49  ? 105  TYR C CA    1 
ATOM   7400  C  C     . TYR C  3  105 ? 14.128  104.217 72.770  1.00 49.76  ? 105  TYR C C     1 
ATOM   7401  O  O     . TYR C  3  105 ? 15.066  103.439 72.907  1.00 52.37  ? 105  TYR C O     1 
ATOM   7402  C  CB    . TYR C  3  105 ? 15.074  105.073 70.647  1.00 46.75  ? 105  TYR C CB    1 
ATOM   7403  C  CG    . TYR C  3  105 ? 14.847  105.404 69.194  1.00 48.66  ? 105  TYR C CG    1 
ATOM   7404  C  CD1   . TYR C  3  105 ? 14.872  106.719 68.745  1.00 49.20  ? 105  TYR C CD1   1 
ATOM   7405  C  CD2   . TYR C  3  105 ? 14.633  104.395 68.256  1.00 50.06  ? 105  TYR C CD2   1 
ATOM   7406  C  CE1   . TYR C  3  105 ? 14.699  107.024 67.391  1.00 50.29  ? 105  TYR C CE1   1 
ATOM   7407  C  CE2   . TYR C  3  105 ? 14.454  104.683 66.904  1.00 49.03  ? 105  TYR C CE2   1 
ATOM   7408  C  CZ    . TYR C  3  105 ? 14.494  105.995 66.471  1.00 50.73  ? 105  TYR C CZ    1 
ATOM   7409  O  OH    . TYR C  3  105 ? 14.394  106.272 65.114  1.00 50.77  ? 105  TYR C OH    1 
ATOM   7410  N  N     . GLY C  3  106 ? 13.369  104.600 73.787  1.00 50.47  ? 106  GLY C N     1 
ATOM   7411  C  CA    . GLY C  3  106 ? 13.615  104.076 75.124  1.00 50.05  ? 106  GLY C CA    1 
ATOM   7412  C  C     . GLY C  3  106 ? 15.004  104.290 75.694  1.00 49.05  ? 106  GLY C C     1 
ATOM   7413  O  O     . GLY C  3  106 ? 15.554  103.414 76.344  1.00 48.54  ? 106  GLY C O     1 
ATOM   7414  N  N     . SER C  3  107 ? 15.573  105.460 75.451  1.00 48.87  ? 107  SER C N     1 
ATOM   7415  C  CA    . SER C  3  107 ? 16.892  105.766 75.961  1.00 48.17  ? 107  SER C CA    1 
ATOM   7416  C  C     . SER C  3  107 ? 16.774  106.021 77.442  1.00 48.16  ? 107  SER C C     1 
ATOM   7417  O  O     . SER C  3  107 ? 17.749  105.891 78.171  1.00 49.11  ? 107  SER C O     1 
ATOM   7418  C  CB    . SER C  3  107 ? 17.442  107.007 75.290  1.00 47.64  ? 107  SER C CB    1 
ATOM   7419  O  OG    . SER C  3  107 ? 17.419  106.843 73.893  1.00 50.90  ? 107  SER C OG    1 
ATOM   7420  N  N     . TYR C  3  108 ? 15.572  106.375 77.885  1.00 47.96  ? 108  TYR C N     1 
ATOM   7421  C  CA    . TYR C  3  108 ? 15.332  106.662 79.293  1.00 47.43  ? 108  TYR C CA    1 
ATOM   7422  C  C     . TYR C  3  108 ? 15.616  105.465 80.174  1.00 46.46  ? 108  TYR C C     1 
ATOM   7423  O  O     . TYR C  3  108 ? 15.688  105.594 81.401  1.00 46.09  ? 108  TYR C O     1 
ATOM   7424  C  CB    . TYR C  3  108 ? 13.898  107.148 79.509  1.00 48.69  ? 108  TYR C CB    1 
ATOM   7425  C  CG    . TYR C  3  108 ? 12.860  106.286 78.863  1.00 49.10  ? 108  TYR C CG    1 
ATOM   7426  C  CD1   . TYR C  3  108 ? 12.347  105.175 79.520  1.00 50.88  ? 108  TYR C CD1   1 
ATOM   7427  C  CD2   . TYR C  3  108 ? 12.401  106.569 77.574  1.00 49.80  ? 108  TYR C CD2   1 
ATOM   7428  C  CE1   . TYR C  3  108 ? 11.388  104.352 78.902  1.00 52.54  ? 108  TYR C CE1   1 
ATOM   7429  C  CE2   . TYR C  3  108 ? 11.454  105.765 76.949  1.00 49.70  ? 108  TYR C CE2   1 
ATOM   7430  C  CZ    . TYR C  3  108 ? 10.949  104.657 77.615  1.00 51.39  ? 108  TYR C CZ    1 
ATOM   7431  O  OH    . TYR C  3  108 ? 10.012  103.854 76.997  1.00 53.13  ? 108  TYR C OH    1 
ATOM   7432  N  N     . LEU C  3  109 ? 15.775  104.300 79.557  1.00 44.46  ? 109  LEU C N     1 
ATOM   7433  C  CA    . LEU C  3  109 ? 16.101  103.119 80.329  1.00 43.95  ? 109  LEU C CA    1 
ATOM   7434  C  C     . LEU C  3  109 ? 17.519  103.249 80.910  1.00 45.16  ? 109  LEU C C     1 
ATOM   7435  O  O     . LEU C  3  109 ? 17.942  102.469 81.754  1.00 45.18  ? 109  LEU C O     1 
ATOM   7436  C  CB    . LEU C  3  109 ? 15.956  101.881 79.471  1.00 42.31  ? 109  LEU C CB    1 
ATOM   7437  C  CG    . LEU C  3  109 ? 14.477  101.536 79.267  1.00 43.18  ? 109  LEU C CG    1 
ATOM   7438  C  CD1   . LEU C  3  109 ? 14.387  100.157 78.632  1.00 43.17  ? 109  LEU C CD1   1 
ATOM   7439  C  CD2   . LEU C  3  109 ? 13.714  101.558 80.602  1.00 41.26  ? 109  LEU C CD2   1 
ATOM   7440  N  N     . TYR C  3  110 ? 18.254  104.247 80.441  1.00 45.91  ? 110  TYR C N     1 
ATOM   7441  C  CA    . TYR C  3  110 ? 19.567  104.543 80.967  1.00 46.25  ? 110  TYR C CA    1 
ATOM   7442  C  C     . TYR C  3  110 ? 19.230  105.617 82.000  1.00 48.42  ? 110  TYR C C     1 
ATOM   7443  O  O     . TYR C  3  110 ? 19.461  106.803 81.765  1.00 49.03  ? 110  TYR C O     1 
ATOM   7444  C  CB    . TYR C  3  110 ? 20.429  105.182 79.904  1.00 46.25  ? 110  TYR C CB    1 
ATOM   7445  C  CG    . TYR C  3  110 ? 20.910  104.275 78.827  1.00 46.61  ? 110  TYR C CG    1 
ATOM   7446  C  CD1   . TYR C  3  110 ? 20.994  102.900 79.028  1.00 47.02  ? 110  TYR C CD1   1 
ATOM   7447  C  CD2   . TYR C  3  110 ? 21.395  104.806 77.627  1.00 48.01  ? 110  TYR C CD2   1 
ATOM   7448  C  CE1   . TYR C  3  110 ? 21.562  102.066 78.053  1.00 48.81  ? 110  TYR C CE1   1 
ATOM   7449  C  CE2   . TYR C  3  110 ? 21.966  103.989 76.649  1.00 49.25  ? 110  TYR C CE2   1 
ATOM   7450  C  CZ    . TYR C  3  110 ? 22.043  102.625 76.872  1.00 49.69  ? 110  TYR C CZ    1 
ATOM   7451  O  OH    . TYR C  3  110 ? 22.588  101.828 75.911  1.00 52.09  ? 110  TYR C OH    1 
ATOM   7452  N  N     . LYS C  3  111 ? 18.679  105.207 83.135  1.00 49.42  ? 111  LYS C N     1 
ATOM   7453  C  CA    . LYS C  3  111 ? 18.254  106.149 84.162  1.00 50.43  ? 111  LYS C CA    1 
ATOM   7454  C  C     . LYS C  3  111 ? 19.103  107.363 84.547  1.00 49.96  ? 111  LYS C C     1 
ATOM   7455  O  O     . LYS C  3  111 ? 18.597  108.478 84.545  1.00 49.17  ? 111  LYS C O     1 
ATOM   7456  C  CB    . LYS C  3  111 ? 17.873  105.381 85.418  1.00 53.39  ? 111  LYS C CB    1 
ATOM   7457  C  CG    . LYS C  3  111 ? 16.573  104.615 85.260  1.00 57.77  ? 111  LYS C CG    1 
ATOM   7458  C  CD    . LYS C  3  111 ? 15.945  104.286 86.609  1.00 62.60  ? 111  LYS C CD    1 
ATOM   7459  C  CE    . LYS C  3  111 ? 14.539  103.679 86.444  1.00 65.66  ? 111  LYS C CE    1 
ATOM   7460  N  NZ    . LYS C  3  111 ? 14.491  102.366 85.716  1.00 66.50  ? 111  LYS C NZ    1 
ATOM   7461  N  N     . GLU C  3  112 ? 20.373  107.177 84.883  1.00 51.25  ? 112  GLU C N     1 
ATOM   7462  C  CA    . GLU C  3  112 ? 21.213  108.318 85.276  1.00 53.01  ? 112  GLU C CA    1 
ATOM   7463  C  C     . GLU C  3  112 ? 21.431  109.314 84.124  1.00 51.47  ? 112  GLU C C     1 
ATOM   7464  O  O     . GLU C  3  112 ? 21.408  110.541 84.306  1.00 49.29  ? 112  GLU C O     1 
ATOM   7465  C  CB    . GLU C  3  112 ? 22.565  107.831 85.828  1.00 55.88  ? 112  GLU C CB    1 
ATOM   7466  C  CG    . GLU C  3  112 ? 22.445  107.038 87.131  1.00 63.82  ? 112  GLU C CG    1 
ATOM   7467  C  CD    . GLU C  3  112 ? 22.521  105.507 86.937  1.00 69.14  ? 112  GLU C CD    1 
ATOM   7468  O  OE1   . GLU C  3  112 ? 21.946  104.972 85.951  1.00 72.21  ? 112  GLU C OE1   1 
ATOM   7469  O  OE2   . GLU C  3  112 ? 23.151  104.834 87.790  1.00 71.05  ? 112  GLU C OE2   1 
ATOM   7470  N  N     . THR C  3  113 ? 21.642  108.781 82.933  1.00 50.68  ? 113  THR C N     1 
ATOM   7471  C  CA    . THR C  3  113 ? 21.831  109.629 81.778  1.00 48.77  ? 113  THR C CA    1 
ATOM   7472  C  C     . THR C  3  113 ? 20.553  110.431 81.572  1.00 47.62  ? 113  THR C C     1 
ATOM   7473  O  O     . THR C  3  113 ? 20.608  111.638 81.387  1.00 48.67  ? 113  THR C O     1 
ATOM   7474  C  CB    . THR C  3  113 ? 22.114  108.790 80.540  1.00 48.86  ? 113  THR C CB    1 
ATOM   7475  O  OG1   . THR C  3  113 ? 23.180  107.887 80.836  1.00 50.13  ? 113  THR C OG1   1 
ATOM   7476  C  CG2   . THR C  3  113 ? 22.507  109.672 79.373  1.00 47.17  ? 113  THR C CG2   1 
ATOM   7477  N  N     . TRP C  3  114 ? 19.401  109.767 81.611  1.00 44.87  ? 114  TRP C N     1 
ATOM   7478  C  CA    . TRP C  3  114 ? 18.132  110.462 81.424  1.00 44.23  ? 114  TRP C CA    1 
ATOM   7479  C  C     . TRP C  3  114 ? 17.924  111.504 82.534  1.00 44.63  ? 114  TRP C C     1 
ATOM   7480  O  O     . TRP C  3  114 ? 17.746  112.696 82.262  1.00 43.79  ? 114  TRP C O     1 
ATOM   7481  C  CB    . TRP C  3  114 ? 16.987  109.437 81.394  1.00 44.80  ? 114  TRP C CB    1 
ATOM   7482  C  CG    . TRP C  3  114 ? 15.582  109.979 81.160  1.00 43.43  ? 114  TRP C CG    1 
ATOM   7483  C  CD1   . TRP C  3  114 ? 14.608  110.179 82.103  1.00 41.19  ? 114  TRP C CD1   1 
ATOM   7484  C  CD2   . TRP C  3  114 ? 14.997  110.336 79.902  1.00 44.23  ? 114  TRP C CD2   1 
ATOM   7485  N  NE1   . TRP C  3  114 ? 13.457  110.632 81.510  1.00 39.35  ? 114  TRP C NE1   1 
ATOM   7486  C  CE2   . TRP C  3  114 ? 13.663  110.739 80.160  1.00 42.48  ? 114  TRP C CE2   1 
ATOM   7487  C  CE3   . TRP C  3  114 ? 15.466  110.350 78.577  1.00 46.32  ? 114  TRP C CE3   1 
ATOM   7488  C  CZ2   . TRP C  3  114 ? 12.791  111.153 79.141  1.00 42.17  ? 114  TRP C CZ2   1 
ATOM   7489  C  CZ3   . TRP C  3  114 ? 14.592  110.759 77.559  1.00 45.94  ? 114  TRP C CZ3   1 
ATOM   7490  C  CH2   . TRP C  3  114 ? 13.270  111.154 77.853  1.00 42.95  ? 114  TRP C CH2   1 
ATOM   7491  N  N     . ASN C  3  115 ? 17.963  111.067 83.786  1.00 44.83  ? 115  ASN C N     1 
ATOM   7492  C  CA    . ASN C  3  115 ? 17.779  111.997 84.890  1.00 44.34  ? 115  ASN C CA    1 
ATOM   7493  C  C     . ASN C  3  115 ? 18.673  113.226 84.796  1.00 44.10  ? 115  ASN C C     1 
ATOM   7494  O  O     . ASN C  3  115 ? 18.197  114.344 84.988  1.00 45.72  ? 115  ASN C O     1 
ATOM   7495  C  CB    . ASN C  3  115 ? 18.019  111.312 86.223  1.00 44.22  ? 115  ASN C CB    1 
ATOM   7496  C  CG    . ASN C  3  115 ? 16.997  110.257 86.519  1.00 46.32  ? 115  ASN C CG    1 
ATOM   7497  O  OD1   . ASN C  3  115 ? 15.814  110.409 86.206  1.00 48.76  ? 115  ASN C OD1   1 
ATOM   7498  N  ND2   . ASN C  3  115 ? 17.437  109.179 87.145  1.00 48.33  ? 115  ASN C ND2   1 
ATOM   7499  N  N     . THR C  3  116 ? 19.963  113.052 84.524  1.00 42.31  ? 116  THR C N     1 
ATOM   7500  C  CA    . THR C  3  116 ? 20.804  114.237 84.434  1.00 42.46  ? 116  THR C CA    1 
ATOM   7501  C  C     . THR C  3  116 ? 20.334  115.050 83.231  1.00 44.02  ? 116  THR C C     1 
ATOM   7502  O  O     . THR C  3  116 ? 20.451  116.280 83.195  1.00 43.92  ? 116  THR C O     1 
ATOM   7503  C  CB    . THR C  3  116 ? 22.279  113.890 84.274  1.00 40.59  ? 116  THR C CB    1 
ATOM   7504  O  OG1   . THR C  3  116 ? 22.472  113.191 83.044  1.00 43.67  ? 116  THR C OG1   1 
ATOM   7505  C  CG2   . THR C  3  116 ? 22.743  113.038 85.428  1.00 39.22  ? 116  THR C CG2   1 
ATOM   7506  N  N     . GLY C  3  117 ? 19.780  114.353 82.244  1.00 44.82  ? 117  GLY C N     1 
ATOM   7507  C  CA    . GLY C  3  117 ? 19.273  115.039 81.074  1.00 44.01  ? 117  GLY C CA    1 
ATOM   7508  C  C     . GLY C  3  117 ? 18.150  115.975 81.500  1.00 43.86  ? 117  GLY C C     1 
ATOM   7509  O  O     . GLY C  3  117 ? 18.085  117.126 81.064  1.00 43.72  ? 117  GLY C O     1 
ATOM   7510  N  N     . VAL C  3  118 ? 17.265  115.489 82.368  1.00 42.11  ? 118  VAL C N     1 
ATOM   7511  C  CA    . VAL C  3  118 ? 16.164  116.312 82.853  1.00 40.37  ? 118  VAL C CA    1 
ATOM   7512  C  C     . VAL C  3  118 ? 16.692  117.519 83.621  1.00 40.08  ? 118  VAL C C     1 
ATOM   7513  O  O     . VAL C  3  118 ? 16.086  118.590 83.578  1.00 41.55  ? 118  VAL C O     1 
ATOM   7514  C  CB    . VAL C  3  118 ? 15.227  115.535 83.792  1.00 39.88  ? 118  VAL C CB    1 
ATOM   7515  C  CG1   . VAL C  3  118 ? 13.950  116.311 83.983  1.00 37.46  ? 118  VAL C CG1   1 
ATOM   7516  C  CG2   . VAL C  3  118 ? 14.938  114.161 83.232  1.00 39.70  ? 118  VAL C CG2   1 
ATOM   7517  N  N     . ILE C  3  119 ? 17.801  117.341 84.338  1.00 37.93  ? 119  ILE C N     1 
ATOM   7518  C  CA    . ILE C  3  119 ? 18.392  118.439 85.087  1.00 37.86  ? 119  ILE C CA    1 
ATOM   7519  C  C     . ILE C  3  119 ? 18.907  119.449 84.053  1.00 38.39  ? 119  ILE C C     1 
ATOM   7520  O  O     . ILE C  3  119 ? 18.788  120.677 84.215  1.00 36.74  ? 119  ILE C O     1 
ATOM   7521  C  CB    . ILE C  3  119 ? 19.578  117.959 85.966  1.00 39.33  ? 119  ILE C CB    1 
ATOM   7522  C  CG1   . ILE C  3  119 ? 19.116  116.897 86.971  1.00 39.23  ? 119  ILE C CG1   1 
ATOM   7523  C  CG2   . ILE C  3  119 ? 20.184  119.145 86.714  1.00 37.14  ? 119  ILE C CG2   1 
ATOM   7524  C  CD1   . ILE C  3  119 ? 18.165  117.426 88.010  1.00 35.92  ? 119  ILE C CD1   1 
ATOM   7525  N  N     . LEU C  3  120 ? 19.482  118.931 82.975  1.00 37.86  ? 120  LEU C N     1 
ATOM   7526  C  CA    . LEU C  3  120 ? 19.969  119.813 81.930  1.00 38.41  ? 120  LEU C CA    1 
ATOM   7527  C  C     . LEU C  3  120 ? 18.808  120.651 81.385  1.00 38.76  ? 120  LEU C C     1 
ATOM   7528  O  O     . LEU C  3  120 ? 18.880  121.886 81.395  1.00 40.02  ? 120  LEU C O     1 
ATOM   7529  C  CB    . LEU C  3  120 ? 20.643  119.001 80.822  1.00 39.61  ? 120  LEU C CB    1 
ATOM   7530  C  CG    . LEU C  3  120 ? 22.079  118.638 81.213  1.00 40.00  ? 120  LEU C CG    1 
ATOM   7531  C  CD1   . LEU C  3  120 ? 22.526  117.382 80.523  1.00 40.80  ? 120  LEU C CD1   1 
ATOM   7532  C  CD2   . LEU C  3  120 ? 22.980  119.801 80.867  1.00 38.44  ? 120  LEU C CD2   1 
ATOM   7533  N  N     . LEU C  3  121 ? 17.730  119.999 80.938  1.00 37.04  ? 121  LEU C N     1 
ATOM   7534  C  CA    . LEU C  3  121 ? 16.573  120.732 80.416  1.00 34.79  ? 121  LEU C CA    1 
ATOM   7535  C  C     . LEU C  3  121 ? 16.131  121.791 81.416  1.00 34.40  ? 121  LEU C C     1 
ATOM   7536  O  O     . LEU C  3  121 ? 15.985  122.957 81.069  1.00 34.46  ? 121  LEU C O     1 
ATOM   7537  C  CB    . LEU C  3  121 ? 15.399  119.789 80.137  1.00 33.95  ? 121  LEU C CB    1 
ATOM   7538  C  CG    . LEU C  3  121 ? 14.090  120.486 79.726  1.00 32.09  ? 121  LEU C CG    1 
ATOM   7539  C  CD1   . LEU C  3  121 ? 14.237  121.146 78.365  1.00 29.36  ? 121  LEU C CD1   1 
ATOM   7540  C  CD2   . LEU C  3  121 ? 12.956  119.483 79.710  1.00 29.73  ? 121  LEU C CD2   1 
ATOM   7541  N  N     . LEU C  3  122 ? 15.917  121.388 82.660  1.00 33.97  ? 122  LEU C N     1 
ATOM   7542  C  CA    . LEU C  3  122 ? 15.518  122.337 83.686  1.00 36.80  ? 122  LEU C CA    1 
ATOM   7543  C  C     . LEU C  3  122 ? 16.518  123.503 83.851  1.00 40.30  ? 122  LEU C C     1 
ATOM   7544  O  O     . LEU C  3  122 ? 16.121  124.683 83.982  1.00 41.37  ? 122  LEU C O     1 
ATOM   7545  C  CB    . LEU C  3  122 ? 15.338  121.609 85.015  1.00 33.93  ? 122  LEU C CB    1 
ATOM   7546  C  CG    . LEU C  3  122 ? 14.008  120.867 85.107  1.00 32.10  ? 122  LEU C CG    1 
ATOM   7547  C  CD1   . LEU C  3  122 ? 13.930  120.096 86.389  1.00 29.30  ? 122  LEU C CD1   1 
ATOM   7548  C  CD2   . LEU C  3  122 ? 12.880  121.871 85.034  1.00 30.46  ? 122  LEU C CD2   1 
ATOM   7549  N  N     . THR C  3  123 ? 17.812  123.192 83.843  1.00 40.23  ? 123  THR C N     1 
ATOM   7550  C  CA    . THR C  3  123 ? 18.790  124.246 84.000  1.00 40.69  ? 123  THR C CA    1 
ATOM   7551  C  C     . THR C  3  123 ? 18.774  125.114 82.765  1.00 41.87  ? 123  THR C C     1 
ATOM   7552  O  O     . THR C  3  123 ? 18.836  126.341 82.854  1.00 43.88  ? 123  THR C O     1 
ATOM   7553  C  CB    . THR C  3  123 ? 20.177  123.673 84.204  1.00 40.87  ? 123  THR C CB    1 
ATOM   7554  O  OG1   . THR C  3  123 ? 20.160  122.862 85.377  1.00 44.82  ? 123  THR C OG1   1 
ATOM   7555  C  CG2   . THR C  3  123 ? 21.209  124.775 84.392  1.00 39.14  ? 123  THR C CG2   1 
ATOM   7556  N  N     . LEU C  3  124 ? 18.682  124.486 81.601  1.00 41.21  ? 124  LEU C N     1 
ATOM   7557  C  CA    . LEU C  3  124 ? 18.663  125.267 80.380  1.00 41.37  ? 124  LEU C CA    1 
ATOM   7558  C  C     . LEU C  3  124 ? 17.524  126.279 80.476  1.00 41.66  ? 124  LEU C C     1 
ATOM   7559  O  O     . LEU C  3  124 ? 17.692  127.473 80.175  1.00 38.68  ? 124  LEU C O     1 
ATOM   7560  C  CB    . LEU C  3  124 ? 18.471  124.364 79.166  1.00 39.73  ? 124  LEU C CB    1 
ATOM   7561  C  CG    . LEU C  3  124 ? 18.215  125.171 77.895  1.00 39.85  ? 124  LEU C CG    1 
ATOM   7562  C  CD1   . LEU C  3  124 ? 19.251  126.284 77.734  1.00 40.64  ? 124  LEU C CD1   1 
ATOM   7563  C  CD2   . LEU C  3  124 ? 18.258  124.230 76.731  1.00 42.79  ? 124  LEU C CD2   1 
ATOM   7564  N  N     . MET C  3  125 ? 16.373  125.786 80.925  1.00 42.27  ? 125  MET C N     1 
ATOM   7565  C  CA    . MET C  3  125 ? 15.205  126.623 81.071  1.00 43.62  ? 125  MET C CA    1 
ATOM   7566  C  C     . MET C  3  125 ? 15.485  127.822 81.969  1.00 42.82  ? 125  MET C C     1 
ATOM   7567  O  O     . MET C  3  125 ? 15.328  128.957 81.534  1.00 44.33  ? 125  MET C O     1 
ATOM   7568  C  CB    . MET C  3  125 ? 14.026  125.809 81.598  1.00 45.80  ? 125  MET C CB    1 
ATOM   7569  C  CG    . MET C  3  125 ? 13.393  124.911 80.536  1.00 49.25  ? 125  MET C CG    1 
ATOM   7570  S  SD    . MET C  3  125 ? 11.767  124.214 81.026  1.00 55.39  ? 125  MET C SD    1 
ATOM   7571  C  CE    . MET C  3  125 ? 11.496  122.965 79.788  1.00 51.84  ? 125  MET C CE    1 
ATOM   7572  N  N     . ALA C  3  126 ? 15.916  127.594 83.204  1.00 40.78  ? 126  ALA C N     1 
ATOM   7573  C  CA    . ALA C  3  126 ? 16.202  128.719 84.091  1.00 38.83  ? 126  ALA C CA    1 
ATOM   7574  C  C     . ALA C  3  126 ? 17.211  129.666 83.469  1.00 38.42  ? 126  ALA C C     1 
ATOM   7575  O  O     . ALA C  3  126 ? 17.039  130.893 83.515  1.00 37.74  ? 126  ALA C O     1 
ATOM   7576  C  CB    . ALA C  3  126 ? 16.715  128.233 85.403  1.00 37.14  ? 126  ALA C CB    1 
ATOM   7577  N  N     . THR C  3  127 ? 18.256  129.097 82.874  1.00 39.13  ? 127  THR C N     1 
ATOM   7578  C  CA    . THR C  3  127 ? 19.301  129.894 82.242  1.00 40.35  ? 127  THR C CA    1 
ATOM   7579  C  C     . THR C  3  127 ? 18.733  130.830 81.188  1.00 40.99  ? 127  THR C C     1 
ATOM   7580  O  O     . THR C  3  127 ? 18.954  132.037 81.240  1.00 42.91  ? 127  THR C O     1 
ATOM   7581  C  CB    . THR C  3  127 ? 20.337  129.016 81.557  1.00 41.25  ? 127  THR C CB    1 
ATOM   7582  O  OG1   . THR C  3  127 ? 20.890  128.106 82.512  1.00 40.06  ? 127  THR C OG1   1 
ATOM   7583  C  CG2   . THR C  3  127 ? 21.446  129.885 80.943  1.00 39.65  ? 127  THR C CG2   1 
ATOM   7584  N  N     . ALA C  3  128 ? 18.003  130.261 80.233  1.00 40.60  ? 128  ALA C N     1 
ATOM   7585  C  CA    . ALA C  3  128 ? 17.395  131.026 79.149  1.00 39.63  ? 128  ALA C CA    1 
ATOM   7586  C  C     . ALA C  3  128 ? 16.440  132.075 79.668  1.00 40.13  ? 128  ALA C C     1 
ATOM   7587  O  O     . ALA C  3  128 ? 16.195  133.072 79.011  1.00 41.58  ? 128  ALA C O     1 
ATOM   7588  C  CB    . ALA C  3  128 ? 16.654  130.092 78.205  1.00 38.44  ? 128  ALA C CB    1 
ATOM   7589  N  N     . PHE C  3  129 ? 15.873  131.837 80.839  1.00 41.94  ? 129  PHE C N     1 
ATOM   7590  C  CA    . PHE C  3  129 ? 14.945  132.788 81.412  1.00 42.90  ? 129  PHE C CA    1 
ATOM   7591  C  C     . PHE C  3  129 ? 15.707  134.019 81.888  1.00 43.06  ? 129  PHE C C     1 
ATOM   7592  O  O     . PHE C  3  129 ? 15.522  135.113 81.358  1.00 41.30  ? 129  PHE C O     1 
ATOM   7593  C  CB    . PHE C  3  129 ? 14.167  132.138 82.558  1.00 43.79  ? 129  PHE C CB    1 
ATOM   7594  C  CG    . PHE C  3  129 ? 13.597  133.121 83.556  1.00 47.46  ? 129  PHE C CG    1 
ATOM   7595  C  CD1   . PHE C  3  129 ? 12.771  134.158 83.149  1.00 46.64  ? 129  PHE C CD1   1 
ATOM   7596  C  CD2   . PHE C  3  129 ? 13.900  133.002 84.921  1.00 48.91  ? 129  PHE C CD2   1 
ATOM   7597  C  CE1   . PHE C  3  129 ? 12.258  135.064 84.088  1.00 48.36  ? 129  PHE C CE1   1 
ATOM   7598  C  CE2   . PHE C  3  129 ? 13.390  133.903 85.860  1.00 47.77  ? 129  PHE C CE2   1 
ATOM   7599  C  CZ    . PHE C  3  129 ? 12.571  134.932 85.443  1.00 47.14  ? 129  PHE C CZ    1 
ATOM   7600  N  N     . VAL C  3  130 ? 16.579  133.850 82.871  1.00 43.51  ? 130  VAL C N     1 
ATOM   7601  C  CA    . VAL C  3  130 ? 17.301  135.008 83.370  1.00 45.10  ? 130  VAL C CA    1 
ATOM   7602  C  C     . VAL C  3  130 ? 17.995  135.758 82.243  1.00 44.28  ? 130  VAL C C     1 
ATOM   7603  O  O     . VAL C  3  130 ? 18.075  136.989 82.252  1.00 42.72  ? 130  VAL C O     1 
ATOM   7604  C  CB    . VAL C  3  130 ? 18.320  134.602 84.431  1.00 45.60  ? 130  VAL C CB    1 
ATOM   7605  C  CG1   . VAL C  3  130 ? 17.584  133.969 85.597  1.00 46.64  ? 130  VAL C CG1   1 
ATOM   7606  C  CG2   . VAL C  3  130 ? 19.343  133.651 83.839  1.00 44.08  ? 130  VAL C CG2   1 
ATOM   7607  N  N     . GLY C  3  131 ? 18.470  135.006 81.260  1.00 43.78  ? 131  GLY C N     1 
ATOM   7608  C  CA    . GLY C  3  131 ? 19.156  135.621 80.147  1.00 45.11  ? 131  GLY C CA    1 
ATOM   7609  C  C     . GLY C  3  131 ? 18.281  136.609 79.415  1.00 46.45  ? 131  GLY C C     1 
ATOM   7610  O  O     . GLY C  3  131 ? 18.685  137.735 79.127  1.00 47.95  ? 131  GLY C O     1 
ATOM   7611  N  N     . TYR C  3  132 ? 17.063  136.184 79.122  1.00 47.53  ? 132  TYR C N     1 
ATOM   7612  C  CA    . TYR C  3  132 ? 16.114  137.016 78.403  1.00 47.59  ? 132  TYR C CA    1 
ATOM   7613  C  C     . TYR C  3  132 ? 15.759  138.287 79.167  1.00 46.63  ? 132  TYR C C     1 
ATOM   7614  O  O     . TYR C  3  132 ? 15.385  139.278 78.562  1.00 48.18  ? 132  TYR C O     1 
ATOM   7615  C  CB    . TYR C  3  132 ? 14.856  136.201 78.110  1.00 49.00  ? 132  TYR C CB    1 
ATOM   7616  C  CG    . TYR C  3  132 ? 13.801  136.904 77.286  1.00 51.65  ? 132  TYR C CG    1 
ATOM   7617  C  CD1   . TYR C  3  132 ? 14.098  137.440 76.032  1.00 52.63  ? 132  TYR C CD1   1 
ATOM   7618  C  CD2   . TYR C  3  132 ? 12.482  136.963 77.723  1.00 53.92  ? 132  TYR C CD2   1 
ATOM   7619  C  CE1   . TYR C  3  132 ? 13.102  138.012 75.229  1.00 53.12  ? 132  TYR C CE1   1 
ATOM   7620  C  CE2   . TYR C  3  132 ? 11.476  137.528 76.922  1.00 56.02  ? 132  TYR C CE2   1 
ATOM   7621  C  CZ    . TYR C  3  132 ? 11.796  138.046 75.680  1.00 54.80  ? 132  TYR C CZ    1 
ATOM   7622  O  OH    . TYR C  3  132 ? 10.787  138.557 74.897  1.00 57.37  ? 132  TYR C OH    1 
ATOM   7623  N  N     . VAL C  3  133 ? 15.891  138.267 80.488  1.00 45.25  ? 133  VAL C N     1 
ATOM   7624  C  CA    . VAL C  3  133 ? 15.562  139.432 81.311  1.00 44.55  ? 133  VAL C CA    1 
ATOM   7625  C  C     . VAL C  3  133 ? 16.631  140.528 81.225  1.00 45.18  ? 133  VAL C C     1 
ATOM   7626  O  O     . VAL C  3  133 ? 16.416  141.666 81.664  1.00 43.85  ? 133  VAL C O     1 
ATOM   7627  C  CB    . VAL C  3  133 ? 15.412  139.028 82.794  1.00 43.88  ? 133  VAL C CB    1 
ATOM   7628  C  CG1   . VAL C  3  133 ? 15.006  140.201 83.607  1.00 43.35  ? 133  VAL C CG1   1 
ATOM   7629  C  CG2   . VAL C  3  133 ? 14.376  137.944 82.942  1.00 46.78  ? 133  VAL C CG2   1 
ATOM   7630  N  N     . LEU C  3  134 ? 17.775  140.197 80.632  1.00 45.36  ? 134  LEU C N     1 
ATOM   7631  C  CA    . LEU C  3  134 ? 18.875  141.151 80.564  1.00 43.78  ? 134  LEU C CA    1 
ATOM   7632  C  C     . LEU C  3  134 ? 18.738  142.346 79.624  1.00 44.36  ? 134  LEU C C     1 
ATOM   7633  O  O     . LEU C  3  134 ? 19.264  143.414 79.924  1.00 45.13  ? 134  LEU C O     1 
ATOM   7634  C  CB    . LEU C  3  134 ? 20.197  140.414 80.304  1.00 39.75  ? 134  LEU C CB    1 
ATOM   7635  C  CG    . LEU C  3  134 ? 20.565  139.314 81.320  1.00 37.65  ? 134  LEU C CG    1 
ATOM   7636  C  CD1   . LEU C  3  134 ? 21.959  138.813 81.022  1.00 40.64  ? 134  LEU C CD1   1 
ATOM   7637  C  CD2   . LEU C  3  134 ? 20.514  139.826 82.735  1.00 34.03  ? 134  LEU C CD2   1 
ATOM   7638  N  N     . PRO C  3  135 ? 18.029  142.208 78.487  1.00 43.81  ? 135  PRO C N     1 
ATOM   7639  C  CA    . PRO C  3  135 ? 17.981  143.432 77.675  1.00 41.92  ? 135  PRO C CA    1 
ATOM   7640  C  C     . PRO C  3  135 ? 17.065  144.434 78.325  1.00 41.30  ? 135  PRO C C     1 
ATOM   7641  O  O     . PRO C  3  135 ? 17.031  145.608 77.970  1.00 38.95  ? 135  PRO C O     1 
ATOM   7642  C  CB    . PRO C  3  135 ? 17.471  142.942 76.333  1.00 42.39  ? 135  PRO C CB    1 
ATOM   7643  C  CG    . PRO C  3  135 ? 17.993  141.539 76.270  1.00 44.27  ? 135  PRO C CG    1 
ATOM   7644  C  CD    . PRO C  3  135 ? 17.676  141.033 77.675  1.00 44.30  ? 135  PRO C CD    1 
ATOM   7645  N  N     . TRP C  3  136 ? 16.310  143.938 79.288  1.00 42.63  ? 136  TRP C N     1 
ATOM   7646  C  CA    . TRP C  3  136 ? 15.404  144.773 80.053  1.00 43.92  ? 136  TRP C CA    1 
ATOM   7647  C  C     . TRP C  3  136 ? 14.363  145.527 79.218  1.00 45.03  ? 136  TRP C C     1 
ATOM   7648  O  O     . TRP C  3  136 ? 14.203  146.745 79.338  1.00 45.05  ? 136  TRP C O     1 
ATOM   7649  C  CB    . TRP C  3  136 ? 16.224  145.747 80.885  1.00 41.47  ? 136  TRP C CB    1 
ATOM   7650  C  CG    . TRP C  3  136 ? 15.584  146.159 82.149  1.00 39.93  ? 136  TRP C CG    1 
ATOM   7651  C  CD1   . TRP C  3  136 ? 15.191  147.415 82.487  1.00 40.33  ? 136  TRP C CD1   1 
ATOM   7652  C  CD2   . TRP C  3  136 ? 15.326  145.335 83.290  1.00 39.74  ? 136  TRP C CD2   1 
ATOM   7653  N  NE1   . TRP C  3  136 ? 14.707  147.437 83.776  1.00 40.67  ? 136  TRP C NE1   1 
ATOM   7654  C  CE2   . TRP C  3  136 ? 14.776  146.173 84.296  1.00 39.90  ? 136  TRP C CE2   1 
ATOM   7655  C  CE3   . TRP C  3  136 ? 15.504  143.976 83.566  1.00 38.65  ? 136  TRP C CE3   1 
ATOM   7656  C  CZ2   . TRP C  3  136 ? 14.402  145.696 85.559  1.00 36.24  ? 136  TRP C CZ2   1 
ATOM   7657  C  CZ3   . TRP C  3  136 ? 15.129  143.498 84.828  1.00 37.92  ? 136  TRP C CZ3   1 
ATOM   7658  C  CH2   . TRP C  3  136 ? 14.585  144.360 85.805  1.00 37.79  ? 136  TRP C CH2   1 
ATOM   7659  N  N     . GLY C  3  137 ? 13.658  144.786 78.371  1.00 45.83  ? 137  GLY C N     1 
ATOM   7660  C  CA    . GLY C  3  137 ? 12.604  145.375 77.571  1.00 46.43  ? 137  GLY C CA    1 
