data_3H1S
# 
_entry.id   3H1S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H1S         
RCSB  RCSB052583   
WWPDB D_1000052583 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          IDP01808 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H1S 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nocek, B.'                                                     1 
'Zhou, M.'                                                      2 
'Papazisi, L.'                                                  3 
'Anderson, W.F.'                                                4 
'Joachimiak, A.'                                                5 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of superoxide dismutase from Francisella tularensis subsp. tularensis SCHU S4' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nocek, B.'      1 
primary 'Zhou, M.'       2 
primary 'Papazisi, L.'   3 
primary 'Anderson, W.F.' 4 
primary 'Joachimiak, A.' 5 
# 
_cell.entry_id           3H1S 
_cell.length_a           136.787 
_cell.length_b           136.787 
_cell.length_c           59.765 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H1S 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase' 22234.732 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'FE (III) ION'         55.845    2   ?        ? ? ? 
3 non-polymer syn GLYCEROL               92.094    3   ?        ? ? ? 
4 water       nat water                  18.015    252 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNAMKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFY
WNCLTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDV
WEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFAD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAMKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFY
WNCLTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDV
WEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFAD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         IDP01808 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   MET n 
1 5   LYS n 
1 6   PHE n 
1 7   GLU n 
1 8   LEU n 
1 9   PRO n 
1 10  LYS n 
1 11  LEU n 
1 12  PRO n 
1 13  TYR n 
1 14  ALA n 
1 15  VAL n 
1 16  ASP n 
1 17  ALA n 
1 18  LEU n 
1 19  GLU n 
1 20  SER n 
1 21  THR n 
1 22  ILE n 
1 23  SER n 
1 24  LYS n 
1 25  GLU n 
1 26  THR n 
1 27  ILE n 
1 28  GLU n 
1 29  TYR n 
1 30  HIS n 
1 31  TYR n 
1 32  GLY n 
1 33  LYS n 
1 34  HIS n 
1 35  HIS n 
1 36  GLN n 
1 37  THR n 
1 38  TYR n 
1 39  VAL n 
1 40  THR n 
1 41  ASN n 
1 42  LEU n 
1 43  ASN n 
1 44  ASN n 
1 45  LEU n 
1 46  VAL n 
1 47  GLU n 
1 48  GLY n 
1 49  THR n 
1 50  GLU n 
1 51  HIS n 
1 52  ASP n 
1 53  GLY n 
1 54  ARG n 
1 55  ASN n 
1 56  LEU n 
1 57  GLU n 
1 58  GLU n 
1 59  ILE n 
1 60  VAL n 
1 61  LYS n 
1 62  THR n 
1 63  SER n 
1 64  ASN n 
1 65  GLY n 
1 66  GLY n 
1 67  ILE n 
1 68  PHE n 
1 69  ASN n 
1 70  ASN n 
1 71  ALA n 
1 72  ALA n 
1 73  GLN n 
1 74  VAL n 
1 75  PHE n 
1 76  ASN n 
1 77  HIS n 
1 78  THR n 
1 79  PHE n 
1 80  TYR n 
1 81  TRP n 
1 82  ASN n 
1 83  CYS n 
1 84  LEU n 
1 85  THR n 
1 86  PRO n 
1 87  ASN n 
1 88  LYS n 
1 89  THR n 
1 90  GLU n 
1 91  ALA n 
1 92  SER n 
1 93  SER n 
1 94  GLN n 
1 95  LEU n 
1 96  LYS n 
1 97  ALA n 
1 98  ALA n 
1 99  LEU n 
1 100 ILE n 
1 101 GLU n 
1 102 THR n 
1 103 PHE n 
1 104 GLY n 
1 105 SER n 
1 106 VAL n 
1 107 GLU n 
1 108 ASN n 
1 109 PHE n 
1 110 LYS n 
1 111 GLU n 
1 112 GLN n 
1 113 PHE n 
1 114 SER n 
1 115 LYS n 
1 116 ALA n 
1 117 ALA n 
1 118 ILE n 
1 119 ALA n 
1 120 THR n 
1 121 PHE n 
1 122 GLY n 
1 123 SER n 
1 124 GLY n 
1 125 TRP n 
1 126 ALA n 
1 127 TRP n 
1 128 LEU n 
1 129 VAL n 
1 130 LYS n 
1 131 ASN n 
1 132 THR n 
1 133 GLU n 
1 134 GLY n 
1 135 LYS n 
1 136 LEU n 
1 137 GLU n 
1 138 ILE n 
1 139 VAL n 
1 140 THR n 
1 141 THR n 
1 142 SER n 
1 143 ASN n 
1 144 ALA n 
1 145 GLY n 
1 146 CYS n 
1 147 PRO n 
1 148 LEU n 
1 149 THR n 
1 150 GLU n 
1 151 ASN n 
1 152 LYS n 
1 153 LYS n 
1 154 PRO n 
1 155 LEU n 
1 156 LEU n 
1 157 THR n 
1 158 PHE n 
1 159 ASP n 
1 160 VAL n 
1 161 TRP n 
1 162 GLU n 
1 163 HIS n 
1 164 ALA n 
1 165 TYR n 
1 166 TYR n 
1 167 ILE n 
1 168 ASP n 
1 169 TYR n 
1 170 ARG n 
1 171 ASN n 
1 172 ALA n 
1 173 ARG n 
1 174 PRO n 
1 175 LYS n 
1 176 TYR n 
1 177 VAL n 
1 178 GLU n 
1 179 ALA n 
1 180 LEU n 
1 181 TRP n 
1 182 ASP n 
1 183 ILE n 
1 184 VAL n 
1 185 ASN n 
1 186 TRP n 
1 187 GLN n 
1 188 PHE n 
1 189 VAL n 
1 190 SER n 
1 191 GLU n 
1 192 GLN n 
1 193 PHE n 
1 194 ALA n 
1 195 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sodB, FTT0068' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Francisella tularensis subsp. tularensis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     119856 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21magic 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pMCSG7 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5NIJ9_FRATT 
_struct_ref.pdbx_db_accession          Q5NIJ9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNC
LTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEH
AYYIDYRNARPKYVEALWDIVNWQFVSEQFAD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H1S A 4 ? 195 ? Q5NIJ9 1 ? 192 ? 1 192 
2 1 3H1S B 4 ? 195 ? Q5NIJ9 1 ? 192 ? 1 192 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3H1S SER A 1 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' -2 1 
1 3H1S ASN A 2 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' -1 2 
1 3H1S ALA A 3 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' 0  3 
2 3H1S SER B 1 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' -2 4 
2 3H1S ASN B 2 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' -1 5 
2 3H1S ALA B 3 ? UNP Q5NIJ9 ? ? 'EXPRESSION TAG' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ?                               'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H1S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.2 potassium acetate 20% Peg 3350 0.1 M Cesium chloride, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-04-08 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9794 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9794 
# 
_reflns.entry_id                     3H1S 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   32413 
_reflns.number_all                   32840 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.032 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        38 
_reflns.B_iso_Wilson_estimate        44.8 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.466 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.0 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1617 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3H1S 
_refine.ls_number_reflns_obs                     30761 
_refine.ls_number_reflns_all                     32408 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    98.62 
_refine.ls_R_factor_obs                          0.16690 
_refine.ls_R_factor_all                          0.1670 
_refine.ls_R_factor_R_work                       0.16485 
_refine.ls_R_factor_R_free                       0.20502 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1647 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               18.936 
_refine.aniso_B[1][1]                            -1.66 
_refine.aniso_B[2][2]                            -1.66 
_refine.aniso_B[3][3]                            2.48 
_refine.aniso_B[1][2]                            -0.83 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1ISC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.141 
_refine.pdbx_overall_ESU_R_Free                  0.132 
_refine.overall_SU_ML                            0.095 
_refine.overall_SU_B                             7.001 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3092 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               3364 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 3193 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2086 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.509  1.919  ? 4340 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.935  3.000  ? 5095 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.871  5.000  ? 380  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.105 25.280 ? 161  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.779 15.000 ? 512  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.136 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 466  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 3556 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 658  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.851  1.500  ? 1900 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.269  1.500  ? 770  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.381  2.000  ? 3068 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.188  3.000  ? 1293 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.291  4.500  ? 1272 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2205 
_refine_ls_shell.R_factor_R_work                  0.229 
_refine_ls_shell.percent_reflns_obs               96.96 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             124 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H1S 
_struct.title                     'Crystal structure of superoxide dismutase from Francisella tularensis subsp. tularensis SCHU S4' 
_struct.pdbx_descriptor           'Superoxide dismutase (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H1S 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;sobD, superoxide dismutase, CSGID, Oxidoreductase, Structural Genomics, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'THE AUTHORS STATE THAT THE BIOLOGICAL UNIT IS UNKNOWN.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23  ? TYR A 31  ? SER A 20  TYR A 28  1 ? 9  
HELX_P HELX_P2  2  LYS A 33  ? GLU A 47  ? LYS A 30  GLU A 44  1 ? 15 
HELX_P HELX_P3  3  ASN A 55  ? SER A 63  ? ASN A 52  SER A 60  1 ? 9  
HELX_P HELX_P4  4  ASN A 64  ? CYS A 83  ? ASN A 61  CYS A 80  1 ? 20 
HELX_P HELX_P5  5  SER A 92  ? GLY A 104 ? SER A 89  GLY A 101 1 ? 13 
HELX_P HELX_P6  6  SER A 105 ? THR A 120 ? SER A 102 THR A 117 1 ? 16 
HELX_P HELX_P7  7  CYS A 146 ? ASN A 151 ? CYS A 143 ASN A 148 5 ? 6  
HELX_P HELX_P8  8  TRP A 161 ? ALA A 164 ? TRP A 158 ALA A 161 5 ? 4  
HELX_P HELX_P9  9  TYR A 165 ? ARG A 170 ? TYR A 162 ARG A 167 1 ? 6  
HELX_P HELX_P10 10 ALA A 172 ? TRP A 181 ? ALA A 169 TRP A 178 1 ? 10 
HELX_P HELX_P11 11 ASP A 182 ? VAL A 184 ? ASP A 179 VAL A 181 5 ? 3  
HELX_P HELX_P12 12 ASN A 185 ? ALA A 194 ? ASN A 182 ALA A 191 1 ? 10 
HELX_P HELX_P13 13 SER B 23  ? TYR B 31  ? SER B 20  TYR B 28  1 ? 9  
HELX_P HELX_P14 14 LYS B 33  ? GLU B 47  ? LYS B 30  GLU B 44  1 ? 15 
HELX_P HELX_P15 15 ASN B 55  ? SER B 63  ? ASN B 52  SER B 60  1 ? 9  
HELX_P HELX_P16 16 ASN B 64  ? CYS B 83  ? ASN B 61  CYS B 80  1 ? 20 
HELX_P HELX_P17 17 SER B 92  ? GLY B 104 ? SER B 89  GLY B 101 1 ? 13 
HELX_P HELX_P18 18 SER B 105 ? THR B 120 ? SER B 102 THR B 117 1 ? 16 
HELX_P HELX_P19 19 CYS B 146 ? ASN B 151 ? CYS B 143 ASN B 148 5 ? 6  
HELX_P HELX_P20 20 TRP B 161 ? ALA B 164 ? TRP B 158 ALA B 161 5 ? 4  
HELX_P HELX_P21 21 TYR B 165 ? ARG B 170 ? TYR B 162 ARG B 167 1 ? 6  
HELX_P HELX_P22 22 ALA B 172 ? TRP B 181 ? ALA B 169 TRP B 178 1 ? 10 
HELX_P HELX_P23 23 ASP B 182 ? VAL B 184 ? ASP B 179 VAL B 181 5 ? 3  
HELX_P HELX_P24 24 ASN B 185 ? ALA B 194 ? ASN B 182 ALA B 191 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 30  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 27   A FE  1001 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc2  metalc ? ? A HIS 77  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 74   A FE  1001 1_555 ? ? ? ? ? ? ? 2.091 ? 
metalc3  metalc ? ? A ASP 159 OD2 ? ? ? 1_555 C FE  . FE ? ? A ASP 156  A FE  1001 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc4  metalc ? ? A HIS 163 NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 160  A FE  1001 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc5  metalc ? ? B HIS 30  NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 27   B FE  1001 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc6  metalc ? ? B HIS 77  NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 74   B FE  1001 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc7  metalc ? ? B ASP 159 OD2 ? ? ? 1_555 F FE  . FE ? ? B ASP 156  B FE  1001 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc8  metalc ? ? B HIS 163 NE2 ? ? ? 1_555 F FE  . FE ? ? B HIS 160  B FE  1001 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc9  metalc ? ? C FE  .   FE  ? ? ? 1_555 H HOH . O  ? ? A FE  1001 A HOH 236  1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc10 metalc ? ? F FE  .   FE  ? ? ? 1_555 I HOH . O  ? ? B FE  1001 B HOH 284  1_555 ? ? ? ? ? ? ? 2.165 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 19 A . ? GLU 16 A SER 20 A ? SER 17 A 1 15.16 
2 GLU 19 B . ? GLU 16 B SER 20 B ? SER 17 B 1 13.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 136 ? SER A 142 ? LEU A 133 SER A 139 
A 2 GLY A 124 ? LYS A 130 ? GLY A 121 LYS A 127 
A 3 LYS A 153 ? ASP A 159 ? LYS A 150 ASP A 156 
B 1 LEU B 136 ? SER B 142 ? LEU B 133 SER B 139 
B 2 GLY B 124 ? LYS B 130 ? GLY B 121 LYS B 127 
B 3 LYS B 153 ? ASP B 159 ? LYS B 150 ASP B 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 139 ? O VAL A 136 N TRP A 127 ? N TRP A 124 
A 2 3 N LEU A 128 ? N LEU A 125 O LEU A 155 ? O LEU A 152 
B 1 2 O VAL B 139 ? O VAL B 136 N TRP B 127 ? N TRP B 124 
B 2 3 N LEU B 128 ? N LEU B 125 O LEU B 155 ? O LEU B 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 1001' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 301' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 302' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE B 1001' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL B 193' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 30  ? HIS A 27  . ? 1_555 ? 
2  AC1 5 HIS A 77  ? HIS A 74  . ? 1_555 ? 
3  AC1 5 ASP A 159 ? ASP A 156 . ? 1_555 ? 
4  AC1 5 HIS A 163 ? HIS A 160 . ? 1_555 ? 
5  AC1 5 HOH H .   ? HOH A 236 . ? 1_555 ? 
6  AC2 5 GLU B 50  ? GLU B 47  . ? 8_544 ? 
7  AC2 5 SER B 63  ? SER B 60  . ? 1_555 ? 
8  AC2 5 ASN B 64  ? ASN B 61  . ? 1_555 ? 
9  AC2 5 HOH I .   ? HOH B 222 . ? 1_555 ? 
10 AC2 5 HOH I .   ? HOH B 360 . ? 6_555 ? 
11 AC3 5 GLU B 58  ? GLU B 55  . ? 1_555 ? 
12 AC3 5 LYS B 61  ? LYS B 58  . ? 1_555 ? 
13 AC3 5 HOH I .   ? HOH B 214 . ? 6_555 ? 
14 AC3 5 HOH I .   ? HOH B 262 . ? 6_555 ? 
15 AC3 5 HOH I .   ? HOH B 313 . ? 6_555 ? 
16 AC4 5 HIS B 30  ? HIS B 27  . ? 1_555 ? 
17 AC4 5 HIS B 77  ? HIS B 74  . ? 1_555 ? 
18 AC4 5 ASP B 159 ? ASP B 156 . ? 1_555 ? 
19 AC4 5 HIS B 163 ? HIS B 160 . ? 1_555 ? 
20 AC4 5 HOH I .   ? HOH B 284 . ? 1_555 ? 
21 AC5 5 GLU B 90  ? GLU B 87  . ? 1_555 ? 
22 AC5 5 ALA B 91  ? ALA B 88  . ? 1_555 ? 
23 AC5 5 VAL B 106 ? VAL B 103 . ? 1_555 ? 
24 AC5 5 LYS B 110 ? LYS B 107 . ? 1_555 ? 
25 AC5 5 TRP B 186 ? TRP B 183 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H1S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H1S 
_atom_sites.fract_transf_matrix[1][1]   0.007311 
_atom_sites.fract_transf_matrix[1][2]   0.004221 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008442 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016732 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 5   ? 7.431  10.545 -11.333 1.00 26.48 ? 2    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 5   ? 6.222  10.324 -10.497 1.00 27.58 ? 2    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 5   ? 6.414  10.808 -9.050  1.00 27.49 ? 2    LYS A C   1 
ATOM   4    O  O   . LYS A 1 5   ? 5.457  11.287 -8.461  1.00 28.10 ? 2    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 5   ? 5.786  8.846  -10.525 1.00 27.36 ? 2    LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 5   ? 4.279  8.609  -10.438 1.00 27.60 ? 2    LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 5   ? 3.684  7.991  -11.715 1.00 27.40 ? 2    LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 5   ? 3.878  6.465  -11.711 1.00 27.91 ? 2    LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 5   ? 3.918  5.844  -13.062 1.00 26.98 ? 2    LYS A NZ  1 
ATOM   10   N  N   . PHE A 1 6   ? 7.612  10.695 -8.459  1.00 27.94 ? 3    PHE A N   1 
ATOM   11   C  CA  . PHE A 1 6   ? 7.838  11.284 -7.112  1.00 27.62 ? 3    PHE A CA  1 
ATOM   12   C  C   . PHE A 1 6   ? 7.900  12.816 -7.192  1.00 28.07 ? 3    PHE A C   1 
ATOM   13   O  O   . PHE A 1 6   ? 8.521  13.367 -8.099  1.00 28.17 ? 3    PHE A O   1 
ATOM   14   C  CB  . PHE A 1 6   ? 9.118  10.761 -6.443  1.00 27.37 ? 3    PHE A CB  1 
ATOM   15   C  CG  . PHE A 1 6   ? 9.033  9.334  -6.018  1.00 25.48 ? 3    PHE A CG  1 
ATOM   16   C  CD1 . PHE A 1 6   ? 8.301  8.978  -4.907  1.00 23.43 ? 3    PHE A CD1 1 
ATOM   17   C  CD2 . PHE A 1 6   ? 9.676  8.337  -6.743  1.00 22.53 ? 3    PHE A CD2 1 
ATOM   18   C  CE1 . PHE A 1 6   ? 8.215  7.662  -4.515  1.00 22.58 ? 3    PHE A CE1 1 
ATOM   19   C  CE2 . PHE A 1 6   ? 9.581  7.018  -6.357  1.00 21.02 ? 3    PHE A CE2 1 
ATOM   20   C  CZ  . PHE A 1 6   ? 8.852  6.684  -5.242  1.00 21.76 ? 3    PHE A CZ  1 
ATOM   21   N  N   . GLU A 1 7   ? 7.284  13.494 -6.230  1.00 28.97 ? 4    GLU A N   1 
ATOM   22   C  CA  . GLU A 1 7   ? 7.259  14.960 -6.207  1.00 29.78 ? 4    GLU A CA  1 
ATOM   23   C  C   . GLU A 1 7   ? 7.902  15.509 -4.932  1.00 29.96 ? 4    GLU A C   1 
ATOM   24   O  O   . GLU A 1 7   ? 7.753  14.924 -3.846  1.00 30.26 ? 4    GLU A O   1 
ATOM   25   C  CB  . GLU A 1 7   ? 5.816  15.458 -6.293  1.00 30.13 ? 4    GLU A CB  1 
ATOM   26   C  CG  . GLU A 1 7   ? 5.256  15.507 -7.697  1.00 31.79 ? 4    GLU A CG  1 
ATOM   27   C  CD  . GLU A 1 7   ? 3.786  15.925 -7.747  1.00 34.71 ? 4    GLU A CD  1 
ATOM   28   O  OE1 . GLU A 1 7   ? 3.360  16.840 -6.995  1.00 36.60 ? 4    GLU A OE1 1 
ATOM   29   O  OE2 . GLU A 1 7   ? 3.037  15.327 -8.549  1.00 37.47 ? 4    GLU A OE2 1 
ATOM   30   N  N   . LEU A 1 8   ? 8.604  16.635 -5.044  1.00 29.92 ? 5    LEU A N   1 
ATOM   31   C  CA  . LEU A 1 8   ? 8.945  17.393 -3.835  1.00 29.80 ? 5    LEU A CA  1 
ATOM   32   C  C   . LEU A 1 8   ? 7.628  17.753 -3.143  1.00 29.75 ? 5    LEU A C   1 
ATOM   33   O  O   . LEU A 1 8   ? 6.767  18.397 -3.754  1.00 29.43 ? 5    LEU A O   1 
ATOM   34   C  CB  . LEU A 1 8   ? 9.715  18.663 -4.167  1.00 29.89 ? 5    LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 8   ? 10.457 19.333 -3.009  1.00 28.93 ? 5    LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 8   ? 11.727 18.602 -2.676  1.00 28.96 ? 5    LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 8   ? 10.775 20.783 -3.348  1.00 28.98 ? 5    LEU A CD2 1 
ATOM   38   N  N   . PRO A 1 9   ? 7.442  17.326 -1.886  1.00 29.62 ? 6    PRO A N   1 
ATOM   39   C  CA  . PRO A 1 9   ? 6.219  17.651 -1.183  1.00 29.72 ? 6    PRO A CA  1 
ATOM   40   C  C   . PRO A 1 9   ? 6.266  19.058 -0.630  1.00 29.41 ? 6    PRO A C   1 
ATOM   41   O  O   . PRO A 1 9   ? 7.333  19.536 -0.308  1.00 29.24 ? 6    PRO A O   1 
ATOM   42   C  CB  . PRO A 1 9   ? 6.208  16.656 -0.021  1.00 29.68 ? 6    PRO A CB  1 
ATOM   43   C  CG  . PRO A 1 9   ? 7.512  16.052 0.011   1.00 30.60 ? 6    PRO A CG  1 
ATOM   44   C  CD  . PRO A 1 9   ? 8.403  16.725 -0.966  1.00 30.26 ? 6    PRO A CD  1 
ATOM   45   N  N   . LYS A 1 10  ? 5.101  19.704 -0.511  1.00 28.76 ? 7    LYS A N   1 
ATOM   46   C  CA  . LYS A 1 10  ? 5.018  21.096 -0.073  1.00 28.26 ? 7    LYS A CA  1 
ATOM   47   C  C   . LYS A 1 10  ? 5.585  21.265 1.354   1.00 27.42 ? 7    LYS A C   1 
ATOM   48   O  O   . LYS A 1 10  ? 5.336  20.443 2.234   1.00 27.15 ? 7    LYS A O   1 
ATOM   49   C  CB  . LYS A 1 10  ? 3.560  21.585 -0.168  1.00 28.81 ? 7    LYS A CB  1 
ATOM   50   C  CG  . LYS A 1 10  ? 3.413  23.096 -0.315  1.00 30.13 ? 7    LYS A CG  1 
ATOM   51   C  CD  . LYS A 1 10  ? 2.100  23.554 -0.930  1.00 30.33 ? 7    LYS A CD  1 
ATOM   52   C  CE  . LYS A 1 10  ? 2.124  25.086 -1.085  1.00 30.74 ? 7    LYS A CE  1 
ATOM   53   N  NZ  . LYS A 1 10  ? 0.822  25.654 -1.455  1.00 31.90 ? 7    LYS A NZ  1 
ATOM   54   N  N   . LEU A 1 11  ? 6.353  22.327 1.566   1.00 26.03 ? 8    LEU A N   1 
ATOM   55   C  CA  . LEU A 1 11  ? 6.884  22.665 2.889   1.00 25.78 ? 8    LEU A CA  1 
ATOM   56   C  C   . LEU A 1 11  ? 5.711  22.978 3.810   1.00 25.45 ? 8    LEU A C   1 
ATOM   57   O  O   . LEU A 1 11  ? 4.739  23.560 3.347   1.00 26.01 ? 8    LEU A O   1 
ATOM   58   C  CB  . LEU A 1 11  ? 7.785  23.899 2.762   1.00 25.54 ? 8    LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 11  ? 8.909  24.113 3.744   1.00 25.19 ? 8    LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 11  ? 9.965  23.039 3.560   1.00 21.37 ? 8    LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 11  ? 9.497  25.524 3.555   1.00 21.87 ? 8    LEU A CD2 1 
ATOM   62   N  N   . PRO A 1 12  ? 5.765  22.583 5.105   1.00 25.29 ? 9    PRO A N   1 
ATOM   63   C  CA  . PRO A 1 12  ? 4.575  22.764 5.974   1.00 24.86 ? 9    PRO A CA  1 
ATOM   64   C  C   . PRO A 1 12  ? 4.346  24.183 6.494   1.00 24.67 ? 9    PRO A C   1 
ATOM   65   O  O   . PRO A 1 12  ? 3.432  24.415 7.301   1.00 25.25 ? 9    PRO A O   1 
ATOM   66   C  CB  . PRO A 1 12  ? 4.849  21.823 7.157   1.00 25.27 ? 9    PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 12  ? 5.963  20.911 6.700   1.00 24.99 ? 9    PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 12  ? 6.772  21.735 5.756   1.00 25.12 ? 9    PRO A CD  1 
ATOM   69   N  N   . TYR A 1 13  ? 5.137  25.124 6.004   1.00 24.21 ? 10   TYR A N   1 
ATOM   70   C  CA  . TYR A 1 13  ? 5.126  26.510 6.464   1.00 23.89 ? 10   TYR A CA  1 
ATOM   71   C  C   . TYR A 1 13  ? 5.797  27.361 5.371   1.00 23.91 ? 10   TYR A C   1 
ATOM   72   O  O   . TYR A 1 13  ? 6.346  26.826 4.396   1.00 23.13 ? 10   TYR A O   1 
ATOM   73   C  CB  . TYR A 1 13  ? 5.894  26.654 7.797   1.00 24.05 ? 10   TYR A CB  1 
ATOM   74   C  CG  . TYR A 1 13  ? 7.024  25.648 7.930   1.00 23.80 ? 10   TYR A CG  1 
ATOM   75   C  CD1 . TYR A 1 13  ? 8.196  25.768 7.166   1.00 25.53 ? 10   TYR A CD1 1 
ATOM   76   C  CD2 . TYR A 1 13  ? 6.898  24.542 8.768   1.00 23.50 ? 10   TYR A CD2 1 
ATOM   77   C  CE1 . TYR A 1 13  ? 9.232  24.814 7.254   1.00 21.39 ? 10   TYR A CE1 1 
ATOM   78   C  CE2 . TYR A 1 13  ? 7.931  23.582 8.868   1.00 24.84 ? 10   TYR A CE2 1 
ATOM   79   C  CZ  . TYR A 1 13  ? 9.085  23.733 8.110   1.00 23.52 ? 10   TYR A CZ  1 
ATOM   80   O  OH  . TYR A 1 13  ? 10.050 22.764 8.216   1.00 22.30 ? 10   TYR A OH  1 
ATOM   81   N  N   . ALA A 1 14  ? 5.737  28.682 5.534   1.00 23.96 ? 11   ALA A N   1 
ATOM   82   C  CA  . ALA A 1 14  ? 6.353  29.606 4.575   1.00 24.44 ? 11   ALA A CA  1 
ATOM   83   C  C   . ALA A 1 14  ? 7.850  29.472 4.664   1.00 24.74 ? 11   ALA A C   1 
ATOM   84   O  O   . ALA A 1 14  ? 8.368  29.010 5.671   1.00 26.08 ? 11   ALA A O   1 
ATOM   85   C  CB  . ALA A 1 14  ? 5.917  31.074 4.850   1.00 24.16 ? 11   ALA A CB  1 
ATOM   86   N  N   . VAL A 1 15  ? 8.543  29.859 3.599   1.00 25.37 ? 12   VAL A N   1 
ATOM   87   C  CA  . VAL A 1 15  ? 9.995  29.690 3.492   1.00 25.67 ? 12   VAL A CA  1 
ATOM   88   C  C   . VAL A 1 15  ? 10.737 30.497 4.564   1.00 26.03 ? 12   VAL A C   1 
ATOM   89   O  O   . VAL A 1 15  ? 11.868 30.143 4.937   1.00 25.91 ? 12   VAL A O   1 
ATOM   90   C  CB  . VAL A 1 15  ? 10.486 30.127 2.111   1.00 25.91 ? 12   VAL A CB  1 
ATOM   91   C  CG1 . VAL A 1 15  ? 10.103 29.093 1.062   1.00 25.38 ? 12   VAL A CG1 1 
ATOM   92   C  CG2 . VAL A 1 15  ? 9.898  31.515 1.755   1.00 25.52 ? 12   VAL A CG2 1 
ATOM   93   N  N   . ASP A 1 16  ? 10.122 31.575 5.048   1.00 25.68 ? 13   ASP A N   1 
ATOM   94   C  CA  . ASP A 1 16  ? 10.742 32.395 6.082   1.00 26.78 ? 13   ASP A CA  1 
ATOM   95   C  C   . ASP A 1 16  ? 10.169 32.170 7.481   1.00 27.29 ? 13   ASP A C   1 
ATOM   96   O  O   . ASP A 1 16  ? 10.505 32.906 8.409   1.00 26.47 ? 13   ASP A O   1 
ATOM   97   C  CB  . ASP A 1 16  ? 10.700 33.889 5.718   1.00 27.64 ? 13   ASP A CB  1 
ATOM   98   C  CG  . ASP A 1 16  ? 9.280  34.448 5.623   1.00 27.98 ? 13   ASP A CG  1 
ATOM   99   O  OD1 . ASP A 1 16  ? 8.306  33.680 5.767   1.00 30.41 ? 13   ASP A OD1 1 
ATOM   100  O  OD2 . ASP A 1 16  ? 9.144  35.656 5.372   1.00 29.22 ? 13   ASP A OD2 1 
ATOM   101  N  N   . ALA A 1 17  ? 9.356  31.125 7.657   1.00 28.15 ? 14   ALA A N   1 
ATOM   102  C  CA  . ALA A 1 17  ? 8.647  30.925 8.932   1.00 28.18 ? 14   ALA A CA  1 
ATOM   103  C  C   . ALA A 1 17  ? 9.565  30.475 10.076  1.00 27.86 ? 14   ALA A C   1 
ATOM   104  O  O   . ALA A 1 17  ? 9.260  30.672 11.256  1.00 27.66 ? 14   ALA A O   1 
ATOM   105  C  CB  . ALA A 1 17  ? 7.520  29.942 8.754   1.00 29.07 ? 14   ALA A CB  1 
ATOM   106  N  N   . LEU A 1 18  ? 10.704 29.902 9.731   1.00 27.11 ? 15   LEU A N   1 
ATOM   107  C  CA  . LEU A 1 18  ? 11.607 29.367 10.731  1.00 26.82 ? 15   LEU A CA  1 
ATOM   108  C  C   . LEU A 1 18  ? 12.717 30.363 11.127  1.00 26.72 ? 15   LEU A C   1 
ATOM   109  O  O   . LEU A 1 18  ? 13.595 30.036 11.931  1.00 27.32 ? 15   LEU A O   1 
ATOM   110  C  CB  . LEU A 1 18  ? 12.218 28.041 10.219  1.00 27.01 ? 15   LEU A CB  1 
ATOM   111  C  CG  . LEU A 1 18  ? 11.267 26.882 9.909   1.00 26.44 ? 15   LEU A CG  1 
ATOM   112  C  CD1 . LEU A 1 18  ? 12.035 25.608 9.827   1.00 25.68 ? 15   LEU A CD1 1 
ATOM   113  C  CD2 . LEU A 1 18  ? 10.161 26.777 10.965  1.00 25.72 ? 15   LEU A CD2 1 
ATOM   114  N  N   . GLU A 1 19  ? 12.680 31.572 10.577  1.00 26.24 ? 16   GLU A N   1 
ATOM   115  C  CA  . GLU A 1 19  ? 13.615 32.613 11.012  1.00 26.36 ? 16   GLU A CA  1 
ATOM   116  C  C   . GLU A 1 19  ? 13.254 32.910 12.475  1.00 26.33 ? 16   GLU A C   1 
ATOM   117  O  O   . GLU A 1 19  ? 12.083 32.969 12.816  1.00 26.49 ? 16   GLU A O   1 
ATOM   118  C  CB  . GLU A 1 19  ? 13.502 33.838 10.090  1.00 26.65 ? 16   GLU A CB  1 
ATOM   119  C  CG  . GLU A 1 19  ? 13.699 33.432 8.631   1.00 26.92 ? 16   GLU A CG  1 
ATOM   120  C  CD  . GLU A 1 19  ? 14.077 34.562 7.700   1.00 29.97 ? 16   GLU A CD  1 
ATOM   121  O  OE1 . GLU A 1 19  ? 13.367 35.603 7.697   1.00 33.45 ? 16   GLU A OE1 1 
ATOM   122  O  OE2 . GLU A 1 19  ? 15.068 34.402 6.951   1.00 28.00 ? 16   GLU A OE2 1 
ATOM   123  N  N   . SER A 1 20  ? 14.216 33.088 13.366  1.00 26.17 ? 17   SER A N   1 
ATOM   124  C  CA  . SER A 1 20  ? 15.608 33.337 13.052  1.00 26.05 ? 17   SER A CA  1 
ATOM   125  C  C   . SER A 1 20  ? 16.477 32.087 13.182  1.00 25.03 ? 17   SER A C   1 
ATOM   126  O  O   . SER A 1 20  ? 17.695 32.148 13.023  1.00 25.83 ? 17   SER A O   1 
ATOM   127  C  CB  . SER A 1 20  ? 16.082 34.415 14.034  1.00 26.28 ? 17   SER A CB  1 
ATOM   128  O  OG  . SER A 1 20  ? 17.308 34.951 13.629  1.00 28.93 ? 17   SER A OG  1 
ATOM   129  N  N   . THR A 1 21  ? 15.859 30.940 13.446  1.00 23.38 ? 18   THR A N   1 
ATOM   130  C  CA  . THR A 1 21  ? 16.602 29.708 13.681  1.00 22.01 ? 18   THR A CA  1 
ATOM   131  C  C   . THR A 1 21  ? 17.244 29.204 12.384  1.00 21.52 ? 18   THR A C   1 
ATOM   132  O  O   . THR A 1 21  ? 18.449 28.879 12.338  1.00 19.43 ? 18   THR A O   1 
ATOM   133  C  CB  . THR A 1 21  ? 15.666 28.626 14.307  1.00 21.98 ? 18   THR A CB  1 
ATOM   134  O  OG1 . THR A 1 21  ? 15.029 29.175 15.473  1.00 23.07 ? 18   THR A OG1 1 
ATOM   135  C  CG2 . THR A 1 21  ? 16.420 27.394 14.701  1.00 20.15 ? 18   THR A CG2 1 
ATOM   136  N  N   . ILE A 1 22  ? 16.426 29.157 11.341  1.00 21.70 ? 19   ILE A N   1 
ATOM   137  C  CA  . ILE A 1 22  ? 16.847 28.763 10.003  1.00 22.22 ? 19   ILE A CA  1 
ATOM   138  C  C   . ILE A 1 22  ? 16.419 29.882 9.061   1.00 22.07 ? 19   ILE A C   1 
ATOM   139  O  O   . ILE A 1 22  ? 15.256 30.291 9.097   1.00 22.93 ? 19   ILE A O   1 
ATOM   140  C  CB  . ILE A 1 22  ? 16.240 27.409 9.558   1.00 22.26 ? 19   ILE A CB  1 
ATOM   141  C  CG1 . ILE A 1 22  ? 16.683 26.276 10.497  1.00 23.25 ? 19   ILE A CG1 1 
ATOM   142  C  CG2 . ILE A 1 22  ? 16.721 27.068 8.175   1.00 22.36 ? 19   ILE A CG2 1 
ATOM   143  C  CD1 . ILE A 1 22  ? 16.085 24.902 10.163  1.00 23.45 ? 19   ILE A CD1 1 
ATOM   144  N  N   . SER A 1 23  ? 17.353 30.408 8.258   1.00 21.66 ? 20   SER A N   1 
ATOM   145  C  CA  . SER A 1 23  ? 17.045 31.524 7.351   1.00 21.47 ? 20   SER A CA  1 
ATOM   146  C  C   . SER A 1 23  ? 16.255 31.069 6.113   1.00 21.75 ? 20   SER A C   1 
ATOM   147  O  O   . SER A 1 23  ? 16.271 29.888 5.729   1.00 21.23 ? 20   SER A O   1 
ATOM   148  C  CB  . SER A 1 23  ? 18.327 32.214 6.896   1.00 21.54 ? 20   SER A CB  1 
ATOM   149  O  OG  . SER A 1 23  ? 19.053 31.418 5.967   1.00 23.22 ? 20   SER A OG  1 
ATOM   150  N  N   . LYS A 1 24  ? 15.580 32.030 5.478   1.00 21.95 ? 21   LYS A N   1 
ATOM   151  C  CA  . LYS A 1 24  ? 14.883 31.811 4.205   1.00 22.35 ? 21   LYS A CA  1 
ATOM   152  C  C   . LYS A 1 24  ? 15.886 31.360 3.153   1.00 22.47 ? 21   LYS A C   1 
ATOM   153  O  O   . LYS A 1 24  ? 15.576 30.535 2.285   1.00 23.38 ? 21   LYS A O   1 
ATOM   154  C  CB  . LYS A 1 24  ? 14.121 33.090 3.778   1.00 23.17 ? 21   LYS A CB  1 
ATOM   155  C  CG  . LYS A 1 24  ? 13.763 33.175 2.281   1.00 25.67 ? 21   LYS A CG  1 
ATOM   156  C  CD  . LYS A 1 24  ? 12.763 34.317 1.928   1.00 28.04 ? 21   LYS A CD  1 
ATOM   157  C  CE  . LYS A 1 24  ? 12.419 34.299 0.397   1.00 28.64 ? 21   LYS A CE  1 
ATOM   158  N  NZ  . LYS A 1 24  ? 11.261 35.144 -0.035  1.00 30.21 ? 21   LYS A NZ  1 
ATOM   159  N  N   . GLU A 1 25  ? 17.107 31.860 3.244   1.00 21.64 ? 22   GLU A N   1 
ATOM   160  C  CA  . GLU A 1 25  ? 18.145 31.433 2.313   1.00 21.93 ? 22   GLU A CA  1 
ATOM   161  C  C   . GLU A 1 25  ? 18.423 29.927 2.484   1.00 20.70 ? 22   GLU A C   1 
ATOM   162  O  O   . GLU A 1 25  ? 18.438 29.172 1.530   1.00 20.16 ? 22   GLU A O   1 
ATOM   163  C  CB  . GLU A 1 25  ? 19.434 32.267 2.459   1.00 21.07 ? 22   GLU A CB  1 
ATOM   164  C  CG  . GLU A 1 25  ? 20.388 31.967 1.322   1.00 21.51 ? 22   GLU A CG  1 
ATOM   165  C  CD  . GLU A 1 25  ? 21.690 32.719 1.375   1.00 20.91 ? 22   GLU A CD  1 
ATOM   166  O  OE1 . GLU A 1 25  ? 21.868 33.621 2.223   1.00 23.67 ? 22   GLU A OE1 1 
ATOM   167  O  OE2 . GLU A 1 25  ? 22.562 32.379 0.571   1.00 21.54 ? 22   GLU A OE2 1 
ATOM   168  N  N   . THR A 1 26  ? 18.589 29.485 3.713   1.00 21.45 ? 23   THR A N   1 
ATOM   169  C  CA  . THR A 1 26  ? 18.780 28.060 3.945   1.00 21.77 ? 23   THR A CA  1 
ATOM   170  C  C   . THR A 1 26  ? 17.600 27.223 3.440   1.00 21.91 ? 23   THR A C   1 
ATOM   171  O  O   . THR A 1 26  ? 17.778 26.266 2.712   1.00 21.42 ? 23   THR A O   1 
ATOM   172  C  CB  . THR A 1 26  ? 19.054 27.817 5.398   1.00 22.50 ? 23   THR A CB  1 
ATOM   173  O  OG1 . THR A 1 26  ? 20.356 28.315 5.662   1.00 22.27 ? 23   THR A OG1 1 
ATOM   174  C  CG2 . THR A 1 26  ? 18.970 26.289 5.762   1.00 22.74 ? 23   THR A CG2 1 
ATOM   175  N  N   . ILE A 1 27  ? 16.381 27.622 3.762   1.00 21.46 ? 24   ILE A N   1 
ATOM   176  C  CA  . ILE A 1 27  ? 15.250 26.904 3.195   1.00 22.57 ? 24   ILE A CA  1 
ATOM   177  C  C   . ILE A 1 27  ? 15.314 26.820 1.667   1.00 22.20 ? 24   ILE A C   1 
ATOM   178  O  O   . ILE A 1 27  ? 15.051 25.777 1.128   1.00 22.30 ? 24   ILE A O   1 
ATOM   179  C  CB  . ILE A 1 27  ? 13.916 27.508 3.586   1.00 22.18 ? 24   ILE A CB  1 
ATOM   180  C  CG1 . ILE A 1 27  ? 13.766 27.519 5.120   1.00 22.27 ? 24   ILE A CG1 1 
ATOM   181  C  CG2 . ILE A 1 27  ? 12.804 26.726 2.869   1.00 22.72 ? 24   ILE A CG2 1 
ATOM   182  C  CD1 . ILE A 1 27  ? 13.907 26.188 5.788   1.00 22.60 ? 24   ILE A CD1 1 
ATOM   183  N  N   . GLU A 1 28  ? 15.647 27.913 0.977   1.00 23.03 ? 25   GLU A N   1 
ATOM   184  C  CA  . GLU A 1 28  ? 15.640 27.916 -0.499  1.00 23.41 ? 25   GLU A CA  1 
ATOM   185  C  C   . GLU A 1 28  ? 16.653 26.954 -1.123  1.00 23.68 ? 25   GLU A C   1 
ATOM   186  O  O   . GLU A 1 28  ? 16.329 26.210 -2.053  1.00 24.50 ? 25   GLU A O   1 
ATOM   187  C  CB  . GLU A 1 28  ? 15.867 29.327 -1.014  1.00 23.85 ? 25   GLU A CB  1 
ATOM   188  C  CG  . GLU A 1 28  ? 14.645 30.251 -0.755  1.00 26.94 ? 25   GLU A CG  1 
ATOM   189  C  CD  . GLU A 1 28  ? 14.911 31.705 -1.121  1.00 31.46 ? 25   GLU A CD  1 
ATOM   190  O  OE1 . GLU A 1 28  ? 16.099 32.117 -1.162  1.00 36.53 ? 25   GLU A OE1 1 
ATOM   191  O  OE2 . GLU A 1 28  ? 13.923 32.437 -1.367  1.00 35.06 ? 25   GLU A OE2 1 
ATOM   192  N  N   . TYR A 1 29  ? 17.877 26.950 -0.612  1.00 23.34 ? 26   TYR A N   1 
ATOM   193  C  CA  . TYR A 1 29  ? 18.848 25.911 -1.023  1.00 22.72 ? 26   TYR A CA  1 
ATOM   194  C  C   . TYR A 1 29  ? 18.541 24.514 -0.456  1.00 22.13 ? 26   TYR A C   1 
ATOM   195  O  O   . TYR A 1 29  ? 18.552 23.561 -1.155  1.00 21.94 ? 26   TYR A O   1 
ATOM   196  C  CB  . TYR A 1 29  ? 20.260 26.319 -0.622  1.00 22.99 ? 26   TYR A CB  1 
ATOM   197  C  CG  . TYR A 1 29  ? 20.829 27.468 -1.429  1.00 22.76 ? 26   TYR A CG  1 
ATOM   198  C  CD1 . TYR A 1 29  ? 21.521 27.232 -2.628  1.00 22.15 ? 26   TYR A CD1 1 
ATOM   199  C  CD2 . TYR A 1 29  ? 20.698 28.796 -0.988  1.00 20.39 ? 26   TYR A CD2 1 
ATOM   200  C  CE1 . TYR A 1 29  ? 22.032 28.297 -3.376  1.00 23.99 ? 26   TYR A CE1 1 
ATOM   201  C  CE2 . TYR A 1 29  ? 21.219 29.860 -1.728  1.00 19.48 ? 26   TYR A CE2 1 
ATOM   202  C  CZ  . TYR A 1 29  ? 21.879 29.615 -2.911  1.00 20.02 ? 26   TYR A CZ  1 
ATOM   203  O  OH  . TYR A 1 29  ? 22.422 30.664 -3.639  1.00 20.89 ? 26   TYR A OH  1 
ATOM   204  N  N   . HIS A 1 30  ? 18.277 24.388 0.819   1.00 22.10 ? 27   HIS A N   1 
ATOM   205  C  CA  . HIS A 1 30  ? 18.109 23.080 1.403   1.00 21.34 ? 27   HIS A CA  1 
ATOM   206  C  C   . HIS A 1 30  ? 16.886 22.398 0.831   1.00 21.07 ? 27   HIS A C   1 
ATOM   207  O  O   . HIS A 1 30  ? 16.957 21.326 0.294   1.00 21.07 ? 27   HIS A O   1 
ATOM   208  C  CB  . HIS A 1 30  ? 18.030 23.187 2.911   1.00 20.93 ? 27   HIS A CB  1 
ATOM   209  C  CG  . HIS A 1 30  ? 18.348 21.923 3.625   1.00 21.15 ? 27   HIS A CG  1 
ATOM   210  N  ND1 . HIS A 1 30  ? 18.373 21.837 4.989   1.00 21.31 ? 27   HIS A ND1 1 
ATOM   211  C  CD2 . HIS A 1 30  ? 18.648 20.693 3.167   1.00 20.10 ? 27   HIS A CD2 1 
ATOM   212  C  CE1 . HIS A 1 30  ? 18.676 20.609 5.343   1.00 23.34 ? 27   HIS A CE1 1 
ATOM   213  N  NE2 . HIS A 1 30  ? 18.856 19.899 4.256   1.00 19.20 ? 27   HIS A NE2 1 
ATOM   214  N  N   . TYR A 1 31  ? 15.757 23.053 0.932   1.00 21.08 ? 28   TYR A N   1 
ATOM   215  C  CA  . TYR A 1 31  ? 14.529 22.482 0.416   1.00 21.01 ? 28   TYR A CA  1 
ATOM   216  C  C   . TYR A 1 31  ? 14.454 22.611 -1.109  1.00 21.10 ? 28   TYR A C   1 
ATOM   217  O  O   . TYR A 1 31  ? 14.194 21.638 -1.827  1.00 20.93 ? 28   TYR A O   1 
ATOM   218  C  CB  . TYR A 1 31  ? 13.323 23.163 1.095   1.00 21.79 ? 28   TYR A CB  1 
ATOM   219  C  CG  . TYR A 1 31  ? 11.993 22.760 0.505   1.00 22.61 ? 28   TYR A CG  1 
ATOM   220  C  CD1 . TYR A 1 31  ? 11.382 21.563 0.865   1.00 24.12 ? 28   TYR A CD1 1 
ATOM   221  C  CD2 . TYR A 1 31  ? 11.343 23.575 -0.410  1.00 24.61 ? 28   TYR A CD2 1 
ATOM   222  C  CE1 . TYR A 1 31  ? 10.172 21.183 0.318   1.00 24.87 ? 28   TYR A CE1 1 
ATOM   223  C  CE2 . TYR A 1 31  ? 10.106 23.206 -0.953  1.00 24.17 ? 28   TYR A CE2 1 
ATOM   224  C  CZ  . TYR A 1 31  ? 9.543  22.009 -0.591  1.00 24.61 ? 28   TYR A CZ  1 
ATOM   225  O  OH  . TYR A 1 31  ? 8.346  21.629 -1.131  1.00 28.10 ? 28   TYR A OH  1 
ATOM   226  N  N   . GLY A 1 32  ? 14.691 23.821 -1.610  1.00 21.06 ? 29   GLY A N   1 
ATOM   227  C  CA  . GLY A 1 32  ? 14.438 24.128 -3.012  1.00 21.16 ? 29   GLY A CA  1 
ATOM   228  C  C   . GLY A 1 32  ? 15.400 23.523 -3.997  1.00 22.04 ? 29   GLY A C   1 
ATOM   229  O  O   . GLY A 1 32  ? 15.053 23.375 -5.156  1.00 21.80 ? 29   GLY A O   1 
ATOM   230  N  N   . LYS A 1 33  ? 16.617 23.194 -3.553  1.00 22.48 ? 30   LYS A N   1 
ATOM   231  C  CA  . LYS A 1 33  ? 17.628 22.610 -4.427  1.00 22.14 ? 30   LYS A CA  1 
ATOM   232  C  C   . LYS A 1 33  ? 18.095 21.219 -3.983  1.00 22.38 ? 30   LYS A C   1 
ATOM   233  O  O   . LYS A 1 33  ? 18.091 20.286 -4.804  1.00 22.40 ? 30   LYS A O   1 
ATOM   234  C  CB  . LYS A 1 33  ? 18.838 23.534 -4.514  1.00 22.59 ? 30   LYS A CB  1 
ATOM   235  C  CG  . LYS A 1 33  ? 18.485 24.948 -4.883  1.00 21.98 ? 30   LYS A CG  1 
ATOM   236  C  CD  . LYS A 1 33  ? 19.697 25.697 -5.433  1.00 23.75 ? 30   LYS A CD  1 
ATOM   237  C  CE  . LYS A 1 33  ? 19.385 27.206 -5.610  1.00 25.83 ? 30   LYS A CE  1 
ATOM   238  N  NZ  . LYS A 1 33  ? 19.980 27.825 -6.843  1.00 28.19 ? 30   LYS A NZ  1 
ATOM   239  N  N   . HIS A 1 34  ? 18.521 21.081 -2.718  1.00 22.09 ? 31   HIS A N   1 
ATOM   240  C  CA  . HIS A 1 34  ? 19.060 19.797 -2.239  1.00 21.30 ? 31   HIS A CA  1 
ATOM   241  C  C   . HIS A 1 34  ? 17.922 18.785 -2.254  1.00 21.79 ? 31   HIS A C   1 
ATOM   242  O  O   . HIS A 1 34  ? 17.998 17.790 -2.965  1.00 20.71 ? 31   HIS A O   1 
ATOM   243  C  CB  . HIS A 1 34  ? 19.693 19.854 -0.838  1.00 21.24 ? 31   HIS A CB  1 
ATOM   244  C  CG  . HIS A 1 34  ? 21.012 20.579 -0.752  1.00 17.82 ? 31   HIS A CG  1 
ATOM   245  N  ND1 . HIS A 1 34  ? 22.233 19.945 -0.828  1.00 17.76 ? 31   HIS A ND1 1 
ATOM   246  C  CD2 . HIS A 1 34  ? 21.285 21.884 -0.502  1.00 19.34 ? 31   HIS A CD2 1 
ATOM   247  C  CE1 . HIS A 1 34  ? 23.200 20.833 -0.666  1.00 19.57 ? 31   HIS A CE1 1 
ATOM   248  N  NE2 . HIS A 1 34  ? 22.648 22.026 -0.462  1.00 19.54 ? 31   HIS A NE2 1 
ATOM   249  N  N   . HIS A 1 35  ? 16.856 19.054 -1.498  1.00 22.51 ? 32   HIS A N   1 
ATOM   250  C  CA  . HIS A 1 35  ? 15.687 18.135 -1.443  1.00 23.23 ? 32   HIS A CA  1 
ATOM   251  C  C   . HIS A 1 35  ? 15.169 17.787 -2.845  1.00 23.09 ? 32   HIS A C   1 
ATOM   252  O  O   . HIS A 1 35  ? 14.939 16.612 -3.166  1.00 23.65 ? 32   HIS A O   1 
ATOM   253  C  CB  . HIS A 1 35  ? 14.560 18.741 -0.590  1.00 23.07 ? 32   HIS A CB  1 
ATOM   254  C  CG  . HIS A 1 35  ? 13.612 17.742 0.015   1.00 24.97 ? 32   HIS A CG  1 
ATOM   255  N  ND1 . HIS A 1 35  ? 13.621 16.391 -0.276  1.00 28.08 ? 32   HIS A ND1 1 
ATOM   256  C  CD2 . HIS A 1 35  ? 12.590 17.924 0.879   1.00 22.76 ? 32   HIS A CD2 1 
ATOM   257  C  CE1 . HIS A 1 35  ? 12.654 15.789 0.398   1.00 22.31 ? 32   HIS A CE1 1 
ATOM   258  N  NE2 . HIS A 1 35  ? 12.019 16.698 1.111   1.00 25.06 ? 32   HIS A NE2 1 
ATOM   259  N  N   . GLN A 1 36  ? 15.014 18.803 -3.683  1.00 23.09 ? 33   GLN A N   1 
ATOM   260  C  CA  . GLN A 1 36  ? 14.529 18.626 -5.035  1.00 23.30 ? 33   GLN A CA  1 
ATOM   261  C  C   . GLN A 1 36  ? 15.446 17.768 -5.869  1.00 23.09 ? 33   GLN A C   1 
ATOM   262  O  O   . GLN A 1 36  ? 14.984 17.054 -6.748  1.00 22.22 ? 33   GLN A O   1 
ATOM   263  C  CB  . GLN A 1 36  ? 14.365 19.996 -5.699  1.00 23.80 ? 33   GLN A CB  1 
ATOM   264  C  CG  . GLN A 1 36  ? 13.915 19.978 -7.142  1.00 25.21 ? 33   GLN A CG  1 
ATOM   265  C  CD  . GLN A 1 36  ? 12.477 19.605 -7.285  1.00 25.57 ? 33   GLN A CD  1 
ATOM   266  O  OE1 . GLN A 1 36  ? 11.603 20.368 -6.894  1.00 25.79 ? 33   GLN A OE1 1 
ATOM   267  N  NE2 . GLN A 1 36  ? 12.211 18.437 -7.867  1.00 25.28 ? 33   GLN A NE2 1 
ATOM   268  N  N   . THR A 1 37  ? 16.753 17.835 -5.613  1.00 22.15 ? 34   THR A N   1 
ATOM   269  C  CA  . THR A 1 37  ? 17.729 17.095 -6.442  1.00 21.28 ? 34   THR A CA  1 
ATOM   270  C  C   . THR A 1 37  ? 17.615 15.599 -6.157  1.00 21.57 ? 34   THR A C   1 
ATOM   271  O  O   . THR A 1 37  ? 17.684 14.746 -7.084  1.00 21.71 ? 34   THR A O   1 
ATOM   272  C  CB  . THR A 1 37  ? 19.128 17.614 -6.190  1.00 20.90 ? 34   THR A CB  1 
ATOM   273  O  OG1 . THR A 1 37  ? 19.234 18.910 -6.789  1.00 19.22 ? 34   THR A OG1 1 
ATOM   274  C  CG2 . THR A 1 37  ? 20.220 16.662 -6.736  1.00 20.60 ? 34   THR A CG2 1 
ATOM   275  N  N   . TYR A 1 38  ? 17.377 15.288 -4.884  1.00 20.91 ? 35   TYR A N   1 
ATOM   276  C  CA  . TYR A 1 38  ? 17.214 13.914 -4.473  1.00 21.47 ? 35   TYR A CA  1 
ATOM   277  C  C   . TYR A 1 38  ? 15.945 13.351 -5.147  1.00 22.88 ? 35   TYR A C   1 
ATOM   278  O  O   . TYR A 1 38  ? 15.969 12.241 -5.651  1.00 22.93 ? 35   TYR A O   1 
ATOM   279  C  CB  . TYR A 1 38  ? 17.113 13.795 -2.972  1.00 21.02 ? 35   TYR A CB  1 
ATOM   280  C  CG  . TYR A 1 38  ? 18.387 14.148 -2.208  1.00 20.54 ? 35   TYR A CG  1 
ATOM   281  C  CD1 . TYR A 1 38  ? 19.598 13.463 -2.465  1.00 21.54 ? 35   TYR A CD1 1 
ATOM   282  C  CD2 . TYR A 1 38  ? 18.385 15.095 -1.218  1.00 21.18 ? 35   TYR A CD2 1 
ATOM   283  C  CE1 . TYR A 1 38  ? 20.748 13.742 -1.749  1.00 21.36 ? 35   TYR A CE1 1 
ATOM   284  C  CE2 . TYR A 1 38  ? 19.582 15.391 -0.486  1.00 21.96 ? 35   TYR A CE2 1 
ATOM   285  C  CZ  . TYR A 1 38  ? 20.741 14.710 -0.770  1.00 20.76 ? 35   TYR A CZ  1 
ATOM   286  O  OH  . TYR A 1 38  ? 21.922 14.970 -0.074  1.00 25.87 ? 35   TYR A OH  1 
ATOM   287  N  N   . VAL A 1 39  ? 14.866 14.125 -5.162  1.00 23.94 ? 36   VAL A N   1 
ATOM   288  C  CA  . VAL A 1 39  ? 13.639 13.722 -5.832  1.00 25.22 ? 36   VAL A CA  1 
ATOM   289  C  C   . VAL A 1 39  ? 13.904 13.479 -7.296  1.00 25.56 ? 36   VAL A C   1 
ATOM   290  O  O   . VAL A 1 39  ? 13.530 12.432 -7.825  1.00 27.42 ? 36   VAL A O   1 
ATOM   291  C  CB  . VAL A 1 39  ? 12.496 14.777 -5.689  1.00 25.19 ? 36   VAL A CB  1 
ATOM   292  C  CG1 . VAL A 1 39  ? 11.264 14.412 -6.576  1.00 25.33 ? 36   VAL A CG1 1 
ATOM   293  C  CG2 . VAL A 1 39  ? 12.082 14.916 -4.243  1.00 24.77 ? 36   VAL A CG2 1 
ATOM   294  N  N   . THR A 1 40  ? 14.513 14.447 -7.962  1.00 25.43 ? 37   THR A N   1 
ATOM   295  C  CA  . THR A 1 40  ? 14.785 14.328 -9.387  1.00 26.26 ? 37   THR A CA  1 
ATOM   296  C  C   . THR A 1 40  ? 15.624 13.090 -9.691  1.00 26.99 ? 37   THR A C   1 
ATOM   297  O  O   . THR A 1 40  ? 15.252 12.250 -10.506 1.00 27.36 ? 37   THR A O   1 
ATOM   298  C  CB  . THR A 1 40  ? 15.468 15.601 -9.907  1.00 26.35 ? 37   THR A CB  1 
ATOM   299  O  OG1 . THR A 1 40  ? 14.560 16.702 -9.751  1.00 26.53 ? 37   THR A OG1 1 
ATOM   300  C  CG2 . THR A 1 40  ? 15.834 15.468 -11.376 1.00 24.83 ? 37   THR A CG2 1 
ATOM   301  N  N   . ASN A 1 41  ? 16.748 12.969 -8.992  1.00 28.28 ? 38   ASN A N   1 
ATOM   302  C  CA  . ASN A 1 41  ? 17.683 11.864 -9.183  1.00 28.65 ? 38   ASN A CA  1 
ATOM   303  C  C   . ASN A 1 41  ? 17.026 10.517 -8.994  1.00 29.39 ? 38   ASN A C   1 
ATOM   304  O  O   . ASN A 1 41  ? 17.236 9.602  -9.802  1.00 29.63 ? 38   ASN A O   1 
ATOM   305  C  CB  . ASN A 1 41  ? 18.865 12.016 -8.224  1.00 28.39 ? 38   ASN A CB  1 
ATOM   306  C  CG  . ASN A 1 41  ? 19.790 13.129 -8.627  1.00 28.50 ? 38   ASN A CG  1 
ATOM   307  O  OD1 . ASN A 1 41  ? 19.699 13.663 -9.738  1.00 29.50 ? 38   ASN A OD1 1 
ATOM   308  N  ND2 . ASN A 1 41  ? 20.686 13.506 -7.723  1.00 28.68 ? 38   ASN A ND2 1 
ATOM   309  N  N   . LEU A 1 42  ? 16.209 10.405 -7.952  1.00 29.93 ? 39   LEU A N   1 
ATOM   310  C  CA  . LEU A 1 42  ? 15.495 9.174  -7.667  1.00 31.06 ? 39   LEU A CA  1 
ATOM   311  C  C   . LEU A 1 42  ? 14.614 8.797  -8.859  1.00 32.19 ? 39   LEU A C   1 
ATOM   312  O  O   . LEU A 1 42  ? 14.703 7.674  -9.373  1.00 32.63 ? 39   LEU A O   1 
ATOM   313  C  CB  . LEU A 1 42  ? 14.643 9.327  -6.397  1.00 30.69 ? 39   LEU A CB  1 
ATOM   314  C  CG  . LEU A 1 42  ? 13.791 8.118  -5.974  1.00 30.44 ? 39   LEU A CG  1 
ATOM   315  C  CD1 . LEU A 1 42  ? 14.616 6.894  -5.570  1.00 29.48 ? 39   LEU A CD1 1 
ATOM   316  C  CD2 . LEU A 1 42  ? 12.901 8.528  -4.837  1.00 29.51 ? 39   LEU A CD2 1 
ATOM   317  N  N   . ASN A 1 43  ? 13.793 9.746  -9.323  1.00 32.72 ? 40   ASN A N   1 
ATOM   318  C  CA  . ASN A 1 43  ? 12.892 9.481  -10.440 1.00 32.91 ? 40   ASN A CA  1 
ATOM   319  C  C   . ASN A 1 43  ? 13.705 8.948  -11.585 1.00 33.43 ? 40   ASN A C   1 
ATOM   320  O  O   . ASN A 1 43  ? 13.364 7.940  -12.162 1.00 33.58 ? 40   ASN A O   1 
ATOM   321  C  CB  . ASN A 1 43  ? 12.137 10.746 -10.902 1.00 33.31 ? 40   ASN A CB  1 
ATOM   322  C  CG  . ASN A 1 43  ? 11.021 11.167 -9.948  1.00 32.18 ? 40   ASN A CG  1 
ATOM   323  O  OD1 . ASN A 1 43  ? 10.356 10.323 -9.357  1.00 32.36 ? 40   ASN A OD1 1 
ATOM   324  N  ND2 . ASN A 1 43  ? 10.803 12.487 -9.817  1.00 27.48 ? 40   ASN A ND2 1 
ATOM   325  N  N   . ASN A 1 44  ? 14.783 9.627  -11.923 1.00 33.89 ? 41   ASN A N   1 
ATOM   326  C  CA  . ASN A 1 44  ? 15.664 9.132  -12.970 1.00 34.50 ? 41   ASN A CA  1 
ATOM   327  C  C   . ASN A 1 44  ? 16.194 7.725  -12.737 1.00 34.91 ? 41   ASN A C   1 
ATOM   328  O  O   . ASN A 1 44  ? 16.309 6.949  -13.679 1.00 34.27 ? 41   ASN A O   1 
ATOM   329  C  CB  . ASN A 1 44  ? 16.837 10.073 -13.168 1.00 34.39 ? 41   ASN A CB  1 
ATOM   330  C  CG  . ASN A 1 44  ? 16.390 11.433 -13.552 1.00 36.05 ? 41   ASN A CG  1 
ATOM   331  O  OD1 . ASN A 1 44  ? 15.200 11.660 -13.708 1.00 38.96 ? 41   ASN A OD1 1 
ATOM   332  N  ND2 . ASN A 1 44  ? 17.322 12.360 -13.697 1.00 36.47 ? 41   ASN A ND2 1 
ATOM   333  N  N   . LEU A 1 45  ? 16.541 7.407  -11.495 1.00 35.28 ? 42   LEU A N   1 
ATOM   334  C  CA  . LEU A 1 45  ? 17.204 6.134  -11.209 1.00 35.51 ? 42   LEU A CA  1 
ATOM   335  C  C   . LEU A 1 45  ? 16.262 4.949  -11.145 1.00 35.92 ? 42   LEU A C   1 
ATOM   336  O  O   . LEU A 1 45  ? 16.673 3.835  -11.433 1.00 35.77 ? 42   LEU A O   1 
ATOM   337  C  CB  . LEU A 1 45  ? 17.950 6.188  -9.890  1.00 34.73 ? 42   LEU A CB  1 
ATOM   338  C  CG  . LEU A 1 45  ? 19.276 6.922  -9.878  1.00 34.05 ? 42   LEU A CG  1 
ATOM   339  C  CD1 . LEU A 1 45  ? 19.859 6.756  -8.471  1.00 32.46 ? 42   LEU A CD1 1 
ATOM   340  C  CD2 . LEU A 1 45  ? 20.176 6.380  -10.949 1.00 31.17 ? 42   LEU A CD2 1 
ATOM   341  N  N   . VAL A 1 46  ? 15.039 5.192  -10.689 1.00 36.58 ? 43   VAL A N   1 
ATOM   342  C  CA  . VAL A 1 46  ? 14.036 4.150  -10.481 1.00 37.01 ? 43   VAL A CA  1 
ATOM   343  C  C   . VAL A 1 46  ? 13.441 3.664  -11.811 1.00 38.13 ? 43   VAL A C   1 
ATOM   344  O  O   . VAL A 1 46  ? 12.995 2.508  -11.923 1.00 38.15 ? 43   VAL A O   1 
ATOM   345  C  CB  . VAL A 1 46  ? 12.920 4.662  -9.545  1.00 36.89 ? 43   VAL A CB  1 
ATOM   346  C  CG1 . VAL A 1 46  ? 11.664 3.879  -9.720  1.00 36.35 ? 43   VAL A CG1 1 
ATOM   347  C  CG2 . VAL A 1 46  ? 13.388 4.613  -8.078  1.00 35.67 ? 43   VAL A CG2 1 
ATOM   348  N  N   . GLU A 1 47  ? 13.459 4.542  -12.816 1.00 38.95 ? 44   GLU A N   1 
ATOM   349  C  CA  . GLU A 1 47  ? 12.815 4.270  -14.100 1.00 39.69 ? 44   GLU A CA  1 
ATOM   350  C  C   . GLU A 1 47  ? 13.429 3.030  -14.726 1.00 39.85 ? 44   GLU A C   1 
ATOM   351  O  O   . GLU A 1 47  ? 14.646 2.893  -14.776 1.00 40.20 ? 44   GLU A O   1 
ATOM   352  C  CB  . GLU A 1 47  ? 12.963 5.466  -15.046 1.00 39.85 ? 44   GLU A CB  1 
ATOM   353  C  CG  . GLU A 1 47  ? 11.837 5.599  -16.058 1.00 40.30 ? 44   GLU A CG  1 
ATOM   354  C  CD  . GLU A 1 47  ? 12.181 6.544  -17.192 1.00 40.19 ? 44   GLU A CD  1 
ATOM   355  O  OE1 . GLU A 1 47  ? 11.786 6.224  -18.326 1.00 37.55 ? 44   GLU A OE1 1 
ATOM   356  O  OE2 . GLU A 1 47  ? 12.854 7.583  -16.950 1.00 38.86 ? 44   GLU A OE2 1 
ATOM   357  N  N   . GLY A 1 48  ? 12.571 2.122  -15.173 1.00 40.53 ? 45   GLY A N   1 
ATOM   358  C  CA  . GLY A 1 48  ? 13.000 0.869  -15.785 1.00 40.49 ? 45   GLY A CA  1 
ATOM   359  C  C   . GLY A 1 48  ? 13.519 -0.164 -14.798 1.00 40.21 ? 45   GLY A C   1 
ATOM   360  O  O   . GLY A 1 48  ? 14.074 -1.186 -15.208 1.00 40.95 ? 45   GLY A O   1 
ATOM   361  N  N   . THR A 1 49  ? 13.318 0.076  -13.508 1.00 39.38 ? 46   THR A N   1 
ATOM   362  C  CA  . THR A 1 49  ? 13.769 -0.842 -12.470 1.00 38.66 ? 46   THR A CA  1 
ATOM   363  C  C   . THR A 1 49  ? 12.557 -1.398 -11.742 1.00 38.91 ? 46   THR A C   1 
ATOM   364  O  O   . THR A 1 49  ? 11.425 -0.995 -12.029 1.00 39.51 ? 46   THR A O   1 
ATOM   365  C  CB  . THR A 1 49  ? 14.652 -0.104 -11.458 1.00 38.30 ? 46   THR A CB  1 
ATOM   366  O  OG1 . THR A 1 49  ? 13.827 0.722  -10.621 1.00 36.73 ? 46   THR A OG1 1 
ATOM   367  C  CG2 . THR A 1 49  ? 15.670 0.756  -12.183 1.00 37.57 ? 46   THR A CG2 1 
ATOM   368  N  N   . GLU A 1 50  ? 12.794 -2.287 -10.779 1.00 39.16 ? 47   GLU A N   1 
ATOM   369  C  CA  . GLU A 1 50  ? 11.711 -2.943 -10.020 1.00 39.44 ? 47   GLU A CA  1 
ATOM   370  C  C   . GLU A 1 50  ? 11.036 -1.935 -9.105  1.00 39.16 ? 47   GLU A C   1 
ATOM   371  O  O   . GLU A 1 50  ? 9.884  -2.090 -8.744  1.00 39.05 ? 47   GLU A O   1 
ATOM   372  C  CB  . GLU A 1 50  ? 12.221 -4.085 -9.130  1.00 40.06 ? 47   GLU A CB  1 
ATOM   373  C  CG  . GLU A 1 50  ? 13.522 -4.788 -9.556  1.00 42.20 ? 47   GLU A CG  1 
ATOM   374  C  CD  . GLU A 1 50  ? 14.593 -4.668 -8.486  1.00 45.78 ? 47   GLU A CD  1 
ATOM   375  O  OE1 . GLU A 1 50  ? 14.345 -5.111 -7.341  1.00 48.68 ? 47   GLU A OE1 1 
ATOM   376  O  OE2 . GLU A 1 50  ? 15.678 -4.111 -8.780  1.00 48.12 ? 47   GLU A OE2 1 
ATOM   377  N  N   . HIS A 1 51  ? 11.778 -0.910 -8.705  1.00 38.48 ? 48   HIS A N   1 
ATOM   378  C  CA  . HIS A 1 51  ? 11.232 0.140  -7.864  1.00 38.24 ? 48   HIS A CA  1 
ATOM   379  C  C   . HIS A 1 51  ? 10.312 1.102  -8.626  1.00 38.59 ? 48   HIS A C   1 
ATOM   380  O  O   . HIS A 1 51  ? 9.738  1.992  -8.012  1.00 38.81 ? 48   HIS A O   1 
ATOM   381  C  CB  . HIS A 1 51  ? 12.377 0.928  -7.211  1.00 37.92 ? 48   HIS A CB  1 
ATOM   382  C  CG  . HIS A 1 51  ? 13.360 0.057  -6.504  1.00 35.62 ? 48   HIS A CG  1 
ATOM   383  N  ND1 . HIS A 1 51  ? 13.055 -0.601 -5.335  1.00 34.03 ? 48   HIS A ND1 1 
ATOM   384  C  CD2 . HIS A 1 51  ? 14.622 -0.305 -6.825  1.00 35.32 ? 48   HIS A CD2 1 
ATOM   385  C  CE1 . HIS A 1 51  ? 14.098 -1.314 -4.950  1.00 34.68 ? 48   HIS A CE1 1 
ATOM   386  N  NE2 . HIS A 1 51  ? 15.064 -1.148 -5.835  1.00 35.12 ? 48   HIS A NE2 1 
ATOM   387  N  N   . ASP A 1 52  ? 10.176 0.944  -9.944  1.00 38.98 ? 49   ASP A N   1 
ATOM   388  C  CA  . ASP A 1 52  ? 9.381  1.892  -10.742 1.00 39.31 ? 49   ASP A CA  1 
ATOM   389  C  C   . ASP A 1 52  ? 7.919  1.723  -10.393 1.00 39.27 ? 49   ASP A C   1 
ATOM   390  O  O   . ASP A 1 52  ? 7.390  0.637  -10.521 1.00 39.64 ? 49   ASP A O   1 
ATOM   391  C  CB  . ASP A 1 52  ? 9.605  1.683  -12.240 1.00 39.40 ? 49   ASP A CB  1 
ATOM   392  C  CG  . ASP A 1 52  ? 9.266  2.907  -13.051 1.00 39.94 ? 49   ASP A CG  1 
ATOM   393  O  OD1 . ASP A 1 52  ? 8.778  3.897  -12.455 1.00 38.41 ? 49   ASP A OD1 1 
ATOM   394  O  OD2 . ASP A 1 52  ? 9.506  2.876  -14.282 1.00 40.34 ? 49   ASP A OD2 1 
ATOM   395  N  N   . GLY A 1 53  ? 7.277  2.787  -9.923  1.00 39.64 ? 50   GLY A N   1 
ATOM   396  C  CA  . GLY A 1 53  ? 5.956  2.673  -9.298  1.00 39.66 ? 50   GLY A CA  1 
ATOM   397  C  C   . GLY A 1 53  ? 5.965  1.728  -8.094  1.00 39.72 ? 50   GLY A C   1 
ATOM   398  O  O   . GLY A 1 53  ? 5.207  0.755  -8.032  1.00 39.74 ? 50   GLY A O   1 
ATOM   399  N  N   . ARG A 1 54  ? 6.859  2.004  -7.159  1.00 39.47 ? 51   ARG A N   1 
ATOM   400  C  CA  . ARG A 1 54  ? 6.884  1.357  -5.851  1.00 39.48 ? 51   ARG A CA  1 
ATOM   401  C  C   . ARG A 1 54  ? 6.846  2.557  -4.905  1.00 38.17 ? 51   ARG A C   1 
ATOM   402  O  O   . ARG A 1 54  ? 7.162  3.661  -5.333  1.00 38.00 ? 51   ARG A O   1 
ATOM   403  C  CB  . ARG A 1 54  ? 8.191  0.567  -5.694  1.00 39.97 ? 51   ARG A CB  1 
ATOM   404  C  CG  . ARG A 1 54  ? 8.091  -0.705 -4.881  1.00 42.23 ? 51   ARG A CG  1 
ATOM   405  C  CD  . ARG A 1 54  ? 9.338  -1.548 -5.086  1.00 45.29 ? 51   ARG A CD  1 
ATOM   406  N  NE  . ARG A 1 54  ? 9.361  -2.741 -4.241  1.00 47.88 ? 51   ARG A NE  1 
ATOM   407  C  CZ  . ARG A 1 54  ? 10.368 -3.618 -4.198  1.00 50.30 ? 51   ARG A CZ  1 
ATOM   408  N  NH1 . ARG A 1 54  ? 11.458 -3.443 -4.948  1.00 51.22 ? 51   ARG A NH1 1 
ATOM   409  N  NH2 . ARG A 1 54  ? 10.287 -4.680 -3.398  1.00 50.74 ? 51   ARG A NH2 1 
ATOM   410  N  N   . ASN A 1 55  ? 6.474  2.369  -3.644  1.00 37.04 ? 52   ASN A N   1 
ATOM   411  C  CA  . ASN A 1 55  ? 6.348  3.528  -2.746  1.00 36.47 ? 52   ASN A CA  1 
ATOM   412  C  C   . ASN A 1 55  ? 7.722  3.958  -2.209  1.00 35.67 ? 52   ASN A C   1 
ATOM   413  O  O   . ASN A 1 55  ? 8.681  3.203  -2.346  1.00 36.39 ? 52   ASN A O   1 
ATOM   414  C  CB  . ASN A 1 55  ? 5.307  3.273  -1.633  1.00 36.40 ? 52   ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 55  ? 5.897  2.703  -0.358  1.00 36.70 ? 52   ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 55  ? 7.043  2.985  0.006   1.00 38.12 ? 52   ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 55  ? 5.090  1.932  0.357   1.00 36.79 ? 52   ASN A ND2 1 
ATOM   418  N  N   . LEU A 1 56  ? 7.820  5.154  -1.616  1.00 33.98 ? 53   LEU A N   1 
ATOM   419  C  CA  . LEU A 1 56  ? 9.116  5.676  -1.126  1.00 32.37 ? 53   LEU A CA  1 
ATOM   420  C  C   . LEU A 1 56  ? 9.699  4.846  -0.007  1.00 32.27 ? 53   LEU A C   1 
ATOM   421  O  O   . LEU A 1 56  ? 10.890 4.484  -0.052  1.00 31.84 ? 53   LEU A O   1 
ATOM   422  C  CB  . LEU A 1 56  ? 8.993  7.114  -0.623  1.00 31.94 ? 53   LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 56  ? 10.318 7.820  -0.262  1.00 29.67 ? 53   LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 56  ? 11.185 7.904  -1.510  1.00 27.01 ? 53   LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 56  ? 10.050 9.190  0.295   1.00 26.82 ? 53   LEU A CD2 1 
ATOM   426  N  N   . GLU A 1 57  ? 8.874  4.553  1.001   1.00 31.84 ? 54   GLU A N   1 
ATOM   427  C  CA  . GLU A 1 57  ? 9.329  3.761  2.160   1.00 32.38 ? 54   GLU A CA  1 
ATOM   428  C  C   . GLU A 1 57  ? 9.758  2.323  1.821   1.00 32.01 ? 54   GLU A C   1 
ATOM   429  O  O   . GLU A 1 57  ? 10.693 1.807  2.425   1.00 31.98 ? 54   GLU A O   1 
ATOM   430  C  CB  . GLU A 1 57  ? 8.291  3.759  3.274   1.00 32.09 ? 54   GLU A CB  1 
ATOM   431  C  CG  . GLU A 1 57  ? 7.875  5.165  3.676   1.00 34.76 ? 54   GLU A CG  1 
ATOM   432  C  CD  . GLU A 1 57  ? 7.253  5.245  5.056   1.00 36.27 ? 54   GLU A CD  1 
ATOM   433  O  OE1 . GLU A 1 57  ? 7.432  4.300  5.844   1.00 39.95 ? 54   GLU A OE1 1 
ATOM   434  O  OE2 . GLU A 1 57  ? 6.625  6.272  5.368   1.00 37.74 ? 54   GLU A OE2 1 
ATOM   435  N  N   . GLU A 1 58  ? 9.085  1.711  0.844   1.00 31.74 ? 55   GLU A N   1 
ATOM   436  C  CA  . GLU A 1 58  ? 9.440  0.379  0.323   1.00 30.78 ? 55   GLU A CA  1 
ATOM   437  C  C   . GLU A 1 58  ? 10.765 0.418  -0.434  1.00 30.41 ? 55   GLU A C   1 
ATOM   438  O  O   . GLU A 1 58  ? 11.524 -0.529 -0.398  1.00 30.51 ? 55   GLU A O   1 
ATOM   439  C  CB  . GLU A 1 58  ? 8.346  -0.176 -0.615  1.00 30.46 ? 55   GLU A CB  1 
ATOM   440  C  CG  . GLU A 1 58  ? 7.171  -0.846 0.092   0.50 29.86 ? 55   GLU A CG  1 
ATOM   441  C  CD  . GLU A 1 58  ? 6.048  -1.303 -0.862  0.50 28.92 ? 55   GLU A CD  1 
ATOM   442  O  OE1 . GLU A 1 58  ? 6.025  -0.911 -2.052  0.50 27.50 ? 55   GLU A OE1 1 
ATOM   443  O  OE2 . GLU A 1 58  ? 5.173  -2.061 -0.406  0.50 27.20 ? 55   GLU A OE2 1 
ATOM   444  N  N   . ILE A 1 59  ? 11.015 1.500  -1.157  1.00 30.19 ? 56   ILE A N   1 
ATOM   445  C  CA  . ILE A 1 59  ? 12.282 1.664  -1.848  1.00 29.86 ? 56   ILE A CA  1 
ATOM   446  C  C   . ILE A 1 59  ? 13.418 1.806  -0.840  1.00 29.52 ? 56   ILE A C   1 
ATOM   447  O  O   . ILE A 1 59  ? 14.473 1.230  -1.047  1.00 29.80 ? 56   ILE A O   1 
ATOM   448  C  CB  . ILE A 1 59  ? 12.295 2.874  -2.820  1.00 29.85 ? 56   ILE A CB  1 
ATOM   449  C  CG1 . ILE A 1 59  ? 11.237 2.705  -3.926  1.00 29.48 ? 56   ILE A CG1 1 
ATOM   450  C  CG2 . ILE A 1 59  ? 13.673 3.014  -3.468  1.00 28.96 ? 56   ILE A CG2 1 
ATOM   451  C  CD1 . ILE A 1 59  ? 11.105 3.893  -4.861  1.00 26.91 ? 56   ILE A CD1 1 
ATOM   452  N  N   . VAL A 1 60  ? 13.202 2.566  0.240   1.00 28.93 ? 57   VAL A N   1 
ATOM   453  C  CA  . VAL A 1 60  ? 14.235 2.775  1.272   1.00 28.07 ? 57   VAL A CA  1 
ATOM   454  C  C   . VAL A 1 60  ? 14.604 1.432  1.956   1.00 28.67 ? 57   VAL A C   1 
ATOM   455  O  O   . VAL A 1 60  ? 15.782 1.158  2.311   1.00 27.79 ? 57   VAL A O   1 
ATOM   456  C  CB  . VAL A 1 60  ? 13.750 3.773  2.338   1.00 27.47 ? 57   VAL A CB  1 
ATOM   457  C  CG1 . VAL A 1 60  ? 14.657 3.771  3.577   1.00 26.59 ? 57   VAL A CG1 1 
ATOM   458  C  CG2 . VAL A 1 60  ? 13.630 5.175  1.728   1.00 25.76 ? 57   VAL A CG2 1 
ATOM   459  N  N   . LYS A 1 61  ? 13.575 0.625  2.169   1.00 28.14 ? 58   LYS A N   1 
ATOM   460  C  CA  . LYS A 1 61  ? 13.727 -0.617 2.886   1.00 28.88 ? 58   LYS A CA  1 
ATOM   461  C  C   . LYS A 1 61  ? 14.344 -1.703 2.023   1.00 29.22 ? 58   LYS A C   1 
ATOM   462  O  O   . LYS A 1 61  ? 14.855 -2.675 2.569   1.00 29.69 ? 58   LYS A O   1 
ATOM   463  C  CB  . LYS A 1 61  ? 12.383 -1.064 3.463   1.00 29.09 ? 58   LYS A CB  1 
ATOM   464  C  CG  . LYS A 1 61  ? 12.037 -0.266 4.703   1.00 29.88 ? 58   LYS A CG  1 
ATOM   465  C  CD  . LYS A 1 61  ? 10.773 -0.732 5.349   1.00 30.94 ? 58   LYS A CD  1 
ATOM   466  C  CE  . LYS A 1 61  ? 10.582 -0.067 6.713   1.00 31.74 ? 58   LYS A CE  1 
ATOM   467  N  NZ  . LYS A 1 61  ? 9.234  -0.400 7.309   1.00 31.62 ? 58   LYS A NZ  1 
ATOM   468  N  N   . THR A 1 62  ? 14.352 -1.512 0.699   1.00 29.72 ? 59   THR A N   1 
ATOM   469  C  CA  . THR A 1 62  ? 14.691 -2.571 -0.269  1.00 29.98 ? 59   THR A CA  1 
ATOM   470  C  C   . THR A 1 62  ? 15.658 -2.179 -1.409  1.00 30.62 ? 59   THR A C   1 
ATOM   471  O  O   . THR A 1 62  ? 15.797 -2.919 -2.382  1.00 31.65 ? 59   THR A O   1 
ATOM   472  C  CB  . THR A 1 62  ? 13.393 -3.090 -0.939  1.00 29.94 ? 59   THR A CB  1 
ATOM   473  O  OG1 . THR A 1 62  ? 12.859 -2.081 -1.816  1.00 29.23 ? 59   THR A OG1 1 
ATOM   474  C  CG2 . THR A 1 62  ? 12.351 -3.456 0.114   1.00 29.22 ? 59   THR A CG2 1 
ATOM   475  N  N   . SER A 1 63  ? 16.327 -1.041 -1.322  1.00 30.87 ? 60   SER A N   1 
ATOM   476  C  CA  . SER A 1 63  ? 17.247 -0.630 -2.382  1.00 31.23 ? 60   SER A CA  1 
ATOM   477  C  C   . SER A 1 63  ? 18.655 -0.495 -1.837  1.00 31.39 ? 60   SER A C   1 
ATOM   478  O  O   . SER A 1 63  ? 18.848 -0.426 -0.634  1.00 32.90 ? 60   SER A O   1 
ATOM   479  C  CB  . SER A 1 63  ? 16.834 0.717  -2.958  1.00 31.28 ? 60   SER A CB  1 
ATOM   480  O  OG  . SER A 1 63  ? 16.778 1.703  -1.930  1.00 32.23 ? 60   SER A OG  1 
ATOM   481  N  N   . ASN A 1 64  ? 19.633 -0.447 -2.732  1.00 31.28 ? 61   ASN A N   1 
ATOM   482  C  CA  . ASN A 1 64  ? 20.993 -0.168 -2.358  1.00 31.60 ? 61   ASN A CA  1 
ATOM   483  C  C   . ASN A 1 64  ? 21.535 0.893  -3.305  1.00 31.10 ? 61   ASN A C   1 
ATOM   484  O  O   . ASN A 1 64  ? 20.797 1.411  -4.172  1.00 30.31 ? 61   ASN A O   1 
ATOM   485  C  CB  . ASN A 1 64  ? 21.846 -1.441 -2.338  1.00 32.20 ? 61   ASN A CB  1 
ATOM   486  C  CG  . ASN A 1 64  ? 22.142 -1.966 -3.725  1.00 34.78 ? 61   ASN A CG  1 
ATOM   487  O  OD1 . ASN A 1 64  ? 21.443 -1.620 -4.684  1.00 39.03 ? 61   ASN A OD1 1 
ATOM   488  N  ND2 . ASN A 1 64  ? 23.204 -2.784 -3.854  1.00 38.04 ? 61   ASN A ND2 1 
ATOM   489  N  N   . GLY A 1 65  ? 22.793 1.252  -3.079  1.00 30.86 ? 62   GLY A N   1 
ATOM   490  C  CA  . GLY A 1 65  ? 23.528 2.219  -3.891  1.00 30.82 ? 62   GLY A CA  1 
ATOM   491  C  C   . GLY A 1 65  ? 22.847 3.553  -4.107  1.00 30.74 ? 62   GLY A C   1 
ATOM   492  O  O   . GLY A 1 65  ? 22.222 4.095  -3.190  1.00 30.21 ? 62   GLY A O   1 
ATOM   493  N  N   . GLY A 1 66  ? 22.954 4.061  -5.337  1.00 30.31 ? 63   GLY A N   1 
ATOM   494  C  CA  . GLY A 1 66  ? 22.361 5.335  -5.726  1.00 30.32 ? 63   GLY A CA  1 
ATOM   495  C  C   . GLY A 1 66  ? 20.858 5.455  -5.489  1.00 30.49 ? 63   GLY A C   1 
ATOM   496  O  O   . GLY A 1 66  ? 20.361 6.542  -5.153  1.00 29.70 ? 63   GLY A O   1 
ATOM   497  N  N   . ILE A 1 67  ? 20.111 4.367  -5.677  1.00 30.89 ? 64   ILE A N   1 
ATOM   498  C  CA  . ILE A 1 67  ? 18.667 4.460  -5.466  1.00 31.57 ? 64   ILE A CA  1 
ATOM   499  C  C   . ILE A 1 67  ? 18.397 4.681  -3.987  1.00 31.81 ? 64   ILE A C   1 
ATOM   500  O  O   . ILE A 1 67  ? 17.570 5.540  -3.618  1.00 31.69 ? 64   ILE A O   1 
ATOM   501  C  CB  . ILE A 1 67  ? 17.832 3.244  -5.976  1.00 31.85 ? 64   ILE A CB  1 
ATOM   502  C  CG1 . ILE A 1 67  ? 17.773 3.229  -7.517  1.00 32.91 ? 64   ILE A CG1 1 
ATOM   503  C  CG2 . ILE A 1 67  ? 16.407 3.327  -5.397  1.00 30.57 ? 64   ILE A CG2 1 
ATOM   504  C  CD1 . ILE A 1 67  ? 17.123 1.952  -8.158  1.00 33.50 ? 64   ILE A CD1 1 
ATOM   505  N  N   . PHE A 1 68  ? 19.078 3.901  -3.150  1.00 30.89 ? 65   PHE A N   1 
ATOM   506  C  CA  . PHE A 1 68  ? 18.930 4.057  -1.714  1.00 31.05 ? 65   PHE A CA  1 
ATOM   507  C  C   . PHE A 1 68  ? 19.286 5.469  -1.276  1.00 30.27 ? 65   PHE A C   1 
ATOM   508  O  O   . PHE A 1 68  ? 18.495 6.142  -0.587  1.00 30.42 ? 65   PHE A O   1 
ATOM   509  C  CB  . PHE A 1 68  ? 19.768 3.030  -0.934  1.00 31.49 ? 65   PHE A CB  1 
ATOM   510  C  CG  . PHE A 1 68  ? 19.747 3.272  0.532   1.00 31.27 ? 65   PHE A CG  1 
ATOM   511  C  CD1 . PHE A 1 68  ? 18.659 2.855  1.294   1.00 30.08 ? 65   PHE A CD1 1 
ATOM   512  C  CD2 . PHE A 1 68  ? 20.765 3.983  1.147   1.00 30.37 ? 65   PHE A CD2 1 
ATOM   513  C  CE1 . PHE A 1 68  ? 18.604 3.108  2.656   1.00 30.18 ? 65   PHE A CE1 1 
ATOM   514  C  CE2 . PHE A 1 68  ? 20.703 4.267  2.509   1.00 31.08 ? 65   PHE A CE2 1 
ATOM   515  C  CZ  . PHE A 1 68  ? 19.622 3.834  3.272   1.00 28.42 ? 65   PHE A CZ  1 
ATOM   516  N  N   . ASN A 1 69  ? 20.450 5.938  -1.689  1.00 29.73 ? 66   ASN A N   1 
ATOM   517  C  CA  . ASN A 1 69  ? 20.903 7.258  -1.261  1.00 29.58 ? 66   ASN A CA  1 
ATOM   518  C  C   . ASN A 1 69  ? 19.854 8.358  -1.518  1.00 30.07 ? 66   ASN A C   1 
ATOM   519  O  O   . ASN A 1 69  ? 19.544 9.161  -0.619  1.00 29.85 ? 66   ASN A O   1 
ATOM   520  C  CB  . ASN A 1 69  ? 22.257 7.578  -1.892  1.00 29.68 ? 66   ASN A CB  1 
ATOM   521  C  CG  . ASN A 1 69  ? 23.397 6.825  -1.222  1.00 27.95 ? 66   ASN A CG  1 
ATOM   522  O  OD1 . ASN A 1 69  ? 23.230 6.307  -0.106  1.00 25.88 ? 66   ASN A OD1 1 
ATOM   523  N  ND2 . ASN A 1 69  ? 24.543 6.757  -1.883  1.00 26.76 ? 66   ASN A ND2 1 
ATOM   524  N  N   . ASN A 1 70  ? 19.316 8.367  -2.728  1.00 30.02 ? 67   ASN A N   1 
ATOM   525  C  CA  . ASN A 1 70  ? 18.373 9.379  -3.159  1.00 30.43 ? 67   ASN A CA  1 
ATOM   526  C  C   . ASN A 1 70  ? 17.006 9.173  -2.504  1.00 30.44 ? 67   ASN A C   1 
ATOM   527  O  O   . ASN A 1 70  ? 16.417 10.122 -2.021  1.00 29.27 ? 67   ASN A O   1 
ATOM   528  C  CB  . ASN A 1 70  ? 18.276 9.397  -4.689  1.00 30.47 ? 67   ASN A CB  1 
ATOM   529  C  CG  . ASN A 1 70  ? 19.504 10.023 -5.334  1.00 31.45 ? 67   ASN A CG  1 
ATOM   530  O  OD1 . ASN A 1 70  ? 20.355 9.319  -5.931  1.00 31.91 ? 67   ASN A OD1 1 
ATOM   531  N  ND2 . ASN A 1 70  ? 19.638 11.333 -5.184  1.00 26.08 ? 67   ASN A ND2 1 
ATOM   532  N  N   . ALA A 1 71  ? 16.548 7.915  -2.431  1.00 30.61 ? 68   ALA A N   1 
ATOM   533  C  CA  . ALA A 1 71  ? 15.259 7.613  -1.750  1.00 29.28 ? 68   ALA A CA  1 
ATOM   534  C  C   . ALA A 1 71  ? 15.297 7.949  -0.246  1.00 28.77 ? 68   ALA A C   1 
ATOM   535  O  O   . ALA A 1 71  ? 14.394 8.619  0.262   1.00 27.87 ? 68   ALA A O   1 
ATOM   536  C  CB  . ALA A 1 71  ? 14.861 6.169  -1.949  1.00 29.06 ? 68   ALA A CB  1 
ATOM   537  N  N   . ALA A 1 72  ? 16.349 7.493  0.442   1.00 28.07 ? 69   ALA A N   1 
ATOM   538  C  CA  . ALA A 1 72  ? 16.486 7.715  1.869   1.00 27.32 ? 69   ALA A CA  1 
ATOM   539  C  C   . ALA A 1 72  ? 16.601 9.203  2.142   1.00 27.36 ? 69   ALA A C   1 
ATOM   540  O  O   . ALA A 1 72  ? 15.971 9.697  3.075   1.00 28.13 ? 69   ALA A O   1 
ATOM   541  C  CB  . ALA A 1 72  ? 17.657 6.968  2.440   1.00 26.09 ? 69   ALA A CB  1 
ATOM   542  N  N   . GLN A 1 73  ? 17.366 9.931  1.333   1.00 27.11 ? 70   GLN A N   1 
ATOM   543  C  CA  . GLN A 1 73  ? 17.424 11.413 1.508   1.00 26.97 ? 70   GLN A CA  1 
ATOM   544  C  C   . GLN A 1 73  ? 16.097 12.117 1.282   1.00 27.08 ? 70   GLN A C   1 
ATOM   545  O  O   . GLN A 1 73  ? 15.794 13.126 1.952   1.00 27.23 ? 70   GLN A O   1 
ATOM   546  C  CB  . GLN A 1 73  ? 18.492 12.045 0.634   1.00 26.56 ? 70   GLN A CB  1 
ATOM   547  C  CG  . GLN A 1 73  ? 19.920 11.749 1.117   1.00 25.26 ? 70   GLN A CG  1 
ATOM   548  C  CD  . GLN A 1 73  ? 20.264 12.378 2.478   1.00 26.88 ? 70   GLN A CD  1 
ATOM   549  O  OE1 . GLN A 1 73  ? 19.920 11.844 3.531   1.00 27.39 ? 70   GLN A OE1 1 
ATOM   550  N  NE2 . GLN A 1 73  ? 20.991 13.484 2.449   1.00 23.25 ? 70   GLN A NE2 1 
ATOM   551  N  N   . VAL A 1 74  ? 15.323 11.623 0.330   1.00 26.98 ? 71   VAL A N   1 
ATOM   552  C  CA  . VAL A 1 74  ? 14.004 12.190 0.113   1.00 27.31 ? 71   VAL A CA  1 
ATOM   553  C  C   . VAL A 1 74  ? 13.201 11.993 1.369   1.00 27.61 ? 71   VAL A C   1 
ATOM   554  O  O   . VAL A 1 74  ? 12.574 12.947 1.873   1.00 27.75 ? 71   VAL A O   1 
ATOM   555  C  CB  . VAL A 1 74  ? 13.264 11.624 -1.139  1.00 26.81 ? 71   VAL A CB  1 
ATOM   556  C  CG1 . VAL A 1 74  ? 11.783 12.103 -1.164  1.00 28.23 ? 71   VAL A CG1 1 
ATOM   557  C  CG2 . VAL A 1 74  ? 13.950 12.074 -2.395  1.00 26.36 ? 71   VAL A CG2 1 
ATOM   558  N  N   . PHE A 1 75  ? 13.182 10.759 1.868   1.00 27.44 ? 72   PHE A N   1 
ATOM   559  C  CA  . PHE A 1 75  ? 12.391 10.449 3.044   1.00 27.54 ? 72   PHE A CA  1 
ATOM   560  C  C   . PHE A 1 75  ? 12.868 11.250 4.271   1.00 27.54 ? 72   PHE A C   1 
ATOM   561  O  O   . PHE A 1 75  ? 12.061 11.807 5.023   1.00 27.60 ? 72   PHE A O   1 
ATOM   562  C  CB  . PHE A 1 75  ? 12.429 8.949  3.376   1.00 27.83 ? 72   PHE A CB  1 
ATOM   563  C  CG  . PHE A 1 75  ? 11.780 8.624  4.693   1.00 28.72 ? 72   PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1 75  ? 10.434 8.223  4.750   1.00 30.11 ? 72   PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1 75  ? 12.474 8.775  5.876   1.00 29.72 ? 72   PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1 75  ? 9.845  7.953  5.948   1.00 28.79 ? 72   PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1 75  ? 11.880 8.522  7.096   1.00 31.02 ? 72   PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1 75  ? 10.572 8.101  7.138   1.00 32.96 ? 72   PHE A CZ  1 
ATOM   569  N  N   . ASN A 1 76  ? 14.182 11.294 4.448   1.00 26.77 ? 73   ASN A N   1 
ATOM   570  C  CA  . ASN A 1 76  ? 14.804 11.939 5.599   1.00 26.80 ? 73   ASN A CA  1 
ATOM   571  C  C   . ASN A 1 76  ? 14.486 13.453 5.622   1.00 26.19 ? 73   ASN A C   1 
ATOM   572  O  O   . ASN A 1 76  ? 14.140 14.019 6.660   1.00 25.82 ? 73   ASN A O   1 
ATOM   573  C  CB  . ASN A 1 76  ? 16.333 11.692 5.583   1.00 26.37 ? 73   ASN A CB  1 
ATOM   574  C  CG  . ASN A 1 76  ? 16.727 10.231 5.819   1.00 27.72 ? 73   ASN A CG  1 
ATOM   575  O  OD1 . ASN A 1 76  ? 15.905 9.378  6.159   1.00 27.62 ? 73   ASN A OD1 1 
ATOM   576  N  ND2 . ASN A 1 76  ? 18.021 9.941  5.616   1.00 25.73 ? 73   ASN A ND2 1 
ATOM   577  N  N   . HIS A 1 77  ? 14.563 14.101 4.471   1.00 26.87 ? 74   HIS A N   1 
ATOM   578  C  CA  . HIS A 1 77  ? 14.328 15.544 4.425   1.00 27.86 ? 74   HIS A CA  1 
ATOM   579  C  C   . HIS A 1 77  ? 12.872 15.887 4.658   1.00 28.27 ? 74   HIS A C   1 
ATOM   580  O  O   . HIS A 1 77  ? 12.601 16.819 5.378   1.00 28.77 ? 74   HIS A O   1 
ATOM   581  C  CB  . HIS A 1 77  ? 14.816 16.179 3.116   1.00 28.12 ? 74   HIS A CB  1 
ATOM   582  C  CG  . HIS A 1 77  ? 16.295 16.344 3.032   1.00 26.47 ? 74   HIS A CG  1 
ATOM   583  N  ND1 . HIS A 1 77  ? 17.111 15.385 2.461   1.00 23.82 ? 74   HIS A ND1 1 
ATOM   584  C  CD2 . HIS A 1 77  ? 17.119 17.320 3.497   1.00 24.28 ? 74   HIS A CD2 1 
ATOM   585  C  CE1 . HIS A 1 77  ? 18.365 15.794 2.533   1.00 24.26 ? 74   HIS A CE1 1 
ATOM   586  N  NE2 . HIS A 1 77  ? 18.397 16.962 3.152   1.00 24.99 ? 74   HIS A NE2 1 
ATOM   587  N  N   . THR A 1 78  ? 11.929 15.134 4.083   1.00 28.55 ? 75   THR A N   1 
ATOM   588  C  CA  . THR A 1 78  ? 10.490 15.350 4.354   1.00 28.08 ? 75   THR A CA  1 
ATOM   589  C  C   . THR A 1 78  ? 10.216 15.180 5.838   1.00 27.52 ? 75   THR A C   1 
ATOM   590  O  O   . THR A 1 78  ? 9.500  15.974 6.437   1.00 27.13 ? 75   THR A O   1 
ATOM   591  C  CB  . THR A 1 78  ? 9.611  14.357 3.500   1.00 28.62 ? 75   THR A CB  1 
ATOM   592  O  OG1 . THR A 1 78  ? 9.818  14.634 2.104   1.00 29.11 ? 75   THR A OG1 1 
ATOM   593  C  CG2 . THR A 1 78  ? 8.105  14.444 3.834   1.00 29.06 ? 75   THR A CG2 1 
ATOM   594  N  N   . PHE A 1 79  ? 10.798 14.142 6.444   1.00 27.11 ? 76   PHE A N   1 
ATOM   595  C  CA  . PHE A 1 79  ? 10.685 13.891 7.878   1.00 26.21 ? 76   PHE A CA  1 
ATOM   596  C  C   . PHE A 1 79  ? 11.209 15.077 8.684   1.00 26.04 ? 76   PHE A C   1 
ATOM   597  O  O   . PHE A 1 79  ? 10.518 15.612 9.562   1.00 24.91 ? 76   PHE A O   1 
ATOM   598  C  CB  . PHE A 1 79  ? 11.398 12.588 8.285   1.00 27.08 ? 76   PHE A CB  1 
ATOM   599  C  CG  . PHE A 1 79  ? 10.950 12.071 9.619   1.00 27.14 ? 76   PHE A CG  1 
ATOM   600  C  CD1 . PHE A 1 79  ? 9.862  11.205 9.712   1.00 27.37 ? 76   PHE A CD1 1 
ATOM   601  C  CD2 . PHE A 1 79  ? 11.562 12.504 10.784  1.00 26.81 ? 76   PHE A CD2 1 
ATOM   602  C  CE1 . PHE A 1 79  ? 9.423  10.752 10.959  1.00 25.57 ? 76   PHE A CE1 1 
ATOM   603  C  CE2 . PHE A 1 79  ? 11.112 12.059 12.024  1.00 27.06 ? 76   PHE A CE2 1 
ATOM   604  C  CZ  . PHE A 1 79  ? 10.031 11.183 12.102  1.00 23.98 ? 76   PHE A CZ  1 
ATOM   605  N  N   . TYR A 1 80  ? 12.403 15.539 8.345   1.00 24.99 ? 77   TYR A N   1 
ATOM   606  C  CA  . TYR A 1 80  ? 12.994 16.723 9.016   1.00 24.74 ? 77   TYR A CA  1 
ATOM   607  C  C   . TYR A 1 80  ? 12.062 17.953 8.944   1.00 24.60 ? 77   TYR A C   1 
ATOM   608  O  O   . TYR A 1 80  ? 11.791 18.594 9.968   1.00 24.66 ? 77   TYR A O   1 
ATOM   609  C  CB  . TYR A 1 80  ? 14.346 16.984 8.371   1.00 24.00 ? 77   TYR A CB  1 
ATOM   610  C  CG  . TYR A 1 80  ? 15.124 18.213 8.733   1.00 22.64 ? 77   TYR A CG  1 
ATOM   611  C  CD1 . TYR A 1 80  ? 15.736 18.335 9.958   1.00 23.00 ? 77   TYR A CD1 1 
ATOM   612  C  CD2 . TYR A 1 80  ? 15.323 19.233 7.796   1.00 21.83 ? 77   TYR A CD2 1 
ATOM   613  C  CE1 . TYR A 1 80  ? 16.511 19.461 10.250  1.00 24.57 ? 77   TYR A CE1 1 
ATOM   614  C  CE2 . TYR A 1 80  ? 16.085 20.341 8.078   1.00 23.82 ? 77   TYR A CE2 1 
ATOM   615  C  CZ  . TYR A 1 80  ? 16.682 20.456 9.288   1.00 24.11 ? 77   TYR A CZ  1 
ATOM   616  O  OH  . TYR A 1 80  ? 17.461 21.554 9.560   1.00 22.64 ? 77   TYR A OH  1 
ATOM   617  N  N   . TRP A 1 81  ? 11.573 18.300 7.760   1.00 24.39 ? 78   TRP A N   1 
ATOM   618  C  CA  . TRP A 1 81  ? 10.714 19.497 7.656   1.00 24.78 ? 78   TRP A CA  1 
ATOM   619  C  C   . TRP A 1 81  ? 9.499  19.409 8.572   1.00 25.08 ? 78   TRP A C   1 
ATOM   620  O  O   . TRP A 1 81  ? 9.107  20.412 9.175   1.00 25.35 ? 78   TRP A O   1 
ATOM   621  C  CB  . TRP A 1 81  ? 10.244 19.775 6.227   1.00 24.88 ? 78   TRP A CB  1 
ATOM   622  C  CG  . TRP A 1 81  ? 11.302 19.900 5.252   1.00 23.67 ? 78   TRP A CG  1 
ATOM   623  C  CD1 . TRP A 1 81  ? 11.427 19.185 4.118   1.00 23.28 ? 78   TRP A CD1 1 
ATOM   624  C  CD2 . TRP A 1 81  ? 12.448 20.780 5.308   1.00 25.91 ? 78   TRP A CD2 1 
ATOM   625  N  NE1 . TRP A 1 81  ? 12.575 19.544 3.463   1.00 25.11 ? 78   TRP A NE1 1 
ATOM   626  C  CE2 . TRP A 1 81  ? 13.219 20.523 4.164   1.00 24.81 ? 78   TRP A CE2 1 
ATOM   627  C  CE3 . TRP A 1 81  ? 12.896 21.738 6.215   1.00 25.12 ? 78   TRP A CE3 1 
ATOM   628  C  CZ2 . TRP A 1 81  ? 14.419 21.191 3.890   1.00 25.32 ? 78   TRP A CZ2 1 
ATOM   629  C  CZ3 . TRP A 1 81  ? 14.072 22.423 5.924   1.00 25.12 ? 78   TRP A CZ3 1 
ATOM   630  C  CH2 . TRP A 1 81  ? 14.818 22.136 4.778   1.00 24.00 ? 78   TRP A CH2 1 
ATOM   631  N  N   . ASN A 1 82  ? 8.914  18.218 8.691   1.00 25.16 ? 79   ASN A N   1 
ATOM   632  C  CA  . ASN A 1 82  ? 7.783  17.991 9.613   1.00 25.84 ? 79   ASN A CA  1 
ATOM   633  C  C   . ASN A 1 82  ? 8.163  18.081 11.096  1.00 26.36 ? 79   ASN A C   1 
ATOM   634  O  O   . ASN A 1 82  ? 7.318  18.363 11.938  1.00 25.63 ? 79   ASN A O   1 
ATOM   635  C  CB  . ASN A 1 82  ? 7.138  16.628 9.328   1.00 26.10 ? 79   ASN A CB  1 
ATOM   636  C  CG  . ASN A 1 82  ? 6.363  16.625 8.056   1.00 26.95 ? 79   ASN A CG  1 
ATOM   637  O  OD1 . ASN A 1 82  ? 5.505  17.481 7.851   1.00 28.96 ? 79   ASN A OD1 1 
ATOM   638  N  ND2 . ASN A 1 82  ? 6.609  15.643 7.202   1.00 29.09 ? 79   ASN A ND2 1 
ATOM   639  N  N   . CYS A 1 83  ? 9.438  17.829 11.408  1.00 25.60 ? 80   CYS A N   1 
ATOM   640  C  CA  . CYS A 1 83  ? 9.973  17.989 12.771  1.00 24.83 ? 80   CYS A CA  1 
ATOM   641  C  C   . CYS A 1 83  ? 10.174 19.434 13.193  1.00 24.87 ? 80   CYS A C   1 
ATOM   642  O  O   . CYS A 1 83  ? 10.543 19.689 14.337  1.00 25.19 ? 80   CYS A O   1 
ATOM   643  C  CB  . CYS A 1 83  ? 11.331 17.270 12.886  1.00 24.72 ? 80   CYS A CB  1 
ATOM   644  S  SG  . CYS A 1 83  ? 11.147 15.477 12.707  1.00 23.56 ? 80   CYS A SG  1 
ATOM   645  N  N   . LEU A 1 84  ? 9.981  20.386 12.292  1.00 24.65 ? 81   LEU A N   1 
ATOM   646  C  CA  . LEU A 1 84  ? 10.212 21.790 12.658  1.00 24.53 ? 81   LEU A CA  1 
ATOM   647  C  C   . LEU A 1 84  ? 8.895  22.543 12.574  1.00 24.28 ? 81   LEU A C   1 