ATOM   7661  C  C     . GLY C  3  137 ? 11.302  145.041 78.287  1.00 46.48  ? 137  GLY C C     1 
ATOM   7662  O  O     . GLY C  3  137 ? 11.331  144.471 79.383  1.00 45.51  ? 137  GLY C O     1 
ATOM   7663  N  N     . GLN C  3  138 ? 10.165  145.381 77.686  1.00 45.44  ? 138  GLN C N     1 
ATOM   7664  C  CA    . GLN C  3  138 ? 8.878   145.097 78.300  1.00 44.52  ? 138  GLN C CA    1 
ATOM   7665  C  C     . GLN C  3  138 ? 8.698   143.618 78.646  1.00 44.41  ? 138  GLN C C     1 
ATOM   7666  O  O     . GLN C  3  138 ? 8.277   143.266 79.752  1.00 42.17  ? 138  GLN C O     1 
ATOM   7667  C  CB    . GLN C  3  138 ? 7.768   145.556 77.373  1.00 44.55  ? 138  GLN C CB    1 
ATOM   7668  C  CG    . GLN C  3  138 ? 7.401   146.979 77.578  1.00 45.75  ? 138  GLN C CG    1 
ATOM   7669  C  CD    . GLN C  3  138 ? 6.759   147.194 78.917  1.00 47.99  ? 138  GLN C CD    1 
ATOM   7670  O  OE1   . GLN C  3  138 ? 7.368   146.968 79.964  1.00 48.20  ? 138  GLN C OE1   1 
ATOM   7671  N  NE2   . GLN C  3  138 ? 5.510   147.630 78.896  1.00 49.58  ? 138  GLN C NE2   1 
ATOM   7672  N  N     . MET C  3  139 ? 9.015   142.751 77.693  1.00 45.05  ? 139  MET C N     1 
ATOM   7673  C  CA    . MET C  3  139 ? 8.902   141.322 77.925  1.00 47.87  ? 139  MET C CA    1 
ATOM   7674  C  C     . MET C  3  139 ? 9.831   140.880 79.056  1.00 48.64  ? 139  MET C C     1 
ATOM   7675  O  O     . MET C  3  139 ? 9.400   140.188 79.982  1.00 49.00  ? 139  MET C O     1 
ATOM   7676  C  CB    . MET C  3  139 ? 9.198   140.548 76.637  1.00 50.43  ? 139  MET C CB    1 
ATOM   7677  C  CG    . MET C  3  139 ? 8.140   140.769 75.567  1.00 52.11  ? 139  MET C CG    1 
ATOM   7678  S  SD    . MET C  3  139 ? 6.491   140.735 76.339  1.00 60.28  ? 139  MET C SD    1 
ATOM   7679  C  CE    . MET C  3  139 ? 5.433   139.891 74.994  1.00 52.95  ? 139  MET C CE    1 
ATOM   7680  N  N     . SER C  3  140 ? 11.097  141.295 78.988  1.00 49.57  ? 140  SER C N     1 
ATOM   7681  C  CA    . SER C  3  140 ? 12.082  140.970 80.024  1.00 48.82  ? 140  SER C CA    1 
ATOM   7682  C  C     . SER C  3  140 ? 11.489  141.244 81.410  1.00 49.22  ? 140  SER C C     1 
ATOM   7683  O  O     . SER C  3  140 ? 11.390  140.354 82.261  1.00 50.05  ? 140  SER C O     1 
ATOM   7684  C  CB    . SER C  3  140 ? 13.337  141.840 79.877  1.00 47.81  ? 140  SER C CB    1 
ATOM   7685  O  OG    . SER C  3  140 ? 13.953  141.708 78.612  1.00 49.33  ? 140  SER C OG    1 
ATOM   7686  N  N     . PHE C  3  141 ? 11.079  142.488 81.624  1.00 48.27  ? 141  PHE C N     1 
ATOM   7687  C  CA    . PHE C  3  141 ? 10.556  142.887 82.913  1.00 46.56  ? 141  PHE C CA    1 
ATOM   7688  C  C     . PHE C  3  141 ? 9.398   142.069 83.368  1.00 46.27  ? 141  PHE C C     1 
ATOM   7689  O  O     . PHE C  3  141 ? 9.421   141.509 84.450  1.00 46.09  ? 141  PHE C O     1 
ATOM   7690  C  CB    . PHE C  3  141 ? 10.130  144.346 82.903  1.00 46.23  ? 141  PHE C CB    1 
ATOM   7691  C  CG    . PHE C  3  141 ? 9.791   144.879 84.264  1.00 46.80  ? 141  PHE C CG    1 
ATOM   7692  C  CD1   . PHE C  3  141 ? 10.774  145.430 85.079  1.00 44.92  ? 141  PHE C CD1   1 
ATOM   7693  C  CD2   . PHE C  3  141 ? 8.491   144.809 84.749  1.00 47.53  ? 141  PHE C CD2   1 
ATOM   7694  C  CE1   . PHE C  3  141 ? 10.467  145.902 86.359  1.00 42.81  ? 141  PHE C CE1   1 
ATOM   7695  C  CE2   . PHE C  3  141 ? 8.187   145.285 86.034  1.00 48.68  ? 141  PHE C CE2   1 
ATOM   7696  C  CZ    . PHE C  3  141 ? 9.188   145.832 86.833  1.00 44.21  ? 141  PHE C CZ    1 
ATOM   7697  N  N     . TRP C  3  142 ? 8.373   141.993 82.540  1.00 47.97  ? 142  TRP C N     1 
ATOM   7698  C  CA    . TRP C  3  142 ? 7.189   141.266 82.947  1.00 48.88  ? 142  TRP C CA    1 
ATOM   7699  C  C     . TRP C  3  142 ? 7.398   139.766 83.005  1.00 48.17  ? 142  TRP C C     1 
ATOM   7700  O  O     . TRP C  3  142 ? 6.755   139.074 83.792  1.00 48.08  ? 142  TRP C O     1 
ATOM   7701  C  CB    . TRP C  3  142 ? 6.006   141.687 82.071  1.00 49.36  ? 142  TRP C CB    1 
ATOM   7702  C  CG    . TRP C  3  142 ? 5.699   143.142 82.317  1.00 52.39  ? 142  TRP C CG    1 
ATOM   7703  C  CD1   . TRP C  3  142 ? 6.008   144.199 81.511  1.00 52.52  ? 142  TRP C CD1   1 
ATOM   7704  C  CD2   . TRP C  3  142 ? 5.170   143.707 83.526  1.00 53.44  ? 142  TRP C CD2   1 
ATOM   7705  N  NE1   . TRP C  3  142 ? 5.715   145.383 82.144  1.00 53.16  ? 142  TRP C NE1   1 
ATOM   7706  C  CE2   . TRP C  3  142 ? 5.199   145.108 83.382  1.00 53.32  ? 142  TRP C CE2   1 
ATOM   7707  C  CE3   . TRP C  3  142 ? 4.681   143.160 84.718  1.00 54.97  ? 142  TRP C CE3   1 
ATOM   7708  C  CZ2   . TRP C  3  142 ? 4.755   145.974 84.387  1.00 55.29  ? 142  TRP C CZ2   1 
ATOM   7709  C  CZ3   . TRP C  3  142 ? 4.238   144.025 85.720  1.00 56.04  ? 142  TRP C CZ3   1 
ATOM   7710  C  CH2   . TRP C  3  142 ? 4.279   145.414 85.546  1.00 55.28  ? 142  TRP C CH2   1 
ATOM   7711  N  N     . GLY C  3  143 ? 8.321   139.257 82.200  1.00 47.37  ? 143  GLY C N     1 
ATOM   7712  C  CA    . GLY C  3  143 ? 8.591   137.838 82.266  1.00 46.05  ? 143  GLY C CA    1 
ATOM   7713  C  C     . GLY C  3  143 ? 9.177   137.597 83.646  1.00 46.17  ? 143  GLY C C     1 
ATOM   7714  O  O     . GLY C  3  143 ? 8.712   136.732 84.397  1.00 44.21  ? 143  GLY C O     1 
ATOM   7715  N  N     . ALA C  3  144 ? 10.202  138.391 83.974  1.00 46.74  ? 144  ALA C N     1 
ATOM   7716  C  CA    . ALA C  3  144 ? 10.874  138.324 85.267  1.00 46.88  ? 144  ALA C CA    1 
ATOM   7717  C  C     . ALA C  3  144 ? 9.822   138.379 86.374  1.00 48.54  ? 144  ALA C C     1 
ATOM   7718  O  O     . ALA C  3  144 ? 9.786   137.528 87.258  1.00 51.36  ? 144  ALA C O     1 
ATOM   7719  C  CB    . ALA C  3  144 ? 11.841  139.477 85.413  1.00 43.13  ? 144  ALA C CB    1 
ATOM   7720  N  N     . THR C  3  145 ? 8.952   139.377 86.318  1.00 48.84  ? 145  THR C N     1 
ATOM   7721  C  CA    . THR C  3  145 ? 7.898   139.527 87.317  1.00 48.45  ? 145  THR C CA    1 
ATOM   7722  C  C     . THR C  3  145 ? 7.053   138.257 87.493  1.00 47.47  ? 145  THR C C     1 
ATOM   7723  O  O     . THR C  3  145 ? 6.812   137.819 88.613  1.00 48.30  ? 145  THR C O     1 
ATOM   7724  C  CB    . THR C  3  145 ? 6.938   140.695 86.943  1.00 48.51  ? 145  THR C CB    1 
ATOM   7725  O  OG1   . THR C  3  145 ? 7.688   141.905 86.778  1.00 49.63  ? 145  THR C OG1   1 
ATOM   7726  C  CG2   . THR C  3  145 ? 5.897   140.905 88.029  1.00 47.17  ? 145  THR C CG2   1 
ATOM   7727  N  N     . VAL C  3  146 ? 6.623   137.661 86.386  1.00 45.81  ? 146  VAL C N     1 
ATOM   7728  C  CA    . VAL C  3  146 ? 5.759   136.485 86.424  1.00 43.31  ? 146  VAL C CA    1 
ATOM   7729  C  C     . VAL C  3  146 ? 6.417   135.195 86.849  1.00 44.18  ? 146  VAL C C     1 
ATOM   7730  O  O     . VAL C  3  146 ? 5.926   134.492 87.729  1.00 43.75  ? 146  VAL C O     1 
ATOM   7731  C  CB    . VAL C  3  146 ? 5.102   136.258 85.053  1.00 40.23  ? 146  VAL C CB    1 
ATOM   7732  C  CG1   . VAL C  3  146 ? 4.233   135.035 85.073  1.00 38.95  ? 146  VAL C CG1   1 
ATOM   7733  C  CG2   . VAL C  3  146 ? 4.273   137.445 84.701  1.00 38.61  ? 146  VAL C CG2   1 
ATOM   7734  N  N     . ILE C  3  147 ? 7.530   134.874 86.215  1.00 45.49  ? 147  ILE C N     1 
ATOM   7735  C  CA    . ILE C  3  147 ? 8.205   133.633 86.521  1.00 46.74  ? 147  ILE C CA    1 
ATOM   7736  C  C     . ILE C  3  147 ? 8.675   133.565 87.960  1.00 48.20  ? 147  ILE C C     1 
ATOM   7737  O  O     . ILE C  3  147 ? 8.373   132.593 88.652  1.00 49.26  ? 147  ILE C O     1 
ATOM   7738  C  CB    . ILE C  3  147 ? 9.349   133.401 85.531  1.00 47.01  ? 147  ILE C CB    1 
ATOM   7739  C  CG1   . ILE C  3  147 ? 8.746   133.083 84.160  1.00 47.25  ? 147  ILE C CG1   1 
ATOM   7740  C  CG2   . ILE C  3  147 ? 10.247  132.270 85.997  1.00 47.10  ? 147  ILE C CG2   1 
ATOM   7741  C  CD1   . ILE C  3  147 ? 9.737   133.078 83.051  1.00 49.27  ? 147  ILE C CD1   1 
ATOM   7742  N  N     . THR C  3  148 ? 9.389   134.585 88.431  1.00 48.99  ? 148  THR C N     1 
ATOM   7743  C  CA    . THR C  3  148 ? 9.843   134.563 89.816  1.00 51.52  ? 148  THR C CA    1 
ATOM   7744  C  C     . THR C  3  148 ? 8.615   134.445 90.708  1.00 52.89  ? 148  THR C C     1 
ATOM   7745  O  O     . THR C  3  148 ? 8.616   133.690 91.675  1.00 55.64  ? 148  THR C O     1 
ATOM   7746  C  CB    . THR C  3  148 ? 10.650  135.836 90.221  1.00 51.68  ? 148  THR C CB    1 
ATOM   7747  O  OG1   . THR C  3  148 ? 9.975   137.004 89.754  1.00 55.29  ? 148  THR C OG1   1 
ATOM   7748  C  CG2   . THR C  3  148 ? 12.041  135.814 89.626  1.00 52.42  ? 148  THR C CG2   1 
ATOM   7749  N  N     . ASN C  3  149 ? 7.554   135.167 90.368  1.00 53.45  ? 149  ASN C N     1 
ATOM   7750  C  CA    . ASN C  3  149 ? 6.328   135.124 91.161  1.00 54.56  ? 149  ASN C CA    1 
ATOM   7751  C  C     . ASN C  3  149 ? 5.733   133.728 91.273  1.00 54.26  ? 149  ASN C C     1 
ATOM   7752  O  O     . ASN C  3  149 ? 4.970   133.433 92.189  1.00 53.33  ? 149  ASN C O     1 
ATOM   7753  C  CB    . ASN C  3  149 ? 5.293   136.081 90.577  1.00 56.99  ? 149  ASN C CB    1 
ATOM   7754  C  CG    . ASN C  3  149 ? 5.104   137.311 91.430  1.00 57.78  ? 149  ASN C CG    1 
ATOM   7755  O  OD1   . ASN C  3  149 ? 4.814   138.394 90.924  1.00 59.36  ? 149  ASN C OD1   1 
ATOM   7756  N  ND2   . ASN C  3  149 ? 5.255   137.149 92.739  1.00 59.04  ? 149  ASN C ND2   1 
ATOM   7757  N  N     . LEU C  3  150 ? 6.076   132.866 90.332  1.00 54.49  ? 150  LEU C N     1 
ATOM   7758  C  CA    . LEU C  3  150 ? 5.568   131.513 90.384  1.00 56.25  ? 150  LEU C CA    1 
ATOM   7759  C  C     . LEU C  3  150 ? 5.828   130.896 91.752  1.00 56.45  ? 150  LEU C C     1 
ATOM   7760  O  O     . LEU C  3  150 ? 5.020   130.118 92.242  1.00 57.76  ? 150  LEU C O     1 
ATOM   7761  C  CB    . LEU C  3  150 ? 6.236   130.643 89.319  1.00 55.77  ? 150  LEU C CB    1 
ATOM   7762  C  CG    . LEU C  3  150 ? 5.832   130.858 87.864  1.00 56.26  ? 150  LEU C CG    1 
ATOM   7763  C  CD1   . LEU C  3  150 ? 6.740   130.015 87.005  1.00 55.80  ? 150  LEU C CD1   1 
ATOM   7764  C  CD2   . LEU C  3  150 ? 4.370   130.478 87.634  1.00 54.13  ? 150  LEU C CD2   1 
ATOM   7765  N  N     . PHE C  3  151 ? 6.944   131.246 92.379  1.00 55.75  ? 151  PHE C N     1 
ATOM   7766  C  CA    . PHE C  3  151 ? 7.260   130.651 93.666  1.00 55.74  ? 151  PHE C CA    1 
ATOM   7767  C  C     . PHE C  3  151 ? 6.383   131.079 94.809  1.00 56.34  ? 151  PHE C C     1 
ATOM   7768  O  O     . PHE C  3  151 ? 6.310   130.394 95.832  1.00 55.64  ? 151  PHE C O     1 
ATOM   7769  C  CB    . PHE C  3  151 ? 8.726   130.876 93.981  1.00 55.16  ? 151  PHE C CB    1 
ATOM   7770  C  CG    . PHE C  3  151 ? 9.612   130.248 92.981  1.00 57.68  ? 151  PHE C CG    1 
ATOM   7771  C  CD1   . PHE C  3  151 ? 9.824   130.861 91.749  1.00 58.80  ? 151  PHE C CD1   1 
ATOM   7772  C  CD2   . PHE C  3  151 ? 10.113  128.967 93.189  1.00 57.63  ? 151  PHE C CD2   1 
ATOM   7773  C  CE1   . PHE C  3  151 ? 10.521  130.194 90.724  1.00 60.60  ? 151  PHE C CE1   1 
ATOM   7774  C  CE2   . PHE C  3  151 ? 10.807  128.291 92.178  1.00 57.69  ? 151  PHE C CE2   1 
ATOM   7775  C  CZ    . PHE C  3  151 ? 11.011  128.901 90.944  1.00 58.68  ? 151  PHE C CZ    1 
ATOM   7776  N  N     . SER C  3  152 ? 5.695   132.199 94.635  1.00 56.89  ? 152  SER C N     1 
ATOM   7777  C  CA    . SER C  3  152 ? 4.813   132.678 95.680  1.00 57.52  ? 152  SER C CA    1 
ATOM   7778  C  C     . SER C  3  152 ? 3.771   131.607 95.955  1.00 59.20  ? 152  SER C C     1 
ATOM   7779  O  O     . SER C  3  152 ? 3.138   131.623 97.001  1.00 61.71  ? 152  SER C O     1 
ATOM   7780  C  CB    . SER C  3  152 ? 4.108   133.949 95.244  1.00 56.24  ? 152  SER C CB    1 
ATOM   7781  O  OG    . SER C  3  152 ? 3.312   133.696 94.106  1.00 56.71  ? 152  SER C OG    1 
ATOM   7782  N  N     . ALA C  3  153 ? 3.593   130.673 95.021  1.00 59.19  ? 153  ALA C N     1 
ATOM   7783  C  CA    . ALA C  3  153 ? 2.602   129.608 95.191  1.00 58.75  ? 153  ALA C CA    1 
ATOM   7784  C  C     . ALA C  3  153 ? 2.966   128.608 96.295  1.00 59.16  ? 153  ALA C C     1 
ATOM   7785  O  O     . ALA C  3  153 ? 2.103   127.871 96.778  1.00 57.97  ? 153  ALA C O     1 
ATOM   7786  C  CB    . ALA C  3  153 ? 2.375   128.875 93.861  1.00 57.42  ? 153  ALA C CB    1 
ATOM   7787  N  N     . ILE C  3  154 ? 4.240   128.575 96.680  1.00 60.56  ? 154  ILE C N     1 
ATOM   7788  C  CA    . ILE C  3  154 ? 4.691   127.677 97.741  1.00 62.65  ? 154  ILE C CA    1 
ATOM   7789  C  C     . ILE C  3  154 ? 4.329   128.375 99.027  1.00 65.92  ? 154  ILE C C     1 
ATOM   7790  O  O     . ILE C  3  154 ? 4.676   129.539 99.208  1.00 67.20  ? 154  ILE C O     1 
ATOM   7791  C  CB    . ILE C  3  154 ? 6.198   127.510 97.745  1.00 61.01  ? 154  ILE C CB    1 
ATOM   7792  C  CG1   . ILE C  3  154 ? 6.665   127.055 96.374  1.00 59.11  ? 154  ILE C CG1   1 
ATOM   7793  C  CG2   . ILE C  3  154 ? 6.599   126.540 98.831  1.00 58.56  ? 154  ILE C CG2   1 
ATOM   7794  C  CD1   . ILE C  3  154 ? 8.135   127.143 96.225  1.00 59.83  ? 154  ILE C CD1   1 
ATOM   7795  N  N     . PRO C  3  155 ? 3.636   127.685 99.943  1.00 68.28  ? 155  PRO C N     1 
ATOM   7796  C  CA    . PRO C  3  155 ? 3.238   128.295 101.216 1.00 70.56  ? 155  PRO C CA    1 
ATOM   7797  C  C     . PRO C  3  155 ? 4.382   128.493 102.199 1.00 72.56  ? 155  PRO C C     1 
ATOM   7798  O  O     . PRO C  3  155 ? 5.349   127.723 102.206 1.00 70.93  ? 155  PRO C O     1 
ATOM   7799  C  CB    . PRO C  3  155 ? 2.172   127.343 101.726 1.00 69.72  ? 155  PRO C CB    1 
ATOM   7800  C  CG    . PRO C  3  155 ? 2.672   126.038 101.242 1.00 69.10  ? 155  PRO C CG    1 
ATOM   7801  C  CD    . PRO C  3  155 ? 3.108   126.320 99.831  1.00 68.00  ? 155  PRO C CD    1 
ATOM   7802  N  N     . TYR C  3  156 ? 4.263   129.547 103.009 1.00 76.13  ? 156  TYR C N     1 
ATOM   7803  C  CA    . TYR C  3  156 ? 5.280   129.900 104.002 1.00 80.27  ? 156  TYR C CA    1 
ATOM   7804  C  C     . TYR C  3  156 ? 6.505   130.530 103.329 1.00 80.89  ? 156  TYR C C     1 
ATOM   7805  O  O     . TYR C  3  156 ? 6.597   131.751 103.197 1.00 81.34  ? 156  TYR C O     1 
ATOM   7806  C  CB    . TYR C  3  156 ? 5.702   128.648 104.778 1.00 83.80  ? 156  TYR C CB    1 
ATOM   7807  C  CG    . TYR C  3  156 ? 4.536   127.893 105.389 1.00 87.12  ? 156  TYR C CG    1 
ATOM   7808  C  CD1   . TYR C  3  156 ? 4.680   126.567 105.827 1.00 87.98  ? 156  TYR C CD1   1 
ATOM   7809  C  CD2   . TYR C  3  156 ? 3.285   128.506 105.538 1.00 87.62  ? 156  TYR C CD2   1 
ATOM   7810  C  CE1   . TYR C  3  156 ? 3.600   125.871 106.398 1.00 88.81  ? 156  TYR C CE1   1 
ATOM   7811  C  CE2   . TYR C  3  156 ? 2.207   127.823 106.106 1.00 88.82  ? 156  TYR C CE2   1 
ATOM   7812  C  CZ    . TYR C  3  156 ? 2.368   126.513 106.534 1.00 89.20  ? 156  TYR C CZ    1 
ATOM   7813  O  OH    . TYR C  3  156 ? 1.296   125.865 107.103 1.00 89.97  ? 156  TYR C OH    1 
ATOM   7814  N  N     . ILE C  3  157 ? 7.428   129.679 102.892 1.00 81.35  ? 157  ILE C N     1 
ATOM   7815  C  CA    . ILE C  3  157 ? 8.667   130.095 102.225 1.00 82.27  ? 157  ILE C CA    1 
ATOM   7816  C  C     . ILE C  3  157 ? 8.495   130.785 100.861 1.00 83.30  ? 157  ILE C C     1 
ATOM   7817  O  O     . ILE C  3  157 ? 9.461   131.310 100.291 1.00 82.39  ? 157  ILE C O     1 
ATOM   7818  C  CB    . ILE C  3  157 ? 9.560   128.877 101.992 1.00 81.27  ? 157  ILE C CB    1 
ATOM   7819  C  CG1   . ILE C  3  157 ? 8.863   127.892 101.046 1.00 80.52  ? 157  ILE C CG1   1 
ATOM   7820  C  CG2   . ILE C  3  157 ? 9.831   128.205 103.297 1.00 81.37  ? 157  ILE C CG2   1 
ATOM   7821  C  CD1   . ILE C  3  157 ? 9.670   126.647 100.734 1.00 79.55  ? 157  ILE C CD1   1 
ATOM   7822  N  N     . GLY C  3  158 ? 7.268   130.769 100.348 1.00 84.30  ? 158  GLY C N     1 
ATOM   7823  C  CA    . GLY C  3  158 ? 6.981   131.337 99.044  1.00 84.23  ? 158  GLY C CA    1 
ATOM   7824  C  C     . GLY C  3  158 ? 7.360   132.778 98.848  1.00 84.17  ? 158  GLY C C     1 
ATOM   7825  O  O     . GLY C  3  158 ? 8.273   133.088 98.088  1.00 82.78  ? 158  GLY C O     1 
ATOM   7826  N  N     . HIS C  3  159 ? 6.643   133.656 99.539  1.00 85.73  ? 159  HIS C N     1 
ATOM   7827  C  CA    . HIS C  3  159 ? 6.867   135.093 99.446  1.00 86.52  ? 159  HIS C CA    1 
ATOM   7828  C  C     . HIS C  3  159 ? 8.288   135.467 99.834  1.00 85.08  ? 159  HIS C C     1 
ATOM   7829  O  O     . HIS C  3  159 ? 8.874   136.410 99.299  1.00 84.59  ? 159  HIS C O     1 
ATOM   7830  C  CB    . HIS C  3  159 ? 5.852   135.810 100.331 1.00 89.22  ? 159  HIS C CB    1 
ATOM   7831  C  CG    . HIS C  3  159 ? 4.431   135.586 99.909  1.00 93.06  ? 159  HIS C CG    1 
ATOM   7832  N  ND1   . HIS C  3  159 ? 3.911   136.104 98.740  1.00 94.78  ? 159  HIS C ND1   1 
ATOM   7833  C  CD2   . HIS C  3  159 ? 3.429   134.873 100.481 1.00 94.74  ? 159  HIS C CD2   1 
ATOM   7834  C  CE1   . HIS C  3  159 ? 2.651   135.721 98.612  1.00 95.62  ? 159  HIS C CE1   1 
ATOM   7835  N  NE2   . HIS C  3  159 ? 2.334   134.973 99.655  1.00 95.72  ? 159  HIS C NE2   1 
ATOM   7836  N  N     . THR C  3  160 ? 8.847   134.700 100.753 1.00 83.81  ? 160  THR C N     1 
ATOM   7837  C  CA    . THR C  3  160 ? 10.203  134.933 101.212 1.00 83.09  ? 160  THR C CA    1 
ATOM   7838  C  C     . THR C  3  160 ? 11.252  134.482 100.177 1.00 81.31  ? 160  THR C C     1 
ATOM   7839  O  O     . THR C  3  160 ? 12.392  134.953 100.186 1.00 81.56  ? 160  THR C O     1 
ATOM   7840  C  CB    . THR C  3  160 ? 10.425  134.209 102.551 1.00 84.05  ? 160  THR C CB    1 
ATOM   7841  O  OG1   . THR C  3  160 ? 9.426   134.644 103.490 1.00 84.46  ? 160  THR C OG1   1 
ATOM   7842  C  CG2   . THR C  3  160 ? 11.828  134.501 103.097 1.00 84.81  ? 160  THR C CG2   1 
ATOM   7843  N  N     . LEU C  3  161 ? 10.872  133.563 99.294  1.00 78.55  ? 161  LEU C N     1 
ATOM   7844  C  CA    . LEU C  3  161 ? 11.788  133.099 98.257  1.00 74.70  ? 161  LEU C CA    1 
ATOM   7845  C  C     . LEU C  3  161 ? 11.780  134.124 97.146  1.00 72.53  ? 161  LEU C C     1 
ATOM   7846  O  O     . LEU C  3  161 ? 12.786  134.330 96.474  1.00 71.97  ? 161  LEU C O     1 
ATOM   7847  C  CB    . LEU C  3  161 ? 11.341  131.749 97.700  1.00 75.12  ? 161  LEU C CB    1 
ATOM   7848  C  CG    . LEU C  3  161 ? 11.792  130.501 98.461  1.00 75.07  ? 161  LEU C CG    1 
ATOM   7849  C  CD1   . LEU C  3  161 ? 10.696  129.452 98.418  1.00 75.12  ? 161  LEU C CD1   1 
ATOM   7850  C  CD2   . LEU C  3  161 ? 13.086  129.973 97.850  1.00 72.16  ? 161  LEU C CD2   1 
ATOM   7851  N  N     . VAL C  3  162 ? 10.631  134.763 96.952  1.00 70.18  ? 162  VAL C N     1 
ATOM   7852  C  CA    . VAL C  3  162 ? 10.498  135.775 95.922  1.00 67.81  ? 162  VAL C CA    1 
ATOM   7853  C  C     . VAL C  3  162 ? 11.427  136.915 96.289  1.00 67.89  ? 162  VAL C C     1 
ATOM   7854  O  O     . VAL C  3  162 ? 12.202  137.372 95.458  1.00 66.71  ? 162  VAL C O     1 
ATOM   7855  C  CB    . VAL C  3  162 ? 9.047   136.267 95.814  1.00 67.16  ? 162  VAL C CB    1 
ATOM   7856  C  CG1   . VAL C  3  162 ? 8.962   137.444 94.863  1.00 67.60  ? 162  VAL C CG1   1 
ATOM   7857  C  CG2   . VAL C  3  162 ? 8.160   135.135 95.317  1.00 64.10  ? 162  VAL C CG2   1 
ATOM   7858  N  N     . GLU C  3  163 ? 11.356  137.359 97.543  1.00 69.23  ? 163  GLU C N     1 
ATOM   7859  C  CA    . GLU C  3  163 ? 12.231  138.429 98.029  1.00 70.64  ? 163  GLU C CA    1 
ATOM   7860  C  C     . GLU C  3  163 ? 13.664  138.162 97.542  1.00 69.07  ? 163  GLU C C     1 
ATOM   7861  O  O     . GLU C  3  163 ? 14.275  139.017 96.909  1.00 70.35  ? 163  GLU C O     1 
ATOM   7862  C  CB    . GLU C  3  163 ? 12.200  138.495 99.570  1.00 73.73  ? 163  GLU C CB    1 
ATOM   7863  C  CG    . GLU C  3  163 ? 13.243  139.442 100.213 1.00 77.98  ? 163  GLU C CG    1 
ATOM   7864  C  CD    . GLU C  3  163 ? 13.323  139.314 101.748 1.00 79.98  ? 163  GLU C CD    1 
ATOM   7865  O  OE1   . GLU C  3  163 ? 13.462  138.181 102.253 1.00 81.32  ? 163  GLU C OE1   1 
ATOM   7866  O  OE2   . GLU C  3  163 ? 13.259  140.344 102.457 1.00 82.07  ? 163  GLU C OE2   1 
ATOM   7867  N  N     . TRP C  3  164 ? 14.198  136.980 97.827  1.00 66.75  ? 164  TRP C N     1 
ATOM   7868  C  CA    . TRP C  3  164 ? 15.547  136.674 97.382  1.00 66.00  ? 164  TRP C CA    1 
ATOM   7869  C  C     . TRP C  3  164 ? 15.632  136.880 95.895  1.00 65.53  ? 164  TRP C C     1 
ATOM   7870  O  O     . TRP C  3  164 ? 16.445  137.657 95.418  1.00 67.88  ? 164  TRP C O     1 
ATOM   7871  C  CB    . TRP C  3  164 ? 15.945  135.224 97.675  1.00 67.26  ? 164  TRP C CB    1 
ATOM   7872  C  CG    . TRP C  3  164 ? 16.134  134.883 99.120  1.00 67.47  ? 164  TRP C CG    1 
ATOM   7873  C  CD1   . TRP C  3  164 ? 16.159  135.750 100.181 1.00 67.48  ? 164  TRP C CD1   1 
ATOM   7874  C  CD2   . TRP C  3  164 ? 16.244  133.567 99.674  1.00 67.37  ? 164  TRP C CD2   1 
ATOM   7875  N  NE1   . TRP C  3  164 ? 16.262  135.055 101.362 1.00 66.81  ? 164  TRP C NE1   1 
ATOM   7876  C  CE2   . TRP C  3  164 ? 16.317  133.712 101.083 1.00 67.43  ? 164  TRP C CE2   1 
ATOM   7877  C  CE3   . TRP C  3  164 ? 16.281  132.272 99.119  1.00 65.75  ? 164  TRP C CE3   1 
ATOM   7878  C  CZ2   . TRP C  3  164 ? 16.425  132.606 101.949 1.00 64.74  ? 164  TRP C CZ2   1 
ATOM   7879  C  CZ3   . TRP C  3  164 ? 16.388  131.167 99.986  1.00 62.52  ? 164  TRP C CZ3   1 
ATOM   7880  C  CH2   . TRP C  3  164 ? 16.458  131.348 101.381 1.00 62.17  ? 164  TRP C CH2   1 
ATOM   7881  N  N     . ALA C  3  165 ? 14.789  136.184 95.152  1.00 64.29  ? 165  ALA C N     1 
ATOM   7882  C  CA    . ALA C  3  165 ? 14.821  136.305 93.702  1.00 64.59  ? 165  ALA C CA    1 
ATOM   7883  C  C     . ALA C  3  165 ? 14.971  137.752 93.216  1.00 63.94  ? 165  ALA C C     1 
ATOM   7884  O  O     . ALA C  3  165 ? 15.672  138.011 92.241  1.00 63.35  ? 165  ALA C O     1 
ATOM   7885  C  CB    . ALA C  3  165 ? 13.558  135.668 93.093  1.00 65.78  ? 165  ALA C CB    1 
ATOM   7886  N  N     . TRP C  3  166 ? 14.320  138.690 93.904  1.00 63.34  ? 166  TRP C N     1 
ATOM   7887  C  CA    . TRP C  3  166 ? 14.365  140.094 93.517  1.00 61.83  ? 166  TRP C CA    1 
ATOM   7888  C  C     . TRP C  3  166 ? 15.345  140.941 94.293  1.00 61.55  ? 166  TRP C C     1 
ATOM   7889  O  O     . TRP C  3  166 ? 15.733  142.014 93.834  1.00 62.30  ? 166  TRP C O     1 
ATOM   7890  C  CB    . TRP C  3  166 ? 12.998  140.728 93.674  1.00 61.11  ? 166  TRP C CB    1 
ATOM   7891  C  CG    . TRP C  3  166 ? 11.950  140.116 92.840  1.00 62.91  ? 166  TRP C CG    1 
ATOM   7892  C  CD1   . TRP C  3  166 ? 12.125  139.376 91.715  1.00 63.84  ? 166  TRP C CD1   1 
ATOM   7893  C  CD2   . TRP C  3  166 ? 10.536  140.239 93.025  1.00 64.11  ? 166  TRP C CD2   1 
ATOM   7894  N  NE1   . TRP C  3  166 ? 10.905  139.026 91.182  1.00 65.17  ? 166  TRP C NE1   1 
ATOM   7895  C  CE2   . TRP C  3  166 ? 9.913   139.547 91.970  1.00 64.72  ? 166  TRP C CE2   1 
ATOM   7896  C  CE3   . TRP C  3  166 ? 9.734   140.871 93.983  1.00 64.39  ? 166  TRP C CE3   1 
ATOM   7897  C  CZ2   . TRP C  3  166 ? 8.527   139.469 91.846  1.00 64.72  ? 166  TRP C CZ2   1 
ATOM   7898  C  CZ3   . TRP C  3  166 ? 8.362   140.792 93.860  1.00 63.98  ? 166  TRP C CZ3   1 
ATOM   7899  C  CH2   . TRP C  3  166 ? 7.772   140.097 92.801  1.00 64.23  ? 166  TRP C CH2   1 
ATOM   7900  N  N     . GLY C  3  167 ? 15.735  140.475 95.470  1.00 60.14  ? 167  GLY C N     1 
ATOM   7901  C  CA    . GLY C  3  167 ? 16.645  141.252 96.277  1.00 60.16  ? 167  GLY C CA    1 
ATOM   7902  C  C     . GLY C  3  167 ? 15.903  142.497 96.718  1.00 60.98  ? 167  GLY C C     1 
ATOM   7903  O  O     . GLY C  3  167 ? 16.491  143.522 97.076  1.00 59.78  ? 167  GLY C O     1 
ATOM   7904  N  N     . GLY C  3  168 ? 14.582  142.402 96.685  1.00 62.39  ? 168  GLY C N     1 
ATOM   7905  C  CA    . GLY C  3  168 ? 13.764  143.524 97.083  1.00 64.29  ? 168  GLY C CA    1 
ATOM   7906  C  C     . GLY C  3  168 ? 12.321  143.104 97.228  1.00 65.43  ? 168  GLY C C     1 
ATOM   7907  O  O     . GLY C  3  168 ? 12.039  141.920 97.439  1.00 64.50  ? 168  GLY C O     1 
ATOM   7908  N  N     . PHE C  3  169 ? 11.414  144.074 97.100  1.00 66.85  ? 169  PHE C N     1 
ATOM   7909  C  CA    . PHE C  3  169 ? 9.987   143.821 97.228  1.00 68.15  ? 169  PHE C CA    1 
ATOM   7910  C  C     . PHE C  3  169 ? 9.277   144.083 95.928  1.00 66.12  ? 169  PHE C C     1 
ATOM   7911  O  O     . PHE C  3  169 ? 8.069   144.286 95.884  1.00 66.56  ? 169  PHE C O     1 
ATOM   7912  C  CB    . PHE C  3  169 ? 9.415   144.669 98.370  1.00 73.80  ? 169  PHE C CB    1 
ATOM   7913  C  CG    . PHE C  3  169 ? 9.882   144.211 99.744  1.00 81.03  ? 169  PHE C CG    1 
ATOM   7914  C  CD1   . PHE C  3  169 ? 9.848   145.074 100.848 1.00 82.77  ? 169  PHE C CD1   1 
ATOM   7915  C  CD2   . PHE C  3  169 ? 10.383  142.905 99.927  1.00 82.10  ? 169  PHE C CD2   1 
ATOM   7916  C  CE1   . PHE C  3  169 ? 10.312  144.637 102.106 1.00 83.84  ? 169  PHE C CE1   1 
ATOM   7917  C  CE2   . PHE C  3  169 ? 10.843  142.468 101.171 1.00 81.86  ? 169  PHE C CE2   1 
ATOM   7918  C  CZ    . PHE C  3  169 ? 10.810  143.329 102.260 1.00 82.85  ? 169  PHE C CZ    1 
ATOM   7919  N  N     . SER C  3  170 ? 10.058  144.050 94.862  1.00 64.33  ? 170  SER C N     1 
ATOM   7920  C  CA    . SER C  3  170 ? 9.555   144.246 93.518  1.00 63.49  ? 170  SER C CA    1 
ATOM   7921  C  C     . SER C  3  170 ? 10.747  144.083 92.602  1.00 62.62  ? 170  SER C C     1 
ATOM   7922  O  O     . SER C  3  170 ? 11.896  144.292 93.022  1.00 61.32  ? 170  SER C O     1 
ATOM   7923  C  CB    . SER C  3  170 ? 9.020   145.649 93.354  1.00 64.31  ? 170  SER C CB    1 
ATOM   7924  O  OG    . SER C  3  170 ? 10.109  146.562 93.331  1.00 66.17  ? 170  SER C OG    1 
ATOM   7925  N  N     . VAL C  3  171 ? 10.483  143.705 91.355  1.00 61.84  ? 171  VAL C N     1 
ATOM   7926  C  CA    . VAL C  3  171 ? 11.565  143.556 90.393  1.00 61.09  ? 171  VAL C CA    1 
ATOM   7927  C  C     . VAL C  3  171 ? 12.238  144.921 90.264  1.00 61.68  ? 171  VAL C C     1 
ATOM   7928  O  O     . VAL C  3  171 ? 11.557  145.939 90.099  1.00 63.14  ? 171  VAL C O     1 
ATOM   7929  C  CB    . VAL C  3  171 ? 11.033  143.131 89.019  1.00 60.09  ? 171  VAL C CB    1 
ATOM   7930  C  CG1   . VAL C  3  171 ? 12.155  143.158 87.997  1.00 58.80  ? 171  VAL C CG1   1 
ATOM   7931  C  CG2   . VAL C  3  171 ? 10.420  141.743 89.114  1.00 59.97  ? 171  VAL C CG2   1 
ATOM   7932  N  N     . ASP C  3  172 ? 13.564  144.953 90.371  1.00 60.71  ? 172  ASP C N     1 
ATOM   7933  C  CA    . ASP C  3  172 ? 14.295  146.210 90.241  1.00 59.10  ? 172  ASP C CA    1 
ATOM   7934  C  C     . ASP C  3  172 ? 15.764  145.918 89.995  1.00 57.75  ? 172  ASP C C     1 
ATOM   7935  O  O     . ASP C  3  172 ? 16.122  144.755 89.778  1.00 57.01  ? 172  ASP C O     1 
ATOM   7936  C  CB    . ASP C  3  172 ? 14.142  147.054 91.491  1.00 60.79  ? 172  ASP C CB    1 
ATOM   7937  C  CG    . ASP C  3  172 ? 14.286  148.524 91.208  1.00 62.82  ? 172  ASP C CG    1 
ATOM   7938  O  OD1   . ASP C  3  172 ? 15.065  148.892 90.298  1.00 63.17  ? 172  ASP C OD1   1 
ATOM   7939  O  OD2   . ASP C  3  172 ? 13.621  149.312 91.909  1.00 65.39  ? 172  ASP C OD2   1 
ATOM   7940  N  N     . ASN C  3  173 ? 16.610  146.953 90.055  1.00 55.38  ? 173  ASN C N     1 
ATOM   7941  C  CA    . ASN C  3  173 ? 18.033  146.785 89.784  1.00 53.36  ? 173  ASN C CA    1 
ATOM   7942  C  C     . ASN C  3  173 ? 18.678  145.641 90.536  1.00 52.94  ? 173  ASN C C     1 
ATOM   7943  O  O     . ASN C  3  173 ? 19.412  144.840 89.957  1.00 53.55  ? 173  ASN C O     1 
ATOM   7944  C  CB    . ASN C  3  173 ? 18.811  148.055 90.061  1.00 52.97  ? 173  ASN C CB    1 
ATOM   7945  C  CG    . ASN C  3  173 ? 19.986  148.210 89.117  1.00 55.72  ? 173  ASN C CG    1 
ATOM   7946  O  OD1   . ASN C  3  173 ? 19.797  148.349 87.914  1.00 58.55  ? 173  ASN C OD1   1 
ATOM   7947  N  ND2   . ASN C  3  173 ? 21.204  148.163 89.646  1.00 57.61  ? 173  ASN C ND2   1 
ATOM   7948  N  N     . PRO C  3  174 ? 18.422  145.540 91.840  1.00 51.95  ? 174  PRO C N     1 
ATOM   7949  C  CA    . PRO C  3  174 ? 19.034  144.433 92.579  1.00 51.04  ? 174  PRO C CA    1 
ATOM   7950  C  C     . PRO C  3  174 ? 18.764  143.072 91.915  1.00 49.41  ? 174  PRO C C     1 
ATOM   7951  O  O     . PRO C  3  174 ? 19.570  142.148 92.032  1.00 49.18  ? 174  PRO C O     1 
ATOM   7952  C  CB    . PRO C  3  174 ? 18.403  144.559 93.972  1.00 51.73  ? 174  PRO C CB    1 
ATOM   7953  C  CG    . PRO C  3  174 ? 17.070  145.215 93.699  1.00 52.32  ? 174  PRO C CG    1 
ATOM   7954  C  CD    . PRO C  3  174 ? 17.459  146.270 92.679  1.00 52.16  ? 174  PRO C CD    1 
ATOM   7955  N  N     . THR C  3  175 ? 17.635  142.971 91.216  1.00 47.20  ? 175  THR C N     1 
ATOM   7956  C  CA    . THR C  3  175 ? 17.252  141.748 90.532  1.00 46.32  ? 175  THR C CA    1 
ATOM   7957  C  C     . THR C  3  175 ? 18.048  141.649 89.247  1.00 46.60  ? 175  THR C C     1 
ATOM   7958  O  O     . THR C  3  175 ? 18.619  140.612 88.925  1.00 48.37  ? 175  THR C O     1 
ATOM   7959  C  CB    . THR C  3  175 ? 15.760  141.747 90.157  1.00 45.66  ? 175  THR C CB    1 
ATOM   7960  O  OG1   . THR C  3  175 ? 15.000  142.332 91.221  1.00 46.74  ? 175  THR C OG1   1 
ATOM   7961  C  CG2   . THR C  3  175 ? 15.274  140.318 89.908  1.00 40.31  ? 175  THR C CG2   1 
ATOM   7962  N  N     . LEU C  3  176 ? 18.090  142.739 88.504  1.00 45.91  ? 176  LEU C N     1 
ATOM   7963  C  CA    . LEU C  3  176 ? 18.811  142.722 87.257  1.00 46.02  ? 176  LEU C CA    1 
ATOM   7964  C  C     . LEU C  3  176 ? 20.241  142.285 87.466  1.00 46.41  ? 176  LEU C C     1 
ATOM   7965  O  O     . LEU C  3  176 ? 20.705  141.381 86.790  1.00 47.52  ? 176  LEU C O     1 
ATOM   7966  C  CB    . LEU C  3  176 ? 18.769  144.095 86.582  1.00 46.53  ? 176  LEU C CB    1 
ATOM   7967  C  CG    . LEU C  3  176 ? 19.478  144.196 85.224  1.00 48.62  ? 176  LEU C CG    1 
ATOM   7968  C  CD1   . LEU C  3  176 ? 19.136  142.999 84.366  1.00 50.02  ? 176  LEU C CD1   1 
ATOM   7969  C  CD2   . LEU C  3  176 ? 19.079  145.479 84.509  1.00 49.61  ? 176  LEU C CD2   1 
ATOM   7970  N  N     . THR C  3  177 ? 20.943  142.897 88.413  1.00 47.77  ? 177  THR C N     1 
ATOM   7971  C  CA    . THR C  3  177 ? 22.343  142.527 88.629  1.00 48.01  ? 177  THR C CA    1 
ATOM   7972  C  C     . THR C  3  177 ? 22.535  141.113 89.137  1.00 48.98  ? 177  THR C C     1 
ATOM   7973  O  O     . THR C  3  177 ? 23.539  140.488 88.788  1.00 50.51  ? 177  THR C O     1 
ATOM   7974  C  CB    . THR C  3  177 ? 23.111  143.495 89.593  1.00 45.95  ? 177  THR C CB    1 
ATOM   7975  O  OG1   . THR C  3  177 ? 22.475  143.533 90.870  1.00 46.70  ? 177  THR C OG1   1 
ATOM   7976  C  CG2   . THR C  3  177 ? 23.162  144.883 89.024  1.00 44.32  ? 177  THR C CG2   1 
ATOM   7977  N  N     . ARG C  3  178 ? 21.614  140.587 89.947  1.00 48.42  ? 178  ARG C N     1 
ATOM   7978  C  CA    . ARG C  3  178 ? 21.837  139.223 90.406  1.00 49.83  ? 178  ARG C CA    1 
ATOM   7979  C  C     . ARG C  3  178 ? 21.523  138.286 89.281  1.00 50.73  ? 178  ARG C C     1 
ATOM   7980  O  O     . ARG C  3  178 ? 22.142  137.229 89.169  1.00 53.54  ? 178  ARG C O     1 
ATOM   7981  C  CB    . ARG C  3  178 ? 21.045  138.865 91.676  1.00 49.33  ? 178  ARG C CB    1 
ATOM   7982  C  CG    . ARG C  3  178 ? 19.546  138.925 91.636  1.00 51.85  ? 178  ARG C CG    1 
ATOM   7983  C  CD    . ARG C  3  178 ? 18.982  138.769 93.071  1.00 54.62  ? 178  ARG C CD    1 
ATOM   7984  N  NE    . ARG C  3  178 ? 19.419  139.863 93.950  1.00 59.50  ? 178  ARG C NE    1 
ATOM   7985  C  CZ    . ARG C  3  178 ? 19.339  139.879 95.286  1.00 60.22  ? 178  ARG C CZ    1 
ATOM   7986  N  NH1   . ARG C  3  178 ? 18.836  138.859 95.968  1.00 59.86  ? 178  ARG C NH1   1 
ATOM   7987  N  NH2   . ARG C  3  178 ? 19.774  140.937 95.953  1.00 61.54  ? 178  ARG C NH2   1 
ATOM   7988  N  N     . PHE C  3  179 ? 20.592  138.693 88.420  1.00 50.52  ? 179  PHE C N     1 
ATOM   7989  C  CA    . PHE C  3  179 ? 20.216  137.889 87.259  1.00 49.27  ? 179  PHE C CA    1 
ATOM   7990  C  C     . PHE C  3  179 ? 21.352  137.796 86.245  1.00 46.65  ? 179  PHE C C     1 
ATOM   7991  O  O     . PHE C  3  179 ? 21.600  136.739 85.680  1.00 47.06  ? 179  PHE C O     1 
ATOM   7992  C  CB    . PHE C  3  179 ? 18.968  138.468 86.601  1.00 50.31  ? 179  PHE C CB    1 
ATOM   7993  C  CG    . PHE C  3  179 ? 17.698  137.901 87.137  1.00 51.64  ? 179  PHE C CG    1 
ATOM   7994  C  CD1   . PHE C  3  179 ? 17.614  137.504 88.472  1.00 52.03  ? 179  PHE C CD1   1 
ATOM   7995  C  CD2   . PHE C  3  179 ? 16.577  137.796 86.327  1.00 51.44  ? 179  PHE C CD2   1 
ATOM   7996  C  CE1   . PHE C  3  179 ? 16.426  137.009 89.001  1.00 52.63  ? 179  PHE C CE1   1 
ATOM   7997  C  CE2   . PHE C  3  179 ? 15.387  137.307 86.843  1.00 54.12  ? 179  PHE C CE2   1 
ATOM   7998  C  CZ    . PHE C  3  179 ? 15.310  136.910 88.192  1.00 54.02  ? 179  PHE C CZ    1 
ATOM   7999  N  N     . PHE C  3  180 ? 22.039  138.898 86.009  1.00 43.81  ? 180  PHE C N     1 
ATOM   8000  C  CA    . PHE C  3  180 ? 23.150  138.855 85.087  1.00 43.90  ? 180  PHE C CA    1 
ATOM   8001  C  C     . PHE C  3  180 ? 24.198  137.874 85.624  1.00 43.92  ? 180  PHE C C     1 
ATOM   8002  O  O     . PHE C  3  180 ? 24.791  137.105 84.873  1.00 45.37  ? 180  PHE C O     1 
ATOM   8003  C  CB    . PHE C  3  180 ? 23.768  140.243 84.920  1.00 42.95  ? 180  PHE C CB    1 
ATOM   8004  C  CG    . PHE C  3  180 ? 25.010  140.241 84.099  1.00 41.98  ? 180  PHE C CG    1 
ATOM   8005  C  CD1   . PHE C  3  180 ? 26.206  140.693 84.626  1.00 41.85  ? 180  PHE C CD1   1 
ATOM   8006  C  CD2   . PHE C  3  180 ? 24.991  139.767 82.804  1.00 44.78  ? 180  PHE C CD2   1 
ATOM   8007  C  CE1   . PHE C  3  180 ? 27.367  140.677 83.880  1.00 41.95  ? 180  PHE C CE1   1 
ATOM   8008  C  CE2   . PHE C  3  180 ? 26.157  139.745 82.035  1.00 48.03  ? 180  PHE C CE2   1 
ATOM   8009  C  CZ    . PHE C  3  180 ? 27.348  140.204 82.578  1.00 45.72  ? 180  PHE C CZ    1 
ATOM   8010  N  N     . ALA C  3  181 ? 24.419  137.888 86.929  1.00 43.44  ? 181  ALA C N     1 
ATOM   8011  C  CA    . ALA C  3  181 ? 25.395  136.989 87.529  1.00 44.54  ? 181  ALA C CA    1 
ATOM   8012  C  C     . ALA C  3  181 ? 24.956  135.552 87.297  1.00 45.62  ? 181  ALA C C     1 
ATOM   8013  O  O     . ALA C  3  181 ? 25.702  134.722 86.787  1.00 45.04  ? 181  ALA C O     1 
ATOM   8014  C  CB    . ALA C  3  181 ? 25.489  137.259 89.022  1.00 44.97  ? 181  ALA C CB    1 
ATOM   8015  N  N     . LEU C  3  182 ? 23.724  135.276 87.700  1.00 47.13  ? 182  LEU C N     1 
ATOM   8016  C  CA    . LEU C  3  182 ? 23.137  133.964 87.568  1.00 47.75  ? 182  LEU C CA    1 
ATOM   8017  C  C     . LEU C  3  182 ? 23.222  133.429 86.135  1.00 48.17  ? 182  LEU C C     1 
ATOM   8018  O  O     . LEU C  3  182 ? 23.561  132.253 85.917  1.00 46.85  ? 182  LEU C O     1 
ATOM   8019  C  CB    . LEU C  3  182 ? 21.692  134.040 88.028  1.00 49.15  ? 182  LEU C CB    1 
ATOM   8020  C  CG    . LEU C  3  182 ? 21.134  132.744 88.602  1.00 51.33  ? 182  LEU C CG    1 
ATOM   8021  C  CD1   . LEU C  3  182 ? 22.246  131.908 89.212  1.00 50.31  ? 182  LEU C CD1   1 
ATOM   8022  C  CD2   . LEU C  3  182 ? 20.090  133.098 89.650  1.00 51.78  ? 182  LEU C CD2   1 
ATOM   8023  N  N     . HIS C  3  183 ? 22.930  134.300 85.165  1.00 47.86  ? 183  HIS C N     1 
ATOM   8024  C  CA    . HIS C  3  183 ? 22.972  133.933 83.750  1.00 46.64  ? 183  HIS C CA    1 
ATOM   8025  C  C     . HIS C  3  183 ? 24.398  133.646 83.317  1.00 46.45  ? 183  HIS C C     1 
ATOM   8026  O  O     . HIS C  3  183 ? 24.631  132.769 82.494  1.00 47.83  ? 183  HIS C O     1 
ATOM   8027  C  CB    . HIS C  3  183 ? 22.396  135.047 82.867  1.00 44.94  ? 183  HIS C CB    1 
ATOM   8028  C  CG    . HIS C  3  183 ? 22.300  134.680 81.415  1.00 45.44  ? 183  HIS C CG    1 
ATOM   8029  N  ND1   . HIS C  3  183 ? 21.450  133.699 80.954  1.00 44.97  ? 183  HIS C ND1   1 
ATOM   8030  C  CD2   . HIS C  3  183 ? 22.961  135.145 80.325  1.00 44.88  ? 183  HIS C CD2   1 
ATOM   8031  C  CE1   . HIS C  3  183 ? 21.592  133.573 79.646  1.00 44.49  ? 183  HIS C CE1   1 
ATOM   8032  N  NE2   . HIS C  3  183 ? 22.503  134.438 79.238  1.00 44.76  ? 183  HIS C NE2   1 
ATOM   8033  N  N     . PHE C  3  184 ? 25.348  134.394 83.866  1.00 45.59  ? 184  PHE C N     1 
ATOM   8034  C  CA    . PHE C  3  184 ? 26.762  134.215 83.532  1.00 45.34  ? 184  PHE C CA    1 
ATOM   8035  C  C     . PHE C  3  184 ? 27.216  132.843 84.061  1.00 46.01  ? 184  PHE C C     1 
ATOM   8036  O  O     . PHE C  3  184 ? 27.965  132.116 83.407  1.00 45.96  ? 184  PHE C O     1 
ATOM   8037  C  CB    . PHE C  3  184 ? 27.586  135.340 84.200  1.00 43.35  ? 184  PHE C CB    1 
ATOM   8038  C  CG    . PHE C  3  184 ? 28.990  135.504 83.660  1.00 43.13  ? 184  PHE C CG    1 
ATOM   8039  C  CD1   . PHE C  3  184 ? 29.416  136.746 83.171  1.00 42.94  ? 184  PHE C CD1   1 
ATOM   8040  C  CD2   . PHE C  3  184 ? 29.880  134.435 83.616  1.00 42.75  ? 184  PHE C CD2   1 
ATOM   8041  C  CE1   . PHE C  3  184 ? 30.705  136.922 82.637  1.00 40.99  ? 184  PHE C CE1   1 
ATOM   8042  C  CE2   . PHE C  3  184 ? 31.166  134.601 83.085  1.00 42.94  ? 184  PHE C CE2   1 
ATOM   8043  C  CZ    . PHE C  3  184 ? 31.575  135.849 82.593  1.00 41.77  ? 184  PHE C CZ    1 
ATOM   8044  N  N     . LEU C  3  185 ? 26.718  132.487 85.237  1.00 45.36  ? 185  LEU C N     1 
ATOM   8045  C  CA    . LEU C  3  185 ? 27.117  131.264 85.890  1.00 45.40  ? 185  LEU C CA    1 
ATOM   8046  C  C     . LEU C  3  185 ? 26.557  129.958 85.361  1.00 46.82  ? 185  LEU C C     1 
ATOM   8047  O  O     . LEU C  3  185 ? 27.326  129.057 85.020  1.00 47.54  ? 185  LEU C O     1 
ATOM   8048  C  CB    . LEU C  3  185 ? 26.806  131.377 87.386  1.00 45.45  ? 185  LEU C CB    1 
ATOM   8049  C  CG    . LEU C  3  185 ? 27.222  130.203 88.278  1.00 44.11  ? 185  LEU C CG    1 
ATOM   8050  C  CD1   . LEU C  3  185 ? 28.753  130.108 88.339  1.00 41.02  ? 185  LEU C CD1   1 
ATOM   8051  C  CD2   . LEU C  3  185 ? 26.628  130.400 89.666  1.00 40.99  ? 185  LEU C CD2   1 
ATOM   8052  N  N     . LEU C  3  186 ? 25.227  129.850 85.301  1.00 46.70  ? 186  LEU C N     1 
ATOM   8053  C  CA    . LEU C  3  186 ? 24.546  128.614 84.872  1.00 44.54  ? 186  LEU C CA    1 
ATOM   8054  C  C     . LEU C  3  186 ? 25.090  127.861 83.654  1.00 44.56  ? 186  LEU C C     1 
ATOM   8055  O  O     . LEU C  3  186 ? 25.186  126.627 83.670  1.00 43.05  ? 186  LEU C O     1 
ATOM   8056  C  CB    . LEU C  3  186 ? 23.063  128.897 84.703  1.00 42.68  ? 186  LEU C CB    1 
ATOM   8057  C  CG    . LEU C  3  186 ? 22.481  129.248 86.072  1.00 41.24  ? 186  LEU C CG    1 
ATOM   8058  C  CD1   . LEU C  3  186 ? 21.001  129.648 85.979  1.00 39.49  ? 186  LEU C CD1   1 
ATOM   8059  C  CD2   . LEU C  3  186 ? 22.679  128.047 86.959  1.00 36.41  ? 186  LEU C CD2   1 
ATOM   8060  N  N     . PRO C  3  187 ? 25.439  128.585 82.579  1.00 44.28  ? 187  PRO C N     1 
ATOM   8061  C  CA    . PRO C  3  187 ? 25.981  127.949 81.373  1.00 44.77  ? 187  PRO C CA    1 
ATOM   8062  C  C     . PRO C  3  187 ? 27.073  126.951 81.738  1.00 44.82  ? 187  PRO C C     1 
ATOM   8063  O  O     . PRO C  3  187 ? 27.113  125.823 81.232  1.00 45.26  ? 187  PRO C O     1 
ATOM   8064  C  CB    . PRO C  3  187 ? 26.525  129.129 80.589  1.00 44.08  ? 187  PRO C CB    1 
ATOM   8065  C  CG    . PRO C  3  187 ? 25.491  130.161 80.871  1.00 44.61  ? 187  PRO C CG    1 
ATOM   8066  C  CD    . PRO C  3  187 ? 25.243  130.026 82.362  1.00 43.66  ? 187  PRO C CD    1 
ATOM   8067  N  N     . PHE C  3  188 ? 27.956  127.372 82.632  1.00 43.85  ? 188  PHE C N     1 
ATOM   8068  C  CA    . PHE C  3  188 ? 29.022  126.497 83.065  1.00 43.35  ? 188  PHE C CA    1 
ATOM   8069  C  C     . PHE C  3  188 ? 28.455  125.337 83.905  1.00 43.02  ? 188  PHE C C     1 
ATOM   8070  O  O     . PHE C  3  188 ? 28.881  124.183 83.752  1.00 43.53  ? 188  PHE C O     1 
ATOM   8071  C  CB    . PHE C  3  188 ? 30.073  127.304 83.814  1.00 44.29  ? 188  PHE C CB    1 
ATOM   8072  C  CG    . PHE C  3  188 ? 30.635  128.450 83.003  1.00 47.32  ? 188  PHE C CG    1 
ATOM   8073  C  CD1   . PHE C  3  188 ? 30.067  129.725 83.067  1.00 48.88  ? 188  PHE C CD1   1 
ATOM   8074  C  CD2   . PHE C  3  188 ? 31.687  128.242 82.118  1.00 47.60  ? 188  PHE C CD2   1 
ATOM   8075  C  CE1   . PHE C  3  188 ? 30.538  130.774 82.257  1.00 47.42  ? 188  PHE C CE1   1 
ATOM   8076  C  CE2   . PHE C  3  188 ? 32.158  129.285 81.308  1.00 47.89  ? 188  PHE C CE2   1 
ATOM   8077  C  CZ    . PHE C  3  188 ? 31.580  130.548 81.381  1.00 47.19  ? 188  PHE C CZ    1 
ATOM   8078  N  N     . ALA C  3  189 ? 27.487  125.598 84.773  1.00 39.47  ? 189  ALA C N     1 
ATOM   8079  C  CA    . ALA C  3  189 ? 26.940  124.468 85.500  1.00 37.58  ? 189  ALA C CA    1 
ATOM   8080  C  C     . ALA C  3  189 ? 26.335  123.514 84.456  1.00 37.95  ? 189  ALA C C     1 
ATOM   8081  O  O     . ALA C  3  189 ? 26.282  122.291 84.666  1.00 38.37  ? 189  ALA C O     1 
ATOM   8082  C  CB    . ALA C  3  189 ? 25.884  124.916 86.465  1.00 36.45  ? 189  ALA C CB    1 
ATOM   8083  N  N     . ILE C  3  190 ? 25.868  124.062 83.332  1.00 35.75  ? 190  ILE C N     1 
ATOM   8084  C  CA    . ILE C  3  190 ? 25.302  123.195 82.311  1.00 36.84  ? 190  ILE C CA    1 
ATOM   8085  C  C     . ILE C  3  190 ? 26.435  122.356 81.728  1.00 38.18  ? 190  ILE C C     1 
ATOM   8086  O  O     . ILE C  3  190 ? 26.357  121.114 81.705  1.00 38.98  ? 190  ILE C O     1 
ATOM   8087  C  CB    . ILE C  3  190 ? 24.594  123.995 81.186  1.00 36.83  ? 190  ILE C CB    1 
ATOM   8088  C  CG1   . ILE C  3  190 ? 23.216  124.469 81.689  1.00 36.11  ? 190  ILE C CG1   1 
ATOM   8089  C  CG2   . ILE C  3  190 ? 24.443  123.125 79.920  1.00 33.46  ? 190  ILE C CG2   1 
ATOM   8090  C  CD1   . ILE C  3  190 ? 22.437  125.377 80.721  1.00 30.57  ? 190  ILE C CD1   1 
ATOM   8091  N  N     . ALA C  3  191 ? 27.494  123.026 81.277  1.00 36.73  ? 191  ALA C N     1 
ATOM   8092  C  CA    . ALA C  3  191 ? 28.641  122.325 80.720  1.00 35.04  ? 191  ALA C CA    1 
ATOM   8093  C  C     . ALA C  3  191 ? 29.136  121.289 81.728  1.00 36.29  ? 191  ALA C C     1 
ATOM   8094  O  O     . ALA C  3  191 ? 29.443  120.151 81.370  1.00 38.88  ? 191  ALA C O     1 
ATOM   8095  C  CB    . ALA C  3  191 ? 29.724  123.294 80.405  1.00 32.46  ? 191  ALA C CB    1 
ATOM   8096  N  N     . GLY C  3  192 ? 29.201  121.661 82.999  1.00 35.09  ? 192  GLY C N     1 
ATOM   8097  C  CA    . GLY C  3  192 ? 29.651  120.698 83.981  1.00 35.27  ? 192  GLY C CA    1 
ATOM   8098  C  C     . GLY C  3  192 ? 28.810  119.431 83.993  1.00 36.74  ? 192  GLY C C     1 
ATOM   8099  O  O     . GLY C  3  192 ? 29.326  118.315 83.824  1.00 37.42  ? 192  GLY C O     1 
ATOM   8100  N  N     . ILE C  3  193 ? 27.505  119.599 84.197  1.00 37.15  ? 193  ILE C N     1 
ATOM   8101  C  CA    . ILE C  3  193 ? 26.592  118.469 84.227  1.00 37.30  ? 193  ILE C CA    1 
ATOM   8102  C  C     . ILE C  3  193 ? 26.585  117.689 82.897  1.00 39.72  ? 193  ILE C C     1 
ATOM   8103  O  O     . ILE C  3  193 ? 26.335  116.478 82.889  1.00 39.24  ? 193  ILE C O     1 
ATOM   8104  C  CB    . ILE C  3  193 ? 25.211  118.946 84.554  1.00 35.52  ? 193  ILE C CB    1 
ATOM   8105  C  CG1   . ILE C  3  193 ? 25.272  119.702 85.873  1.00 31.64  ? 193  ILE C CG1   1 
ATOM   8106  C  CG2   . ILE C  3  193 ? 24.244  117.771 84.572  1.00 32.12  ? 193  ILE C CG2   1 
ATOM   8107  C  CD1   . ILE C  3  193 ? 24.060  120.502 86.164  1.00 31.33  ? 193  ILE C CD1   1 
ATOM   8108  N  N     . THR C  3  194 ? 26.856  118.366 81.781  1.00 39.06  ? 194  THR C N     1 
ATOM   8109  C  CA    . THR C  3  194 ? 26.922  117.655 80.514  1.00 41.87  ? 194  THR C CA    1 
ATOM   8110  C  C     . THR C  3  194 ? 28.034  116.604 80.610  1.00 43.53  ? 194  THR C C     1 
ATOM   8111  O  O     . THR C  3  194 ? 27.928  115.525 80.026  1.00 45.51  ? 194  THR C O     1 
ATOM   8112  C  CB    . THR C  3  194 ? 27.241  118.580 79.339  1.00 41.98  ? 194  THR C CB    1 
ATOM   8113  O  OG1   . THR C  3  194 ? 26.194  119.537 79.185  1.00 45.87  ? 194  THR C OG1   1 
ATOM   8114  C  CG2   . THR C  3  194 ? 27.333  117.789 78.066  1.00 38.02  ? 194  THR C CG2   1 
ATOM   8115  N  N     . ILE C  3  195 ? 29.105  116.915 81.335  1.00 43.68  ? 195  ILE C N     1 
ATOM   8116  C  CA    . ILE C  3  195 ? 30.187  115.947 81.513  1.00 44.69  ? 195  ILE C CA    1 
ATOM   8117  C  C     . ILE C  3  195 ? 29.663  114.733 82.290  1.00 46.99  ? 195  ILE C C     1 
ATOM   8118  O  O     . ILE C  3  195 ? 29.948  113.578 81.942  1.00 45.99  ? 195  ILE C O     1 
ATOM   8119  C  CB    . ILE C  3  195 ? 31.350  116.529 82.303  1.00 43.58  ? 195  ILE C CB    1 
ATOM   8120  C  CG1   . ILE C  3  195 ? 31.913  117.739 81.573  1.00 45.61  ? 195  ILE C CG1   1 
ATOM   8121  C  CG2   . ILE C  3  195 ? 32.431  115.495 82.443  1.00 38.27  ? 195  ILE C CG2   1 
ATOM   8122  C  CD1   . ILE C  3  195 ? 32.334  117.416 80.161  1.00 48.45  ? 195  ILE C CD1   1 
ATOM   8123  N  N     . ILE C  3  196 ? 28.913  114.992 83.360  1.00 47.67  ? 196  ILE C N     1 
ATOM   8124  C  CA    . ILE C  3  196 ? 28.330  113.896 84.133  1.00 47.31  ? 196  ILE C CA    1 
ATOM   8125  C  C     . ILE C  3  196 ? 27.386  113.076 83.226  1.00 46.42  ? 196  ILE C C     1 
ATOM   8126  O  O     . ILE C  3  196 ? 27.359  111.842 83.301  1.00 45.58  ? 196  ILE C O     1 
ATOM   8127  C  CB    . ILE C  3  196 ? 27.516  114.423 85.335  1.00 47.28  ? 196  ILE C CB    1 
ATOM   8128  C  CG1   . ILE C  3  196 ? 28.423  115.182 86.295  1.00 44.55  ? 196  ILE C CG1   1 
ATOM   8129  C  CG2   . ILE C  3  196 ? 26.827  113.266 86.055  1.00 47.28  ? 196  ILE C CG2   1 
ATOM   8130  C  CD1   . ILE C  3  196 ? 27.694  115.573 87.554  1.00 42.24  ? 196  ILE C CD1   1 
ATOM   8131  N  N     . HIS C  3  197 ? 26.621  113.775 82.381  1.00 44.05  ? 197  HIS C N     1 
ATOM   8132  C  CA    . HIS C  3  197 ? 25.682  113.152 81.439  1.00 43.22  ? 197  HIS C CA    1 
ATOM   8133  C  C     . HIS C  3  197 ? 26.477  112.135 80.600  1.00 43.20  ? 197  HIS C C     1 
ATOM   8134  O  O     . HIS C  3  197 ? 26.280  110.919 80.713  1.00 42.18  ? 197  HIS C O     1 
ATOM   8135  C  CB    . HIS C  3  197 ? 25.072  114.250 80.540  1.00 42.75  ? 197  HIS C CB    1 
ATOM   8136  C  CG    . HIS C  3  197 ? 23.881  113.830 79.717  1.00 41.25  ? 197  HIS C CG    1 
ATOM   8137  N  ND1   . HIS C  3  197 ? 22.701  113.380 80.273  1.00 39.25  ? 197  HIS C ND1   1 
ATOM   8138  C  CD2   . HIS C  3  197 ? 23.654  113.919 78.381  1.00 40.59  ? 197  HIS C CD2   1 
ATOM   8139  C  CE1   . HIS C  3  197 ? 21.799  113.219 79.317  1.00 39.15  ? 197  HIS C CE1   1 
ATOM   8140  N  NE2   . HIS C  3  197 ? 22.351  113.542 78.159  1.00 40.78  ? 197  HIS C NE2   1 
ATOM   8141  N  N     . LEU C  3  198 ? 27.394  112.629 79.778  1.00 42.21  ? 198  LEU C N     1 
ATOM   8142  C  CA    . LEU C  3  198 ? 28.194  111.747 78.945  1.00 44.14  ? 198  LEU C CA    1 
ATOM   8143  C  C     . LEU C  3  198 ? 28.930  110.642 79.715  1.00 46.47  ? 198  LEU C C     1 
ATOM   8144  O  O     . LEU C  3  198 ? 29.176  109.552 79.183  1.00 47.21  ? 198  LEU C O     1 
ATOM   8145  C  CB    . LEU C  3  198 ? 29.188  112.574 78.156  1.00 42.47  ? 198  LEU C CB    1 
ATOM   8146  C  CG    . LEU C  3  198 ? 28.475  113.543 77.227  1.00 43.11  ? 198  LEU C CG    1 
ATOM   8147  C  CD1   . LEU C  3  198 ? 29.479  114.386 76.498  1.00 43.05  ? 198  LEU C CD1   1 
ATOM   8148  C  CD2   . LEU C  3  198 ? 27.631  112.757 76.236  1.00 44.99  ? 198  LEU C CD2   1 
ATOM   8149  N  N     . THR C  3  199 ? 29.279  110.919 80.967  1.00 47.56  ? 199  THR C N     1 
ATOM   8150  C  CA    . THR C  3  199 ? 29.981  109.937 81.778  1.00 46.89  ? 199  THR C CA    1 
ATOM   8151  C  C     . THR C  3  199 ? 29.103  108.752 82.108  1.00 45.98  ? 199  THR C C     1 
ATOM   8152  O  O     . THR C  3  199 ? 29.536  107.610 82.005  1.00 46.65  ? 199  THR C O     1 
ATOM   8153  C  CB    . THR C  3  199 ? 30.496  110.556 83.067  1.00 47.17  ? 199  THR C CB    1 
ATOM   8154  O  OG1   . THR C  3  199 ? 31.708  111.258 82.788  1.00 47.31  ? 199  THR C OG1   1 
ATOM   8155  C  CG2   . THR C  3  199 ? 30.765  109.481 84.097  1.00 46.78  ? 199  THR C CG2   1 
ATOM   8156  N  N     . PHE C  3  200 ? 27.876  109.022 82.527  1.00 45.11  ? 200  PHE C N     1 
ATOM   8157  C  CA    . PHE C  3  200 ? 26.952  107.941 82.822  1.00 45.33  ? 200  PHE C CA    1 
ATOM   8158  C  C     . PHE C  3  200 ? 26.646  107.249 81.492  1.00 46.03  ? 200  PHE C C     1 
ATOM   8159  O  O     . PHE C  3  200 ? 26.614  106.028 81.417  1.00 46.40  ? 200  PHE C O     1 
ATOM   8160  C  CB    . PHE C  3  200 ? 25.649  108.483 83.401  1.00 45.88  ? 200  PHE C CB    1 
ATOM   8161  C  CG    . PHE C  3  200 ? 25.705  108.812 84.862  1.00 45.01  ? 200  PHE C CG    1 
ATOM   8162  C  CD1   . PHE C  3  200 ? 25.862  107.805 85.798  1.00 45.17  ? 200  PHE C CD1   1 
ATOM   8163  C  CD2   . PHE C  3  200 ? 25.536  110.125 85.302  1.00 43.89  ? 200  PHE C CD2   1 
ATOM   8164  C  CE1   . PHE C  3  200 ? 25.844  108.094 87.142  1.00 45.12  ? 200  PHE C CE1   1 
ATOM   8165  C  CE2   . PHE C  3  200 ? 25.517  110.425 86.637  1.00 43.26  ? 200  PHE C CE2   1 
ATOM   8166  C  CZ    . PHE C  3  200 ? 25.670  109.411 87.564  1.00 45.57  ? 200  PHE C CZ    1 
ATOM   8167  N  N     . LEU C  3  201 ? 26.412  108.029 80.437  1.00 46.68  ? 201  LEU C N     1 
ATOM   8168  C  CA    . LEU C  3  201 ? 26.120  107.441 79.134  1.00 46.91  ? 201  LEU C CA    1 
ATOM   8169  C  C     . LEU C  3  201 ? 27.185  106.450 78.717  1.00 49.02  ? 201  LEU C C     1 
ATOM   8170  O  O     . LEU C  3  201 ? 26.871  105.336 78.327  1.00 49.26  ? 201  LEU C O     1 
ATOM   8171  C  CB    . LEU C  3  201 ? 26.029  108.501 78.054  1.00 44.84  ? 201  LEU C CB    1 
ATOM   8172  C  CG    . LEU C  3  201 ? 25.881  107.834 76.693  1.00 44.66  ? 201  LEU C CG    1 
ATOM   8173  C  CD1   . LEU C  3  201 ? 24.524  107.179 76.605  1.00 45.40  ? 201  LEU C CD1   1 
ATOM   8174  C  CD2   . LEU C  3  201 ? 26.046  108.844 75.598  1.00 45.46  ? 201  LEU C CD2   1 
ATOM   8175  N  N     . HIS C  3  202 ? 28.444  106.867 78.788  1.00 51.02  ? 202  HIS C N     1 
ATOM   8176  C  CA    . HIS C  3  202 ? 29.548  106.006 78.413  1.00 54.15  ? 202  HIS C CA    1 
ATOM   8177  C  C     . HIS C  3  202 ? 29.613  104.691 79.175  1.00 55.29  ? 202  HIS C C     1 
ATOM   8178  O  O     . HIS C  3  202 ? 30.209  103.733 78.698  1.00 55.94  ? 202  HIS C O     1 
ATOM   8179  C  CB    . HIS C  3  202 ? 30.855  106.765 78.567  1.00 56.43  ? 202  HIS C CB    1 
ATOM   8180  C  CG    . HIS C  3  202 ? 31.054  107.816 77.523  1.00 59.51  ? 202  HIS C CG    1 
ATOM   8181  N  ND1   . HIS C  3  202 ? 31.873  108.909 77.710  1.00 61.65  ? 202  HIS C ND1   1 
ATOM   8182  C  CD2   . HIS C  3  202 ? 30.525  107.949 76.284  1.00 59.76  ? 202  HIS C CD2   1 