ATOM   648  O  O   . LEU A 1 84  ? 8.012  22.141 11.828  1.00 25.10 ? 81   LEU A O   1 
ATOM   649  C  CB  . LEU A 1 84  ? 11.246 22.423 11.736  1.00 23.68 ? 81   LEU A CB  1 
ATOM   650  C  CG  . LEU A 1 84  ? 12.563 21.641 11.554  1.00 23.41 ? 81   LEU A CG  1 
ATOM   651  C  CD1 . LEU A 1 84  ? 13.402 22.288 10.455  1.00 22.42 ? 81   LEU A CD1 1 
ATOM   652  C  CD2 . LEU A 1 84  ? 13.361 21.519 12.878  1.00 21.05 ? 81   LEU A CD2 1 
ATOM   653  N  N   . THR A 1 85  ? 8.756  23.630 13.310  1.00 24.09 ? 82   THR A N   1 
ATOM   654  C  CA  . THR A 1 85  ? 7.514  24.434 13.155  1.00 23.94 ? 82   THR A CA  1 
ATOM   655  C  C   . THR A 1 85  ? 7.693  25.858 13.672  1.00 23.97 ? 82   THR A C   1 
ATOM   656  O  O   . THR A 1 85  ? 8.488  26.080 14.596  1.00 22.53 ? 82   THR A O   1 
ATOM   657  C  CB  . THR A 1 85  ? 6.326  23.747 13.872  1.00 24.02 ? 82   THR A CB  1 
ATOM   658  O  OG1 . THR A 1 85  ? 5.143  24.539 13.745  1.00 23.04 ? 82   THR A OG1 1 
ATOM   659  C  CG2 . THR A 1 85  ? 6.625  23.530 15.334  1.00 24.62 ? 82   THR A CG2 1 
ATOM   660  N  N   . PRO A 1 86  ? 6.972  26.829 13.058  1.00 24.86 ? 83   PRO A N   1 
ATOM   661  C  CA  . PRO A 1 86  ? 6.933  28.176 13.632  1.00 25.80 ? 83   PRO A CA  1 
ATOM   662  C  C   . PRO A 1 86  ? 5.990  28.275 14.833  1.00 25.78 ? 83   PRO A C   1 
ATOM   663  O  O   . PRO A 1 86  ? 6.011  29.298 15.529  1.00 26.94 ? 83   PRO A O   1 
ATOM   664  C  CB  . PRO A 1 86  ? 6.421  29.030 12.474  1.00 25.76 ? 83   PRO A CB  1 
ATOM   665  C  CG  . PRO A 1 86  ? 5.526  28.098 11.706  1.00 25.55 ? 83   PRO A CG  1 
ATOM   666  C  CD  . PRO A 1 86  ? 6.194  26.750 11.804  1.00 24.66 ? 83   PRO A CD  1 
ATOM   667  N  N   . ASN A 1 87  ? 5.189  27.238 15.078  1.00 25.85 ? 84   ASN A N   1 
ATOM   668  C  CA  . ASN A 1 87  ? 4.096  27.308 16.044  1.00 27.06 ? 84   ASN A CA  1 
ATOM   669  C  C   . ASN A 1 87  ? 4.520  26.740 17.351  1.00 27.15 ? 84   ASN A C   1 
ATOM   670  O  O   . ASN A 1 87  ? 5.468  25.956 17.388  1.00 27.70 ? 84   ASN A O   1 
ATOM   671  C  CB  . ASN A 1 87  ? 2.915  26.503 15.550  1.00 26.83 ? 84   ASN A CB  1 
ATOM   672  C  CG  . ASN A 1 87  ? 2.429  26.981 14.241  1.00 27.89 ? 84   ASN A CG  1 
ATOM   673  O  OD1 . ASN A 1 87  ? 2.461  28.179 13.956  1.00 29.80 ? 84   ASN A OD1 1 
ATOM   674  N  ND2 . ASN A 1 87  ? 1.967  26.060 13.419  1.00 31.23 ? 84   ASN A ND2 1 
ATOM   675  N  N   . LYS A 1 88  ? 3.817  27.134 18.406  1.00 25.99 ? 85   LYS A N   1 
ATOM   676  C  CA  . LYS A 1 88  ? 3.992  26.574 19.754  1.00 26.87 ? 85   LYS A CA  1 
ATOM   677  C  C   . LYS A 1 88  ? 3.462  25.127 19.802  1.00 26.71 ? 85   LYS A C   1 
ATOM   678  O  O   . LYS A 1 88  ? 2.333  24.866 19.393  1.00 25.04 ? 85   LYS A O   1 
ATOM   679  C  CB  . LYS A 1 88  ? 3.249  27.429 20.795  1.00 27.95 ? 85   LYS A CB  1 
ATOM   680  C  CG  . LYS A 1 88  ? 2.624  26.605 21.941  1.00 30.95 ? 85   LYS A CG  1 
ATOM   681  C  CD  . LYS A 1 88  ? 1.258  27.148 22.443  1.00 33.46 ? 85   LYS A CD  1 
ATOM   682  C  CE  . LYS A 1 88  ? 1.435  28.122 23.614  1.00 33.21 ? 85   LYS A CE  1 
ATOM   683  N  NZ  . LYS A 1 88  ? 0.260  28.885 23.959  1.00 30.10 ? 85   LYS A NZ  1 
ATOM   684  N  N   . THR A 1 89  ? 4.292  24.192 20.272  1.00 26.80 ? 86   THR A N   1 
ATOM   685  C  CA  . THR A 1 89  ? 3.882  22.782 20.425  1.00 27.16 ? 86   THR A CA  1 
ATOM   686  C  C   . THR A 1 89  ? 4.413  22.253 21.767  1.00 27.77 ? 86   THR A C   1 
ATOM   687  O  O   . THR A 1 89  ? 5.251  22.895 22.422  1.00 27.21 ? 86   THR A O   1 
ATOM   688  C  CB  . THR A 1 89  ? 4.403  21.923 19.252  1.00 27.63 ? 86   THR A CB  1 
ATOM   689  O  OG1 . THR A 1 89  ? 5.811  21.841 19.338  1.00 27.87 ? 86   THR A OG1 1 
ATOM   690  C  CG2 . THR A 1 89  ? 4.054  22.511 17.894  1.00 27.70 ? 86   THR A CG2 1 
ATOM   691  N  N   . GLU A 1 90  ? 3.879  21.131 22.230  1.00 28.43 ? 87   GLU A N   1 
ATOM   692  C  CA  . GLU A 1 90  ? 4.498  20.399 23.357  1.00 29.03 ? 87   GLU A CA  1 
ATOM   693  C  C   . GLU A 1 90  ? 4.271  18.906 23.237  1.00 29.01 ? 87   GLU A C   1 
ATOM   694  O  O   . GLU A 1 90  ? 3.409  18.433 22.474  1.00 28.45 ? 87   GLU A O   1 
ATOM   695  C  CB  . GLU A 1 90  ? 4.040  20.904 24.743  1.00 30.43 ? 87   GLU A CB  1 
ATOM   696  C  CG  . GLU A 1 90  ? 2.579  20.811 25.043  1.00 31.88 ? 87   GLU A CG  1 
ATOM   697  C  CD  . GLU A 1 90  ? 2.173  21.673 26.243  1.00 37.57 ? 87   GLU A CD  1 
ATOM   698  O  OE1 . GLU A 1 90  ? 2.530  21.314 27.392  1.00 40.10 ? 87   GLU A OE1 1 
ATOM   699  O  OE2 . GLU A 1 90  ? 1.461  22.695 26.046  1.00 40.26 ? 87   GLU A OE2 1 
ATOM   700  N  N   . ALA A 1 91  ? 5.078  18.171 23.989  1.00 28.17 ? 88   ALA A N   1 
ATOM   701  C  CA  . ALA A 1 91  ? 5.024  16.732 23.992  1.00 27.60 ? 88   ALA A CA  1 
ATOM   702  C  C   . ALA A 1 91  ? 3.736  16.234 24.679  1.00 27.04 ? 88   ALA A C   1 
ATOM   703  O  O   . ALA A 1 91  ? 3.304  16.799 25.701  1.00 28.03 ? 88   ALA A O   1 
ATOM   704  C  CB  . ALA A 1 91  ? 6.248  16.181 24.687  1.00 26.81 ? 88   ALA A CB  1 
ATOM   705  N  N   . SER A 1 92  ? 3.127  15.192 24.092  1.00 27.15 ? 89   SER A N   1 
ATOM   706  C  CA  . SER A 1 92  ? 2.012  14.454 24.710  1.00 26.40 ? 89   SER A CA  1 
ATOM   707  C  C   . SER A 1 92  ? 2.520  13.882 25.986  1.00 26.04 ? 89   SER A C   1 
ATOM   708  O  O   . SER A 1 92  ? 3.713  13.718 26.180  1.00 27.08 ? 89   SER A O   1 
ATOM   709  C  CB  . SER A 1 92  ? 1.502  13.291 23.847  1.00 26.82 ? 89   SER A CB  1 
ATOM   710  O  OG  . SER A 1 92  ? 2.532  12.343 23.549  1.00 27.72 ? 89   SER A OG  1 
ATOM   711  N  N   . SER A 1 93  ? 1.610  13.584 26.881  1.00 25.54 ? 90   SER A N   1 
ATOM   712  C  CA  . SER A 1 93  ? 1.992  13.016 28.158  1.00 24.96 ? 90   SER A CA  1 
ATOM   713  C  C   . SER A 1 93  ? 2.633  11.623 28.018  1.00 23.64 ? 90   SER A C   1 
ATOM   714  O  O   . SER A 1 93  ? 3.561  11.291 28.758  1.00 22.54 ? 90   SER A O   1 
ATOM   715  C  CB  . SER A 1 93  ? 0.748  12.991 29.005  1.00 25.09 ? 90   SER A CB  1 
ATOM   716  O  OG  . SER A 1 93  ? 0.200  14.274 28.812  1.00 26.62 ? 90   SER A OG  1 
ATOM   717  N  N   . GLN A 1 94  ? 2.139  10.816 27.083  1.00 23.78 ? 91   GLN A N   1 
ATOM   718  C  CA  . GLN A 1 94  ? 2.733  9.477  26.831  1.00 23.80 ? 91   GLN A CA  1 
ATOM   719  C  C   . GLN A 1 94  ? 4.183  9.587  26.308  1.00 23.44 ? 91   GLN A C   1 
ATOM   720  O  O   . GLN A 1 94  ? 5.069  8.826  26.724  1.00 22.28 ? 91   GLN A O   1 
ATOM   721  C  CB  . GLN A 1 94  ? 1.843  8.624  25.886  1.00 25.14 ? 91   GLN A CB  1 
ATOM   722  C  CG  . GLN A 1 94  ? 1.500  9.251  24.513  1.00 26.64 ? 91   GLN A CG  1 
ATOM   723  C  CD  . GLN A 1 94  ? 0.694  8.327  23.586  1.00 28.07 ? 91   GLN A CD  1 
ATOM   724  O  OE1 . GLN A 1 94  ? 0.825  7.089  23.611  1.00 27.65 ? 91   GLN A OE1 1 
ATOM   725  N  NE2 . GLN A 1 94  ? -0.153 8.939  22.759  1.00 28.19 ? 91   GLN A NE2 1 
ATOM   726  N  N   . LEU A 1 95  ? 4.422  10.557 25.433  1.00 23.08 ? 92   LEU A N   1 
ATOM   727  C  CA  . LEU A 1 95  ? 5.781  10.798 24.911  1.00 24.19 ? 92   LEU A CA  1 
ATOM   728  C  C   . LEU A 1 95  ? 6.679  11.333 26.010  1.00 23.74 ? 92   LEU A C   1 
ATOM   729  O  O   . LEU A 1 95  ? 7.820  10.911 26.171  1.00 24.40 ? 92   LEU A O   1 
ATOM   730  C  CB  . LEU A 1 95  ? 5.769  11.787 23.730  1.00 24.12 ? 92   LEU A CB  1 
ATOM   731  C  CG  . LEU A 1 95  ? 7.135  12.207 23.191  1.00 24.51 ? 92   LEU A CG  1 
ATOM   732  C  CD1 . LEU A 1 95  ? 8.042  10.981 22.786  1.00 23.39 ? 92   LEU A CD1 1 
ATOM   733  C  CD2 . LEU A 1 95  ? 6.967  13.218 22.034  1.00 25.42 ? 92   LEU A CD2 1 
ATOM   734  N  N   . LYS A 1 96  ? 6.127  12.212 26.829  1.00 24.30 ? 93   LYS A N   1 
ATOM   735  C  CA  . LYS A 1 96  ? 6.902  12.805 27.907  1.00 24.67 ? 93   LYS A CA  1 
ATOM   736  C  C   . LYS A 1 96  ? 7.297  11.725 28.894  1.00 25.12 ? 93   LYS A C   1 
ATOM   737  O  O   . LYS A 1 96  ? 8.441  11.674 29.346  1.00 26.83 ? 93   LYS A O   1 
ATOM   738  C  CB  . LYS A 1 96  ? 6.068  13.893 28.612  1.00 25.21 ? 93   LYS A CB  1 
ATOM   739  C  CG  . LYS A 1 96  ? 6.906  15.023 29.138  1.00 25.30 ? 93   LYS A CG  1 
ATOM   740  C  CD  . LYS A 1 96  ? 6.123  16.265 29.417  1.00 25.91 ? 93   LYS A CD  1 
ATOM   741  C  CE  . LYS A 1 96  ? 5.578  16.279 30.819  1.00 27.85 ? 93   LYS A CE  1 
ATOM   742  N  NZ  . LYS A 1 96  ? 4.915  17.599 31.068  1.00 27.41 ? 93   LYS A NZ  1 
ATOM   743  N  N   . ALA A 1 97  ? 6.326  10.870 29.217  1.00 25.31 ? 94   ALA A N   1 
ATOM   744  C  CA  . ALA A 1 97  ? 6.501  9.731  30.135  1.00 25.33 ? 94   ALA A CA  1 
ATOM   745  C  C   . ALA A 1 97  ? 7.607  8.831  29.649  1.00 24.13 ? 94   ALA A C   1 
ATOM   746  O  O   . ALA A 1 97  ? 8.492  8.440  30.396  1.00 23.96 ? 94   ALA A O   1 
ATOM   747  C  CB  . ALA A 1 97  ? 5.195  8.931  30.216  1.00 24.78 ? 94   ALA A CB  1 
ATOM   748  N  N   . ALA A 1 98  ? 7.512  8.459  28.388  1.00 24.58 ? 95   ALA A N   1 
ATOM   749  C  CA  . ALA A 1 98  ? 8.541  7.583  27.756  1.00 23.99 ? 95   ALA A CA  1 
ATOM   750  C  C   . ALA A 1 98  ? 9.924  8.234  27.766  1.00 24.63 ? 95   ALA A C   1 
ATOM   751  O  O   . ALA A 1 98  ? 10.961 7.546  27.905  1.00 25.58 ? 95   ALA A O   1 
ATOM   752  C  CB  . ALA A 1 98  ? 8.110  7.225  26.358  1.00 23.52 ? 95   ALA A CB  1 
ATOM   753  N  N   . LEU A 1 99  ? 9.963  9.560  27.590  1.00 24.78 ? 96   LEU A N   1 
ATOM   754  C  CA  . LEU A 1 99  ? 11.231 10.281 27.632  1.00 23.79 ? 96   LEU A CA  1 
ATOM   755  C  C   . LEU A 1 99  ? 11.851 10.248 29.001  1.00 23.49 ? 96   LEU A C   1 
ATOM   756  O  O   . LEU A 1 99  ? 13.057 10.115 29.140  1.00 24.33 ? 96   LEU A O   1 
ATOM   757  C  CB  . LEU A 1 99  ? 11.076 11.733 27.175  1.00 24.48 ? 96   LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 99  ? 11.035 11.973 25.658  1.00 22.61 ? 96   LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 99  ? 10.645 13.404 25.419  1.00 19.38 ? 96   LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 99  ? 12.360 11.643 24.906  1.00 22.91 ? 96   LEU A CD2 1 
ATOM   761  N  N   . ILE A 1 100 ? 11.032 10.353 30.023  1.00 22.33 ? 97   ILE A N   1 
ATOM   762  C  CA  . ILE A 1 100 ? 11.531 10.398 31.397  1.00 22.15 ? 97   ILE A CA  1 
ATOM   763  C  C   . ILE A 1 100 ? 12.072 9.032  31.874  1.00 22.87 ? 97   ILE A C   1 
ATOM   764  O  O   . ILE A 1 100 ? 13.086 8.970  32.582  1.00 21.97 ? 97   ILE A O   1 
ATOM   765  C  CB  . ILE A 1 100 ? 10.406 10.892 32.370  1.00 22.01 ? 97   ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 100 ? 10.021 12.358 32.049  1.00 20.64 ? 97   ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 100 ? 10.866 10.756 33.820  1.00 20.70 ? 97   ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 100 ? 8.805  12.908 32.790  1.00 20.90 ? 97   ILE A CD1 1 
ATOM   769  N  N   . GLU A 1 101 ? 11.363 7.957  31.510  1.00 24.31 ? 98   GLU A N   1 
ATOM   770  C  CA  . GLU A 1 101 ? 11.775 6.580  31.808  1.00 25.14 ? 98   GLU A CA  1 
ATOM   771  C  C   . GLU A 1 101 ? 13.127 6.259  31.176  1.00 25.71 ? 98   GLU A C   1 
ATOM   772  O  O   . GLU A 1 101 ? 14.022 5.697  31.822  1.00 26.00 ? 98   GLU A O   1 
ATOM   773  C  CB  . GLU A 1 101 ? 10.733 5.603  31.269  1.00 25.95 ? 98   GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 101 ? 10.894 4.197  31.779  1.00 28.17 ? 98   GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 101 ? 9.945  3.202  31.130  1.00 33.18 ? 98   GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 101 ? 8.718  3.269  31.371  1.00 36.15 ? 98   GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 101 ? 10.436 2.295  30.424  1.00 38.13 ? 98   GLU A OE2 1 
ATOM   778  N  N   . THR A 1 102 ? 13.273 6.639  29.913  1.00 25.72 ? 99   THR A N   1 
ATOM   779  C  CA  . THR A 1 102 ? 14.445 6.250  29.119  1.00 25.97 ? 99   THR A CA  1 
ATOM   780  C  C   . THR A 1 102 ? 15.657 7.134  29.427  1.00 26.09 ? 99   THR A C   1 
ATOM   781  O  O   . THR A 1 102 ? 16.766 6.629  29.696  1.00 25.77 ? 99   THR A O   1 
ATOM   782  C  CB  . THR A 1 102 ? 14.076 6.307  27.624  1.00 26.17 ? 99   THR A CB  1 
ATOM   783  O  OG1 . THR A 1 102 ? 12.952 5.440  27.418  1.00 28.71 ? 99   THR A OG1 1 
ATOM   784  C  CG2 . THR A 1 102 ? 15.245 5.912  26.705  1.00 26.24 ? 99   THR A CG2 1 
ATOM   785  N  N   . PHE A 1 103 ? 15.442 8.445  29.397  1.00 25.78 ? 100  PHE A N   1 
ATOM   786  C  CA  . PHE A 1 103 ? 16.532 9.414  29.529  1.00 26.17 ? 100  PHE A CA  1 
ATOM   787  C  C   . PHE A 1 103 ? 16.618 10.066 30.886  1.00 27.12 ? 100  PHE A C   1 
ATOM   788  O  O   . PHE A 1 103 ? 17.517 10.860 31.127  1.00 28.00 ? 100  PHE A O   1 
ATOM   789  C  CB  . PHE A 1 103 ? 16.381 10.457 28.432  1.00 25.83 ? 100  PHE A CB  1 
ATOM   790  C  CG  . PHE A 1 103 ? 16.353 9.838  27.084  1.00 25.30 ? 100  PHE A CG  1 
ATOM   791  C  CD1 . PHE A 1 103 ? 17.536 9.372  26.511  1.00 26.00 ? 100  PHE A CD1 1 
ATOM   792  C  CD2 . PHE A 1 103 ? 15.164 9.612  26.428  1.00 25.11 ? 100  PHE A CD2 1 
ATOM   793  C  CE1 . PHE A 1 103 ? 17.529 8.739  25.279  1.00 24.26 ? 100  PHE A CE1 1 
ATOM   794  C  CE2 . PHE A 1 103 ? 15.156 8.967  25.189  1.00 23.55 ? 100  PHE A CE2 1 
ATOM   795  C  CZ  . PHE A 1 103 ? 16.339 8.536  24.625  1.00 23.67 ? 100  PHE A CZ  1 
ATOM   796  N  N   . GLY A 1 104 ? 15.681 9.739  31.773  1.00 27.32 ? 101  GLY A N   1 
ATOM   797  C  CA  . GLY A 1 104 ? 15.646 10.347 33.107  1.00 27.40 ? 101  GLY A CA  1 
ATOM   798  C  C   . GLY A 1 104 ? 14.768 11.588 33.141  1.00 27.25 ? 101  GLY A C   1 
ATOM   799  O  O   . GLY A 1 104 ? 13.954 11.743 34.043  1.00 27.70 ? 101  GLY A O   1 
ATOM   800  N  N   . SER A 1 105 ? 14.937 12.478 32.173  1.00 26.90 ? 102  SER A N   1 
ATOM   801  C  CA  . SER A 1 105 ? 14.105 13.677 32.079  1.00 26.52 ? 102  SER A CA  1 
ATOM   802  C  C   . SER A 1 105 ? 14.097 14.202 30.669  1.00 26.61 ? 102  SER A C   1 
ATOM   803  O  O   . SER A 1 105 ? 14.935 13.810 29.832  1.00 26.36 ? 102  SER A O   1 
ATOM   804  C  CB  . SER A 1 105 ? 14.596 14.770 33.022  1.00 26.58 ? 102  SER A CB  1 
ATOM   805  O  OG  . SER A 1 105 ? 15.900 15.200 32.676  1.00 24.25 ? 102  SER A OG  1 
ATOM   806  N  N   . VAL A 1 106 ? 13.174 15.122 30.405  1.00 26.29 ? 103  VAL A N   1 
ATOM   807  C  CA  . VAL A 1 106 ? 13.069 15.705 29.074  1.00 26.08 ? 103  VAL A CA  1 
ATOM   808  C  C   . VAL A 1 106 ? 14.333 16.481 28.778  1.00 26.32 ? 103  VAL A C   1 
ATOM   809  O  O   . VAL A 1 106 ? 14.938 16.302 27.703  1.00 26.28 ? 103  VAL A O   1 
ATOM   810  C  CB  . VAL A 1 106 ? 11.814 16.597 28.924  1.00 26.34 ? 103  VAL A CB  1 
ATOM   811  C  CG1 . VAL A 1 106 ? 11.841 17.324 27.609  1.00 24.98 ? 103  VAL A CG1 1 
ATOM   812  C  CG2 . VAL A 1 106 ? 10.558 15.742 29.043  1.00 25.66 ? 103  VAL A CG2 1 
ATOM   813  N  N   . GLU A 1 107 ? 14.776 17.306 29.727  1.00 26.12 ? 104  GLU A N   1 
ATOM   814  C  CA  . GLU A 1 107 ? 16.017 18.035 29.527  1.00 26.21 ? 104  GLU A CA  1 
ATOM   815  C  C   . GLU A 1 107 ? 17.190 17.100 29.262  1.00 26.27 ? 104  GLU A C   1 
ATOM   816  O  O   . GLU A 1 107 ? 17.991 17.388 28.379  1.00 24.81 ? 104  GLU A O   1 
ATOM   817  C  CB  . GLU A 1 107 ? 16.307 19.000 30.661  1.00 26.38 ? 104  GLU A CB  1 
ATOM   818  C  CG  . GLU A 1 107 ? 15.479 20.300 30.531  1.00 28.57 ? 104  GLU A CG  1 
ATOM   819  C  CD  . GLU A 1 107 ? 15.759 21.116 29.239  1.00 31.04 ? 104  GLU A CD  1 
ATOM   820  O  OE1 . GLU A 1 107 ? 14.787 21.697 28.678  1.00 33.12 ? 104  GLU A OE1 1 
ATOM   821  O  OE2 . GLU A 1 107 ? 16.934 21.187 28.787  1.00 31.06 ? 104  GLU A OE2 1 
ATOM   822  N  N   . ASN A 1 108 ? 17.271 15.972 29.976  1.00 26.72 ? 105  ASN A N   1 
ATOM   823  C  CA  . ASN A 1 108 ? 18.374 15.005 29.729  1.00 27.06 ? 105  ASN A CA  1 
ATOM   824  C  C   . ASN A 1 108 ? 18.298 14.400 28.356  1.00 26.90 ? 105  ASN A C   1 
ATOM   825  O  O   . ASN A 1 108 ? 19.347 14.149 27.730  1.00 26.95 ? 105  ASN A O   1 
ATOM   826  C  CB  . ASN A 1 108 ? 18.408 13.875 30.748  1.00 27.29 ? 105  ASN A CB  1 
ATOM   827  C  CG  . ASN A 1 108 ? 18.791 14.346 32.131  1.00 28.62 ? 105  ASN A CG  1 
ATOM   828  O  OD1 . ASN A 1 108 ? 19.108 15.519 32.343  1.00 29.15 ? 105  ASN A OD1 1 
ATOM   829  N  ND2 . ASN A 1 108 ? 18.727 13.419 33.110  1.00 31.55 ? 105  ASN A ND2 1 
ATOM   830  N  N   . PHE A 1 109 ? 17.078 14.170 27.869  1.00 26.33 ? 106  PHE A N   1 
ATOM   831  C  CA  . PHE A 1 109 ? 16.917 13.795 26.485  1.00 26.75 ? 106  PHE A CA  1 
ATOM   832  C  C   . PHE A 1 109 ? 17.491 14.833 25.508  1.00 27.32 ? 106  PHE A C   1 
ATOM   833  O  O   . PHE A 1 109 ? 18.134 14.487 24.506  1.00 26.58 ? 106  PHE A O   1 
ATOM   834  C  CB  . PHE A 1 109 ? 15.477 13.503 26.082  1.00 26.68 ? 106  PHE A CB  1 
ATOM   835  C  CG  . PHE A 1 109 ? 15.307 13.490 24.587  1.00 25.54 ? 106  PHE A CG  1 
ATOM   836  C  CD1 . PHE A 1 109 ? 15.910 12.491 23.837  1.00 24.63 ? 106  PHE A CD1 1 
ATOM   837  C  CD2 . PHE A 1 109 ? 14.688 14.533 23.926  1.00 21.40 ? 106  PHE A CD2 1 
ATOM   838  C  CE1 . PHE A 1 109 ? 15.830 12.501 22.440  1.00 24.14 ? 106  PHE A CE1 1 
ATOM   839  C  CE2 . PHE A 1 109 ? 14.577 14.549 22.564  1.00 21.99 ? 106  PHE A CE2 1 
ATOM   840  C  CZ  . PHE A 1 109 ? 15.173 13.527 21.804  1.00 23.85 ? 106  PHE A CZ  1 
ATOM   841  N  N   . LYS A 1 110 ? 17.238 16.101 25.783  1.00 27.32 ? 107  LYS A N   1 
ATOM   842  C  CA  . LYS A 1 110 ? 17.689 17.145 24.889  1.00 27.36 ? 107  LYS A CA  1 
ATOM   843  C  C   . LYS A 1 110 ? 19.196 17.266 24.935  1.00 27.56 ? 107  LYS A C   1 
ATOM   844  O  O   . LYS A 1 110 ? 19.825 17.425 23.894  1.00 28.49 ? 107  LYS A O   1 
ATOM   845  C  CB  . LYS A 1 110 ? 17.055 18.456 25.270  1.00 27.82 ? 107  LYS A CB  1 
ATOM   846  C  CG  . LYS A 1 110 ? 15.541 18.423 25.184  1.00 29.95 ? 107  LYS A CG  1 
ATOM   847  C  CD  . LYS A 1 110 ? 14.967 19.587 25.997  1.00 33.51 ? 107  LYS A CD  1 
ATOM   848  C  CE  . LYS A 1 110 ? 14.093 20.454 25.137  1.00 37.57 ? 107  LYS A CE  1 
ATOM   849  N  NZ  . LYS A 1 110 ? 14.909 21.002 24.044  1.00 37.80 ? 107  LYS A NZ  1 
ATOM   850  N  N   . GLU A 1 111 ? 19.790 17.168 26.118  1.00 27.79 ? 108  GLU A N   1 
ATOM   851  C  CA  . GLU A 1 111 ? 21.254 17.158 26.220  1.00 28.73 ? 108  GLU A CA  1 
ATOM   852  C  C   . GLU A 1 111 ? 21.812 16.015 25.378  1.00 27.33 ? 108  GLU A C   1 
ATOM   853  O  O   . GLU A 1 111 ? 22.579 16.256 24.471  1.00 26.27 ? 108  GLU A O   1 
ATOM   854  C  CB  . GLU A 1 111 ? 21.742 16.983 27.651  1.00 29.72 ? 108  GLU A CB  1 
ATOM   855  C  CG  . GLU A 1 111 ? 22.177 18.253 28.284  1.00 34.39 ? 108  GLU A CG  1 
ATOM   856  C  CD  . GLU A 1 111 ? 22.125 18.181 29.795  1.00 39.52 ? 108  GLU A CD  1 
ATOM   857  O  OE1 . GLU A 1 111 ? 23.116 17.677 30.361  1.00 44.02 ? 108  GLU A OE1 1 
ATOM   858  O  OE2 . GLU A 1 111 ? 21.120 18.631 30.419  1.00 43.62 ? 108  GLU A OE2 1 
ATOM   859  N  N   . GLN A 1 112 ? 21.371 14.793 25.659  1.00 26.83 ? 109  GLN A N   1 
ATOM   860  C  CA  . GLN A 1 112 ? 21.919 13.605 24.997  1.00 27.32 ? 109  GLN A CA  1 
ATOM   861  C  C   . GLN A 1 112 ? 21.731 13.635 23.493  1.00 26.59 ? 109  GLN A C   1 
ATOM   862  O  O   . GLN A 1 112 ? 22.619 13.240 22.675  1.00 25.75 ? 109  GLN A O   1 
ATOM   863  C  CB  . GLN A 1 112 ? 21.283 12.351 25.579  1.00 27.78 ? 109  GLN A CB  1 
ATOM   864  C  CG  . GLN A 1 112 ? 21.615 12.117 27.034  1.00 29.86 ? 109  GLN A CG  1 
ATOM   865  C  CD  . GLN A 1 112 ? 21.091 10.778 27.522  1.00 34.71 ? 109  GLN A CD  1 
ATOM   866  O  OE1 . GLN A 1 112 ? 21.124 9.773  26.800  1.00 37.68 ? 109  GLN A OE1 1 
ATOM   867  N  NE2 . GLN A 1 112 ? 20.615 10.751 28.758  1.00 41.17 ? 109  GLN A NE2 1 
ATOM   868  N  N   . PHE A 1 113 ? 20.557 14.081 23.090  1.00 26.40 ? 110  PHE A N   1 
ATOM   869  C  CA  . PHE A 1 113 ? 20.292 14.221 21.662  1.00 26.01 ? 110  PHE A CA  1 
ATOM   870  C  C   . PHE A 1 113 ? 21.184 15.280 20.995  1.00 26.32 ? 110  PHE A C   1 
ATOM   871  O  O   . PHE A 1 113 ? 21.672 15.085 19.866  1.00 24.83 ? 110  PHE A O   1 
ATOM   872  C  CB  . PHE A 1 113 ? 18.835 14.555 21.414  1.00 26.46 ? 110  PHE A CB  1 
ATOM   873  C  CG  . PHE A 1 113 ? 18.390 14.317 20.013  1.00 26.18 ? 110  PHE A CG  1 
ATOM   874  C  CD1 . PHE A 1 113 ? 18.222 13.025 19.544  1.00 24.86 ? 110  PHE A CD1 1 
ATOM   875  C  CD2 . PHE A 1 113 ? 18.098 15.375 19.179  1.00 22.64 ? 110  PHE A CD2 1 
ATOM   876  C  CE1 . PHE A 1 113 ? 17.798 12.810 18.251  1.00 25.70 ? 110  PHE A CE1 1 
ATOM   877  C  CE2 . PHE A 1 113 ? 17.676 15.167 17.909  1.00 25.33 ? 110  PHE A CE2 1 
ATOM   878  C  CZ  . PHE A 1 113 ? 17.493 13.868 17.432  1.00 25.26 ? 110  PHE A CZ  1 
ATOM   879  N  N   . SER A 1 114 ? 21.411 16.375 21.696  1.00 25.88 ? 111  SER A N   1 
ATOM   880  C  CA  . SER A 1 114 ? 22.295 17.400 21.192  1.00 25.86 ? 111  SER A CA  1 
ATOM   881  C  C   . SER A 1 114 ? 23.722 16.878 21.115  1.00 26.37 ? 111  SER A C   1 
ATOM   882  O  O   . SER A 1 114 ? 24.401 17.120 20.131  1.00 25.03 ? 111  SER A O   1 
ATOM   883  C  CB  . SER A 1 114 ? 22.246 18.685 22.017  1.00 26.44 ? 111  SER A CB  1 
ATOM   884  O  OG  . SER A 1 114 ? 20.928 19.208 22.045  1.00 25.42 ? 111  SER A OG  1 
ATOM   885  N  N   . LYS A 1 115 ? 24.170 16.162 22.139  1.00 26.28 ? 112  LYS A N   1 
ATOM   886  C  CA  . LYS A 1 115 ? 25.508 15.621 22.121  1.00 26.55 ? 112  LYS A CA  1 
ATOM   887  C  C   . LYS A 1 115 ? 25.660 14.703 20.897  1.00 25.65 ? 112  LYS A C   1 
ATOM   888  O  O   . LYS A 1 115 ? 26.671 14.769 20.182  1.00 25.81 ? 112  LYS A O   1 
ATOM   889  C  CB  . LYS A 1 115 ? 25.828 14.878 23.419  1.00 27.37 ? 112  LYS A CB  1 
ATOM   890  C  CG  . LYS A 1 115 ? 27.300 14.645 23.694  1.00 29.12 ? 112  LYS A CG  1 
ATOM   891  C  CD  . LYS A 1 115 ? 27.567 13.968 25.089  1.00 32.59 ? 112  LYS A CD  1 
ATOM   892  C  CE  . LYS A 1 115 ? 28.940 13.222 25.024  1.00 33.27 ? 112  LYS A CE  1 
ATOM   893  N  NZ  . LYS A 1 115 ? 29.553 12.946 26.351  1.00 36.67 ? 112  LYS A NZ  1 
ATOM   894  N  N   . ALA A 1 116 ? 24.656 13.858 20.657  1.00 25.54 ? 113  ALA A N   1 
ATOM   895  C  CA  . ALA A 1 116 ? 24.710 12.872 19.582  1.00 24.74 ? 113  ALA A CA  1 
ATOM   896  C  C   . ALA A 1 116 ? 24.803 13.596 18.239  1.00 24.22 ? 113  ALA A C   1 
ATOM   897  O  O   . ALA A 1 116 ? 25.579 13.211 17.366  1.00 22.82 ? 113  ALA A O   1 
ATOM   898  C  CB  . ALA A 1 116 ? 23.469 11.954 19.595  1.00 24.58 ? 113  ALA A CB  1 
ATOM   899  N  N   . ALA A 1 117 ? 23.963 14.614 18.085  1.00 23.95 ? 114  ALA A N   1 
ATOM   900  C  CA  . ALA A 1 117 ? 23.904 15.381 16.842  1.00 23.40 ? 114  ALA A CA  1 
ATOM   901  C  C   . ALA A 1 117 ? 25.239 16.026 16.578  1.00 23.68 ? 114  ALA A C   1 
ATOM   902  O  O   . ALA A 1 117 ? 25.701 16.041 15.414  1.00 22.90 ? 114  ALA A O   1 
ATOM   903  C  CB  . ALA A 1 117 ? 22.811 16.449 16.902  1.00 23.89 ? 114  ALA A CB  1 
ATOM   904  N  N   . ILE A 1 118 ? 25.831 16.610 17.639  1.00 22.64 ? 115  ILE A N   1 
ATOM   905  C  CA  . ILE A 1 118 ? 27.094 17.354 17.495  1.00 23.16 ? 115  ILE A CA  1 
ATOM   906  C  C   . ILE A 1 118 ? 28.274 16.387 17.202  1.00 22.60 ? 115  ILE A C   1 
ATOM   907  O  O   . ILE A 1 118 ? 29.168 16.679 16.440  1.00 21.03 ? 115  ILE A O   1 
ATOM   908  C  CB  . ILE A 1 118 ? 27.365 18.191 18.783  1.00 23.58 ? 115  ILE A CB  1 
ATOM   909  C  CG1 . ILE A 1 118 ? 26.356 19.331 18.892  1.00 23.34 ? 115  ILE A CG1 1 
ATOM   910  C  CG2 . ILE A 1 118 ? 28.840 18.734 18.875  1.00 23.74 ? 115  ILE A CG2 1 
ATOM   911  C  CD1 . ILE A 1 118 ? 26.320 19.979 20.303  1.00 23.62 ? 115  ILE A CD1 1 
ATOM   912  N  N   . ALA A 1 119 ? 28.234 15.204 17.805  1.00 22.39 ? 116  ALA A N   1 
ATOM   913  C  CA  . ALA A 1 119 ? 29.326 14.249 17.739  1.00 21.48 ? 116  ALA A CA  1 
ATOM   914  C  C   . ALA A 1 119 ? 29.344 13.482 16.402  1.00 22.60 ? 116  ALA A C   1 
ATOM   915  O  O   . ALA A 1 119 ? 30.326 12.827 16.113  1.00 23.00 ? 116  ALA A O   1 
ATOM   916  C  CB  . ALA A 1 119 ? 29.255 13.233 18.914  1.00 20.03 ? 116  ALA A CB  1 
ATOM   917  N  N   . THR A 1 120 ? 28.265 13.531 15.619  1.00 21.98 ? 117  THR A N   1 
ATOM   918  C  CA  . THR A 1 120 ? 28.175 12.815 14.348  1.00 22.34 ? 117  THR A CA  1 
ATOM   919  C  C   . THR A 1 120 ? 29.239 13.339 13.391  1.00 21.82 ? 117  THR A C   1 
ATOM   920  O  O   . THR A 1 120 ? 29.257 14.510 13.067  1.00 20.80 ? 117  THR A O   1 
ATOM   921  C  CB  . THR A 1 120 ? 26.755 12.950 13.720  1.00 21.92 ? 117  THR A CB  1 
ATOM   922  O  OG1 . THR A 1 120 ? 25.805 12.297 14.565  1.00 23.08 ? 117  THR A OG1 1 
ATOM   923  C  CG2 . THR A 1 120 ? 26.674 12.337 12.328  1.00 22.79 ? 117  THR A CG2 1 
ATOM   924  N  N   . PHE A 1 121 ? 30.124 12.463 12.947  1.00 21.40 ? 118  PHE A N   1 
ATOM   925  C  CA  . PHE A 1 121 ? 31.208 12.924 12.183  1.00 21.33 ? 118  PHE A CA  1 
ATOM   926  C  C   . PHE A 1 121 ? 30.855 12.863 10.703  1.00 21.67 ? 118  PHE A C   1 
ATOM   927  O  O   . PHE A 1 121 ? 30.280 11.872 10.222  1.00 19.77 ? 118  PHE A O   1 
ATOM   928  C  CB  . PHE A 1 121 ? 32.443 12.086 12.475  1.00 21.87 ? 118  PHE A CB  1 
ATOM   929  C  CG  . PHE A 1 121 ? 33.674 12.605 11.826  1.00 20.43 ? 118  PHE A CG  1 
ATOM   930  C  CD1 . PHE A 1 121 ? 34.270 13.750 12.325  1.00 18.42 ? 118  PHE A CD1 1 
ATOM   931  C  CD2 . PHE A 1 121 ? 34.236 11.966 10.713  1.00 20.43 ? 118  PHE A CD2 1 
ATOM   932  C  CE1 . PHE A 1 121 ? 35.428 14.252 11.791  1.00 19.47 ? 118  PHE A CE1 1 
ATOM   933  C  CE2 . PHE A 1 121 ? 35.411 12.455 10.150  1.00 20.82 ? 118  PHE A CE2 1 
ATOM   934  C  CZ  . PHE A 1 121 ? 36.010 13.638 10.677  1.00 21.52 ? 118  PHE A CZ  1 
ATOM   935  N  N   . GLY A 1 122 ? 31.233 13.899 9.977   1.00 20.64 ? 119  GLY A N   1 
ATOM   936  C  CA  . GLY A 1 122 ? 30.876 13.978 8.564   1.00 20.29 ? 119  GLY A CA  1 
ATOM   937  C  C   . GLY A 1 122 ? 29.417 14.351 8.438   1.00 20.62 ? 119  GLY A C   1 
ATOM   938  O  O   . GLY A 1 122 ? 28.831 14.987 9.357   1.00 19.58 ? 119  GLY A O   1 
ATOM   939  N  N   . SER A 1 123 ? 28.829 13.966 7.305   1.00 19.40 ? 120  SER A N   1 
ATOM   940  C  CA  . SER A 1 123 ? 27.439 14.255 7.016   1.00 20.44 ? 120  SER A CA  1 
ATOM   941  C  C   . SER A 1 123 ? 26.557 13.167 7.608   1.00 20.04 ? 120  SER A C   1 
ATOM   942  O  O   . SER A 1 123 ? 26.908 11.984 7.596   1.00 20.61 ? 120  SER A O   1 
ATOM   943  C  CB  . SER A 1 123 ? 27.184 14.287 5.477   1.00 19.39 ? 120  SER A CB  1 
ATOM   944  O  OG  . SER A 1 123 ? 28.061 15.165 4.780   1.00 20.47 ? 120  SER A OG  1 
ATOM   945  N  N   . GLY A 1 124 ? 25.372 13.558 8.056   1.00 20.72 ? 121  GLY A N   1 
ATOM   946  C  CA  . GLY A 1 124 ? 24.466 12.567 8.600   1.00 21.65 ? 121  GLY A CA  1 
ATOM   947  C  C   . GLY A 1 124 ? 23.295 13.171 9.346   1.00 21.28 ? 121  GLY A C   1 
ATOM   948  O  O   . GLY A 1 124 ? 22.926 14.322 9.118   1.00 20.57 ? 121  GLY A O   1 
ATOM   949  N  N   . TRP A 1 125 ? 22.747 12.360 10.258  1.00 21.66 ? 122  TRP A N   1 
ATOM   950  C  CA  . TRP A 1 125 ? 21.475 12.625 10.937  1.00 21.93 ? 122  TRP A CA  1 
ATOM   951  C  C   . TRP A 1 125 ? 21.472 12.070 12.345  1.00 22.58 ? 122  TRP A C   1 
ATOM   952  O  O   . TRP A 1 125 ? 22.000 10.996 12.606  1.00 23.96 ? 122  TRP A O   1 
ATOM   953  C  CB  . TRP A 1 125 ? 20.322 11.913 10.203  1.00 23.07 ? 122  TRP A CB  1 
ATOM   954  C  CG  . TRP A 1 125 ? 20.199 12.239 8.751   1.00 21.26 ? 122  TRP A CG  1 
ATOM   955  C  CD1 . TRP A 1 125 ? 20.920 11.689 7.694   1.00 22.10 ? 122  TRP A CD1 1 
ATOM   956  C  CD2 . TRP A 1 125 ? 19.325 13.208 8.181   1.00 22.57 ? 122  TRP A CD2 1 
ATOM   957  N  NE1 . TRP A 1 125 ? 20.514 12.275 6.520   1.00 22.12 ? 122  TRP A NE1 1 
ATOM   958  C  CE2 . TRP A 1 125 ? 19.536 13.205 6.798   1.00 22.03 ? 122  TRP A CE2 1 
ATOM   959  C  CE3 . TRP A 1 125 ? 18.327 14.056 8.719   1.00 23.41 ? 122  TRP A CE3 1 
ATOM   960  C  CZ2 . TRP A 1 125 ? 18.839 14.070 5.941   1.00 24.45 ? 122  TRP A CZ2 1 
ATOM   961  C  CZ3 . TRP A 1 125 ? 17.651 14.896 7.880   1.00 25.18 ? 122  TRP A CZ3 1 
ATOM   962  C  CH2 . TRP A 1 125 ? 17.911 14.901 6.492   1.00 24.30 ? 122  TRP A CH2 1 
ATOM   963  N  N   . ALA A 1 126 ? 20.805 12.776 13.253  1.00 23.10 ? 123  ALA A N   1 
ATOM   964  C  CA  . ALA A 1 126 ? 20.575 12.301 14.597  1.00 23.48 ? 123  ALA A CA  1 
ATOM   965  C  C   . ALA A 1 126 ? 19.090 11.955 14.675  1.00 23.96 ? 123  ALA A C   1 
ATOM   966  O  O   . ALA A 1 126 ? 18.267 12.728 14.192  1.00 22.26 ? 123  ALA A O   1 
ATOM   967  C  CB  . ALA A 1 126 ? 20.895 13.369 15.591  1.00 24.27 ? 123  ALA A CB  1 
ATOM   968  N  N   . TRP A 1 127 ? 18.762 10.840 15.314  1.00 23.87 ? 124  TRP A N   1 
ATOM   969  C  CA  . TRP A 1 127 ? 17.375 10.367 15.373  1.00 23.50 ? 124  TRP A CA  1 
ATOM   970  C  C   . TRP A 1 127 ? 16.953 9.991  16.803  1.00 24.17 ? 124  TRP A C   1 
ATOM   971  O  O   . TRP A 1 127 ? 17.739 9.403  17.564  1.00 24.45 ? 124  TRP A O   1 
ATOM   972  C  CB  . TRP A 1 127 ? 17.159 9.111  14.504  1.00 23.46 ? 124  TRP A CB  1 
ATOM   973  C  CG  . TRP A 1 127 ? 17.506 9.225  13.095  1.00 21.62 ? 124  TRP A CG  1 
ATOM   974  C  CD1 . TRP A 1 127 ? 18.758 9.022  12.540  1.00 21.92 ? 124  TRP A CD1 1 
ATOM   975  C  CD2 . TRP A 1 127 ? 16.643 9.509  12.009  1.00 22.52 ? 124  TRP A CD2 1 
ATOM   976  N  NE1 . TRP A 1 127 ? 18.701 9.174  11.195  1.00 21.79 ? 124  TRP A NE1 1 
ATOM   977  C  CE2 . TRP A 1 127 ? 17.418 9.468  10.835  1.00 22.14 ? 124  TRP A CE2 1 
ATOM   978  C  CE3 . TRP A 1 127 ? 15.278 9.777  11.892  1.00 26.47 ? 124  TRP A CE3 1 
ATOM   979  C  CZ2 . TRP A 1 127 ? 16.886 9.736  9.584   1.00 22.81 ? 124  TRP A CZ2 1 
ATOM   980  C  CZ3 . TRP A 1 127 ? 14.750 10.031 10.639  1.00 24.92 ? 124  TRP A CZ3 1 
ATOM   981  C  CH2 . TRP A 1 127 ? 15.555 9.979  9.493   1.00 25.73 ? 124  TRP A CH2 1 
ATOM   982  N  N   . LEU A 1 128 ? 15.710 10.361 17.162  1.00 23.42 ? 125  LEU A N   1 
ATOM   983  C  CA  . LEU A 1 128 ? 14.962 9.632  18.152  1.00 22.86 ? 125  LEU A CA  1 
ATOM   984  C  C   . LEU A 1 128 ? 14.008 8.658  17.449  1.00 22.98 ? 125  LEU A C   1 
ATOM   985  O  O   . LEU A 1 128 ? 13.269 9.042  16.529  1.00 21.52 ? 125  LEU A O   1 
ATOM   986  C  CB  . LEU A 1 128 ? 14.142 10.598 19.012  1.00 23.43 ? 125  LEU A CB  1 
ATOM   987  C  CG  . LEU A 1 128 ? 13.315 9.963  20.113  1.00 22.55 ? 125  LEU A CG  1 
ATOM   988  C  CD1 . LEU A 1 128 ? 14.203 9.507  21.268  1.00 23.49 ? 125  LEU A CD1 1 
ATOM   989  C  CD2 . LEU A 1 128 ? 12.310 11.033 20.585  1.00 22.55 ? 125  LEU A CD2 1 
ATOM   990  N  N   . VAL A 1 129 ? 14.042 7.397  17.895  1.00 24.75 ? 126  VAL A N   1 
ATOM   991  C  CA  . VAL A 1 129 ? 13.310 6.320  17.257  1.00 25.29 ? 126  VAL A CA  1 
ATOM   992  C  C   . VAL A 1 129 ? 12.645 5.470  18.326  1.00 25.66 ? 126  VAL A C   1 
ATOM   993  O  O   . VAL A 1 129 ? 12.986 5.560  19.494  1.00 25.84 ? 126  VAL A O   1 
ATOM   994  C  CB  . VAL A 1 129 ? 14.250 5.363  16.427  1.00 26.27 ? 126  VAL A CB  1 
ATOM   995  C  CG1 . VAL A 1 129 ? 14.930 6.096  15.242  1.00 23.89 ? 126  VAL A CG1 1 
ATOM   996  C  CG2 . VAL A 1 129 ? 15.262 4.638  17.367  1.00 26.29 ? 126  VAL A CG2 1 
ATOM   997  N  N   . LYS A 1 130 ? 11.701 4.648  17.902  1.00 26.61 ? 127  LYS A N   1 
ATOM   998  C  CA  . LYS A 1 130 ? 11.087 3.670  18.774  1.00 27.85 ? 127  LYS A CA  1 
ATOM   999  C  C   . LYS A 1 130 ? 11.618 2.338  18.320  1.00 28.58 ? 127  LYS A C   1 
ATOM   1000 O  O   . LYS A 1 130 ? 11.578 2.058  17.129  1.00 28.44 ? 127  LYS A O   1 
ATOM   1001 C  CB  . LYS A 1 130 ? 9.547  3.760  18.693  1.00 28.39 ? 127  LYS A CB  1 
ATOM   1002 C  CG  . LYS A 1 130 ? 8.892  3.465  19.968  1.00 29.43 ? 127  LYS A CG  1 
ATOM   1003 C  CD  . LYS A 1 130 ? 7.366  3.703  19.918  1.00 32.21 ? 127  LYS A CD  1 
ATOM   1004 C  CE  . LYS A 1 130 ? 6.778  3.532  21.317  1.00 33.52 ? 127  LYS A CE  1 
ATOM   1005 N  NZ  . LYS A 1 130 ? 5.256  3.546  21.401  1.00 35.40 ? 127  LYS A NZ  1 
ATOM   1006 N  N   . ASN A 1 131 ? 12.205 1.572  19.253  1.00 29.85 ? 128  ASN A N   1 
ATOM   1007 C  CA  . ASN A 1 131 ? 12.820 0.238  18.922  1.00 31.15 ? 128  ASN A CA  1 
ATOM   1008 C  C   . ASN A 1 131 ? 11.837 -0.886 19.261  1.00 30.77 ? 128  ASN A C   1 
ATOM   1009 O  O   . ASN A 1 131 ? 10.730 -0.636 19.772  1.00 31.67 ? 128  ASN A O   1 
ATOM   1010 C  CB  . ASN A 1 131 ? 14.182 -0.029 19.599  1.00 30.22 ? 128  ASN A CB  1 
ATOM   1011 C  CG  . ASN A 1 131 ? 14.080 -0.225 21.117  1.00 32.92 ? 128  ASN A CG  1 
ATOM   1012 O  OD1 . ASN A 1 131 ? 13.072 -0.708 21.671  1.00 37.49 ? 128  ASN A OD1 1 
ATOM   1013 N  ND2 . ASN A 1 131 ? 15.124 0.197  21.815  1.00 37.16 ? 128  ASN A ND2 1 
ATOM   1014 N  N   . THR A 1 132 ? 12.246 -2.112 18.954  1.00 32.54 ? 129  THR A N   1 
ATOM   1015 C  CA  . THR A 1 132 ? 11.384 -3.313 18.989  1.00 32.73 ? 129  THR A CA  1 
ATOM   1016 C  C   . THR A 1 132 ? 10.912 -3.681 20.413  1.00 34.11 ? 129  THR A C   1 
ATOM   1017 O  O   . THR A 1 132 ? 9.949  -4.385 20.576  1.00 34.04 ? 129  THR A O   1 
ATOM   1018 C  CB  . THR A 1 132 ? 12.151 -4.540 18.402  1.00 32.56 ? 129  THR A CB  1 
ATOM   1019 O  OG1 . THR A 1 132 ? 12.666 -4.258 17.076  1.00 32.90 ? 129  THR A OG1 1 
ATOM   1020 C  CG2 . THR A 1 132 ? 11.261 -5.780 18.374  1.00 33.49 ? 129  THR A CG2 1 
ATOM   1021 N  N   . GLU A 1 133 ? 11.616 -3.232 21.445  1.00 35.78 ? 130  GLU A N   1 
ATOM   1022 C  CA  . GLU A 1 133 ? 11.191 -3.442 22.844  1.00 37.12 ? 130  GLU A CA  1 
ATOM   1023 C  C   . GLU A 1 133 ? 10.203 -2.358 23.301  1.00 37.46 ? 130  GLU A C   1 
ATOM   1024 O  O   . GLU A 1 133 ? 9.809  -2.302 24.483  1.00 39.04 ? 130  GLU A O   1 
ATOM   1025 C  CB  . GLU A 1 133 ? 12.421 -3.442 23.767  1.00 37.42 ? 130  GLU A CB  1 
ATOM   1026 C  CG  . GLU A 1 133 ? 12.207 -4.082 25.121  1.00 38.14 ? 130  GLU A CG  1 
ATOM   1027 C  CD  . GLU A 1 133 ? 12.705 -5.538 25.229  1.00 37.38 ? 130  GLU A CD  1 
ATOM   1028 O  OE1 . GLU A 1 133 ? 13.315 -6.109 24.282  1.00 33.36 ? 130  GLU A OE1 1 
ATOM   1029 O  OE2 . GLU A 1 133 ? 12.465 -6.102 26.315  1.00 39.86 ? 130  GLU A OE2 1 
ATOM   1030 N  N   . GLY A 1 134 ? 9.799  -1.496 22.371  1.00 37.40 ? 131  GLY A N   1 
ATOM   1031 C  CA  . GLY A 1 134 ? 8.809  -0.463 22.646  1.00 36.74 ? 131  GLY A CA  1 
ATOM   1032 C  C   . GLY A 1 134 ? 9.429  0.716  23.333  1.00 36.66 ? 131  GLY A C   1 
ATOM   1033 O  O   . GLY A 1 134 ? 8.721  1.536  23.914  1.00 36.80 ? 131  GLY A O   1 
ATOM   1034 N  N   . LYS A 1 135 ? 10.756 0.831  23.245  1.00 35.54 ? 132  LYS A N   1 
ATOM   1035 C  CA  . LYS A 1 135 ? 11.461 1.817  24.035  1.00 34.50 ? 132  LYS A CA  1 
ATOM   1036 C  C   . LYS A 1 135 ? 12.036 2.899  23.100  1.00 32.32 ? 132  LYS A C   1 
ATOM   1037 O  O   . LYS A 1 135 ? 12.160 2.716  21.882  1.00 31.39 ? 132  LYS A O   1 
ATOM   1038 C  CB  . LYS A 1 135 ? 12.570 1.144  24.872  1.00 34.93 ? 132  LYS A CB  1 
ATOM   1039 C  CG  . LYS A 1 135 ? 12.080 0.063  25.902  1.00 36.28 ? 132  LYS A CG  1 
ATOM   1040 C  CD  . LYS A 1 135 ? 11.962 0.563  27.347  1.00 36.06 ? 132  LYS A CD  1 
ATOM   1041 C  CE  . LYS A 1 135 ? 10.537 0.944  27.720  1.00 36.31 ? 132  LYS A CE  1 
ATOM   1042 N  NZ  . LYS A 1 135 ? 10.084 0.291  28.993  1.00 36.96 ? 132  LYS A NZ  1 
ATOM   1043 N  N   . LEU A 1 136 ? 12.351 4.031  23.704  1.00 30.49 ? 133  LEU A N   1 
ATOM   1044 C  CA  . LEU A 1 136 ? 12.945 5.110  22.981  1.00 28.76 ? 133  LEU A CA  1 
ATOM   1045 C  C   . LEU A 1 136 ? 14.464 4.885  22.895  1.00 28.29 ? 133  LEU A C   1 
ATOM   1046 O  O   . LEU A 1 136 ? 15.077 4.269  23.775  1.00 27.47 ? 133  LEU A O   1 
ATOM   1047 C  CB  . LEU A 1 136 ? 12.594 6.427  23.628  1.00 28.82 ? 133  LEU A CB  1 
ATOM   1048 C  CG  . LEU A 1 136 ? 11.100 6.755  23.527  1.00 29.03 ? 133  LEU A CG  1 
ATOM   1049 C  CD1 . LEU A 1 136 ? 10.797 8.151  24.045  1.00 27.21 ? 133  LEU A CD1 1 
ATOM   1050 C  CD2 . LEU A 1 136 ? 10.600 6.578  22.071  1.00 27.78 ? 133  LEU A CD2 1 
ATOM   1051 N  N   . GLU A 1 137 ? 15.045 5.400  21.814  1.00 26.95 ? 134  GLU A N   1 
ATOM   1052 C  CA  . GLU A 1 137 ? 16.441 5.194  21.508  1.00 26.75 ? 134  GLU A CA  1 
ATOM   1053 C  C   . GLU A 1 137 ? 16.970 6.376  20.677  1.00 25.02 ? 134  GLU A C   1 
ATOM   1054 O  O   . GLU A 1 137 ? 16.291 6.817  19.746  1.00 24.73 ? 134  GLU A O   1 
ATOM   1055 C  CB  . GLU A 1 137 ? 16.533 3.910  20.691  1.00 27.35 ? 134  GLU A CB  1 
ATOM   1056 C  CG  . GLU A 1 137 ? 17.819 3.191  20.680  1.00 30.35 ? 134  GLU A CG  1 
ATOM   1057 C  CD  . GLU A 1 137 ? 17.653 1.880  19.907  1.00 30.94 ? 134  GLU A CD  1 
ATOM   1058 O  OE1 . GLU A 1 137 ? 17.700 1.898  18.671  1.00 31.57 ? 134  GLU A OE1 1 