ATOM   8183  C  CE1   . HIS C  3  202 ? 31.836  109.674 76.634  1.00 61.82  ? 202  HIS C CE1   1 
ATOM   8184  N  NE2   . HIS C  3  202 ? 31.026  109.113 75.754  1.00 61.25  ? 202  HIS C NE2   1 
ATOM   8185  N  N     . GLU C  3  203 ? 29.004  104.640 80.353  1.00 56.91  ? 203  GLU C N     1 
ATOM   8186  C  CA    . GLU C  3  203 ? 28.994  103.419 81.157  1.00 58.97  ? 203  GLU C CA    1 
ATOM   8187  C  C     . GLU C  3  203 ? 28.341  102.307 80.375  1.00 59.10  ? 203  GLU C C     1 
ATOM   8188  O  O     . GLU C  3  203 ? 28.737  101.151 80.479  1.00 60.22  ? 203  GLU C O     1 
ATOM   8189  C  CB    . GLU C  3  203 ? 28.193  103.625 82.442  1.00 62.65  ? 203  GLU C CB    1 
ATOM   8190  C  CG    . GLU C  3  203 ? 28.906  104.408 83.512  1.00 69.45  ? 203  GLU C CG    1 
ATOM   8191  C  CD    . GLU C  3  203 ? 29.962  103.571 84.201  1.00 74.16  ? 203  GLU C CD    1 
ATOM   8192  O  OE1   . GLU C  3  203 ? 29.580  102.582 84.879  1.00 77.00  ? 203  GLU C OE1   1 
ATOM   8193  O  OE2   . GLU C  3  203 ? 31.167  103.896 84.059  1.00 76.13  ? 203  GLU C OE2   1 
ATOM   8194  N  N     . SER C  3  204 ? 27.332  102.688 79.591  1.00 60.03  ? 204  SER C N     1 
ATOM   8195  C  CA    . SER C  3  204 ? 26.522  101.776 78.772  1.00 58.71  ? 204  SER C CA    1 
ATOM   8196  C  C     . SER C  3  204 ? 26.749  101.873 77.277  1.00 58.57  ? 204  SER C C     1 
ATOM   8197  O  O     . SER C  3  204 ? 26.550  100.903 76.553  1.00 58.18  ? 204  SER C O     1 
ATOM   8198  C  CB    . SER C  3  204 ? 25.041  102.047 79.034  1.00 58.93  ? 204  SER C CB    1 
ATOM   8199  O  OG    . SER C  3  204 ? 24.740  103.426 78.878  1.00 58.54  ? 204  SER C OG    1 
ATOM   8200  N  N     . GLY C  3  205 ? 27.151  103.052 76.815  1.00 59.58  ? 205  GLY C N     1 
ATOM   8201  C  CA    . GLY C  3  205 ? 27.355  103.254 75.396  1.00 59.66  ? 205  GLY C CA    1 
ATOM   8202  C  C     . GLY C  3  205 ? 26.017  103.618 74.777  1.00 59.77  ? 205  GLY C C     1 
ATOM   8203  O  O     . GLY C  3  205 ? 24.963  103.382 75.371  1.00 60.90  ? 205  GLY C O     1 
ATOM   8204  N  N     . SER C  3  206 ? 26.041  104.203 73.589  1.00 58.30  ? 206  SER C N     1 
ATOM   8205  C  CA    . SER C  3  206 ? 24.801  104.587 72.940  1.00 56.45  ? 206  SER C CA    1 
ATOM   8206  C  C     . SER C  3  206 ? 23.854  103.410 72.748  1.00 55.28  ? 206  SER C C     1 
ATOM   8207  O  O     . SER C  3  206 ? 24.268  102.258 72.648  1.00 56.53  ? 206  SER C O     1 
ATOM   8208  C  CB    . SER C  3  206 ? 25.085  105.211 71.574  1.00 57.06  ? 206  SER C CB    1 
ATOM   8209  O  OG    . SER C  3  206 ? 25.931  106.335 71.686  1.00 58.64  ? 206  SER C OG    1 
ATOM   8210  N  N     . ASN C  3  207 ? 22.572  103.730 72.720  1.00 53.40  ? 207  ASN C N     1 
ATOM   8211  C  CA    . ASN C  3  207 ? 21.507  102.779 72.480  1.00 51.62  ? 207  ASN C CA    1 
ATOM   8212  C  C     . ASN C  3  207 ? 21.340  102.909 70.957  1.00 51.17  ? 207  ASN C C     1 
ATOM   8213  O  O     . ASN C  3  207 ? 22.059  103.694 70.335  1.00 51.41  ? 207  ASN C O     1 
ATOM   8214  C  CB    . ASN C  3  207 ? 20.270  103.270 73.213  1.00 53.33  ? 207  ASN C CB    1 
ATOM   8215  C  CG    . ASN C  3  207 ? 19.011  102.529 72.823  1.00 53.46  ? 207  ASN C CG    1 
ATOM   8216  O  OD1   . ASN C  3  207 ? 17.896  103.029 73.034  1.00 54.66  ? 207  ASN C OD1   1 
ATOM   8217  N  ND2   . ASN C  3  207 ? 19.170  101.339 72.276  1.00 50.73  ? 207  ASN C ND2   1 
ATOM   8218  N  N     . ASN C  3  208 ? 20.428  102.160 70.339  1.00 49.62  ? 208  ASN C N     1 
ATOM   8219  C  CA    . ASN C  3  208 ? 20.251  102.267 68.885  1.00 47.41  ? 208  ASN C CA    1 
ATOM   8220  C  C     . ASN C  3  208 ? 18.815  101.999 68.447  1.00 46.05  ? 208  ASN C C     1 
ATOM   8221  O  O     . ASN C  3  208 ? 18.042  101.385 69.164  1.00 44.99  ? 208  ASN C O     1 
ATOM   8222  C  CB    . ASN C  3  208 ? 21.204  101.314 68.153  1.00 46.38  ? 208  ASN C CB    1 
ATOM   8223  C  CG    . ASN C  3  208 ? 20.753  99.890  68.227  1.00 45.86  ? 208  ASN C CG    1 
ATOM   8224  O  OD1   . ASN C  3  208 ? 19.807  99.495  67.554  1.00 46.56  ? 208  ASN C OD1   1 
ATOM   8225  N  ND2   . ASN C  3  208 ? 21.411  99.107  69.063  1.00 46.14  ? 208  ASN C ND2   1 
ATOM   8226  N  N     . PRO C  3  209 ? 18.449  102.453 67.243  1.00 46.24  ? 209  PRO C N     1 
ATOM   8227  C  CA    . PRO C  3  209 ? 17.104  102.281 66.685  1.00 45.73  ? 209  PRO C CA    1 
ATOM   8228  C  C     . PRO C  3  209 ? 16.416  100.930 66.928  1.00 45.56  ? 209  PRO C C     1 
ATOM   8229  O  O     . PRO C  3  209 ? 15.250  100.894 67.307  1.00 46.92  ? 209  PRO C O     1 
ATOM   8230  C  CB    . PRO C  3  209 ? 17.316  102.557 65.208  1.00 45.38  ? 209  PRO C CB    1 
ATOM   8231  C  CG    . PRO C  3  209 ? 18.401  103.594 65.231  1.00 46.15  ? 209  PRO C CG    1 
ATOM   8232  C  CD    . PRO C  3  209 ? 19.359  103.045 66.242  1.00 46.34  ? 209  PRO C CD    1 
ATOM   8233  N  N     . LEU C  3  210 ? 17.119  99.824  66.720  1.00 43.55  ? 210  LEU C N     1 
ATOM   8234  C  CA    . LEU C  3  210 ? 16.508  98.519  66.916  1.00 42.43  ? 210  LEU C CA    1 
ATOM   8235  C  C     . LEU C  3  210 ? 16.243  98.151  68.356  1.00 42.96  ? 210  LEU C C     1 
ATOM   8236  O  O     . LEU C  3  210 ? 15.455  97.256  68.630  1.00 41.30  ? 210  LEU C O     1 
ATOM   8237  C  CB    . LEU C  3  210 ? 17.362  97.435  66.288  1.00 42.75  ? 210  LEU C CB    1 
ATOM   8238  C  CG    . LEU C  3  210 ? 17.486  97.528  64.772  1.00 43.65  ? 210  LEU C CG    1 
ATOM   8239  C  CD1   . LEU C  3  210 ? 18.090  96.230  64.275  1.00 44.20  ? 210  LEU C CD1   1 
ATOM   8240  C  CD2   . LEU C  3  210 ? 16.125  97.756  64.124  1.00 43.40  ? 210  LEU C CD2   1 
ATOM   8241  N  N     . GLY C  3  211 ? 16.918  98.826  69.279  1.00 45.48  ? 211  GLY C N     1 
ATOM   8242  C  CA    . GLY C  3  211 ? 16.708  98.564  70.696  1.00 46.55  ? 211  GLY C CA    1 
ATOM   8243  C  C     . GLY C  3  211 ? 17.118  97.177  71.139  1.00 47.77  ? 211  GLY C C     1 
ATOM   8244  O  O     . GLY C  3  211 ? 16.489  96.579  72.017  1.00 47.77  ? 211  GLY C O     1 
ATOM   8245  N  N     . ILE C  3  212 ? 18.151  96.655  70.493  1.00 48.51  ? 212  ILE C N     1 
ATOM   8246  C  CA    . ILE C  3  212 ? 18.698  95.348  70.819  1.00 51.33  ? 212  ILE C CA    1 
ATOM   8247  C  C     . ILE C  3  212 ? 20.213  95.531  70.884  1.00 54.25  ? 212  ILE C C     1 
ATOM   8248  O  O     . ILE C  3  212 ? 20.768  96.437  70.236  1.00 54.93  ? 212  ILE C O     1 
ATOM   8249  C  CB    . ILE C  3  212 ? 18.357  94.252  69.757  1.00 51.07  ? 212  ILE C CB    1 
ATOM   8250  C  CG1   . ILE C  3  212 ? 18.607  94.764  68.347  1.00 51.11  ? 212  ILE C CG1   1 
ATOM   8251  C  CG2   . ILE C  3  212 ? 16.916  93.807  69.888  1.00 52.99  ? 212  ILE C CG2   1 
ATOM   8252  C  CD1   . ILE C  3  212 ? 18.474  93.682  67.318  1.00 50.33  ? 212  ILE C CD1   1 
ATOM   8253  N  N     . SER C  3  213 ? 20.887  94.678  71.651  1.00 54.73  ? 213  SER C N     1 
ATOM   8254  C  CA    . SER C  3  213 ? 22.326  94.806  71.813  1.00 55.31  ? 213  SER C CA    1 
ATOM   8255  C  C     . SER C  3  213 ? 23.090  95.002  70.508  1.00 55.80  ? 213  SER C C     1 
ATOM   8256  O  O     . SER C  3  213 ? 22.831  94.322  69.524  1.00 57.55  ? 213  SER C O     1 
ATOM   8257  C  CB    . SER C  3  213 ? 22.862  93.593  72.546  1.00 55.69  ? 213  SER C CB    1 
ATOM   8258  O  OG    . SER C  3  213 ? 24.079  93.936  73.173  1.00 59.98  ? 213  SER C OG    1 
ATOM   8259  N  N     . SER C  3  214 ? 24.041  95.927  70.505  1.00 56.05  ? 214  SER C N     1 
ATOM   8260  C  CA    . SER C  3  214 ? 24.832  96.187  69.306  1.00 57.28  ? 214  SER C CA    1 
ATOM   8261  C  C     . SER C  3  214 ? 26.292  95.728  69.434  1.00 58.58  ? 214  SER C C     1 
ATOM   8262  O  O     . SER C  3  214 ? 27.132  96.047  68.583  1.00 59.38  ? 214  SER C O     1 
ATOM   8263  C  CB    . SER C  3  214 ? 24.785  97.677  68.974  1.00 56.16  ? 214  SER C CB    1 
ATOM   8264  O  OG    . SER C  3  214 ? 25.018  98.455  70.136  1.00 55.12  ? 214  SER C OG    1 
ATOM   8265  N  N     . ASP C  3  215 ? 26.582  94.966  70.487  1.00 58.46  ? 215  ASP C N     1 
ATOM   8266  C  CA    . ASP C  3  215 ? 27.933  94.473  70.751  1.00 58.32  ? 215  ASP C CA    1 
ATOM   8267  C  C     . ASP C  3  215 ? 28.488  93.637  69.600  1.00 57.73  ? 215  ASP C C     1 
ATOM   8268  O  O     . ASP C  3  215 ? 29.707  93.501  69.434  1.00 58.17  ? 215  ASP C O     1 
ATOM   8269  C  CB    . ASP C  3  215 ? 27.932  93.650  72.040  1.00 59.26  ? 215  ASP C CB    1 
ATOM   8270  C  CG    . ASP C  3  215 ? 27.484  94.457  73.259  1.00 60.59  ? 215  ASP C CG    1 
ATOM   8271  O  OD1   . ASP C  3  215 ? 27.201  93.831  74.308  1.00 62.13  ? 215  ASP C OD1   1 
ATOM   8272  O  OD2   . ASP C  3  215 ? 27.423  95.708  73.181  1.00 60.82  ? 215  ASP C OD2   1 
ATOM   8273  N  N     . SER C  3  216 ? 27.583  93.078  68.807  1.00 56.77  ? 216  SER C N     1 
ATOM   8274  C  CA    . SER C  3  216 ? 27.952  92.255  67.660  1.00 56.34  ? 216  SER C CA    1 
ATOM   8275  C  C     . SER C  3  216 ? 28.337  93.133  66.485  1.00 55.68  ? 216  SER C C     1 
ATOM   8276  O  O     . SER C  3  216 ? 28.657  92.632  65.408  1.00 55.62  ? 216  SER C O     1 
ATOM   8277  C  CB    . SER C  3  216 ? 26.773  91.386  67.244  1.00 56.41  ? 216  SER C CB    1 
ATOM   8278  O  OG    . SER C  3  216 ? 25.597  92.184  67.178  1.00 60.58  ? 216  SER C OG    1 
ATOM   8279  N  N     . ASP C  3  217 ? 28.301  94.445  66.692  1.00 54.57  ? 217  ASP C N     1 
ATOM   8280  C  CA    . ASP C  3  217 ? 28.615  95.355  65.613  1.00 53.54  ? 217  ASP C CA    1 
ATOM   8281  C  C     . ASP C  3  217 ? 28.848  96.796  66.082  1.00 52.75  ? 217  ASP C C     1 
ATOM   8282  O  O     . ASP C  3  217 ? 27.980  97.654  65.938  1.00 53.26  ? 217  ASP C O     1 
ATOM   8283  C  CB    . ASP C  3  217 ? 27.469  95.306  64.599  1.00 53.04  ? 217  ASP C CB    1 
ATOM   8284  C  CG    . ASP C  3  217 ? 27.884  95.787  63.239  1.00 54.29  ? 217  ASP C CG    1 
ATOM   8285  O  OD1   . ASP C  3  217 ? 27.002  96.084  62.407  1.00 54.90  ? 217  ASP C OD1   1 
ATOM   8286  O  OD2   . ASP C  3  217 ? 29.104  95.862  63.001  1.00 55.60  ? 217  ASP C OD2   1 
ATOM   8287  N  N     . LYS C  3  218 ? 30.019  97.067  66.642  1.00 51.67  ? 218  LYS C N     1 
ATOM   8288  C  CA    . LYS C  3  218 ? 30.330  98.420  67.109  1.00 51.71  ? 218  LYS C CA    1 
ATOM   8289  C  C     . LYS C  3  218 ? 31.360  99.047  66.183  1.00 51.00  ? 218  LYS C C     1 
ATOM   8290  O  O     . LYS C  3  218 ? 32.031  98.346  65.441  1.00 52.93  ? 218  LYS C O     1 
ATOM   8291  C  CB    . LYS C  3  218 ? 30.883  98.383  68.537  1.00 50.98  ? 218  LYS C CB    1 
ATOM   8292  C  CG    . LYS C  3  218 ? 29.903  97.866  69.588  1.00 49.96  ? 218  LYS C CG    1 
ATOM   8293  C  CD    . LYS C  3  218 ? 29.013  98.971  70.158  1.00 48.51  ? 218  LYS C CD    1 
ATOM   8294  C  CE    . LYS C  3  218 ? 28.198  98.455  71.350  1.00 48.98  ? 218  LYS C CE    1 
ATOM   8295  N  NZ    . LYS C  3  218 ? 27.395  99.505  72.045  1.00 48.09  ? 218  LYS C NZ    1 
ATOM   8296  N  N     . ILE C  3  219 ? 31.482  100.364 66.201  1.00 49.38  ? 219  ILE C N     1 
ATOM   8297  C  CA    . ILE C  3  219 ? 32.467  101.003 65.346  1.00 49.66  ? 219  ILE C CA    1 
ATOM   8298  C  C     . ILE C  3  219 ? 33.105  102.166 66.062  1.00 50.40  ? 219  ILE C C     1 
ATOM   8299  O  O     . ILE C  3  219 ? 32.485  102.815 66.905  1.00 51.72  ? 219  ILE C O     1 
ATOM   8300  C  CB    . ILE C  3  219 ? 31.872  101.493 64.003  1.00 48.84  ? 219  ILE C CB    1 
ATOM   8301  C  CG1   . ILE C  3  219 ? 30.483  102.086 64.208  1.00 50.51  ? 219  ILE C CG1   1 
ATOM   8302  C  CG2   . ILE C  3  219 ? 31.773  100.348 63.037  1.00 48.35  ? 219  ILE C CG2   1 
ATOM   8303  C  CD1   . ILE C  3  219 ? 29.810  102.507 62.912  1.00 50.31  ? 219  ILE C CD1   1 
ATOM   8304  N  N     . PRO C  3  220 ? 34.373  102.441 65.750  1.00 50.26  ? 220  PRO C N     1 
ATOM   8305  C  CA    . PRO C  3  220 ? 35.030  103.558 66.425  1.00 49.28  ? 220  PRO C CA    1 
ATOM   8306  C  C     . PRO C  3  220 ? 34.279  104.855 66.102  1.00 49.33  ? 220  PRO C C     1 
ATOM   8307  O  O     . PRO C  3  220 ? 33.889  105.088 64.949  1.00 49.02  ? 220  PRO C O     1 
ATOM   8308  C  CB    . PRO C  3  220 ? 36.433  103.526 65.831  1.00 47.82  ? 220  PRO C CB    1 
ATOM   8309  C  CG    . PRO C  3  220 ? 36.170  103.080 64.418  1.00 46.35  ? 220  PRO C CG    1 
ATOM   8310  C  CD    . PRO C  3  220 ? 35.166  101.966 64.600  1.00 48.50  ? 220  PRO C CD    1 
ATOM   8311  N  N     . PHE C  3  221 ? 34.058  105.678 67.121  1.00 48.15  ? 221  PHE C N     1 
ATOM   8312  C  CA    . PHE C  3  221 ? 33.375  106.949 66.939  1.00 47.51  ? 221  PHE C CA    1 
ATOM   8313  C  C     . PHE C  3  221 ? 34.016  107.676 65.769  1.00 49.35  ? 221  PHE C C     1 
ATOM   8314  O  O     . PHE C  3  221 ? 33.331  108.259 64.926  1.00 50.27  ? 221  PHE C O     1 
ATOM   8315  C  CB    . PHE C  3  221 ? 33.519  107.797 68.186  1.00 45.91  ? 221  PHE C CB    1 
ATOM   8316  C  CG    . PHE C  3  221 ? 32.921  109.163 68.058  1.00 43.99  ? 221  PHE C CG    1 
ATOM   8317  C  CD1   . PHE C  3  221 ? 31.610  109.395 68.446  1.00 42.28  ? 221  PHE C CD1   1 
ATOM   8318  C  CD2   . PHE C  3  221 ? 33.671  110.221 67.547  1.00 43.19  ? 221  PHE C CD2   1 
ATOM   8319  C  CE1   . PHE C  3  221 ? 31.061  110.656 68.329  1.00 41.19  ? 221  PHE C CE1   1 
ATOM   8320  C  CE2   . PHE C  3  221 ? 33.125  111.489 67.425  1.00 41.87  ? 221  PHE C CE2   1 
ATOM   8321  C  CZ    . PHE C  3  221 ? 31.817  111.706 67.818  1.00 41.41  ? 221  PHE C CZ    1 
ATOM   8322  N  N     . HIS C  3  222 ? 35.345  107.664 65.736  1.00 51.16  ? 222  HIS C N     1 
ATOM   8323  C  CA    . HIS C  3  222 ? 36.070  108.292 64.644  1.00 52.26  ? 222  HIS C CA    1 
ATOM   8324  C  C     . HIS C  3  222 ? 36.480  107.189 63.685  1.00 53.07  ? 222  HIS C C     1 
ATOM   8325  O  O     . HIS C  3  222 ? 36.990  106.161 64.121  1.00 54.54  ? 222  HIS C O     1 
ATOM   8326  C  CB    . HIS C  3  222 ? 37.324  108.981 65.135  1.00 52.07  ? 222  HIS C CB    1 
ATOM   8327  C  CG    . HIS C  3  222 ? 38.057  109.685 64.042  1.00 54.81  ? 222  HIS C CG    1 
ATOM   8328  N  ND1   . HIS C  3  222 ? 37.506  110.734 63.338  1.00 55.30  ? 222  HIS C ND1   1 
ATOM   8329  C  CD2   . HIS C  3  222 ? 39.268  109.453 63.485  1.00 55.95  ? 222  HIS C CD2   1 
ATOM   8330  C  CE1   . HIS C  3  222 ? 38.346  111.118 62.394  1.00 55.50  ? 222  HIS C CE1   1 
ATOM   8331  N  NE2   . HIS C  3  222 ? 39.422  110.357 62.461  1.00 56.16  ? 222  HIS C NE2   1 
ATOM   8332  N  N     . PRO C  3  223 ? 36.292  107.389 62.367  1.00 52.63  ? 223  PRO C N     1 
ATOM   8333  C  CA    . PRO C  3  223 ? 35.729  108.569 61.713  1.00 51.93  ? 223  PRO C CA    1 
ATOM   8334  C  C     . PRO C  3  223 ? 34.235  108.497 61.459  1.00 51.28  ? 223  PRO C C     1 
ATOM   8335  O  O     . PRO C  3  223 ? 33.657  109.458 60.969  1.00 50.84  ? 223  PRO C O     1 
ATOM   8336  C  CB    . PRO C  3  223 ? 36.494  108.613 60.405  1.00 52.13  ? 223  PRO C CB    1 
ATOM   8337  C  CG    . PRO C  3  223 ? 36.501  107.170 60.032  1.00 52.27  ? 223  PRO C CG    1 
ATOM   8338  C  CD    . PRO C  3  223 ? 36.843  106.470 61.353  1.00 52.60  ? 223  PRO C CD    1 
ATOM   8339  N  N     . TYR C  3  224 ? 33.605  107.376 61.784  1.00 50.70  ? 224  TYR C N     1 
ATOM   8340  C  CA    . TYR C  3  224 ? 32.179  107.244 61.522  1.00 52.12  ? 224  TYR C CA    1 
ATOM   8341  C  C     . TYR C  3  224 ? 31.249  108.332 62.051  1.00 52.57  ? 224  TYR C C     1 
ATOM   8342  O  O     . TYR C  3  224 ? 30.518  108.949 61.274  1.00 52.30  ? 224  TYR C O     1 
ATOM   8343  C  CB    . TYR C  3  224 ? 31.696  105.874 61.982  1.00 53.64  ? 224  TYR C CB    1 
ATOM   8344  C  CG    . TYR C  3  224 ? 32.248  104.787 61.107  1.00 54.90  ? 224  TYR C CG    1 
ATOM   8345  C  CD1   . TYR C  3  224 ? 32.793  103.633 61.650  1.00 54.82  ? 224  TYR C CD1   1 
ATOM   8346  C  CD2   . TYR C  3  224 ? 32.331  104.969 59.728  1.00 55.54  ? 224  TYR C CD2   1 
ATOM   8347  C  CE1   . TYR C  3  224 ? 33.422  102.699 60.838  1.00 55.52  ? 224  TYR C CE1   1 
ATOM   8348  C  CE2   . TYR C  3  224 ? 32.961  104.043 58.913  1.00 54.87  ? 224  TYR C CE2   1 
ATOM   8349  C  CZ    . TYR C  3  224 ? 33.508  102.916 59.469  1.00 54.08  ? 224  TYR C CZ    1 
ATOM   8350  O  OH    . TYR C  3  224 ? 34.171  102.033 58.660  1.00 52.17  ? 224  TYR C OH    1 
ATOM   8351  N  N     . TYR C  3  225 ? 31.263  108.587 63.351  1.00 51.35  ? 225  TYR C N     1 
ATOM   8352  C  CA    . TYR C  3  225 ? 30.368  109.597 63.859  1.00 51.40  ? 225  TYR C CA    1 
ATOM   8353  C  C     . TYR C  3  225 ? 30.959  110.978 63.963  1.00 53.05  ? 225  TYR C C     1 
ATOM   8354  O  O     . TYR C  3  225 ? 30.220  111.950 64.063  1.00 54.80  ? 225  TYR C O     1 
ATOM   8355  C  CB    . TYR C  3  225 ? 29.773  109.148 65.185  1.00 49.77  ? 225  TYR C CB    1 
ATOM   8356  C  CG    . TYR C  3  225 ? 28.959  107.906 64.999  1.00 49.35  ? 225  TYR C CG    1 
ATOM   8357  C  CD1   . TYR C  3  225 ? 29.446  106.667 65.387  1.00 50.99  ? 225  TYR C CD1   1 
ATOM   8358  C  CD2   . TYR C  3  225 ? 27.743  107.950 64.329  1.00 50.55  ? 225  TYR C CD2   1 
ATOM   8359  C  CE1   . TYR C  3  225 ? 28.738  105.495 65.106  1.00 51.49  ? 225  TYR C CE1   1 
ATOM   8360  C  CE2   . TYR C  3  225 ? 27.034  106.793 64.035  1.00 49.80  ? 225  TYR C CE2   1 
ATOM   8361  C  CZ    . TYR C  3  225 ? 27.537  105.572 64.428  1.00 50.85  ? 225  TYR C CZ    1 
ATOM   8362  O  OH    . TYR C  3  225 ? 26.836  104.424 64.159  1.00 53.65  ? 225  TYR C OH    1 
ATOM   8363  N  N     . SER C  3  226 ? 32.279  111.095 63.951  1.00 53.91  ? 226  SER C N     1 
ATOM   8364  C  CA    . SER C  3  226 ? 32.849  112.431 64.003  1.00 54.64  ? 226  SER C CA    1 
ATOM   8365  C  C     . SER C  3  226 ? 32.443  113.050 62.665  1.00 54.65  ? 226  SER C C     1 
ATOM   8366  O  O     . SER C  3  226 ? 31.977  114.179 62.612  1.00 52.60  ? 226  SER C O     1 
ATOM   8367  C  CB    . SER C  3  226 ? 34.372  112.372 64.159  1.00 56.40  ? 226  SER C CB    1 
ATOM   8368  O  OG    . SER C  3  226 ? 34.939  111.358 63.353  1.00 60.95  ? 226  SER C OG    1 
ATOM   8369  N  N     . PHE C  3  227 ? 32.585  112.276 61.590  1.00 55.59  ? 227  PHE C N     1 
ATOM   8370  C  CA    . PHE C  3  227 ? 32.203  112.726 60.253  1.00 56.49  ? 227  PHE C CA    1 
ATOM   8371  C  C     . PHE C  3  227 ? 30.700  112.943 60.147  1.00 57.02  ? 227  PHE C C     1 
ATOM   8372  O  O     . PHE C  3  227 ? 30.243  113.929 59.566  1.00 56.70  ? 227  PHE C O     1 
ATOM   8373  C  CB    . PHE C  3  227 ? 32.616  111.698 59.206  1.00 58.11  ? 227  PHE C CB    1 
ATOM   8374  C  CG    . PHE C  3  227 ? 33.922  111.993 58.570  1.00 61.43  ? 227  PHE C CG    1 
ATOM   8375  C  CD1   . PHE C  3  227 ? 33.993  112.811 57.465  1.00 62.72  ? 227  PHE C CD1   1 
ATOM   8376  C  CD2   . PHE C  3  227 ? 35.099  111.507 59.117  1.00 63.44  ? 227  PHE C CD2   1 
ATOM   8377  C  CE1   . PHE C  3  227 ? 35.225  113.147 56.916  1.00 64.28  ? 227  PHE C CE1   1 
ATOM   8378  C  CE2   . PHE C  3  227 ? 36.333  111.840 58.573  1.00 63.14  ? 227  PHE C CE2   1 
ATOM   8379  C  CZ    . PHE C  3  227 ? 36.395  112.658 57.476  1.00 63.03  ? 227  PHE C CZ    1 
ATOM   8380  N  N     . LYS C  3  228 ? 29.922  112.015 60.696  1.00 57.02  ? 228  LYS C N     1 
ATOM   8381  C  CA    . LYS C  3  228 ? 28.479  112.154 60.627  1.00 55.47  ? 228  LYS C CA    1 
ATOM   8382  C  C     . LYS C  3  228 ? 28.086  113.411 61.376  1.00 54.74  ? 228  LYS C C     1 
ATOM   8383  O  O     . LYS C  3  228 ? 27.356  114.245 60.853  1.00 55.79  ? 228  LYS C O     1 
ATOM   8384  C  CB    . LYS C  3  228 ? 27.781  110.940 61.231  1.00 55.06  ? 228  LYS C CB    1 
ATOM   8385  C  CG    . LYS C  3  228 ? 26.340  110.838 60.793  1.00 55.67  ? 228  LYS C CG    1 
ATOM   8386  C  CD    . LYS C  3  228 ? 25.635  109.639 61.386  1.00 57.33  ? 228  LYS C CD    1 
ATOM   8387  C  CE    . LYS C  3  228 ? 24.200  109.587 60.889  1.00 58.20  ? 228  LYS C CE    1 
ATOM   8388  N  NZ    . LYS C  3  228 ? 23.436  108.503 61.534  1.00 58.67  ? 228  LYS C NZ    1 
ATOM   8389  N  N     . ASP C  3  229 ? 28.597  113.565 62.591  1.00 54.01  ? 229  ASP C N     1 
ATOM   8390  C  CA    . ASP C  3  229 ? 28.288  114.743 63.394  1.00 52.92  ? 229  ASP C CA    1 
ATOM   8391  C  C     . ASP C  3  229 ? 28.632  116.056 62.689  1.00 52.12  ? 229  ASP C C     1 
ATOM   8392  O  O     . ASP C  3  229 ? 27.804  116.958 62.637  1.00 52.83  ? 229  ASP C O     1 
ATOM   8393  C  CB    . ASP C  3  229 ? 28.967  114.637 64.767  1.00 51.87  ? 229  ASP C CB    1 
ATOM   8394  C  CG    . ASP C  3  229 ? 28.283  113.594 65.676  1.00 52.87  ? 229  ASP C CG    1 
ATOM   8395  O  OD1   . ASP C  3  229 ? 28.735  113.375 66.822  1.00 51.29  ? 229  ASP C OD1   1 
ATOM   8396  O  OD2   . ASP C  3  229 ? 27.278  112.988 65.240  1.00 52.37  ? 229  ASP C OD2   1 
ATOM   8397  N  N     . ILE C  3  230 ? 29.825  116.168 62.120  1.00 52.31  ? 230  ILE C N     1 
ATOM   8398  C  CA    . ILE C  3  230 ? 30.193  117.399 61.413  1.00 52.22  ? 230  ILE C CA    1 
ATOM   8399  C  C     . ILE C  3  230 ? 29.149  117.699 60.348  1.00 50.52  ? 230  ILE C C     1 
ATOM   8400  O  O     . ILE C  3  230 ? 28.721  118.838 60.196  1.00 50.45  ? 230  ILE C O     1 
ATOM   8401  C  CB    . ILE C  3  230 ? 31.567  117.285 60.709  1.00 53.68  ? 230  ILE C CB    1 
ATOM   8402  C  CG1   . ILE C  3  230 ? 32.648  116.906 61.715  1.00 56.28  ? 230  ILE C CG1   1 
ATOM   8403  C  CG2   . ILE C  3  230 ? 31.939  118.606 60.083  1.00 53.53  ? 230  ILE C CG2   1 
ATOM   8404  C  CD1   . ILE C  3  230 ? 32.762  117.872 62.898  1.00 57.25  ? 230  ILE C CD1   1 
ATOM   8405  N  N     . LEU C  3  231 ? 28.749  116.672 59.608  1.00 49.15  ? 231  LEU C N     1 
ATOM   8406  C  CA    . LEU C  3  231 ? 27.745  116.836 58.564  1.00 49.87  ? 231  LEU C CA    1 
ATOM   8407  C  C     . LEU C  3  231 ? 26.461  117.378 59.193  1.00 50.41  ? 231  LEU C C     1 
ATOM   8408  O  O     . LEU C  3  231 ? 25.842  118.332 58.695  1.00 48.88  ? 231  LEU C O     1 
ATOM   8409  C  CB    . LEU C  3  231 ? 27.455  115.491 57.889  1.00 48.17  ? 231  LEU C CB    1 
ATOM   8410  C  CG    . LEU C  3  231 ? 26.228  115.475 56.968  1.00 47.46  ? 231  LEU C CG    1 
ATOM   8411  C  CD1   . LEU C  3  231 ? 26.390  116.507 55.856  1.00 46.25  ? 231  LEU C CD1   1 
ATOM   8412  C  CD2   . LEU C  3  231 ? 26.044  114.084 56.386  1.00 45.98  ? 231  LEU C CD2   1 
ATOM   8413  N  N     . GLY C  3  232 ? 26.075  116.752 60.298  1.00 50.21  ? 232  GLY C N     1 
ATOM   8414  C  CA    . GLY C  3  232 ? 24.882  117.161 61.001  1.00 50.64  ? 232  GLY C CA    1 
ATOM   8415  C  C     . GLY C  3  232 ? 24.955  118.617 61.382  1.00 51.63  ? 232  GLY C C     1 
ATOM   8416  O  O     . GLY C  3  232 ? 24.024  119.367 61.110  1.00 51.99  ? 232  GLY C O     1 
ATOM   8417  N  N     . LEU C  3  233 ? 26.063  119.017 62.006  1.00 52.78  ? 233  LEU C N     1 
ATOM   8418  C  CA    . LEU C  3  233 ? 26.262  120.400 62.426  1.00 52.08  ? 233  LEU C CA    1 
ATOM   8419  C  C     . LEU C  3  233 ? 25.996  121.344 61.262  1.00 53.08  ? 233  LEU C C     1 
ATOM   8420  O  O     . LEU C  3  233 ? 25.210  122.272 61.390  1.00 51.95  ? 233  LEU C O     1 
ATOM   8421  C  CB    . LEU C  3  233 ? 27.687  120.601 62.937  1.00 51.20  ? 233  LEU C CB    1 
ATOM   8422  C  CG    . LEU C  3  233 ? 28.060  122.018 63.404  1.00 53.30  ? 233  LEU C CG    1 
ATOM   8423  C  CD1   . LEU C  3  233 ? 27.435  122.333 64.757  1.00 52.96  ? 233  LEU C CD1   1 
ATOM   8424  C  CD2   . LEU C  3  233 ? 29.559  122.131 63.519  1.00 52.70  ? 233  LEU C CD2   1 
ATOM   8425  N  N     . THR C  3  234 ? 26.635  121.091 60.120  1.00 55.24  ? 234  THR C N     1 
ATOM   8426  C  CA    . THR C  3  234 ? 26.461  121.939 58.931  1.00 57.00  ? 234  THR C CA    1 
ATOM   8427  C  C     . THR C  3  234 ? 25.027  121.999 58.429  1.00 56.91  ? 234  THR C C     1 
ATOM   8428  O  O     . THR C  3  234 ? 24.638  122.972 57.790  1.00 57.12  ? 234  THR C O     1 
ATOM   8429  C  CB    . THR C  3  234 ? 27.316  121.475 57.750  1.00 56.89  ? 234  THR C CB    1 
ATOM   8430  O  OG1   . THR C  3  234 ? 26.873  120.177 57.343  1.00 59.07  ? 234  THR C OG1   1 
ATOM   8431  C  CG2   . THR C  3  234 ? 28.779  121.432 58.133  1.00 56.06  ? 234  THR C CG2   1 
ATOM   8432  N  N     . LEU C  3  235 ? 24.250  120.952 58.680  1.00 57.40  ? 235  LEU C N     1 
ATOM   8433  C  CA    . LEU C  3  235 ? 22.856  120.976 58.259  1.00 58.40  ? 235  LEU C CA    1 
ATOM   8434  C  C     . LEU C  3  235 ? 22.068  121.888 59.212  1.00 60.23  ? 235  LEU C C     1 
ATOM   8435  O  O     . LEU C  3  235 ? 21.278  122.714 58.769  1.00 61.42  ? 235  LEU C O     1 
ATOM   8436  C  CB    . LEU C  3  235 ? 22.279  119.565 58.233  1.00 55.56  ? 235  LEU C CB    1 
ATOM   8437  C  CG    . LEU C  3  235 ? 23.000  118.685 57.207  1.00 55.84  ? 235  LEU C CG    1 
ATOM   8438  C  CD1   . LEU C  3  235 ? 22.408  117.302 57.210  1.00 55.16  ? 235  LEU C CD1   1 
ATOM   8439  C  CD2   . LEU C  3  235 ? 22.888  119.288 55.825  1.00 53.78  ? 235  LEU C CD2   1 
ATOM   8440  N  N     . MET C  3  236 ? 22.294  121.769 60.516  1.00 61.49  ? 236  MET C N     1 
ATOM   8441  C  CA    . MET C  3  236 ? 21.596  122.640 61.458  1.00 63.39  ? 236  MET C CA    1 
ATOM   8442  C  C     . MET C  3  236 ? 22.039  124.089 61.235  1.00 63.71  ? 236  MET C C     1 
ATOM   8443  O  O     . MET C  3  236 ? 21.246  125.023 61.338  1.00 64.94  ? 236  MET C O     1 
ATOM   8444  C  CB    . MET C  3  236 ? 21.921  122.271 62.918  1.00 65.48  ? 236  MET C CB    1 
ATOM   8445  C  CG    . MET C  3  236 ? 21.272  123.218 63.971  1.00 66.22  ? 236  MET C CG    1 
ATOM   8446  S  SD    . MET C  3  236 ? 22.155  123.396 65.582  1.00 67.91  ? 236  MET C SD    1 
ATOM   8447  C  CE    . MET C  3  236 ? 21.742  125.030 66.032  1.00 63.83  ? 236  MET C CE    1 
ATOM   8448  N  N     . LEU C  3  237 ? 23.316  124.269 60.934  1.00 62.64  ? 237  LEU C N     1 
ATOM   8449  C  CA    . LEU C  3  237 ? 23.859  125.597 60.760  1.00 60.85  ? 237  LEU C CA    1 
ATOM   8450  C  C     . LEU C  3  237 ? 23.172  126.444 59.714  1.00 59.50  ? 237  LEU C C     1 
ATOM   8451  O  O     . LEU C  3  237 ? 22.978  127.645 59.917  1.00 59.11  ? 237  LEU C O     1 
ATOM   8452  C  CB    . LEU C  3  237 ? 25.355  125.502 60.467  1.00 62.70  ? 237  LEU C CB    1 
ATOM   8453  C  CG    . LEU C  3  237 ? 26.242  126.296 61.445  1.00 64.42  ? 237  LEU C CG    1 
ATOM   8454  C  CD1   . LEU C  3  237 ? 25.546  126.391 62.807  1.00 63.91  ? 237  LEU C CD1   1 
ATOM   8455  C  CD2   . LEU C  3  237 ? 27.631  125.634 61.573  1.00 62.85  ? 237  LEU C CD2   1 
ATOM   8456  N  N     . THR C  3  238 ? 22.780  125.836 58.605  1.00 57.10  ? 238  THR C N     1 
ATOM   8457  C  CA    . THR C  3  238 ? 22.145  126.616 57.564  1.00 56.03  ? 238  THR C CA    1 
ATOM   8458  C  C     . THR C  3  238 ? 20.890  127.356 58.040  1.00 55.57  ? 238  THR C C     1 
ATOM   8459  O  O     . THR C  3  238 ? 20.860  128.586 58.040  1.00 54.91  ? 238  THR C O     1 
ATOM   8460  C  CB    . THR C  3  238 ? 21.838  125.745 56.342  1.00 55.65  ? 238  THR C CB    1 
ATOM   8461  O  OG1   . THR C  3  238 ? 23.048  125.144 55.877  1.00 53.97  ? 238  THR C OG1   1 
ATOM   8462  C  CG2   . THR C  3  238 ? 21.293  126.592 55.221  1.00 57.04  ? 238  THR C CG2   1 
ATOM   8463  N  N     . PRO C  3  239 ? 19.841  126.629 58.459  1.00 55.75  ? 239  PRO C N     1 
ATOM   8464  C  CA    . PRO C  3  239 ? 18.631  127.320 58.922  1.00 55.57  ? 239  PRO C CA    1 
ATOM   8465  C  C     . PRO C  3  239 ? 18.927  128.335 60.010  1.00 56.27  ? 239  PRO C C     1 
ATOM   8466  O  O     . PRO C  3  239 ? 18.433  129.455 59.961  1.00 57.57  ? 239  PRO C O     1 
ATOM   8467  C  CB    . PRO C  3  239 ? 17.739  126.185 59.415  1.00 54.36  ? 239  PRO C CB    1 
ATOM   8468  C  CG    . PRO C  3  239 ? 18.705  125.119 59.775  1.00 55.57  ? 239  PRO C CG    1 
ATOM   8469  C  CD    . PRO C  3  239 ? 19.721  125.179 58.667  1.00 55.37  ? 239  PRO C CD    1 
ATOM   8470  N  N     . PHE C  3  240 ? 19.740  127.940 60.985  1.00 57.03  ? 240  PHE C N     1 
ATOM   8471  C  CA    . PHE C  3  240 ? 20.128  128.823 62.087  1.00 57.78  ? 240  PHE C CA    1 
ATOM   8472  C  C     . PHE C  3  240 ? 20.739  130.115 61.563  1.00 58.49  ? 240  PHE C C     1 
ATOM   8473  O  O     . PHE C  3  240 ? 20.398  131.192 62.037  1.00 60.46  ? 240  PHE C O     1 
ATOM   8474  C  CB    . PHE C  3  240 ? 21.132  128.114 62.997  1.00 57.89  ? 240  PHE C CB    1 
ATOM   8475  C  CG    . PHE C  3  240 ? 21.762  128.999 64.045  1.00 57.63  ? 240  PHE C CG    1 
ATOM   8476  C  CD1   . PHE C  3  240 ? 23.122  128.891 64.330  1.00 59.02  ? 240  PHE C CD1   1 
ATOM   8477  C  CD2   . PHE C  3  240 ? 21.006  129.887 64.784  1.00 58.73  ? 240  PHE C CD2   1 
ATOM   8478  C  CE1   . PHE C  3  240 ? 23.720  129.651 65.336  1.00 59.07  ? 240  PHE C CE1   1 
ATOM   8479  C  CE2   . PHE C  3  240 ? 21.599  130.657 65.799  1.00 60.01  ? 240  PHE C CE2   1 
ATOM   8480  C  CZ    . PHE C  3  240 ? 22.956  130.534 66.070  1.00 59.54  ? 240  PHE C CZ    1 
ATOM   8481  N  N     . LEU C  3  241 ? 21.638  130.022 60.589  1.00 57.59  ? 241  LEU C N     1 
ATOM   8482  C  CA    . LEU C  3  241 ? 22.251  131.226 60.053  1.00 57.23  ? 241  LEU C CA    1 
ATOM   8483  C  C     . LEU C  3  241 ? 21.322  131.957 59.100  1.00 57.07  ? 241  LEU C C     1 
ATOM   8484  O  O     . LEU C  3  241 ? 21.319  133.182 59.040  1.00 57.71  ? 241  LEU C O     1 
ATOM   8485  C  CB    . LEU C  3  241 ? 23.554  130.893 59.345  1.00 57.57  ? 241  LEU C CB    1 
ATOM   8486  C  CG    . LEU C  3  241 ? 24.645  130.327 60.247  1.00 58.33  ? 241  LEU C CG    1 
ATOM   8487  C  CD1   . LEU C  3  241 ? 25.951  130.381 59.484  1.00 59.53  ? 241  LEU C CD1   1 
ATOM   8488  C  CD2   . LEU C  3  241 ? 24.757  131.135 61.539  1.00 57.43  ? 241  LEU C CD2   1 
ATOM   8489  N  N     . THR C  3  242 ? 20.538  131.208 58.341  1.00 56.86  ? 242  THR C N     1 
ATOM   8490  C  CA    . THR C  3  242 ? 19.594  131.819 57.415  1.00 57.75  ? 242  THR C CA    1 
ATOM   8491  C  C     . THR C  3  242 ? 18.681  132.714 58.230  1.00 58.14  ? 242  THR C C     1 
ATOM   8492  O  O     . THR C  3  242 ? 18.471  133.882 57.917  1.00 58.75  ? 242  THR C O     1 
ATOM   8493  C  CB    . THR C  3  242 ? 18.754  130.751 56.734  1.00 58.13  ? 242  THR C CB    1 
ATOM   8494  O  OG1   . THR C  3  242 ? 19.618  129.924 55.942  1.00 60.71  ? 242  THR C OG1   1 
ATOM   8495  C  CG2   . THR C  3  242 ? 17.683  131.380 55.865  1.00 55.56  ? 242  THR C CG2   1 
ATOM   8496  N  N     . LEU C  3  243 ? 18.144  132.133 59.291  1.00 57.87  ? 243  LEU C N     1 
ATOM   8497  C  CA    . LEU C  3  243 ? 17.272  132.828 60.207  1.00 56.92  ? 243  LEU C CA    1 
ATOM   8498  C  C     . LEU C  3  243 ? 18.026  134.020 60.803  1.00 56.46  ? 243  LEU C C     1 
ATOM   8499  O  O     . LEU C  3  243 ? 17.581  135.155 60.724  1.00 57.69  ? 243  LEU C O     1 
ATOM   8500  C  CB    . LEU C  3  243 ? 16.866  131.857 61.304  1.00 57.36  ? 243  LEU C CB    1 
ATOM   8501  C  CG    . LEU C  3  243 ? 15.634  132.219 62.114  1.00 59.89  ? 243  LEU C CG    1 
ATOM   8502  C  CD1   . LEU C  3  243 ? 14.486  132.538 61.172  1.00 58.68  ? 243  LEU C CD1   1 
ATOM   8503  C  CD2   . LEU C  3  243 ? 15.296  131.062 63.039  1.00 59.59  ? 243  LEU C CD2   1 
ATOM   8504  N  N     . ALA C  3  244 ? 19.183  133.757 61.389  1.00 56.09  ? 244  ALA C N     1 
ATOM   8505  C  CA    . ALA C  3  244 ? 19.974  134.813 62.004  1.00 56.00  ? 244  ALA C CA    1 
ATOM   8506  C  C     . ALA C  3  244 ? 20.307  135.949 61.067  1.00 56.32  ? 244  ALA C C     1 
ATOM   8507  O  O     . ALA C  3  244 ? 20.134  137.107 61.422  1.00 59.46  ? 244  ALA C O     1 
ATOM   8508  C  CB    . ALA C  3  244 ? 21.269  134.248 62.586  1.00 53.96  ? 244  ALA C CB    1 
ATOM   8509  N  N     . LEU C  3  245 ? 20.785  135.632 59.873  1.00 54.99  ? 245  LEU C N     1 
ATOM   8510  C  CA    . LEU C  3  245 ? 21.185  136.667 58.936  1.00 53.36  ? 245  LEU C CA    1 
ATOM   8511  C  C     . LEU C  3  245 ? 20.071  137.276 58.122  1.00 53.93  ? 245  LEU C C     1 
ATOM   8512  O  O     . LEU C  3  245 ? 20.115  138.459 57.817  1.00 54.92  ? 245  LEU C O     1 
ATOM   8513  C  CB    . LEU C  3  245 ? 22.261  136.127 57.998  1.00 52.77  ? 245  LEU C CB    1 
ATOM   8514  C  CG    . LEU C  3  245 ? 23.636  135.910 58.635  1.00 52.02  ? 245  LEU C CG    1 
ATOM   8515  C  CD1   . LEU C  3  245 ? 24.498  135.001 57.760  1.00 51.71  ? 245  LEU C CD1   1 
ATOM   8516  C  CD2   . LEU C  3  245 ? 24.302  137.266 58.847  1.00 52.66  ? 245  LEU C CD2   1 
ATOM   8517  N  N     . PHE C  3  246 ? 19.067  136.489 57.765  1.00 54.54  ? 246  PHE C N     1 
ATOM   8518  C  CA    . PHE C  3  246 ? 17.978  137.024 56.959  1.00 54.68  ? 246  PHE C CA    1 
ATOM   8519  C  C     . PHE C  3  246 ? 16.730  137.486 57.716  1.00 55.39  ? 246  PHE C C     1 
ATOM   8520  O  O     . PHE C  3  246 ? 16.213  138.556 57.433  1.00 56.39  ? 246  PHE C O     1 
ATOM   8521  C  CB    . PHE C  3  246 ? 17.598  136.017 55.884  1.00 55.01  ? 246  PHE C CB    1 
ATOM   8522  C  CG    . PHE C  3  246 ? 18.656  135.829 54.832  1.00 56.44  ? 246  PHE C CG    1 
ATOM   8523  C  CD1   . PHE C  3  246 ? 19.334  134.616 54.707  1.00 56.40  ? 246  PHE C CD1   1 
ATOM   8524  C  CD2   . PHE C  3  246 ? 18.977  136.867 53.963  1.00 55.80  ? 246  PHE C CD2   1 
ATOM   8525  C  CE1   . PHE C  3  246 ? 20.315  134.445 53.731  1.00 55.73  ? 246  PHE C CE1   1 
ATOM   8526  C  CE2   . PHE C  3  246 ? 19.957  136.702 52.984  1.00 55.37  ? 246  PHE C CE2   1 
ATOM   8527  C  CZ    . PHE C  3  246 ? 20.626  135.491 52.868  1.00 54.81  ? 246  PHE C CZ    1 
ATOM   8528  N  N     . SER C  3  247 ? 16.245  136.701 58.671  1.00 55.56  ? 247  SER C N     1 
ATOM   8529  C  CA    . SER C  3  247 ? 15.063  137.074 59.446  1.00 55.09  ? 247  SER C CA    1 
ATOM   8530  C  C     . SER C  3  247 ? 15.433  137.033 60.923  1.00 54.67  ? 247  SER C C     1 
ATOM   8531  O  O     . SER C  3  247 ? 14.983  136.160 61.669  1.00 56.68  ? 247  SER C O     1 
ATOM   8532  C  CB    . SER C  3  247 ? 13.947  136.077 59.166  1.00 56.48  ? 247  SER C CB    1 
ATOM   8533  O  OG    . SER C  3  247 ? 12.788  136.401 59.905  1.00 61.19  ? 247  SER C OG    1 
ATOM   8534  N  N     . PRO C  3  248 ? 16.254  137.985 61.367  1.00 53.15  ? 248  PRO C N     1 
ATOM   8535  C  CA    . PRO C  3  248 ? 16.745  138.114 62.740  1.00 53.36  ? 248  PRO C CA    1 
ATOM   8536  C  C     . PRO C  3  248 ? 15.758  138.036 63.878  1.00 53.29  ? 248  PRO C C     1 
ATOM   8537  O  O     . PRO C  3  248 ? 15.985  137.305 64.830  1.00 54.63  ? 248  PRO C O     1 
ATOM   8538  C  CB    . PRO C  3  248 ? 17.465  139.447 62.724  1.00 52.71  ? 248  PRO C CB    1 
ATOM   8539  C  CG    . PRO C  3  248 ? 17.935  139.547 61.314  1.00 53.02  ? 248  PRO C CG    1 
ATOM   8540  C  CD    . PRO C  3  248 ? 16.727  139.106 60.550  1.00 52.75  ? 248  PRO C CD    1 
ATOM   8541  N  N     . ASN C  3  249 ? 14.665  138.778 63.798  1.00 53.25  ? 249  ASN C N     1 
ATOM   8542  C  CA    . ASN C  3  249 ? 13.705  138.761 64.893  1.00 53.55  ? 249  ASN C CA    1 
ATOM   8543  C  C     . ASN C  3  249 ? 12.521  137.859 64.638  1.00 53.03  ? 249  ASN C C     1 
ATOM   8544  O  O     . ASN C  3  249 ? 11.519  137.959 65.333  1.00 53.36  ? 249  ASN C O     1 
ATOM   8545  C  CB    . ASN C  3  249 ? 13.197  140.171 65.158  1.00 56.11  ? 249  ASN C CB    1 
ATOM   8546  C  CG    . ASN C  3  249 ? 14.298  141.207 65.060  1.00 59.01  ? 249  ASN C CG    1 
ATOM   8547  O  OD1   . ASN C  3  249 ? 15.185  141.263 65.907  1.00 59.36  ? 249  ASN C OD1   1 
ATOM   8548  N  ND2   . ASN C  3  249 ? 14.257  142.027 64.006  1.00 61.23  ? 249  ASN C ND2   1 
ATOM   8549  N  N     . LEU C  3  250 ? 12.628  136.977 63.651  1.00 52.08  ? 250  LEU C N     1 
ATOM   8550  C  CA    . LEU C  3  250 ? 11.517  136.098 63.335  1.00 50.65  ? 250  LEU C CA    1 
ATOM   8551  C  C     . LEU C  3  250 ? 10.991  135.402 64.564  1.00 50.71  ? 250  LEU C C     1 
ATOM   8552  O  O     . LEU C  3  250 ? 9.815   135.497 64.878  1.00 49.85  ? 250  LEU C O     1 
ATOM   8553  C  CB    . LEU C  3  250 ? 11.916  135.042 62.313  1.00 51.14  ? 250  LEU C CB    1 
ATOM   8554  C  CG    . LEU C  3  250 ? 10.668  134.355 61.739  1.00 52.52  ? 250  LEU C CG    1 
ATOM   8555  C  CD1   . LEU C  3  250 ? 9.901   135.375 60.919  1.00 51.02  ? 250  LEU C CD1   1 
ATOM   8556  C  CD2   . LEU C  3  250 ? 11.024  133.156 60.874  1.00 51.52  ? 250  LEU C CD2   1 
ATOM   8557  N  N     . LEU C  3  251 ? 11.873  134.711 65.270  1.00 52.68  ? 251  LEU C N     1 
ATOM   8558  C  CA    . LEU C  3  251 ? 11.478  133.965 66.461  1.00 54.15  ? 251  LEU C CA    1 
ATOM   8559  C  C     . LEU C  3  251 ? 11.324  134.831 67.725  1.00 55.34  ? 251  LEU C C     1 
ATOM   8560  O  O     . LEU C  3  251 ? 10.989  134.326 68.817  1.00 56.90  ? 251  LEU C O     1 
ATOM   8561  C  CB    . LEU C  3  251 ? 12.490  132.835 66.715  1.00 52.61  ? 251  LEU C CB    1 
ATOM   8562  C  CG    . LEU C  3  251 ? 12.863  132.009 65.484  1.00 51.44  ? 251  LEU C CG    1 
ATOM   8563  C  CD1   . LEU C  3  251 ? 13.860  130.960 65.867  1.00 51.43  ? 251  LEU C CD1   1 
ATOM   8564  C  CD2   . LEU C  3  251 ? 11.636  131.372 64.899  1.00 49.16  ? 251  LEU C CD2   1 
ATOM   8565  N  N     . GLY C  3  252 ? 11.539  136.132 67.579  1.00 54.26  ? 252  GLY C N     1 
ATOM   8566  C  CA    . GLY C  3  252 ? 11.434  136.996 68.734  1.00 55.40  ? 252  GLY C CA    1 
ATOM   8567  C  C     . GLY C  3  252 ? 10.279  137.967 68.757  1.00 56.47  ? 252  GLY C C     1 
ATOM   8568  O  O     . GLY C  3  252 ? 9.789   138.423 67.725  1.00 58.43  ? 252  GLY C O     1 
ATOM   8569  N  N     . ASP C  3  253 ? 9.865   138.308 69.968  1.00 57.77  ? 253  ASP C N     1 
ATOM   8570  C  CA    . ASP C  3  253 ? 8.759   139.233 70.184  1.00 57.84  ? 253  ASP C CA    1 
ATOM   8571  C  C     . ASP C  3  253 ? 9.213   140.667 69.955  1.00 56.28  ? 253  ASP C C     1 
ATOM   8572  O  O     . ASP C  3  253 ? 10.267  141.075 70.425  1.00 56.83  ? 253  ASP C O     1 
ATOM   8573  C  CB    . ASP C  3  253 ? 8.231   139.078 71.608  1.00 59.92  ? 253  ASP C CB    1 
ATOM   8574  C  CG    . ASP C  3  253 ? 6.869   139.660 71.771  1.00 61.65  ? 253  ASP C CG    1 
ATOM   8575  O  OD1   . ASP C  3  253 ? 6.704   140.820 71.334  1.00 64.73  ? 253  ASP C OD1   1 
ATOM   8576  O  OD2   . ASP C  3  253 ? 5.980   138.967 72.323  1.00 61.35  ? 253  ASP C OD2   1 
ATOM   8577  N  N     . PRO C  3  254 ? 8.421   141.453 69.223  1.00 55.23  ? 254  PRO C N     1 
ATOM   8578  C  CA    . PRO C  3  254 ? 8.780   142.842 68.948  1.00 53.92  ? 254  PRO C CA    1 
ATOM   8579  C  C     . PRO C  3  254 ? 8.405   143.720 70.110  1.00 51.64  ? 254  PRO C C     1 
ATOM   8580  O  O     . PRO C  3  254 ? 8.792   144.883 70.180  1.00 52.43  ? 254  PRO C O     1 
ATOM   8581  C  CB    . PRO C  3  254 ? 7.959   143.160 67.711  1.00 53.92  ? 254  PRO C CB    1 
ATOM   8582  C  CG    . PRO C  3  254 ? 6.708   142.444 67.997  1.00 53.79  ? 254  PRO C CG    1 
ATOM   8583  C  CD    . PRO C  3  254 ? 7.184   141.094 68.511  1.00 55.30  ? 254  PRO C CD    1 
ATOM   8584  N  N     . GLU C  3  255 ? 7.639   143.154 71.022  1.00 48.97  ? 255  GLU C N     1 
ATOM   8585  C  CA    . GLU C  3  255 ? 7.204   143.892 72.183  1.00 49.43  ? 255  GLU C CA    1 
ATOM   8586  C  C     . GLU C  3  255 ? 8.381   144.222 73.087  1.00 48.91  ? 255  GLU C C     1 
ATOM   8587  O  O     . GLU C  3  255 ? 8.312   145.137 73.893  1.00 49.14  ? 255  GLU C O     1 
ATOM   8588  C  CB    . GLU C  3  255 ? 6.187   143.066 72.950  1.00 50.84  ? 255  GLU C CB    1 
ATOM   8589  C  CG    . GLU C  3  255 ? 5.616   143.766 74.138  1.00 57.11  ? 255  GLU C CG    1 
ATOM   8590  C  CD    . GLU C  3  255 ? 4.699   144.889 73.732  1.00 61.50  ? 255  GLU C CD    1 
ATOM   8591  O  OE1   . GLU C  3  255 ? 3.655   144.571 73.092  1.00 63.50  ? 255  GLU C OE1   1 
ATOM   8592  O  OE2   . GLU C  3  255 ? 5.031   146.068 74.050  1.00 61.58  ? 255  GLU C OE2   1 
ATOM   8593  N  N     . ASN C  3  256 ? 9.471   143.480 72.937  1.00 49.34  ? 256  ASN C N     1 
ATOM   8594  C  CA    . ASN C  3  256 ? 10.651  143.665 73.769  1.00 48.78  ? 256  ASN C CA    1 
ATOM   8595  C  C     . ASN C  3  256 ? 11.630  144.704 73.241  1.00 48.92  ? 256  ASN C C     1 
ATOM   8596  O  O     . ASN C  3  256 ? 12.816  144.688 73.583  1.00 51.11  ? 256  ASN C O     1 
ATOM   8597  C  CB    . ASN C  3  256 ? 11.357  142.322 73.960  1.00 50.45  ? 256  ASN C CB    1 
ATOM   8598  C  CG    . ASN C  3  256 ? 11.974  142.170 75.344  1.00 52.02  ? 256  ASN C CG    1 
ATOM   8599  O  OD1   . ASN C  3  256 ? 11.336  142.464 76.352  1.00 53.68  ? 256  ASN C OD1   1 
ATOM   8600  N  ND2   . ASN C  3  256 ? 13.214  141.689 75.396  1.00 53.30  ? 256  ASN C ND2   1 
ATOM   8601  N  N     . PHE C  3  257 ? 11.144  145.597 72.390  1.00 47.95  ? 257  PHE C N     1 
ATOM   8602  C  CA    . PHE C  3  257 ? 11.968  146.684 71.871  1.00 47.50  ? 257  PHE C CA    1 
ATOM   8603  C  C     . PHE C  3  257 ? 11.510  147.951 72.615  1.00 47.50  ? 257  PHE C C     1 
ATOM   8604  O  O     . PHE C  3  257 ? 11.910  149.072 72.305  1.00 46.25  ? 257  PHE C O     1 
ATOM   8605  C  CB    . PHE C  3  257 ? 11.766  146.867 70.372  1.00 46.75  ? 257  PHE C CB    1 
ATOM   8606  C  CG    . PHE C  3  257 ? 12.622  145.983 69.540  1.00 47.45  ? 257  PHE C CG    1 
ATOM   8607  C  CD1   . PHE C  3  257 ? 12.203  144.710 69.191  1.00 49.05  ? 257  PHE C CD1   1 
ATOM   8608  C  CD2   . PHE C  3  257 ? 13.856  146.426 69.084  1.00 49.63  ? 257  PHE C CD2   1 
ATOM   8609  C  CE1   . PHE C  3  257 ? 13.008  143.887 68.390  1.00 49.26  ? 257  PHE C CE1   1 
ATOM   8610  C  CE2   . PHE C  3  257 ? 14.673  145.606 68.277  1.00 49.25  ? 257  PHE C CE2   1 
ATOM   8611  C  CZ    . PHE C  3  257 ? 14.246  144.342 67.934  1.00 47.73  ? 257  PHE C CZ    1 
ATOM   8612  N  N     . THR C  3  258 ? 10.641  147.742 73.591  1.00 47.44  ? 258  THR C N     1 
ATOM   8613  C  CA    . THR C  3  258 ? 10.119  148.815 74.401  1.00 48.69  ? 258  THR C CA    1 
ATOM   8614  C  C     . THR C  3  258 ? 10.672  148.604 75.790  1.00 50.40  ? 258  THR C C     1 
ATOM   8615  O  O     . THR C  3  258 ? 10.357  147.609 76.458  1.00 52.10  ? 258  THR C O     1 
ATOM   8616  C  CB    . THR C  3  258 ? 8.614   148.758 74.512  1.00 49.29  ? 258  THR C CB    1 
ATOM   8617  O  OG1   . THR C  3  258 ? 8.031   148.843 73.211  1.00 50.72  ? 258  THR C OG1   1 
ATOM   8618  C  CG2   . THR C  3  258 ? 8.123   149.897 75.369  1.00 49.49  ? 258  THR C CG2   1 
ATOM   8619  N  N     . PRO C  3  259 ? 11.497  149.543 76.253  1.00 49.75  ? 259  PRO C N     1 
ATOM   8620  C  CA    . PRO C  3  259 ? 12.087  149.429 77.578  1.00 49.00  ? 259  PRO C CA    1 
ATOM   8621  C  C     . PRO C  3  259 ? 11.061  149.165 78.668  1.00 48.45  ? 259  PRO C C     1 
ATOM   8622  O  O     . PRO C  3  259 ? 9.978   149.745 78.691  1.00 46.74  ? 259  PRO C O     1 
ATOM   8623  C  CB    . PRO C  3  259 ? 12.809  150.759 77.730  1.00 49.64  ? 259  PRO C CB    1 
ATOM   8624  C  CG    . PRO C  3  259 ? 13.258  151.025 76.328  1.00 47.34  ? 259  PRO C CG    1 
ATOM   8625  C  CD    . PRO C  3  259 ? 11.994  150.743 75.567  1.00 48.72  ? 259  PRO C CD    1 
ATOM   8626  N  N     . ALA C  3  260 ? 11.426  148.258 79.561  1.00 48.75  ? 260  ALA C N     1 
ATOM   8627  C  CA    . ALA C  3  260 ? 10.574  147.890 80.672  1.00 48.99  ? 260  ALA C CA    1 
ATOM   8628  C  C     . ALA C  3  260 ? 9.894   149.098 81.304  1.00 47.69  ? 260  ALA C C     1 
ATOM   8629  O  O     . ALA C  3  260 ? 10.541  150.077 81.626  1.00 45.45  ? 260  ALA C O     1 
ATOM   8630  C  CB    . ALA C  3  260 ? 11.398  147.142 81.731  1.00 49.25  ? 260  ALA C CB    1 
ATOM   8631  N  N     . ASN C  3  261 ? 8.579   149.006 81.450  1.00 49.10  ? 261  ASN C N     1 
ATOM   8632  C  CA    . ASN C  3  261 ? 7.769   150.036 82.072  1.00 50.36  ? 261  ASN C CA    1 
ATOM   8633  C  C     . ASN C  3  261 ? 7.090   149.316 83.232  1.00 50.57  ? 261  ASN C C     1 
ATOM   8634  O  O     . ASN C  3  261 ? 6.130   148.561 83.039  1.00 48.49  ? 261  ASN C O     1 
ATOM   8635  C  CB    . ASN C  3  261 ? 6.718   150.553 81.097  1.00 53.88  ? 261  ASN C CB    1 
ATOM   8636  C  CG    . ASN C  3  261 ? 5.774   151.569 81.731  1.00 56.81  ? 261  ASN C CG    1 
ATOM   8637  O  OD1   . ASN C  3  261 ? 5.657   151.660 82.960  1.00 58.99  ? 261  ASN C OD1   1 
ATOM   8638  N  ND2   . ASN C  3  261 ? 5.077   152.326 80.890  1.00 57.51  ? 261  ASN C ND2   1 
ATOM   8639  N  N     . PRO C  3  262 ? 7.604   149.521 84.452  1.00 51.29  ? 262  PRO C N     1 
ATOM   8640  C  CA    . PRO C  3  262 ? 7.103   148.920 85.692  1.00 51.75  ? 262  PRO C CA    1 
ATOM   8641  C  C     . PRO C  3  262 ? 5.639   149.174 85.940  1.00 52.40  ? 262  PRO C C     1 
ATOM   8642  O  O     . PRO C  3  262 ? 5.023   148.488 86.741  1.00 55.18  ? 262  PRO C O     1 
ATOM   8643  C  CB    . PRO C  3  262 ? 7.968   149.562 86.766  1.00 50.77  ? 262  PRO C CB    1 
ATOM   8644  C  CG    . PRO C  3  262 ? 9.264   149.771 86.065  1.00 51.34  ? 262  PRO C CG    1 
ATOM   8645  C  CD    . PRO C  3  262 ? 8.827   150.300 84.711  1.00 51.26  ? 262  PRO C CD    1 
ATOM   8646  N  N     . LEU C  3  263 ? 5.081   150.150 85.244  1.00 52.43  ? 263  LEU C N     1 
ATOM   8647  C  CA    . LEU C  3  263 ? 3.691   150.501 85.445  1.00 54.31  ? 263  LEU C CA    1 
ATOM   8648  C  C     . LEU C  3  263 ? 2.743   150.032 84.367  1.00 55.33  ? 263  LEU C C     1 
ATOM   8649  O  O     . LEU C  3  263 ? 1.543   150.265 84.458  1.00 58.11  ? 263  LEU C O     1 
ATOM   8650  C  CB    . LEU C  3  263 ? 3.560   152.018 85.581  1.00 54.27  ? 263  LEU C CB    1 
ATOM   8651  C  CG    . LEU C  3  263 ? 4.418   152.646 86.687  1.00 56.93  ? 263  LEU C CG    1 
ATOM   8652  C  CD1   . LEU C  3  263 ? 4.290   154.173 86.685  1.00 55.30  ? 263  LEU C CD1   1 
ATOM   8653  C  CD2   . LEU C  3  263 ? 3.990   152.070 88.028  1.00 58.69  ? 263  LEU C CD2   1 
ATOM   8654  N  N     . VAL C  3  264 ? 3.247   149.364 83.346  1.00 54.75  ? 264  VAL C N     1 
ATOM   8655  C  CA    . VAL C  3  264 ? 2.350   148.962 82.288  1.00 54.13  ? 264  VAL C CA    1 
ATOM   8656  C  C     . VAL C  3  264 ? 2.671   147.624 81.689  1.00 55.38  ? 264  VAL C C     1 
ATOM   8657  O  O     . VAL C  3  264 ? 3.731   147.443 81.096  1.00 56.18  ? 264  VAL C O     1 
ATOM   8658  C  CB    . VAL C  3  264 ? 2.379   149.971 81.149  1.00 53.46  ? 264  VAL C CB    1 
ATOM   8659  C  CG1   . VAL C  3  264 ? 1.161   149.776 80.259  1.00 54.37  ? 264  VAL C CG1   1 
ATOM   8660  C  CG2   . VAL C  3  264 ? 2.453   151.366 81.701  1.00 53.12  ? 264  VAL C CG2   1 
ATOM   8661  N  N     . THR C  3  265 ? 1.758   146.675 81.835  1.00 56.03  ? 265  THR C N     1 
ATOM   8662  C  CA    . THR C  3  265 ? 1.989   145.375 81.240  1.00 56.25  ? 265  THR C CA    1 
ATOM   8663  C  C     . THR C  3  265 ? 1.367   145.450 79.859  1.00 56.88  ? 265  THR C C     1 
ATOM   8664  O  O     . THR C  3  265 ? 0.225   145.888 79.711  1.00 58.56  ? 265  THR C O     1 
ATOM   8665  C  CB    . THR C  3  265 ? 1.324   144.256 82.043  1.00 54.91  ? 265  THR C CB    1 
ATOM   8666  O  OG1   . THR C  3  265 ? 1.914   144.210 83.346  1.00 54.63  ? 265  THR C OG1   1 
ATOM   8667  C  CG2   . THR C  3  265 ? 1.513   142.909 81.349  1.00 52.60  ? 265  THR C CG2   1 
ATOM   8668  N  N     . PRO C  3  266 ? 2.128   145.083 78.826  1.00 56.14  ? 266  PRO C N     1 
ATOM   8669  C  CA    . PRO C  3  266 ? 1.603   145.120 77.469  1.00 56.68  ? 266  PRO C CA    1 
ATOM   8670  C  C     . PRO C  3  266 ? 0.340   144.300 77.386  1.00 57.91  ? 266  PRO C C     1 
ATOM   8671  O  O     . PRO C  3  266 ? 0.226   143.244 77.991  1.00 57.41  ? 266  PRO C O     1 
ATOM   8672  C  CB    . PRO C  3  266 ? 2.734   144.533 76.650  1.00 57.26  ? 266  PRO C CB    1 
ATOM   8673  C  CG    . PRO C  3  266 ? 3.923   145.102 77.334  1.00 59.34  ? 266  PRO C CG    1 
ATOM   8674  C  CD    . PRO C  3  266 ? 3.586   144.900 78.812  1.00 57.65  ? 266  PRO C CD    1 
ATOM   8675  N  N     . PRO C  3  267 ? -0.631  144.784 76.621  1.00 59.47  ? 267  PRO C N     1 
ATOM   8676  C  CA    . PRO C  3  267 ? -1.896  144.091 76.469  1.00 60.72  ? 267  PRO C CA    1 
ATOM   8677  C  C     . PRO C  3  267 ? -1.683  142.718 75.863  1.00 62.24  ? 267  PRO C C     1 
ATOM   8678  O  O     . PRO C  3  267 ? -2.408  141.784 76.176  1.00 63.63  ? 267  PRO C O     1 
ATOM   8679  C  CB    . PRO C  3  267 ? -2.673  145.029 75.562  1.00 60.28  ? 267  PRO C CB    1 
ATOM   8680  C  CG    . PRO C  3  267 ? -1.612  145.520 74.656  1.00 60.05  ? 267  PRO C CG    1 
ATOM   8681  C  CD    . PRO C  3  267 ? -0.489  145.837 75.601  1.00 60.59  ? 267  PRO C CD    1 
ATOM   8682  N  N     . HIS C  3  268 ? -0.695  142.594 74.986  1.00 64.23  ? 268  HIS C N     1 
ATOM   8683  C  CA    . HIS C  3  268 ? -0.421  141.308 74.356  1.00 67.22  ? 268  HIS C CA    1 
ATOM   8684  C  C     . HIS C  3  268 ? 0.934   140.894 74.848  1.00 67.03  ? 268  HIS C C     1 
ATOM   8685  O  O     . HIS C  3  268 ? 1.953   141.430 74.402  1.00 69.37  ? 268  HIS C O     1 
ATOM   8686  C  CB    . HIS C  3  268 ? -0.422  141.441 72.832  1.00 71.11  ? 268  HIS C CB    1 
ATOM   8687  C  CG    . HIS C  3  268 ? -1.775  141.732 72.258  1.00 75.63  ? 268  HIS C CG    1 
ATOM   8688  N  ND1   . HIS C  3  268 ? -1.965  142.585 71.190  1.00 76.56  ? 268  HIS C ND1   1 
ATOM   8689  C  CD2   . HIS C  3  268 ? -3.008  141.307 72.628  1.00 76.36  ? 268  HIS C CD2   1 
ATOM   8690  C  CE1   . HIS C  3  268 ? -3.258  142.677 70.931  1.00 78.26  ? 268  HIS C CE1   1 
ATOM   8691  N  NE2   . HIS C  3  268 ? -3.912  141.912 71.789  1.00 78.26  ? 268  HIS C NE2   1 
ATOM   8692  N  N     . ILE C  3  269 ? 0.947   139.949 75.782  1.00 64.52  ? 269  ILE C N     1 
ATOM   8693  C  CA    . ILE C  3  269 ? 2.197   139.494 76.365  1.00 61.32  ? 269  ILE C CA    1 
ATOM   8694  C  C     . ILE C  3  269 ? 2.310   137.995 76.325  1.00 62.21  ? 269  ILE C C     1 
ATOM   8695  O  O     . ILE C  3  269 ? 1.620   137.301 77.069  1.00 64.39  ? 269  ILE C O     1 
ATOM   8696  C  CB    . ILE C  3  269 ? 2.304   139.939 77.820  1.00 58.02  ? 269  ILE C CB    1 
ATOM   8697  C  CG1   . ILE C  3  269 ? 3.567   139.362 78.445  1.00 56.61  ? 269  ILE C CG1   1 
ATOM   8698  C  CG2   . ILE C  3  269 ? 1.064   139.526 78.575  1.00 54.29  ? 269  ILE C CG2   1 
ATOM   8699  C  CD1   . ILE C  3  269 ? 3.793   139.819 79.848  1.00 56.73  ? 269  ILE C CD1   1 
ATOM   8700  N  N     . LYS C  3  270 ? 3.186   137.484 75.472  1.00 60.81  ? 270  LYS C N     1 
ATOM   8701  C  CA    . LYS C  3  270 ? 3.339   136.049 75.387  1.00 59.74  ? 270  LYS C CA    1 
ATOM   8702  C  C     . LYS C  3  270 ? 4.756   135.590 75.675  1.00 58.44  ? 270  LYS C C     1 
ATOM   8703  O  O     . LYS C  3  270 ? 5.725   136.285 75.396  1.00 59.94  ? 270  LYS C O     1 
ATOM   8704  C  CB    . LYS C  3  270 ? 2.899   135.555 74.009  1.00 61.03  ? 270  LYS C CB    1 