ATOM   1059 O  OE2 . GLU A 1 137 ? 17.352 0.852  20.530  1.00 33.47 ? 134  GLU A OE2 1 
ATOM   1060 N  N   . ILE A 1 138 ? 18.150 6.887  21.034  1.00 23.85 ? 135  ILE A N   1 
ATOM   1061 C  CA  . ILE A 1 138 ? 18.860 7.833  20.166  1.00 23.36 ? 135  ILE A CA  1 
ATOM   1062 C  C   . ILE A 1 138 ? 19.826 6.996  19.286  1.00 23.31 ? 135  ILE A C   1 
ATOM   1063 O  O   . ILE A 1 138 ? 20.598 6.171  19.819  1.00 22.66 ? 135  ILE A O   1 
ATOM   1064 C  CB  . ILE A 1 138 ? 19.669 8.865  20.945  1.00 23.93 ? 135  ILE A CB  1 
ATOM   1065 C  CG1 . ILE A 1 138 ? 18.759 9.752  21.802  1.00 22.25 ? 135  ILE A CG1 1 
ATOM   1066 C  CG2 . ILE A 1 138 ? 20.498 9.735  19.984  1.00 23.20 ? 135  ILE A CG2 1 
ATOM   1067 C  CD1 . ILE A 1 138 ? 19.482 10.674 22.720  1.00 23.31 ? 135  ILE A CD1 1 
ATOM   1068 N  N   . VAL A 1 139 ? 19.734 7.191  17.977  1.00 22.52 ? 136  VAL A N   1 
ATOM   1069 C  CA  . VAL A 1 139 ? 20.706 6.616  17.018  1.00 23.98 ? 136  VAL A CA  1 
ATOM   1070 C  C   . VAL A 1 139 ? 21.122 7.700  16.031  1.00 23.67 ? 136  VAL A C   1 
ATOM   1071 O  O   . VAL A 1 139 ? 20.400 8.657  15.772  1.00 23.80 ? 136  VAL A O   1 
ATOM   1072 C  CB  . VAL A 1 139 ? 20.134 5.398  16.245  1.00 24.30 ? 136  VAL A CB  1 
ATOM   1073 C  CG1 . VAL A 1 139 ? 19.578 4.348  17.210  1.00 25.74 ? 136  VAL A CG1 1 
ATOM   1074 C  CG2 . VAL A 1 139 ? 19.037 5.804  15.316  1.00 27.12 ? 136  VAL A CG2 1 
ATOM   1075 N  N   . THR A 1 140 ? 22.318 7.582  15.491  1.00 23.70 ? 137  THR A N   1 
ATOM   1076 C  CA  . THR A 1 140 ? 22.739 8.506  14.464  1.00 23.65 ? 137  THR A CA  1 
ATOM   1077 C  C   . THR A 1 140 ? 23.009 7.737  13.191  1.00 22.74 ? 137  THR A C   1 
ATOM   1078 O  O   . THR A 1 140 ? 23.358 6.552  13.250  1.00 22.96 ? 137  THR A O   1 
ATOM   1079 C  CB  . THR A 1 140 ? 24.009 9.272  14.859  1.00 24.28 ? 137  THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 140 ? 25.092 8.365  14.989  1.00 23.55 ? 137  THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 140 ? 23.819 10.003 16.148  1.00 24.00 ? 137  THR A CG2 1 
ATOM   1082 N  N   . THR A 1 141 ? 22.895 8.395  12.062  1.00 21.90 ? 138  THR A N   1 
ATOM   1083 C  CA  . THR A 1 141 ? 23.194 7.785  10.797  1.00 23.33 ? 138  THR A CA  1 
ATOM   1084 C  C   . THR A 1 141 ? 24.138 8.624  9.959   1.00 24.11 ? 138  THR A C   1 
ATOM   1085 O  O   . THR A 1 141 ? 24.178 9.814  10.076  1.00 23.76 ? 138  THR A O   1 
ATOM   1086 C  CB  . THR A 1 141 ? 21.963 7.490  9.964   1.00 23.16 ? 138  THR A CB  1 
ATOM   1087 O  OG1 . THR A 1 141 ? 21.338 8.704  9.588   1.00 24.74 ? 138  THR A OG1 1 
ATOM   1088 C  CG2 . THR A 1 141 ? 21.019 6.599  10.699  1.00 22.73 ? 138  THR A CG2 1 
ATOM   1089 N  N   . SER A 1 142 ? 24.883 7.943  9.106   1.00 23.38 ? 139  SER A N   1 
ATOM   1090 C  CA  . SER A 1 142 ? 25.823 8.565  8.220   1.00 23.27 ? 139  SER A CA  1 
ATOM   1091 C  C   . SER A 1 142 ? 25.219 8.755  6.854   1.00 22.58 ? 139  SER A C   1 
ATOM   1092 O  O   . SER A 1 142 ? 24.567 7.891  6.328   1.00 21.72 ? 139  SER A O   1 
ATOM   1093 C  CB  . SER A 1 142 ? 27.094 7.728  8.138   1.00 23.14 ? 139  SER A CB  1 
ATOM   1094 O  OG  . SER A 1 142 ? 27.883 8.176  7.091   1.00 24.37 ? 139  SER A OG  1 
ATOM   1095 N  N   . ASN A 1 143 ? 25.442 9.916  6.295   1.00 20.65 ? 140  ASN A N   1 
ATOM   1096 C  CA  . ASN A 1 143 ? 25.066 10.217 4.949   1.00 20.82 ? 140  ASN A CA  1 
ATOM   1097 C  C   . ASN A 1 143 ? 23.573 10.068 4.702   1.00 20.80 ? 140  ASN A C   1 
ATOM   1098 O  O   . ASN A 1 143 ? 22.828 10.872 5.163   1.00 21.32 ? 140  ASN A O   1 
ATOM   1099 C  CB  . ASN A 1 143 ? 25.934 9.437  3.962   1.00 21.56 ? 140  ASN A CB  1 
ATOM   1100 C  CG  . ASN A 1 143 ? 27.386 9.899  3.977   1.00 21.07 ? 140  ASN A CG  1 
ATOM   1101 O  OD1 . ASN A 1 143 ? 27.683 10.980 4.394   1.00 20.81 ? 140  ASN A OD1 1 
ATOM   1102 N  ND2 . ASN A 1 143 ? 28.265 9.067  3.528   1.00 18.46 ? 140  ASN A ND2 1 
ATOM   1103 N  N   . ALA A 1 144 ? 23.149 9.042  3.993   1.00 19.26 ? 141  ALA A N   1 
ATOM   1104 C  CA  . ALA A 1 144 ? 21.723 8.843  3.755   1.00 19.89 ? 141  ALA A CA  1 
ATOM   1105 C  C   . ALA A 1 144 ? 21.035 7.852  4.664   1.00 20.26 ? 141  ALA A C   1 
ATOM   1106 O  O   . ALA A 1 144 ? 19.891 7.571  4.485   1.00 20.20 ? 141  ALA A O   1 
ATOM   1107 C  CB  . ALA A 1 144 ? 21.464 8.495  2.351   1.00 18.21 ? 141  ALA A CB  1 
ATOM   1108 N  N   . GLY A 1 145 ? 21.741 7.359  5.650   1.00 20.33 ? 142  GLY A N   1 
ATOM   1109 C  CA  . GLY A 1 145 ? 21.265 6.259  6.488   1.00 20.91 ? 142  GLY A CA  1 
ATOM   1110 C  C   . GLY A 1 145 ? 19.958 6.633  7.157   1.00 20.85 ? 142  GLY A C   1 
ATOM   1111 O  O   . GLY A 1 145 ? 19.806 7.770  7.600   1.00 20.10 ? 142  GLY A O   1 
ATOM   1112 N  N   . CYS A 1 146 ? 19.042 5.659  7.185   1.00 21.58 ? 143  CYS A N   1 
ATOM   1113 C  CA  . CYS A 1 146 ? 17.713 5.821  7.683   1.00 21.31 ? 143  CYS A CA  1 
ATOM   1114 C  C   . CYS A 1 146 ? 17.336 4.637  8.586   1.00 22.15 ? 143  CYS A C   1 
ATOM   1115 O  O   . CYS A 1 146 ? 17.578 3.482  8.194   1.00 20.78 ? 143  CYS A O   1 
ATOM   1116 C  CB  . CYS A 1 146 ? 16.763 5.819  6.508   1.00 22.19 ? 143  CYS A CB  1 
ATOM   1117 S  SG  . CYS A 1 146 ? 15.073 6.176  7.005   1.00 22.03 ? 143  CYS A SG  1 
ATOM   1118 N  N   . PRO A 1 147 ? 16.750 4.905  9.782   1.00 22.19 ? 144  PRO A N   1 
ATOM   1119 C  CA  . PRO A 1 147 ? 16.263 3.891  10.740  1.00 23.61 ? 144  PRO A CA  1 
ATOM   1120 C  C   . PRO A 1 147 ? 15.254 2.886  10.179  1.00 24.32 ? 144  PRO A C   1 
ATOM   1121 O  O   . PRO A 1 147 ? 15.130 1.776  10.706  1.00 26.05 ? 144  PRO A O   1 
ATOM   1122 C  CB  . PRO A 1 147 ? 15.587 4.725  11.821  1.00 23.74 ? 144  PRO A CB  1 
ATOM   1123 C  CG  . PRO A 1 147 ? 16.277 6.031  11.775  1.00 24.23 ? 144  PRO A CG  1 
ATOM   1124 C  CD  . PRO A 1 147 ? 16.708 6.248  10.369  1.00 23.16 ? 144  PRO A CD  1 
ATOM   1125 N  N   . LEU A 1 148 ? 14.555 3.253  9.111   1.00 24.28 ? 145  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 148 ? 13.619 2.347  8.472   1.00 23.95 ? 145  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 148 ? 14.317 1.089  8.044   1.00 25.27 ? 145  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 148 ? 13.724 0.022  8.118   1.00 25.25 ? 145  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 148 ? 12.995 2.993  7.239   1.00 23.94 ? 145  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 148 ? 12.015 4.161  7.411   1.00 23.14 ? 145  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 148 ? 11.278 4.324  6.101   1.00 24.90 ? 145  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 148 ? 11.043 3.928  8.551   1.00 26.15 ? 145  LEU A CD2 1 
ATOM   1133 N  N   . THR A 1 149 ? 15.575 1.193  7.614   1.00 24.94 ? 146  THR A N   1 
ATOM   1134 C  CA  . THR A 1 149 ? 16.307 0.009  7.190   1.00 25.61 ? 146  THR A CA  1 
ATOM   1135 C  C   . THR A 1 149 ? 16.670 -0.924 8.344   1.00 26.72 ? 146  THR A C   1 
ATOM   1136 O  O   . THR A 1 149 ? 17.102 -2.045 8.105   1.00 27.35 ? 146  THR A O   1 
ATOM   1137 C  CB  . THR A 1 149 ? 17.564 0.361  6.429   1.00 25.52 ? 146  THR A CB  1 
ATOM   1138 O  OG1 . THR A 1 149 ? 18.497 0.995  7.319   1.00 22.60 ? 146  THR A OG1 1 
ATOM   1139 C  CG2 . THR A 1 149 ? 17.206 1.260  5.276   1.00 25.53 ? 146  THR A CG2 1 
ATOM   1140 N  N   . GLU A 1 150 ? 16.491 -0.481 9.584   1.00 27.80 ? 147  GLU A N   1 
ATOM   1141 C  CA  . GLU A 1 150 ? 16.624 -1.344 10.768  1.00 28.83 ? 147  GLU A CA  1 
ATOM   1142 C  C   . GLU A 1 150 ? 15.243 -1.609 11.343  1.00 28.60 ? 147  GLU A C   1 
ATOM   1143 O  O   . GLU A 1 150 ? 15.121 -1.963 12.502  1.00 26.96 ? 147  GLU A O   1 
ATOM   1144 C  CB  . GLU A 1 150 ? 17.389 -0.677 11.903  1.00 29.67 ? 147  GLU A CB  1 
ATOM   1145 C  CG  . GLU A 1 150 ? 18.458 0.285  11.494  1.00 35.12 ? 147  GLU A CG  1 
ATOM   1146 C  CD  . GLU A 1 150 ? 19.536 -0.415 10.866  1.00 39.39 ? 147  GLU A CD  1 
ATOM   1147 O  OE1 . GLU A 1 150 ? 20.429 -0.839 11.624  1.00 45.63 ? 147  GLU A OE1 1 
ATOM   1148 O  OE2 . GLU A 1 150 ? 19.477 -0.568 9.623   1.00 45.27 ? 147  GLU A OE2 1 
ATOM   1149 N  N   . ASN A 1 151 ? 14.214 -1.382 10.555  1.00 29.68 ? 148  ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 151 ? 12.863 -1.488 11.086  1.00 30.52 ? 148  ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 151 ? 12.681 -0.737 12.390  1.00 30.22 ? 148  ASN A C   1 
ATOM   1152 O  O   . ASN A 1 151 ? 12.010 -1.213 13.302  1.00 30.00 ? 148  ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 151 ? 12.507 -2.975 11.259  1.00 30.72 ? 148  ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 151 ? 11.651 -3.461 10.168  1.00 31.85 ? 148  ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 151 ? 12.128 -3.780 9.084   1.00 35.02 ? 148  ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 151 ? 10.351 -3.494 10.421  1.00 34.55 ? 148  ASN A ND2 1 
ATOM   1157 N  N   . LYS A 1 152 ? 13.256 0.454  12.514  1.00 30.26 ? 149  LYS A N   1 
ATOM   1158 C  CA  . LYS A 1 152 ? 12.985 1.229  13.714  1.00 30.12 ? 149  LYS A CA  1 
ATOM   1159 C  C   . LYS A 1 152 ? 12.151 2.423  13.316  1.00 30.57 ? 149  LYS A C   1 
ATOM   1160 O  O   . LYS A 1 152 ? 12.248 2.902  12.152  1.00 31.05 ? 149  LYS A O   1 
ATOM   1161 C  CB  . LYS A 1 152 ? 14.240 1.663  14.446  1.00 30.24 ? 149  LYS A CB  1 
ATOM   1162 C  CG  . LYS A 1 152 ? 15.143 0.520  14.804  1.00 30.13 ? 149  LYS A CG  1 
ATOM   1163 C  CD  . LYS A 1 152 ? 16.110 0.871  15.949  1.00 29.73 ? 149  LYS A CD  1 
ATOM   1164 C  CE  . LYS A 1 152 ? 17.470 0.181  15.758  1.00 29.19 ? 149  LYS A CE  1 
ATOM   1165 N  NZ  . LYS A 1 152 ? 18.220 -0.006 17.025  1.00 26.71 ? 149  LYS A NZ  1 
ATOM   1166 N  N   . LYS A 1 153 ? 11.349 2.898  14.290  1.00 28.58 ? 150  LYS A N   1 
ATOM   1167 C  CA  . LYS A 1 153 ? 10.360 3.908  14.030  1.00 28.15 ? 150  LYS A CA  1 
ATOM   1168 C  C   . LYS A 1 153 ? 10.923 5.295  14.340  1.00 25.62 ? 150  LYS A C   1 
ATOM   1169 O  O   . LYS A 1 153 ? 11.180 5.607  15.488  1.00 26.42 ? 150  LYS A O   1 
ATOM   1170 C  CB  . LYS A 1 153 ? 9.077  3.684  14.863  1.00 27.29 ? 150  LYS A CB  1 
ATOM   1171 C  CG  . LYS A 1 153 ? 8.504  2.254  14.688  1.00 32.80 ? 150  LYS A CG  1 
ATOM   1172 C  CD  . LYS A 1 153 ? 7.224  2.049  15.485  1.00 34.70 ? 150  LYS A CD  1 
ATOM   1173 C  CE  . LYS A 1 153 ? 6.616  0.692  15.333  1.00 36.73 ? 150  LYS A CE  1 
ATOM   1174 N  NZ  . LYS A 1 153 ? 5.258  0.715  15.979  1.00 36.78 ? 150  LYS A NZ  1 
ATOM   1175 N  N   . PRO A 1 154 ? 11.095 6.118  13.321  1.00 24.19 ? 151  PRO A N   1 
ATOM   1176 C  CA  . PRO A 1 154 ? 11.611 7.476  13.543  1.00 23.81 ? 151  PRO A CA  1 
ATOM   1177 C  C   . PRO A 1 154 ? 10.511 8.379  14.136  1.00 23.69 ? 151  PRO A C   1 
ATOM   1178 O  O   . PRO A 1 154 ? 9.357  8.348  13.674  1.00 24.98 ? 151  PRO A O   1 
ATOM   1179 C  CB  . PRO A 1 154 ? 11.898 7.967  12.172  1.00 22.55 ? 151  PRO A CB  1 
ATOM   1180 C  CG  . PRO A 1 154 ? 11.105 7.181  11.319  1.00 24.66 ? 151  PRO A CG  1 
ATOM   1181 C  CD  . PRO A 1 154 ? 10.726 5.919  11.931  1.00 23.39 ? 151  PRO A CD  1 
ATOM   1182 N  N   . LEU A 1 155 ? 10.912 9.173  15.111  1.00 24.18 ? 152  LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 155 ? 10.041 10.103 15.814  1.00 23.54 ? 152  LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 155 ? 10.498 11.588 15.568  1.00 24.57 ? 152  LEU A C   1 
ATOM   1185 O  O   . LEU A 1 155 ? 9.663  12.481 15.291  1.00 24.54 ? 152  LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 155 ? 10.131 9.753  17.286  1.00 23.85 ? 152  LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 155 ? 9.767  8.316  17.651  1.00 23.92 ? 152  LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 155 ? 9.774  8.071  19.162  1.00 26.19 ? 152  LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 155 ? 8.445  7.887  16.990  1.00 25.78 ? 152  LEU A CD2 1 
ATOM   1190 N  N   . LEU A 1 156 ? 11.819 11.821 15.648  1.00 24.51 ? 153  LEU A N   1 
ATOM   1191 C  CA  . LEU A 1 156 ? 12.437 13.147 15.428  1.00 24.04 ? 153  LEU A CA  1 
ATOM   1192 C  C   . LEU A 1 156 ? 13.791 12.989 14.715  1.00 23.22 ? 153  LEU A C   1 
ATOM   1193 O  O   . LEU A 1 156 ? 14.524 12.021 14.997  1.00 23.52 ? 153  LEU A O   1 
ATOM   1194 C  CB  . LEU A 1 156 ? 12.691 13.822 16.771  1.00 25.12 ? 153  LEU A CB  1 
ATOM   1195 C  CG  . LEU A 1 156 ? 13.393 15.184 16.832  1.00 25.82 ? 153  LEU A CG  1 
ATOM   1196 C  CD1 . LEU A 1 156 ? 12.572 16.174 16.167  1.00 26.11 ? 153  LEU A CD1 1 
ATOM   1197 C  CD2 . LEU A 1 156 ? 13.754 15.599 18.254  1.00 22.94 ? 153  LEU A CD2 1 
ATOM   1198 N  N   . THR A 1 157 ? 14.155 13.956 13.868  1.00 21.68 ? 154  THR A N   1 
ATOM   1199 C  CA  . THR A 1 157 ? 15.523 13.976 13.317  1.00 21.79 ? 154  THR A CA  1 
ATOM   1200 C  C   . THR A 1 157 ? 16.061 15.391 13.187  1.00 20.58 ? 154  THR A C   1 
ATOM   1201 O  O   . THR A 1 157 ? 15.300 16.331 12.928  1.00 20.48 ? 154  THR A O   1 
ATOM   1202 C  CB  . THR A 1 157 ? 15.612 13.300 11.934  1.00 21.32 ? 154  THR A CB  1 
ATOM   1203 O  OG1 . THR A 1 157 ? 16.982 12.982 11.607  1.00 22.34 ? 154  THR A OG1 1 
ATOM   1204 C  CG2 . THR A 1 157 ? 15.041 14.183 10.856  1.00 21.87 ? 154  THR A CG2 1 
ATOM   1205 N  N   . PHE A 1 158 ? 17.367 15.530 13.384  1.00 19.86 ? 155  PHE A N   1 
ATOM   1206 C  CA  . PHE A 1 158 ? 18.070 16.747 13.011  1.00 19.81 ? 155  PHE A CA  1 
ATOM   1207 C  C   . PHE A 1 158 ? 19.045 16.355 11.892  1.00 19.52 ? 155  PHE A C   1 
ATOM   1208 O  O   . PHE A 1 158 ? 19.868 15.462 12.084  1.00 17.84 ? 155  PHE A O   1 
ATOM   1209 C  CB  . PHE A 1 158 ? 18.946 17.227 14.162  1.00 21.62 ? 155  PHE A CB  1 
ATOM   1210 C  CG  . PHE A 1 158 ? 18.217 17.801 15.365  1.00 22.34 ? 155  PHE A CG  1 
ATOM   1211 C  CD1 . PHE A 1 158 ? 16.850 18.005 15.375  1.00 23.89 ? 155  PHE A CD1 1 
ATOM   1212 C  CD2 . PHE A 1 158 ? 18.968 18.178 16.501  1.00 24.66 ? 155  PHE A CD2 1 
ATOM   1213 C  CE1 . PHE A 1 158 ? 16.223 18.540 16.502  1.00 25.40 ? 155  PHE A CE1 1 
ATOM   1214 C  CE2 . PHE A 1 158 ? 18.327 18.759 17.619  1.00 25.94 ? 155  PHE A CE2 1 
ATOM   1215 C  CZ  . PHE A 1 158 ? 16.983 18.907 17.617  1.00 24.41 ? 155  PHE A CZ  1 
ATOM   1216 N  N   . ASP A 1 159 ? 18.963 17.057 10.772  1.00 18.64 ? 156  ASP A N   1 
ATOM   1217 C  CA  . ASP A 1 159 ? 19.932 17.006 9.705   1.00 19.53 ? 156  ASP A CA  1 
ATOM   1218 C  C   . ASP A 1 159 ? 21.194 17.719 10.150  1.00 19.33 ? 156  ASP A C   1 
ATOM   1219 O  O   . ASP A 1 159 ? 21.155 18.917 10.445  1.00 19.45 ? 156  ASP A O   1 
ATOM   1220 C  CB  . ASP A 1 159 ? 19.353 17.719 8.466   1.00 20.46 ? 156  ASP A CB  1 
ATOM   1221 C  CG  . ASP A 1 159 ? 20.142 17.457 7.187   1.00 20.89 ? 156  ASP A CG  1 
ATOM   1222 O  OD1 . ASP A 1 159 ? 21.169 16.776 7.301   1.00 20.21 ? 156  ASP A OD1 1 
ATOM   1223 O  OD2 . ASP A 1 159 ? 19.729 17.940 6.074   1.00 19.91 ? 156  ASP A OD2 1 
ATOM   1224 N  N   . VAL A 1 160 ? 22.320 17.014 10.164  1.00 18.33 ? 157  VAL A N   1 
ATOM   1225 C  CA  . VAL A 1 160 ? 23.648 17.626 10.488  1.00 17.94 ? 157  VAL A CA  1 
ATOM   1226 C  C   . VAL A 1 160 ? 24.668 17.585 9.318   1.00 18.78 ? 157  VAL A C   1 
ATOM   1227 O  O   . VAL A 1 160 ? 25.906 17.827 9.513   1.00 16.19 ? 157  VAL A O   1 
ATOM   1228 C  CB  . VAL A 1 160 ? 24.288 17.030 11.783  1.00 17.90 ? 157  VAL A CB  1 
ATOM   1229 C  CG1 . VAL A 1 160 ? 23.403 17.358 13.003  1.00 18.07 ? 157  VAL A CG1 1 
ATOM   1230 C  CG2 . VAL A 1 160 ? 24.577 15.504 11.687  1.00 17.73 ? 157  VAL A CG2 1 
ATOM   1231 N  N   . TRP A 1 161 ? 24.156 17.295 8.108   1.00 18.50 ? 158  TRP A N   1 
ATOM   1232 C  CA  . TRP A 1 161 ? 24.900 17.649 6.882   1.00 19.00 ? 158  TRP A CA  1 
ATOM   1233 C  C   . TRP A 1 161 ? 25.200 19.143 6.957   1.00 18.67 ? 158  TRP A C   1 
ATOM   1234 O  O   . TRP A 1 161 ? 24.333 19.926 7.372   1.00 19.08 ? 158  TRP A O   1 
ATOM   1235 C  CB  . TRP A 1 161 ? 24.093 17.415 5.606   1.00 18.66 ? 158  TRP A CB  1 
ATOM   1236 C  CG  . TRP A 1 161 ? 23.967 16.000 5.145   1.00 19.21 ? 158  TRP A CG  1 
ATOM   1237 C  CD1 . TRP A 1 161 ? 23.370 14.967 5.818   1.00 21.22 ? 158  TRP A CD1 1 
ATOM   1238 C  CD2 . TRP A 1 161 ? 24.391 15.458 3.872   1.00 19.71 ? 158  TRP A CD2 1 
ATOM   1239 N  NE1 . TRP A 1 161 ? 23.408 13.836 5.056   1.00 20.98 ? 158  TRP A NE1 1 
ATOM   1240 C  CE2 . TRP A 1 161 ? 24.023 14.104 3.859   1.00 20.46 ? 158  TRP A CE2 1 
ATOM   1241 C  CE3 . TRP A 1 161 ? 25.063 15.993 2.755   1.00 19.39 ? 158  TRP A CE3 1 
ATOM   1242 C  CZ2 . TRP A 1 161 ? 24.293 13.264 2.771   1.00 19.41 ? 158  TRP A CZ2 1 
ATOM   1243 C  CZ3 . TRP A 1 161 ? 25.334 15.164 1.683   1.00 16.66 ? 158  TRP A CZ3 1 
ATOM   1244 C  CH2 . TRP A 1 161 ? 24.927 13.818 1.691   1.00 18.22 ? 158  TRP A CH2 1 
ATOM   1245 N  N   . GLU A 1 162 ? 26.410 19.535 6.557   1.00 18.07 ? 159  GLU A N   1 
ATOM   1246 C  CA  . GLU A 1 162 ? 26.828 20.938 6.691   1.00 17.77 ? 159  GLU A CA  1 
ATOM   1247 C  C   . GLU A 1 162 ? 25.885 21.905 5.927   1.00 18.52 ? 159  GLU A C   1 
ATOM   1248 O  O   . GLU A 1 162 ? 25.611 23.002 6.399   1.00 16.95 ? 159  GLU A O   1 
ATOM   1249 C  CB  . GLU A 1 162 ? 28.304 21.120 6.260   1.00 18.34 ? 159  GLU A CB  1 
ATOM   1250 C  CG  . GLU A 1 162 ? 29.263 20.522 7.222   1.00 16.05 ? 159  GLU A CG  1 
ATOM   1251 C  CD  . GLU A 1 162 ? 30.676 20.683 6.873   1.00 18.20 ? 159  GLU A CD  1 
ATOM   1252 O  OE1 . GLU A 1 162 ? 31.498 21.079 7.754   1.00 20.49 ? 159  GLU A OE1 1 
ATOM   1253 O  OE2 . GLU A 1 162 ? 31.017 20.315 5.750   1.00 16.74 ? 159  GLU A OE2 1 
ATOM   1254 N  N   . HIS A 1 163 ? 25.331 21.482 4.786   1.00 17.80 ? 160  HIS A N   1 
ATOM   1255 C  CA  . HIS A 1 163 ? 24.361 22.329 4.111   1.00 18.98 ? 160  HIS A CA  1 
ATOM   1256 C  C   . HIS A 1 163 ? 23.161 22.770 5.014   1.00 19.21 ? 160  HIS A C   1 
ATOM   1257 O  O   . HIS A 1 163 ? 22.559 23.768 4.733   1.00 20.39 ? 160  HIS A O   1 
ATOM   1258 C  CB  . HIS A 1 163 ? 23.835 21.748 2.748   1.00 17.29 ? 160  HIS A CB  1 
ATOM   1259 C  CG  . HIS A 1 163 ? 23.056 20.482 2.855   1.00 19.68 ? 160  HIS A CG  1 
ATOM   1260 N  ND1 . HIS A 1 163 ? 23.450 19.308 2.229   1.00 18.68 ? 160  HIS A ND1 1 
ATOM   1261 C  CD2 . HIS A 1 163 ? 21.854 20.222 3.428   1.00 21.87 ? 160  HIS A CD2 1 
ATOM   1262 C  CE1 . HIS A 1 163 ? 22.532 18.378 2.452   1.00 20.91 ? 160  HIS A CE1 1 
ATOM   1263 N  NE2 . HIS A 1 163 ? 21.565 18.907 3.189   1.00 21.25 ? 160  HIS A NE2 1 
ATOM   1264 N  N   . ALA A 1 164 ? 22.795 21.969 6.024   1.00 20.65 ? 161  ALA A N   1 
ATOM   1265 C  CA  . ALA A 1 164 ? 21.653 22.248 6.881   1.00 18.69 ? 161  ALA A CA  1 
ATOM   1266 C  C   . ALA A 1 164 ? 21.810 23.554 7.658   1.00 20.04 ? 161  ALA A C   1 
ATOM   1267 O  O   . ALA A 1 164 ? 20.813 24.226 8.017   1.00 18.70 ? 161  ALA A O   1 
ATOM   1268 C  CB  . ALA A 1 164 ? 21.473 21.098 7.845   1.00 19.54 ? 161  ALA A CB  1 
ATOM   1269 N  N   . TYR A 1 165 ? 23.058 23.940 7.905   1.00 19.52 ? 162  TYR A N   1 
ATOM   1270 C  CA  . TYR A 1 165 ? 23.334 25.059 8.784   1.00 20.25 ? 162  TYR A CA  1 
ATOM   1271 C  C   . TYR A 1 165 ? 24.454 26.023 8.353   1.00 20.47 ? 162  TYR A C   1 
ATOM   1272 O  O   . TYR A 1 165 ? 24.615 27.064 8.991   1.00 21.38 ? 162  TYR A O   1 
ATOM   1273 C  CB  . TYR A 1 165 ? 23.672 24.480 10.158  1.00 20.51 ? 162  TYR A CB  1 
ATOM   1274 C  CG  . TYR A 1 165 ? 24.872 23.536 10.230  1.00 20.26 ? 162  TYR A CG  1 
ATOM   1275 C  CD1 . TYR A 1 165 ? 26.180 24.045 10.387  1.00 18.86 ? 162  TYR A CD1 1 
ATOM   1276 C  CD2 . TYR A 1 165 ? 24.711 22.142 10.202  1.00 18.97 ? 162  TYR A CD2 1 
ATOM   1277 C  CE1 . TYR A 1 165 ? 27.283 23.183 10.493  1.00 18.82 ? 162  TYR A CE1 1 
ATOM   1278 C  CE2 . TYR A 1 165 ? 25.804 21.286 10.309  1.00 19.87 ? 162  TYR A CE2 1 
ATOM   1279 C  CZ  . TYR A 1 165 ? 27.079 21.805 10.471  1.00 18.30 ? 162  TYR A CZ  1 
ATOM   1280 O  OH  . TYR A 1 165 ? 28.151 20.954 10.577  1.00 20.37 ? 162  TYR A OH  1 
ATOM   1281 N  N   . TYR A 1 166 ? 25.240 25.680 7.322   1.00 19.98 ? 163  TYR A N   1 
ATOM   1282 C  CA  . TYR A 1 166 ? 26.484 26.426 7.040   1.00 19.45 ? 163  TYR A CA  1 
ATOM   1283 C  C   . TYR A 1 166 ? 26.230 27.884 6.701   1.00 19.64 ? 163  TYR A C   1 
ATOM   1284 O  O   . TYR A 1 166 ? 27.022 28.757 7.060   1.00 18.83 ? 163  TYR A O   1 
ATOM   1285 C  CB  . TYR A 1 166 ? 27.380 25.754 5.947   1.00 18.46 ? 163  TYR A CB  1 
ATOM   1286 C  CG  . TYR A 1 166 ? 28.848 25.922 6.274   1.00 18.35 ? 163  TYR A CG  1 
ATOM   1287 C  CD1 . TYR A 1 166 ? 29.612 26.910 5.678   1.00 16.55 ? 163  TYR A CD1 1 
ATOM   1288 C  CD2 . TYR A 1 166 ? 29.478 25.085 7.197   1.00 19.87 ? 163  TYR A CD2 1 
ATOM   1289 C  CE1 . TYR A 1 166 ? 30.942 27.076 5.984   1.00 16.89 ? 163  TYR A CE1 1 
ATOM   1290 C  CE2 . TYR A 1 166 ? 30.804 25.297 7.534   1.00 15.70 ? 163  TYR A CE2 1 
ATOM   1291 C  CZ  . TYR A 1 166 ? 31.506 26.296 6.947   1.00 14.53 ? 163  TYR A CZ  1 
ATOM   1292 O  OH  . TYR A 1 166 ? 32.839 26.445 7.271   1.00 19.18 ? 163  TYR A OH  1 
ATOM   1293 N  N   . ILE A 1 167 ? 25.133 28.129 6.003   1.00 20.30 ? 164  ILE A N   1 
ATOM   1294 C  CA  . ILE A 1 167 ? 24.741 29.496 5.617   1.00 21.51 ? 164  ILE A CA  1 
ATOM   1295 C  C   . ILE A 1 167 ? 24.471 30.351 6.871   1.00 21.99 ? 164  ILE A C   1 
ATOM   1296 O  O   . ILE A 1 167 ? 24.856 31.526 6.953   1.00 22.26 ? 164  ILE A O   1 
ATOM   1297 C  CB  . ILE A 1 167 ? 23.478 29.494 4.732   1.00 20.95 ? 164  ILE A CB  1 
ATOM   1298 C  CG1 . ILE A 1 167 ? 23.726 28.716 3.439   1.00 21.17 ? 164  ILE A CG1 1 
ATOM   1299 C  CG2 . ILE A 1 167 ? 23.051 30.956 4.450   1.00 19.27 ? 164  ILE A CG2 1 
ATOM   1300 C  CD1 . ILE A 1 167 ? 22.494 28.531 2.571   1.00 19.36 ? 164  ILE A CD1 1 
ATOM   1301 N  N   . ASP A 1 168 ? 23.848 29.746 7.869   1.00 22.49 ? 165  ASP A N   1 
ATOM   1302 C  CA  . ASP A 1 168 ? 23.350 30.512 9.029   1.00 23.45 ? 165  ASP A CA  1 
ATOM   1303 C  C   . ASP A 1 168 ? 24.277 30.486 10.236  1.00 23.17 ? 165  ASP A C   1 
ATOM   1304 O  O   . ASP A 1 168 ? 24.199 31.380 11.091  1.00 22.22 ? 165  ASP A O   1 
ATOM   1305 C  CB  . ASP A 1 168 ? 21.987 29.959 9.427   1.00 22.94 ? 165  ASP A CB  1 
ATOM   1306 C  CG  . ASP A 1 168 ? 20.969 30.117 8.326   1.00 23.50 ? 165  ASP A CG  1 
ATOM   1307 O  OD1 . ASP A 1 168 ? 21.058 31.108 7.551   1.00 22.58 ? 165  ASP A OD1 1 
ATOM   1308 O  OD2 . ASP A 1 168 ? 20.050 29.268 8.256   1.00 22.94 ? 165  ASP A OD2 1 
ATOM   1309 N  N   . TYR A 1 169 ? 25.173 29.486 10.280  1.00 21.51 ? 166  TYR A N   1 
ATOM   1310 C  CA  . TYR A 1 169 ? 26.003 29.205 11.457  1.00 20.38 ? 166  TYR A CA  1 
ATOM   1311 C  C   . TYR A 1 169 ? 27.474 28.859 11.120  1.00 20.19 ? 166  TYR A C   1 
ATOM   1312 O  O   . TYR A 1 169 ? 28.296 28.689 12.036  1.00 19.44 ? 166  TYR A O   1 
ATOM   1313 C  CB  . TYR A 1 169 ? 25.393 28.030 12.220  1.00 21.05 ? 166  TYR A CB  1 
ATOM   1314 C  CG  . TYR A 1 169 ? 24.000 28.279 12.754  1.00 20.29 ? 166  TYR A CG  1 
ATOM   1315 C  CD1 . TYR A 1 169 ? 23.817 28.922 13.966  1.00 23.42 ? 166  TYR A CD1 1 
ATOM   1316 C  CD2 . TYR A 1 169 ? 22.873 27.885 12.042  1.00 21.07 ? 166  TYR A CD2 1 
ATOM   1317 C  CE1 . TYR A 1 169 ? 22.519 29.157 14.476  1.00 22.28 ? 166  TYR A CE1 1 
ATOM   1318 C  CE2 . TYR A 1 169 ? 21.564 28.108 12.541  1.00 21.05 ? 166  TYR A CE2 1 
ATOM   1319 C  CZ  . TYR A 1 169 ? 21.403 28.733 13.748  1.00 22.84 ? 166  TYR A CZ  1 
ATOM   1320 O  OH  . TYR A 1 169 ? 20.136 29.028 14.251  1.00 21.85 ? 166  TYR A OH  1 
ATOM   1321 N  N   . ARG A 1 170 ? 27.783 28.735 9.836   1.00 19.55 ? 167  ARG A N   1 
ATOM   1322 C  CA  . ARG A 1 170 ? 29.133 28.319 9.357   1.00 20.11 ? 167  ARG A CA  1 
ATOM   1323 C  C   . ARG A 1 170 ? 29.520 27.027 10.076  1.00 20.30 ? 167  ARG A C   1 
ATOM   1324 O  O   . ARG A 1 170 ? 28.726 26.093 10.096  1.00 20.36 ? 167  ARG A O   1 
ATOM   1325 C  CB  . ARG A 1 170 ? 30.142 29.472 9.568   1.00 19.62 ? 167  ARG A CB  1 
ATOM   1326 C  CG  . ARG A 1 170 ? 29.809 30.744 8.770   1.00 19.49 ? 167  ARG A CG  1 
ATOM   1327 C  CD  . ARG A 1 170 ? 30.168 30.554 7.250   1.00 17.65 ? 167  ARG A CD  1 
ATOM   1328 N  NE  . ARG A 1 170 ? 30.021 31.732 6.400   1.00 15.21 ? 167  ARG A NE  1 
ATOM   1329 C  CZ  . ARG A 1 170 ? 28.888 32.151 5.851   1.00 17.28 ? 167  ARG A CZ  1 
ATOM   1330 N  NH1 . ARG A 1 170 ? 27.749 31.514 6.052   1.00 18.90 ? 167  ARG A NH1 1 
ATOM   1331 N  NH2 . ARG A 1 170 ? 28.885 33.251 5.108   1.00 21.74 ? 167  ARG A NH2 1 
ATOM   1332 N  N   . ASN A 1 171 ? 30.678 26.979 10.728  1.00 20.51 ? 168  ASN A N   1 
ATOM   1333 C  CA  . ASN A 1 171 ? 31.115 25.724 11.386  1.00 21.15 ? 168  ASN A CA  1 
ATOM   1334 C  C   . ASN A 1 171 ? 30.494 25.474 12.780  1.00 20.64 ? 168  ASN A C   1 
ATOM   1335 O  O   . ASN A 1 171 ? 30.765 24.434 13.390  1.00 19.44 ? 168  ASN A O   1 
ATOM   1336 C  CB  . ASN A 1 171 ? 32.641 25.666 11.468  1.00 20.72 ? 168  ASN A CB  1 
ATOM   1337 C  CG  . ASN A 1 171 ? 33.179 26.719 12.362  1.00 21.18 ? 168  ASN A CG  1 
ATOM   1338 O  OD1 . ASN A 1 171 ? 32.850 27.891 12.194  1.00 18.63 ? 168  ASN A OD1 1 
ATOM   1339 N  ND2 . ASN A 1 171 ? 33.976 26.321 13.354  1.00 23.30 ? 168  ASN A ND2 1 
ATOM   1340 N  N   . ALA A 1 172 ? 29.637 26.387 13.254  1.00 19.81 ? 169  ALA A N   1 
ATOM   1341 C  CA  . ALA A 1 172 ? 29.127 26.357 14.593  1.00 20.63 ? 169  ALA A CA  1 
ATOM   1342 C  C   . ALA A 1 172 ? 27.898 25.418 14.714  1.00 21.77 ? 169  ALA A C   1 
ATOM   1343 O  O   . ALA A 1 172 ? 26.785 25.854 15.072  1.00 20.91 ? 169  ALA A O   1 
ATOM   1344 C  CB  . ALA A 1 172 ? 28.781 27.813 15.048  1.00 21.05 ? 169  ALA A CB  1 
ATOM   1345 N  N   . ARG A 1 173 ? 28.118 24.128 14.433  1.00 21.93 ? 170  ARG A N   1 
ATOM   1346 C  CA  . ARG A 1 173 ? 27.055 23.136 14.511  1.00 22.03 ? 170  ARG A CA  1 
ATOM   1347 C  C   . ARG A 1 173 ? 26.385 23.155 15.872  1.00 22.23 ? 170  ARG A C   1 
ATOM   1348 O  O   . ARG A 1 173 ? 25.179 22.994 15.916  1.00 22.44 ? 170  ARG A O   1 
ATOM   1349 C  CB  . ARG A 1 173 ? 27.527 21.718 14.259  1.00 21.58 ? 170  ARG A CB  1 
ATOM   1350 C  CG  . ARG A 1 173 ? 26.390 20.747 13.868  1.00 21.60 ? 170  ARG A CG  1 
ATOM   1351 C  CD  . ARG A 1 173 ? 26.813 19.331 13.940  1.00 20.42 ? 170  ARG A CD  1 
ATOM   1352 N  NE  . ARG A 1 173 ? 27.553 18.941 12.749  1.00 16.98 ? 170  ARG A NE  1 
ATOM   1353 C  CZ  . ARG A 1 173 ? 27.999 17.714 12.549  1.00 19.88 ? 170  ARG A CZ  1 
ATOM   1354 N  NH1 . ARG A 1 173 ? 27.741 16.744 13.427  1.00 16.84 ? 170  ARG A NH1 1 
ATOM   1355 N  NH2 . ARG A 1 173 ? 28.657 17.437 11.440  1.00 20.73 ? 170  ARG A NH2 1 
ATOM   1356 N  N   . PRO A 1 174 ? 27.157 23.296 16.978  1.00 22.62 ? 171  PRO A N   1 
ATOM   1357 C  CA  . PRO A 1 174 ? 26.466 23.319 18.281  1.00 22.69 ? 171  PRO A CA  1 
ATOM   1358 C  C   . PRO A 1 174 ? 25.426 24.439 18.462  1.00 23.25 ? 171  PRO A C   1 
ATOM   1359 O  O   . PRO A 1 174 ? 24.408 24.241 19.134  1.00 23.04 ? 171  PRO A O   1 
ATOM   1360 C  CB  . PRO A 1 174 ? 27.618 23.496 19.276  1.00 22.98 ? 171  PRO A CB  1 
ATOM   1361 C  CG  . PRO A 1 174 ? 28.773 22.787 18.607  1.00 22.22 ? 171  PRO A CG  1 
ATOM   1362 C  CD  . PRO A 1 174 ? 28.632 23.254 17.159  1.00 22.26 ? 171  PRO A CD  1 
ATOM   1363 N  N   . LYS A 1 175 ? 25.688 25.595 17.875  1.00 22.71 ? 172  LYS A N   1 
ATOM   1364 C  CA  . LYS A 1 175 ? 24.765 26.739 17.934  1.00 23.40 ? 172  LYS A CA  1 
ATOM   1365 C  C   . LYS A 1 175 ? 23.482 26.434 17.153  1.00 22.69 ? 172  LYS A C   1 
ATOM   1366 O  O   . LYS A 1 175 ? 22.356 26.692 17.651  1.00 23.01 ? 172  LYS A O   1 
ATOM   1367 C  CB  . LYS A 1 175 ? 25.436 27.986 17.377  1.00 23.37 ? 172  LYS A CB  1 
ATOM   1368 C  CG  . LYS A 1 175 ? 26.562 28.478 18.260  1.00 28.90 ? 172  LYS A CG  1 
ATOM   1369 C  CD  . LYS A 1 175 ? 27.107 29.839 17.788  1.00 35.68 ? 172  LYS A CD  1 
ATOM   1370 C  CE  . LYS A 1 175 ? 28.681 29.896 17.831  1.00 38.78 ? 172  LYS A CE  1 
ATOM   1371 N  NZ  . LYS A 1 175 ? 29.261 30.829 16.783  1.00 39.25 ? 172  LYS A NZ  1 
ATOM   1372 N  N   . TYR A 1 176 ? 23.669 25.855 15.964  1.00 20.40 ? 173  TYR A N   1 
ATOM   1373 C  CA  . TYR A 1 176 ? 22.561 25.287 15.170  1.00 20.53 ? 173  TYR A CA  1 
ATOM   1374 C  C   . TYR A 1 176 ? 21.730 24.257 15.935  1.00 20.83 ? 173  TYR A C   1 
ATOM   1375 O  O   . TYR A 1 176 ? 20.516 24.402 16.057  1.00 22.51 ? 173  TYR A O   1 
ATOM   1376 C  CB  . TYR A 1 176 ? 23.107 24.683 13.886  1.00 19.87 ? 173  TYR A CB  1 
ATOM   1377 C  CG  . TYR A 1 176 ? 22.201 23.752 13.137  1.00 19.99 ? 173  TYR A CG  1 
ATOM   1378 C  CD1 . TYR A 1 176 ? 21.121 24.223 12.419  1.00 20.43 ? 173  TYR A CD1 1 
ATOM   1379 C  CD2 . TYR A 1 176 ? 22.479 22.360 13.071  1.00 21.70 ? 173  TYR A CD2 1 
ATOM   1380 C  CE1 . TYR A 1 176 ? 20.282 23.353 11.708  1.00 21.14 ? 173  TYR A CE1 1 
ATOM   1381 C  CE2 . TYR A 1 176 ? 21.675 21.502 12.336  1.00 20.36 ? 173  TYR A CE2 1 
ATOM   1382 C  CZ  . TYR A 1 176 ? 20.574 22.005 11.652  1.00 20.07 ? 173  TYR A CZ  1 
ATOM   1383 O  OH  . TYR A 1 176 ? 19.766 21.154 10.907  1.00 22.99 ? 173  TYR A OH  1 
ATOM   1384 N  N   . VAL A 1 177 ? 22.375 23.257 16.499  1.00 20.41 ? 174  VAL A N   1 
ATOM   1385 C  CA  . VAL A 1 177 ? 21.642 22.233 17.248  1.00 20.87 ? 174  VAL A CA  1 
ATOM   1386 C  C   . VAL A 1 177 ? 20.894 22.811 18.448  1.00 21.34 ? 174  VAL A C   1 
ATOM   1387 O  O   . VAL A 1 177 ? 19.724 22.451 18.715  1.00 21.42 ? 174  VAL A O   1 
ATOM   1388 C  CB  . VAL A 1 177 ? 22.584 21.093 17.727  1.00 20.75 ? 174  VAL A CB  1 
ATOM   1389 C  CG1 . VAL A 1 177 ? 21.832 20.168 18.671  1.00 18.35 ? 174  VAL A CG1 1 
ATOM   1390 C  CG2 . VAL A 1 177 ? 23.142 20.277 16.513  1.00 18.62 ? 174  VAL A CG2 1 
ATOM   1391 N  N   . GLU A 1 178 ? 21.572 23.683 19.186  1.00 21.97 ? 175  GLU A N   1 
ATOM   1392 C  CA  . GLU A 1 178 ? 20.932 24.404 20.274  1.00 23.82 ? 175  GLU A CA  1 
ATOM   1393 C  C   . GLU A 1 178 ? 19.710 25.185 19.778  1.00 24.28 ? 175  GLU A C   1 
ATOM   1394 O  O   . GLU A 1 178 ? 18.623 25.073 20.346  1.00 23.92 ? 175  GLU A O   1 
ATOM   1395 C  CB  . GLU A 1 178 ? 21.917 25.368 20.932  1.00 24.53 ? 175  GLU A CB  1 
ATOM   1396 C  CG  . GLU A 1 178 ? 21.353 26.129 22.134  1.00 26.06 ? 175  GLU A CG  1 
ATOM   1397 C  CD  . GLU A 1 178 ? 22.312 27.196 22.655  1.00 31.78 ? 175  GLU A CD  1 
ATOM   1398 O  OE1 . GLU A 1 178 ? 22.955 27.915 21.841  1.00 34.31 ? 175  GLU A OE1 1 
ATOM   1399 O  OE2 . GLU A 1 178 ? 22.415 27.338 23.900  1.00 36.00 ? 175  GLU A OE2 1 
ATOM   1400 N  N   . ALA A 1 179 ? 19.889 25.956 18.709  1.00 25.09 ? 176  ALA A N   1 
ATOM   1401 C  CA  . ALA A 1 179 ? 18.799 26.792 18.169  1.00 25.39 ? 176  ALA A CA  1 
ATOM   1402 C  C   . ALA A 1 179 ? 17.621 25.957 17.650  1.00 26.12 ? 176  ALA A C   1 
ATOM   1403 O  O   . ALA A 1 179 ? 16.461 26.392 17.719  1.00 26.70 ? 176  ALA A O   1 
ATOM   1404 C  CB  . ALA A 1 179 ? 19.334 27.775 17.078  1.00 24.96 ? 176  ALA A CB  1 
ATOM   1405 N  N   . LEU A 1 180 ? 17.895 24.727 17.189  1.00 26.65 ? 177  LEU A N   1 
ATOM   1406 C  CA  . LEU A 1 180 ? 16.819 23.899 16.668  1.00 26.51 ? 177  LEU A CA  1 
ATOM   1407 C  C   . LEU A 1 180 ? 15.690 23.650 17.673  1.00 26.56 ? 177  LEU A C   1 
ATOM   1408 O  O   . LEU A 1 180 ? 14.544 23.568 17.265  1.00 26.95 ? 177  LEU A O   1 
ATOM   1409 C  CB  . LEU A 1 180 ? 17.351 22.555 16.158  1.00 27.08 ? 177  LEU A CB  1 
ATOM   1410 C  CG  . LEU A 1 180 ? 17.924 22.538 14.746  1.00 26.47 ? 177  LEU A CG  1 
ATOM   1411 C  CD1 . LEU A 1 180 ? 18.301 21.120 14.318  1.00 25.70 ? 177  LEU A CD1 1 
ATOM   1412 C  CD2 . LEU A 1 180 ? 16.956 23.143 13.774  1.00 25.82 ? 177  LEU A CD2 1 
ATOM   1413 N  N   . TRP A 1 181 ? 15.999 23.514 18.967  1.00 26.57 ? 178  TRP A N   1 
ATOM   1414 C  CA  . TRP A 1 181 ? 14.967 23.206 19.968  1.00 26.47 ? 178  TRP A CA  1 
ATOM   1415 C  C   . TRP A 1 181 ? 13.854 24.244 19.950  1.00 27.58 ? 178  TRP A C   1 
ATOM   1416 O  O   . TRP A 1 181 ? 12.696 23.933 20.265  1.00 28.51 ? 178  TRP A O   1 
ATOM   1417 C  CB  . TRP A 1 181 ? 15.570 23.034 21.362  1.00 25.69 ? 178  TRP A CB  1 
ATOM   1418 C  CG  . TRP A 1 181 ? 16.516 21.859 21.384  1.00 23.82 ? 178  TRP A CG  1 
ATOM   1419 C  CD1 . TRP A 1 181 ? 17.880 21.917 21.382  1.00 23.81 ? 178  TRP A CD1 1 
ATOM   1420 C  CD2 . TRP A 1 181 ? 16.179 20.463 21.355  1.00 22.49 ? 178  TRP A CD2 1 
ATOM   1421 N  NE1 . TRP A 1 181 ? 18.417 20.645 21.376  1.00 21.22 ? 178  TRP A NE1 1 
ATOM   1422 C  CE2 . TRP A 1 181 ? 17.390 19.739 21.345  1.00 22.77 ? 178  TRP A CE2 1 
ATOM   1423 C  CE3 . TRP A 1 181 ? 14.970 19.749 21.353  1.00 23.49 ? 178  TRP A CE3 1 
ATOM   1424 C  CZ2 . TRP A 1 181 ? 17.430 18.327 21.331  1.00 21.30 ? 178  TRP A CZ2 1 
ATOM   1425 C  CZ3 . TRP A 1 181 ? 15.013 18.345 21.320  1.00 24.51 ? 178  TRP A CZ3 1 
ATOM   1426 C  CH2 . TRP A 1 181 ? 16.236 17.658 21.312  1.00 23.34 ? 178  TRP A CH2 1 
ATOM   1427 N  N   . ASP A 1 182 ? 14.174 25.463 19.528  1.00 27.81 ? 179  ASP A N   1 
ATOM   1428 C  CA  . ASP A 1 182 ? 13.168 26.512 19.454  1.00 28.68 ? 179  ASP A CA  1 
ATOM   1429 C  C   . ASP A 1 182 ? 12.067 26.215 18.461  1.00 28.21 ? 179  ASP A C   1 
ATOM   1430 O  O   . ASP A 1 182 ? 10.965 26.806 18.558  1.00 27.54 ? 179  ASP A O   1 
ATOM   1431 C  CB  . ASP A 1 182 ? 13.787 27.863 19.080  1.00 29.10 ? 179  ASP A CB  1 
ATOM   1432 C  CG  . ASP A 1 182 ? 14.740 28.362 20.115  1.00 29.89 ? 179  ASP A CG  1 
ATOM   1433 O  OD1 . ASP A 1 182 ? 14.661 27.908 21.275  1.00 31.91 ? 179  ASP A OD1 1 
ATOM   1434 O  OD2 . ASP A 1 182 ? 15.577 29.206 19.757  1.00 32.89 ? 179  ASP A OD2 1 
ATOM   1435 N  N   . ILE A 1 183 ? 12.363 25.364 17.488  1.00 26.86 ? 180  ILE A N   1 
ATOM   1436 C  CA  . ILE A 1 183 ? 11.429 25.121 16.423  1.00 26.40 ? 180  ILE A CA  1 
ATOM   1437 C  C   . ILE A 1 183 ? 11.062 23.645 16.311  1.00 25.66 ? 180  ILE A C   1 
ATOM   1438 O  O   . ILE A 1 183 ? 10.450 23.242 15.333  1.00 26.90 ? 180  ILE A O   1 
ATOM   1439 C  CB  . ILE A 1 183 ? 11.921 25.701 15.100  1.00 26.46 ? 180  ILE A CB  1 
ATOM   1440 C  CG1 . ILE A 1 183 ? 13.301 25.122 14.698  1.00 25.19 ? 180  ILE A CG1 1 
ATOM   1441 C  CG2 . ILE A 1 183 ? 12.004 27.241 15.203  1.00 27.16 ? 180  ILE A CG2 1 
ATOM   1442 C  CD1 . ILE A 1 183 ? 13.639 25.346 13.263  1.00 24.73 ? 180  ILE A CD1 1 
ATOM   1443 N  N   . VAL A 1 184 ? 11.358 22.853 17.335  1.00 25.37 ? 181  VAL A N   1 
ATOM   1444 C  CA  . VAL A 1 184 ? 11.017 21.415 17.273  1.00 24.86 ? 181  VAL A CA  1 
ATOM   1445 C  C   . VAL A 1 184 ? 9.497  21.221 17.420  1.00 25.65 ? 181  VAL A C   1 
ATOM   1446 O  O   . VAL A 1 184 ? 8.841  21.752 18.360  1.00 25.94 ? 181  VAL A O   1 
ATOM   1447 C  CB  . VAL A 1 184 ? 11.800 20.564 18.319  1.00 24.64 ? 181  VAL A CB  1 
ATOM   1448 C  CG1 . VAL A 1 184 ? 11.051 19.257 18.643  1.00 23.26 ? 181  VAL A CG1 1 
ATOM   1449 C  CG2 . VAL A 1 184 ? 13.261 20.284 17.827  1.00 23.45 ? 181  VAL A CG2 1 
ATOM   1450 N  N   . ASN A 1 185 ? 8.917  20.466 16.477  1.00 26.19 ? 182  ASN A N   1 
ATOM   1451 C  CA  . ASN A 1 185 ? 7.472  20.250 16.452  1.00 25.32 ? 182  ASN A CA  1 
ATOM   1452 C  C   . ASN A 1 185 ? 7.138  19.073 17.321  1.00 25.49 ? 182  ASN A C   1 
ATOM   1453 O  O   . ASN A 1 185 ? 7.152  17.918 16.854  1.00 25.33 ? 182  ASN A O   1 
ATOM   1454 C  CB  . ASN A 1 185 ? 6.982  19.984 15.025  1.00 26.11 ? 182  ASN A CB  1 
ATOM   1455 C  CG  . ASN A 1 185 ? 5.469  19.882 14.928  1.00 25.80 ? 182  ASN A CG  1 
ATOM   1456 O  OD1 . ASN A 1 185 ? 4.772  19.724 15.939  1.00 25.49 ? 182  ASN A OD1 1 
ATOM   1457 N  ND2 . ASN A 1 185 ? 4.951  19.966 13.710  1.00 24.03 ? 182  ASN A ND2 1 
ATOM   1458 N  N   . TRP A 1 186 ? 6.847  19.341 18.580  1.00 25.27 ? 183  TRP A N   1 
ATOM   1459 C  CA  . TRP A 1 186 ? 6.503  18.294 19.511  1.00 25.68 ? 183  TRP A CA  1 
ATOM   1460 C  C   . TRP A 1 186 ? 5.153  17.598 19.199  1.00 26.53 ? 183  TRP A C   1 
ATOM   1461 O  O   . TRP A 1 186 ? 4.936  16.453 19.618  1.00 26.48 ? 183  TRP A O   1 
ATOM   1462 C  CB  . TRP A 1 186 ? 6.606  18.808 20.948  1.00 25.59 ? 183  TRP A CB  1 
ATOM   1463 C  CG  . TRP A 1 186 ? 8.043  19.106 21.331  1.00 25.60 ? 183  TRP A CG  1 
ATOM   1464 C  CD1 . TRP A 1 186 ? 8.652  20.346 21.381  1.00 23.53 ? 183  TRP A CD1 1 
ATOM   1465 C  CD2 . TRP A 1 186 ? 9.066  18.150 21.649  1.00 25.18 ? 183  TRP A CD2 1 
ATOM   1466 N  NE1 . TRP A 1 186 ? 9.956  20.211 21.753  1.00 25.91 ? 183  TRP A NE1 1 
ATOM   1467 C  CE2 . TRP A 1 186 ? 10.248 18.877 21.908  1.00 24.98 ? 183  TRP A CE2 1 
ATOM   1468 C  CE3 . TRP A 1 186 ? 9.090  16.754 21.766  1.00 26.00 ? 183  TRP A CE3 1 
ATOM   1469 C  CZ2 . TRP A 1 186 ? 11.433 18.264 22.281  1.00 25.43 ? 183  TRP A CZ2 1 
ATOM   1470 C  CZ3 . TRP A 1 186 ? 10.285 16.132 22.129  1.00 26.60 ? 183  TRP A CZ3 1 
ATOM   1471 C  CH2 . TRP A 1 186 ? 11.444 16.892 22.379  1.00 26.60 ? 183  TRP A CH2 1 
ATOM   1472 N  N   . GLN A 1 187 ? 4.272  18.243 18.436  1.00 26.75 ? 184  GLN A N   1 
ATOM   1473 C  CA  . GLN A 1 187 ? 3.051  17.574 17.984  1.00 26.80 ? 184  GLN A CA  1 
ATOM   1474 C  C   . GLN A 1 187 ? 3.392  16.470 16.987  1.00 27.31 ? 184  GLN A C   1 
ATOM   1475 O  O   . GLN A 1 187 ? 2.867  15.368 17.070  1.00 27.18 ? 184  GLN A O   1 
ATOM   1476 C  CB  . GLN A 1 187 ? 2.056  18.574 17.380  1.00 26.45 ? 184  GLN A CB  1 
ATOM   1477 C  CG  . GLN A 1 187 ? 0.646  18.028 17.273  1.00 27.34 ? 184  GLN A CG  1 
ATOM   1478 C  CD  . GLN A 1 187 ? 0.085  17.534 18.619  1.00 30.28 ? 184  GLN A CD  1 
ATOM   1479 O  OE1 . GLN A 1 187 ? -0.657 16.537 18.688  1.00 32.67 ? 184  GLN A OE1 1 
ATOM   1480 N  NE2 . GLN A 1 187 ? 0.444  18.226 19.689  1.00 30.52 ? 184  GLN A NE2 1 
ATOM   1481 N  N   . PHE A 1 188 ? 4.303  16.756 16.062  1.00 27.41 ? 185  PHE A N   1 
ATOM   1482 C  CA  . PHE A 1 188 ? 4.673  15.772 15.073  1.00 27.40 ? 185  PHE A CA  1 
ATOM   1483 C  C   . PHE A 1 188 ? 5.392  14.622 15.736  1.00 27.57 ? 185  PHE A C   1 
ATOM   1484 O  O   . PHE A 1 188 ? 5.072  13.458 15.442  1.00 27.39 ? 185  PHE A O   1 
ATOM   1485 C  CB  . PHE A 1 188 ? 5.518  16.359 13.982  1.00 27.22 ? 185  PHE A CB  1 
ATOM   1486 C  CG  . PHE A 1 188 ? 5.930  15.359 12.935  1.00 27.39 ? 185  PHE A CG  1 
ATOM   1487 C  CD1 . PHE A 1 188 ? 4.994  14.815 12.088  1.00 28.26 ? 185  PHE A CD1 1 
ATOM   1488 C  CD2 . PHE A 1 188 ? 7.282  14.994 12.780  1.00 28.28 ? 185  PHE A CD2 1 
ATOM   1489 C  CE1 . PHE A 1 188 ? 5.378  13.909 11.088  1.00 28.56 ? 185  PHE A CE1 1 
ATOM   1490 C  CE2 . PHE A 1 188 ? 7.687  14.078 11.786  1.00 27.73 ? 185  PHE A CE2 1 
ATOM   1491 C  CZ  . PHE A 1 188 ? 6.746  13.537 10.946  1.00 28.25 ? 185  PHE A CZ  1 
ATOM   1492 N  N   . VAL A 1 189 ? 6.318  14.919 16.650  1.00 26.72 ? 186  VAL A N   1 
ATOM   1493 C  CA  . VAL A 1 189 ? 7.045  13.849 17.349  1.00 26.25 ? 186  VAL A CA  1 
ATOM   1494 C  C   . VAL A 1 189 ? 6.018  12.956 18.117  1.00 26.10 ? 186  VAL A C   1 
ATOM   1495 O  O   . VAL A 1 189 ? 6.139  11.721 18.140  1.00 24.95 ? 186  VAL A O   1 
ATOM   1496 C  CB  . VAL A 1 189 ? 8.152  14.413 18.304  1.00 26.18 ? 186  VAL A CB  1 
ATOM   1497 C  CG1 . VAL A 1 189 ? 8.934  13.285 18.988  1.00 26.09 ? 186  VAL A CG1 1 
ATOM   1498 C  CG2 . VAL A 1 189 ? 9.112  15.403 17.572  1.00 24.76 ? 186  VAL A CG2 1 
ATOM   1499 N  N   . SER A 1 190 ? 4.989  13.584 18.706  1.00 24.44 ? 187  SER A N   1 
ATOM   1500 C  CA  . SER A 1 190 ? 3.938  12.879 19.426  1.00 23.94 ? 187  SER A CA  1 
ATOM   1501 C  C   . SER A 1 190 ? 3.027  12.072 18.470  1.00 23.76 ? 187  SER A C   1 
ATOM   1502 O  O   . SER A 1 190 ? 2.662  10.968 18.759  1.00 23.87 ? 187  SER A O   1 
ATOM   1503 C  CB  . SER A 1 190 ? 3.078  13.880 20.246  1.00 24.46 ? 187  SER A CB  1 
ATOM   1504 O  OG  . SER A 1 190 ? 3.826  14.620 21.215  1.00 24.13 ? 187  SER A OG  1 
ATOM   1505 N  N   . GLU A 1 191 ? 2.674  12.595 17.312  1.00 24.48 ? 188  GLU A N   1 
ATOM   1506 C  CA  . GLU A 1 191 ? 1.852  11.816 16.382  1.00 25.47 ? 188  GLU A CA  1 
ATOM   1507 C  C   . GLU A 1 191 ? 2.603  10.561 15.913  1.00 26.18 ? 188  GLU A C   1 
ATOM   1508 O  O   . GLU A 1 191 ? 2.060  9.458  16.007  1.00 25.94 ? 188  GLU A O   1 
ATOM   1509 C  CB  . GLU A 1 191 ? 1.414  12.663 15.191  1.00 25.73 ? 188  GLU A CB  1 
ATOM   1510 C  CG  . GLU A 1 191 ? 0.359  13.749 15.547  1.00 27.16 ? 188  GLU A CG  1 
ATOM   1511 C  CD  . GLU A 1 191 ? 0.245  14.802 14.480  1.00 28.49 ? 188  GLU A CD  1 
ATOM   1512 O  OE1 . GLU A 1 191 ? 1.187  14.906 13.652  1.00 30.80 ? 188  GLU A OE1 1 
ATOM   1513 O  OE2 . GLU A 1 191 ? -0.783 15.517 14.457  1.00 30.86 ? 188  GLU A OE2 1 
ATOM   1514 N  N   . GLN A 1 192 ? 3.843  10.745 15.450  1.00 26.19 ? 189  GLN A N   1 
ATOM   1515 C  CA  . GLN A 1 192 ? 4.723  9.638  15.032  1.00 26.97 ? 189  GLN A CA  1 
ATOM   1516 C  C   . GLN A 1 192 ? 4.834  8.593  16.112  1.00 27.51 ? 189  GLN A C   1 
ATOM   1517 O  O   . GLN A 1 192 ? 4.801  7.397  15.838  1.00 26.84 ? 189  GLN A O   1 
ATOM   1518 C  CB  . GLN A 1 192 ? 6.123  10.153 14.723  1.00 26.47 ? 189  GLN A CB  1 
ATOM   1519 C  CG  . GLN A 1 192 ? 6.154  11.089 13.555  1.00 27.78 ? 189  GLN A CG  1 
ATOM   1520 C  CD  . GLN A 1 192 ? 5.207  10.656 12.468  1.00 29.85 ? 189  GLN A CD  1 
ATOM   1521 O  OE1 . GLN A 1 192 ? 4.203  11.331 12.204  1.00 35.17 ? 189  GLN A OE1 1 
ATOM   1522 N  NE2 . GLN A 1 192 ? 5.474  9.505  11.873  1.00 26.63 ? 189  GLN A NE2 1 
ATOM   1523 N  N   . PHE A 1 193 ? 4.911  9.046  17.333  1.00 28.02 ? 190  PHE A N   1 
ATOM   1524 C  CA  . PHE A 1 193 ? 5.097  8.152  18.420  1.00 28.83 ? 190  PHE A CA  1 
ATOM   1525 C  C   . PHE A 1 193 ? 3.845  7.392  18.795  1.00 30.16 ? 190  PHE A C   1 
ATOM   1526 O  O   . PHE A 1 193 ? 3.907  6.406  19.472  1.00 29.69 ? 190  PHE A O   1 
ATOM   1527 C  CB  . PHE A 1 193 ? 5.566  8.926  19.602  1.00 27.98 ? 190  PHE A CB  1 
ATOM   1528 C  CG  . PHE A 1 193 ? 5.493  8.187  20.854  1.00 27.90 ? 190  PHE A CG  1 
ATOM   1529 C  CD1 . PHE A 1 193 ? 6.601  7.623  21.385  1.00 30.85 ? 190  PHE A CD1 1 
ATOM   1530 C  CD2 . PHE A 1 193 ? 4.323  8.076  21.529  1.00 29.05 ? 190  PHE A CD2 1 
ATOM   1531 C  CE1 . PHE A 1 193 ? 6.549  6.964  22.546  1.00 32.03 ? 190  PHE A CE1 1 
ATOM   1532 C  CE2 . PHE A 1 193 ? 4.276  7.423  22.702  1.00 30.16 ? 190  PHE A CE2 1 
ATOM   1533 C  CZ  . PHE A 1 193 ? 5.383  6.865  23.212  1.00 30.12 ? 190  PHE A CZ  1 
ATOM   1534 N  N   . ALA A 1 194 ? 2.706  7.884  18.369  1.00 31.98 ? 191  ALA A N   1 
ATOM   1535 C  CA  . ALA A 1 194 ? 1.472  7.252  18.735  1.00 33.59 ? 191  ALA A CA  1 
ATOM   1536 C  C   . ALA A 1 194 ? 1.527  5.783  18.343  1.00 33.96 ? 191  ALA A C   1 
ATOM   1537 O  O   . ALA A 1 194 ? 1.573  4.902  19.210  1.00 35.94 ? 191  ALA A O   1 
ATOM   1538 C  CB  . ALA A 1 194 ? 0.319  7.956  18.084  1.00 33.81 ? 191  ALA A CB  1 
ATOM   1539 N  N   . MET B 1 4   ? 55.716 15.844 20.893  1.00 38.94 ? 1    MET B N   1 
ATOM   1540 C  CA  . MET B 1 4   ? 55.093 16.871 21.781  1.00 38.64 ? 1    MET B CA  1 
ATOM   1541 C  C   . MET B 1 4   ? 53.670 17.254 21.347  1.00 37.33 ? 1    MET B C   1 
ATOM   1542 O  O   . MET B 1 4   ? 52.735 16.465 21.597  1.00 38.93 ? 1    MET B O   1 
ATOM   1543 C  CB  . MET B 1 4   ? 55.995 18.098 21.975  1.00 39.61 ? 1    MET B CB  1 
ATOM   1544 C  CG  . MET B 1 4   ? 56.477 18.894 20.724  1.00 41.08 ? 1    MET B CG  1 
ATOM   1545 S  SD  . MET B 1 4   ? 56.553 20.641 21.183  1.00 49.09 ? 1    MET B SD  1 
ATOM   1546 C  CE  . MET B 1 4   ? 57.963 20.780 22.309  1.00 39.61 ? 1    MET B CE  1 
ATOM   1547 N  N   . LYS B 1 5   ? 53.465 18.432 20.763  1.00 35.05 ? 2    LYS B N   1 
ATOM   1548 C  CA  . LYS B 1 5   ? 52.155 18.817 20.257  1.00 34.05 ? 2    LYS B CA  1 
ATOM   1549 C  C   . LYS B 1 5   ? 52.177 19.146 18.757  1.00 31.38 ? 2    LYS B C   1 
ATOM   1550 O  O   . LYS B 1 5   ? 53.165 19.631 18.243  1.00 31.16 ? 2    LYS B O   1 
ATOM   1551 C  CB  . LYS B 1 5   ? 51.630 19.991 21.079  1.00 34.38 ? 2    LYS B CB  1 
ATOM   1552 C  CG  . LYS B 1 5   ? 51.072 19.521 22.412  1.00 37.23 ? 2    LYS B CG  1 
ATOM   1553 C  CD  . LYS B 1 5   ? 49.836 20.277 22.828  1.00 40.47 ? 2    LYS B CD  1 
ATOM   1554 C  CE  . LYS B 1 5   ? 49.344 19.790 24.196  1.00 40.73 ? 2    LYS B CE  1 
ATOM   1555 N  NZ  . LYS B 1 5   ? 48.909 20.941 25.004  1.00 41.18 ? 2    LYS B NZ  1 
ATOM   1556 N  N   . PHE B 1 6   ? 51.093 18.827 18.060  1.00 28.53 ? 3    PHE B N   1 
ATOM   1557 C  CA  . PHE B 1 6   ? 50.948 19.149 16.634  1.00 27.17 ? 3    PHE B CA  1 
ATOM   1558 C  C   . PHE B 1 6   ? 50.501 20.580 16.488  1.00 26.55 ? 3    PHE B C   1 
ATOM   1559 O  O   . PHE B 1 6   ? 49.790 21.092 17.340  1.00 24.30 ? 3    PHE B O   1 
ATOM   1560 C  CB  . PHE B 1 6   ? 49.915 18.231 15.968  1.00 26.76 ? 3    PHE B CB  1 
ATOM   1561 C  CG  . PHE B 1 6   ? 50.369 16.808 15.895  1.00 24.08 ? 3    PHE B CG  1 
ATOM   1562 C  CD1 . PHE B 1 6   ? 51.368 16.437 14.993  1.00 25.73 ? 3    PHE B CD1 1 
ATOM   1563 C  CD2 . PHE B 1 6   ? 49.881 15.868 16.785  1.00 18.91 ? 3    PHE B CD2 1 
ATOM   1564 C  CE1 . PHE B 1 6   ? 51.815 15.120 14.932  1.00 24.66 ? 3    PHE B CE1 1 
ATOM   1565 C  CE2 . PHE B 1 6   ? 50.311 14.587 16.737  1.00 20.73 ? 3    PHE B CE2 1 
ATOM   1566 C  CZ  . PHE B 1 6   ? 51.303 14.193 15.809  1.00 22.29 ? 3    PHE B CZ  1 
ATOM   1567 N  N   . GLU B 1 7   ? 50.966 21.252 15.455  1.00 27.12 ? 4    GLU B N   1 
ATOM   1568 C  CA  . GLU B 1 7   ? 50.536 22.636 15.241  1.00 27.96 ? 4    GLU B CA  1 
ATOM   1569 C  C   . GLU B 1 7   ? 49.873 22.754 13.869  1.00 26.88 ? 4    GLU B C   1 
ATOM   1570 O  O   . GLU B 1 7   ? 50.029 21.883 13.020  1.00 26.57 ? 4    GLU B O   1 
ATOM   1571 C  CB  . GLU B 1 7   ? 51.706 23.612 15.433  1.00 29.72 ? 4    GLU B CB  1 
ATOM   1572 C  CG  . GLU B 1 7   ? 51.275 25.065 15.783  1.00 35.85 ? 4    GLU B CG  1 
ATOM   1573 C  CD  . GLU B 1 7   ? 52.475 26.008 16.025  1.00 42.79 ? 4    GLU B CD  1 
ATOM   1574 O  OE1 . GLU B 1 7   ? 53.631 25.505 15.996  1.00 48.33 ? 4    GLU B OE1 1 
ATOM   1575 O  OE2 . GLU B 1 7   ? 52.273 27.250 16.220  1.00 46.49 ? 4    GLU B OE2 1 
ATOM   1576 N  N   . LEU B 1 8   ? 49.076 23.793 13.696  1.00 25.46 ? 5    LEU B N   1 
ATOM   1577 C  CA  . LEU B 1 8   ? 48.481 24.112 12.430  1.00 25.47 ? 5    LEU B CA  1 
ATOM   1578 C  C   . LEU B 1 8   ? 49.637 24.625 11.549  1.00 25.62 ? 5    LEU B C   1 
ATOM   1579 O  O   . LEU B 1 8   ? 50.338 25.575 11.935  1.00 21.85 ? 5    LEU B O   1 
ATOM   1580 C  CB  . LEU B 1 8   ? 47.400 25.194 12.629  1.00 26.16 ? 5    LEU B CB  1 
ATOM   1581 C  CG  . LEU B 1 8   ? 46.577 25.618 11.413  1.00 26.05 ? 5    LEU B CG  1 
ATOM   1582 C  CD1 . LEU B 1 8   ? 45.665 24.462 11.027  1.00 27.31 ? 5    LEU B CD1 1 
ATOM   1583 C  CD2 . LEU B 1 8   ? 45.777 26.860 11.733  1.00 27.10 ? 5    LEU B CD2 1 
ATOM   1584 N  N   . PRO B 1 9   ? 49.848 24.010 10.368  1.00 26.07 ? 6    PRO B N   1 
ATOM   1585 C  CA  . PRO B 1 9   ? 50.997 24.474 9.566   1.00 27.60 ? 6    PRO B CA  1 
ATOM   1586 C  C   . PRO B 1 9   ? 50.697 25.863 9.034   1.00 27.08 ? 6    PRO B C   1 
ATOM   1587 O  O   . PRO B 1 9   ? 49.537 26.173 8.810   1.00 25.81 ? 6    PRO B O   1 
ATOM   1588 C  CB  . PRO B 1 9   ? 51.021 23.492 8.385   1.00 28.02 ? 6    PRO B CB  1 
ATOM   1589 C  CG  . PRO B 1 9   ? 49.540 23.154 8.154   1.00 29.07 ? 6    PRO B CG  1 
ATOM   1590 C  CD  . PRO B 1 9   ? 48.942 23.146 9.592   1.00 27.65 ? 6    PRO B CD  1 
ATOM   1591 N  N   . LYS B 1 10  ? 51.700 26.680 8.803   1.00 26.67 ? 7    LYS B N   1 
ATOM   1592 C  CA  . LYS B 1 10  ? 51.405 27.989 8.248   1.00 27.89 ? 7    LYS B CA  1 
ATOM   1593 C  C   . LYS B 1 10  ? 50.848 27.844 6.811   1.00 26.51 ? 7    LYS B C   1 
ATOM   1594 O  O   . LYS B 1 10  ? 51.221 26.942 6.051   1.00 24.84 ? 7    LYS B O   1 
ATOM   1595 C  CB  . LYS B 1 10  ? 52.595 28.935 8.368   1.00 29.16 ? 7    LYS B CB  1 
ATOM   1596 C  CG  . LYS B 1 10  ? 52.712 29.424 9.865   1.00 33.66 ? 7    LYS B CG  1 
ATOM   1597 C  CD  . LYS B 1 10  ? 53.572 30.661 10.137  1.00 39.45 ? 7    LYS B CD  1 
ATOM   1598 C  CE  . LYS B 1 10  ? 53.248 31.187 11.568  1.00 41.47 ? 7    LYS B CE  1 
ATOM   1599 N  NZ  . LYS B 1 10  ? 54.221 32.118 12.236  1.00 43.02 ? 7    LYS B NZ  1 
ATOM   1600 N  N   . LEU B 1 11  ? 49.872 28.658 6.483   1.00 26.34 ? 8    LEU B N   1 
ATOM   1601 C  CA  . LEU B 1 11  ? 49.291 28.577 5.162   1.00 26.23 ? 8    LEU B CA  1 
ATOM   1602 C  C   . LEU B 1 11  ? 50.404 28.979 4.155   1.00 26.43 ? 8    LEU B C   1 
ATOM   1603 O  O   . LEU B 1 11  ? 51.223 29.849 4.449   1.00 26.62 ? 8    LEU B O   1 
ATOM   1604 C  CB  . LEU B 1 11  ? 48.047 29.465 5.114   1.00 26.71 ? 8    LEU B CB  1 
ATOM   1605 C  CG  . LEU B 1 11  ? 47.090 29.378 3.918   1.00 25.27 ? 8    LEU B CG  1 
ATOM   1606 C  CD1 . LEU B 1 11  ? 46.427 27.990 3.826   1.00 23.52 ? 8    LEU B CD1 1 
ATOM   1607 C  CD2 . LEU B 1 11  ? 46.033 30.508 4.071   1.00 24.66 ? 8    LEU B CD2 1 
ATOM   1608 N  N   . PRO B 1 12  ? 50.491 28.319 2.983   1.00 26.65 ? 9    PRO B N   1 
ATOM   1609 C  CA  . PRO B 1 12  ? 51.635 28.636 2.085   1.00 25.34 ? 9    PRO B CA  1 
ATOM   1610 C  C   . PRO B 1 12  ? 51.494 29.924 1.299   1.00 24.79 ? 9    PRO B C   1 
ATOM   1611 O  O   . PRO B 1 12  ? 52.362 30.202 0.486   1.00 23.76 ? 9    PRO B O   1 
ATOM   1612 C  CB  . PRO B 1 12  ? 51.638 27.461 1.093   1.00 25.74 ? 9    PRO B CB  1 
ATOM   1613 C  CG  . PRO B 1 12  ? 50.755 26.415 1.725   1.00 26.94 ? 9    PRO B CG  1 
ATOM   1614 C  CD  . PRO B 1 12  ? 49.735 27.170 2.488   1.00 26.81 ? 9    PRO B CD  1 
ATOM   1615 N  N   . TYR B 1 13  ? 50.414 30.672 1.527   1.00 23.78 ? 10   TYR B N   1 
ATOM   1616 C  CA  . TYR B 1 13  ? 50.108 31.921 0.818   1.00 24.07 ? 10   TYR B CA  1 
ATOM   1617 C  C   . TYR B 1 13  ? 49.199 32.778 1.704   1.00 23.46 ? 10   TYR B C   1 
ATOM   1618 O  O   . TYR B 1 13  ? 48.724 32.325 2.755   1.00 23.99 ? 10   TYR B O   1 
ATOM   1619 C  CB  . TYR B 1 13  ? 49.416 31.612 -0.562  1.00 24.20 ? 10   TYR B CB  1 
ATOM   1620 C  CG  . TYR B 1 13  ? 48.579 30.332 -0.512  1.00 22.27 ? 10   TYR B CG  1 
ATOM   1621 C  CD1 . TYR B 1 13  ? 47.328 30.307 0.143   1.00 21.64 ? 10   TYR B CD1 1 
ATOM   1622 C  CD2 . TYR B 1 13  ? 49.089 29.143 -1.032  1.00 24.34 ? 10   TYR B CD2 1 
ATOM   1623 C  CE1 . TYR B 1 13  ? 46.567 29.109 0.233   1.00 23.72 ? 10   TYR B CE1 1 
ATOM   1624 C  CE2 . TYR B 1 13  ? 48.383 27.939 -0.947  1.00 23.73 ? 10   TYR B CE2 1 
ATOM   1625 C  CZ  . TYR B 1 13  ? 47.122 27.913 -0.313  1.00 23.66 ? 10   TYR B CZ  1 
ATOM   1626 O  OH  . TYR B 1 13  ? 46.479 26.716 -0.225  1.00 21.61 ? 10   TYR B OH  1 
ATOM   1627 N  N   . ALA B 1 14  ? 48.954 34.000 1.265   1.00 22.75 ? 11   ALA B N   1 
ATOM   1628 C  CA  . ALA B 1 14  ? 48.066 34.950 1.942   1.00 23.46 ? 11   ALA B CA  1 
ATOM   1629 C  C   . ALA B 1 14  ? 46.642 34.398 1.934   1.00 23.48 ? 11   ALA B C   1 
ATOM   1630 O  O   . ALA B 1 14  ? 46.269 33.691 0.992   1.00 24.18 ? 11   ALA B O   1 
ATOM   1631 C  CB  . ALA B 1 14  ? 48.091 36.327 1.207   1.00 22.42 ? 11   ALA B CB  1 
ATOM   1632 N  N   . VAL B 1 15  ? 45.812 34.828 2.882   1.00 23.87 ? 12   VAL B N   1 
ATOM   1633 C  CA  . VAL B 1 15  ? 44.435 34.275 2.983   1.00 24.66 ? 12   VAL B CA  1 
ATOM   1634 C  C   . VAL B 1 15  ? 43.538 34.580 1.766   1.00 24.19 ? 12   VAL B C   1 
ATOM   1635 O  O   . VAL B 1 15  ? 42.539 33.911 1.582   1.00 23.87 ? 12   VAL B O   1 
ATOM   1636 C  CB  . VAL B 1 15  ? 43.715 34.710 4.287   1.00 23.76 ? 12   VAL B CB  1 
ATOM   1637 C  CG1 . VAL B 1 15  ? 44.344 34.004 5.482   1.00 25.80 ? 12   VAL B CG1 1 
ATOM   1638 C  CG2 . VAL B 1 15  ? 43.726 36.233 4.436   1.00 25.53 ? 12   VAL B CG2 1 
ATOM   1639 N  N   . ASP B 1 16  ? 43.903 35.600 0.976   1.00 24.57 ? 13   ASP B N   1 
ATOM   1640 C  CA  . ASP B 1 16  ? 43.139 36.036 -0.208  1.00 24.46 ? 13   ASP B CA  1 
ATOM   1641 C  C   . ASP B 1 16  ? 43.856 35.751 -1.540  1.00 24.25 ? 13   ASP B C   1 
ATOM   1642 O  O   . ASP B 1 16  ? 43.412 36.175 -2.616  1.00 23.51 ? 13   ASP B O   1 
ATOM   1643 C  CB  . ASP B 1 16  ? 42.770 37.523 -0.106  1.00 24.74 ? 13   ASP B CB  1 
ATOM   1644 C  CG  . ASP B 1 16  ? 43.986 38.458 0.048   1.00 25.47 ? 13   ASP B CG  1 
ATOM   1645 O  OD1 . ASP B 1 16  ? 45.157 38.023 0.042   1.00 26.46 ? 13   ASP B OD1 1 
ATOM   1646 O  OD2 . ASP B 1 16  ? 43.739 39.681 0.126   1.00 28.79 ? 13   ASP B OD2 1 
ATOM   1647 N  N   . ALA B 1 17  ? 44.934 34.990 -1.445  1.00 23.84 ? 14   ALA B N   1 
ATOM   1648 C  CA  . ALA B 1 17  ? 45.757 34.623 -2.577  1.00 24.30 ? 14   ALA B CA  1 
ATOM   1649 C  C   . ALA B 1 17  ? 45.012 33.733 -3.589  1.00 24.14 ? 14   ALA B C   1 
ATOM   1650 O  O   . ALA B 1 17  ? 45.317 33.752 -4.775  1.00 22.87 ? 14   ALA B O   1 
ATOM   1651 C  CB  . ALA B 1 17  ? 46.996 33.878 -2.066  1.00 25.20 ? 14   ALA B CB  1 
ATOM   1652 N  N   . LEU B 1 18  ? 44.017 33.001 -3.119  1.00 23.82 ? 15   LEU B N   1 
ATOM   1653 C  CA  . LEU B 1 18  ? 43.289 32.041 -3.969  1.00 24.52 ? 15   LEU B CA  1 
ATOM   1654 C  C   . LEU B 1 18  ? 41.967 32.589 -4.541  1.00 24.24 ? 15   LEU B C   1 
ATOM   1655 O  O   . LEU B 1 18  ? 41.267 31.862 -5.236  1.00 23.89 ? 15   LEU B O   1 
ATOM   1656 C  CB  . LEU B 1 18  ? 43.030 30.756 -3.183  1.00 23.85 ? 15   LEU B CB  1 
ATOM   1657 C  CG  . LEU B 1 18  ? 44.252 29.966 -2.730  1.00 23.24 ? 15   LEU B CG  1 
ATOM   1658 C  CD1 . LEU B 1 18  ? 43.742 28.633 -2.117  1.00 22.15 ? 15   LEU B CD1 1 
ATOM   1659 C  CD2 . LEU B 1 18  ? 45.237 29.680 -3.857  1.00 23.42 ? 15   LEU B CD2 1 
ATOM   1660 N  N   . GLU B 1 19  ? 41.661 33.868 -4.307  1.00 24.20 ? 16   GLU B N   1 
ATOM   1661 C  CA  . GLU B 1 19  ? 40.489 34.475 -4.944  1.00 25.50 ? 16   GLU B CA  1 
ATOM   1662 C  C   . GLU B 1 19  ? 40.847 34.583 -6.443  1.00 25.83 ? 16   GLU B C   1 
ATOM   1663 O  O   . GLU B 1 19  ? 41.993 34.828 -6.776  1.00 27.04 ? 16   GLU B O   1 
ATOM   1664 C  CB  . GLU B 1 19  ? 40.154 35.840 -4.332  1.00 26.26 ? 16   GLU B CB  1 
ATOM   1665 C  CG  . GLU B 1 19  ? 40.201 35.834 -2.797  1.00 28.23 ? 16   GLU B CG  1 
ATOM   1666 C  CD  . GLU B 1 19  ? 39.395 36.912 -2.175  1.00 30.90 ? 16   GLU B CD  1 
ATOM   1667 O  OE1 . GLU B 1 19  ? 39.895 38.063 -2.147  1.00 35.94 ? 16   GLU B OE1 1 
ATOM   1668 O  OE2 . GLU B 1 19  ? 38.249 36.638 -1.744  1.00 31.21 ? 16   GLU B OE2 1 
ATOM   1669 N  N   . SER B 1 20  ? 39.933 34.370 -7.372  1.00 25.22 ? 17   SER B N   1 
ATOM   1670 C  CA  . SER B 1 20  ? 38.519 34.296 -7.189  1.00 25.60 ? 17   SER B CA  1 
ATOM   1671 C  C   . SER B 1 20  ? 38.044 32.857 -6.909  1.00 25.34 ? 17   SER B C   1 
ATOM   1672 O  O   . SER B 1 20  ? 36.870 32.615 -6.576  1.00 25.83 ? 17   SER B O   1 
ATOM   1673 C  CB  . SER B 1 20  ? 37.942 34.851 -8.518  1.00 26.33 ? 17   SER B CB  1 
ATOM   1674 O  OG  . SER B 1 20  ? 36.561 34.830 -8.526  1.00 30.96 ? 17   SER B OG  1 
ATOM   1675 N  N   . THR B 1 21  ? 38.947 31.888 -6.981  1.00 24.09 ? 18   THR B N   1 
ATOM   1676 C  CA  . THR B 1 21  ? 38.535 30.495 -6.843  1.00 23.72 ? 18   THR B CA  1 
ATOM   1677 C  C   . THR B 1 21  ? 38.012 30.127 -5.463  1.00 23.54 ? 18   THR B C   1 
ATOM   1678 O  O   . THR B 1 21  ? 36.972 29.491 -5.342  1.00 22.31 ? 18   THR B O   1 
ATOM   1679 C  CB  . THR B 1 21  ? 39.690 29.581 -7.194  1.00 23.97 ? 18   THR B CB  1 
ATOM   1680 O  OG1 . THR B 1 21  ? 40.156 30.011 -8.464  1.00 22.54 ? 18   THR B OG1 1 
ATOM   1681 C  CG2 . THR B 1 21  ? 39.216 28.138 -7.254  1.00 22.42 ? 18   THR B CG2 1 
ATOM   1682 N  N   . ILE B 1 22  ? 38.758 30.527 -4.429  1.00 23.93 ? 19   ILE B N   1 
ATOM   1683 C  CA  . ILE B 1 22  ? 38.365 30.311 -3.047  1.00 23.46 ? 19   ILE B CA  1 
ATOM   1684 C  C   . ILE B 1 22  ? 38.510 31.626 -2.283  1.00 23.89 ? 19   ILE B C   1 
ATOM   1685 O  O   . ILE B 1 22  ? 39.541 32.274 -2.344  1.00 24.19 ? 19   ILE B O   1 
ATOM   1686 C  CB  . ILE B 1 22  ? 39.215 29.231 -2.335  1.00 23.92 ? 19   ILE B CB  1 
ATOM   1687 C  CG1 . ILE B 1 22  ? 39.094 27.882 -3.033  1.00 23.18 ? 19   ILE B CG1 1 
ATOM   1688 C  CG2 . ILE B 1 22  ? 38.763 29.078 -0.861  1.00 22.01 ? 19   ILE B CG2 1 
ATOM   1689 C  CD1 . ILE B 1 22  ? 40.125 26.833 -2.564  1.00 20.01 ? 19   ILE B CD1 1 
ATOM   1690 N  N   . SER B 1 23  ? 37.447 32.004 -1.581  1.00 23.48 ? 20   SER B N   1 
ATOM   1691 C  CA  . SER B 1 23  ? 37.333 33.321 -1.018  1.00 24.55 ? 20   SER B CA  1 
ATOM   1692 C  C   . SER B 1 23  ? 38.146 33.396 0.274   1.00 24.74 ? 20   SER B C   1 
ATOM   1693 O  O   . SER B 1 23  ? 38.408 32.386 0.943   1.00 24.47 ? 20   SER B O   1 
ATOM   1694 C  CB  . SER B 1 23  ? 35.871 33.666 -0.773  1.00 23.89 ? 20   SER B CB  1 
ATOM   1695 O  OG  . SER B 1 23  ? 35.363 33.076 0.396   1.00 24.06 ? 20   SER B OG  1 
ATOM   1696 N  N   . LYS B 1 24  ? 38.585 34.606 0.562   1.00 25.48 ? 21   LYS B N   1 
ATOM   1697 C  CA  . LYS B 1 24  ? 39.170 34.936 1.845   1.00 25.51 ? 21   LYS B CA  1 
ATOM   1698 C  C   . LYS B 1 24  ? 38.353 34.357 2.982   1.00 25.10 ? 21   LYS B C   1 
ATOM   1699 O  O   . LYS B 1 24  ? 38.927 33.798 3.899   1.00 23.85 ? 21   LYS B O   1 
ATOM   1700 C  CB  . LYS B 1 24  ? 39.259 36.451 2.026   1.00 25.70 ? 21   LYS B CB  1 
ATOM   1701 C  CG  . LYS B 1 24  ? 39.794 36.882 3.376   1.00 27.39 ? 21   LYS B CG  1 
ATOM   1702 C  CD  . LYS B 1 24  ? 40.034 38.405 3.434   1.00 28.39 ? 21   LYS B CD  1 
ATOM   1703 C  CE  . LYS B 1 24  ? 40.465 38.810 4.829   1.00 28.15 ? 21   LYS B CE  1 
ATOM   1704 N  NZ  . LYS B 1 24  ? 40.731 40.237 4.926   1.00 30.70 ? 21   LYS B NZ  1 
ATOM   1705 N  N   . GLU B 1 25  ? 37.030 34.542 2.934   1.00 24.38 ? 22   GLU B N   1 
ATOM   1706 C  CA  . GLU B 1 25  ? 36.157 34.049 3.985   1.00 24.58 ? 22   GLU B CA  1 
ATOM   1707 C  C   . GLU B 1 25  ? 36.261 32.526 4.091   1.00 24.78 ? 22   GLU B C   1 
ATOM   1708 O  O   . GLU B 1 25  ? 36.359 32.015 5.181   1.00 25.17 ? 22   GLU B O   1 
ATOM   1709 C  CB  . GLU B 1 25  ? 34.703 34.489 3.767   1.00 24.63 ? 22   GLU B CB  1 
ATOM   1710 C  CG  . GLU B 1 25  ? 33.764 34.118 4.916   1.00 26.35 ? 22   GLU B CG  1 
ATOM   1711 C  CD  . GLU B 1 25  ? 32.316 34.521 4.647   1.00 25.06 ? 22   GLU B CD  1 
ATOM   1712 O  OE1 . GLU B 1 25  ? 32.080 35.225 3.652   1.00 23.67 ? 22   GLU B OE1 1 
ATOM   1713 O  OE2 . GLU B 1 25  ? 31.421 34.138 5.423   1.00 25.27 ? 22   GLU B OE2 1 
ATOM   1714 N  N   . THR B 1 26  ? 36.279 31.805 2.976   1.00 23.84 ? 23   THR B N   1 
ATOM   1715 C  CA  . THR B 1 26  ? 36.411 30.351 3.045   1.00 23.65 ? 23   THR B CA  1 
ATOM   1716 C  C   . THR B 1 26  ? 37.700 29.954 3.724   1.00 23.88 ? 23   THR B C   1 
ATOM   1717 O  O   . THR B 1 26  ? 37.699 29.116 4.630   1.00 24.15 ? 23   THR B O   1 
ATOM   1718 C  CB  . THR B 1 26  ? 36.267 29.694 1.639   1.00 23.43 ? 23   THR B CB  1 
ATOM   1719 O  OG1 . THR B 1 26  ? 34.904 29.852 1.229   1.00 23.16 ? 23   THR B OG1 1 
ATOM   1720 C  CG2 . THR B 1 26  ? 36.646 28.236 1.645   1.00 22.29 ? 23   THR B CG2 1 
ATOM   1721 N  N   . ILE B 1 27  ? 38.794 30.578 3.331   1.00 25.02 ? 24   ILE B N   1 
ATOM   1722 C  CA  . ILE B 1 27  ? 40.051 30.300 3.976   1.00 25.60 ? 24   ILE B CA  1 
ATOM   1723 C  C   . ILE B 1 27  ? 39.995 30.575 5.492   1.00 24.58 ? 24   ILE B C   1 
ATOM   1724 O  O   . ILE B 1 27  ? 40.454 29.747 6.294   1.00 24.37 ? 24   ILE B O   1 
ATOM   1725 C  CB  . ILE B 1 27  ? 41.189 31.050 3.325   1.00 25.26 ? 24   ILE B CB  1 
ATOM   1726 C  CG1 . ILE B 1 27  ? 41.359 30.562 1.895   1.00 27.37 ? 24   ILE B CG1 1 
ATOM   1727 C  CG2 . ILE B 1 27  ? 42.485 30.869 4.124   1.00 26.20 ? 24   ILE B CG2 1 
ATOM   1728 C  CD1 . ILE B 1 27  ? 41.774 29.111 1.790   1.00 25.45 ? 24   ILE B CD1 1 
ATOM   1729 N  N   . GLU B 1 28  ? 39.433 31.727 5.861   1.00 24.04 ? 25   GLU B N   1 
ATOM   1730 C  CA  . GLU B 1 28  ? 39.213 32.084 7.249   1.00 22.86 ? 25   GLU B CA  1 
ATOM   1731 C  C   . GLU B 1 28  ? 38.538 30.960 8.006   1.00 21.42 ? 25   GLU B C   1 
ATOM   1732 O  O   . GLU B 1 28  ? 39.029 30.594 9.074   1.00 19.65 ? 25   GLU B O   1 
ATOM   1733 C  CB  . GLU B 1 28  ? 38.366 33.378 7.366   1.00 24.62 ? 25   GLU B CB  1 
ATOM   1734 C  CG  . GLU B 1 28  ? 37.848 33.778 8.801   1.00 29.47 ? 25   GLU B CG  1 
ATOM   1735 C  CD  . GLU B 1 28  ? 36.907 35.053 8.806   1.00 36.32 ? 25   GLU B CD  1 
ATOM   1736 O  OE1 . GLU B 1 28  ? 36.851 35.766 7.753   1.00 41.16 ? 25   GLU B OE1 1 
ATOM   1737 O  OE2 . GLU B 1 28  ? 36.265 35.325 9.875   1.00 37.07 ? 25   GLU B OE2 1 
ATOM   1738 N  N   . TYR B 1 29  ? 37.476 30.406 7.463   1.00 19.23 ? 26   TYR B N   1 
ATOM   1739 C  CA  . TYR B 1 29  ? 36.782 29.356 8.152   1.00 19.18 ? 26   TYR B CA  1 
ATOM   1740 C  C   . TYR B 1 29  ? 37.459 28.004 7.994   1.00 19.87 ? 26   TYR B C   1 
ATOM   1741 O  O   . TYR B 1 29  ? 37.694 27.335 8.947   1.00 19.45 ? 26   TYR B O   1 
ATOM   1742 C  CB  . TYR B 1 29  ? 35.335 29.271 7.721   1.00 19.54 ? 26   TYR B CB  1 
ATOM   1743 C  CG  . TYR B 1 29  ? 34.462 30.318 8.335   1.00 18.29 ? 26   TYR B CG  1 
ATOM   1744 C  CD1 . TYR B 1 29  ? 33.910 30.137 9.572   1.00 15.67 ? 26   TYR B CD1 1 
ATOM   1745 C  CD2 . TYR B 1 29  ? 34.206 31.493 7.683   1.00 16.55 ? 26   TYR B CD2 1 
ATOM   1746 C  CE1 . TYR B 1 29  ? 33.142 31.078 10.135  1.00 17.03 ? 26   TYR B CE1 1 
ATOM   1747 C  CE2 . TYR B 1 29  ? 33.430 32.435 8.242   1.00 17.89 ? 26   TYR B CE2 1 
ATOM   1748 C  CZ  . TYR B 1 29  ? 32.901 32.231 9.468   1.00 17.88 ? 26   TYR B CZ  1 
ATOM   1749 O  OH  . TYR B 1 29  ? 32.117 33.167 10.032  1.00 17.06 ? 26   TYR B OH  1 
ATOM   1750 N  N   . HIS B 1 30  ? 37.740 27.613 6.770   1.00 19.89 ? 27   HIS B N   1 
ATOM   1751 C  CA  . HIS B 1 30  ? 38.278 26.309 6.458   1.00 19.37 ? 27   HIS B CA  1 
ATOM   1752 C  C   . HIS B 1 30  ? 39.644 26.039 7.107   1.00 19.46 ? 27   HIS B C   1 
ATOM   1753 O  O   . HIS B 1 30  ? 39.810 25.087 7.797   1.00 18.04 ? 27   HIS B O   1 
ATOM   1754 C  CB  . HIS B 1 30  ? 38.306 26.135 4.953   1.00 18.70 ? 27   HIS B CB  1 
ATOM   1755 C  CG  . HIS B 1 30  ? 38.394 24.724 4.504   1.00 18.99 ? 27   HIS B CG  1 
ATOM   1756 N  ND1 . HIS B 1 30  ? 38.500 24.377 3.185   1.00 15.17 ? 27   HIS B ND1 1 
ATOM   1757 C  CD2 . HIS B 1 30  ? 38.398 23.569 5.197   1.00 15.41 ? 27   HIS B CD2 1 
ATOM   1758 C  CE1 . HIS B 1 30  ? 38.568 23.071 3.084   1.00 17.61 ? 27   HIS B CE1 1 
ATOM   1759 N  NE2 . HIS B 1 30  ? 38.498 22.558 4.290   1.00 14.21 ? 27   HIS B NE2 1 
ATOM   1760 N  N   . TYR B 1 31  ? 40.605 26.909 6.881   1.00 18.99 ? 28   TYR B N   1 
ATOM   1761 C  CA  . TYR B 1 31  ? 41.904 26.857 7.541   1.00 18.88 ? 28   TYR B CA  1 
ATOM   1762 C  C   . TYR B 1 31  ? 41.864 27.302 9.011   1.00 18.88 ? 28   TYR B C   1 
ATOM   1763 O  O   . TYR B 1 31  ? 42.300 26.593 9.913   1.00 19.33 ? 28   TYR B O   1 
ATOM   1764 C  CB  . TYR B 1 31  ? 42.929 27.695 6.750   1.00 18.39 ? 28   TYR B CB  1 
ATOM   1765 C  CG  . TYR B 1 31  ? 44.265 27.856 7.414   1.00 18.56 ? 28   TYR B CG  1 
ATOM   1766 C  CD1 . TYR B 1 31  ? 45.172 26.800 7.456   1.00 18.61 ? 28   TYR B CD1 1 
ATOM   1767 C  CD2 . TYR B 1 31  ? 44.649 29.062 7.970   1.00 20.25 ? 28   TYR B CD2 1 
ATOM   1768 C  CE1 . TYR B 1 31  ? 46.418 26.942 8.022   1.00 20.66 ? 28   TYR B CE1 1 
ATOM   1769 C  CE2 . TYR B 1 31  ? 45.912 29.199 8.582   1.00 21.47 ? 28   TYR B CE2 1 
ATOM   1770 C  CZ  . TYR B 1 31  ? 46.760 28.131 8.617   1.00 18.85 ? 28   TYR B CZ  1 
ATOM   1771 O  OH  . TYR B 1 31  ? 47.974 28.275 9.169   1.00 18.43 ? 28   TYR B OH  1 
ATOM   1772 N  N   . GLY B 1 32  ? 41.327 28.464 9.256   1.00 18.35 ? 29   GLY B N   1 
ATOM   1773 C  CA  . GLY B 1 32  ? 41.463 29.075 10.549  1.00 19.62 ? 29   GLY B CA  1 
ATOM   1774 C  C   . GLY B 1 32  ? 40.562 28.486 11.603  1.00 18.68 ? 29   GLY B C   1 
ATOM   1775 O  O   . GLY B 1 32  ? 40.859 28.587 12.762  1.00 18.33 ? 29   GLY B O   1 
ATOM   1776 N  N   . LYS B 1 33  ? 39.468 27.837 11.202  1.00 17.71 ? 30   LYS B N   1 
ATOM   1777 C  CA  . LYS B 1 33  ? 38.592 27.236 12.192  1.00 16.81 ? 30   LYS B CA  1 
ATOM   1778 C  C   . LYS B 1 33  ? 38.556 25.705 12.087  1.00 17.23 ? 30   LYS B C   1 
ATOM   1779 O  O   . LYS B 1 33  ? 38.808 25.026 13.102  1.00 16.82 ? 30   LYS B O   1 
ATOM   1780 C  CB  . LYS B 1 33  ? 37.209 27.854 12.106  1.00 17.00 ? 30   LYS B CB  1 
ATOM   1781 C  CG  . LYS B 1 33  ? 37.294 29.388 12.442  1.00 18.99 ? 30   LYS B CG  1 
ATOM   1782 C  CD  . LYS B 1 33  ? 35.931 30.052 12.492  1.00 22.23 ? 30   LYS B CD  1 
ATOM   1783 C  CE  . LYS B 1 33  ? 36.002 31.592 12.675  1.00 25.40 ? 30   LYS B CE  1 
ATOM   1784 N  NZ  . LYS B 1 33  ? 36.638 31.975 13.966  1.00 26.34 ? 30   LYS B NZ  1 
ATOM   1785 N  N   . HIS B 1 34  ? 38.219 25.165 10.902  1.00 15.48 ? 31   HIS B N   1 
ATOM   1786 C  CA  . HIS B 1 34  ? 38.036 23.730 10.765  1.00 16.16 ? 31   HIS B CA  1 
ATOM   1787 C  C   . HIS B 1 34  ? 39.362 23.016 10.943  1.00 15.39 ? 31   HIS B C   1 
ATOM   1788 O  O   . HIS B 1 34  ? 39.431 22.041 11.647  1.00 14.56 ? 31   HIS B O   1 
ATOM   1789 C  CB  . HIS B 1 34  ? 37.477 23.323 9.369   1.00 14.39 ? 31   HIS B CB  1 
ATOM   1790 C  CG  . HIS B 1 34  ? 36.041 23.672 9.134   1.00 14.28 ? 31   HIS B CG  1 
ATOM   1791 N  ND1 . HIS B 1 34  ? 35.008 22.783 9.330   1.00 15.99 ? 31   HIS B ND1 1 
ATOM   1792 C  CD2 . HIS B 1 34  ? 35.466 24.804 8.661   1.00 14.86 ? 31   HIS B CD2 1 
ATOM   1793 C  CE1 . HIS B 1 34  ? 33.859 23.351 9.007   1.00 20.25 ? 31   HIS B CE1 1 
ATOM   1794 N  NE2 . HIS B 1 34  ? 34.107 24.577 8.573   1.00 13.97 ? 31   HIS B NE2 1 
ATOM   1795 N  N   . HIS B 1 35  ? 40.385 23.451 10.212  1.00 16.93 ? 32   HIS B N   1 
ATOM   1796 C  CA  . HIS B 1 35  ? 41.692 22.767 10.222  1.00 16.80 ? 32   HIS B CA  1 
ATOM   1797 C  C   . HIS B 1 35  ? 42.263 22.970 11.631  1.00 17.71 ? 32   HIS B C   1 
ATOM   1798 O  O   . HIS B 1 35  ? 42.762 22.026 12.208  1.00 17.68 ? 32   HIS B O   1 
ATOM   1799 C  CB  . HIS B 1 35  ? 42.590 23.352 9.154   1.00 16.34 ? 32   HIS B CB  1 
ATOM   1800 C  CG  . HIS B 1 35  ? 43.870 22.625 8.874   1.00 15.12 ? 32   HIS B CG  1 
ATOM   1801 N  ND1 . HIS B 1 35  ? 44.268 21.432 9.466   1.00 17.26 ? 32   HIS B ND1 1 
ATOM   1802 C  CD2 . HIS B 1 35  ? 44.812 22.908 7.947   1.00 13.29 ? 32   HIS B CD2 1 
ATOM   1803 C  CE1 . HIS B 1 35  ? 45.411 21.034 8.924   1.00 13.48 ? 32   HIS B CE1 1 
ATOM   1804 N  NE2 . HIS B 1 35  ? 45.784 21.941 8.031   1.00 16.76 ? 32   HIS B NE2 1 
ATOM   1805 N  N   . GLN B 1 36  ? 42.113 24.161 12.201  1.00 18.33 ? 33   GLN B N   1 
ATOM   1806 C  CA  . GLN B 1 36  ? 42.581 24.411 13.588  1.00 18.78 ? 33   GLN B CA  1 
ATOM   1807 C  C   . GLN B 1 36  ? 41.885 23.490 14.625  1.00 17.83 ? 33   GLN B C   1 
ATOM   1808 O  O   . GLN B 1 36  ? 42.547 22.957 15.487  1.00 16.83 ? 33   GLN B O   1 
ATOM   1809 C  CB  . GLN B 1 36  ? 42.375 25.864 13.988  1.00 18.33 ? 33   GLN B CB  1 
ATOM   1810 C  CG  . GLN B 1 36  ? 42.715 26.149 15.386  1.00 20.94 ? 33   GLN B CG  1 
ATOM   1811 C  CD  . GLN B 1 36  ? 44.193 26.082 15.631  1.00 23.51 ? 33   GLN B CD  1 
ATOM   1812 O  OE1 . GLN B 1 36  ? 44.945 26.960 15.196  1.00 25.17 ? 33   GLN B OE1 1 
ATOM   1813 N  NE2 . GLN B 1 36  ? 44.619 25.067 16.342  1.00 23.92 ? 33   GLN B NE2 1 
ATOM   1814 N  N   . THR B 1 37  ? 40.564 23.296 14.485  1.00 17.49 ? 34   THR B N   1 
ATOM   1815 C  CA  . THR B 1 37  ? 39.781 22.413 15.369  1.00 16.75 ? 34   THR B CA  1 
ATOM   1816 C  C   . THR B 1 37  ? 40.289 20.984 15.325  1.00 15.91 ? 34   THR B C   1 
ATOM   1817 O  O   . THR B 1 37  ? 40.430 20.316 16.381  1.00 16.28 ? 34   THR B O   1 
ATOM   1818 C  CB  . THR B 1 37  ? 38.291 22.479 15.031  1.00 17.10 ? 34   THR B CB  1 
ATOM   1819 O  OG1 . THR B 1 37  ? 37.858 23.823 15.234  1.00 14.59 ? 34   THR B OG1 1 
ATOM   1820 C  CG2 . THR B 1 37  ? 37.450 21.512 15.895  1.00 16.16 ? 34   THR B CG2 1 
ATOM   1821 N  N   . TYR B 1 38  ? 40.613 20.520 14.136  1.00 15.09 ? 35   TYR B N   1 
ATOM   1822 C  CA  . TYR B 1 38  ? 41.181 19.164 14.008  1.00 15.73 ? 35   TYR B CA  1 
ATOM   1823 C  C   . TYR B 1 38  ? 42.514 19.033 14.761  1.00 15.81 ? 35   TYR B C   1 
ATOM   1824 O  O   . TYR B 1 38  ? 42.739 18.026 15.416  1.00 15.68 ? 35   TYR B O   1 
ATOM   1825 C  CB  . TYR B 1 38  ? 41.363 18.757 12.531  1.00 15.67 ? 35   TYR B CB  1 
ATOM   1826 C  CG  . TYR B 1 38  ? 40.043 18.569 11.725  1.00 14.64 ? 35   TYR B CG  1 
ATOM   1827 C  CD1 . TYR B 1 38  ? 39.049 17.677 12.149  1.00 16.65 ? 35   TYR B CD1 1 
ATOM   1828 C  CD2 . TYR B 1 38  ? 39.828 19.243 10.514  1.00 14.57 ? 35   TYR B CD2 1 
ATOM   1829 C  CE1 . TYR B 1 38  ? 37.886 17.499 11.455  1.00 16.99 ? 35   TYR B CE1 1 
ATOM   1830 C  CE2 . TYR B 1 38  ? 38.618 19.066 9.796   1.00 18.60 ? 35   TYR B CE2 1 
ATOM   1831 C  CZ  . TYR B 1 38  ? 37.672 18.220 10.284  1.00 16.64 ? 35   TYR B CZ  1 
ATOM   1832 O  OH  . TYR B 1 38  ? 36.534 18.021 9.584   1.00 21.59 ? 35   TYR B OH  1 
ATOM   1833 N  N   . VAL B 1 39  ? 43.400 20.036 14.616  1.00 17.25 ? 36   VAL B N   1 
ATOM   1834 C  CA  . VAL B 1 39  ? 44.657 20.078 15.341  1.00 16.69 ? 36   VAL B CA  1 
ATOM   1835 C  C   . VAL B 1 39  ? 44.413 20.086 16.853  1.00 19.29 ? 36   VAL B C   1 
ATOM   1836 O  O   . VAL B 1 39  ? 44.931 19.242 17.561  1.00 18.89 ? 36   VAL B O   1 
ATOM   1837 C  CB  . VAL B 1 39  ? 45.523 21.266 14.948  1.00 17.14 ? 36   VAL B CB  1 
ATOM   1838 C  CG1 . VAL B 1 39  ? 46.799 21.332 15.883  1.00 13.78 ? 36   VAL B CG1 1 
ATOM   1839 C  CG2 . VAL B 1 39  ? 45.931 21.198 13.429  1.00 15.16 ? 36   VAL B CG2 1 
ATOM   1840 N  N   . THR B 1 40  ? 43.544 20.972 17.336  1.00 18.87 ? 37   THR B N   1 
ATOM   1841 C  CA  . THR B 1 40  ? 43.262 21.020 18.767  1.00 19.43 ? 37   THR B CA  1 
ATOM   1842 C  C   . THR B 1 40  ? 42.697 19.711 19.292  1.00 19.19 ? 37   THR B C   1 
ATOM   1843 O  O   . THR B 1 40  ? 43.161 19.179 20.340  1.00 17.34 ? 37   THR B O   1 
ATOM   1844 C  CB  . THR B 1 40  ? 42.291 22.147 19.094  1.00 20.01 ? 37   THR B CB  1 
ATOM   1845 O  OG1 . THR B 1 40  ? 42.892 23.347 18.644  1.00 20.18 ? 37   THR B OG1 1 
ATOM   1846 C  CG2 . THR B 1 40  ? 41.976 22.193 20.606  1.00 20.73 ? 37   THR B CG2 1 
ATOM   1847 N  N   . ASN B 1 41  ? 41.721 19.154 18.570  1.00 18.92 ? 38   ASN B N   1 
ATOM   1848 C  CA  . ASN B 1 41  ? 41.138 17.868 18.981  1.00 18.37 ? 38   ASN B CA  1 
ATOM   1849 C  C   . ASN B 1 41  ? 42.168 16.757 18.971  1.00 18.05 ? 38   ASN B C   1 
ATOM   1850 O  O   . ASN B 1 41  ? 42.172 15.919 19.890  1.00 17.20 ? 38   ASN B O   1 
ATOM   1851 C  CB  . ASN B 1 41  ? 39.932 17.450 18.112  1.00 18.25 ? 38   ASN B CB  1 
ATOM   1852 C  CG  . ASN B 1 41  ? 38.747 18.405 18.232  1.00 21.13 ? 38   ASN B CG  1 
ATOM   1853 O  OD1 . ASN B 1 41  ? 38.685 19.286 19.112  1.00 19.90 ? 38   ASN B OD1 1 
ATOM   1854 N  ND2 . ASN B 1 41  ? 37.811 18.228 17.360  1.00 22.43 ? 38   ASN B ND2 1 
ATOM   1855 N  N   . LEU B 1 42  ? 43.006 16.724 17.917  1.00 17.04 ? 39   LEU B N   1 
ATOM   1856 C  CA  . LEU B 1 42  ? 44.023 15.690 17.828  1.00 16.31 ? 39   LEU B CA  1 
ATOM   1857 C  C   . LEU B 1 42  ? 44.913 15.730 19.087  1.00 16.66 ? 39   LEU B C   1 
ATOM   1858 O  O   . LEU B 1 42  ? 45.129 14.706 19.758  1.00 16.15 ? 39   LEU B O   1 
ATOM   1859 C  CB  . LEU B 1 42  ? 44.853 15.849 16.563  1.00 16.03 ? 39   LEU B CB  1 
ATOM   1860 C  CG  . LEU B 1 42  ? 46.065 14.920 16.412  1.00 15.10 ? 39   LEU B CG  1 
ATOM   1861 C  CD1 . LEU B 1 42  ? 45.572 13.452 16.345  1.00 15.49 ? 39   LEU B CD1 1 
ATOM   1862 C  CD2 . LEU B 1 42  ? 46.948 15.308 15.249  1.00 15.37 ? 39   LEU B CD2 1 
ATOM   1863 N  N   . ASN B 1 43  ? 45.428 16.917 19.410  1.00 16.16 ? 40   ASN B N   1 
ATOM   1864 C  CA  . ASN B 1 43  ? 46.302 17.082 20.590  1.00 17.90 ? 40   ASN B CA  1 
ATOM   1865 C  C   . ASN B 1 43  ? 45.607 16.633 21.884  1.00 18.43 ? 40   ASN B C   1 
ATOM   1866 O  O   . ASN B 1 43  ? 46.185 15.871 22.685  1.00 19.27 ? 40   ASN B O   1 
ATOM   1867 C  CB  . ASN B 1 43  ? 46.819 18.532 20.701  1.00 17.07 ? 40   ASN B CB  1 
ATOM   1868 C  CG  . ASN B 1 43  ? 47.886 18.890 19.622  1.00 21.30 ? 40   ASN B CG  1 
ATOM   1869 O  OD1 . ASN B 1 43  ? 48.694 18.031 19.194  1.00 17.83 ? 40   ASN B OD1 1 
ATOM   1870 N  ND2 . ASN B 1 43  ? 47.874 20.163 19.163  1.00 15.87 ? 40   ASN B ND2 1 
ATOM   1871 N  N   . ASN B 1 44  ? 44.361 17.049 22.048  1.00 18.17 ? 41   ASN B N   1 
ATOM   1872 C  CA  . ASN B 1 44  ? 43.552 16.690 23.222  1.00 17.52 ? 41   ASN B CA  1 
ATOM   1873 C  C   . ASN B 1 44  ? 43.376 15.210 23.354  1.00 16.78 ? 41   ASN B C   1 
ATOM   1874 O  O   . ASN B 1 44  ? 43.549 14.632 24.443  1.00 12.91 ? 41   ASN B O   1 
ATOM   1875 C  CB  . ASN B 1 44  ? 42.200 17.390 23.168  1.00 17.98 ? 41   ASN B CB  1 
ATOM   1876 C  CG  . ASN B 1 44  ? 42.327 18.846 23.543  1.00 23.87 ? 41   ASN B CG  1 
ATOM   1877 O  OD1 . ASN B 1 44  ? 43.406 19.268 23.994  1.00 27.75 ? 41   ASN B OD1 1 
ATOM   1878 N  ND2 . ASN B 1 44  ? 41.233 19.618 23.422  1.00 28.66 ? 41   ASN B ND2 1 
ATOM   1879 N  N   . LEU B 1 45  ? 43.132 14.552 22.224  1.00 15.25 ? 42   LEU B N   1 
ATOM   1880 C  CA  . LEU B 1 45  ? 42.852 13.098 22.269  1.00 16.27 ? 42   LEU B CA  1 
ATOM   1881 C  C   . LEU B 1 45  ? 44.097 12.198 22.414  1.00 15.31 ? 42   LEU B C   1 