ATOM   8705  C  CG    . LYS C  3  270 ? 1.451   135.913 73.668  1.00 67.33  ? 270  LYS C CG    1 
ATOM   8706  C  CD    . LYS C  3  270 ? 0.401   135.316 74.645  1.00 70.31  ? 270  LYS C CD    1 
ATOM   8707  C  CE    . LYS C  3  270 ? -0.995  135.958 74.455  1.00 72.88  ? 270  LYS C CE    1 
ATOM   8708  N  NZ    . LYS C  3  270 ? -1.018  137.454 74.740  1.00 74.23  ? 270  LYS C NZ    1 
ATOM   8709  N  N     . PRO C  3  271 ? 4.894   134.401 76.257  1.00 56.76  ? 271  PRO C N     1 
ATOM   8710  C  CA    . PRO C  3  271 ? 6.186   133.797 76.599  1.00 54.65  ? 271  PRO C CA    1 
ATOM   8711  C  C     . PRO C  3  271 ? 7.005   133.412 75.351  1.00 53.05  ? 271  PRO C C     1 
ATOM   8712  O  O     . PRO C  3  271 ? 6.454   133.242 74.259  1.00 51.99  ? 271  PRO C O     1 
ATOM   8713  C  CB    . PRO C  3  271 ? 5.770   132.574 77.402  1.00 55.34  ? 271  PRO C CB    1 
ATOM   8714  C  CG    . PRO C  3  271 ? 4.462   133.008 78.014  1.00 54.86  ? 271  PRO C CG    1 
ATOM   8715  C  CD    . PRO C  3  271 ? 3.787   133.653 76.870  1.00 55.26  ? 271  PRO C CD    1 
ATOM   8716  N  N     . GLU C  3  272 ? 8.318   133.276 75.510  1.00 51.74  ? 272  GLU C N     1 
ATOM   8717  C  CA    . GLU C  3  272 ? 9.171   132.887 74.393  1.00 51.63  ? 272  GLU C CA    1 
ATOM   8718  C  C     . GLU C  3  272 ? 8.628   131.559 73.832  1.00 51.53  ? 272  GLU C C     1 
ATOM   8719  O  O     . GLU C  3  272 ? 8.215   130.677 74.596  1.00 52.27  ? 272  GLU C O     1 
ATOM   8720  C  CB    . GLU C  3  272 ? 10.607  132.731 74.871  1.00 53.54  ? 272  GLU C CB    1 
ATOM   8721  C  CG    . GLU C  3  272 ? 11.172  133.932 75.614  1.00 58.81  ? 272  GLU C CG    1 
ATOM   8722  C  CD    . GLU C  3  272 ? 10.793  133.951 77.098  1.00 64.10  ? 272  GLU C CD    1 
ATOM   8723  O  OE1   . GLU C  3  272 ? 9.656   134.372 77.418  1.00 65.08  ? 272  GLU C OE1   1 
ATOM   8724  O  OE2   . GLU C  3  272 ? 11.638  133.539 77.940  1.00 66.84  ? 272  GLU C OE2   1 
ATOM   8725  N  N     . TRP C  3  273 ? 8.631   131.397 72.509  1.00 49.79  ? 273  TRP C N     1 
ATOM   8726  C  CA    . TRP C  3  273 ? 8.052   130.192 71.918  1.00 47.56  ? 273  TRP C CA    1 
ATOM   8727  C  C     . TRP C  3  273 ? 8.385   128.886 72.602  1.00 48.44  ? 273  TRP C C     1 
ATOM   8728  O  O     . TRP C  3  273 ? 7.503   128.043 72.761  1.00 49.59  ? 273  TRP C O     1 
ATOM   8729  C  CB    . TRP C  3  273 ? 8.377   130.082 70.431  1.00 45.17  ? 273  TRP C CB    1 
ATOM   8730  C  CG    . TRP C  3  273 ? 9.766   129.739 70.110  1.00 44.14  ? 273  TRP C CG    1 
ATOM   8731  C  CD1   . TRP C  3  273 ? 10.775  130.603 69.789  1.00 46.18  ? 273  TRP C CD1   1 
ATOM   8732  C  CD2   . TRP C  3  273 ? 10.325  128.430 70.063  1.00 43.25  ? 273  TRP C CD2   1 
ATOM   8733  N  NE1   . TRP C  3  273 ? 11.940  129.906 69.541  1.00 44.95  ? 273  TRP C NE1   1 
ATOM   8734  C  CE2   . TRP C  3  273 ? 11.691  128.570 69.706  1.00 44.64  ? 273  TRP C CE2   1 
ATOM   8735  C  CE3   . TRP C  3  273 ? 9.810   127.148 70.288  1.00 39.81  ? 273  TRP C CE3   1 
ATOM   8736  C  CZ2   . TRP C  3  273 ? 12.544  127.473 69.570  1.00 44.47  ? 273  TRP C CZ2   1 
ATOM   8737  C  CZ3   . TRP C  3  273 ? 10.654  126.059 70.153  1.00 40.36  ? 273  TRP C CZ3   1 
ATOM   8738  C  CH2   . TRP C  3  273 ? 12.009  126.226 69.797  1.00 42.80  ? 273  TRP C CH2   1 
ATOM   8739  N  N     . TYR C  3  274 ? 9.637   128.704 73.022  1.00 48.86  ? 274  TYR C N     1 
ATOM   8740  C  CA    . TYR C  3  274 ? 10.021  127.458 73.688  1.00 46.59  ? 274  TYR C CA    1 
ATOM   8741  C  C     . TYR C  3  274 ? 9.366   127.245 75.072  1.00 45.50  ? 274  TYR C C     1 
ATOM   8742  O  O     . TYR C  3  274 ? 9.503   126.187 75.678  1.00 42.94  ? 274  TYR C O     1 
ATOM   8743  C  CB    . TYR C  3  274 ? 11.559  127.339 73.757  1.00 47.26  ? 274  TYR C CB    1 
ATOM   8744  C  CG    . TYR C  3  274 ? 12.321  128.589 74.164  1.00 49.85  ? 274  TYR C CG    1 
ATOM   8745  C  CD1   . TYR C  3  274 ? 12.371  129.013 75.499  1.00 49.37  ? 274  TYR C CD1   1 
ATOM   8746  C  CD2   . TYR C  3  274 ? 13.004  129.347 73.211  1.00 50.41  ? 274  TYR C CD2   1 
ATOM   8747  C  CE1   . TYR C  3  274 ? 13.081  130.165 75.870  1.00 49.53  ? 274  TYR C CE1   1 
ATOM   8748  C  CE2   . TYR C  3  274 ? 13.724  130.503 73.575  1.00 50.12  ? 274  TYR C CE2   1 
ATOM   8749  C  CZ    . TYR C  3  274 ? 13.752  130.906 74.900  1.00 49.89  ? 274  TYR C CZ    1 
ATOM   8750  O  OH    . TYR C  3  274 ? 14.407  132.073 75.234  1.00 50.10  ? 274  TYR C OH    1 
ATOM   8751  N  N     . PHE C  3  275 ? 8.620   128.238 75.549  1.00 45.11  ? 275  PHE C N     1 
ATOM   8752  C  CA    . PHE C  3  275 ? 7.945   128.132 76.837  1.00 44.83  ? 275  PHE C CA    1 
ATOM   8753  C  C     . PHE C  3  275 ? 6.440   128.019 76.672  1.00 45.96  ? 275  PHE C C     1 
ATOM   8754  O  O     . PHE C  3  275 ? 5.732   127.655 77.610  1.00 46.54  ? 275  PHE C O     1 
ATOM   8755  C  CB    . PHE C  3  275 ? 8.231   129.360 77.697  1.00 43.02  ? 275  PHE C CB    1 
ATOM   8756  C  CG    . PHE C  3  275 ? 9.584   129.362 78.329  1.00 40.79  ? 275  PHE C CG    1 
ATOM   8757  C  CD1   . PHE C  3  275 ? 10.406  128.246 78.265  1.00 40.02  ? 275  PHE C CD1   1 
ATOM   8758  C  CD2   . PHE C  3  275 ? 10.015  130.460 79.047  1.00 38.33  ? 275  PHE C CD2   1 
ATOM   8759  C  CE1   . PHE C  3  275 ? 11.637  128.226 78.916  1.00 37.63  ? 275  PHE C CE1   1 
ATOM   8760  C  CE2   . PHE C  3  275 ? 11.236  130.440 79.695  1.00 37.06  ? 275  PHE C CE2   1 
ATOM   8761  C  CZ    . PHE C  3  275 ? 12.047  129.324 79.631  1.00 35.26  ? 275  PHE C CZ    1 
ATOM   8762  N  N     . LEU C  3  276 ? 5.957   128.336 75.477  1.00 46.10  ? 276  LEU C N     1 
ATOM   8763  C  CA    . LEU C  3  276 ? 4.533   128.314 75.184  1.00 44.80  ? 276  LEU C CA    1 
ATOM   8764  C  C     . LEU C  3  276 ? 3.771   127.091 75.640  1.00 44.64  ? 276  LEU C C     1 
ATOM   8765  O  O     . LEU C  3  276 ? 2.734   127.227 76.295  1.00 45.13  ? 276  LEU C O     1 
ATOM   8766  C  CB    . LEU C  3  276 ? 4.308   128.528 73.691  1.00 44.41  ? 276  LEU C CB    1 
ATOM   8767  C  CG    . LEU C  3  276 ? 4.711   129.930 73.204  1.00 43.42  ? 276  LEU C CG    1 
ATOM   8768  C  CD1   . LEU C  3  276 ? 4.557   130.018 71.707  1.00 40.62  ? 276  LEU C CD1   1 
ATOM   8769  C  CD2   . LEU C  3  276 ? 3.858   130.988 73.897  1.00 42.70  ? 276  LEU C CD2   1 
ATOM   8770  N  N     . PHE C  3  277 ? 4.266   125.898 75.321  1.00 43.72  ? 277  PHE C N     1 
ATOM   8771  C  CA    . PHE C  3  277 ? 3.544   124.688 75.723  1.00 42.73  ? 277  PHE C CA    1 
ATOM   8772  C  C     . PHE C  3  277 ? 3.290   124.648 77.225  1.00 42.18  ? 277  PHE C C     1 
ATOM   8773  O  O     . PHE C  3  277 ? 2.175   124.395 77.660  1.00 42.84  ? 277  PHE C O     1 
ATOM   8774  C  CB    . PHE C  3  277 ? 4.289   123.431 75.262  1.00 41.88  ? 277  PHE C CB    1 
ATOM   8775  C  CG    . PHE C  3  277 ? 5.433   123.059 76.131  1.00 43.34  ? 277  PHE C CG    1 
ATOM   8776  C  CD1   . PHE C  3  277 ? 5.252   122.200 77.205  1.00 41.71  ? 277  PHE C CD1   1 
ATOM   8777  C  CD2   . PHE C  3  277 ? 6.692   123.615 75.922  1.00 44.91  ? 277  PHE C CD2   1 
ATOM   8778  C  CE1   . PHE C  3  277 ? 6.308   121.901 78.070  1.00 41.98  ? 277  PHE C CE1   1 
ATOM   8779  C  CE2   . PHE C  3  277 ? 7.754   123.321 76.785  1.00 43.75  ? 277  PHE C CE2   1 
ATOM   8780  C  CZ    . PHE C  3  277 ? 7.557   122.460 77.865  1.00 42.05  ? 277  PHE C CZ    1 
ATOM   8781  N  N     . ALA C  3  278 ? 4.310   124.917 78.027  1.00 42.82  ? 278  ALA C N     1 
ATOM   8782  C  CA    . ALA C  3  278 ? 4.132   124.908 79.474  1.00 44.36  ? 278  ALA C CA    1 
ATOM   8783  C  C     . ALA C  3  278 ? 3.176   126.033 79.872  1.00 46.47  ? 278  ALA C C     1 
ATOM   8784  O  O     . ALA C  3  278 ? 2.221   125.825 80.625  1.00 46.74  ? 278  ALA C O     1 
ATOM   8785  C  CB    . ALA C  3  278 ? 5.463   125.081 80.159  1.00 42.23  ? 278  ALA C CB    1 
ATOM   8786  N  N     . TYR C  3  279 ? 3.447   127.230 79.361  1.00 48.22  ? 279  TYR C N     1 
ATOM   8787  C  CA    . TYR C  3  279 ? 2.613   128.401 79.620  1.00 49.69  ? 279  TYR C CA    1 
ATOM   8788  C  C     . TYR C  3  279 ? 1.162   128.018 79.402  1.00 50.25  ? 279  TYR C C     1 
ATOM   8789  O  O     . TYR C  3  279 ? 0.316   128.328 80.236  1.00 53.12  ? 279  TYR C O     1 
ATOM   8790  C  CB    . TYR C  3  279 ? 2.993   129.530 78.657  1.00 51.84  ? 279  TYR C CB    1 
ATOM   8791  C  CG    . TYR C  3  279 ? 2.077   130.746 78.629  1.00 53.79  ? 279  TYR C CG    1 
ATOM   8792  C  CD1   . TYR C  3  279 ? 1.914   131.555 79.741  1.00 53.62  ? 279  TYR C CD1   1 
ATOM   8793  C  CD2   . TYR C  3  279 ? 1.456   131.142 77.438  1.00 56.41  ? 279  TYR C CD2   1 
ATOM   8794  C  CE1   . TYR C  3  279 ? 1.164   132.746 79.666  1.00 55.36  ? 279  TYR C CE1   1 
ATOM   8795  C  CE2   . TYR C  3  279 ? 0.704   132.323 77.354  1.00 55.32  ? 279  TYR C CE2   1 
ATOM   8796  C  CZ    . TYR C  3  279 ? 0.568   133.122 78.464  1.00 55.38  ? 279  TYR C CZ    1 
ATOM   8797  O  OH    . TYR C  3  279 ? -0.114  134.320 78.343  1.00 56.14  ? 279  TYR C OH    1 
ATOM   8798  N  N     . ALA C  3  280 ? 0.877   127.336 78.289  1.00 48.13  ? 280  ALA C N     1 
ATOM   8799  C  CA    . ALA C  3  280 ? -0.486  126.935 77.969  1.00 46.13  ? 280  ALA C CA    1 
ATOM   8800  C  C     . ALA C  3  280 ? -1.069  126.026 79.048  1.00 46.35  ? 280  ALA C C     1 
ATOM   8801  O  O     . ALA C  3  280 ? -2.189  126.236 79.518  1.00 46.17  ? 280  ALA C O     1 
ATOM   8802  C  CB    . ALA C  3  280 ? -0.517  126.252 76.630  1.00 44.58  ? 280  ALA C CB    1 
ATOM   8803  N  N     . ILE C  3  281 ? -0.306  125.025 79.460  1.00 46.74  ? 281  ILE C N     1 
ATOM   8804  C  CA    . ILE C  3  281 ? -0.785  124.118 80.490  1.00 47.04  ? 281  ILE C CA    1 
ATOM   8805  C  C     . ILE C  3  281 ? -1.123  124.861 81.780  1.00 48.25  ? 281  ILE C C     1 
ATOM   8806  O  O     . ILE C  3  281 ? -2.109  124.544 82.434  1.00 48.24  ? 281  ILE C O     1 
ATOM   8807  C  CB    . ILE C  3  281 ? 0.257   123.019 80.800  1.00 45.12  ? 281  ILE C CB    1 
ATOM   8808  C  CG1   . ILE C  3  281 ? 0.508   122.198 79.537  1.00 43.56  ? 281  ILE C CG1   1 
ATOM   8809  C  CG2   . ILE C  3  281 ? -0.227  122.136 81.950  1.00 41.51  ? 281  ILE C CG2   1 
ATOM   8810  C  CD1   . ILE C  3  281 ? 1.210   120.898 79.784  1.00 44.03  ? 281  ILE C CD1   1 
ATOM   8811  N  N     . LEU C  3  282 ? -0.313  125.851 82.141  1.00 49.73  ? 282  LEU C N     1 
ATOM   8812  C  CA    . LEU C  3  282 ? -0.552  126.601 83.371  1.00 52.66  ? 282  LEU C CA    1 
ATOM   8813  C  C     . LEU C  3  282 ? -1.760  127.524 83.273  1.00 54.76  ? 282  LEU C C     1 
ATOM   8814  O  O     . LEU C  3  282 ? -2.447  127.781 84.282  1.00 55.46  ? 282  LEU C O     1 
ATOM   8815  C  CB    . LEU C  3  282 ? 0.695   127.409 83.760  1.00 51.51  ? 282  LEU C CB    1 
ATOM   8816  C  CG    . LEU C  3  282 ? 0.534   128.351 84.960  1.00 49.13  ? 282  LEU C CG    1 
ATOM   8817  C  CD1   . LEU C  3  282 ? 1.877   128.644 85.561  1.00 48.59  ? 282  LEU C CD1   1 
ATOM   8818  C  CD2   . LEU C  3  282 ? -0.147  129.633 84.514  1.00 49.10  ? 282  LEU C CD2   1 
ATOM   8819  N  N     . ARG C  3  283 ? -1.996  128.037 82.068  1.00 55.63  ? 283  ARG C N     1 
ATOM   8820  C  CA    . ARG C  3  283 ? -3.125  128.909 81.822  1.00 57.62  ? 283  ARG C CA    1 
ATOM   8821  C  C     . ARG C  3  283 ? -4.425  128.117 81.858  1.00 59.02  ? 283  ARG C C     1 
ATOM   8822  O  O     . ARG C  3  283 ? -5.496  128.701 81.989  1.00 61.61  ? 283  ARG C O     1 
ATOM   8823  C  CB    . ARG C  3  283 ? -3.027  129.583 80.459  1.00 57.86  ? 283  ARG C CB    1 
ATOM   8824  C  CG    . ARG C  3  283 ? -2.264  130.876 80.440  1.00 60.68  ? 283  ARG C CG    1 
ATOM   8825  C  CD    . ARG C  3  283 ? -2.736  131.767 79.293  1.00 59.70  ? 283  ARG C CD    1 
ATOM   8826  N  NE    . ARG C  3  283 ? -3.015  130.986 78.097  1.00 60.67  ? 283  ARG C NE    1 
ATOM   8827  C  CZ    . ARG C  3  283 ? -2.974  131.473 76.863  1.00 61.45  ? 283  ARG C CZ    1 
ATOM   8828  N  NH1   . ARG C  3  283 ? -2.663  132.750 76.662  1.00 60.03  ? 283  ARG C NH1   1 
ATOM   8829  N  NH2   . ARG C  3  283 ? -3.234  130.677 75.828  1.00 61.25  ? 283  ARG C NH2   1 
ATOM   8830  N  N     . SER C  3  284 ? -4.353  126.799 81.730  1.00 58.40  ? 284  SER C N     1 
ATOM   8831  C  CA    . SER C  3  284 ? -5.575  126.007 81.759  1.00 60.01  ? 284  SER C CA    1 
ATOM   8832  C  C     . SER C  3  284 ? -6.219  125.912 83.130  1.00 59.42  ? 284  SER C C     1 
ATOM   8833  O  O     . SER C  3  284 ? -7.416  126.128 83.258  1.00 59.27  ? 284  SER C O     1 
ATOM   8834  C  CB    . SER C  3  284 ? -5.319  124.616 81.203  1.00 61.91  ? 284  SER C CB    1 
ATOM   8835  O  OG    . SER C  3  284 ? -5.123  124.711 79.802  1.00 67.19  ? 284  SER C OG    1 
ATOM   8836  N  N     . ILE C  3  285 ? -5.444  125.583 84.155  1.00 59.11  ? 285  ILE C N     1 
ATOM   8837  C  CA    . ILE C  3  285 ? -6.009  125.510 85.493  1.00 58.52  ? 285  ILE C CA    1 
ATOM   8838  C  C     . ILE C  3  285 ? -6.308  126.940 85.933  1.00 59.27  ? 285  ILE C C     1 
ATOM   8839  O  O     . ILE C  3  285 ? -5.394  127.770 86.039  1.00 59.31  ? 285  ILE C O     1 
ATOM   8840  C  CB    . ILE C  3  285 ? -5.036  124.900 86.496  1.00 58.34  ? 285  ILE C CB    1 
ATOM   8841  C  CG1   . ILE C  3  285 ? -4.698  123.462 86.104  1.00 57.31  ? 285  ILE C CG1   1 
ATOM   8842  C  CG2   . ILE C  3  285 ? -5.651  124.952 87.880  1.00 58.67  ? 285  ILE C CG2   1 
ATOM   8843  C  CD1   . ILE C  3  285 ? -3.969  123.330 84.789  1.00 56.76  ? 285  ILE C CD1   1 
ATOM   8844  N  N     . PRO C  3  286 ? -7.597  127.246 86.197  1.00 59.03  ? 286  PRO C N     1 
ATOM   8845  C  CA    . PRO C  3  286 ? -8.073  128.566 86.627  1.00 58.03  ? 286  PRO C CA    1 
ATOM   8846  C  C     . PRO C  3  286 ? -7.889  128.719 88.136  1.00 58.58  ? 286  PRO C C     1 
ATOM   8847  O  O     . PRO C  3  286 ? -8.795  129.139 88.861  1.00 58.41  ? 286  PRO C O     1 
ATOM   8848  C  CB    . PRO C  3  286 ? -9.535  128.528 86.223  1.00 55.31  ? 286  PRO C CB    1 
ATOM   8849  C  CG    . PRO C  3  286 ? -9.909  127.130 86.585  1.00 55.11  ? 286  PRO C CG    1 
ATOM   8850  C  CD    . PRO C  3  286 ? -8.718  126.284 86.153  1.00 57.18  ? 286  PRO C CD    1 
ATOM   8851  N  N     . ASN C  3  287 ? -6.700  128.366 88.599  1.00 58.74  ? 287  ASN C N     1 
ATOM   8852  C  CA    . ASN C  3  287 ? -6.376  128.427 90.011  1.00 59.37  ? 287  ASN C CA    1 
ATOM   8853  C  C     . ASN C  3  287 ? -4.888  128.685 90.085  1.00 59.15  ? 287  ASN C C     1 
ATOM   8854  O  O     . ASN C  3  287 ? -4.134  128.143 89.279  1.00 60.57  ? 287  ASN C O     1 
ATOM   8855  C  CB    . ASN C  3  287 ? -6.735  127.089 90.662  1.00 59.45  ? 287  ASN C CB    1 
ATOM   8856  C  CG    . ASN C  3  287 ? -6.021  126.868 91.966  1.00 59.98  ? 287  ASN C CG    1 
ATOM   8857  O  OD1   . ASN C  3  287 ? -4.793  126.716 92.000  1.00 60.59  ? 287  ASN C OD1   1 
ATOM   8858  N  ND2   . ASN C  3  287 ? -6.780  126.849 93.058  1.00 59.57  ? 287  ASN C ND2   1 
ATOM   8859  N  N     . LYS C  3  288 ? -4.455  129.504 91.038  1.00 58.56  ? 288  LYS C N     1 
ATOM   8860  C  CA    . LYS C  3  288 ? -3.032  129.815 91.142  1.00 58.04  ? 288  LYS C CA    1 
ATOM   8861  C  C     . LYS C  3  288 ? -2.162  128.592 91.372  1.00 58.78  ? 288  LYS C C     1 
ATOM   8862  O  O     . LYS C  3  288 ? -1.331  128.263 90.518  1.00 60.63  ? 288  LYS C O     1 
ATOM   8863  C  CB    . LYS C  3  288 ? -2.771  130.831 92.248  1.00 56.05  ? 288  LYS C CB    1 
ATOM   8864  C  CG    . LYS C  3  288 ? -1.350  131.356 92.266  1.00 53.39  ? 288  LYS C CG    1 
ATOM   8865  C  CD    . LYS C  3  288 ? -1.225  132.499 93.246  1.00 54.96  ? 288  LYS C CD    1 
ATOM   8866  C  CE    . LYS C  3  288 ? 0.171   133.093 93.298  1.00 54.33  ? 288  LYS C CE    1 
ATOM   8867  N  NZ    . LYS C  3  288 ? 0.199   134.312 94.177  1.00 55.97  ? 288  LYS C NZ    1 
ATOM   8868  N  N     . LEU C  3  289 ? -2.355  127.911 92.503  1.00 57.95  ? 289  LEU C N     1 
ATOM   8869  C  CA    . LEU C  3  289 ? -1.542  126.738 92.835  1.00 57.98  ? 289  LEU C CA    1 
ATOM   8870  C  C     . LEU C  3  289 ? -1.635  125.559 91.865  1.00 57.90  ? 289  LEU C C     1 
ATOM   8871  O  O     . LEU C  3  289 ? -0.611  124.969 91.497  1.00 57.97  ? 289  LEU C O     1 
ATOM   8872  C  CB    . LEU C  3  289 ? -1.863  126.253 94.245  1.00 58.68  ? 289  LEU C CB    1 
ATOM   8873  C  CG    . LEU C  3  289 ? -0.998  125.084 94.720  1.00 57.94  ? 289  LEU C CG    1 
ATOM   8874  C  CD1   . LEU C  3  289 ? 0.465   125.464 94.609  1.00 57.48  ? 289  LEU C CD1   1 
ATOM   8875  C  CD2   . LEU C  3  289 ? -1.349  124.738 96.145  1.00 56.58  ? 289  LEU C CD2   1 
ATOM   8876  N  N     . GLY C  3  290 ? -2.852  125.198 91.466  1.00 56.78  ? 290  GLY C N     1 
ATOM   8877  C  CA    . GLY C  3  290 ? -3.005  124.106 90.521  1.00 55.34  ? 290  GLY C CA    1 
ATOM   8878  C  C     . GLY C  3  290 ? -2.177  124.392 89.281  1.00 54.98  ? 290  GLY C C     1 
ATOM   8879  O  O     . GLY C  3  290 ? -1.343  123.585 88.878  1.00 55.00  ? 290  GLY C O     1 
ATOM   8880  N  N     . GLY C  3  291 ? -2.404  125.561 88.690  1.00 54.30  ? 291  GLY C N     1 
ATOM   8881  C  CA    . GLY C  3  291 ? -1.677  125.963 87.502  1.00 53.31  ? 291  GLY C CA    1 
ATOM   8882  C  C     . GLY C  3  291 ? -0.182  125.836 87.685  1.00 52.34  ? 291  GLY C C     1 
ATOM   8883  O  O     . GLY C  3  291 ? 0.511   125.358 86.786  1.00 53.56  ? 291  GLY C O     1 
ATOM   8884  N  N     . VAL C  3  292 ? 0.322   126.261 88.839  1.00 50.10  ? 292  VAL C N     1 
ATOM   8885  C  CA    . VAL C  3  292 ? 1.750   126.169 89.098  1.00 49.85  ? 292  VAL C CA    1 
ATOM   8886  C  C     . VAL C  3  292 ? 2.151   124.695 89.172  1.00 49.37  ? 292  VAL C C     1 
ATOM   8887  O  O     . VAL C  3  292 ? 3.124   124.273 88.528  1.00 50.01  ? 292  VAL C O     1 
ATOM   8888  C  CB    . VAL C  3  292 ? 2.123   126.876 90.413  1.00 50.91  ? 292  VAL C CB    1 
ATOM   8889  C  CG1   . VAL C  3  292 ? 3.566   126.613 90.756  1.00 52.05  ? 292  VAL C CG1   1 
ATOM   8890  C  CG2   . VAL C  3  292 ? 1.915   128.355 90.279  1.00 49.58  ? 292  VAL C CG2   1 
ATOM   8891  N  N     . LEU C  3  293 ? 1.399   123.920 89.953  1.00 46.49  ? 293  LEU C N     1 
ATOM   8892  C  CA    . LEU C  3  293 ? 1.653   122.492 90.082  1.00 44.98  ? 293  LEU C CA    1 
ATOM   8893  C  C     . LEU C  3  293 ? 1.643   121.842 88.707  1.00 44.61  ? 293  LEU C C     1 
ATOM   8894  O  O     . LEU C  3  293 ? 2.547   121.058 88.379  1.00 45.42  ? 293  LEU C O     1 
ATOM   8895  C  CB    . LEU C  3  293 ? 0.587   121.849 90.950  1.00 44.17  ? 293  LEU C CB    1 
ATOM   8896  C  CG    . LEU C  3  293 ? 0.712   122.267 92.407  1.00 44.53  ? 293  LEU C CG    1 
ATOM   8897  C  CD1   . LEU C  3  293 ? -0.569  121.996 93.135  1.00 43.78  ? 293  LEU C CD1   1 
ATOM   8898  C  CD2   . LEU C  3  293 ? 1.854   121.523 93.032  1.00 42.26  ? 293  LEU C CD2   1 
ATOM   8899  N  N     . ALA C  3  294 ? 0.628   122.168 87.902  1.00 42.56  ? 294  ALA C N     1 
ATOM   8900  C  CA    . ALA C  3  294 ? 0.524   121.626 86.547  1.00 41.19  ? 294  ALA C CA    1 
ATOM   8901  C  C     . ALA C  3  294 ? 1.797   122.011 85.769  1.00 41.39  ? 294  ALA C C     1 
ATOM   8902  O  O     . ALA C  3  294 ? 2.404   121.171 85.094  1.00 40.64  ? 294  ALA C O     1 
ATOM   8903  C  CB    . ALA C  3  294 ? -0.710  122.164 85.861  1.00 38.08  ? 294  ALA C CB    1 
ATOM   8904  N  N     . LEU C  3  295 ? 2.207   123.273 85.880  1.00 40.12  ? 295  LEU C N     1 
ATOM   8905  C  CA    . LEU C  3  295 ? 3.415   123.725 85.212  1.00 40.90  ? 295  LEU C CA    1 
ATOM   8906  C  C     . LEU C  3  295 ? 4.567   122.845 85.647  1.00 40.73  ? 295  LEU C C     1 
ATOM   8907  O  O     . LEU C  3  295 ? 5.241   122.229 84.833  1.00 42.03  ? 295  LEU C O     1 
ATOM   8908  C  CB    . LEU C  3  295 ? 3.744   125.181 85.569  1.00 41.68  ? 295  LEU C CB    1 
ATOM   8909  C  CG    . LEU C  3  295 ? 5.087   125.712 85.026  1.00 41.81  ? 295  LEU C CG    1 
ATOM   8910  C  CD1   . LEU C  3  295 ? 5.262   125.293 83.571  1.00 42.23  ? 295  LEU C CD1   1 
ATOM   8911  C  CD2   . LEU C  3  295 ? 5.158   127.234 85.145  1.00 41.29  ? 295  LEU C CD2   1 
ATOM   8912  N  N     . ALA C  3  296 ? 4.796   122.793 86.944  1.00 40.13  ? 296  ALA C N     1 
ATOM   8913  C  CA    . ALA C  3  296 ? 5.875   121.977 87.460  1.00 41.07  ? 296  ALA C CA    1 
ATOM   8914  C  C     . ALA C  3  296 ? 5.799   120.562 86.892  1.00 41.43  ? 296  ALA C C     1 
ATOM   8915  O  O     . ALA C  3  296 ? 6.776   120.036 86.332  1.00 40.78  ? 296  ALA C O     1 
ATOM   8916  C  CB    . ALA C  3  296 ? 5.798   121.932 88.967  1.00 41.92  ? 296  ALA C CB    1 
ATOM   8917  N  N     . ALA C  3  297 ? 4.625   119.958 87.028  1.00 39.65  ? 297  ALA C N     1 
ATOM   8918  C  CA    . ALA C  3  297 ? 4.419   118.601 86.550  1.00 39.35  ? 297  ALA C CA    1 
ATOM   8919  C  C     . ALA C  3  297 ? 4.719   118.422 85.068  1.00 38.98  ? 297  ALA C C     1 
ATOM   8920  O  O     . ALA C  3  297 ? 5.329   117.432 84.665  1.00 38.04  ? 297  ALA C O     1 
ATOM   8921  C  CB    . ALA C  3  297 ? 3.006   118.167 86.841  1.00 37.02  ? 297  ALA C CB    1 
ATOM   8922  N  N     . SER C  3  298 ? 4.295   119.383 84.258  1.00 39.35  ? 298  SER C N     1 
ATOM   8923  C  CA    . SER C  3  298 ? 4.498   119.294 82.818  1.00 39.61  ? 298  SER C CA    1 
ATOM   8924  C  C     . SER C  3  298 ? 5.940   119.026 82.422  1.00 40.19  ? 298  SER C C     1 
ATOM   8925  O  O     . SER C  3  298 ? 6.196   118.509 81.339  1.00 39.44  ? 298  SER C O     1 
ATOM   8926  C  CB    . SER C  3  298 ? 4.057   120.573 82.139  1.00 37.81  ? 298  SER C CB    1 
ATOM   8927  O  OG    . SER C  3  298 ? 5.018   121.581 82.367  1.00 34.61  ? 298  SER C OG    1 
ATOM   8928  N  N     . VAL C  3  299 ? 6.883   119.398 83.277  1.00 40.19  ? 299  VAL C N     1 
ATOM   8929  C  CA    . VAL C  3  299 ? 8.288   119.165 82.963  1.00 40.87  ? 299  VAL C CA    1 
ATOM   8930  C  C     . VAL C  3  299 ? 8.846   118.065 83.857  1.00 41.43  ? 299  VAL C C     1 
ATOM   8931  O  O     . VAL C  3  299 ? 9.486   117.114 83.380  1.00 39.72  ? 299  VAL C O     1 
ATOM   8932  C  CB    . VAL C  3  299 ? 9.107   120.438 83.136  1.00 41.07  ? 299  VAL C CB    1 
ATOM   8933  C  CG1   . VAL C  3  299 ? 10.571  120.135 82.999  1.00 41.91  ? 299  VAL C CG1   1 
ATOM   8934  C  CG2   . VAL C  3  299 ? 8.717   121.430 82.074  1.00 43.30  ? 299  VAL C CG2   1 
ATOM   8935  N  N     . LEU C  3  300 ? 8.592   118.191 85.156  1.00 41.64  ? 300  LEU C N     1 
ATOM   8936  C  CA    . LEU C  3  300 ? 9.036   117.181 86.102  1.00 41.17  ? 300  LEU C CA    1 
ATOM   8937  C  C     . LEU C  3  300 ? 8.589   115.773 85.709  1.00 41.46  ? 300  LEU C C     1 
ATOM   8938  O  O     . LEU C  3  300 ? 9.310   114.809 85.965  1.00 43.82  ? 300  LEU C O     1 
ATOM   8939  C  CB    . LEU C  3  300 ? 8.521   117.501 87.501  1.00 39.16  ? 300  LEU C CB    1 
ATOM   8940  C  CG    . LEU C  3  300 ? 9.338   118.615 88.127  1.00 37.55  ? 300  LEU C CG    1 
ATOM   8941  C  CD1   . LEU C  3  300 ? 8.952   118.749 89.569  1.00 35.45  ? 300  LEU C CD1   1 
ATOM   8942  C  CD2   . LEU C  3  300 ? 10.818  118.283 87.987  1.00 34.46  ? 300  LEU C CD2   1 
ATOM   8943  N  N     . ILE C  3  301 ? 7.421   115.644 85.083  1.00 39.77  ? 301  ILE C N     1 
ATOM   8944  C  CA    . ILE C  3  301 ? 6.934   114.328 84.697  1.00 38.96  ? 301  ILE C CA    1 
ATOM   8945  C  C     . ILE C  3  301 ? 7.966   113.502 83.919  1.00 40.22  ? 301  ILE C C     1 
ATOM   8946  O  O     . ILE C  3  301 ? 7.876   112.267 83.881  1.00 40.18  ? 301  ILE C O     1 
ATOM   8947  C  CB    . ILE C  3  301 ? 5.661   114.428 83.871  1.00 37.75  ? 301  ILE C CB    1 
ATOM   8948  C  CG1   . ILE C  3  301 ? 5.041   113.041 83.720  1.00 35.72  ? 301  ILE C CG1   1 
ATOM   8949  C  CG2   . ILE C  3  301 ? 5.967   115.049 82.532  1.00 38.06  ? 301  ILE C CG2   1 
ATOM   8950  C  CD1   . ILE C  3  301 ? 3.743   113.047 82.972  1.00 37.39  ? 301  ILE C CD1   1 
ATOM   8951  N  N     . LEU C  3  302 ? 8.943   114.169 83.305  1.00 39.37  ? 302  LEU C N     1 
ATOM   8952  C  CA    . LEU C  3  302 ? 9.973   113.448 82.572  1.00 39.23  ? 302  LEU C CA    1 
ATOM   8953  C  C     . LEU C  3  302 ? 10.675  112.451 83.495  1.00 39.23  ? 302  LEU C C     1 
ATOM   8954  O  O     . LEU C  3  302 ? 11.133  111.402 83.062  1.00 39.68  ? 302  LEU C O     1 
ATOM   8955  C  CB    . LEU C  3  302 ? 11.000  114.414 81.982  1.00 40.37  ? 302  LEU C CB    1 
ATOM   8956  C  CG    . LEU C  3  302 ? 10.610  115.261 80.761  1.00 41.39  ? 302  LEU C CG    1 
ATOM   8957  C  CD1   . LEU C  3  302 ? 11.824  116.029 80.252  1.00 39.24  ? 302  LEU C CD1   1 
ATOM   8958  C  CD2   . LEU C  3  302 ? 10.075  114.377 79.658  1.00 39.54  ? 302  LEU C CD2   1 
ATOM   8959  N  N     . PHE C  3  303 ? 10.755  112.773 84.775  1.00 39.46  ? 303  PHE C N     1 
ATOM   8960  C  CA    . PHE C  3  303 ? 11.390  111.872 85.711  1.00 41.12  ? 303  PHE C CA    1 
ATOM   8961  C  C     . PHE C  3  303 ? 10.642  110.526 85.804  1.00 43.76  ? 303  PHE C C     1 
ATOM   8962  O  O     . PHE C  3  303 ? 11.247  109.481 86.075  1.00 45.85  ? 303  PHE C O     1 
ATOM   8963  C  CB    . PHE C  3  303 ? 11.493  112.545 87.086  1.00 38.14  ? 303  PHE C CB    1 
ATOM   8964  C  CG    . PHE C  3  303 ? 12.636  113.525 87.204  1.00 37.61  ? 303  PHE C CG    1 
ATOM   8965  C  CD1   . PHE C  3  303 ? 12.405  114.855 87.569  1.00 38.18  ? 303  PHE C CD1   1 
ATOM   8966  C  CD2   . PHE C  3  303 ? 13.950  113.128 86.949  1.00 37.71  ? 303  PHE C CD2   1 
ATOM   8967  C  CE1   . PHE C  3  303 ? 13.474  115.792 87.683  1.00 35.76  ? 303  PHE C CE1   1 
ATOM   8968  C  CE2   . PHE C  3  303 ? 15.028  114.053 87.060  1.00 37.27  ? 303  PHE C CE2   1 
ATOM   8969  C  CZ    . PHE C  3  303 ? 14.783  115.387 87.429  1.00 34.53  ? 303  PHE C CZ    1 
ATOM   8970  N  N     . LEU C  3  304 ? 9.339   110.534 85.550  1.00 45.06  ? 304  LEU C N     1 
ATOM   8971  C  CA    . LEU C  3  304 ? 8.566   109.299 85.636  1.00 47.23  ? 304  LEU C CA    1 
ATOM   8972  C  C     . LEU C  3  304 ? 8.659   108.360 84.437  1.00 49.08  ? 304  LEU C C     1 
ATOM   8973  O  O     . LEU C  3  304 ? 8.566   107.149 84.593  1.00 50.86  ? 304  LEU C O     1 
ATOM   8974  C  CB    . LEU C  3  304 ? 7.088   109.601 85.894  1.00 45.71  ? 304  LEU C CB    1 
ATOM   8975  C  CG    . LEU C  3  304 ? 6.712   110.193 87.250  1.00 45.19  ? 304  LEU C CG    1 
ATOM   8976  C  CD1   . LEU C  3  304 ? 5.226   110.033 87.445  1.00 42.59  ? 304  LEU C CD1   1 
ATOM   8977  C  CD2   . LEU C  3  304 ? 7.462   109.480 88.364  1.00 42.84  ? 304  LEU C CD2   1 
ATOM   8978  N  N     . ILE C  3  305 ? 8.838   108.912 83.245  1.00 49.74  ? 305  ILE C N     1 
ATOM   8979  C  CA    . ILE C  3  305 ? 8.906   108.105 82.028  1.00 49.87  ? 305  ILE C CA    1 
ATOM   8980  C  C     . ILE C  3  305 ? 9.560   106.727 82.188  1.00 50.77  ? 305  ILE C C     1 
ATOM   8981  O  O     . ILE C  3  305 ? 9.023   105.717 81.716  1.00 50.83  ? 305  ILE C O     1 
ATOM   8982  C  CB    . ILE C  3  305 ? 9.649   108.861 80.916  1.00 48.93  ? 305  ILE C CB    1 
ATOM   8983  C  CG1   . ILE C  3  305 ? 8.949   110.188 80.625  1.00 48.00  ? 305  ILE C CG1   1 
ATOM   8984  C  CG2   . ILE C  3  305 ? 9.736   108.000 79.672  1.00 48.38  ? 305  ILE C CG2   1 
ATOM   8985  C  CD1   . ILE C  3  305 ? 7.571   110.044 80.115  1.00 47.96  ? 305  ILE C CD1   1 
ATOM   8986  N  N     . PRO C  3  306 ? 10.729  106.669 82.845  1.00 51.40  ? 306  PRO C N     1 
ATOM   8987  C  CA    . PRO C  3  306 ? 11.458  105.414 83.065  1.00 51.59  ? 306  PRO C CA    1 
ATOM   8988  C  C     . PRO C  3  306 ? 10.647  104.353 83.793  1.00 51.10  ? 306  PRO C C     1 
ATOM   8989  O  O     . PRO C  3  306 ? 10.752  103.175 83.501  1.00 50.89  ? 306  PRO C O     1 
ATOM   8990  C  CB    . PRO C  3  306 ? 12.660  105.852 83.887  1.00 52.21  ? 306  PRO C CB    1 
ATOM   8991  C  CG    . PRO C  3  306 ? 12.886  107.251 83.407  1.00 53.98  ? 306  PRO C CG    1 
ATOM   8992  C  CD    . PRO C  3  306 ? 11.491  107.808 83.382  1.00 52.20  ? 306  PRO C CD    1 
ATOM   8993  N  N     . PHE C  3  307 ? 9.837   104.783 84.748  1.00 51.66  ? 307  PHE C N     1 
ATOM   8994  C  CA    . PHE C  3  307 ? 9.010   103.874 85.527  1.00 50.73  ? 307  PHE C CA    1 
ATOM   8995  C  C     . PHE C  3  307 ? 7.686   103.578 84.847  1.00 49.63  ? 307  PHE C C     1 
ATOM   8996  O  O     . PHE C  3  307 ? 6.872   102.835 85.365  1.00 50.08  ? 307  PHE C O     1 
ATOM   8997  C  CB    . PHE C  3  307 ? 8.793   104.487 86.898  1.00 51.51  ? 307  PHE C CB    1 
ATOM   8998  C  CG    . PHE C  3  307 ? 10.068  104.948 87.529  1.00 56.46  ? 307  PHE C CG    1 
ATOM   8999  C  CD1   . PHE C  3  307 ? 11.005  104.018 88.008  1.00 57.48  ? 307  PHE C CD1   1 
ATOM   9000  C  CD2   . PHE C  3  307 ? 10.384  106.309 87.581  1.00 58.02  ? 307  PHE C CD2   1 
ATOM   9001  C  CE1   . PHE C  3  307 ? 12.243  104.442 88.530  1.00 57.99  ? 307  PHE C CE1   1 
ATOM   9002  C  CE2   . PHE C  3  307 ? 11.620  106.742 88.101  1.00 59.59  ? 307  PHE C CE2   1 
ATOM   9003  C  CZ    . PHE C  3  307 ? 12.552  105.805 88.576  1.00 58.19  ? 307  PHE C CZ    1 
ATOM   9004  N  N     . LEU C  3  308 ? 7.479   104.149 83.672  1.00 49.51  ? 308  LEU C N     1 
ATOM   9005  C  CA    . LEU C  3  308 ? 6.248   103.928 82.946  1.00 50.09  ? 308  LEU C CA    1 
ATOM   9006  C  C     . LEU C  3  308 ? 6.457   103.026 81.758  1.00 50.55  ? 308  LEU C C     1 
ATOM   9007  O  O     . LEU C  3  308 ? 5.538   102.828 80.959  1.00 51.37  ? 308  LEU C O     1 
ATOM   9008  C  CB    . LEU C  3  308 ? 5.666   105.251 82.470  1.00 50.41  ? 308  LEU C CB    1 
ATOM   9009  C  CG    . LEU C  3  308 ? 5.100   106.099 83.598  1.00 50.12  ? 308  LEU C CG    1 
ATOM   9010  C  CD1   . LEU C  3  308 ? 4.218   107.173 83.006  1.00 51.27  ? 308  LEU C CD1   1 
ATOM   9011  C  CD2   . LEU C  3  308 ? 4.289   105.221 84.523  1.00 46.76  ? 308  LEU C CD2   1 
ATOM   9012  N  N     . HIS C  3  309 ? 7.668   102.489 81.639  1.00 49.82  ? 309  HIS C N     1 
ATOM   9013  C  CA    . HIS C  3  309 ? 8.002   101.601 80.531  1.00 49.42  ? 309  HIS C CA    1 
ATOM   9014  C  C     . HIS C  3  309 ? 7.474   100.211 80.847  1.00 48.61  ? 309  HIS C C     1 
ATOM   9015  O  O     . HIS C  3  309 ? 7.941   99.573  81.784  1.00 49.70  ? 309  HIS C O     1 
ATOM   9016  C  CB    . HIS C  3  309 ? 9.516   101.554 80.338  1.00 49.85  ? 309  HIS C CB    1 
ATOM   9017  C  CG    . HIS C  3  309 ? 9.946   100.803 79.121  1.00 50.21  ? 309  HIS C CG    1 
ATOM   9018  N  ND1   . HIS C  3  309 ? 10.196  101.422 77.917  1.00 51.39  ? 309  HIS C ND1   1 
ATOM   9019  C  CD2   . HIS C  3  309 ? 10.141  99.480  78.912  1.00 49.97  ? 309  HIS C CD2   1 
ATOM   9020  C  CE1   . HIS C  3  309 ? 10.528  100.513 77.017  1.00 51.31  ? 309  HIS C CE1   1 
ATOM   9021  N  NE2   . HIS C  3  309 ? 10.501  99.326  77.595  1.00 50.24  ? 309  HIS C NE2   1 
ATOM   9022  N  N     . LYS C  3  310 ? 6.494   99.752  80.075  1.00 47.82  ? 310  LYS C N     1 
ATOM   9023  C  CA    . LYS C  3  310 ? 5.896   98.437  80.289  1.00 47.14  ? 310  LYS C CA    1 
ATOM   9024  C  C     . LYS C  3  310 ? 6.219   97.534  79.113  1.00 46.60  ? 310  LYS C C     1 
ATOM   9025  O  O     . LYS C  3  310 ? 6.091   96.324  79.182  1.00 47.17  ? 310  LYS C O     1 
ATOM   9026  C  CB    . LYS C  3  310 ? 4.368   98.545  80.425  1.00 47.10  ? 310  LYS C CB    1 
ATOM   9027  C  CG    . LYS C  3  310 ? 3.897   99.372  81.593  1.00 50.49  ? 310  LYS C CG    1 
ATOM   9028  C  CD    . LYS C  3  310 ? 4.328   98.754  82.922  1.00 55.69  ? 310  LYS C CD    1 
ATOM   9029  C  CE    . LYS C  3  310 ? 3.809   99.568  84.133  1.00 58.70  ? 310  LYS C CE    1 
ATOM   9030  N  NZ    . LYS C  3  310 ? 3.912   98.848  85.452  1.00 60.39  ? 310  LYS C NZ    1 
ATOM   9031  N  N     . SER C  3  311 ? 6.640   98.126  78.017  1.00 46.37  ? 311  SER C N     1 
ATOM   9032  C  CA    . SER C  3  311 ? 6.938   97.330  76.858  1.00 46.71  ? 311  SER C CA    1 
ATOM   9033  C  C     . SER C  3  311 ? 8.025   96.301  77.162  1.00 45.96  ? 311  SER C C     1 
ATOM   9034  O  O     . SER C  3  311 ? 8.882   96.535  78.005  1.00 43.89  ? 311  SER C O     1 
ATOM   9035  C  CB    . SER C  3  311 ? 7.367   98.247  75.720  1.00 46.72  ? 311  SER C CB    1 
ATOM   9036  O  OG    . SER C  3  311 ? 7.591   97.488  74.553  1.00 53.36  ? 311  SER C OG    1 
ATOM   9037  N  N     . LYS C  3  312 ? 7.965   95.155  76.483  1.00 46.81  ? 312  LYS C N     1 
ATOM   9038  C  CA    . LYS C  3  312 ? 8.957   94.091  76.645  1.00 47.14  ? 312  LYS C CA    1 
ATOM   9039  C  C     . LYS C  3  312 ? 10.071  94.345  75.650  1.00 46.93  ? 312  LYS C C     1 
ATOM   9040  O  O     . LYS C  3  312 ? 11.103  93.677  75.665  1.00 46.41  ? 312  LYS C O     1 
ATOM   9041  C  CB    . LYS C  3  312 ? 8.338   92.718  76.380  1.00 47.74  ? 312  LYS C CB    1 
ATOM   9042  C  CG    . LYS C  3  312 ? 7.557   92.164  77.548  1.00 51.41  ? 312  LYS C CG    1 
ATOM   9043  C  CD    . LYS C  3  312 ? 8.216   90.900  78.101  1.00 55.44  ? 312  LYS C CD    1 
ATOM   9044  C  CE    . LYS C  3  312 ? 7.611   90.487  79.457  1.00 58.81  ? 312  LYS C CE    1 
ATOM   9045  N  NZ    . LYS C  3  312 ? 7.744   91.561  80.523  1.00 58.49  ? 312  LYS C NZ    1 
ATOM   9046  N  N     . GLN C  3  313 ? 9.826   95.320  74.780  1.00 47.11  ? 313  GLN C N     1 
ATOM   9047  C  CA    . GLN C  3  313 ? 10.760  95.744  73.751  1.00 47.08  ? 313  GLN C CA    1 
ATOM   9048  C  C     . GLN C  3  313 ? 11.211  97.145  74.161  1.00 48.79  ? 313  GLN C C     1 
ATOM   9049  O  O     . GLN C  3  313 ? 10.459  97.883  74.796  1.00 50.40  ? 313  GLN C O     1 
ATOM   9050  C  CB    . GLN C  3  313 ? 10.052  95.744  72.398  1.00 45.32  ? 313  GLN C CB    1 
ATOM   9051  C  CG    . GLN C  3  313 ? 9.415   94.393  72.109  1.00 44.32  ? 313  GLN C CG    1 
ATOM   9052  C  CD    . GLN C  3  313 ? 8.971   94.209  70.674  1.00 45.15  ? 313  GLN C CD    1 
ATOM   9053  O  OE1   . GLN C  3  313 ? 8.096   94.929  70.157  1.00 47.72  ? 313  GLN C OE1   1 
ATOM   9054  N  NE2   . GLN C  3  313 ? 9.567   93.231  70.018  1.00 41.19  ? 313  GLN C NE2   1 
ATOM   9055  N  N     . ARG C  3  314 ? 12.438  97.517  73.818  1.00 49.92  ? 314  ARG C N     1 
ATOM   9056  C  CA    . ARG C  3  314 ? 12.965  98.821  74.221  1.00 48.09  ? 314  ARG C CA    1 
ATOM   9057  C  C     . ARG C  3  314 ? 12.561  100.034 73.404  1.00 48.16  ? 314  ARG C C     1 
ATOM   9058  O  O     . ARG C  3  314 ? 12.401  101.117 73.957  1.00 49.38  ? 314  ARG C O     1 
ATOM   9059  C  CB    . ARG C  3  314 ? 14.483  98.773  74.279  1.00 47.72  ? 314  ARG C CB    1 
ATOM   9060  C  CG    . ARG C  3  314 ? 15.081  100.089 74.632  1.00 47.80  ? 314  ARG C CG    1 
ATOM   9061  C  CD    . ARG C  3  314 ? 16.545  99.975  74.947  1.00 49.93  ? 314  ARG C CD    1 
ATOM   9062  N  NE    . ARG C  3  314 ? 16.902  101.007 75.905  1.00 51.63  ? 314  ARG C NE    1 
ATOM   9063  C  CZ    . ARG C  3  314 ? 18.142  101.380 76.178  1.00 52.74  ? 314  ARG C CZ    1 
ATOM   9064  N  NH1   . ARG C  3  314 ? 19.159  100.799 75.554  1.00 53.52  ? 314  ARG C NH1   1 
ATOM   9065  N  NH2   . ARG C  3  314 ? 18.357  102.333 77.076  1.00 53.60  ? 314  ARG C NH2   1 
ATOM   9066  N  N     . THR C  3  315 ? 12.421  99.881  72.093  1.00 47.61  ? 315  THR C N     1 
ATOM   9067  C  CA    . THR C  3  315 ? 12.047  101.020 71.277  1.00 45.79  ? 315  THR C CA    1 
ATOM   9068  C  C     . THR C  3  315 ? 10.687  100.799 70.679  1.00 46.50  ? 315  THR C C     1 
ATOM   9069  O  O     . THR C  3  315 ? 10.106  99.715  70.789  1.00 46.96  ? 315  THR C O     1 
ATOM   9070  C  CB    . THR C  3  315 ? 13.013  101.250 70.109  1.00 43.95  ? 315  THR C CB    1 
ATOM   9071  O  OG1   . THR C  3  315 ? 12.931  100.135 69.222  1.00 43.19  ? 315  THR C OG1   1 
ATOM   9072  C  CG2   . THR C  3  315 ? 14.441  101.420 70.599  1.00 41.25  ? 315  THR C CG2   1 
ATOM   9073  N  N     . MET C  3  316 ? 10.204  101.845 70.021  1.00 47.20  ? 316  MET C N     1 
ATOM   9074  C  CA    . MET C  3  316 ? 8.909   101.834 69.359  1.00 48.63  ? 316  MET C CA    1 
ATOM   9075  C  C     . MET C  3  316 ? 9.035   101.432 67.882  1.00 49.77  ? 316  MET C C     1 
ATOM   9076  O  O     . MET C  3  316 ? 8.052   101.434 67.140  1.00 51.96  ? 316  MET C O     1 
ATOM   9077  C  CB    . MET C  3  316 ? 8.260   103.216 69.486  1.00 46.35  ? 316  MET C CB    1 
ATOM   9078  C  CG    . MET C  3  316 ? 7.891   103.560 70.912  1.00 44.63  ? 316  MET C CG    1 
ATOM   9079  S  SD    . MET C  3  316 ? 7.441   105.271 71.145  1.00 45.27  ? 316  MET C SD    1 
ATOM   9080  C  CE    . MET C  3  316 ? 6.767   105.245 72.768  1.00 42.89  ? 316  MET C CE    1 
ATOM   9081  N  N     . THR C  3  317 ? 10.242  101.074 67.457  1.00 48.54  ? 317  THR C N     1 
ATOM   9082  C  CA    . THR C  3  317 ? 10.455  100.678 66.076  1.00 47.25  ? 317  THR C CA    1 
ATOM   9083  C  C     . THR C  3  317 ? 9.494   99.582  65.663  1.00 47.49  ? 317  THR C C     1 
ATOM   9084  O  O     . THR C  3  317 ? 8.971   99.598  64.559  1.00 47.34  ? 317  THR C O     1 
ATOM   9085  C  CB    . THR C  3  317 ? 11.859  100.150 65.875  1.00 46.38  ? 317  THR C CB    1 
ATOM   9086  O  OG1   . THR C  3  317 ? 12.793  101.105 66.383  1.00 47.72  ? 317  THR C OG1   1 
ATOM   9087  C  CG2   . THR C  3  317 ? 12.129  99.898  64.407  1.00 45.47  ? 317  THR C CG2   1 
ATOM   9088  N  N     . PHE C  3  318 ? 9.251   98.641  66.565  1.00 48.14  ? 318  PHE C N     1 
ATOM   9089  C  CA    . PHE C  3  318 ? 8.380   97.518  66.268  1.00 49.45  ? 318  PHE C CA    1 
ATOM   9090  C  C     . PHE C  3  318 ? 7.056   97.546  67.022  1.00 50.25  ? 318  PHE C C     1 
ATOM   9091  O  O     . PHE C  3  318 ? 6.415   96.504  67.214  1.00 50.63  ? 318  PHE C O     1 
ATOM   9092  C  CB    . PHE C  3  318 ? 9.120   96.220  66.586  1.00 49.78  ? 318  PHE C CB    1 
ATOM   9093  C  CG    . PHE C  3  318 ? 10.446  96.095  65.902  1.00 48.54  ? 318  PHE C CG    1 
ATOM   9094  C  CD1   . PHE C  3  318 ? 11.545  95.586  66.584  1.00 47.64  ? 318  PHE C CD1   1 
ATOM   9095  C  CD2   . PHE C  3  318 ? 10.599  96.469  64.572  1.00 49.38  ? 318  PHE C CD2   1 
ATOM   9096  C  CE1   . PHE C  3  318 ? 12.790  95.448  65.950  1.00 48.01  ? 318  PHE C CE1   1 
ATOM   9097  C  CE2   . PHE C  3  318 ? 11.845  96.333  63.922  1.00 50.02  ? 318  PHE C CE2   1 
ATOM   9098  C  CZ    . PHE C  3  318 ? 12.941  95.821  64.614  1.00 48.69  ? 318  PHE C CZ    1 
ATOM   9099  N  N     . ARG C  3  319 ? 6.652   98.731  67.458  1.00 50.84  ? 319  ARG C N     1 
ATOM   9100  C  CA    . ARG C  3  319 ? 5.398   98.885  68.188  1.00 53.24  ? 319  ARG C CA    1 
ATOM   9101  C  C     . ARG C  3  319 ? 4.562   99.954  67.509  1.00 54.53  ? 319  ARG C C     1 
ATOM   9102  O  O     . ARG C  3  319 ? 4.588   101.114 67.914  1.00 56.90  ? 319  ARG C O     1 
ATOM   9103  C  CB    . ARG C  3  319 ? 5.674   99.293  69.632  1.00 53.70  ? 319  ARG C CB    1 
ATOM   9104  C  CG    . ARG C  3  319 ? 6.219   98.180  70.512  1.00 53.45  ? 319  ARG C CG    1 
ATOM   9105  C  CD    . ARG C  3  319 ? 6.231   98.649  71.951  1.00 53.20  ? 319  ARG C CD    1 
ATOM   9106  N  NE    . ARG C  3  319 ? 7.278   99.634  72.191  1.00 52.33  ? 319  ARG C NE    1 
ATOM   9107  C  CZ    . ARG C  3  319 ? 7.278   100.492 73.202  1.00 52.87  ? 319  ARG C CZ    1 
ATOM   9108  N  NH1   . ARG C  3  319 ? 6.284   100.501 74.074  1.00 52.61  ? 319  ARG C NH1   1 
ATOM   9109  N  NH2   . ARG C  3  319 ? 8.283   101.339 73.348  1.00 55.55  ? 319  ARG C NH2   1 
ATOM   9110  N  N     . PRO C  3  320 ? 3.788   99.572  66.483  1.00 54.74  ? 320  PRO C N     1 
ATOM   9111  C  CA    . PRO C  3  320 ? 2.932   100.473 65.706  1.00 53.52  ? 320  PRO C CA    1 
ATOM   9112  C  C     . PRO C  3  320 ? 1.965   101.269 66.537  1.00 53.56  ? 320  PRO C C     1 
ATOM   9113  O  O     . PRO C  3  320 ? 1.742   102.446 66.256  1.00 55.91  ? 320  PRO C O     1 
ATOM   9114  C  CB    . PRO C  3  320 ? 2.224   99.535  64.758  1.00 53.86  ? 320  PRO C CB    1 
ATOM   9115  C  CG    . PRO C  3  320 ? 2.059   98.326  65.595  1.00 55.06  ? 320  PRO C CG    1 
ATOM   9116  C  CD    . PRO C  3  320 ? 3.420   98.172  66.220  1.00 55.26  ? 320  PRO C CD    1 
ATOM   9117  N  N     . LEU C  3  321 ? 1.386   100.646 67.555  1.00 50.88  ? 321  LEU C N     1 
ATOM   9118  C  CA    . LEU C  3  321 ? 0.453   101.372 68.399  1.00 49.94  ? 321  LEU C CA    1 
ATOM   9119  C  C     . LEU C  3  321 ? 1.208   102.446 69.170  1.00 49.27  ? 321  LEU C C     1 
ATOM   9120  O  O     . LEU C  3  321 ? 0.827   103.612 69.166  1.00 50.33  ? 321  LEU C O     1 
ATOM   9121  C  CB    . LEU C  3  321 ? -0.227  100.423 69.369  1.00 52.34  ? 321  LEU C CB    1 
ATOM   9122  C  CG    . LEU C  3  321 ? -0.848  99.180  68.733  1.00 51.66  ? 321  LEU C CG    1 
ATOM   9123  C  CD1   . LEU C  3  321 ? -1.576  98.350  69.804  1.00 50.34  ? 321  LEU C CD1   1 
ATOM   9124  C  CD2   . LEU C  3  321 ? -1.781  99.614  67.634  1.00 48.16  ? 321  LEU C CD2   1 
ATOM   9125  N  N     . SER C  3  322 ? 2.287   102.058 69.831  1.00 48.56  ? 322  SER C N     1 
ATOM   9126  C  CA    . SER C  3  322 ? 3.088   103.024 70.563  1.00 47.60  ? 322  SER C CA    1 
ATOM   9127  C  C     . SER C  3  322 ? 3.543   104.167 69.646  1.00 48.51  ? 322  SER C C     1 
ATOM   9128  O  O     . SER C  3  322 ? 3.622   105.318 70.066  1.00 49.14  ? 322  SER C O     1 
ATOM   9129  C  CB    . SER C  3  322 ? 4.298   102.333 71.177  1.00 46.49  ? 322  SER C CB    1 
ATOM   9130  O  OG    . SER C  3  322 ? 3.885   101.400 72.153  1.00 44.38  ? 322  SER C OG    1 
ATOM   9131  N  N     . GLN C  3  323 ? 3.845   103.855 68.393  1.00 49.26  ? 323  GLN C N     1 
ATOM   9132  C  CA    . GLN C  3  323 ? 4.266   104.875 67.448  1.00 51.12  ? 323  GLN C CA    1 
ATOM   9133  C  C     . GLN C  3  323 ? 3.177   105.938 67.224  1.00 52.49  ? 323  GLN C C     1 
ATOM   9134  O  O     . GLN C  3  323 ? 3.456   107.142 67.149  1.00 53.47  ? 323  GLN C O     1 
ATOM   9135  C  CB    . GLN C  3  323 ? 4.626   104.226 66.121  1.00 51.71  ? 323  GLN C CB    1 
ATOM   9136  C  CG    . GLN C  3  323 ? 5.941   103.506 66.126  1.00 55.07  ? 323  GLN C CG    1 
ATOM   9137  C  CD    . GLN C  3  323 ? 6.185   102.765 64.823  1.00 58.02  ? 323  GLN C CD    1 
ATOM   9138  O  OE1   . GLN C  3  323 ? 5.902   103.283 63.748  1.00 60.64  ? 323  GLN C OE1   1 
ATOM   9139  N  NE2   . GLN C  3  323 ? 6.728   101.557 64.911  1.00 59.05  ? 323  GLN C NE2   1 
ATOM   9140  N  N     . THR C  3  324 ? 1.931   105.505 67.115  1.00 52.16  ? 324  THR C N     1 
ATOM   9141  C  CA    . THR C  3  324 ? 0.853   106.457 66.898  1.00 53.13  ? 324  THR C CA    1 
ATOM   9142  C  C     . THR C  3  324 ? 0.646   107.315 68.137  1.00 51.82  ? 324  THR C C     1 
ATOM   9143  O  O     . THR C  3  324 ? 0.517   108.542 68.069  1.00 51.91  ? 324  THR C O     1 
ATOM   9144  C  CB    . THR C  3  324 ? -0.461  105.728 66.537  1.00 53.44  ? 324  THR C CB    1 
ATOM   9145  O  OG1   . THR C  3  324 ? -0.391  105.286 65.177  1.00 57.31  ? 324  THR C OG1   1 
ATOM   9146  C  CG2   . THR C  3  324 ? -1.640  106.645 66.684  1.00 52.29  ? 324  THR C CG2   1 
ATOM   9147  N  N     . LEU C  3  325 ? 0.604   106.655 69.278  1.00 49.88  ? 325  LEU C N     1 
ATOM   9148  C  CA    . LEU C  3  325 ? 0.429   107.362 70.523  1.00 48.80  ? 325  LEU C CA    1 
ATOM   9149  C  C     . LEU C  3  325 ? 1.536   108.416 70.612  1.00 48.29  ? 325  LEU C C     1 
ATOM   9150  O  O     . LEU C  3  325 ? 1.294   109.534 71.029  1.00 49.59  ? 325  LEU C O     1 
ATOM   9151  C  CB    . LEU C  3  325 ? 0.529   106.373 71.674  1.00 47.88  ? 325  LEU C CB    1 
ATOM   9152  C  CG    . LEU C  3  325 ? 0.001   106.843 73.011  1.00 48.66  ? 325  LEU C CG    1 
ATOM   9153  C  CD1   . LEU C  3  325 ? -1.377  107.452 72.810  1.00 49.20  ? 325  LEU C CD1   1 
ATOM   9154  C  CD2   . LEU C  3  325 ? -0.064  105.655 73.970  1.00 49.51  ? 325  LEU C CD2   1 
ATOM   9155  N  N     . PHE C  3  326 ? 2.745   108.056 70.193  1.00 46.78  ? 326  PHE C N     1 
ATOM   9156  C  CA    . PHE C  3  326 ? 3.881   108.968 70.226  1.00 45.97  ? 326  PHE C CA    1 
ATOM   9157  C  C     . PHE C  3  326 ? 3.643   110.232 69.396  1.00 47.91  ? 326  PHE C C     1 
ATOM   9158  O  O     . PHE C  3  326 ? 3.747   111.362 69.905  1.00 48.62  ? 326  PHE C O     1 
ATOM   9159  C  CB    . PHE C  3  326 ? 5.139   108.266 69.703  1.00 43.41  ? 326  PHE C CB    1 
ATOM   9160  C  CG    . PHE C  3  326 ? 6.341   109.177 69.581  1.00 40.88  ? 326  PHE C CG    1 
ATOM   9161  C  CD1   . PHE C  3  326 ? 7.164   109.417 70.677  1.00 39.78  ? 326  PHE C CD1   1 
ATOM   9162  C  CD2   . PHE C  3  326 ? 6.633   109.810 68.373  1.00 38.33  ? 326  PHE C CD2   1 
ATOM   9163  C  CE1   . PHE C  3  326 ? 8.258   110.272 70.571  1.00 39.59  ? 326  PHE C CE1   1 
ATOM   9164  C  CE2   . PHE C  3  326 ? 7.718   110.665 68.256  1.00 36.93  ? 326  PHE C CE2   1 
ATOM   9165  C  CZ    . PHE C  3  326 ? 8.535   110.898 69.358  1.00 38.46  ? 326  PHE C CZ    1 
ATOM   9166  N  N     . TRP C  3  327 ? 3.340   110.048 68.111  1.00 47.62  ? 327  TRP C N     1 
ATOM   9167  C  CA    . TRP C  3  327 ? 3.115   111.186 67.231  1.00 46.68  ? 327  TRP C CA    1 
ATOM   9168  C  C     . TRP C  3  327 ? 1.914   111.995 67.649  1.00 46.64  ? 327  TRP C C     1 
ATOM   9169  O  O     . TRP C  3  327 ? 1.799   113.173 67.331  1.00 46.95  ? 327  TRP C O     1 
ATOM   9170  C  CB    . TRP C  3  327 ? 2.961   110.711 65.803  1.00 45.79  ? 327  TRP C CB    1 
ATOM   9171  C  CG    . TRP C  3  327 ? 4.237   110.200 65.281  1.00 45.77  ? 327  TRP C CG    1 
ATOM   9172  C  CD1   . TRP C  3  327 ? 4.548   108.908 64.976  1.00 44.48  ? 327  TRP C CD1   1 
ATOM   9173  C  CD2   . TRP C  3  327 ? 5.409   110.971 65.024  1.00 46.49  ? 327  TRP C CD2   1 
ATOM   9174  N  NE1   . TRP C  3  327 ? 5.849   108.825 64.537  1.00 43.25  ? 327  TRP C NE1   1 
ATOM   9175  C  CE2   . TRP C  3  327 ? 6.403   110.076 64.557  1.00 44.09  ? 327  TRP C CE2   1 
ATOM   9176  C  CE3   . TRP C  3  327 ? 5.721   112.335 65.146  1.00 47.22  ? 327  TRP C CE3   1 
ATOM   9177  C  CZ2   . TRP C  3  327 ? 7.686   110.493 64.213  1.00 43.76  ? 327  TRP C CZ2   1 
ATOM   9178  C  CZ3   . TRP C  3  327 ? 7.006   112.754 64.805  1.00 48.77  ? 327  TRP C CZ3   1 
ATOM   9179  C  CH2   . TRP C  3  327 ? 7.975   111.826 64.343  1.00 46.90  ? 327  TRP C CH2   1 
ATOM   9180  N  N     . LEU C  3  328 ? 1.017   111.355 68.376  1.00 46.85  ? 328  LEU C N     1 
ATOM   9181  C  CA    . LEU C  3  328 ? -0.162  112.040 68.853  1.00 47.69  ? 328  LEU C CA    1 
ATOM   9182  C  C     . LEU C  3  328 ? 0.329   113.037 69.883  1.00 47.30  ? 328  LEU C C     1 
ATOM   9183  O  O     . LEU C  3  328 ? -0.037  114.215 69.868  1.00 47.44  ? 328  LEU C O     1 
ATOM   9184  C  CB    . LEU C  3  328 ? -1.096  111.051 69.516  1.00 50.80  ? 328  LEU C CB    1 
ATOM   9185  C  CG    . LEU C  3  328 ? -2.549  111.412 69.302  1.00 52.11  ? 328  LEU C CG    1 
ATOM   9186  C  CD1   . LEU C  3  328 ? -2.888  111.276 67.804  1.00 51.43  ? 328  LEU C CD1   1 
ATOM   9187  C  CD2   . LEU C  3  328 ? -3.402  110.489 70.157  1.00 53.01  ? 328  LEU C CD2   1 
ATOM   9188  N  N     . LEU C  3  329 ? 1.171   112.542 70.783  1.00 46.12  ? 329  LEU C N     1 
ATOM   9189  C  CA    . LEU C  3  329 ? 1.746   113.369 71.825  1.00 43.40  ? 329  LEU C CA    1 
ATOM   9190  C  C     . LEU C  3  329 ? 2.505   114.536 71.187  1.00 41.68  ? 329  LEU C C     1 
ATOM   9191  O  O     . LEU C  3  329 ? 2.376   115.674 71.645  1.00 42.14  ? 329  LEU C O     1 
ATOM   9192  C  CB    . LEU C  3  329 ? 2.685   112.542 72.697  1.00 42.58  ? 329  LEU C CB    1 
ATOM   9193  C  CG    . LEU C  3  329 ? 3.393   113.353 73.777  1.00 42.98  ? 329  LEU C CG    1 
ATOM   9194  C  CD1   . LEU C  3  329 ? 2.374   113.735 74.817  1.00 44.00  ? 329  LEU C CD1   1 
ATOM   9195  C  CD2   . LEU C  3  329 ? 4.529   112.565 74.403  1.00 42.13  ? 329  LEU C CD2   1 
ATOM   9196  N  N     . VAL C  3  330 ? 3.275   114.278 70.130  1.00 37.48  ? 330  VAL C N     1 
ATOM   9197  C  CA    . VAL C  3  330 ? 4.004   115.376 69.509  1.00 36.90  ? 330  VAL C CA    1 
ATOM   9198  C  C     . VAL C  3  330 ? 3.050   116.458 69.029  1.00 37.11  ? 330  VAL C C     1 
ATOM   9199  O  O     . VAL C  3  330 ? 3.250   117.641 69.307  1.00 35.60  ? 330  VAL C O     1 
ATOM   9200  C  CB    . VAL C  3  330 ? 4.859   114.917 68.331  1.00 36.28  ? 330  VAL C CB    1 
ATOM   9201  C  CG1   . VAL C  3  330 ? 5.554   116.099 67.732  1.00 33.55  ? 330  VAL C CG1   1 
ATOM   9202  C  CG2   . VAL C  3  330 ? 5.893   113.923 68.793  1.00 36.56  ? 330  VAL C CG2   1 
ATOM   9203  N  N     . ALA C  3  331 ? 1.997   116.056 68.320  1.00 39.17  ? 331  ALA C N     1 
ATOM   9204  C  CA    . ALA C  3  331 ? 0.996   117.018 67.824  1.00 39.30  ? 331  ALA C CA    1 
ATOM   9205  C  C     . ALA C  3  331 ? 0.274   117.671 69.006  1.00 38.77  ? 331  ALA C C     1 
ATOM   9206  O  O     . ALA C  3  331 ? -0.096  118.849 68.939  1.00 37.25  ? 331  ALA C O     1 
ATOM   9207  C  CB    . ALA C  3  331 ? -0.003  116.327 66.921  1.00 37.39  ? 331  ALA C CB    1 
ATOM   9208  N  N     . ASN C  3  332 ? 0.086   116.897 70.079  1.00 38.14  ? 332  ASN C N     1 
ATOM   9209  C  CA    . ASN C  3  332 ? -0.553  117.393 71.296  1.00 38.67  ? 332  ASN C CA    1 
ATOM   9210  C  C     . ASN C  3  332 ? 0.231   118.638 71.775  1.00 40.20  ? 332  ASN C C     1 
ATOM   9211  O  O     . ASN C  3  332 ? -0.366  119.682 72.099  1.00 40.61  ? 332  ASN C O     1 
ATOM   9212  C  CB    . ASN C  3  332 ? -0.541  116.298 72.376  1.00 36.06  ? 332  ASN C CB    1 
ATOM   9213  C  CG    . ASN C  3  332 ? -1.345  116.675 73.631  1.00 35.53  ? 332  ASN C CG    1 
ATOM   9214  O  OD1   . ASN C  3  332 ? -1.594  117.852 73.909  1.00 33.41  ? 332  ASN C OD1   1 
ATOM   9215  N  ND2   . ASN C  3  332 ? -1.724  115.660 74.414  1.00 35.23  ? 332  ASN C ND2   1 
ATOM   9216  N  N     . LEU C  3  333 ? 1.563   118.532 71.791  1.00 39.39  ? 333  LEU C N     1 
ATOM   9217  C  CA    . LEU C  3  333 ? 2.428   119.635 72.222  1.00 39.45  ? 333  LEU C CA    1 
ATOM   9218  C  C     . LEU C  3  333 ? 2.375   120.772 71.235  1.00 40.61  ? 333  LEU C C     1 
ATOM   9219  O  O     . LEU C  3  333 ? 2.353   121.950 71.618  1.00 41.47  ? 333  LEU C O     1 
ATOM   9220  C  CB    . LEU C  3  333 ? 3.870   119.178 72.336  1.00 37.76  ? 333  LEU C CB    1 
ATOM   9221  C  CG    . LEU C  3  333 ? 4.143   118.199 73.467  1.00 38.03  ? 333  LEU C CG    1 
ATOM   9222  C  CD1   . LEU C  3  333 ? 5.443   117.502 73.185  1.00 36.26  ? 333  LEU C CD1   1 
ATOM   9223  C  CD2   . LEU C  3  333 ? 4.156   118.923 74.814  1.00 36.72  ? 333  LEU C CD2   1 
ATOM   9224  N  N     . LEU C  3  334 ? 2.385   120.406 69.958  1.00 40.65  ? 334  LEU C N     1 
ATOM   9225  C  CA    . LEU C  3  334 ? 2.298   121.377 68.873  1.00 40.31  ? 334  LEU C CA    1 