ATOM   1882 O  O   . LEU B 1 45  ? 44.051 11.117 23.016  1.00 13.47 ? 42   LEU B O   1 
ATOM   1883 C  CB  . LEU B 1 45  ? 42.066 12.684 21.007  1.00 15.67 ? 42   LEU B CB  1 
ATOM   1884 C  CG  . LEU B 1 45  ? 40.632 13.199 20.898  1.00 17.59 ? 42   LEU B CG  1 
ATOM   1885 C  CD1 . LEU B 1 45  ? 40.028 12.949 19.523  1.00 18.27 ? 42   LEU B CD1 1 
ATOM   1886 C  CD2 . LEU B 1 45  ? 39.737 12.610 22.068  1.00 21.82 ? 42   LEU B CD2 1 
ATOM   1887 N  N   . VAL B 1 46  ? 45.195 12.634 21.792  1.00 15.86 ? 43   VAL B N   1 
ATOM   1888 C  CA  . VAL B 1 46  ? 46.460 11.919 21.808  1.00 16.40 ? 43   VAL B CA  1 
ATOM   1889 C  C   . VAL B 1 46  ? 47.158 12.003 23.151  1.00 16.27 ? 43   VAL B C   1 
ATOM   1890 O  O   . VAL B 1 46  ? 47.849 11.058 23.602  1.00 13.61 ? 43   VAL B O   1 
ATOM   1891 C  CB  . VAL B 1 46  ? 47.317 12.450 20.639  1.00 17.44 ? 43   VAL B CB  1 
ATOM   1892 C  CG1 . VAL B 1 46  ? 48.702 12.256 20.837  1.00 22.47 ? 43   VAL B CG1 1 
ATOM   1893 C  CG2 . VAL B 1 46  ? 46.799 11.741 19.391  1.00 17.77 ? 43   VAL B CG2 1 
ATOM   1894 N  N   . GLU B 1 47  ? 46.919 13.102 23.847  1.00 18.13 ? 44   GLU B N   1 
ATOM   1895 C  CA  . GLU B 1 47  ? 47.706 13.382 25.042  1.00 18.58 ? 44   GLU B CA  1 
ATOM   1896 C  C   . GLU B 1 47  ? 47.668 12.191 25.970  1.00 19.89 ? 44   GLU B C   1 
ATOM   1897 O  O   . GLU B 1 47  ? 46.582 11.744 26.365  1.00 20.83 ? 44   GLU B O   1 
ATOM   1898 C  CB  . GLU B 1 47  ? 47.149 14.602 25.770  1.00 19.43 ? 44   GLU B CB  1 
ATOM   1899 C  CG  . GLU B 1 47  ? 48.025 15.030 26.966  1.00 20.30 ? 44   GLU B CG  1 
ATOM   1900 C  CD  . GLU B 1 47  ? 47.435 16.241 27.673  1.00 23.82 ? 44   GLU B CD  1 
ATOM   1901 O  OE1 . GLU B 1 47  ? 47.831 16.514 28.811  1.00 28.28 ? 44   GLU B OE1 1 
ATOM   1902 O  OE2 . GLU B 1 47  ? 46.558 16.890 27.088  1.00 27.16 ? 44   GLU B OE2 1 
ATOM   1903 N  N   . GLY B 1 48  ? 48.843 11.670 26.342  1.00 21.07 ? 45   GLY B N   1 
ATOM   1904 C  CA  . GLY B 1 48  ? 48.918 10.591 27.363  1.00 21.38 ? 45   GLY B CA  1 
ATOM   1905 C  C   . GLY B 1 48  ? 48.709 9.169  26.807  1.00 21.05 ? 45   GLY B C   1 
ATOM   1906 O  O   . GLY B 1 48  ? 48.766 8.167  27.566  1.00 22.95 ? 45   GLY B O   1 
ATOM   1907 N  N   . THR B 1 49  ? 48.410 9.071  25.514  1.00 19.89 ? 46   THR B N   1 
ATOM   1908 C  CA  . THR B 1 49  ? 48.296 7.768  24.826  1.00 17.99 ? 46   THR B CA  1 
ATOM   1909 C  C   . THR B 1 49  ? 49.612 7.403  24.197  1.00 17.32 ? 46   THR B C   1 
ATOM   1910 O  O   . THR B 1 49  ? 50.542 8.220  24.118  1.00 16.66 ? 46   THR B O   1 
ATOM   1911 C  CB  . THR B 1 49  ? 47.228 7.821  23.713  1.00 18.54 ? 46   THR B CB  1 
ATOM   1912 O  OG1 . THR B 1 49  ? 47.717 8.541  22.548  1.00 16.65 ? 46   THR B OG1 1 
ATOM   1913 C  CG2 . THR B 1 49  ? 45.943 8.485  24.215  1.00 19.09 ? 46   THR B CG2 1 
ATOM   1914 N  N   . GLU B 1 50  ? 49.644 6.188  23.640  1.00 16.32 ? 47   GLU B N   1 
ATOM   1915 C  CA  . GLU B 1 50  ? 50.806 5.652  22.914  1.00 14.63 ? 47   GLU B CA  1 
ATOM   1916 C  C   . GLU B 1 50  ? 51.085 6.450  21.622  1.00 16.19 ? 47   GLU B C   1 
ATOM   1917 O  O   . GLU B 1 50  ? 52.174 6.388  21.104  1.00 17.70 ? 47   GLU B O   1 
ATOM   1918 C  CB  . GLU B 1 50  ? 50.560 4.201  22.581  1.00 15.26 ? 47   GLU B CB  1 
ATOM   1919 C  CG  . GLU B 1 50  ? 50.350 3.227  23.760  1.00 14.89 ? 47   GLU B CG  1 
ATOM   1920 C  CD  . GLU B 1 50  ? 48.910 3.033  24.200  1.00 18.15 ? 47   GLU B CD  1 
ATOM   1921 O  OE1 . GLU B 1 50  ? 48.044 3.917  23.965  1.00 18.36 ? 47   GLU B OE1 1 
ATOM   1922 O  OE2 . GLU B 1 50  ? 48.656 1.992  24.841  1.00 17.46 ? 47   GLU B OE2 1 
ATOM   1923 N  N   . HIS B 1 51  ? 50.071 7.140  21.100  1.00 16.87 ? 48   HIS B N   1 
ATOM   1924 C  CA  . HIS B 1 51  ? 50.200 8.010  19.932  1.00 17.82 ? 48   HIS B CA  1 
ATOM   1925 C  C   . HIS B 1 51  ? 50.878 9.329  20.223  1.00 18.19 ? 48   HIS B C   1 
ATOM   1926 O  O   . HIS B 1 51  ? 51.393 9.977  19.284  1.00 19.26 ? 48   HIS B O   1 
ATOM   1927 C  CB  . HIS B 1 51  ? 48.855 8.295  19.283  1.00 18.14 ? 48   HIS B CB  1 
ATOM   1928 C  CG  . HIS B 1 51  ? 48.217 7.102  18.625  1.00 17.67 ? 48   HIS B CG  1 
ATOM   1929 N  ND1 . HIS B 1 51  ? 48.792 6.426  17.565  1.00 16.68 ? 48   HIS B ND1 1 
ATOM   1930 C  CD2 . HIS B 1 51  ? 47.033 6.498  18.849  1.00 19.60 ? 48   HIS B CD2 1 
ATOM   1931 C  CE1 . HIS B 1 51  ? 48.012 5.418  17.213  1.00 14.67 ? 48   HIS B CE1 1 
ATOM   1932 N  NE2 . HIS B 1 51  ? 46.930 5.445  17.966  1.00 17.46 ? 48   HIS B NE2 1 
ATOM   1933 N  N   . ASP B 1 52  ? 50.907 9.747  21.493  1.00 19.69 ? 49   ASP B N   1 
ATOM   1934 C  CA  . ASP B 1 52  ? 51.597 10.953 21.875  1.00 19.21 ? 49   ASP B CA  1 
ATOM   1935 C  C   . ASP B 1 52  ? 53.073 10.774 21.588  1.00 19.37 ? 49   ASP B C   1 
ATOM   1936 O  O   . ASP B 1 52  ? 53.695 9.926  22.140  1.00 19.98 ? 49   ASP B O   1 
ATOM   1937 C  CB  . ASP B 1 52  ? 51.349 11.269 23.386  1.00 18.35 ? 49   ASP B CB  1 
ATOM   1938 C  CG  . ASP B 1 52  ? 51.678 12.712 23.744  1.00 21.21 ? 49   ASP B CG  1 
ATOM   1939 O  OD1 . ASP B 1 52  ? 52.287 13.472 22.957  1.00 26.44 ? 49   ASP B OD1 1 
ATOM   1940 O  OD2 . ASP B 1 52  ? 51.329 13.097 24.849  1.00 19.67 ? 49   ASP B OD2 1 
ATOM   1941 N  N   . GLY B 1 53  ? 53.618 11.549 20.663  1.00 18.80 ? 50   GLY B N   1 
ATOM   1942 C  CA  . GLY B 1 53  ? 55.014 11.403 20.263  1.00 18.59 ? 50   GLY B CA  1 
ATOM   1943 C  C   . GLY B 1 53  ? 55.230 10.783 18.897  1.00 17.78 ? 50   GLY B C   1 
ATOM   1944 O  O   . GLY B 1 53  ? 56.317 10.853 18.367  1.00 18.53 ? 50   GLY B O   1 
ATOM   1945 N  N   . ARG B 1 54  ? 54.214 10.135 18.348  1.00 15.89 ? 51   ARG B N   1 
ATOM   1946 C  CA  . ARG B 1 54  ? 54.322 9.517  17.052  1.00 16.38 ? 51   ARG B CA  1 
ATOM   1947 C  C   . ARG B 1 54  ? 54.204 10.561 15.940  1.00 15.92 ? 51   ARG B C   1 
ATOM   1948 O  O   . ARG B 1 54  ? 53.599 11.639 16.138  1.00 16.08 ? 51   ARG B O   1 
ATOM   1949 C  CB  . ARG B 1 54  ? 53.229 8.462  16.876  1.00 15.90 ? 51   ARG B CB  1 
ATOM   1950 C  CG  . ARG B 1 54  ? 53.501 7.127  17.666  1.00 15.84 ? 51   ARG B CG  1 
ATOM   1951 C  CD  . ARG B 1 54  ? 52.508 6.080  17.319  1.00 16.20 ? 51   ARG B CD  1 
ATOM   1952 N  NE  . ARG B 1 54  ? 52.834 4.849  18.016  1.00 14.99 ? 51   ARG B NE  1 
ATOM   1953 C  CZ  . ARG B 1 54  ? 52.006 4.099  18.721  1.00 17.13 ? 51   ARG B CZ  1 
ATOM   1954 N  NH1 . ARG B 1 54  ? 50.707 4.412  18.834  1.00 14.80 ? 51   ARG B NH1 1 
ATOM   1955 N  NH2 . ARG B 1 54  ? 52.507 3.003  19.301  1.00 13.96 ? 51   ARG B NH2 1 
ATOM   1956 N  N   . ASN B 1 55  ? 54.855 10.322 14.816  1.00 16.21 ? 52   ASN B N   1 
ATOM   1957 C  CA  . ASN B 1 55  ? 54.662 11.213 13.673  1.00 15.44 ? 52   ASN B CA  1 
ATOM   1958 C  C   . ASN B 1 55  ? 53.244 11.110 13.122  1.00 15.63 ? 52   ASN B C   1 
ATOM   1959 O  O   . ASN B 1 55  ? 52.576 10.100 13.299  1.00 15.80 ? 52   ASN B O   1 
ATOM   1960 C  CB  . ASN B 1 55  ? 55.739 11.085 12.621  1.00 17.16 ? 52   ASN B CB  1 
ATOM   1961 C  CG  . ASN B 1 55  ? 55.739 9.758  11.910  1.00 23.60 ? 52   ASN B CG  1 
ATOM   1962 O  OD1 . ASN B 1 55  ? 54.753 9.365  11.282  1.00 23.82 ? 52   ASN B OD1 1 
ATOM   1963 N  ND2 . ASN B 1 55  ? 56.917 9.078  11.934  1.00 26.50 ? 52   ASN B ND2 1 
ATOM   1964 N  N   . LEU B 1 56  ? 52.748 12.211 12.555  1.00 15.31 ? 53   LEU B N   1 
ATOM   1965 C  CA  . LEU B 1 56  ? 51.364 12.255 12.088  1.00 14.89 ? 53   LEU B CA  1 
ATOM   1966 C  C   . LEU B 1 56  ? 50.996 11.113 11.139  1.00 15.76 ? 53   LEU B C   1 
ATOM   1967 O  O   . LEU B 1 56  ? 49.895 10.569 11.238  1.00 15.74 ? 53   LEU B O   1 
ATOM   1968 C  CB  . LEU B 1 56  ? 51.079 13.626 11.463  1.00 15.14 ? 53   LEU B CB  1 
ATOM   1969 C  CG  . LEU B 1 56  ? 49.622 13.857 11.071  1.00 15.29 ? 53   LEU B CG  1 
ATOM   1970 C  CD1 . LEU B 1 56  ? 48.655 13.870 12.142  1.00 13.21 ? 53   LEU B CD1 1 
ATOM   1971 C  CD2 . LEU B 1 56  ? 49.495 15.189 10.273  1.00 13.54 ? 53   LEU B CD2 1 
ATOM   1972 N  N   . GLU B 1 57  ? 51.896 10.770 10.204  1.00 13.84 ? 54   GLU B N   1 
ATOM   1973 C  CA  . GLU B 1 57  ? 51.587 9.724  9.225   1.00 14.42 ? 54   GLU B CA  1 
ATOM   1974 C  C   . GLU B 1 57  ? 51.420 8.381  9.877   1.00 14.09 ? 54   GLU B C   1 
ATOM   1975 O  O   . GLU B 1 57  ? 50.544 7.621  9.497   1.00 12.06 ? 54   GLU B O   1 
ATOM   1976 C  CB  . GLU B 1 57  ? 52.701 9.620  8.143   1.00 15.16 ? 54   GLU B CB  1 
ATOM   1977 C  CG  . GLU B 1 57  ? 52.660 10.733 7.176   1.00 17.50 ? 54   GLU B CG  1 
ATOM   1978 C  CD  . GLU B 1 57  ? 53.651 10.586 6.078   1.00 25.51 ? 54   GLU B CD  1 
ATOM   1979 O  OE1 . GLU B 1 57  ? 54.142 9.448  5.813   1.00 30.42 ? 54   GLU B OE1 1 
ATOM   1980 O  OE2 . GLU B 1 57  ? 53.921 11.632 5.463   1.00 29.75 ? 54   GLU B OE2 1 
ATOM   1981 N  N   . GLU B 1 58  ? 52.243 8.098  10.867  1.00 12.65 ? 55   GLU B N   1 
ATOM   1982 C  CA  . GLU B 1 58  ? 52.016 6.865  11.637  1.00 12.26 ? 55   GLU B CA  1 
ATOM   1983 C  C   . GLU B 1 58  ? 50.682 6.835  12.374  1.00 12.45 ? 55   GLU B C   1 
ATOM   1984 O  O   . GLU B 1 58  ? 49.929 5.810  12.355  1.00 11.34 ? 55   GLU B O   1 
ATOM   1985 C  CB  . GLU B 1 58  ? 53.157 6.572  12.579  1.00 13.48 ? 55   GLU B CB  1 
ATOM   1986 C  CG  . GLU B 1 58  ? 53.028 5.139  13.200  1.00 13.98 ? 55   GLU B CG  1 
ATOM   1987 C  CD  . GLU B 1 58  ? 54.105 4.797  14.286  1.00 16.50 ? 55   GLU B CD  1 
ATOM   1988 O  OE1 . GLU B 1 58  ? 55.289 5.240  14.161  1.00 14.66 ? 55   GLU B OE1 1 
ATOM   1989 O  OE2 . GLU B 1 58  ? 53.759 4.014  15.227  1.00 16.07 ? 55   GLU B OE2 1 
ATOM   1990 N  N   . ILE B 1 59  ? 50.376 7.935  13.046  1.00 13.03 ? 56   ILE B N   1 
ATOM   1991 C  CA  . ILE B 1 59  ? 49.055 8.032  13.683  1.00 12.01 ? 56   ILE B CA  1 
ATOM   1992 C  C   . ILE B 1 59  ? 47.923 7.744  12.681  1.00 12.62 ? 56   ILE B C   1 
ATOM   1993 O  O   . ILE B 1 59  ? 47.005 6.956  12.974  1.00 13.46 ? 56   ILE B O   1 
ATOM   1994 C  CB  . ILE B 1 59  ? 48.823 9.365  14.388  1.00 13.10 ? 56   ILE B CB  1 
ATOM   1995 C  CG1 . ILE B 1 59  ? 49.933 9.595  15.431  1.00 12.73 ? 56   ILE B CG1 1 
ATOM   1996 C  CG2 . ILE B 1 59  ? 47.354 9.340  15.068  1.00 12.74 ? 56   ILE B CG2 1 
ATOM   1997 C  CD1 . ILE B 1 59  ? 49.871 10.888 16.279  1.00 11.46 ? 56   ILE B CD1 1 
ATOM   1998 N  N   . VAL B 1 60  ? 47.937 8.418  11.514  1.00 12.98 ? 57   VAL B N   1 
ATOM   1999 C  CA  . VAL B 1 60  ? 46.946 8.165  10.461  1.00 12.42 ? 57   VAL B CA  1 
ATOM   2000 C  C   . VAL B 1 60  ? 46.806 6.687  10.073  1.00 12.56 ? 57   VAL B C   1 
ATOM   2001 O  O   . VAL B 1 60  ? 45.692 6.137  9.943   1.00 13.29 ? 57   VAL B O   1 
ATOM   2002 C  CB  . VAL B 1 60  ? 47.247 9.045  9.188   1.00 11.25 ? 57   VAL B CB  1 
ATOM   2003 C  CG1 . VAL B 1 60  ? 46.260 8.661  8.013   1.00 11.57 ? 57   VAL B CG1 1 
ATOM   2004 C  CG2 . VAL B 1 60  ? 47.121 10.558 9.469   1.00 10.69 ? 57   VAL B CG2 1 
ATOM   2005 N  N   . LYS B 1 61  ? 47.969 6.044  9.913   1.00 13.79 ? 58   LYS B N   1 
ATOM   2006 C  CA  . LYS B 1 61  ? 48.052 4.686  9.477   1.00 14.06 ? 58   LYS B CA  1 
ATOM   2007 C  C   . LYS B 1 61  ? 47.609 3.679  10.520  1.00 13.68 ? 58   LYS B C   1 
ATOM   2008 O  O   . LYS B 1 61  ? 47.266 2.537  10.172  1.00 13.28 ? 58   LYS B O   1 
ATOM   2009 C  CB  . LYS B 1 61  ? 49.464 4.326  9.006   1.00 12.51 ? 58   LYS B CB  1 
ATOM   2010 C  CG  . LYS B 1 61  ? 49.843 5.018  7.726   1.00 15.50 ? 58   LYS B CG  1 
ATOM   2011 C  CD  . LYS B 1 61  ? 51.320 4.703  7.393   1.00 17.25 ? 58   LYS B CD  1 
ATOM   2012 C  CE  . LYS B 1 61  ? 51.760 5.252  6.083   1.00 20.55 ? 58   LYS B CE  1 
ATOM   2013 N  NZ  . LYS B 1 61  ? 53.180 4.718  5.771   1.00 20.89 ? 58   LYS B NZ  1 
ATOM   2014 N  N   . THR B 1 62  ? 47.665 4.059  11.789  1.00 13.58 ? 59   THR B N   1 
ATOM   2015 C  CA  . THR B 1 62  ? 47.520 3.055  12.846  1.00 13.00 ? 59   THR B CA  1 
ATOM   2016 C  C   . THR B 1 62  ? 46.429 3.332  13.900  1.00 14.95 ? 59   THR B C   1 
ATOM   2017 O  O   . THR B 1 62  ? 46.216 2.526  14.832  1.00 17.34 ? 59   THR B O   1 
ATOM   2018 C  CB  . THR B 1 62  ? 48.836 2.853  13.615  1.00 14.12 ? 59   THR B CB  1 
ATOM   2019 O  OG1 . THR B 1 62  ? 49.216 4.096  14.247  1.00 14.81 ? 59   THR B OG1 1 
ATOM   2020 C  CG2 . THR B 1 62  ? 49.984 2.369  12.659  1.00 13.87 ? 59   THR B CG2 1 
ATOM   2021 N  N   . SER B 1 63  ? 45.760 4.453  13.795  1.00 14.19 ? 60   SER B N   1 
ATOM   2022 C  CA  . SER B 1 63  ? 44.705 4.817  14.764  1.00 13.83 ? 60   SER B CA  1 
ATOM   2023 C  C   . SER B 1 63  ? 43.306 4.499  14.305  1.00 14.39 ? 60   SER B C   1 
ATOM   2024 O  O   . SER B 1 63  ? 43.061 4.081  13.134  1.00 15.98 ? 60   SER B O   1 
ATOM   2025 C  CB  . SER B 1 63  ? 44.821 6.285  15.085  1.00 13.46 ? 60   SER B CB  1 
ATOM   2026 O  OG  . SER B 1 63  ? 44.573 7.160  13.977  1.00 15.24 ? 60   SER B OG  1 
ATOM   2027 N  N   . ASN B 1 64  ? 42.364 4.687  15.225  1.00 15.16 ? 61   ASN B N   1 
ATOM   2028 C  CA  . ASN B 1 64  ? 40.965 4.532  14.913  1.00 15.47 ? 61   ASN B CA  1 
ATOM   2029 C  C   . ASN B 1 64  ? 40.173 5.571  15.725  1.00 15.95 ? 61   ASN B C   1 
ATOM   2030 O  O   . ASN B 1 64  ? 40.746 6.424  16.394  1.00 14.54 ? 61   ASN B O   1 
ATOM   2031 C  CB  . ASN B 1 64  ? 40.510 3.098  15.185  1.00 16.11 ? 61   ASN B CB  1 
ATOM   2032 C  CG  . ASN B 1 64  ? 40.504 2.737  16.669  1.00 20.51 ? 61   ASN B CG  1 
ATOM   2033 O  OD1 . ASN B 1 64  ? 40.468 3.580  17.548  1.00 26.16 ? 61   ASN B OD1 1 
ATOM   2034 N  ND2 . ASN B 1 64  ? 40.514 1.441  16.938  1.00 24.93 ? 61   ASN B ND2 1 
ATOM   2035 N  N   . GLY B 1 65  ? 38.855 5.534  15.575  1.00 16.12 ? 62   GLY B N   1 
ATOM   2036 C  CA  . GLY B 1 65  ? 37.977 6.404  16.348  1.00 17.97 ? 62   GLY B CA  1 
ATOM   2037 C  C   . GLY B 1 65  ? 38.268 7.871  16.157  1.00 18.06 ? 62   GLY B C   1 
ATOM   2038 O  O   . GLY B 1 65  ? 38.590 8.339  15.040  1.00 16.80 ? 62   GLY B O   1 
ATOM   2039 N  N   . GLY B 1 66  ? 38.162 8.603  17.261  1.00 17.81 ? 63   GLY B N   1 
ATOM   2040 C  CA  . GLY B 1 66  ? 38.344 10.064 17.196  1.00 17.40 ? 63   GLY B CA  1 
ATOM   2041 C  C   . GLY B 1 66  ? 39.764 10.513 16.862  1.00 15.83 ? 63   GLY B C   1 
ATOM   2042 O  O   . GLY B 1 66  ? 39.954 11.524 16.220  1.00 17.42 ? 63   GLY B O   1 
ATOM   2043 N  N   . ILE B 1 67  ? 40.746 9.772  17.331  1.00 15.85 ? 64   ILE B N   1 
ATOM   2044 C  CA  . ILE B 1 67  ? 42.127 10.050 17.046  1.00 15.25 ? 64   ILE B CA  1 
ATOM   2045 C  C   . ILE B 1 67  ? 42.304 9.980  15.530  1.00 15.69 ? 64   ILE B C   1 
ATOM   2046 O  O   . ILE B 1 67  ? 42.851 10.908 14.922  1.00 16.02 ? 64   ILE B O   1 
ATOM   2047 C  CB  . ILE B 1 67  ? 43.108 9.146  17.770  1.00 14.65 ? 64   ILE B CB  1 
ATOM   2048 C  CG1 . ILE B 1 67  ? 43.302 9.611  19.233  1.00 16.24 ? 64   ILE B CG1 1 
ATOM   2049 C  CG2 . ILE B 1 67  ? 44.555 9.260  17.162  1.00 12.47 ? 64   ILE B CG2 1 
ATOM   2050 C  CD1 . ILE B 1 67  ? 43.948 8.510  20.242  1.00 16.08 ? 64   ILE B CD1 1 
ATOM   2051 N  N   . PHE B 1 68  ? 41.832 8.889  14.912  1.00 15.49 ? 65   PHE B N   1 
ATOM   2052 C  CA  . PHE B 1 68  ? 41.950 8.771  13.473  1.00 15.76 ? 65   PHE B CA  1 
ATOM   2053 C  C   . PHE B 1 68  ? 41.305 9.953  12.744  1.00 15.93 ? 65   PHE B C   1 
ATOM   2054 O  O   . PHE B 1 68  ? 41.874 10.547 11.820  1.00 16.73 ? 65   PHE B O   1 
ATOM   2055 C  CB  . PHE B 1 68  ? 41.365 7.463  12.928  1.00 15.22 ? 65   PHE B CB  1 
ATOM   2056 C  CG  . PHE B 1 68  ? 41.375 7.421  11.454  1.00 14.39 ? 65   PHE B CG  1 
ATOM   2057 C  CD1 . PHE B 1 68  ? 42.577 7.176  10.773  1.00 14.18 ? 65   PHE B CD1 1 
ATOM   2058 C  CD2 . PHE B 1 68  ? 40.226 7.643  10.702  1.00 16.21 ? 65   PHE B CD2 1 
ATOM   2059 C  CE1 . PHE B 1 68  ? 42.644 7.300  9.351   1.00 16.30 ? 65   PHE B CE1 1 
ATOM   2060 C  CE2 . PHE B 1 68  ? 40.277 7.731  9.312   1.00 15.09 ? 65   PHE B CE2 1 
ATOM   2061 C  CZ  . PHE B 1 68  ? 41.472 7.501  8.629   1.00 17.08 ? 65   PHE B CZ  1 
ATOM   2062 N  N   . ASN B 1 69  ? 40.065 10.200 13.078  1.00 16.46 ? 66   ASN B N   1 
ATOM   2063 C  CA  . ASN B 1 69  ? 39.311 11.202 12.373  1.00 16.71 ? 66   ASN B CA  1 
ATOM   2064 C  C   . ASN B 1 69  ? 40.036 12.532 12.373  1.00 16.24 ? 66   ASN B C   1 
ATOM   2065 O  O   . ASN B 1 69  ? 40.061 13.241 11.360  1.00 15.60 ? 66   ASN B O   1 
ATOM   2066 C  CB  . ASN B 1 69  ? 37.920 11.336 12.985  1.00 16.69 ? 66   ASN B CB  1 
ATOM   2067 C  CG  . ASN B 1 69  ? 36.986 10.229 12.567  1.00 18.26 ? 66   ASN B CG  1 
ATOM   2068 O  OD1 . ASN B 1 69  ? 37.233 9.513  11.580  1.00 18.44 ? 66   ASN B OD1 1 
ATOM   2069 N  ND2 . ASN B 1 69  ? 35.870 10.103 13.304  1.00 16.49 ? 66   ASN B ND2 1 
ATOM   2070 N  N   . ASN B 1 70  ? 40.533 12.930 13.539  1.00 15.56 ? 67   ASN B N   1 
ATOM   2071 C  CA  . ASN B 1 70  ? 41.244 14.186 13.675  1.00 15.97 ? 67   ASN B CA  1 
ATOM   2072 C  C   . ASN B 1 70  ? 42.645 14.125 13.018  1.00 15.07 ? 67   ASN B C   1 
ATOM   2073 O  O   . ASN B 1 70  ? 42.994 15.017 12.247  1.00 16.22 ? 67   ASN B O   1 
ATOM   2074 C  CB  . ASN B 1 70  ? 41.289 14.639 15.148  1.00 16.56 ? 67   ASN B CB  1 
ATOM   2075 C  CG  . ASN B 1 70  ? 39.919 15.021 15.660  1.00 17.12 ? 67   ASN B CG  1 
ATOM   2076 O  OD1 . ASN B 1 70  ? 39.277 14.325 16.500  1.00 19.99 ? 67   ASN B OD1 1 
ATOM   2077 N  ND2 . ASN B 1 70  ? 39.426 16.114 15.130  1.00 12.17 ? 67   ASN B ND2 1 
ATOM   2078 N  N   . ALA B 1 71  ? 43.387 13.034 13.221  1.00 15.07 ? 68   ALA B N   1 
ATOM   2079 C  CA  . ALA B 1 71  ? 44.709 12.884 12.616  1.00 14.58 ? 68   ALA B CA  1 
ATOM   2080 C  C   . ALA B 1 71  ? 44.678 12.952 11.105  1.00 15.67 ? 68   ALA B C   1 
ATOM   2081 O  O   . ALA B 1 71  ? 45.406 13.710 10.499  1.00 16.96 ? 68   ALA B O   1 
ATOM   2082 C  CB  . ALA B 1 71  ? 45.393 11.600 13.079  1.00 14.07 ? 68   ALA B CB  1 
ATOM   2083 N  N   . ALA B 1 72  ? 43.785 12.168 10.501  1.00 15.20 ? 69   ALA B N   1 
ATOM   2084 C  CA  . ALA B 1 72  ? 43.679 12.043 9.088   1.00 13.69 ? 69   ALA B CA  1 
ATOM   2085 C  C   . ALA B 1 72  ? 43.202 13.387 8.540   1.00 14.02 ? 69   ALA B C   1 
ATOM   2086 O  O   . ALA B 1 72  ? 43.804 13.905 7.586   1.00 14.60 ? 69   ALA B O   1 
ATOM   2087 C  CB  . ALA B 1 72  ? 42.713 10.816 8.699   1.00 12.44 ? 69   ALA B CB  1 
ATOM   2088 N  N   . GLN B 1 73  ? 42.246 14.053 9.196   1.00 13.04 ? 70   GLN B N   1 
ATOM   2089 C  CA  . GLN B 1 73  ? 41.848 15.375 8.716   1.00 14.18 ? 70   GLN B CA  1 
ATOM   2090 C  C   . GLN B 1 73  ? 42.960 16.446 8.799   1.00 14.92 ? 70   GLN B C   1 
ATOM   2091 O  O   . GLN B 1 73  ? 43.054 17.297 7.934   1.00 17.17 ? 70   GLN B O   1 
ATOM   2092 C  CB  . GLN B 1 73  ? 40.564 15.861 9.397   1.00 13.78 ? 70   GLN B CB  1 
ATOM   2093 C  CG  . GLN B 1 73  ? 39.253 15.130 8.973   1.00 15.40 ? 70   GLN B CG  1 
ATOM   2094 C  CD  . GLN B 1 73  ? 38.858 15.434 7.523   1.00 16.39 ? 70   GLN B CD  1 
ATOM   2095 O  OE1 . GLN B 1 73  ? 39.459 14.898 6.610   1.00 18.17 ? 70   GLN B OE1 1 
ATOM   2096 N  NE2 . GLN B 1 73  ? 37.859 16.287 7.320   1.00 15.56 ? 70   GLN B NE2 1 
ATOM   2097 N  N   . VAL B 1 74  ? 43.809 16.403 9.819   1.00 15.84 ? 71   VAL B N   1 
ATOM   2098 C  CA  . VAL B 1 74  ? 44.931 17.338 9.909   1.00 15.58 ? 71   VAL B CA  1 
ATOM   2099 C  C   . VAL B 1 74  ? 45.848 17.114 8.692   1.00 16.32 ? 71   VAL B C   1 
ATOM   2100 O  O   . VAL B 1 74  ? 46.201 18.043 7.995   1.00 16.04 ? 71   VAL B O   1 
ATOM   2101 C  CB  . VAL B 1 74  ? 45.759 17.190 11.247  1.00 15.70 ? 71   VAL B CB  1 
ATOM   2102 C  CG1 . VAL B 1 74  ? 47.107 17.927 11.142  1.00 16.02 ? 71   VAL B CG1 1 
ATOM   2103 C  CG2 . VAL B 1 74  ? 44.941 17.672 12.455  1.00 14.91 ? 71   VAL B CG2 1 
ATOM   2104 N  N   . PHE B 1 75  ? 46.175 15.861 8.433   1.00 15.94 ? 72   PHE B N   1 
ATOM   2105 C  CA  . PHE B 1 75  ? 47.030 15.510 7.310   1.00 15.83 ? 72   PHE B CA  1 
ATOM   2106 C  C   . PHE B 1 75  ? 46.420 15.926 5.970   1.00 15.86 ? 72   PHE B C   1 
ATOM   2107 O  O   . PHE B 1 75  ? 47.115 16.517 5.089   1.00 16.46 ? 72   PHE B O   1 
ATOM   2108 C  CB  . PHE B 1 75  ? 47.329 14.010 7.321   1.00 15.69 ? 72   PHE B CB  1 
ATOM   2109 C  CG  . PHE B 1 75  ? 48.119 13.574 6.135   1.00 15.27 ? 72   PHE B CG  1 
ATOM   2110 C  CD1 . PHE B 1 75  ? 49.501 13.536 6.178   1.00 17.75 ? 72   PHE B CD1 1 
ATOM   2111 C  CD2 . PHE B 1 75  ? 47.469 13.238 4.939   1.00 17.43 ? 72   PHE B CD2 1 
ATOM   2112 C  CE1 . PHE B 1 75  ? 50.262 13.198 5.040   1.00 17.75 ? 72   PHE B CE1 1 
ATOM   2113 C  CE2 . PHE B 1 75  ? 48.222 12.879 3.798   1.00 20.81 ? 72   PHE B CE2 1 
ATOM   2114 C  CZ  . PHE B 1 75  ? 49.623 12.859 3.869   1.00 18.14 ? 72   PHE B CZ  1 
ATOM   2115 N  N   . ASN B 1 76  ? 45.143 15.589 5.802   1.00 15.48 ? 73   ASN B N   1 
ATOM   2116 C  CA  . ASN B 1 76  ? 44.435 15.771 4.525   1.00 16.39 ? 73   ASN B CA  1 
ATOM   2117 C  C   . ASN B 1 76  ? 44.370 17.281 4.195   1.00 15.76 ? 73   ASN B C   1 
ATOM   2118 O  O   . ASN B 1 76  ? 44.549 17.673 3.063   1.00 16.13 ? 73   ASN B O   1 
ATOM   2119 C  CB  . ASN B 1 76  ? 43.010 15.194 4.554   1.00 15.55 ? 73   ASN B CB  1 
ATOM   2120 C  CG  . ASN B 1 76  ? 42.955 13.695 4.705   1.00 16.18 ? 73   ASN B CG  1 
ATOM   2121 O  OD1 . ASN B 1 76  ? 43.913 12.989 4.444   1.00 15.14 ? 73   ASN B OD1 1 
ATOM   2122 N  ND2 . ASN B 1 76  ? 41.778 13.204 5.088   1.00 15.24 ? 73   ASN B ND2 1 
ATOM   2123 N  N   . HIS B 1 77  ? 44.076 18.101 5.209   1.00 17.05 ? 74   HIS B N   1 
ATOM   2124 C  CA  . HIS B 1 77  ? 43.971 19.540 5.023   1.00 16.61 ? 74   HIS B CA  1 
ATOM   2125 C  C   . HIS B 1 77  ? 45.353 20.172 4.715   1.00 16.27 ? 74   HIS B C   1 
ATOM   2126 O  O   . HIS B 1 77  ? 45.463 21.016 3.827   1.00 16.44 ? 74   HIS B O   1 
ATOM   2127 C  CB  . HIS B 1 77  ? 43.292 20.247 6.200   1.00 16.57 ? 74   HIS B CB  1 
ATOM   2128 C  CG  . HIS B 1 77  ? 41.821 20.074 6.201   1.00 15.38 ? 74   HIS B CG  1 
ATOM   2129 N  ND1 . HIS B 1 77  ? 41.196 18.961 6.729   1.00 15.24 ? 74   HIS B ND1 1 
ATOM   2130 C  CD2 . HIS B 1 77  ? 40.844 20.838 5.671   1.00 15.09 ? 74   HIS B CD2 1 
ATOM   2131 C  CE1 . HIS B 1 77  ? 39.890 19.070 6.553   1.00 13.50 ? 74   HIS B CE1 1 
ATOM   2132 N  NE2 . HIS B 1 77  ? 39.651 20.190 5.897   1.00 15.11 ? 74   HIS B NE2 1 
ATOM   2133 N  N   . THR B 1 78  ? 46.390 19.756 5.401   1.00 16.47 ? 75   THR B N   1 
ATOM   2134 C  CA  . THR B 1 78  ? 47.713 20.234 5.082   1.00 17.35 ? 75   THR B CA  1 
ATOM   2135 C  C   . THR B 1 78  ? 48.061 19.878 3.674   1.00 16.86 ? 75   THR B C   1 
ATOM   2136 O  O   . THR B 1 78  ? 48.548 20.708 2.899   1.00 18.77 ? 75   THR B O   1 
ATOM   2137 C  CB  . THR B 1 78  ? 48.731 19.670 6.067   1.00 16.39 ? 75   THR B CB  1 
ATOM   2138 O  OG1 . THR B 1 78  ? 48.418 20.211 7.344   1.00 18.61 ? 75   THR B OG1 1 
ATOM   2139 C  CG2 . THR B 1 78  ? 50.198 20.042 5.682   1.00 15.44 ? 75   THR B CG2 1 
ATOM   2140 N  N   . PHE B 1 79  ? 47.783 18.633 3.297   1.00 16.70 ? 76   PHE B N   1 
ATOM   2141 C  CA  . PHE B 1 79  ? 47.993 18.200 1.921   1.00 16.75 ? 76   PHE B CA  1 
ATOM   2142 C  C   . PHE B 1 79  ? 47.212 19.105 0.917   1.00 16.22 ? 76   PHE B C   1 
ATOM   2143 O  O   . PHE B 1 79  ? 47.789 19.629 -0.045  1.00 16.36 ? 76   PHE B O   1 
ATOM   2144 C  CB  . PHE B 1 79  ? 47.635 16.729 1.765   1.00 15.81 ? 76   PHE B CB  1 
ATOM   2145 C  CG  . PHE B 1 79  ? 48.217 16.116 0.556   1.00 17.11 ? 76   PHE B CG  1 
ATOM   2146 C  CD1 . PHE B 1 79  ? 49.515 15.638 0.574   1.00 18.78 ? 76   PHE B CD1 1 
ATOM   2147 C  CD2 . PHE B 1 79  ? 47.520 16.090 -0.623  1.00 14.39 ? 76   PHE B CD2 1 
ATOM   2148 C  CE1 . PHE B 1 79  ? 50.111 15.080 -0.580  1.00 18.48 ? 76   PHE B CE1 1 
ATOM   2149 C  CE2 . PHE B 1 79  ? 48.118 15.543 -1.772  1.00 16.80 ? 76   PHE B CE2 1 
ATOM   2150 C  CZ  . PHE B 1 79  ? 49.406 15.063 -1.744  1.00 15.39 ? 76   PHE B CZ  1 
ATOM   2151 N  N   . TYR B 1 80  ? 45.928 19.325 1.184   1.00 15.64 ? 77   TYR B N   1 
ATOM   2152 C  CA  . TYR B 1 80  ? 45.073 20.151 0.344   1.00 16.85 ? 77   TYR B CA  1 
ATOM   2153 C  C   . TYR B 1 80  ? 45.623 21.565 0.125   1.00 17.15 ? 77   TYR B C   1 
ATOM   2154 O  O   . TYR B 1 80  ? 45.677 22.032 -1.008  1.00 18.86 ? 77   TYR B O   1 
ATOM   2155 C  CB  . TYR B 1 80  ? 43.701 20.227 1.010   1.00 15.72 ? 77   TYR B CB  1 
ATOM   2156 C  CG  . TYR B 1 80  ? 42.658 21.100 0.393   1.00 13.96 ? 77   TYR B CG  1 
ATOM   2157 C  CD1 . TYR B 1 80  ? 42.123 20.815 -0.867  1.00 14.23 ? 77   TYR B CD1 1 
ATOM   2158 C  CD2 . TYR B 1 80  ? 42.162 22.194 1.074   1.00 15.60 ? 77   TYR B CD2 1 
ATOM   2159 C  CE1 . TYR B 1 80  ? 41.093 21.571 -1.391  1.00 16.71 ? 77   TYR B CE1 1 
ATOM   2160 C  CE2 . TYR B 1 80  ? 41.138 22.964 0.577   1.00 16.03 ? 77   TYR B CE2 1 
ATOM   2161 C  CZ  . TYR B 1 80  ? 40.612 22.657 -0.698  1.00 18.80 ? 77   TYR B CZ  1 
ATOM   2162 O  OH  . TYR B 1 80  ? 39.591 23.408 -1.241  1.00 17.63 ? 77   TYR B OH  1 
ATOM   2163 N  N   . TRP B 1 81  ? 46.054 22.242 1.192   1.00 18.69 ? 78   TRP B N   1 
ATOM   2164 C  CA  . TRP B 1 81  ? 46.615 23.618 1.032   1.00 19.24 ? 78   TRP B CA  1 
ATOM   2165 C  C   . TRP B 1 81  ? 47.876 23.650 0.157   1.00 19.57 ? 78   TRP B C   1 
ATOM   2166 O  O   . TRP B 1 81  ? 48.121 24.636 -0.559  1.00 20.21 ? 78   TRP B O   1 
ATOM   2167 C  CB  . TRP B 1 81  ? 46.931 24.324 2.377   1.00 18.50 ? 78   TRP B CB  1 
ATOM   2168 C  CG  . TRP B 1 81  ? 45.785 24.375 3.322   1.00 20.28 ? 78   TRP B CG  1 
ATOM   2169 C  CD1 . TRP B 1 81  ? 45.777 23.865 4.552   1.00 18.23 ? 78   TRP B CD1 1 
ATOM   2170 C  CD2 . TRP B 1 81  ? 44.440 24.851 3.069   1.00 20.57 ? 78   TRP B CD2 1 
ATOM   2171 N  NE1 . TRP B 1 81  ? 44.535 24.012 5.117   1.00 21.12 ? 78   TRP B NE1 1 
ATOM   2172 C  CE2 . TRP B 1 81  ? 43.712 24.654 4.245   1.00 20.95 ? 78   TRP B CE2 1 
ATOM   2173 C  CE3 . TRP B 1 81  ? 43.817 25.492 1.984   1.00 21.48 ? 78   TRP B CE3 1 
ATOM   2174 C  CZ2 . TRP B 1 81  ? 42.357 25.001 4.378   1.00 21.92 ? 78   TRP B CZ2 1 
ATOM   2175 C  CZ3 . TRP B 1 81  ? 42.494 25.854 2.104   1.00 23.22 ? 78   TRP B CZ3 1 
ATOM   2176 C  CH2 . TRP B 1 81  ? 41.772 25.607 3.303   1.00 23.34 ? 78   TRP B CH2 1 
ATOM   2177 N  N   . ASN B 1 82  ? 48.655 22.581 0.223   1.00 19.51 ? 79   ASN B N   1 
ATOM   2178 C  CA  . ASN B 1 82  ? 49.857 22.431 -0.625  1.00 20.55 ? 79   ASN B CA  1 
ATOM   2179 C  C   . ASN B 1 82  ? 49.551 22.117 -2.086  1.00 20.44 ? 79   ASN B C   1 
ATOM   2180 O  O   . ASN B 1 82  ? 50.407 22.336 -2.922  1.00 22.40 ? 79   ASN B O   1 
ATOM   2181 C  CB  . ASN B 1 82  ? 50.779 21.362 -0.045  1.00 20.93 ? 79   ASN B CB  1 
ATOM   2182 C  CG  . ASN B 1 82  ? 51.560 21.865 1.222   1.00 22.15 ? 79   ASN B CG  1 
ATOM   2183 O  OD1 . ASN B 1 82  ? 52.087 22.970 1.222   1.00 21.71 ? 79   ASN B OD1 1 
ATOM   2184 N  ND2 . ASN B 1 82  ? 51.653 21.042 2.249   1.00 23.62 ? 79   ASN B ND2 1 
ATOM   2185 N  N   . CYS B 1 83  ? 48.369 21.548 -2.355  1.00 18.59 ? 80   CYS B N   1 
ATOM   2186 C  CA  . CYS B 1 83  ? 47.868 21.268 -3.683  1.00 18.80 ? 80   CYS B CA  1 
ATOM   2187 C  C   . CYS B 1 83  ? 47.336 22.481 -4.408  1.00 19.74 ? 80   CYS B C   1 
ATOM   2188 O  O   . CYS B 1 83  ? 46.994 22.387 -5.591  1.00 19.84 ? 80   CYS B O   1 
ATOM   2189 C  CB  . CYS B 1 83  ? 46.746 20.256 -3.608  1.00 19.00 ? 80   CYS B CB  1 
ATOM   2190 S  SG  . CYS B 1 83  ? 47.407 18.596 -3.248  1.00 20.58 ? 80   CYS B SG  1 
ATOM   2191 N  N   . LEU B 1 84  ? 47.195 23.593 -3.685  1.00 21.41 ? 81   LEU B N   1 
ATOM   2192 C  CA  . LEU B 1 84  ? 46.698 24.858 -4.251  1.00 21.16 ? 81   LEU B CA  1 
ATOM   2193 C  C   . LEU B 1 84  ? 47.784 25.947 -4.243  1.00 21.29 ? 81   LEU B C   1 
ATOM   2194 O  O   . LEU B 1 84  ? 48.702 25.940 -3.432  1.00 21.73 ? 81   LEU B O   1 
ATOM   2195 C  CB  . LEU B 1 84  ? 45.451 25.312 -3.434  1.00 21.76 ? 81   LEU B CB  1 
ATOM   2196 C  CG  . LEU B 1 84  ? 44.325 24.259 -3.218  1.00 21.63 ? 81   LEU B CG  1 
ATOM   2197 C  CD1 . LEU B 1 84  ? 43.176 24.886 -2.359  1.00 20.60 ? 81   LEU B CD1 1 
ATOM   2198 C  CD2 . LEU B 1 84  ? 43.787 23.693 -4.504  1.00 19.20 ? 81   LEU B CD2 1 
ATOM   2199 N  N   . THR B 1 85  ? 47.697 26.917 -5.174  1.00 22.72 ? 82   THR B N   1 
ATOM   2200 C  CA  . THR B 1 85  ? 48.688 27.959 -5.216  1.00 21.32 ? 82   THR B CA  1 
ATOM   2201 C  C   . THR B 1 85  ? 48.168 29.138 -6.070  1.00 20.90 ? 82   THR B C   1 
ATOM   2202 O  O   . THR B 1 85  ? 47.413 28.935 -7.038  1.00 20.14 ? 82   THR B O   1 
ATOM   2203 C  CB  . THR B 1 85  ? 50.010 27.440 -5.842  1.00 22.09 ? 82   THR B CB  1 
ATOM   2204 O  OG1 . THR B 1 85  ? 50.983 28.480 -5.871  1.00 21.26 ? 82   THR B OG1 1 
ATOM   2205 C  CG2 . THR B 1 85  ? 49.779 26.833 -7.309  1.00 18.50 ? 82   THR B CG2 1 
ATOM   2206 N  N   . PRO B 1 86  ? 48.559 30.347 -5.709  1.00 20.79 ? 83   PRO B N   1 
ATOM   2207 C  CA  . PRO B 1 86  ? 48.274 31.486 -6.636  1.00 20.66 ? 83   PRO B CA  1 
ATOM   2208 C  C   . PRO B 1 86  ? 49.294 31.601 -7.748  1.00 21.70 ? 83   PRO B C   1 
ATOM   2209 O  O   . PRO B 1 86  ? 49.172 32.469 -8.622  1.00 21.59 ? 83   PRO B O   1 
ATOM   2210 C  CB  . PRO B 1 86  ? 48.361 32.693 -5.706  1.00 21.42 ? 83   PRO B CB  1 
ATOM   2211 C  CG  . PRO B 1 86  ? 49.508 32.292 -4.709  1.00 20.88 ? 83   PRO B CG  1 
ATOM   2212 C  CD  . PRO B 1 86  ? 49.250 30.803 -4.478  1.00 21.63 ? 83   PRO B CD  1 
ATOM   2213 N  N   . ASN B 1 87  ? 50.303 30.751 -7.760  1.00 22.11 ? 84   ASN B N   1 
ATOM   2214 C  CA  . ASN B 1 87  ? 51.356 30.874 -8.781  1.00 24.13 ? 84   ASN B CA  1 
ATOM   2215 C  C   . ASN B 1 87  ? 51.129 29.967 -9.964  1.00 23.84 ? 84   ASN B C   1 
ATOM   2216 O  O   . ASN B 1 87  ? 50.402 28.971 -9.867  1.00 23.50 ? 84   ASN B O   1 
ATOM   2217 C  CB  . ASN B 1 87  ? 52.691 30.513 -8.150  1.00 24.35 ? 84   ASN B CB  1 
ATOM   2218 C  CG  . ASN B 1 87  ? 53.036 31.418 -7.000  1.00 27.64 ? 84   ASN B CG  1 
ATOM   2219 O  OD1 . ASN B 1 87  ? 52.798 32.632 -7.037  1.00 33.11 ? 84   ASN B OD1 1 
ATOM   2220 N  ND2 . ASN B 1 87  ? 53.592 30.837 -5.980  1.00 33.06 ? 84   ASN B ND2 1 
ATOM   2221 N  N   . LYS B 1 88  ? 51.761 30.306 -11.072 1.00 23.86 ? 85   LYS B N   1 
ATOM   2222 C  CA  . LYS B 1 88  ? 51.724 29.490 -12.295 1.00 22.59 ? 85   LYS B CA  1 
ATOM   2223 C  C   . LYS B 1 88  ? 52.600 28.251 -12.146 1.00 22.31 ? 85   LYS B C   1 
ATOM   2224 O  O   . LYS B 1 88  ? 53.757 28.338 -11.695 1.00 19.44 ? 85   LYS B O   1 
ATOM   2225 C  CB  . LYS B 1 88  ? 52.288 30.306 -13.430 1.00 23.98 ? 85   LYS B CB  1 
ATOM   2226 C  CG  . LYS B 1 88  ? 52.311 29.625 -14.780 1.00 24.25 ? 85   LYS B CG  1 
ATOM   2227 C  CD  . LYS B 1 88  ? 53.077 30.515 -15.718 1.00 28.77 ? 85   LYS B CD  1 
ATOM   2228 C  CE  . LYS B 1 88  ? 52.479 30.640 -17.084 1.00 30.87 ? 85   LYS B CE  1 
ATOM   2229 N  NZ  . LYS B 1 88  ? 53.003 31.903 -17.842 1.00 29.39 ? 85   LYS B NZ  1 
ATOM   2230 N  N   . THR B 1 89  ? 52.056 27.098 -12.524 1.00 22.41 ? 86   THR B N   1 
ATOM   2231 C  CA  . THR B 1 89  ? 52.763 25.844 -12.390 1.00 22.83 ? 86   THR B CA  1 
ATOM   2232 C  C   . THR B 1 89  ? 52.405 24.973 -13.572 1.00 23.01 ? 86   THR B C   1 
ATOM   2233 O  O   . THR B 1 89  ? 51.422 25.236 -14.245 1.00 23.60 ? 86   THR B O   1 
ATOM   2234 C  CB  . THR B 1 89  ? 52.387 25.134 -11.069 1.00 22.09 ? 86   THR B CB  1 
ATOM   2235 O  OG1 . THR B 1 89  ? 51.011 24.702 -11.111 1.00 22.63 ? 86   THR B OG1 1 
ATOM   2236 C  CG2 . THR B 1 89  ? 52.636 26.029 -9.851  1.00 20.46 ? 86   THR B CG2 1 
ATOM   2237 N  N   . GLU B 1 90  ? 53.210 23.943 -13.815 1.00 23.89 ? 87   GLU B N   1 
ATOM   2238 C  CA  . GLU B 1 90  ? 52.933 22.930 -14.835 1.00 24.01 ? 87   GLU B CA  1 
ATOM   2239 C  C   . GLU B 1 90  ? 53.456 21.550 -14.366 1.00 23.64 ? 87   GLU B C   1 
ATOM   2240 O  O   . GLU B 1 90  ? 54.361 21.438 -13.536 1.00 23.65 ? 87   GLU B O   1 
ATOM   2241 C  CB  . GLU B 1 90  ? 53.538 23.340 -16.171 1.00 26.03 ? 87   GLU B CB  1 
ATOM   2242 C  CG  . GLU B 1 90  ? 54.939 22.887 -16.466 1.00 28.80 ? 87   GLU B CG  1 
ATOM   2243 C  CD  . GLU B 1 90  ? 55.375 23.265 -17.882 1.00 33.64 ? 87   GLU B CD  1 
ATOM   2244 O  OE1 . GLU B 1 90  ? 56.339 24.036 -18.007 1.00 37.74 ? 87   GLU B OE1 1 
ATOM   2245 O  OE2 . GLU B 1 90  ? 54.733 22.830 -18.873 1.00 37.77 ? 87   GLU B OE2 1 
ATOM   2246 N  N   . ALA B 1 91  ? 52.878 20.493 -14.895 1.00 22.04 ? 88   ALA B N   1 
ATOM   2247 C  CA  . ALA B 1 91  ? 53.310 19.159 -14.543 1.00 22.02 ? 88   ALA B CA  1 
ATOM   2248 C  C   . ALA B 1 91  ? 54.758 18.956 -15.075 1.00 21.89 ? 88   ALA B C   1 
ATOM   2249 O  O   . ALA B 1 91  ? 55.077 19.361 -16.198 1.00 21.01 ? 88   ALA B O   1 
ATOM   2250 C  CB  . ALA B 1 91  ? 52.350 18.130 -15.170 1.00 21.64 ? 88   ALA B CB  1 
ATOM   2251 N  N   . SER B 1 92  ? 55.599 18.304 -14.284 1.00 21.23 ? 89   SER B N   1 
ATOM   2252 C  CA  . SER B 1 92  ? 56.882 17.758 -14.757 1.00 20.51 ? 89   SER B CA  1 
ATOM   2253 C  C   . SER B 1 92  ? 56.696 16.859 -15.971 1.00 21.06 ? 89   SER B C   1 
ATOM   2254 O  O   . SER B 1 92  ? 55.617 16.341 -16.191 1.00 20.50 ? 89   SER B O   1 
ATOM   2255 C  CB  . SER B 1 92  ? 57.583 16.977 -13.670 1.00 20.90 ? 89   SER B CB  1 
ATOM   2256 O  OG  . SER B 1 92  ? 56.854 15.790 -13.269 1.00 18.82 ? 89   SER B OG  1 
ATOM   2257 N  N   . SER B 1 93  ? 57.758 16.668 -16.752 1.00 19.96 ? 90   SER B N   1 
ATOM   2258 C  CA  . SER B 1 93  ? 57.691 15.801 -17.911 1.00 21.06 ? 90   SER B CA  1 
ATOM   2259 C  C   . SER B 1 93  ? 57.366 14.377 -17.509 1.00 20.21 ? 90   SER B C   1 
ATOM   2260 O  O   . SER B 1 93  ? 56.624 13.639 -18.204 1.00 20.07 ? 90   SER B O   1 
ATOM   2261 C  CB  . SER B 1 93  ? 59.023 15.857 -18.706 1.00 21.24 ? 90   SER B CB  1 
ATOM   2262 O  OG  . SER B 1 93  ? 60.069 15.308 -17.933 1.00 25.92 ? 90   SER B OG  1 
ATOM   2263 N  N   . GLN B 1 94  ? 57.930 13.968 -16.384 1.00 20.59 ? 91   GLN B N   1 
ATOM   2264 C  CA  . GLN B 1 94  ? 57.661 12.630 -15.848 1.00 20.95 ? 91   GLN B CA  1 
ATOM   2265 C  C   . GLN B 1 94  ? 56.177 12.429 -15.437 1.00 21.88 ? 91   GLN B C   1 
ATOM   2266 O  O   . GLN B 1 94  ? 55.556 11.392 -15.791 1.00 21.42 ? 91   GLN B O   1 
ATOM   2267 C  CB  . GLN B 1 94  ? 58.535 12.357 -14.625 1.00 21.10 ? 91   GLN B CB  1 
ATOM   2268 C  CG  . GLN B 1 94  ? 60.018 12.233 -14.908 1.00 22.87 ? 91   GLN B CG  1 
ATOM   2269 C  CD  . GLN B 1 94  ? 60.716 13.582 -14.937 1.00 23.81 ? 91   GLN B CD  1 
ATOM   2270 O  OE1 . GLN B 1 94  ? 60.103 14.653 -14.693 1.00 22.83 ? 91   GLN B OE1 1 
ATOM   2271 N  NE2 . GLN B 1 94  ? 62.004 13.551 -15.227 1.00 24.86 ? 91   GLN B NE2 1 
ATOM   2272 N  N   . LEU B 1 95  ? 55.633 13.392 -14.687 1.00 21.96 ? 92   LEU B N   1 
ATOM   2273 C  CA  . LEU B 1 95  ? 54.206 13.319 -14.335 1.00 21.14 ? 92   LEU B CA  1 
ATOM   2274 C  C   . LEU B 1 95  ? 53.312 13.382 -15.571 1.00 21.29 ? 92   LEU B C   1 
ATOM   2275 O  O   . LEU B 1 95  ? 52.320 12.642 -15.685 1.00 18.95 ? 92   LEU B O   1 
ATOM   2276 C  CB  . LEU B 1 95  ? 53.808 14.423 -13.382 1.00 21.54 ? 92   LEU B CB  1 
ATOM   2277 C  CG  . LEU B 1 95  ? 52.316 14.447 -12.976 1.00 19.15 ? 92   LEU B CG  1 
ATOM   2278 C  CD1 . LEU B 1 95  ? 51.855 13.168 -12.264 1.00 20.30 ? 92   LEU B CD1 1 
ATOM   2279 C  CD2 . LEU B 1 95  ? 52.020 15.603 -12.080 1.00 19.80 ? 92   LEU B CD2 1 
ATOM   2280 N  N   . LYS B 1 96  ? 53.656 14.277 -16.508 1.00 21.92 ? 93   LYS B N   1 
ATOM   2281 C  CA  . LYS B 1 96  ? 52.886 14.337 -17.732 1.00 22.22 ? 93   LYS B CA  1 
ATOM   2282 C  C   . LYS B 1 96  ? 52.868 12.998 -18.428 1.00 21.45 ? 93   LYS B C   1 
ATOM   2283 O  O   . LYS B 1 96  ? 51.813 12.558 -18.830 1.00 21.89 ? 93   LYS B O   1 
ATOM   2284 C  CB  . LYS B 1 96  ? 53.413 15.402 -18.711 1.00 22.05 ? 93   LYS B CB  1 
ATOM   2285 C  CG  . LYS B 1 96  ? 52.966 16.790 -18.412 1.00 26.01 ? 93   LYS B CG  1 
ATOM   2286 C  CD  . LYS B 1 96  ? 53.516 17.783 -19.524 1.00 27.60 ? 93   LYS B CD  1 
ATOM   2287 C  CE  . LYS B 1 96  ? 53.856 19.201 -19.003 1.00 29.91 ? 93   LYS B CE  1 
ATOM   2288 N  NZ  . LYS B 1 96  ? 55.010 19.778 -19.838 1.00 33.27 ? 93   LYS B NZ  1 
ATOM   2289 N  N   . ALA B 1 97  ? 54.039 12.381 -18.600 1.00 20.96 ? 94   ALA B N   1 
ATOM   2290 C  CA  . ALA B 1 97  ? 54.146 11.116 -19.312 1.00 21.08 ? 94   ALA B CA  1 
ATOM   2291 C  C   . ALA B 1 97  ? 53.300 10.032 -18.593 1.00 21.79 ? 94   ALA B C   1 
ATOM   2292 O  O   . ALA B 1 97  ? 52.607 9.224  -19.239 1.00 21.15 ? 94   ALA B O   1 
ATOM   2293 C  CB  . ALA B 1 97  ? 55.625 10.668 -19.415 1.00 20.55 ? 94   ALA B CB  1 
ATOM   2294 N  N   . ALA B 1 98  ? 53.349 10.012 -17.263 1.00 21.58 ? 95   ALA B N   1 
ATOM   2295 C  CA  . ALA B 1 98  ? 52.574 9.033  -16.501 1.00 21.71 ? 95   ALA B CA  1 
ATOM   2296 C  C   . ALA B 1 98  ? 51.036 9.239  -16.693 1.00 22.09 ? 95   ALA B C   1 
ATOM   2297 O  O   . ALA B 1 98  ? 50.274 8.262  -16.861 1.00 21.92 ? 95   ALA B O   1 
ATOM   2298 C  CB  . ALA B 1 98  ? 52.971 9.066  -14.999 1.00 22.44 ? 95   ALA B CB  1 
ATOM   2299 N  N   . LEU B 1 99  ? 50.596 10.495 -16.665 1.00 22.12 ? 96   LEU B N   1 
ATOM   2300 C  CA  . LEU B 1 99  ? 49.167 10.844 -16.836 1.00 22.00 ? 96   LEU B CA  1 
ATOM   2301 C  C   . LEU B 1 99  ? 48.701 10.433 -18.216 1.00 21.42 ? 96   LEU B C   1 
ATOM   2302 O  O   . LEU B 1 99  ? 47.599 9.872  -18.369 1.00 21.19 ? 96   LEU B O   1 
ATOM   2303 C  CB  . LEU B 1 99  ? 48.942 12.359 -16.643 1.00 21.76 ? 96   LEU B CB  1 
ATOM   2304 C  CG  . LEU B 1 99  ? 48.998 12.895 -15.181 1.00 22.65 ? 96   LEU B CG  1 
ATOM   2305 C  CD1 . LEU B 1 99  ? 48.910 14.420 -15.223 1.00 22.66 ? 96   LEU B CD1 1 
ATOM   2306 C  CD2 . LEU B 1 99  ? 47.879 12.324 -14.261 1.00 21.80 ? 96   LEU B CD2 1 
ATOM   2307 N  N   . ILE B 1 100 ? 49.538 10.700 -19.212 1.00 19.99 ? 97   ILE B N   1 
ATOM   2308 C  CA  . ILE B 1 100 ? 49.214 10.348 -20.592 1.00 20.52 ? 97   ILE B CA  1 
ATOM   2309 C  C   . ILE B 1 100 ? 49.100 8.837  -20.730 1.00 21.18 ? 97   ILE B C   1 
ATOM   2310 O  O   . ILE B 1 100 ? 48.117 8.350  -21.239 1.00 19.75 ? 97   ILE B O   1 
ATOM   2311 C  CB  . ILE B 1 100 ? 50.227 10.889 -21.620 1.00 21.13 ? 97   ILE B CB  1 
ATOM   2312 C  CG1 . ILE B 1 100 ? 50.059 12.409 -21.802 1.00 18.92 ? 97   ILE B CG1 1 
ATOM   2313 C  CG2 . ILE B 1 100 ? 50.059 10.156 -22.967 1.00 18.51 ? 97   ILE B CG2 1 
ATOM   2314 C  CD1 . ILE B 1 100 ? 51.349 13.109 -22.202 1.00 20.60 ? 97   ILE B CD1 1 
ATOM   2315 N  N   . GLU B 1 101 ? 50.067 8.106  -20.183 1.00 20.90 ? 98   GLU B N   1 
ATOM   2316 C  CA  . GLU B 1 101 ? 50.070 6.702  -20.365 1.00 22.03 ? 98   GLU B CA  1 
ATOM   2317 C  C   . GLU B 1 101 ? 48.936 6.034  -19.587 1.00 21.90 ? 98   GLU B C   1 
ATOM   2318 O  O   . GLU B 1 101 ? 48.409 5.051  -20.061 1.00 20.89 ? 98   GLU B O   1 
ATOM   2319 C  CB  . GLU B 1 101 ? 51.400 6.093  -19.963 1.00 23.40 ? 98   GLU B CB  1 
ATOM   2320 C  CG  . GLU B 1 101 ? 52.491 6.346  -20.973 1.00 26.28 ? 98   GLU B CG  1 
ATOM   2321 C  CD  . GLU B 1 101 ? 53.820 5.775  -20.553 1.00 29.18 ? 98   GLU B CD  1 
ATOM   2322 O  OE1 . GLU B 1 101 ? 53.867 4.940  -19.631 1.00 29.62 ? 98   GLU B OE1 1 
ATOM   2323 O  OE2 . GLU B 1 101 ? 54.807 6.138  -21.192 1.00 31.44 ? 98   GLU B OE2 1 
ATOM   2324 N  N   . THR B 1 102 ? 48.588 6.526  -18.401 1.00 20.98 ? 99   THR B N   1 
ATOM   2325 C  CA  . THR B 1 102 ? 47.535 5.897  -17.626 1.00 21.87 ? 99   THR B CA  1 
ATOM   2326 C  C   . THR B 1 102 ? 46.130 6.301  -18.105 1.00 20.87 ? 99   THR B C   1 
ATOM   2327 O  O   . THR B 1 102 ? 45.226 5.471  -18.088 1.00 19.21 ? 99   THR B O   1 
ATOM   2328 C  CB  . THR B 1 102 ? 47.698 6.279  -16.142 1.00 21.51 ? 99   THR B CB  1 
ATOM   2329 O  OG1 . THR B 1 102 ? 49.065 6.017  -15.802 1.00 23.20 ? 99   THR B OG1 1 
ATOM   2330 C  CG2 . THR B 1 102 ? 46.728 5.507  -15.198 1.00 23.12 ? 99   THR B CG2 1 
ATOM   2331 N  N   . PHE B 1 103 ? 45.928 7.582  -18.386 1.00 19.87 ? 100  PHE B N   1 
ATOM   2332 C  CA  . PHE B 1 103 ? 44.566 8.106  -18.571 1.00 20.83 ? 100  PHE B CA  1 
ATOM   2333 C  C   . PHE B 1 103 ? 44.324 8.566  -19.998 1.00 21.18 ? 100  PHE B C   1 
ATOM   2334 O  O   . PHE B 1 103 ? 43.175 8.880  -20.346 1.00 22.41 ? 100  PHE B O   1 
ATOM   2335 C  CB  . PHE B 1 103 ? 44.285 9.275  -17.643 1.00 21.67 ? 100  PHE B CB  1 
ATOM   2336 C  CG  . PHE B 1 103 ? 44.400 8.922  -16.173 1.00 21.83 ? 100  PHE B CG  1 
ATOM   2337 C  CD1 . PHE B 1 103 ? 43.366 8.279  -15.513 1.00 23.29 ? 100  PHE B CD1 1 
ATOM   2338 C  CD2 . PHE B 1 103 ? 45.515 9.319  -15.434 1.00 20.82 ? 100  PHE B CD2 1 
ATOM   2339 C  CE1 . PHE B 1 103 ? 43.484 7.947  -14.154 1.00 21.79 ? 100  PHE B CE1 1 
ATOM   2340 C  CE2 . PHE B 1 103 ? 45.632 8.990  -14.095 1.00 20.51 ? 100  PHE B CE2 1 
ATOM   2341 C  CZ  . PHE B 1 103 ? 44.613 8.311  -13.458 1.00 22.66 ? 100  PHE B CZ  1 
ATOM   2342 N  N   . GLY B 1 104 ? 45.381 8.597  -20.813 1.00 20.49 ? 101  GLY B N   1 
ATOM   2343 C  CA  . GLY B 1 104 ? 45.274 8.898  -22.234 1.00 21.34 ? 101  GLY B CA  1 
ATOM   2344 C  C   . GLY B 1 104 ? 45.821 10.289 -22.509 1.00 22.03 ? 101  GLY B C   1 
ATOM   2345 O  O   . GLY B 1 104 ? 46.446 10.538 -23.559 1.00 21.96 ? 101  GLY B O   1 
ATOM   2346 N  N   . SER B 1 105 ? 45.542 11.216 -21.604 1.00 21.30 ? 102  SER B N   1 
ATOM   2347 C  CA  . SER B 1 105 ? 46.003 12.604 -21.711 1.00 22.08 ? 102  SER B CA  1 
ATOM   2348 C  C   . SER B 1 105 ? 45.851 13.310 -20.392 1.00 21.11 ? 102  SER B C   1 
ATOM   2349 O  O   . SER B 1 105 ? 45.123 12.844 -19.516 1.00 21.07 ? 102  SER B O   1 
ATOM   2350 C  CB  . SER B 1 105 ? 45.215 13.376 -22.767 1.00 22.15 ? 102  SER B CB  1 
ATOM   2351 O  OG  . SER B 1 105 ? 43.890 13.543 -22.321 1.00 23.12 ? 102  SER B OG  1 
ATOM   2352 N  N   . VAL B 1 106 ? 46.501 14.451 -20.239 1.00 21.59 ? 103  VAL B N   1 
ATOM   2353 C  CA  . VAL B 1 106 ? 46.307 15.215 -19.009 1.00 21.50 ? 103  VAL B CA  1 
ATOM   2354 C  C   . VAL B 1 106 ? 44.835 15.646 -18.873 1.00 21.46 ? 103  VAL B C   1 
ATOM   2355 O  O   . VAL B 1 106 ? 44.277 15.630 -17.767 1.00 19.08 ? 103  VAL B O   1 
ATOM   2356 C  CB  . VAL B 1 106 ? 47.242 16.441 -18.899 1.00 21.95 ? 103  VAL B CB  1 
ATOM   2357 C  CG1 . VAL B 1 106 ? 46.888 17.291 -17.603 1.00 21.84 ? 103  VAL B CG1 1 
ATOM   2358 C  CG2 . VAL B 1 106 ? 48.680 15.983 -18.838 1.00 22.21 ? 103  VAL B CG2 1 
ATOM   2359 N  N   . GLU B 1 107 ? 44.213 16.053 -19.988 1.00 22.48 ? 104  GLU B N   1 
ATOM   2360 C  CA  . GLU B 1 107 ? 42.825 16.522 -19.965 1.00 23.36 ? 104  GLU B CA  1 
ATOM   2361 C  C   . GLU B 1 107 ? 41.859 15.351 -19.558 1.00 23.73 ? 104  GLU B C   1 
ATOM   2362 O  O   . GLU B 1 107 ? 40.936 15.566 -18.802 1.00 22.59 ? 104  GLU B O   1 
ATOM   2363 C  CB  . GLU B 1 107 ? 42.477 17.143 -21.332 1.00 24.02 ? 104  GLU B CB  1 
ATOM   2364 C  CG  . GLU B 1 107 ? 41.473 18.260 -21.348 1.00 28.64 ? 104  GLU B CG  1 
ATOM   2365 C  CD  . GLU B 1 107 ? 41.589 19.283 -20.198 1.00 32.31 ? 104  GLU B CD  1 
ATOM   2366 O  OE1 . GLU B 1 107 ? 42.677 19.854 -19.942 1.00 31.92 ? 104  GLU B OE1 1 
ATOM   2367 O  OE2 . GLU B 1 107 ? 40.551 19.508 -19.551 1.00 36.64 ? 104  GLU B OE2 1 
ATOM   2368 N  N   . ASN B 1 108 ? 42.109 14.138 -20.051 1.00 22.81 ? 105  ASN B N   1 
ATOM   2369 C  CA  . ASN B 1 108 ? 41.339 12.975 -19.668 1.00 22.96 ? 105  ASN B CA  1 
ATOM   2370 C  C   . ASN B 1 108 ? 41.460 12.749 -18.180 1.00 21.74 ? 105  ASN B C   1 
ATOM   2371 O  O   . ASN B 1 108 ? 40.467 12.462 -17.537 1.00 21.74 ? 105  ASN B O   1 
ATOM   2372 C  CB  . ASN B 1 108 ? 41.781 11.677 -20.373 1.00 23.09 ? 105  ASN B CB  1 
ATOM   2373 C  CG  . ASN B 1 108 ? 41.418 11.652 -21.815 1.00 26.29 ? 105  ASN B CG  1 
ATOM   2374 O  OD1 . ASN B 1 108 ? 40.816 12.612 -22.307 1.00 26.42 ? 105  ASN B OD1 1 
ATOM   2375 N  ND2 . ASN B 1 108 ? 41.834 10.589 -22.545 1.00 25.02 ? 105  ASN B ND2 1 
ATOM   2376 N  N   . PHE B 1 109 ? 42.658 12.869 -17.610 1.00 20.70 ? 106  PHE B N   1 
ATOM   2377 C  CA  . PHE B 1 109 ? 42.770 12.713 -16.173 1.00 19.74 ? 106  PHE B CA  1 
ATOM   2378 C  C   . PHE B 1 109 ? 41.881 13.761 -15.511 1.00 20.18 ? 106  PHE B C   1 
ATOM   2379 O  O   . PHE B 1 109 ? 41.129 13.448 -14.607 1.00 19.91 ? 106  PHE B O   1 
ATOM   2380 C  CB  . PHE B 1 109 ? 44.192 12.891 -15.674 1.00 20.43 ? 106  PHE B CB  1 
ATOM   2381 C  CG  . PHE B 1 109 ? 44.260 13.228 -14.213 1.00 18.91 ? 106  PHE B CG  1 
ATOM   2382 C  CD1 . PHE B 1 109 ? 43.932 12.254 -13.245 1.00 20.52 ? 106  PHE B CD1 1 
ATOM   2383 C  CD2 . PHE B 1 109 ? 44.615 14.476 -13.792 1.00 18.57 ? 106  PHE B CD2 1 
ATOM   2384 C  CE1 . PHE B 1 109 ? 43.959 12.570 -11.917 1.00 20.26 ? 106  PHE B CE1 1 
ATOM   2385 C  CE2 . PHE B 1 109 ? 44.654 14.797 -12.455 1.00 18.82 ? 106  PHE B CE2 1 
ATOM   2386 C  CZ  . PHE B 1 109 ? 44.352 13.883 -11.533 1.00 21.16 ? 106  PHE B CZ  1 
ATOM   2387 N  N   . LYS B 1 110 ? 41.958 15.018 -15.951 1.00 20.77 ? 107  LYS B N   1 
ATOM   2388 C  CA  . LYS B 1 110 ? 41.188 16.074 -15.266 1.00 20.14 ? 107  LYS B CA  1 
ATOM   2389 C  C   . LYS B 1 110 ? 39.700 15.765 -15.312 1.00 20.41 ? 107  LYS B C   1 
ATOM   2390 O  O   . LYS B 1 110 ? 38.962 15.961 -14.326 1.00 21.23 ? 107  LYS B O   1 
ATOM   2391 C  CB  . LYS B 1 110 ? 41.529 17.443 -15.840 1.00 20.72 ? 107  LYS B CB  1 
ATOM   2392 C  CG  . LYS B 1 110 ? 43.024 17.869 -15.547 1.00 20.93 ? 107  LYS B CG  1 
ATOM   2393 C  CD  . LYS B 1 110 ? 43.498 19.034 -16.420 1.00 20.45 ? 107  LYS B CD  1 
ATOM   2394 C  CE  . LYS B 1 110 ? 42.577 20.175 -16.270 1.00 22.01 ? 107  LYS B CE  1 
ATOM   2395 N  NZ  . LYS B 1 110 ? 43.114 21.488 -16.878 1.00 25.55 ? 107  LYS B NZ  1 
ATOM   2396 N  N   . GLU B 1 111 ? 39.259 15.223 -16.435 1.00 20.16 ? 108  GLU B N   1 
ATOM   2397 C  CA  . GLU B 1 111 ? 37.864 14.868 -16.603 1.00 21.15 ? 108  GLU B CA  1 
ATOM   2398 C  C   . GLU B 1 111 ? 37.439 13.772 -15.626 1.00 19.34 ? 108  GLU B C   1 
ATOM   2399 O  O   . GLU B 1 111 ? 36.435 13.914 -14.963 1.00 17.61 ? 108  GLU B O   1 
ATOM   2400 C  CB  . GLU B 1 111 ? 37.564 14.427 -18.048 1.00 21.13 ? 108  GLU B CB  1 
ATOM   2401 C  CG  . GLU B 1 111 ? 37.672 15.573 -19.026 1.00 27.49 ? 108  GLU B CG  1 
ATOM   2402 C  CD  . GLU B 1 111 ? 37.759 15.140 -20.520 1.00 31.90 ? 108  GLU B CD  1 
ATOM   2403 O  OE1 . GLU B 1 111 ? 37.718 13.919 -20.835 1.00 34.96 ? 108  GLU B OE1 1 
ATOM   2404 O  OE2 . GLU B 1 111 ? 37.885 16.068 -21.362 1.00 33.08 ? 108  GLU B OE2 1 
ATOM   2405 N  N   . GLN B 1 112 ? 38.203 12.690 -15.584 1.00 18.28 ? 109  GLN B N   1 
ATOM   2406 C  CA  . GLN B 1 112 ? 37.921 11.552 -14.697 1.00 19.35 ? 109  GLN B CA  1 
ATOM   2407 C  C   . GLN B 1 112 ? 37.924 11.964 -13.214 1.00 18.28 ? 109  GLN B C   1 
ATOM   2408 O  O   . GLN B 1 112 ? 37.101 11.492 -12.390 1.00 19.40 ? 109  GLN B O   1 
ATOM   2409 C  CB  . GLN B 1 112 ? 38.977 10.467 -14.928 1.00 18.90 ? 109  GLN B CB  1 
ATOM   2410 C  CG  . GLN B 1 112 ? 38.827 9.756  -16.293 1.00 23.40 ? 109  GLN B CG  1 
ATOM   2411 C  CD  . GLN B 1 112 ? 39.563 8.386  -16.325 1.00 26.71 ? 109  GLN B CD  1 
ATOM   2412 O  OE1 . GLN B 1 112 ? 39.769 7.708  -15.283 1.00 29.80 ? 109  GLN B OE1 1 
ATOM   2413 N  NE2 . GLN B 1 112 ? 39.930 7.973  -17.514 1.00 26.40 ? 109  GLN B NE2 1 
ATOM   2414 N  N   . PHE B 1 113 ? 38.914 12.779 -12.874 1.00 17.42 ? 110  PHE B N   1 
ATOM   2415 C  CA  . PHE B 1 113 ? 39.116 13.216 -11.518 1.00 16.75 ? 110  PHE B CA  1 
ATOM   2416 C  C   . PHE B 1 113 ? 37.963 14.122 -11.094 1.00 16.57 ? 110  PHE B C   1 
ATOM   2417 O  O   . PHE B 1 113 ? 37.364 13.943 -10.016 1.00 16.99 ? 110  PHE B O   1 
ATOM   2418 C  CB  . PHE B 1 113 ? 40.440 13.927 -11.404 1.00 17.32 ? 110  PHE B CB  1 
ATOM   2419 C  CG  . PHE B 1 113 ? 40.872 14.186 -9.976  1.00 18.81 ? 110  PHE B CG  1 
ATOM   2420 C  CD1 . PHE B 1 113 ? 41.371 13.157 -9.201  1.00 20.68 ? 110  PHE B CD1 1 
ATOM   2421 C  CD2 . PHE B 1 113 ? 40.732 15.428 -9.398  1.00 21.78 ? 110  PHE B CD2 1 
ATOM   2422 C  CE1 . PHE B 1 113 ? 41.802 13.369 -7.907  1.00 18.28 ? 110  PHE B CE1 1 
ATOM   2423 C  CE2 . PHE B 1 113 ? 41.158 15.642 -8.068  1.00 20.52 ? 110  PHE B CE2 1 
ATOM   2424 C  CZ  . PHE B 1 113 ? 41.677 14.609 -7.328  1.00 19.37 ? 110  PHE B CZ  1 
ATOM   2425 N  N   . SER B 1 114 ? 37.582 15.033 -11.983 1.00 16.03 ? 111  SER B N   1 
ATOM   2426 C  CA  . SER B 1 114 ? 36.453 15.899 -11.729 1.00 16.49 ? 111  SER B CA  1 
ATOM   2427 C  C   . SER B 1 114 ? 35.172 15.082 -11.529 1.00 17.76 ? 111  SER B C   1 
ATOM   2428 O  O   . SER B 1 114 ? 34.374 15.368 -10.635 1.00 18.19 ? 111  SER B O   1 
ATOM   2429 C  CB  . SER B 1 114 ? 36.243 16.844 -12.901 1.00 16.50 ? 111  SER B CB  1 
ATOM   2430 O  OG  . SER B 1 114 ? 37.329 17.721 -13.031 1.00 15.39 ? 111  SER B OG  1 
ATOM   2431 N  N   . LYS B 1 115 ? 34.995 14.052 -12.349 1.00 17.49 ? 112  LYS B N   1 
ATOM   2432 C  CA  . LYS B 1 115 ? 33.789 13.273 -12.250 1.00 17.77 ? 112  LYS B CA  1 
ATOM   2433 C  C   . LYS B 1 115 ? 33.759 12.536 -10.875 1.00 16.46 ? 112  LYS B C   1 
ATOM   2434 O  O   . LYS B 1 115 ? 32.717 12.499 -10.225 1.00 13.60 ? 112  LYS B O   1 
ATOM   2435 C  CB  . LYS B 1 115 ? 33.681 12.350 -13.448 1.00 18.07 ? 112  LYS B CB  1 
ATOM   2436 C  CG  . LYS B 1 115 ? 32.562 11.358 -13.436 1.00 22.62 ? 112  LYS B CG  1 
ATOM   2437 C  CD  . LYS B 1 115 ? 32.443 10.672 -14.829 1.00 25.88 ? 112  LYS B CD  1 
ATOM   2438 C  CE  . LYS B 1 115 ? 31.248 9.705  -14.872 1.00 27.23 ? 112  LYS B CE  1 
ATOM   2439 N  NZ  . LYS B 1 115 ? 31.547 8.462  -15.620 1.00 31.47 ? 112  LYS B NZ  1 
ATOM   2440 N  N   . ALA B 1 116 ? 34.901 11.973 -10.482 1.00 15.65 ? 113  ALA B N   1 
ATOM   2441 C  CA  . ALA B 1 116 ? 35.023 11.229 -9.232  1.00 15.11 ? 113  ALA B CA  1 
ATOM   2442 C  C   . ALA B 1 116 ? 34.730 12.131 -8.017  1.00 16.02 ? 113  ALA B C   1 
ATOM   2443 O  O   . ALA B 1 116 ? 34.033 11.720 -7.085  1.00 17.62 ? 113  ALA B O   1 
ATOM   2444 C  CB  . ALA B 1 116 ? 36.399 10.623 -9.103  1.00 15.33 ? 113  ALA B CB  1 
ATOM   2445 N  N   . ALA B 1 117 ? 35.289 13.343 -8.046  1.00 15.93 ? 114  ALA B N   1 
ATOM   2446 C  CA  . ALA B 1 117 ? 35.073 14.340 -7.039  1.00 17.13 ? 114  ALA B CA  1 
ATOM   2447 C  C   . ALA B 1 117 ? 33.597 14.783 -6.914  1.00 17.10 ? 114  ALA B C   1 
ATOM   2448 O  O   . ALA B 1 117 ? 33.074 14.928 -5.812  1.00 17.55 ? 114  ALA B O   1 
ATOM   2449 C  CB  . ALA B 1 117 ? 36.017 15.553 -7.276  1.00 16.08 ? 114  ALA B CB  1 
ATOM   2450 N  N   . ILE B 1 118 ? 32.927 14.981 -8.056  1.00 19.21 ? 115  ILE B N   1 
ATOM   2451 C  CA  . ILE B 1 118 ? 31.529 15.381 -8.111  1.00 18.87 ? 115  ILE B CA  1 
ATOM   2452 C  C   . ILE B 1 118 ? 30.641 14.242 -7.593  1.00 20.08 ? 115  ILE B C   1 
ATOM   2453 O  O   . ILE B 1 118 ? 29.620 14.504 -6.944  1.00 19.85 ? 115  ILE B O   1 
ATOM   2454 C  CB  . ILE B 1 118 ? 31.159 15.837 -9.589  1.00 20.11 ? 115  ILE B CB  1 
ATOM   2455 C  CG1 . ILE B 1 118 ? 31.849 17.167 -9.883  1.00 20.98 ? 115  ILE B CG1 1 
ATOM   2456 C  CG2 . ILE B 1 118 ? 29.617 15.924 -9.854  1.00 19.62 ? 115  ILE B CG2 1 
ATOM   2457 C  CD1 . ILE B 1 118 ? 31.727 17.609 -11.331 1.00 21.83 ? 115  ILE B CD1 1 
ATOM   2458 N  N   . ALA B 1 119 ? 31.008 12.987 -7.859  1.00 19.41 ? 116  ALA B N   1 
ATOM   2459 C  CA  . ALA B 1 119 ? 30.140 11.873 -7.490  1.00 18.68 ? 116  ALA B CA  1 
ATOM   2460 C  C   . ALA B 1 119 ? 30.285 11.393 -6.096  1.00 18.23 ? 116  ALA B C   1 
ATOM   2461 O  O   . ALA B 1 119 ? 29.531 10.553 -5.674  1.00 18.89 ? 116  ALA B O   1 
ATOM   2462 C  CB  . ALA B 1 119 ? 30.308 10.693 -8.451  1.00 19.70 ? 116  ALA B CB  1 
ATOM   2463 N  N   . THR B 1 120 ? 31.293 11.845 -5.382  1.00 16.94 ? 117  THR B N   1 
ATOM   2464 C  CA  . THR B 1 120 ? 31.534 11.352 -4.040  1.00 16.81 ? 117  THR B CA  1 
ATOM   2465 C  C   . THR B 1 120 ? 30.325 11.730 -3.213  1.00 17.71 ? 117  THR B C   1 
ATOM   2466 O  O   . THR B 1 120 ? 29.922 12.906 -3.239  1.00 18.01 ? 117  THR B O   1 
ATOM   2467 C  CB  . THR B 1 120 ? 32.827 11.984 -3.500  1.00 16.88 ? 117  THR B CB  1 
ATOM   2468 O  OG1 . THR B 1 120 ? 33.905 11.466 -4.265  1.00 15.32 ? 117  THR B OG1 1 
ATOM   2469 C  CG2 . THR B 1 120 ? 33.047 11.676 -2.037  1.00 17.61 ? 117  THR B CG2 1 
ATOM   2470 N  N   . PHE B 1 121 ? 29.697 10.768 -2.520  1.00 16.88 ? 118  PHE B N   1 
ATOM   2471 C  CA  . PHE B 1 121 ? 28.463 11.091 -1.794  1.00 16.49 ? 118  PHE B CA  1 
ATOM   2472 C  C   . PHE B 1 121 ? 28.773 11.416 -0.327  1.00 16.60 ? 118  PHE B C   1 
ATOM   2473 O  O   . PHE B 1 121 ? 29.472 10.669 0.344   1.00 15.93 ? 118  PHE B O   1 
ATOM   2474 C  CB  . PHE B 1 121 ? 27.463 9.928  -1.882  1.00 17.33 ? 118  PHE B CB  1 
ATOM   2475 C  CG  . PHE B 1 121 ? 26.119 10.199 -1.191  1.00 16.55 ? 118  PHE B CG  1 
ATOM   2476 C  CD1 . PHE B 1 121 ? 25.219 11.082 -1.730  1.00 19.44 ? 118  PHE B CD1 1 
ATOM   2477 C  CD2 . PHE B 1 121 ? 25.750 9.488  -0.065  1.00 19.61 ? 118  PHE B CD2 1 
ATOM   2478 C  CE1 . PHE B 1 121 ? 23.976 11.317 -1.104  1.00 20.24 ? 118  PHE B CE1 1 
ATOM   2479 C  CE2 . PHE B 1 121 ? 24.504 9.679  0.550   1.00 21.76 ? 118  PHE B CE2 1 
ATOM   2480 C  CZ  . PHE B 1 121 ? 23.625 10.613 0.027   1.00 21.25 ? 118  PHE B CZ  1 
ATOM   2481 N  N   . GLY B 1 122 ? 28.166 12.491 0.184   1.00 16.04 ? 119  GLY B N   1 
ATOM   2482 C  CA  . GLY B 1 122 ? 28.423 12.930 1.544   1.00 17.00 ? 119  GLY B CA  1 
ATOM   2483 C  C   . GLY B 1 122 ? 29.750 13.661 1.592   1.00 16.68 ? 119  GLY B C   1 
ATOM   2484 O  O   . GLY B 1 122 ? 30.204 14.253 0.583   1.00 17.35 ? 119  GLY B O   1 
ATOM   2485 N  N   . SER B 1 123 ? 30.357 13.682 2.774   1.00 16.06 ? 120  SER B N   1 
ATOM   2486 C  CA  . SER B 1 123 ? 31.618 14.362 2.961   1.00 14.85 ? 120  SER B CA  1 
ATOM   2487 C  C   . SER B 1 123 ? 32.754 13.438 2.532   1.00 15.53 ? 120  SER B C   1 
ATOM   2488 O  O   . SER B 1 123 ? 32.737 12.236 2.839   1.00 14.18 ? 120  SER B O   1 
ATOM   2489 C  CB  . SER B 1 123 ? 31.830 14.737 4.436   1.00 15.04 ? 120  SER B CB  1 
ATOM   2490 O  OG  . SER B 1 123 ? 30.720 15.427 4.979   1.00 15.05 ? 120  SER B OG  1 
ATOM   2491 N  N   . GLY B 1 124 ? 33.758 13.986 1.877   1.00 16.05 ? 121  GLY B N   1 
ATOM   2492 C  CA  . GLY B 1 124 ? 34.970 13.200 1.595   1.00 16.21 ? 121  GLY B CA  1 
ATOM   2493 C  C   . GLY B 1 124 ? 36.001 13.943 0.753   1.00 14.31 ? 121  GLY B C   1 
ATOM   2494 O  O   . GLY B 1 124 ? 36.041 15.178 0.716   1.00 15.51 ? 121  GLY B O   1 
ATOM   2495 N  N   . TRP B 1 125 ? 36.855 13.151 0.131   1.00 13.60 ? 122  TRP B N   1 
ATOM   2496 C  CA  . TRP B 1 125 ? 38.007 13.607 -0.624  1.00 13.92 ? 122  TRP B CA  1 
ATOM   2497 C  C   . TRP B 1 125 ? 38.222 12.831 -1.937  1.00 13.32 ? 122  TRP B C   1 
ATOM   2498 O  O   . TRP B 1 125 ? 37.923 11.626 -2.028  1.00 12.75 ? 122  TRP B O   1 
ATOM   2499 C  CB  . TRP B 1 125 ? 39.222 13.389 0.229   1.00 13.15 ? 122  TRP B CB  1 
ATOM   2500 C  CG  . TRP B 1 125 ? 39.197 14.060 1.558   1.00 15.67 ? 122  TRP B CG  1 
ATOM   2501 C  CD1 . TRP B 1 125 ? 38.618 13.594 2.686   1.00 14.31 ? 122  TRP B CD1 1 
ATOM   2502 C  CD2 . TRP B 1 125 ? 39.834 15.314 1.908   1.00 16.10 ? 122  TRP B CD2 1 
ATOM   2503 N  NE1 . TRP B 1 125 ? 38.837 14.489 3.727   1.00 16.55 ? 122  TRP B NE1 1 
ATOM   2504 C  CE2 . TRP B 1 125 ? 39.552 15.559 3.256   1.00 13.54 ? 122  TRP B CE2 1 
ATOM   2505 C  CE3 . TRP B 1 125 ? 40.551 16.291 1.176   1.00 12.90 ? 122  TRP B CE3 1 
ATOM   2506 C  CZ2 . TRP B 1 125 ? 39.999 16.726 3.918   1.00 14.11 ? 122  TRP B CZ2 1 
ATOM   2507 C  CZ3 . TRP B 1 125 ? 41.025 17.388 1.818   1.00 13.78 ? 122  TRP B CZ3 1 
ATOM   2508 C  CH2 . TRP B 1 125 ? 40.729 17.623 3.179   1.00 14.21 ? 122  TRP B CH2 1 
ATOM   2509 N  N   . ALA B 1 126 ? 38.682 13.538 -2.978  1.00 13.46 ? 123  ALA B N   1 
ATOM   2510 C  CA  . ALA B 1 126 ? 39.144 12.892 -4.219  1.00 14.17 ? 123  ALA B CA  1 
ATOM   2511 C  C   . ALA B 1 126 ? 40.639 12.978 -4.253  1.00 14.24 ? 123  ALA B C   1 
ATOM   2512 O  O   . ALA B 1 126 ? 41.211 14.036 -3.956  1.00 16.13 ? 123  ALA B O   1 
ATOM   2513 C  CB  . ALA B 1 126 ? 38.516 13.579 -5.515  1.00 15.39 ? 123  ALA B CB  1 
ATOM   2514 N  N   . TRP B 1 127 ? 41.286 11.862 -4.612  1.00 14.45 ? 124  TRP B N   1 
ATOM   2515 C  CA  . TRP B 1 127 ? 42.711 11.752 -4.606  1.00 14.27 ? 124  TRP B CA  1 
ATOM   2516 C  C   . TRP B 1 127 ? 43.268 11.198 -5.910  1.00 14.35 ? 124  TRP B C   1 
ATOM   2517 O  O   . TRP B 1 127 ? 42.711 10.251 -6.500  1.00 14.57 ? 124  TRP B O   1 
ATOM   2518 C  CB  . TRP B 1 127 ? 43.183 10.800 -3.508  1.00 14.55 ? 124  TRP B CB  1 
ATOM   2519 C  CG  . TRP B 1 127 ? 42.722 11.085 -2.113  1.00 16.44 ? 124  TRP B CG  1 
ATOM   2520 C  CD1 . TRP B 1 127 ? 41.544 10.672 -1.532  1.00 15.54 ? 124  TRP B CD1 1 
ATOM   2521 C  CD2 . TRP B 1 127 ? 43.456 11.789 -1.093  1.00 13.85 ? 124  TRP B CD2 1 
ATOM   2522 N  NE1 . TRP B 1 127 ? 41.514 11.088 -0.227  1.00 15.42 ? 124  TRP B NE1 1 
ATOM   2523 C  CE2 . TRP B 1 127 ? 42.669 11.771 0.068   1.00 14.08 ? 124  TRP B CE2 1 
ATOM   2524 C  CE3 . TRP B 1 127 ? 44.681 12.463 -1.063  1.00 14.11 ? 124  TRP B CE3 1 
ATOM   2525 C  CZ2 . TRP B 1 127 ? 43.060 12.420 1.221   1.00 14.05 ? 124  TRP B CZ2 1 
ATOM   2526 C  CZ3 . TRP B 1 127 ? 45.119 13.027 0.139   1.00 14.25 ? 124  TRP B CZ3 1 
ATOM   2527 C  CH2 . TRP B 1 127 ? 44.296 13.023 1.252   1.00 14.15 ? 124  TRP B CH2 1 
ATOM   2528 N  N   . LEU B 1 128 ? 44.413 11.751 -6.314  1.00 13.68 ? 125  LEU B N   1 
ATOM   2529 C  CA  . LEU B 1 128 ? 45.302 11.062 -7.221  1.00 13.75 ? 125  LEU B CA  1 
ATOM   2530 C  C   . LEU B 1 128 ? 46.419 10.538 -6.391  1.00 13.47 ? 125  LEU B C   1 
ATOM   2531 O  O   . LEU B 1 128 ? 47.004 11.260 -5.588  1.00 15.88 ? 125  LEU B O   1 
ATOM   2532 C  CB  . LEU B 1 128 ? 45.860 11.990 -8.290  1.00 13.79 ? 125  LEU B CB  1 
ATOM   2533 C  CG  . LEU B 1 128 ? 46.974 11.395 -9.194  1.00 13.96 ? 125  LEU B CG  1 
ATOM   2534 C  CD1 . LEU B 1 128 ? 46.407 10.332 -10.161 1.00 14.99 ? 125  LEU B CD1 1 
ATOM   2535 C  CD2 . LEU B 1 128 ? 47.701 12.486 -10.012 1.00 16.75 ? 125  LEU B CD2 1 
ATOM   2536 N  N   . VAL B 1 129 ? 46.660 9.244  -6.518  1.00 15.31 ? 126  VAL B N   1 
ATOM   2537 C  CA  . VAL B 1 129 ? 47.668 8.532  -5.761  1.00 15.29 ? 126  VAL B CA  1 
ATOM   2538 C  C   . VAL B 1 129 ? 48.624 7.742  -6.669  1.00 16.09 ? 126  VAL B C   1 
ATOM   2539 O  O   . VAL B 1 129 ? 48.276 7.388  -7.802  1.00 16.83 ? 126  VAL B O   1 
ATOM   2540 C  CB  . VAL B 1 129 ? 47.063 7.548  -4.765  1.00 15.71 ? 126  VAL B CB  1 
ATOM   2541 C  CG1 . VAL B 1 129 ? 46.012 8.256  -3.816  1.00 13.71 ? 126  VAL B CG1 1 
ATOM   2542 C  CG2 . VAL B 1 129 ? 46.406 6.340  -5.507  1.00 12.27 ? 126  VAL B CG2 1 
ATOM   2543 N  N   . LYS B 1 130 ? 49.792 7.399  -6.110  1.00 16.96 ? 127  LYS B N   1 
ATOM   2544 C  CA  . LYS B 1 130 ? 50.759 6.500  -6.758  1.00 17.69 ? 127  LYS B CA  1 
ATOM   2545 C  C   . LYS B 1 130 ? 50.835 5.240  -5.860  1.00 18.53 ? 127  LYS B C   1 
ATOM   2546 O  O   . LYS B 1 130 ? 51.102 5.363  -4.647  1.00 17.23 ? 127  LYS B O   1 
ATOM   2547 C  CB  . LYS B 1 130 ? 52.111 7.176  -6.846  1.00 17.45 ? 127  LYS B CB  1 
ATOM   2548 C  CG  . LYS B 1 130 ? 53.223 6.383  -7.548  1.00 20.69 ? 127  LYS B CG  1 
ATOM   2549 C  CD  . LYS B 1 130 ? 54.550 7.167  -7.670  1.00 23.83 ? 127  LYS B CD  1 
ATOM   2550 C  CE  . LYS B 1 130 ? 55.323 7.301  -6.353  1.00 27.89 ? 127  LYS B CE  1 
ATOM   2551 N  NZ  . LYS B 1 130 ? 56.740 7.864  -6.535  1.00 28.69 ? 127  LYS B NZ  1 
ATOM   2552 N  N   . ASN B 1 131 ? 50.487 4.073  -6.411  1.00 18.21 ? 128  ASN B N   1 
ATOM   2553 C  CA  . ASN B 1 131 ? 50.556 2.798  -5.644  1.00 20.98 ? 128  ASN B CA  1 
ATOM   2554 C  C   . ASN B 1 131 ? 51.990 2.256  -5.592  1.00 21.14 ? 128  ASN B C   1 
ATOM   2555 O  O   . ASN B 1 131 ? 52.904 2.865  -6.181  1.00 22.20 ? 128  ASN B O   1 
ATOM   2556 C  CB  . ASN B 1 131 ? 49.495 1.785  -6.165  1.00 21.44 ? 128  ASN B CB  1 
ATOM   2557 C  CG  . ASN B 1 131 ? 49.859 1.123  -7.461  1.00 21.43 ? 128  ASN B CG  1 
ATOM   2558 O  OD1 . ASN B 1 131 ? 51.038 1.083  -7.874  1.00 21.61 ? 128  ASN B OD1 1 
ATOM   2559 N  ND2 . ASN B 1 131 ? 48.811 0.597  -8.164  1.00 20.51 ? 128  ASN B ND2 1 
ATOM   2560 N  N   . THR B 1 132 ? 52.239 1.121  -4.918  1.00 22.47 ? 129  THR B N   1 
ATOM   2561 C  CA  . THR B 1 132 ? 53.627 0.669  -4.741  1.00 23.01 ? 129  THR B CA  1 
ATOM   2562 C  C   . THR B 1 132 ? 54.307 0.204  -6.014  1.00 23.85 ? 129  THR B C   1 
ATOM   2563 O  O   . THR B 1 132 ? 55.540 0.159  -6.075  1.00 23.94 ? 129  THR B O   1 
ATOM   2564 C  CB  . THR B 1 132 ? 53.756 -0.497 -3.721  1.00 21.92 ? 129  THR B CB  1 
ATOM   2565 O  OG1 . THR B 1 132 ? 52.581 -1.305 -3.803  1.00 24.02 ? 129  THR B OG1 1 
ATOM   2566 C  CG2 . THR B 1 132 ? 53.973 0.069  -2.284  1.00 25.50 ? 129  THR B CG2 1 
ATOM   2567 N  N   . GLU B 1 133 ? 53.524 -0.192 -7.013  1.00 24.67 ? 130  GLU B N   1 
ATOM   2568 C  CA  . GLU B 1 133 ? 54.099 -0.505 -8.312  1.00 25.82 ? 130  GLU B CA  1 
ATOM   2569 C  C   . GLU B 1 133 ? 54.382 0.749  -9.121  1.00 25.58 ? 130  GLU B C   1 
ATOM   2570 O  O   . GLU B 1 133 ? 54.839 0.664  -10.262 1.00 25.63 ? 130  GLU B O   1 
ATOM   2571 C  CB  . GLU B 1 133 ? 53.200 -1.435 -9.116  1.00 26.54 ? 130  GLU B CB  1 
ATOM   2572 C  CG  . GLU B 1 133 ? 53.135 -2.819 -8.558  1.00 30.17 ? 130  GLU B CG  1 
ATOM   2573 C  CD  . GLU B 1 133 ? 52.082 -2.906 -7.479  1.00 36.90 ? 130  GLU B CD  1 
ATOM   2574 O  OE1 . GLU B 1 133 ? 50.880 -2.907 -7.848  1.00 41.34 ? 130  GLU B OE1 1 
ATOM   2575 O  OE2 . GLU B 1 133 ? 52.460 -2.934 -6.286  1.00 35.93 ? 130  GLU B OE2 1 
ATOM   2576 N  N   . GLY B 1 134 ? 54.133 1.907  -8.528  1.00 24.95 ? 131  GLY B N   1 
ATOM   2577 C  CA  . GLY B 1 134 ? 54.297 3.179  -9.210  1.00 23.95 ? 131  GLY B CA  1 
ATOM   2578 C  C   . GLY B 1 134 ? 53.129 3.569  -10.089 1.00 23.02 ? 131  GLY B C   1 
ATOM   2579 O  O   . GLY B 1 134 ? 53.218 4.547  -10.834 1.00 24.86 ? 131  GLY B O   1 
ATOM   2580 N  N   . LYS B 1 135 ? 52.040 2.816  -10.049 1.00 21.10 ? 132  LYS B N   1 
ATOM   2581 C  CA  . LYS B 1 135 ? 50.917 3.056  -10.947 1.00 19.40 ? 132  LYS B CA  1 
ATOM   2582 C  C   . LYS B 1 135 ? 50.027 4.198  -10.411 1.00 19.11 ? 132  LYS B C   1 
ATOM   2583 O  O   . LYS B 1 135 ? 49.794 4.301  -9.209  1.00 19.13 ? 132  LYS B O   1 
ATOM   2584 C  CB  . LYS B 1 135 ? 50.081 1.778  -11.068 1.00 19.91 ? 132  LYS B CB  1 
ATOM   2585 C  CG  . LYS B 1 135 ? 48.771 1.874  -11.891 1.00 20.77 ? 132  LYS B CG  1 
ATOM   2586 C  CD  . LYS B 1 135 ? 47.917 0.612  -11.695 1.00 23.63 ? 132  LYS B CD  1 
ATOM   2587 C  CE  . LYS B 1 135 ? 46.480 0.857  -12.239 1.00 27.50 ? 132  LYS B CE  1 
ATOM   2588 N  NZ  . LYS B 1 135 ? 45.750 -0.443 -12.560 1.00 26.97 ? 132  LYS B NZ  1 
ATOM   2589 N  N   . LEU B 1 136 ? 49.515 5.043  -11.302 1.00 17.36 ? 133  LEU B N   1 
ATOM   2590 C  CA  . LEU B 1 136 ? 48.564 6.064  -10.909 1.00 16.99 ? 133  LEU B CA  1 
ATOM   2591 C  C   . LEU B 1 136 ? 47.113 5.550  -10.823 1.00 16.41 ? 133  LEU B C   1 
ATOM   2592 O  O   . LEU B 1 136 ? 46.653 4.812  -11.669 1.00 15.39 ? 133  LEU B O   1 
ATOM   2593 C  CB  . LEU B 1 136 ? 48.630 7.246  -11.875 1.00 16.33 ? 133  LEU B CB  1 
ATOM   2594 C  CG  . LEU B 1 136 ? 49.964 7.971  -12.041 1.00 17.03 ? 133  LEU B CG  1 
ATOM   2595 C  CD1 . LEU B 1 136 ? 49.775 9.092  -13.082 1.00 13.55 ? 133  LEU B CD1 1 
ATOM   2596 C  CD2 . LEU B 1 136 ? 50.338 8.541  -10.681 1.00 18.29 ? 133  LEU B CD2 1 
ATOM   2597 N  N   . GLU B 1 137 ? 46.395 5.974  -9.784  1.00 17.27 ? 134  GLU B N   1 
ATOM   2598 C  CA  . GLU B 1 137 ? 44.956 5.621  -9.581  1.00 16.97 ? 134  GLU B CA  1 
ATOM   2599 C  C   . GLU B 1 137 ? 44.203 6.844  -9.071  1.00 16.08 ? 134  GLU B C   1 
ATOM   2600 O  O   . GLU B 1 137 ? 44.779 7.684  -8.316  1.00 17.48 ? 134  GLU B O   1 
ATOM   2601 C  CB  . GLU B 1 137 ? 44.779 4.540  -8.479  1.00 16.64 ? 134  GLU B CB  1 
ATOM   2602 C  CG  . GLU B 1 137 ? 45.512 3.190  -8.773  1.00 17.29 ? 134  GLU B CG  1 
ATOM   2603 C  CD  . GLU B 1 137 ? 45.426 2.219  -7.611  1.00 20.66 ? 134  GLU B CD  1 
ATOM   2604 O  OE1 . GLU B 1 137 ? 45.011 2.628  -6.499  1.00 19.80 ? 134  GLU B OE1 1 
ATOM   2605 O  OE2 . GLU B 1 137 ? 45.760 1.038  -7.790  1.00 21.02 ? 134  GLU B OE2 1 
ATOM   2606 N  N   . ILE B 1 138 ? 42.924 6.917  -9.424  1.00 15.86 ? 135  ILE B N   1 
ATOM   2607 C  CA  . ILE B 1 138 ? 42.006 7.892  -8.795  1.00 16.00 ? 135  ILE B CA  1 
ATOM   2608 C  C   . ILE B 1 138 ? 41.320 7.118  -7.635  1.00 16.38 ? 135  ILE B C   1 
ATOM   2609 O  O   . ILE B 1 138 ? 40.718 6.051  -7.835  1.00 16.88 ? 135  ILE B O   1 
ATOM   2610 C  CB  . ILE B 1 138 ? 41.000 8.447  -9.802  1.00 16.52 ? 135  ILE B CB  1 
ATOM   2611 C  CG1 . ILE B 1 138 ? 41.715 9.313  -10.856 1.00 15.39 ? 135  ILE B CG1 1 
ATOM   2612 C  CG2 . ILE B 1 138 ? 39.926 9.291  -9.185  1.00 14.58 ? 135  ILE B CG2 1 
ATOM   2613 C  CD1 . ILE B 1 138 ? 40.886 9.726  -12.020 1.00 15.56 ? 135  ILE B CD1 1 
ATOM   2614 N  N   . VAL B 1 139 ? 41.348 7.716  -6.460  1.00 17.26 ? 136  VAL B N   1 
ATOM   2615 C  CA  . VAL B 1 139 ? 40.817 7.114  -5.261  1.00 17.02 ? 136  VAL B CA  1 
ATOM   2616 C  C   . VAL B 1 139 ? 39.904 8.134  -4.586  1.00 16.38 ? 136  VAL B C   1 
ATOM   2617 O  O   . VAL B 1 139 ? 40.264 9.296  -4.428  1.00 17.77 ? 136  VAL B O   1 
ATOM   2618 C  CB  . VAL B 1 139 ? 41.968 6.655  -4.333  1.00 18.13 ? 136  VAL B CB  1 
ATOM   2619 C  CG1 . VAL B 1 139 ? 41.400 6.244  -2.928  1.00 17.29 ? 136  VAL B CG1 1 
ATOM   2620 C  CG2 . VAL B 1 139 ? 42.847 5.548  -5.022  1.00 15.40 ? 136  VAL B CG2 1 
ATOM   2621 N  N   . THR B 1 140 ? 38.721 7.726  -4.216  1.00 15.34 ? 137  THR B N   1 
ATOM   2622 C  CA  . THR B 1 140 ? 37.913 8.569  -3.347  1.00 14.80 ? 137  THR B CA  1 
ATOM   2623 C  C   . THR B 1 140 ? 37.912 8.022  -1.926  1.00 14.60 ? 137  THR B C   1 
ATOM   2624 O  O   . THR B 1 140 ? 37.965 6.797  -1.684  1.00 16.01 ? 137  THR B O   1 
ATOM   2625 C  CB  . THR B 1 140 ? 36.485 8.753  -3.815  1.00 14.77 ? 137  THR B CB  1 
ATOM   2626 O  OG1 . THR B 1 140 ? 35.808 7.504  -3.796  1.00 15.97 ? 137  THR B OG1 1 
ATOM   2627 C  CG2 . THR B 1 140 ? 36.426 9.354  -5.215  1.00 17.73 ? 137  THR B CG2 1 
ATOM   2628 N  N   . THR B 1 141 ? 37.772 8.940  -0.977  1.00 15.43 ? 138  THR B N   1 
ATOM   2629 C  CA  . THR B 1 141 ? 37.559 8.554  0.431   1.00 15.64 ? 138  THR B CA  1 
ATOM   2630 C  C   . THR B 1 141 ? 36.345 9.267  1.035   1.00 14.08 ? 138  THR B C   1 
ATOM   2631 O  O   . THR B 1 141 ? 35.963 10.339 0.618   1.00 13.91 ? 138  THR B O   1 
ATOM   2632 C  CB  . THR B 1 141 ? 38.848 8.814  1.332   1.00 15.58 ? 138  THR B CB  1 
ATOM   2633 O  OG1 . THR B 1 141 ? 39.126 10.217 1.367   1.00 15.13 ? 138  THR B OG1 1 
ATOM   2634 C  CG2 . THR B 1 141 ? 40.077 8.025  0.795   1.00 16.11 ? 138  THR B CG2 1 
ATOM   2635 N  N   . SER B 1 142 ? 35.795 8.635  2.065   1.00 15.55 ? 139  SER B N   1 
ATOM   2636 C  CA  . SER B 1 142 ? 34.681 9.155  2.853   1.00 15.58 ? 139  SER B CA  1 
ATOM   2637 C  C   . SER B 1 142 ? 35.209 9.797  4.127   1.00 14.96 ? 139  SER B C   1 
ATOM   2638 O  O   . SER B 1 142 ? 36.049 9.225  4.824   1.00 14.23 ? 139  SER B O   1 
ATOM   2639 C  CB  . SER B 1 142 ? 33.779 7.996  3.270   1.00 15.97 ? 139  SER B CB  1 
ATOM   2640 O  OG  . SER B 1 142 ? 32.699 8.488  4.039   1.00 18.39 ? 139  SER B OG  1 
ATOM   2641 N  N   . ASN B 1 143 ? 34.670 10.956 4.464   1.00 15.18 ? 140  ASN B N   1 
ATOM   2642 C  CA  . ASN B 1 143 ? 34.931 11.600 5.732   1.00 13.91 ? 140  ASN B CA  1 
ATOM   2643 C  C   . ASN B 1 143 ? 36.402 11.914 5.938   1.00 14.43 ? 140  ASN B C   1 
ATOM   2644 O  O   . ASN B 1 143 ? 36.903 12.768 5.225   1.00 13.66 ? 140  ASN B O   1 
ATOM   2645 C  CB  . ASN B 1 143 ? 34.315 10.812 6.857   1.00 14.81 ? 140  ASN B CB  1 
ATOM   2646 C  CG  . ASN B 1 143 ? 32.802 10.849 6.807   1.00 14.13 ? 140  ASN B CG  1 
ATOM   2647 O  OD1 . ASN B 1 143 ? 32.206 11.640 6.067   1.00 14.00 ? 140  ASN B OD1 1 
ATOM   2648 N  ND2 . ASN B 1 143 ? 32.191 9.935  7.508   1.00 13.73 ? 140  ASN B ND2 1 
ATOM   2649 N  N   . ALA B 1 144 ? 37.099 11.230 6.853   1.00 13.18 ? 141  ALA B N   1 
ATOM   2650 C  CA  . ALA B 1 144 ? 38.501 11.548 7.130   1.00 13.59 ? 141  ALA B CA  1 
ATOM   2651 C  C   . ALA B 1 144 ? 39.427 10.607 6.356   1.00 14.51 ? 141  ALA B C   1 
ATOM   2652 O  O   . ALA B 1 144 ? 40.655 10.704 6.501   1.00 15.01 ? 141  ALA B O   1 
ATOM   2653 C  CB  . ALA B 1 144 ? 38.843 11.479 8.687   1.00 13.80 ? 141  ALA B CB  1 
ATOM   2654 N  N   . GLY B 1 145 ? 38.867 9.728  5.541   1.00 13.86 ? 142  GLY B N   1 
ATOM   2655 C  CA  . GLY B 1 145 ? 39.643 8.656  4.901   1.00 13.57 ? 142  GLY B CA  1 
ATOM   2656 C  C   . GLY B 1 145 ? 40.854 9.212  4.215   1.00 14.29 ? 142  GLY B C   1 
ATOM   2657 O  O   . GLY B 1 145 ? 40.753 10.247 3.543   1.00 14.18 ? 142  GLY B O   1 
ATOM   2658 N  N   . CYS B 1 146 ? 41.962 8.490  4.297   1.00 15.21 ? 143  CYS B N   1 
ATOM   2659 C  CA  . CYS B 1 146 ? 43.233 8.955  3.710   1.00 15.11 ? 143  CYS B CA  1 
ATOM   2660 C  C   . CYS B 1 146 ? 43.962 7.758  3.109   1.00 16.05 ? 143  CYS B C   1 
ATOM   2661 O  O   . CYS B 1 146 ? 44.076 6.712  3.757   1.00 14.98 ? 143  CYS B O   1 
ATOM   2662 C  CB  . CYS B 1 146 ? 44.051 9.602  4.820   1.00 16.75 ? 143  CYS B CB  1 
ATOM   2663 S  SG  . CYS B 1 146 ? 45.740 10.083 4.357   1.00 15.77 ? 143  CYS B SG  1 
ATOM   2664 N  N   . PRO B 1 147 ? 44.498 7.910  1.900   1.00 15.51 ? 144  PRO B N   1 
ATOM   2665 C  CA  . PRO B 1 147 ? 45.103 6.763  1.162   1.00 15.88 ? 144  PRO B CA  1 
ATOM   2666 C  C   . PRO B 1 147 ? 46.368 6.206  1.798   1.00 14.89 ? 144  PRO B C   1 
ATOM   2667 O  O   . PRO B 1 147 ? 46.764 5.082  1.474   1.00 16.25 ? 144  PRO B O   1 
ATOM   2668 C  CB  . PRO B 1 147 ? 45.378 7.303  -0.225  1.00 17.08 ? 144  PRO B CB  1 
ATOM   2669 C  CG  . PRO B 1 147 ? 45.125 8.787  -0.169  1.00 20.13 ? 144  PRO B CG  1 
ATOM   2670 C  CD  . PRO B 1 147 ? 44.270 9.089  1.036   1.00 16.83 ? 144  PRO B CD  1 
ATOM   2671 N  N   . LEU B 1 148 ? 46.986 6.945  2.715   1.00 14.36 ? 145  LEU B N   1 
ATOM   2672 C  CA  . LEU B 1 148 ? 48.045 6.348  3.489   1.00 13.36 ? 145  LEU B CA  1 
ATOM   2673 C  C   . LEU B 1 148 ? 47.643 5.077  4.142   1.00 13.54 ? 145  LEU B C   1 
ATOM   2674 O  O   . LEU B 1 148 ? 48.474 4.187  4.268   1.00 14.95 ? 145  LEU B O   1 
ATOM   2675 C  CB  . LEU B 1 148 ? 48.628 7.306  4.546   1.00 14.06 ? 145  LEU B CB  1 
ATOM   2676 C  CG  . LEU B 1 148 ? 49.216 8.620  4.096   1.00 15.10 ? 145  LEU B CG  1 
ATOM   2677 C  CD1 . LEU B 1 148 ? 49.599 9.459  5.344   1.00 16.26 ? 145  LEU B CD1 1 
ATOM   2678 C  CD2 . LEU B 1 148 ? 50.390 8.380  3.179   1.00 21.00 ? 145  LEU B CD2 1 
ATOM   2679 N  N   . THR B 1 149 ? 46.408 4.965  4.591   1.00 13.29 ? 146  THR B N   1 
ATOM   2680 C  CA  . THR B 1 149 ? 45.989 3.745  5.301   1.00 13.74 ? 146  THR B CA  1 
ATOM   2681 C  C   . THR B 1 149 ? 45.890 2.515  4.379   1.00 14.30 ? 146  THR B C   1 
ATOM   2682 O  O   . THR B 1 149 ? 45.761 1.375  4.854   1.00 14.76 ? 146  THR B O   1 
ATOM   2683 C  CB  . THR B 1 149 ? 44.583 3.889  5.981   1.00 15.60 ? 146  THR B CB  1 
ATOM   2684 O  OG1 . THR B 1 149 ? 43.535 3.955  5.012   1.00 13.06 ? 146  THR B OG1 1 
ATOM   2685 C  CG2 . THR B 1 149 ? 44.514 5.064  6.895   1.00 14.18 ? 146  THR B CG2 1 
ATOM   2686 N  N   . GLU B 1 150 ? 45.962 2.770  3.074   1.00 14.10 ? 147  GLU B N   1 
ATOM   2687 C  CA  . GLU B 1 150 ? 46.000 1.709  2.041   1.00 15.04 ? 147  GLU B CA  1 
ATOM   2688 C  C   . GLU B 1 150 ? 47.373 1.630  1.397   1.00 14.62 ? 147  GLU B C   1 
ATOM   2689 O  O   . GLU B 1 150 ? 47.559 0.978  0.390   1.00 16.33 ? 147  GLU B O   1 
ATOM   2690 C  CB  . GLU B 1 150 ? 44.906 1.994  1.006   1.00 15.15 ? 147  GLU B CB  1 
ATOM   2691 C  CG  . GLU B 1 150 ? 43.516 2.087  1.604   1.00 16.26 ? 147  GLU B CG  1 
ATOM   2692 C  CD  . GLU B 1 150 ? 42.471 2.415  0.553   1.00 16.40 ? 147  GLU B CD  1 
ATOM   2693 O  OE1 . GLU B 1 150 ? 42.047 1.481  -0.159  1.00 19.93 ? 147  GLU B OE1 1 
ATOM   2694 O  OE2 . GLU B 1 150 ? 42.080 3.598  0.456   1.00 18.50 ? 147  GLU B OE2 1 
ATOM   2695 N  N   . ASN B 1 151 ? 48.368 2.196  2.043   1.00 15.74 ? 148  ASN B N   1 
ATOM   2696 C  CA  . ASN B 1 151 ? 49.761 2.145  1.551   1.00 17.17 ? 148  ASN B CA  1 
ATOM   2697 C  C   . ASN B 1 151 ? 49.922 2.811  0.147   1.00 16.52 ? 148  ASN B C   1 
ATOM   2698 O  O   . ASN B 1 151 ? 50.750 2.371  -0.655  1.00 18.20 ? 148  ASN B O   1 
ATOM   2699 C  CB  . ASN B 1 151 ? 50.274 0.721  1.492   1.00 16.99 ? 148  ASN B CB  1 
ATOM   2700 C  CG  . ASN B 1 151 ? 51.824 0.626  1.223   1.00 22.28 ? 148  ASN B CG  1 
ATOM   2701 O  OD1 . ASN B 1 151 ? 52.630 1.360  1.826   1.00 26.24 ? 148  ASN B OD1 1 
ATOM   2702 N  ND2 . ASN B 1 151 ? 52.227 -0.312 0.335   1.00 25.79 ? 148  ASN B ND2 1 
ATOM   2703 N  N   . LYS B 1 152 ? 49.124 3.827  -0.118  1.00 16.34 ? 149  LYS B N   1 
ATOM   2704 C  CA  . LYS B 1 152 ? 49.200 4.569  -1.347  1.00 15.69 ? 149  LYS B CA  1 
ATOM   2705 C  C   . LYS B 1 152 ? 49.668 5.999  -1.080  1.00 17.11 ? 149  LYS B C   1 
ATOM   2706 O  O   . LYS B 1 152 ? 49.245 6.635  -0.125  1.00 16.59 ? 149  LYS B O   1 