ATOM   9226  C  C     . LEU C  3  334 ? 1.044   122.207 69.111  1.00 39.80  ? 334  LEU C C     1 
ATOM   9227  O  O     . LEU C  3  334 ? 1.036   123.417 68.940  1.00 37.93  ? 334  LEU C O     1 
ATOM   9228  C  CB    . LEU C  3  334 ? 2.178   120.637 67.558  1.00 42.35  ? 334  LEU C CB    1 
ATOM   9229  C  CG    . LEU C  3  334 ? 2.321   121.486 66.316  1.00 43.32  ? 334  LEU C CG    1 
ATOM   9230  C  CD1   . LEU C  3  334 ? 3.571   122.332 66.426  1.00 45.83  ? 334  LEU C CD1   1 
ATOM   9231  C  CD2   . LEU C  3  334 ? 2.400   120.563 65.113  1.00 43.32  ? 334  LEU C CD2   1 
ATOM   9232  N  N     . ILE C  3  335 ? -0.018  121.524 69.528  1.00 39.85  ? 335  ILE C N     1 
ATOM   9233  C  CA    . ILE C  3  335 ? -1.276  122.169 69.833  1.00 38.25  ? 335  ILE C CA    1 
ATOM   9234  C  C     . ILE C  3  335 ? -1.095  123.085 71.040  1.00 36.40  ? 335  ILE C C     1 
ATOM   9235  O  O     . ILE C  3  335 ? -1.409  124.269 70.984  1.00 34.58  ? 335  ILE C O     1 
ATOM   9236  C  CB    . ILE C  3  335 ? -2.379  121.115 70.120  1.00 38.79  ? 335  ILE C CB    1 
ATOM   9237  C  CG1   . ILE C  3  335 ? -2.744  120.394 68.814  1.00 39.84  ? 335  ILE C CG1   1 
ATOM   9238  C  CG2   . ILE C  3  335 ? -3.631  121.795 70.708  1.00 38.28  ? 335  ILE C CG2   1 
ATOM   9239  C  CD1   . ILE C  3  335 ? -3.799  119.305 68.958  1.00 37.88  ? 335  ILE C CD1   1 
ATOM   9240  N  N     . LEU C  3  336 ? -0.581  122.539 72.132  1.00 36.88  ? 336  LEU C N     1 
ATOM   9241  C  CA    . LEU C  3  336 ? -0.376  123.355 73.319  1.00 39.60  ? 336  LEU C CA    1 
ATOM   9242  C  C     . LEU C  3  336 ? 0.429   124.611 72.967  1.00 41.86  ? 336  LEU C C     1 
ATOM   9243  O  O     . LEU C  3  336 ? 0.105   125.712 73.432  1.00 44.23  ? 336  LEU C O     1 
ATOM   9244  C  CB    . LEU C  3  336 ? 0.294   122.533 74.424  1.00 38.60  ? 336  LEU C CB    1 
ATOM   9245  C  CG    . LEU C  3  336 ? -0.701  121.545 75.071  1.00 41.84  ? 336  LEU C CG    1 
ATOM   9246  C  CD1   . LEU C  3  336 ? 0.005   120.398 75.754  1.00 43.81  ? 336  LEU C CD1   1 
ATOM   9247  C  CD2   . LEU C  3  336 ? -1.561  122.276 76.071  1.00 41.84  ? 336  LEU C CD2   1 
ATOM   9248  N  N     . THR C  3  337 ? 1.450   124.472 72.122  1.00 41.63  ? 337  THR C N     1 
ATOM   9249  C  CA    . THR C  3  337 ? 2.243   125.638 71.720  1.00 40.97  ? 337  THR C CA    1 
ATOM   9250  C  C     . THR C  3  337 ? 1.359   126.660 71.009  1.00 40.94  ? 337  THR C C     1 
ATOM   9251  O  O     . THR C  3  337 ? 1.405   127.847 71.324  1.00 38.62  ? 337  THR C O     1 
ATOM   9252  C  CB    . THR C  3  337 ? 3.397   125.247 70.771  1.00 41.52  ? 337  THR C CB    1 
ATOM   9253  O  OG1   . THR C  3  337 ? 4.285   124.346 71.449  1.00 43.00  ? 337  THR C OG1   1 
ATOM   9254  C  CG2   . THR C  3  337 ? 4.174   126.505 70.314  1.00 36.84  ? 337  THR C CG2   1 
ATOM   9255  N  N     . TRP C  3  338 ? 0.574   126.189 70.038  1.00 41.09  ? 338  TRP C N     1 
ATOM   9256  C  CA    . TRP C  3  338 ? -0.347  127.052 69.312  1.00 41.71  ? 338  TRP C CA    1 
ATOM   9257  C  C     . TRP C  3  338 ? -1.213  127.788 70.320  1.00 42.14  ? 338  TRP C C     1 
ATOM   9258  O  O     . TRP C  3  338 ? -1.300  129.009 70.296  1.00 42.50  ? 338  TRP C O     1 
ATOM   9259  C  CB    . TRP C  3  338 ? -1.255  126.235 68.401  1.00 41.94  ? 338  TRP C CB    1 
ATOM   9260  C  CG    . TRP C  3  338 ? -2.435  127.008 67.903  1.00 43.76  ? 338  TRP C CG    1 
ATOM   9261  C  CD1   . TRP C  3  338 ? -2.420  128.232 67.307  1.00 42.82  ? 338  TRP C CD1   1 
ATOM   9262  C  CD2   . TRP C  3  338 ? -3.806  126.599 67.941  1.00 47.08  ? 338  TRP C CD2   1 
ATOM   9263  N  NE1   . TRP C  3  338 ? -3.697  128.619 66.965  1.00 44.91  ? 338  TRP C NE1   1 
ATOM   9264  C  CE2   . TRP C  3  338 ? -4.570  127.633 67.342  1.00 47.76  ? 338  TRP C CE2   1 
ATOM   9265  C  CE3   . TRP C  3  338 ? -4.470  125.458 68.422  1.00 48.88  ? 338  TRP C CE3   1 
ATOM   9266  C  CZ2   . TRP C  3  338 ? -5.970  127.560 67.211  1.00 47.60  ? 338  TRP C CZ2   1 
ATOM   9267  C  CZ3   . TRP C  3  338 ? -5.874  125.386 68.290  1.00 50.09  ? 338  TRP C CZ3   1 
ATOM   9268  C  CH2   . TRP C  3  338 ? -6.601  126.433 67.688  1.00 48.41  ? 338  TRP C CH2   1 
ATOM   9269  N  N     . ILE C  3  339 ? -1.857  127.035 71.203  1.00 41.34  ? 339  ILE C N     1 
ATOM   9270  C  CA    . ILE C  3  339 ? -2.702  127.632 72.217  1.00 42.20  ? 339  ILE C CA    1 
ATOM   9271  C  C     . ILE C  3  339 ? -2.003  128.726 73.014  1.00 41.21  ? 339  ILE C C     1 
ATOM   9272  O  O     . ILE C  3  339 ? -2.555  129.805 73.215  1.00 38.97  ? 339  ILE C O     1 
ATOM   9273  C  CB    . ILE C  3  339 ? -3.214  126.569 73.185  1.00 43.83  ? 339  ILE C CB    1 
ATOM   9274  C  CG1   . ILE C  3  339 ? -4.247  125.693 72.474  1.00 47.63  ? 339  ILE C CG1   1 
ATOM   9275  C  CG2   . ILE C  3  339 ? -3.841  127.219 74.394  1.00 43.42  ? 339  ILE C CG2   1 
ATOM   9276  C  CD1   . ILE C  3  339 ? -5.520  126.433 72.067  1.00 47.48  ? 339  ILE C CD1   1 
ATOM   9277  N  N     . GLY C  3  340 ? -0.793  128.439 73.477  1.00 41.72  ? 340  GLY C N     1 
ATOM   9278  C  CA    . GLY C  3  340 ? -0.042  129.417 74.250  1.00 42.27  ? 340  GLY C CA    1 
ATOM   9279  C  C     . GLY C  3  340 ? 0.057   130.789 73.607  1.00 43.12  ? 340  GLY C C     1 
ATOM   9280  O  O     . GLY C  3  340 ? 0.094   131.794 74.315  1.00 42.04  ? 340  GLY C O     1 
ATOM   9281  N  N     . SER C  3  341 ? 0.099   130.827 72.271  1.00 45.25  ? 341  SER C N     1 
ATOM   9282  C  CA    . SER C  3  341 ? 0.183   132.079 71.494  1.00 46.61  ? 341  SER C CA    1 
ATOM   9283  C  C     . SER C  3  341 ? -1.181  132.788 71.335  1.00 47.98  ? 341  SER C C     1 
ATOM   9284  O  O     . SER C  3  341 ? -1.259  133.927 70.883  1.00 48.93  ? 341  SER C O     1 
ATOM   9285  C  CB    . SER C  3  341 ? 0.752   131.809 70.095  1.00 44.95  ? 341  SER C CB    1 
ATOM   9286  O  OG    . SER C  3  341 ? -0.241  131.271 69.237  1.00 44.15  ? 341  SER C OG    1 
ATOM   9287  N  N     . GLN C  3  342 ? -2.256  132.110 71.703  1.00 48.78  ? 342  GLN C N     1 
ATOM   9288  C  CA    . GLN C  3  342 ? -3.564  132.710 71.598  1.00 49.09  ? 342  GLN C CA    1 
ATOM   9289  C  C     . GLN C  3  342 ? -4.055  133.271 72.925  1.00 49.39  ? 342  GLN C C     1 
ATOM   9290  O  O     . GLN C  3  342 ? -3.629  132.833 73.995  1.00 49.39  ? 342  GLN C O     1 
ATOM   9291  C  CB    . GLN C  3  342 ? -4.542  131.681 71.066  1.00 49.42  ? 342  GLN C CB    1 
ATOM   9292  C  CG    . GLN C  3  342 ? -4.070  131.102 69.772  1.00 50.55  ? 342  GLN C CG    1 
ATOM   9293  C  CD    . GLN C  3  342 ? -3.853  132.164 68.742  1.00 51.32  ? 342  GLN C CD    1 
ATOM   9294  O  OE1   . GLN C  3  342 ? -3.356  131.896 67.662  1.00 54.63  ? 342  GLN C OE1   1 
ATOM   9295  N  NE2   . GLN C  3  342 ? -4.237  133.383 69.063  1.00 53.18  ? 342  GLN C NE2   1 
ATOM   9296  N  N     . PRO C  3  343 ? -4.952  134.269 72.865  1.00 49.28  ? 343  PRO C N     1 
ATOM   9297  C  CA    . PRO C  3  343 ? -5.551  134.941 74.018  1.00 47.87  ? 343  PRO C CA    1 
ATOM   9298  C  C     . PRO C  3  343 ? -6.463  134.017 74.810  1.00 47.36  ? 343  PRO C C     1 
ATOM   9299  O  O     . PRO C  3  343 ? -7.011  133.056 74.265  1.00 44.98  ? 343  PRO C O     1 
ATOM   9300  C  CB    . PRO C  3  343 ? -6.313  136.076 73.376  1.00 47.92  ? 343  PRO C CB    1 
ATOM   9301  C  CG    . PRO C  3  343 ? -6.708  135.500 72.055  1.00 47.17  ? 343  PRO C CG    1 
ATOM   9302  C  CD    . PRO C  3  343 ? -5.430  134.887 71.616  1.00 48.59  ? 343  PRO C CD    1 
ATOM   9303  N  N     . VAL C  3  344 ? -6.611  134.307 76.099  1.00 48.32  ? 344  VAL C N     1 
ATOM   9304  C  CA    . VAL C  3  344 ? -7.449  133.482 76.950  1.00 50.46  ? 344  VAL C CA    1 
ATOM   9305  C  C     . VAL C  3  344 ? -8.896  133.791 76.597  1.00 51.75  ? 344  VAL C C     1 
ATOM   9306  O  O     . VAL C  3  344 ? -9.533  134.671 77.184  1.00 50.91  ? 344  VAL C O     1 
ATOM   9307  C  CB    . VAL C  3  344 ? -7.204  133.763 78.457  1.00 51.12  ? 344  VAL C CB    1 
ATOM   9308  C  CG1   . VAL C  3  344 ? -7.854  132.689 79.295  1.00 51.46  ? 344  VAL C CG1   1 
ATOM   9309  C  CG2   . VAL C  3  344 ? -5.733  133.801 78.752  1.00 50.95  ? 344  VAL C CG2   1 
ATOM   9310  N  N     . GLU C  3  345 ? -9.391  133.068 75.602  1.00 53.64  ? 345  GLU C N     1 
ATOM   9311  C  CA    . GLU C  3  345 ? -10.756 133.214 75.123  1.00 55.13  ? 345  GLU C CA    1 
ATOM   9312  C  C     . GLU C  3  345 ? -11.206 131.934 74.450  1.00 55.02  ? 345  GLU C C     1 
ATOM   9313  O  O     . GLU C  3  345 ? -10.386 131.072 74.107  1.00 57.19  ? 345  GLU C O     1 
ATOM   9314  C  CB    . GLU C  3  345 ? -10.845 134.316 74.092  1.00 57.75  ? 345  GLU C CB    1 
ATOM   9315  C  CG    . GLU C  3  345 ? -10.443 135.666 74.569  1.00 62.64  ? 345  GLU C CG    1 
ATOM   9316  C  CD    . GLU C  3  345 ? -10.635 136.681 73.470  1.00 67.47  ? 345  GLU C CD    1 
ATOM   9317  O  OE1   . GLU C  3  345 ? -11.745 136.686 72.884  1.00 71.27  ? 345  GLU C OE1   1 
ATOM   9318  O  OE2   . GLU C  3  345 ? -9.698  137.461 73.185  1.00 68.42  ? 345  GLU C OE2   1 
ATOM   9319  N  N     . HIS C  3  346 ? -12.512 131.823 74.237  1.00 52.48  ? 346  HIS C N     1 
ATOM   9320  C  CA    . HIS C  3  346 ? -13.076 130.659 73.573  1.00 49.90  ? 346  HIS C CA    1 
ATOM   9321  C  C     . HIS C  3  346 ? -12.761 130.753 72.073  1.00 48.91  ? 346  HIS C C     1 
ATOM   9322  O  O     . HIS C  3  346 ? -12.695 131.850 71.526  1.00 50.16  ? 346  HIS C O     1 
ATOM   9323  C  CB    . HIS C  3  346 ? -14.571 130.662 73.791  1.00 47.96  ? 346  HIS C CB    1 
ATOM   9324  C  CG    . HIS C  3  346 ? -15.268 129.517 73.140  1.00 50.59  ? 346  HIS C CG    1 
ATOM   9325  N  ND1   . HIS C  3  346 ? -15.103 128.212 73.559  1.00 52.54  ? 346  HIS C ND1   1 
ATOM   9326  C  CD2   . HIS C  3  346 ? -16.110 129.470 72.080  1.00 49.52  ? 346  HIS C CD2   1 
ATOM   9327  C  CE1   . HIS C  3  346 ? -15.814 127.411 72.785  1.00 50.76  ? 346  HIS C CE1   1 
ATOM   9328  N  NE2   . HIS C  3  346 ? -16.433 128.150 71.879  1.00 51.20  ? 346  HIS C NE2   1 
ATOM   9329  N  N     . PRO C  3  347 ? -12.559 129.617 71.384  1.00 47.79  ? 347  PRO C N     1 
ATOM   9330  C  CA    . PRO C  3  347 ? -12.587 128.222 71.839  1.00 48.56  ? 347  PRO C CA    1 
ATOM   9331  C  C     . PRO C  3  347 ? -11.235 127.802 72.413  1.00 49.26  ? 347  PRO C C     1 
ATOM   9332  O  O     . PRO C  3  347 ? -11.075 126.702 72.956  1.00 50.92  ? 347  PRO C O     1 
ATOM   9333  C  CB    . PRO C  3  347 ? -12.927 127.460 70.558  1.00 47.34  ? 347  PRO C CB    1 
ATOM   9334  C  CG    . PRO C  3  347 ? -12.125 128.219 69.522  1.00 47.85  ? 347  PRO C CG    1 
ATOM   9335  C  CD    . PRO C  3  347 ? -12.330 129.686 69.923  1.00 47.71  ? 347  PRO C CD    1 
ATOM   9336  N  N     . PHE C  3  348 ? -10.263 128.691 72.269  1.00 47.73  ? 348  PHE C N     1 
ATOM   9337  C  CA    . PHE C  3  348 ? -8.921  128.448 72.733  1.00 45.81  ? 348  PHE C CA    1 
ATOM   9338  C  C     . PHE C  3  348 ? -8.865  127.860 74.131  1.00 45.48  ? 348  PHE C C     1 
ATOM   9339  O  O     . PHE C  3  348 ? -8.288  126.802 74.344  1.00 46.14  ? 348  PHE C O     1 
ATOM   9340  C  CB    . PHE C  3  348 ? -8.157  129.747 72.665  1.00 46.22  ? 348  PHE C CB    1 
ATOM   9341  C  CG    . PHE C  3  348 ? -7.967  130.241 71.276  1.00 47.91  ? 348  PHE C CG    1 
ATOM   9342  C  CD1   . PHE C  3  348 ? -7.826  131.602 71.015  1.00 49.42  ? 348  PHE C CD1   1 
ATOM   9343  C  CD2   . PHE C  3  348 ? -7.885  129.344 70.222  1.00 48.05  ? 348  PHE C CD2   1 
ATOM   9344  C  CE1   . PHE C  3  348 ? -7.598  132.071 69.713  1.00 49.22  ? 348  PHE C CE1   1 
ATOM   9345  C  CE2   . PHE C  3  348 ? -7.657  129.797 68.912  1.00 50.38  ? 348  PHE C CE2   1 
ATOM   9346  C  CZ    . PHE C  3  348 ? -7.512  131.167 68.659  1.00 49.75  ? 348  PHE C CZ    1 
ATOM   9347  N  N     . ILE C  3  349 ? -9.476  128.534 75.086  1.00 44.70  ? 349  ILE C N     1 
ATOM   9348  C  CA    . ILE C  3  349 ? -9.465  128.056 76.458  1.00 44.59  ? 349  ILE C CA    1 
ATOM   9349  C  C     . ILE C  3  349 ? -9.770  126.576 76.570  1.00 44.93  ? 349  ILE C C     1 
ATOM   9350  O  O     . ILE C  3  349 ? -8.929  125.797 77.016  1.00 46.69  ? 349  ILE C O     1 
ATOM   9351  C  CB    . ILE C  3  349 ? -10.463 128.858 77.323  1.00 43.83  ? 349  ILE C CB    1 
ATOM   9352  C  CG1   . ILE C  3  349 ? -9.935  130.285 77.496  1.00 43.26  ? 349  ILE C CG1   1 
ATOM   9353  C  CG2   . ILE C  3  349 ? -10.639 128.195 78.677  1.00 43.10  ? 349  ILE C CG2   1 
ATOM   9354  C  CD1   . ILE C  3  349 ? -10.957 131.281 77.826  1.00 41.81  ? 349  ILE C CD1   1 
ATOM   9355  N  N     . ILE C  3  350 ? -10.968 126.185 76.156  1.00 44.51  ? 350  ILE C N     1 
ATOM   9356  C  CA    . ILE C  3  350 ? -11.357 124.790 76.248  1.00 43.37  ? 350  ILE C CA    1 
ATOM   9357  C  C     . ILE C  3  350 ? -10.369 123.873 75.530  1.00 42.37  ? 350  ILE C C     1 
ATOM   9358  O  O     . ILE C  3  350 ? -9.909  122.895 76.118  1.00 41.63  ? 350  ILE C O     1 
ATOM   9359  C  CB    . ILE C  3  350 ? -12.788 124.591 75.713  1.00 43.10  ? 350  ILE C CB    1 
ATOM   9360  C  CG1   . ILE C  3  350 ? -13.195 123.133 75.832  1.00 42.01  ? 350  ILE C CG1   1 
ATOM   9361  C  CG2   . ILE C  3  350 ? -12.873 125.036 74.293  1.00 43.86  ? 350  ILE C CG2   1 
ATOM   9362  C  CD1   . ILE C  3  350 ? -13.102 122.600 77.234  1.00 41.91  ? 350  ILE C CD1   1 
ATOM   9363  N  N     . ILE C  3  351 ? -10.032 124.188 74.280  1.00 41.89  ? 351  ILE C N     1 
ATOM   9364  C  CA    . ILE C  3  351 ? -9.066  123.376 73.520  1.00 42.48  ? 351  ILE C CA    1 
ATOM   9365  C  C     . ILE C  3  351 ? -7.796  123.167 74.352  1.00 43.71  ? 351  ILE C C     1 
ATOM   9366  O  O     . ILE C  3  351 ? -7.300  122.045 74.481  1.00 42.15  ? 351  ILE C O     1 
ATOM   9367  C  CB    . ILE C  3  351 ? -8.614  124.066 72.217  1.00 41.82  ? 351  ILE C CB    1 
ATOM   9368  C  CG1   . ILE C  3  351 ? -9.824  124.500 71.388  1.00 41.55  ? 351  ILE C CG1   1 
ATOM   9369  C  CG2   . ILE C  3  351 ? -7.713  123.135 71.439  1.00 38.60  ? 351  ILE C CG2   1 
ATOM   9370  C  CD1   . ILE C  3  351 ? -9.466  125.126 70.044  1.00 42.11  ? 351  ILE C CD1   1 
ATOM   9371  N  N     . GLY C  3  352 ? -7.276  124.272 74.891  1.00 45.06  ? 352  GLY C N     1 
ATOM   9372  C  CA    . GLY C  3  352 ? -6.087  124.238 75.722  1.00 47.25  ? 352  GLY C CA    1 
ATOM   9373  C  C     . GLY C  3  352 ? -6.258  123.244 76.852  1.00 49.79  ? 352  GLY C C     1 
ATOM   9374  O  O     . GLY C  3  352 ? -5.436  122.337 77.026  1.00 51.02  ? 352  GLY C O     1 
ATOM   9375  N  N     . GLN C  3  353 ? -7.337  123.400 77.614  1.00 51.00  ? 353  GLN C N     1 
ATOM   9376  C  CA    . GLN C  3  353 ? -7.634  122.505 78.728  1.00 51.29  ? 353  GLN C CA    1 
ATOM   9377  C  C     . GLN C  3  353 ? -7.664  121.055 78.296  1.00 51.98  ? 353  GLN C C     1 
ATOM   9378  O  O     . GLN C  3  353 ? -7.178  120.181 79.002  1.00 53.82  ? 353  GLN C O     1 
ATOM   9379  C  CB    . GLN C  3  353 ? -8.964  122.879 79.322  1.00 51.60  ? 353  GLN C CB    1 
ATOM   9380  C  CG    . GLN C  3  353 ? -8.972  124.290 79.797  1.00 53.31  ? 353  GLN C CG    1 
ATOM   9381  C  CD    . GLN C  3  353 ? -10.313 124.683 80.303  1.00 54.29  ? 353  GLN C CD    1 
ATOM   9382  O  OE1   . GLN C  3  353 ? -11.270 124.832 79.530  1.00 55.17  ? 353  GLN C OE1   1 
ATOM   9383  N  NE2   . GLN C  3  353 ? -10.415 124.840 81.616  1.00 55.32  ? 353  GLN C NE2   1 
ATOM   9384  N  N     . MET C  3  354 ? -8.247  120.795 77.138  1.00 51.56  ? 354  MET C N     1 
ATOM   9385  C  CA    . MET C  3  354 ? -8.280  119.445 76.632  1.00 51.62  ? 354  MET C CA    1 
ATOM   9386  C  C     . MET C  3  354 ? -6.843  118.999 76.398  1.00 50.54  ? 354  MET C C     1 
ATOM   9387  O  O     . MET C  3  354 ? -6.378  118.034 77.008  1.00 49.17  ? 354  MET C O     1 
ATOM   9388  C  CB    . MET C  3  354 ? -9.050  119.392 75.315  1.00 56.78  ? 354  MET C CB    1 
ATOM   9389  C  CG    . MET C  3  354 ? -10.531 119.665 75.443  1.00 62.15  ? 354  MET C CG    1 
ATOM   9390  S  SD    . MET C  3  354 ? -11.321 118.326 76.319  1.00 69.27  ? 354  MET C SD    1 
ATOM   9391  C  CE    . MET C  3  354 ? -11.151 118.898 78.074  1.00 69.23  ? 354  MET C CE    1 
ATOM   9392  N  N     . ALA C  3  355 ? -6.135  119.712 75.520  1.00 49.52  ? 355  ALA C N     1 
ATOM   9393  C  CA    . ALA C  3  355 ? -4.752  119.363 75.189  1.00 49.63  ? 355  ALA C CA    1 
ATOM   9394  C  C     . ALA C  3  355 ? -3.950  119.048 76.446  1.00 49.93  ? 355  ALA C C     1 
ATOM   9395  O  O     . ALA C  3  355 ? -3.212  118.055 76.500  1.00 49.82  ? 355  ALA C O     1 
ATOM   9396  C  CB    . ALA C  3  355 ? -4.099  120.489 74.428  1.00 47.57  ? 355  ALA C CB    1 
ATOM   9397  N  N     . SER C  3  356 ? -4.102  119.902 77.453  1.00 48.17  ? 356  SER C N     1 
ATOM   9398  C  CA    . SER C  3  356 ? -3.418  119.714 78.712  1.00 46.09  ? 356  SER C CA    1 
ATOM   9399  C  C     . SER C  3  356 ? -3.826  118.387 79.301  1.00 46.36  ? 356  SER C C     1 
ATOM   9400  O  O     . SER C  3  356 ? -2.998  117.514 79.549  1.00 46.85  ? 356  SER C O     1 
ATOM   9401  C  CB    . SER C  3  356 ? -3.775  120.833 79.661  1.00 44.76  ? 356  SER C CB    1 
ATOM   9402  O  OG    . SER C  3  356 ? -3.230  122.038 79.174  1.00 45.91  ? 356  SER C OG    1 
ATOM   9403  N  N     . LEU C  3  357 ? -5.115  118.224 79.530  1.00 47.09  ? 357  LEU C N     1 
ATOM   9404  C  CA    . LEU C  3  357 ? -5.597  116.967 80.081  1.00 48.34  ? 357  LEU C CA    1 
ATOM   9405  C  C     . LEU C  3  357 ? -5.039  115.830 79.209  1.00 47.87  ? 357  LEU C C     1 
ATOM   9406  O  O     . LEU C  3  357 ? -4.495  114.843 79.701  1.00 45.74  ? 357  LEU C O     1 
ATOM   9407  C  CB    . LEU C  3  357 ? -7.123  116.971 80.074  1.00 49.31  ? 357  LEU C CB    1 
ATOM   9408  C  CG    . LEU C  3  357 ? -7.779  115.844 80.842  1.00 50.46  ? 357  LEU C CG    1 
ATOM   9409  C  CD1   . LEU C  3  357 ? -7.173  115.711 82.236  1.00 50.80  ? 357  LEU C CD1   1 
ATOM   9410  C  CD2   . LEU C  3  357 ? -9.237  116.168 80.918  1.00 51.83  ? 357  LEU C CD2   1 
ATOM   9411  N  N     . SER C  3  358 ? -5.160  116.012 77.900  1.00 48.10  ? 358  SER C N     1 
ATOM   9412  C  CA    . SER C  3  358 ? -4.667  115.056 76.927  1.00 48.24  ? 358  SER C CA    1 
ATOM   9413  C  C     . SER C  3  358 ? -3.207  114.692 77.193  1.00 49.54  ? 358  SER C C     1 
ATOM   9414  O  O     . SER C  3  358 ? -2.866  113.528 77.347  1.00 50.68  ? 358  SER C O     1 
ATOM   9415  C  CB    . SER C  3  358 ? -4.781  115.648 75.532  1.00 47.06  ? 358  SER C CB    1 
ATOM   9416  O  OG    . SER C  3  358 ? -4.151  114.787 74.611  1.00 47.19  ? 358  SER C OG    1 
ATOM   9417  N  N     . TYR C  3  359 ? -2.351  115.708 77.231  1.00 50.46  ? 359  TYR C N     1 
ATOM   9418  C  CA    . TYR C  3  359 ? -0.919  115.541 77.479  1.00 49.58  ? 359  TYR C CA    1 
ATOM   9419  C  C     . TYR C  3  359 ? -0.596  114.599 78.631  1.00 49.07  ? 359  TYR C C     1 
ATOM   9420  O  O     . TYR C  3  359 ? 0.052   113.578 78.427  1.00 47.81  ? 359  TYR C O     1 
ATOM   9421  C  CB    . TYR C  3  359 ? -0.288  116.906 77.763  1.00 49.30  ? 359  TYR C CB    1 
ATOM   9422  C  CG    . TYR C  3  359 ? 1.169   116.873 78.170  1.00 48.90  ? 359  TYR C CG    1 
ATOM   9423  C  CD1   . TYR C  3  359 ? 2.180   116.652 77.228  1.00 50.39  ? 359  TYR C CD1   1 
ATOM   9424  C  CD2   . TYR C  3  359 ? 1.543   117.099 79.490  1.00 49.45  ? 359  TYR C CD2   1 
ATOM   9425  C  CE1   . TYR C  3  359 ? 3.535   116.666 77.599  1.00 49.74  ? 359  TYR C CE1   1 
ATOM   9426  C  CE2   . TYR C  3  359 ? 2.891   117.115 79.873  1.00 50.10  ? 359  TYR C CE2   1 
ATOM   9427  C  CZ    . TYR C  3  359 ? 3.872   116.903 78.925  1.00 49.62  ? 359  TYR C CZ    1 
ATOM   9428  O  OH    . TYR C  3  359 ? 5.182   116.963 79.304  1.00 49.74  ? 359  TYR C OH    1 
ATOM   9429  N  N     . PHE C  3  360 ? -1.053  114.935 79.837  1.00 49.10  ? 360  PHE C N     1 
ATOM   9430  C  CA    . PHE C  3  360 ? -0.759  114.103 81.004  1.00 50.07  ? 360  PHE C CA    1 
ATOM   9431  C  C     . PHE C  3  360 ? -1.327  112.706 80.919  1.00 50.57  ? 360  PHE C C     1 
ATOM   9432  O  O     . PHE C  3  360 ? -0.835  111.787 81.584  1.00 53.44  ? 360  PHE C O     1 
ATOM   9433  C  CB    . PHE C  3  360 ? -1.240  114.752 82.304  1.00 47.69  ? 360  PHE C CB    1 
ATOM   9434  C  CG    . PHE C  3  360 ? -0.468  115.974 82.681  1.00 45.89  ? 360  PHE C CG    1 
ATOM   9435  C  CD1   . PHE C  3  360 ? -0.928  117.234 82.332  1.00 43.75  ? 360  PHE C CD1   1 
ATOM   9436  C  CD2   . PHE C  3  360 ? 0.760   115.858 83.314  1.00 45.75  ? 360  PHE C CD2   1 
ATOM   9437  C  CE1   . PHE C  3  360 ? -0.170  118.353 82.603  1.00 45.76  ? 360  PHE C CE1   1 
ATOM   9438  C  CE2   . PHE C  3  360 ? 1.533   116.977 83.592  1.00 45.12  ? 360  PHE C CE2   1 
ATOM   9439  C  CZ    . PHE C  3  360 ? 1.074   118.226 83.238  1.00 45.83  ? 360  PHE C CZ    1 
ATOM   9440  N  N     . THR C  3  361 ? -2.352  112.536 80.102  1.00 48.15  ? 361  THR C N     1 
ATOM   9441  C  CA    . THR C  3  361 ? -2.948  111.231 79.978  1.00 47.51  ? 361  THR C CA    1 
ATOM   9442  C  C     . THR C  3  361 ? -2.125  110.334 79.083  1.00 47.58  ? 361  THR C C     1 
ATOM   9443  O  O     . THR C  3  361 ? -1.878  109.170 79.418  1.00 50.77  ? 361  THR C O     1 
ATOM   9444  C  CB    . THR C  3  361 ? -4.354  111.325 79.428  1.00 47.34  ? 361  THR C CB    1 
ATOM   9445  O  OG1   . THR C  3  361 ? -5.144  112.126 80.309  1.00 49.10  ? 361  THR C OG1   1 
ATOM   9446  C  CG2   . THR C  3  361 ? -4.964  109.959 79.322  1.00 46.47  ? 361  THR C CG2   1 
ATOM   9447  N  N     . ILE C  3  362 ? -1.689  110.851 77.943  1.00 45.32  ? 362  ILE C N     1 
ATOM   9448  C  CA    . ILE C  3  362 ? -0.902  110.013 77.064  1.00 43.82  ? 362  ILE C CA    1 
ATOM   9449  C  C     . ILE C  3  362 ? 0.344   109.524 77.801  1.00 44.02  ? 362  ILE C C     1 
ATOM   9450  O  O     . ILE C  3  362 ? 0.740   108.385 77.646  1.00 44.13  ? 362  ILE C O     1 
ATOM   9451  C  CB    . ILE C  3  362 ? -0.485  110.750 75.816  1.00 41.37  ? 362  ILE C CB    1 
ATOM   9452  C  CG1   . ILE C  3  362 ? -1.696  111.382 75.172  1.00 40.57  ? 362  ILE C CG1   1 
ATOM   9453  C  CG2   . ILE C  3  362 ? 0.112   109.795 74.838  1.00 39.23  ? 362  ILE C CG2   1 
ATOM   9454  C  CD1   . ILE C  3  362 ? -1.343  112.244 74.003  1.00 45.97  ? 362  ILE C CD1   1 
ATOM   9455  N  N     . LEU C  3  363 ? 0.933   110.369 78.639  1.00 45.55  ? 363  LEU C N     1 
ATOM   9456  C  CA    . LEU C  3  363 ? 2.145   109.996 79.386  1.00 46.74  ? 363  LEU C CA    1 
ATOM   9457  C  C     . LEU C  3  363 ? 1.954   109.114 80.623  1.00 47.88  ? 363  LEU C C     1 
ATOM   9458  O  O     . LEU C  3  363 ? 2.755   108.208 80.865  1.00 48.38  ? 363  LEU C O     1 
ATOM   9459  C  CB    . LEU C  3  363 ? 2.928   111.245 79.804  1.00 43.41  ? 363  LEU C CB    1 
ATOM   9460  C  CG    . LEU C  3  363 ? 3.579   112.025 78.660  1.00 41.84  ? 363  LEU C CG    1 
ATOM   9461  C  CD1   . LEU C  3  363 ? 4.224   113.276 79.218  1.00 42.03  ? 363  LEU C CD1   1 
ATOM   9462  C  CD2   . LEU C  3  363 ? 4.591   111.170 77.951  1.00 38.72  ? 363  LEU C CD2   1 
ATOM   9463  N  N     . LEU C  3  364 ? 0.911   109.376 81.407  1.00 47.50  ? 364  LEU C N     1 
ATOM   9464  C  CA    . LEU C  3  364 ? 0.659   108.596 82.611  1.00 46.42  ? 364  LEU C CA    1 
ATOM   9465  C  C     . LEU C  3  364 ? -0.209  107.357 82.413  1.00 47.10  ? 364  LEU C C     1 
ATOM   9466  O  O     . LEU C  3  364 ? -0.064  106.377 83.139  1.00 48.17  ? 364  LEU C O     1 
ATOM   9467  C  CB    . LEU C  3  364 ? 0.010   109.483 83.668  1.00 45.13  ? 364  LEU C CB    1 
ATOM   9468  C  CG    . LEU C  3  364 ? 0.835   110.692 84.093  1.00 45.27  ? 364  LEU C CG    1 
ATOM   9469  C  CD1   . LEU C  3  364 ? 0.106   111.454 85.156  1.00 44.82  ? 364  LEU C CD1   1 
ATOM   9470  C  CD2   . LEU C  3  364 ? 2.172   110.233 84.634  1.00 45.99  ? 364  LEU C CD2   1 
ATOM   9471  N  N     . ILE C  3  365 ? -1.099  107.371 81.429  1.00 46.71  ? 365  ILE C N     1 
ATOM   9472  C  CA    . ILE C  3  365 ? -1.986  106.229 81.255  1.00 46.36  ? 365  ILE C CA    1 
ATOM   9473  C  C     . ILE C  3  365 ? -1.944  105.471 79.946  1.00 47.08  ? 365  ILE C C     1 
ATOM   9474  O  O     . ILE C  3  365 ? -1.820  104.247 79.937  1.00 48.72  ? 365  ILE C O     1 
ATOM   9475  C  CB    . ILE C  3  365 ? -3.433  106.645 81.465  1.00 45.86  ? 365  ILE C CB    1 
ATOM   9476  C  CG1   . ILE C  3  365 ? -3.595  107.200 82.870  1.00 43.11  ? 365  ILE C CG1   1 
ATOM   9477  C  CG2   . ILE C  3  365 ? -4.359  105.457 81.224  1.00 44.31  ? 365  ILE C CG2   1 
ATOM   9478  C  CD1   . ILE C  3  365 ? -4.819  108.026 83.009  1.00 43.26  ? 365  ILE C CD1   1 
ATOM   9479  N  N     . LEU C  3  366 ? -2.072  106.167 78.833  1.00 45.44  ? 366  LEU C N     1 
ATOM   9480  C  CA    . LEU C  3  366 ? -2.079  105.447 77.576  1.00 44.34  ? 366  LEU C CA    1 
ATOM   9481  C  C     . LEU C  3  366 ? -0.801  104.670 77.290  1.00 43.94  ? 366  LEU C C     1 
ATOM   9482  O  O     . LEU C  3  366 ? -0.843  103.459 77.039  1.00 43.56  ? 366  LEU C O     1 
ATOM   9483  C  CB    . LEU C  3  366 ? -2.386  106.400 76.420  1.00 43.75  ? 366  LEU C CB    1 
ATOM   9484  C  CG    . LEU C  3  366 ? -3.691  107.203 76.495  1.00 40.99  ? 366  LEU C CG    1 
ATOM   9485  C  CD1   . LEU C  3  366 ? -4.070  107.610 75.082  1.00 37.03  ? 366  LEU C CD1   1 
ATOM   9486  C  CD2   . LEU C  3  366 ? -4.797  106.374 77.131  1.00 37.04  ? 366  LEU C CD2   1 
ATOM   9487  N  N     . PHE C  3  367 ? 0.338