ATOM   2707 C  CB  . LYS B 1 152 ? 47.843 4.555  -2.086  1.00 15.44 ? 149  LYS B CB  1 
ATOM   2708 C  CG  . LYS B 1 152 ? 47.355 3.138  -2.386  1.00 16.77 ? 149  LYS B CG  1 
ATOM   2709 C  CD  . LYS B 1 152 ? 46.052 3.029  -3.117  1.00 17.78 ? 149  LYS B CD  1 
ATOM   2710 C  CE  . LYS B 1 152 ? 45.608 1.567  -3.260  1.00 18.32 ? 149  LYS B CE  1 
ATOM   2711 N  NZ  . LYS B 1 152 ? 44.438 1.489  -4.155  1.00 15.25 ? 149  LYS B NZ  1 
ATOM   2712 N  N   . LYS B 1 153 ? 50.472 6.547  -1.986  1.00 16.57 ? 150  LYS B N   1 
ATOM   2713 C  CA  . LYS B 1 153 ? 51.065 7.866  -1.748  1.00 16.45 ? 150  LYS B CA  1 
ATOM   2714 C  C   . LYS B 1 153 ? 50.204 8.921  -2.402  1.00 16.39 ? 150  LYS B C   1 
ATOM   2715 O  O   . LYS B 1 153 ? 49.968 8.849  -3.606  1.00 15.85 ? 150  LYS B O   1 
ATOM   2716 C  CB  . LYS B 1 153 ? 52.521 7.940  -2.295  1.00 15.94 ? 150  LYS B CB  1 
ATOM   2717 C  CG  . LYS B 1 153 ? 53.164 9.300  -2.017  1.00 15.78 ? 150  LYS B CG  1 
ATOM   2718 C  CD  . LYS B 1 153 ? 54.519 9.479  -2.687  1.00 16.96 ? 150  LYS B CD  1 
ATOM   2719 C  CE  . LYS B 1 153 ? 55.325 10.662 -2.143  1.00 17.59 ? 150  LYS B CE  1 
ATOM   2720 N  NZ  . LYS B 1 153 ? 56.759 10.668 -2.730  1.00 17.97 ? 150  LYS B NZ  1 
ATOM   2721 N  N   . PRO B 1 154 ? 49.726 9.896  -1.623  1.00 15.69 ? 151  PRO B N   1 
ATOM   2722 C  CA  . PRO B 1 154 ? 48.883 10.912 -2.244  1.00 15.65 ? 151  PRO B CA  1 
ATOM   2723 C  C   . PRO B 1 154 ? 49.685 11.892 -3.067  1.00 15.02 ? 151  PRO B C   1 
ATOM   2724 O  O   . PRO B 1 154 ? 50.813 12.260 -2.675  1.00 14.10 ? 151  PRO B O   1 
ATOM   2725 C  CB  . PRO B 1 154 ? 48.212 11.599 -1.052  1.00 14.72 ? 151  PRO B CB  1 
ATOM   2726 C  CG  . PRO B 1 154 ? 49.113 11.293 0.103   1.00 18.24 ? 151  PRO B CG  1 
ATOM   2727 C  CD  . PRO B 1 154 ? 49.698 9.961  -0.153  1.00 15.89 ? 151  PRO B CD  1 
ATOM   2728 N  N   . LEU B 1 155 ? 49.139 12.245 -4.239  1.00 15.63 ? 152  LEU B N   1 
ATOM   2729 C  CA  . LEU B 1 155 ? 49.735 13.264 -5.119  1.00 14.60 ? 152  LEU B CA  1 
ATOM   2730 C  C   . LEU B 1 155 ? 48.949 14.549 -5.265  1.00 14.32 ? 152  LEU B C   1 
ATOM   2731 O  O   . LEU B 1 155 ? 49.570 15.628 -5.420  1.00 14.64 ? 152  LEU B O   1 
ATOM   2732 C  CB  . LEU B 1 155 ? 50.029 12.692 -6.486  1.00 14.59 ? 152  LEU B CB  1 
ATOM   2733 C  CG  . LEU B 1 155 ? 50.713 11.299 -6.549  1.00 15.93 ? 152  LEU B CG  1 
ATOM   2734 C  CD1 . LEU B 1 155 ? 50.826 10.896 -8.018  1.00 16.51 ? 152  LEU B CD1 1 
ATOM   2735 C  CD2 . LEU B 1 155 ? 52.076 11.265 -5.870  1.00 14.95 ? 152  LEU B CD2 1 
ATOM   2736 N  N   . LEU B 1 156 ? 47.620 14.459 -5.230  1.00 14.29 ? 153  LEU B N   1 
ATOM   2737 C  CA  . LEU B 1 156 ? 46.716 15.586 -5.363  1.00 13.97 ? 153  LEU B CA  1 
ATOM   2738 C  C   . LEU B 1 156 ? 45.453 15.261 -4.615  1.00 14.53 ? 153  LEU B C   1 
ATOM   2739 O  O   . LEU B 1 156 ? 44.975 14.098 -4.677  1.00 16.63 ? 153  LEU B O   1 
ATOM   2740 C  CB  . LEU B 1 156 ? 46.309 15.834 -6.817  1.00 14.59 ? 153  LEU B CB  1 
ATOM   2741 C  CG  . LEU B 1 156 ? 45.260 16.936 -7.110  1.00 15.07 ? 153  LEU B CG  1 
ATOM   2742 C  CD1 . LEU B 1 156 ? 45.788 18.361 -6.732  1.00 14.43 ? 153  LEU B CD1 1 
ATOM   2743 C  CD2 . LEU B 1 156 ? 44.792 16.931 -8.550  1.00 15.63 ? 153  LEU B CD2 1 
ATOM   2744 N  N   . THR B 1 157 ? 44.872 16.252 -3.958  1.00 14.34 ? 154  THR B N   1 
ATOM   2745 C  CA  . THR B 1 157 ? 43.557 16.033 -3.344  1.00 14.46 ? 154  THR B CA  1 
ATOM   2746 C  C   . THR B 1 157 ? 42.631 17.210 -3.519  1.00 14.74 ? 154  THR B C   1 
ATOM   2747 O  O   . THR B 1 157 ? 43.083 18.354 -3.527  1.00 15.81 ? 154  THR B O   1 
ATOM   2748 C  CB  . THR B 1 157 ? 43.591 15.624 -1.886  1.00 15.42 ? 154  THR B CB  1 
ATOM   2749 O  OG1 . THR B 1 157 ? 42.306 15.053 -1.582  1.00 17.82 ? 154  THR B OG1 1 
ATOM   2750 C  CG2 . THR B 1 157 ? 43.861 16.790 -0.925  1.00 11.54 ? 154  THR B CG2 1 
ATOM   2751 N  N   . PHE B 1 158 ? 41.343 16.915 -3.749  1.00 15.49 ? 155  PHE B N   1 
ATOM   2752 C  CA  . PHE B 1 158 ? 40.274 17.884 -3.679  1.00 15.68 ? 155  PHE B CA  1 
ATOM   2753 C  C   . PHE B 1 158 ? 39.376 17.538 -2.483  1.00 16.73 ? 155  PHE B C   1 
ATOM   2754 O  O   . PHE B 1 158 ? 38.777 16.458 -2.462  1.00 17.48 ? 155  PHE B O   1 
ATOM   2755 C  CB  . PHE B 1 158 ? 39.377 17.921 -4.941  1.00 16.47 ? 155  PHE B CB  1 
ATOM   2756 C  CG  . PHE B 1 158 ? 40.016 18.484 -6.169  1.00 16.42 ? 155  PHE B CG  1 
ATOM   2757 C  CD1 . PHE B 1 158 ? 41.323 18.947 -6.195  1.00 14.81 ? 155  PHE B CD1 1 
ATOM   2758 C  CD2 . PHE B 1 158 ? 39.252 18.540 -7.374  1.00 20.36 ? 155  PHE B CD2 1 
ATOM   2759 C  CE1 . PHE B 1 158 ? 41.897 19.429 -7.367  1.00 19.65 ? 155  PHE B CE1 1 
ATOM   2760 C  CE2 . PHE B 1 158 ? 39.813 19.060 -8.537  1.00 21.43 ? 155  PHE B CE2 1 
ATOM   2761 C  CZ  . PHE B 1 158 ? 41.135 19.474 -8.536  1.00 18.29 ? 155  PHE B CZ  1 
ATOM   2762 N  N   . ASP B 1 159 ? 39.245 18.482 -1.544  1.00 15.51 ? 156  ASP B N   1 
ATOM   2763 C  CA  . ASP B 1 159 ? 38.291 18.383 -0.439  1.00 15.39 ? 156  ASP B CA  1 
ATOM   2764 C  C   . ASP B 1 159 ? 36.898 18.596 -0.996  1.00 16.28 ? 156  ASP B C   1 
ATOM   2765 O  O   . ASP B 1 159 ? 36.660 19.632 -1.619  1.00 15.41 ? 156  ASP B O   1 
ATOM   2766 C  CB  . ASP B 1 159 ? 38.604 19.453 0.590   1.00 14.35 ? 156  ASP B CB  1 
ATOM   2767 C  CG  . ASP B 1 159 ? 37.831 19.311 1.877   1.00 15.81 ? 156  ASP B CG  1 
ATOM   2768 O  OD1 . ASP B 1 159 ? 36.921 18.445 2.019   1.00 15.16 ? 156  ASP B OD1 1 
ATOM   2769 O  OD2 . ASP B 1 159 ? 38.176 20.079 2.796   1.00 14.05 ? 156  ASP B OD2 1 
ATOM   2770 N  N   . VAL B 1 160 ? 35.978 17.661 -0.724  1.00 15.73 ? 157  VAL B N   1 
ATOM   2771 C  CA  . VAL B 1 160 ? 34.601 17.805 -1.190  1.00 15.07 ? 157  VAL B CA  1 
ATOM   2772 C  C   . VAL B 1 160 ? 33.600 17.795 -0.012  1.00 14.38 ? 157  VAL B C   1 
ATOM   2773 O  O   . VAL B 1 160 ? 32.376 17.691 -0.210  1.00 15.02 ? 157  VAL B O   1 
ATOM   2774 C  CB  . VAL B 1 160 ? 34.205 16.867 -2.377  1.00 15.30 ? 157  VAL B CB  1 
ATOM   2775 C  CG1 . VAL B 1 160 ? 35.010 17.192 -3.681  1.00 15.05 ? 157  VAL B CG1 1 
ATOM   2776 C  CG2 . VAL B 1 160 ? 34.328 15.342 -2.012  1.00 14.95 ? 157  VAL B CG2 1 
ATOM   2777 N  N   . TRP B 1 161 ? 34.097 17.927 1.215   1.00 14.51 ? 158  TRP B N   1 
ATOM   2778 C  CA  . TRP B 1 161 ? 33.209 18.288 2.340   1.00 14.29 ? 158  TRP B CA  1 
ATOM   2779 C  C   . TRP B 1 161 ? 32.520 19.584 1.974   1.00 15.41 ? 158  TRP B C   1 
ATOM   2780 O  O   . TRP B 1 161 ? 33.158 20.442 1.391   1.00 15.94 ? 158  TRP B O   1 
ATOM   2781 C  CB  . TRP B 1 161 ? 34.017 18.521 3.612   1.00 14.76 ? 158  TRP B CB  1 
ATOM   2782 C  CG  . TRP B 1 161 ? 34.471 17.289 4.307   1.00 11.44 ? 158  TRP B CG  1 
ATOM   2783 C  CD1 . TRP B 1 161 ? 35.330 16.373 3.844   1.00 9.49  ? 158  TRP B CD1 1 
ATOM   2784 C  CD2 . TRP B 1 161 ? 34.192 16.944 5.662   1.00 10.55 ? 158  TRP B CD2 1 
ATOM   2785 N  NE1 . TRP B 1 161 ? 35.544 15.410 4.787   1.00 10.60 ? 158  TRP B NE1 1 
ATOM   2786 C  CE2 . TRP B 1 161 ? 34.887 15.780 5.941   1.00 10.06 ? 158  TRP B CE2 1 
ATOM   2787 C  CE3 . TRP B 1 161 ? 33.439 17.538 6.675   1.00 12.27 ? 158  TRP B CE3 1 
ATOM   2788 C  CZ2 . TRP B 1 161 ? 34.803 15.132 7.183   1.00 8.90  ? 158  TRP B CZ2 1 
ATOM   2789 C  CZ3 . TRP B 1 161 ? 33.353 16.885 7.931   1.00 12.32 ? 158  TRP B CZ3 1 
ATOM   2790 C  CH2 . TRP B 1 161 ? 34.040 15.719 8.159   1.00 10.87 ? 158  TRP B CH2 1 
ATOM   2791 N  N   . GLU B 1 162 ? 31.252 19.769 2.334   1.00 14.65 ? 159  GLU B N   1 
ATOM   2792 C  CA  . GLU B 1 162 ? 30.557 20.960 1.928   1.00 15.74 ? 159  GLU B CA  1 
ATOM   2793 C  C   . GLU B 1 162 ? 31.230 22.239 2.408   1.00 16.04 ? 159  GLU B C   1 
ATOM   2794 O  O   . GLU B 1 162 ? 31.218 23.232 1.702   1.00 16.56 ? 159  GLU B O   1 
ATOM   2795 C  CB  . GLU B 1 162 ? 29.078 20.906 2.385   1.00 15.45 ? 159  GLU B CB  1 
ATOM   2796 C  CG  . GLU B 1 162 ? 28.320 19.836 1.539   1.00 16.69 ? 159  GLU B CG  1 
ATOM   2797 C  CD  . GLU B 1 162 ? 26.864 19.641 1.942   1.00 16.78 ? 159  GLU B CD  1 
ATOM   2798 O  OE1 . GLU B 1 162 ? 26.024 19.517 1.028   1.00 18.86 ? 159  GLU B OE1 1 
ATOM   2799 O  OE2 . GLU B 1 162 ? 26.584 19.556 3.154   1.00 15.68 ? 159  GLU B OE2 1 
ATOM   2800 N  N   . HIS B 1 163 ? 31.778 22.232 3.629   1.00 15.72 ? 160  HIS B N   1 
ATOM   2801 C  CA  . HIS B 1 163 ? 32.498 23.416 4.118   1.00 15.01 ? 160  HIS B CA  1 
ATOM   2802 C  C   . HIS B 1 163 ? 33.568 23.943 3.170   1.00 14.31 ? 160  HIS B C   1 
ATOM   2803 O  O   . HIS B 1 163 ? 33.885 25.126 3.229   1.00 16.14 ? 160  HIS B O   1 
ATOM   2804 C  CB  . HIS B 1 163 ? 33.024 23.239 5.580   1.00 14.40 ? 160  HIS B CB  1 
ATOM   2805 C  CG  . HIS B 1 163 ? 34.127 22.243 5.725   1.00 15.76 ? 160  HIS B CG  1 
ATOM   2806 N  ND1 . HIS B 1 163 ? 34.038 21.134 6.562   1.00 12.37 ? 160  HIS B ND1 1 
ATOM   2807 C  CD2 . HIS B 1 163 ? 35.366 22.200 5.175   1.00 14.28 ? 160  HIS B CD2 1 
ATOM   2808 C  CE1 . HIS B 1 163 ? 35.166 20.453 6.483   1.00 14.12 ? 160  HIS B CE1 1 
ATOM   2809 N  NE2 . HIS B 1 163 ? 35.986 21.074 5.655   1.00 11.52 ? 160  HIS B NE2 1 
ATOM   2810 N  N   . ALA B 1 164 ? 34.126 23.114 2.304   1.00 14.24 ? 161  ALA B N   1 
ATOM   2811 C  CA  . ALA B 1 164 ? 35.177 23.569 1.411   1.00 14.19 ? 161  ALA B CA  1 
ATOM   2812 C  C   . ALA B 1 164 ? 34.680 24.513 0.343   1.00 14.96 ? 161  ALA B C   1 
ATOM   2813 O  O   . ALA B 1 164 ? 35.466 25.280 -0.156  1.00 15.18 ? 161  ALA B O   1 
ATOM   2814 C  CB  . ALA B 1 164 ? 35.918 22.360 0.744   1.00 13.19 ? 161  ALA B CB  1 
ATOM   2815 N  N   . TYR B 1 165 ? 33.391 24.421 -0.028  1.00 14.50 ? 162  TYR B N   1 
ATOM   2816 C  CA  . TYR B 1 165 ? 32.837 25.198 -1.068  1.00 14.72 ? 162  TYR B CA  1 
ATOM   2817 C  C   . TYR B 1 165 ? 31.545 25.962 -0.790  1.00 15.61 ? 162  TYR B C   1 
ATOM   2818 O  O   . TYR B 1 165 ? 31.187 26.838 -1.595  1.00 17.45 ? 162  TYR B O   1 
ATOM   2819 C  CB  . TYR B 1 165 ? 32.657 24.334 -2.301  1.00 14.20 ? 162  TYR B CB  1 
ATOM   2820 C  CG  . TYR B 1 165 ? 31.780 23.137 -2.141  1.00 13.84 ? 162  TYR B CG  1 
ATOM   2821 C  CD1 . TYR B 1 165 ? 30.433 23.229 -2.352  1.00 12.61 ? 162  TYR B CD1 1 
ATOM   2822 C  CD2 . TYR B 1 165 ? 32.322 21.900 -1.822  1.00 14.64 ? 162  TYR B CD2 1 
ATOM   2823 C  CE1 . TYR B 1 165 ? 29.606 22.114 -2.280  1.00 15.16 ? 162  TYR B CE1 1 
ATOM   2824 C  CE2 . TYR B 1 165 ? 31.522 20.764 -1.704  1.00 16.56 ? 162  TYR B CE2 1 
ATOM   2825 C  CZ  . TYR B 1 165 ? 30.134 20.881 -1.941  1.00 15.02 ? 162  TYR B CZ  1 
ATOM   2826 O  OH  . TYR B 1 165 ? 29.327 19.758 -1.863  1.00 15.35 ? 162  TYR B OH  1 
ATOM   2827 N  N   . TYR B 1 166 ? 30.887 25.700 0.339   1.00 15.93 ? 163  TYR B N   1 
ATOM   2828 C  CA  . TYR B 1 166 ? 29.515 26.163 0.509   1.00 16.51 ? 163  TYR B CA  1 
ATOM   2829 C  C   . TYR B 1 166 ? 29.387 27.701 0.527   1.00 17.02 ? 163  TYR B C   1 
ATOM   2830 O  O   . TYR B 1 166 ? 28.470 28.238 -0.067  1.00 17.40 ? 163  TYR B O   1 
ATOM   2831 C  CB  . TYR B 1 166 ? 28.795 25.513 1.699   1.00 16.30 ? 163  TYR B CB  1 
ATOM   2832 C  CG  . TYR B 1 166 ? 27.323 25.206 1.363   1.00 19.36 ? 163  TYR B CG  1 
ATOM   2833 C  CD1 . TYR B 1 166 ? 26.289 26.055 1.800   1.00 22.29 ? 163  TYR B CD1 1 
ATOM   2834 C  CD2 . TYR B 1 166 ? 26.980 24.114 0.587   1.00 20.75 ? 163  TYR B CD2 1 
ATOM   2835 C  CE1 . TYR B 1 166 ? 24.969 25.788 1.492   1.00 22.22 ? 163  TYR B CE1 1 
ATOM   2836 C  CE2 . TYR B 1 166 ? 25.671 23.840 0.251   1.00 23.15 ? 163  TYR B CE2 1 
ATOM   2837 C  CZ  . TYR B 1 166 ? 24.660 24.683 0.705   1.00 23.69 ? 163  TYR B CZ  1 
ATOM   2838 O  OH  . TYR B 1 166 ? 23.356 24.421 0.383   1.00 24.58 ? 163  TYR B OH  1 
ATOM   2839 N  N   . ILE B 1 167 ? 30.333 28.386 1.150   1.00 17.33 ? 164  ILE B N   1 
ATOM   2840 C  CA  . ILE B 1 167 ? 30.312 29.842 1.235   1.00 18.41 ? 164  ILE B CA  1 
ATOM   2841 C  C   . ILE B 1 167 ? 30.344 30.464 -0.154  1.00 19.98 ? 164  ILE B C   1 
ATOM   2842 O  O   . ILE B 1 167 ? 29.632 31.437 -0.435  1.00 19.89 ? 164  ILE B O   1 
ATOM   2843 C  CB  . ILE B 1 167 ? 31.497 30.359 2.097   1.00 18.30 ? 164  ILE B CB  1 
ATOM   2844 C  CG1 . ILE B 1 167 ? 31.378 29.838 3.515   1.00 14.98 ? 164  ILE B CG1 1 
ATOM   2845 C  CG2 . ILE B 1 167 ? 31.532 31.909 2.164   1.00 17.97 ? 164  ILE B CG2 1 
ATOM   2846 C  CD1 . ILE B 1 167 ? 32.587 30.084 4.388   1.00 13.06 ? 164  ILE B CD1 1 
ATOM   2847 N  N   . ASP B 1 168 ? 31.142 29.865 -1.025  1.00 22.48 ? 165  ASP B N   1 
ATOM   2848 C  CA  . ASP B 1 168 ? 31.481 30.432 -2.335  1.00 23.04 ? 165  ASP B CA  1 
ATOM   2849 C  C   . ASP B 1 168 ? 30.626 29.910 -3.473  1.00 23.06 ? 165  ASP B C   1 
ATOM   2850 O  O   . ASP B 1 168 ? 30.450 30.645 -4.408  1.00 22.90 ? 165  ASP B O   1 
ATOM   2851 C  CB  . ASP B 1 168 ? 32.963 30.195 -2.654  1.00 22.96 ? 165  ASP B CB  1 
ATOM   2852 C  CG  . ASP B 1 168 ? 33.890 30.809 -1.590  1.00 24.22 ? 165  ASP B CG  1 
ATOM   2853 O  OD1 . ASP B 1 168 ? 33.480 31.824 -0.922  1.00 22.15 ? 165  ASP B OD1 1 
ATOM   2854 O  OD2 . ASP B 1 168 ? 35.000 30.228 -1.367  1.00 27.33 ? 165  ASP B OD2 1 
ATOM   2855 N  N   . TYR B 1 169 ? 30.104 28.681 -3.371  1.00 22.63 ? 166  TYR B N   1 
ATOM   2856 C  CA  . TYR B 1 169 ? 29.370 28.002 -4.463  1.00 23.42 ? 166  TYR B CA  1 
ATOM   2857 C  C   . TYR B 1 169 ? 28.027 27.415 -4.027  1.00 23.86 ? 166  TYR B C   1 
ATOM   2858 O  O   . TYR B 1 169 ? 27.316 26.807 -4.847  1.00 23.42 ? 166  TYR B O   1 
ATOM   2859 C  CB  . TYR B 1 169 ? 30.247 26.855 -5.073  1.00 22.66 ? 166  TYR B CB  1 
ATOM   2860 C  CG  . TYR B 1 169 ? 31.579 27.355 -5.626  1.00 23.79 ? 166  TYR B CG  1 
ATOM   2861 C  CD1 . TYR B 1 169 ? 31.658 27.844 -6.925  1.00 27.11 ? 166  TYR B CD1 1 
ATOM   2862 C  CD2 . TYR B 1 169 ? 32.737 27.377 -4.841  1.00 25.79 ? 166  TYR B CD2 1 
ATOM   2863 C  CE1 . TYR B 1 169 ? 32.866 28.332 -7.431  1.00 28.46 ? 166  TYR B CE1 1 
ATOM   2864 C  CE2 . TYR B 1 169 ? 33.938 27.870 -5.318  1.00 23.81 ? 166  TYR B CE2 1 
ATOM   2865 C  CZ  . TYR B 1 169 ? 33.991 28.369 -6.608  1.00 25.34 ? 166  TYR B CZ  1 
ATOM   2866 O  OH  . TYR B 1 169 ? 35.170 28.882 -7.150  1.00 25.23 ? 166  TYR B OH  1 
ATOM   2867 N  N   . ARG B 1 170 ? 27.691 27.554 -2.742  1.00 24.30 ? 167  ARG B N   1 
ATOM   2868 C  CA  . ARG B 1 170 ? 26.540 26.860 -2.175  1.00 24.25 ? 167  ARG B CA  1 
ATOM   2869 C  C   . ARG B 1 170 ? 26.535 25.379 -2.624  1.00 23.86 ? 167  ARG B C   1 
ATOM   2870 O  O   . ARG B 1 170 ? 27.585 24.736 -2.535  1.00 24.15 ? 167  ARG B O   1 
ATOM   2871 C  CB  . ARG B 1 170 ? 25.244 27.623 -2.528  1.00 24.46 ? 167  ARG B CB  1 
ATOM   2872 C  CG  . ARG B 1 170 ? 25.247 29.020 -1.924  1.00 24.23 ? 167  ARG B CG  1 
ATOM   2873 C  CD  . ARG B 1 170 ? 24.944 29.008 -0.421  1.00 26.87 ? 167  ARG B CD  1 
ATOM   2874 N  NE  . ARG B 1 170 ? 24.744 30.347 0.133   1.00 25.23 ? 167  ARG B NE  1 
ATOM   2875 C  CZ  . ARG B 1 170 ? 25.697 31.161 0.586   1.00 25.11 ? 167  ARG B CZ  1 
ATOM   2876 N  NH1 . ARG B 1 170 ? 26.980 30.791 0.578   1.00 25.36 ? 167  ARG B NH1 1 
ATOM   2877 N  NH2 . ARG B 1 170 ? 25.365 32.375 1.055   1.00 25.05 ? 167  ARG B NH2 1 
ATOM   2878 N  N   . ASN B 1 171 ? 25.427 24.856 -3.157  1.00 23.08 ? 168  ASN B N   1 
ATOM   2879 C  CA  . ASN B 1 171 ? 25.374 23.431 -3.512  1.00 23.77 ? 168  ASN B CA  1 
ATOM   2880 C  C   . ASN B 1 171 ? 26.053 23.050 -4.841  1.00 23.04 ? 168  ASN B C   1 
ATOM   2881 O  O   . ASN B 1 171 ? 26.122 21.864 -5.158  1.00 21.94 ? 168  ASN B O   1 
ATOM   2882 C  CB  . ASN B 1 171 ? 23.946 22.941 -3.524  1.00 23.62 ? 168  ASN B CB  1 
ATOM   2883 C  CG  . ASN B 1 171 ? 23.140 23.570 -4.631  1.00 25.05 ? 168  ASN B CG  1 
ATOM   2884 O  OD1 . ASN B 1 171 ? 23.074 24.797 -4.742  1.00 23.73 ? 168  ASN B OD1 1 
ATOM   2885 N  ND2 . ASN B 1 171 ? 22.516 22.740 -5.456  1.00 24.31 ? 168  ASN B ND2 1 
ATOM   2886 N  N   . ALA B 1 172 ? 26.566 24.033 -5.587  1.00 22.56 ? 169  ALA B N   1 
ATOM   2887 C  CA  . ALA B 1 172 ? 27.194 23.815 -6.893  1.00 21.75 ? 169  ALA B CA  1 
ATOM   2888 C  C   . ALA B 1 172 ? 28.616 23.316 -6.786  1.00 21.20 ? 169  ALA B C   1 
ATOM   2889 O  O   . ALA B 1 172 ? 29.558 23.997 -7.217  1.00 20.84 ? 169  ALA B O   1 
ATOM   2890 C  CB  . ALA B 1 172 ? 27.159 25.136 -7.788  1.00 22.24 ? 169  ALA B CB  1 
ATOM   2891 N  N   . ARG B 1 173 ? 28.770 22.105 -6.253  1.00 20.73 ? 170  ARG B N   1 
ATOM   2892 C  CA  . ARG B 1 173 ? 30.047 21.474 -6.193  1.00 20.87 ? 170  ARG B CA  1 
ATOM   2893 C  C   . ARG B 1 173 ? 30.737 21.375 -7.541  1.00 22.44 ? 170  ARG B C   1 
ATOM   2894 O  O   . ARG B 1 173 ? 31.953 21.558 -7.591  1.00 22.87 ? 170  ARG B O   1 
ATOM   2895 C  CB  . ARG B 1 173 ? 29.959 20.057 -5.548  1.00 20.94 ? 170  ARG B CB  1 
ATOM   2896 C  CG  . ARG B 1 173 ? 31.318 19.445 -5.273  1.00 20.61 ? 170  ARG B CG  1 
ATOM   2897 C  CD  . ARG B 1 173 ? 31.259 17.966 -4.978  1.00 21.32 ? 170  ARG B CD  1 
ATOM   2898 N  NE  . ARG B 1 173 ? 30.522 17.629 -3.758  1.00 19.46 ? 170  ARG B NE  1 
ATOM   2899 C  CZ  . ARG B 1 173 ? 30.408 16.396 -3.266  1.00 21.67 ? 170  ARG B CZ  1 
ATOM   2900 N  NH1 . ARG B 1 173 ? 31.015 15.359 -3.842  1.00 22.98 ? 170  ARG B NH1 1 
ATOM   2901 N  NH2 . ARG B 1 173 ? 29.692 16.184 -2.186  1.00 22.28 ? 170  ARG B NH2 1 
ATOM   2902 N  N   . PRO B 1 174 ? 29.997 21.084 -8.642  1.00 22.76 ? 171  PRO B N   1 
ATOM   2903 C  CA  . PRO B 1 174 ? 30.719 21.038 -9.926  1.00 23.56 ? 171  PRO B CA  1 
ATOM   2904 C  C   . PRO B 1 174 ? 31.463 22.320 -10.322 1.00 23.76 ? 171  PRO B C   1 
ATOM   2905 O  O   . PRO B 1 174 ? 32.531 22.245 -10.973 1.00 23.57 ? 171  PRO B O   1 
ATOM   2906 C  CB  . PRO B 1 174 ? 29.597 20.738 -10.956 1.00 23.89 ? 171  PRO B CB  1 
ATOM   2907 C  CG  . PRO B 1 174 ? 28.536 19.965 -10.131 1.00 22.97 ? 171  PRO B CG  1 
ATOM   2908 C  CD  . PRO B 1 174 ? 28.575 20.711 -8.802  1.00 24.00 ? 171  PRO B CD  1 
ATOM   2909 N  N   . LYS B 1 175 ? 30.887 23.477 -9.995  1.00 24.05 ? 172  LYS B N   1 
ATOM   2910 C  CA  . LYS B 1 175 ? 31.510 24.742 -10.307 1.00 24.65 ? 172  LYS B CA  1 
ATOM   2911 C  C   . LYS B 1 175 ? 32.797 24.909 -9.494  1.00 24.37 ? 172  LYS B C   1 
ATOM   2912 O  O   . LYS B 1 175 ? 33.824 25.367 -10.039 1.00 23.67 ? 172  LYS B O   1 
ATOM   2913 C  CB  . LYS B 1 175 ? 30.558 25.930 -10.014 1.00 25.29 ? 172  LYS B CB  1 
ATOM   2914 C  CG  . LYS B 1 175 ? 29.259 25.931 -10.782 1.00 27.72 ? 172  LYS B CG  1 
ATOM   2915 C  CD  . LYS B 1 175 ? 29.523 26.104 -12.263 1.00 29.36 ? 172  LYS B CD  1 
ATOM   2916 C  CE  . LYS B 1 175 ? 28.282 26.412 -13.021 1.00 31.77 ? 172  LYS B CE  1 
ATOM   2917 N  NZ  . LYS B 1 175 ? 28.704 26.646 -14.429 1.00 31.44 ? 172  LYS B NZ  1 
ATOM   2918 N  N   . TYR B 1 176 ? 32.742 24.544 -8.196  1.00 24.02 ? 173  TYR B N   1 
ATOM   2919 C  CA  . TYR B 1 176 ? 33.911 24.495 -7.348  1.00 24.12 ? 173  TYR B CA  1 
ATOM   2920 C  C   . TYR B 1 176 ? 35.044 23.593 -7.938  1.00 24.83 ? 173  TYR B C   1 
ATOM   2921 O  O   . TYR B 1 176 ? 36.188 24.026 -8.091  1.00 22.53 ? 173  TYR B O   1 
ATOM   2922 C  CB  . TYR B 1 176 ? 33.486 23.982 -5.949  1.00 24.23 ? 173  TYR B CB  1 
ATOM   2923 C  CG  . TYR B 1 176 ? 34.585 23.491 -5.021  1.00 24.87 ? 173  TYR B CG  1 
ATOM   2924 C  CD1 . TYR B 1 176 ? 35.559 24.350 -4.506  1.00 23.43 ? 173  TYR B CD1 1 
ATOM   2925 C  CD2 . TYR B 1 176 ? 34.600 22.145 -4.595  1.00 21.48 ? 173  TYR B CD2 1 
ATOM   2926 C  CE1 . TYR B 1 176 ? 36.530 23.861 -3.617  1.00 23.77 ? 173  TYR B CE1 1 
ATOM   2927 C  CE2 . TYR B 1 176 ? 35.573 21.668 -3.758  1.00 22.48 ? 173  TYR B CE2 1 
ATOM   2928 C  CZ  . TYR B 1 176 ? 36.515 22.522 -3.259  1.00 20.73 ? 173  TYR B CZ  1 
ATOM   2929 O  OH  . TYR B 1 176 ? 37.453 22.019 -2.420  1.00 23.33 ? 173  TYR B OH  1 
ATOM   2930 N  N   . VAL B 1 177 ? 34.692 22.357 -8.296  1.00 25.05 ? 174  VAL B N   1 
ATOM   2931 C  CA  . VAL B 1 177 ? 35.669 21.396 -8.852  1.00 24.87 ? 174  VAL B CA  1 
ATOM   2932 C  C   . VAL B 1 177 ? 36.258 21.924 -10.146 1.00 24.35 ? 174  VAL B C   1 
ATOM   2933 O  O   . VAL B 1 177 ? 37.457 21.870 -10.381 1.00 24.46 ? 174  VAL B O   1 
ATOM   2934 C  CB  . VAL B 1 177 ? 35.001 19.977 -9.016  1.00 25.14 ? 174  VAL B CB  1 
ATOM   2935 C  CG1 . VAL B 1 177 ? 35.901 18.991 -9.820  1.00 24.97 ? 174  VAL B CG1 1 
ATOM   2936 C  CG2 . VAL B 1 177 ? 34.643 19.380 -7.631  1.00 24.17 ? 174  VAL B CG2 1 
ATOM   2937 N  N   . GLU B 1 178 ? 35.403 22.449 -11.018 1.00 24.60 ? 175  GLU B N   1 
ATOM   2938 C  CA  . GLU B 1 178 ? 35.872 23.029 -12.265 1.00 23.38 ? 175  GLU B CA  1 
ATOM   2939 C  C   . GLU B 1 178 ? 36.896 24.161 -11.971 1.00 23.24 ? 175  GLU B C   1 
ATOM   2940 O  O   . GLU B 1 178 ? 38.002 24.166 -12.546 1.00 21.19 ? 175  GLU B O   1 
ATOM   2941 C  CB  . GLU B 1 178 ? 34.665 23.520 -13.058 1.00 24.23 ? 175  GLU B CB  1 
ATOM   2942 C  CG  . GLU B 1 178 ? 35.002 24.203 -14.392 1.00 26.91 ? 175  GLU B CG  1 
ATOM   2943 C  CD  . GLU B 1 178 ? 33.770 24.823 -15.105 1.00 31.19 ? 175  GLU B CD  1 
ATOM   2944 O  OE1 . GLU B 1 178 ? 32.829 25.370 -14.465 1.00 34.49 ? 175  GLU B OE1 1 
ATOM   2945 O  OE2 . GLU B 1 178 ? 33.779 24.814 -16.339 1.00 33.88 ? 175  GLU B OE2 1 
ATOM   2946 N  N   . ALA B 1 179 ? 36.562 25.062 -11.042 1.00 22.22 ? 176  ALA B N   1 
ATOM   2947 C  CA  . ALA B 1 179 ? 37.414 26.233 -10.741 1.00 23.26 ? 176  ALA B CA  1 
ATOM   2948 C  C   . ALA B 1 179 ? 38.734 25.886 -10.086 1.00 22.85 ? 176  ALA B C   1 
ATOM   2949 O  O   . ALA B 1 179 ? 39.762 26.583 -10.291 1.00 21.66 ? 176  ALA B O   1 
ATOM   2950 C  CB  . ALA B 1 179 ? 36.657 27.282 -9.866  1.00 23.53 ? 176  ALA B CB  1 
ATOM   2951 N  N   . LEU B 1 180 ? 38.732 24.786 -9.327  1.00 22.89 ? 177  LEU B N   1 
ATOM   2952 C  CA  . LEU B 1 180 ? 39.928 24.391 -8.606  1.00 23.81 ? 177  LEU B CA  1 
ATOM   2953 C  C   . LEU B 1 180 ? 41.113 24.150 -9.546  1.00 23.03 ? 177  LEU B C   1 
ATOM   2954 O  O   . LEU B 1 180 ? 42.258 24.416 -9.202  1.00 23.57 ? 177  LEU B O   1 
ATOM   2955 C  CB  . LEU B 1 180 ? 39.689 23.126 -7.776  1.00 23.09 ? 177  LEU B CB  1 
ATOM   2956 C  CG  . LEU B 1 180 ? 39.031 23.250 -6.397  1.00 25.13 ? 177  LEU B CG  1 
ATOM   2957 C  CD1 . LEU B 1 180 ? 38.848 21.855 -5.663  1.00 26.41 ? 177  LEU B CD1 1 
ATOM   2958 C  CD2 . LEU B 1 180 ? 39.881 24.167 -5.509  1.00 23.90 ? 177  LEU B CD2 1 
ATOM   2959 N  N   . TRP B 1 181 ? 40.850 23.628 -10.722 1.00 22.35 ? 178  TRP B N   1 
ATOM   2960 C  CA  . TRP B 1 181 ? 41.945 23.413 -11.666 1.00 22.11 ? 178  TRP B CA  1 
ATOM   2961 C  C   . TRP B 1 181 ? 42.813 24.652 -11.933 1.00 22.85 ? 178  TRP B C   1 
ATOM   2962 O  O   . TRP B 1 181 ? 44.024 24.529 -12.228 1.00 22.89 ? 178  TRP B O   1 
ATOM   2963 C  CB  . TRP B 1 181 ? 41.401 22.867 -12.984 1.00 21.40 ? 178  TRP B CB  1 
ATOM   2964 C  CG  . TRP B 1 181 ? 40.806 21.566 -12.817 1.00 20.17 ? 178  TRP B CG  1 
ATOM   2965 C  CD1 . TRP B 1 181 ? 39.482 21.259 -12.881 1.00 20.74 ? 178  TRP B CD1 1 
ATOM   2966 C  CD2 . TRP B 1 181 ? 41.495 20.343 -12.494 1.00 20.05 ? 178  TRP B CD2 1 
ATOM   2967 N  NE1 . TRP B 1 181 ? 39.293 19.914 -12.609 1.00 20.52 ? 178  TRP B NE1 1 
ATOM   2968 C  CE2 . TRP B 1 181 ? 40.514 19.323 -12.400 1.00 19.84 ? 178  TRP B CE2 1 
ATOM   2969 C  CE3 . TRP B 1 181 ? 42.835 20.013 -12.287 1.00 18.72 ? 178  TRP B CE3 1 
ATOM   2970 C  CZ2 . TRP B 1 181 ? 40.833 17.987 -12.072 1.00 22.30 ? 178  TRP B CZ2 1 
ATOM   2971 C  CZ3 . TRP B 1 181 ? 43.157 18.681 -11.970 1.00 21.91 ? 178  TRP B CZ3 1 
ATOM   2972 C  CH2 . TRP B 1 181 ? 42.153 17.688 -11.869 1.00 20.80 ? 178  TRP B CH2 1 
ATOM   2973 N  N   . ASP B 1 182 ? 42.195 25.831 -11.896 1.00 22.22 ? 179  ASP B N   1 
ATOM   2974 C  CA  . ASP B 1 182 ? 42.941 27.084 -12.058 1.00 22.48 ? 179  ASP B CA  1 
ATOM   2975 C  C   . ASP B 1 182 ? 44.008 27.371 -10.977 1.00 23.21 ? 179  ASP B C   1 
ATOM   2976 O  O   . ASP B 1 182 ? 44.903 28.171 -11.241 1.00 22.22 ? 179  ASP B O   1 
ATOM   2977 C  CB  . ASP B 1 182 ? 41.961 28.237 -12.032 1.00 23.17 ? 179  ASP B CB  1 
ATOM   2978 C  CG  . ASP B 1 182 ? 41.040 28.237 -13.242 1.00 26.47 ? 179  ASP B CG  1 
ATOM   2979 O  OD1 . ASP B 1 182 ? 41.346 27.534 -14.220 1.00 28.31 ? 179  ASP B OD1 1 
ATOM   2980 O  OD2 . ASP B 1 182 ? 40.030 28.951 -13.215 1.00 28.49 ? 179  ASP B OD2 1 
ATOM   2981 N  N   . ILE B 1 183 ? 43.901 26.743 -9.784  1.00 21.90 ? 180  ILE B N   1 
ATOM   2982 C  CA  . ILE B 1 183 ? 44.838 26.969 -8.670  1.00 22.95 ? 180  ILE B CA  1 
ATOM   2983 C  C   . ILE B 1 183 ? 45.565 25.711 -8.219  1.00 22.02 ? 180  ILE B C   1 
ATOM   2984 O  O   . ILE B 1 183 ? 46.289 25.745 -7.206  1.00 23.40 ? 180  ILE B O   1 
ATOM   2985 C  CB  . ILE B 1 183 ? 44.155 27.667 -7.410  1.00 22.68 ? 180  ILE B CB  1 
ATOM   2986 C  CG1 . ILE B 1 183 ? 42.959 26.841 -6.880  1.00 24.17 ? 180  ILE B CG1 1 
ATOM   2987 C  CG2 . ILE B 1 183 ? 43.754 29.135 -7.788  1.00 24.03 ? 180  ILE B CG2 1 
ATOM   2988 C  CD1 . ILE B 1 183 ? 42.310 27.311 -5.510  1.00 21.79 ? 180  ILE B CD1 1 
ATOM   2989 N  N   . VAL B 1 184 ? 45.404 24.620 -8.970  1.00 20.58 ? 181  VAL B N   1 
ATOM   2990 C  CA  . VAL B 1 184 ? 46.156 23.407 -8.693  1.00 21.43 ? 181  VAL B CA  1 
ATOM   2991 C  C   . VAL B 1 184 ? 47.634 23.654 -8.798  1.00 21.19 ? 181  VAL B C   1 
ATOM   2992 O  O   . VAL B 1 184 ? 48.112 24.269 -9.766  1.00 20.12 ? 181  VAL B O   1 
ATOM   2993 C  CB  . VAL B 1 184 ? 45.762 22.217 -9.579  1.00 20.88 ? 181  VAL B CB  1 
ATOM   2994 C  CG1 . VAL B 1 184 ? 46.808 21.101 -9.469  1.00 22.50 ? 181  VAL B CG1 1 
ATOM   2995 C  CG2 . VAL B 1 184 ? 44.342 21.683 -9.133  1.00 20.16 ? 181  VAL B CG2 1 
ATOM   2996 N  N   . ASN B 1 185 ? 48.329 23.264 -7.744  1.00 20.56 ? 182  ASN B N   1 
ATOM   2997 C  CA  . ASN B 1 185 ? 49.764 23.384 -7.680  1.00 21.43 ? 182  ASN B CA  1 
ATOM   2998 C  C   . ASN B 1 185 ? 50.435 22.143 -8.295  1.00 22.42 ? 182  ASN B C   1 
ATOM   2999 O  O   . ASN B 1 185 ? 50.755 21.160 -7.592  1.00 20.12 ? 182  ASN B O   1 
ATOM   3000 C  CB  . ASN B 1 185 ? 50.233 23.617 -6.258  1.00 21.72 ? 182  ASN B CB  1 
ATOM   3001 C  CG  . ASN B 1 185 ? 51.720 23.884 -6.180  1.00 22.25 ? 182  ASN B CG  1 
ATOM   3002 O  OD1 . ASN B 1 185 ? 52.443 23.675 -7.150  1.00 19.09 ? 182  ASN B OD1 1 
ATOM   3003 N  ND2 . ASN B 1 185 ? 52.180 24.324 -5.021  1.00 20.39 ? 182  ASN B ND2 1 
ATOM   3004 N  N   . TRP B 1 186 ? 50.681 22.221 -9.610  1.00 21.49 ? 183  TRP B N   1 
ATOM   3005 C  CA  . TRP B 1 186 ? 51.318 21.123 -10.340 1.00 21.45 ? 183  TRP B CA  1 
ATOM   3006 C  C   . TRP B 1 186 ? 52.755 20.926 -9.948  1.00 21.08 ? 183  TRP B C   1 
ATOM   3007 O  O   . TRP B 1 186 ? 53.305 19.841 -10.159 1.00 21.95 ? 183  TRP B O   1 
ATOM   3008 C  CB  . TRP B 1 186 ? 51.219 21.316 -11.854 1.00 22.27 ? 183  TRP B CB  1 
ATOM   3009 C  CG  . TRP B 1 186 ? 49.818 21.187 -12.291 1.00 22.44 ? 183  TRP B CG  1 
ATOM   3010 C  CD1 . TRP B 1 186 ? 48.931 22.192 -12.546 1.00 22.19 ? 183  TRP B CD1 1 
ATOM   3011 C  CD2 . TRP B 1 186 ? 49.116 19.962 -12.490 1.00 23.47 ? 183  TRP B CD2 1 
ATOM   3012 N  NE1 . TRP B 1 186 ? 47.708 21.669 -12.908 1.00 22.13 ? 183  TRP B NE1 1 
ATOM   3013 C  CE2 . TRP B 1 186 ? 47.799 20.299 -12.893 1.00 24.76 ? 183  TRP B CE2 1 
ATOM   3014 C  CE3 . TRP B 1 186 ? 49.463 18.612 -12.353 1.00 24.69 ? 183  TRP B CE3 1 
ATOM   3015 C  CZ2 . TRP B 1 186 ? 46.832 19.337 -13.145 1.00 24.29 ? 183  TRP B CZ2 1 
ATOM   3016 C  CZ3 . TRP B 1 186 ? 48.519 17.657 -12.675 1.00 25.03 ? 183  TRP B CZ3 1 
ATOM   3017 C  CH2 . TRP B 1 186 ? 47.208 18.025 -13.049 1.00 25.30 ? 183  TRP B CH2 1 
ATOM   3018 N  N   . GLN B 1 187 ? 53.372 21.921 -9.326  1.00 19.62 ? 184  GLN B N   1 
ATOM   3019 C  CA  . GLN B 1 187 ? 54.752 21.699 -8.875  1.00 20.56 ? 184  GLN B CA  1 
ATOM   3020 C  C   . GLN B 1 187 ? 54.742 20.710 -7.706  1.00 19.24 ? 184  GLN B C   1 
ATOM   3021 O  O   . GLN B 1 187 ? 55.503 19.730 -7.681  1.00 19.17 ? 184  GLN B O   1 
ATOM   3022 C  CB  . GLN B 1 187 ? 55.436 22.983 -8.464  1.00 20.11 ? 184  GLN B CB  1 
ATOM   3023 C  CG  . GLN B 1 187 ? 56.956 22.835 -8.228  1.00 23.48 ? 184  GLN B CG  1 
ATOM   3024 C  CD  . GLN B 1 187 ? 57.544 24.048 -7.508  1.00 29.92 ? 184  GLN B CD  1 
ATOM   3025 O  OE1 . GLN B 1 187 ? 58.265 23.910 -6.514  1.00 34.62 ? 184  GLN B OE1 1 
ATOM   3026 N  NE2 . GLN B 1 187 ? 57.231 25.248 -8.002  1.00 33.12 ? 184  GLN B NE2 1 
ATOM   3027 N  N   . PHE B 1 188 ? 53.860 20.970 -6.750  1.00 19.89 ? 185  PHE B N   1 
ATOM   3028 C  CA  . PHE B 1 188 ? 53.722 20.080 -5.597  1.00 20.15 ? 185  PHE B CA  1 
ATOM   3029 C  C   . PHE B 1 188 ? 53.300 18.665 -6.006  1.00 20.25 ? 185  PHE B C   1 
ATOM   3030 O  O   . PHE B 1 188 ? 53.892 17.638 -5.568  1.00 21.55 ? 185  PHE B O   1 
ATOM   3031 C  CB  . PHE B 1 188 ? 52.711 20.643 -4.626  1.00 19.92 ? 185  PHE B CB  1 
ATOM   3032 C  CG  . PHE B 1 188 ? 52.461 19.752 -3.439  1.00 21.53 ? 185  PHE B CG  1 
ATOM   3033 C  CD1 . PHE B 1 188 ? 53.397 19.696 -2.411  1.00 19.50 ? 185  PHE B CD1 1 
ATOM   3034 C  CD2 . PHE B 1 188 ? 51.274 18.978 -3.350  1.00 20.28 ? 185  PHE B CD2 1 
ATOM   3035 C  CE1 . PHE B 1 188 ? 53.196 18.895 -1.325  1.00 20.25 ? 185  PHE B CE1 1 
ATOM   3036 C  CE2 . PHE B 1 188 ? 51.053 18.184 -2.256  1.00 20.03 ? 185  PHE B CE2 1 
ATOM   3037 C  CZ  . PHE B 1 188 ? 52.008 18.137 -1.218  1.00 23.77 ? 185  PHE B CZ  1 
ATOM   3038 N  N   . VAL B 1 189 ? 52.309 18.570 -6.885  1.00 21.88 ? 186  VAL B N   1 
ATOM   3039 C  CA  . VAL B 1 189 ? 51.902 17.254 -7.413  1.00 20.12 ? 186  VAL B CA  1 
ATOM   3040 C  C   . VAL B 1 189 ? 53.083 16.511 -8.057  1.00 20.70 ? 186  VAL B C   1 
ATOM   3041 O  O   . VAL B 1 189 ? 53.295 15.289 -7.812  1.00 20.31 ? 186  VAL B O   1 
ATOM   3042 C  CB  . VAL B 1 189 ? 50.700 17.339 -8.403  1.00 21.23 ? 186  VAL B CB  1 
ATOM   3043 C  CG1 . VAL B 1 189 ? 50.286 15.892 -8.869  1.00 18.67 ? 186  VAL B CG1 1 
ATOM   3044 C  CG2 . VAL B 1 189 ? 49.483 18.094 -7.752  1.00 18.42 ? 186  VAL B CG2 1 
ATOM   3045 N  N   . SER B 1 190 ? 53.890 17.236 -8.830  1.00 20.09 ? 187  SER B N   1 
ATOM   3046 C  CA  . SER B 1 190 ? 55.036 16.633 -9.484  1.00 20.91 ? 187  SER B CA  1 
ATOM   3047 C  C   . SER B 1 190 ? 56.100 16.142 -8.505  1.00 21.30 ? 187  SER B C   1 
ATOM   3048 O  O   . SER B 1 190 ? 56.713 15.066 -8.702  1.00 20.26 ? 187  SER B O   1 
ATOM   3049 C  CB  . SER B 1 190 ? 55.658 17.599 -10.480 1.00 20.57 ? 187  SER B CB  1 
ATOM   3050 O  OG  . SER B 1 190 ? 54.753 17.934 -11.513 1.00 19.54 ? 187  SER B OG  1 
ATOM   3051 N  N   . GLU B 1 191 ? 56.308 16.926 -7.443  1.00 22.44 ? 188  GLU B N   1 
ATOM   3052 C  CA  . GLU B 1 191 ? 57.294 16.632 -6.443  1.00 22.75 ? 188  GLU B CA  1 
ATOM   3053 C  C   . GLU B 1 191 ? 56.874 15.374 -5.688  1.00 23.21 ? 188  GLU B C   1 
ATOM   3054 O  O   . GLU B 1 191 ? 57.708 14.503 -5.392  1.00 21.42 ? 188  GLU B O   1 
ATOM   3055 C  CB  . GLU B 1 191 ? 57.454 17.821 -5.488  1.00 23.42 ? 188  GLU B CB  1 
ATOM   3056 C  CG  . GLU B 1 191 ? 58.214 18.989 -6.079  1.00 25.13 ? 188  GLU B CG  1 
ATOM   3057 C  CD  . GLU B 1 191 ? 58.131 20.284 -5.252  1.00 26.52 ? 188  GLU B CD  1 
ATOM   3058 O  OE1 . GLU B 1 191 ? 57.351 20.380 -4.264  1.00 26.64 ? 188  GLU B OE1 1 
ATOM   3059 O  OE2 . GLU B 1 191 ? 58.837 21.230 -5.626  1.00 24.72 ? 188  GLU B OE2 1 
ATOM   3060 N  N   . GLN B 1 192 ? 55.580 15.256 -5.415  1.00 22.78 ? 189  GLN B N   1 
ATOM   3061 C  CA  . GLN B 1 192 ? 55.071 14.051 -4.779  1.00 23.19 ? 189  GLN B CA  1 
ATOM   3062 C  C   . GLN B 1 192 ? 55.166 12.830 -5.687  1.00 22.56 ? 189  GLN B C   1 
ATOM   3063 O  O   . GLN B 1 192 ? 55.425 11.721 -5.204  1.00 22.44 ? 189  GLN B O   1 
ATOM   3064 C  CB  . GLN B 1 192 ? 53.644 14.259 -4.243  1.00 23.31 ? 189  GLN B CB  1 
ATOM   3065 C  CG  . GLN B 1 192 ? 53.504 15.406 -3.260  1.00 24.58 ? 189  GLN B CG  1 
ATOM   3066 C  CD  . GLN B 1 192 ? 54.496 15.368 -2.126  1.00 26.09 ? 189  GLN B CD  1 
ATOM   3067 O  OE1 . GLN B 1 192 ? 55.263 16.335 -1.929  1.00 33.41 ? 189  GLN B OE1 1 
ATOM   3068 N  NE2 . GLN B 1 192 ? 54.522 14.297 -1.393  1.00 21.50 ? 189  GLN B NE2 1 
ATOM   3069 N  N   . PHE B 1 193 ? 55.003 13.020 -7.002  1.00 21.82 ? 190  PHE B N   1 
ATOM   3070 C  CA  . PHE B 1 193 ? 55.081 11.911 -7.965  1.00 21.97 ? 190  PHE B CA  1 
ATOM   3071 C  C   . PHE B 1 193 ? 56.501 11.353 -8.023  1.00 24.53 ? 190  PHE B C   1 
ATOM   3072 O  O   . PHE B 1 193 ? 56.665 10.126 -8.149  1.00 22.73 ? 190  PHE B O   1 
ATOM   3073 C  CB  . PHE B 1 193 ? 54.642 12.345 -9.388  1.00 21.25 ? 190  PHE B CB  1 
ATOM   3074 C  CG  . PHE B 1 193 ? 54.755 11.261 -10.405 1.00 20.57 ? 190  PHE B CG  1 
ATOM   3075 C  CD1 . PHE B 1 193 ? 53.870 10.191 -10.400 1.00 22.60 ? 190  PHE B CD1 1 
ATOM   3076 C  CD2 . PHE B 1 193 ? 55.769 11.264 -11.327 1.00 21.41 ? 190  PHE B CD2 1 
ATOM   3077 C  CE1 . PHE B 1 193 ? 53.962 9.178  -11.319 1.00 22.35 ? 190  PHE B CE1 1 
ATOM   3078 C  CE2 . PHE B 1 193 ? 55.882 10.255 -12.225 1.00 21.60 ? 190  PHE B CE2 1 
ATOM   3079 C  CZ  . PHE B 1 193 ? 54.960 9.209  -12.250 1.00 23.93 ? 190  PHE B CZ  1 
ATOM   3080 N  N   . ALA B 1 194 ? 57.498 12.252 -7.965  1.00 27.39 ? 191  ALA B N   1 
ATOM   3081 C  CA  . ALA B 1 194 ? 58.938 11.899 -8.008  1.00 31.68 ? 191  ALA B CA  1 
ATOM   3082 C  C   . ALA B 1 194 ? 59.294 10.772 -6.992  1.00 36.47 ? 191  ALA B C   1 
ATOM   3083 O  O   . ALA B 1 194 ? 58.948 10.868 -5.814  1.00 35.24 ? 191  ALA B O   1 
ATOM   3084 C  CB  . ALA B 1 194 ? 59.775 13.151 -7.748  1.00 30.89 ? 191  ALA B CB  1 
ATOM   3085 N  N   . ASP B 1 195 ? 59.985 9.732  -7.489  1.00 43.24 ? 192  ASP B N   1 
ATOM   3086 C  CA  . ASP B 1 195 ? 60.211 8.358  -6.855  1.00 48.22 ? 192  ASP B CA  1 
ATOM   3087 C  C   . ASP B 1 195 ? 59.287 7.195  -7.308  1.00 50.23 ? 192  ASP B C   1 
ATOM   3088 O  O   . ASP B 1 195 ? 59.701 6.318  -8.110  1.00 54.44 ? 192  ASP B O   1 
ATOM   3089 C  CB  . ASP B 1 195 ? 60.189 8.400  -5.332  1.00 50.12 ? 192  ASP B CB  1 
ATOM   3090 C  CG  . ASP B 1 195 ? 61.192 9.338  -4.788  1.00 53.21 ? 192  ASP B CG  1 
ATOM   3091 O  OD1 . ASP B 1 195 ? 62.101 9.700  -5.567  1.00 61.93 ? 192  ASP B OD1 1 
ATOM   3092 O  OD2 . ASP B 1 195 ? 61.031 9.766  -3.625  1.00 58.33 ? 192  ASP B OD2 1 
HETATM 3093 FE FE  . FE  C 2 .   ? 19.922 17.993 4.143   1.00 39.11 ? 1001 FE  A FE  1 
HETATM 3094 C  C1  . GOL D 3 .   ? 39.121 3.418  8.466   1.00 48.16 ? 301  GOL B C1  1 
HETATM 3095 O  O1  . GOL D 3 .   ? 38.973 2.869  7.154   1.00 45.90 ? 301  GOL B O1  1 
HETATM 3096 C  C2  . GOL D 3 .   ? 40.412 2.949  9.141   1.00 48.51 ? 301  GOL B C2  1 
HETATM 3097 O  O2  . GOL D 3 .   ? 40.316 1.542  9.448   1.00 43.64 ? 301  GOL B O2  1 
HETATM 3098 C  C3  . GOL D 3 .   ? 40.700 3.798  10.395  1.00 46.33 ? 301  GOL B C3  1 
HETATM 3099 O  O3  . GOL D 3 .   ? 40.032 3.253  11.552  1.00 44.87 ? 301  GOL B O3  1 
HETATM 3100 C  C1  . GOL E 3 .   ? 55.025 6.226  9.133   1.00 45.78 ? 302  GOL B C1  1 
HETATM 3101 O  O1  . GOL E 3 .   ? 54.481 6.276  7.804   1.00 46.18 ? 302  GOL B O1  1 
HETATM 3102 C  C2  . GOL E 3 .   ? 55.452 4.763  9.474   1.00 47.35 ? 302  GOL B C2  1 
HETATM 3103 O  O2  . GOL E 3 .   ? 54.522 3.843  8.969   1.00 49.80 ? 302  GOL B O2  1 
HETATM 3104 C  C3  . GOL E 3 .   ? 55.758 4.294  10.905  1.00 46.29 ? 302  GOL B C3  1 
HETATM 3105 O  O3  . GOL E 3 .   ? 56.500 5.209  11.710  1.00 44.16 ? 302  GOL B O3  1 
HETATM 3106 FE FE  . FE  F 2 .   ? 37.854 20.469 4.758   1.00 30.80 ? 1001 FE  B FE  1 
HETATM 3107 C  C1  . GOL G 3 .   ? 47.048 20.804 -17.081 1.00 53.10 ? 193  GOL B C1  1 
HETATM 3108 O  O1  . GOL G 3 .   ? 46.021 21.782 -17.186 1.00 55.62 ? 193  GOL B O1  1 
HETATM 3109 C  C2  . GOL G 3 .   ? 48.331 21.372 -16.476 1.00 50.44 ? 193  GOL B C2  1 
HETATM 3110 O  O2  . GOL G 3 .   ? 48.625 22.567 -17.167 1.00 52.39 ? 193  GOL B O2  1 
HETATM 3111 C  C3  . GOL G 3 .   ? 49.470 20.366 -16.632 1.00 47.06 ? 193  GOL B C3  1 
HETATM 3112 O  O3  . GOL G 3 .   ? 50.751 20.956 -16.739 1.00 40.78 ? 193  GOL B O3  1 
HETATM 3113 O  O   . HOH H 4 .   ? 29.131 10.616 8.067   1.00 20.21 ? 193  HOH A O   1 
HETATM 3114 O  O   . HOH H 4 .   ? 7.041  24.314 19.316  1.00 23.65 ? 194  HOH A O   1 
HETATM 3115 O  O   . HOH H 4 .   ? 7.190  19.592 25.307  1.00 30.06 ? 195  HOH A O   1 
HETATM 3116 O  O   . HOH H 4 .   ? 12.875 30.782 15.218  1.00 22.07 ? 196  HOH A O   1 
HETATM 3117 O  O   . HOH H 4 .   ? 10.354 0.530  9.736   1.00 37.50 ? 197  HOH A O   1 
HETATM 3118 O  O   . HOH H 4 .   ? 20.033 2.940  6.768   1.00 27.22 ? 198  HOH A O   1 
HETATM 3119 O  O   . HOH H 4 .   ? 27.667 17.771 4.927   1.00 17.88 ? 199  HOH A O   1 
HETATM 3120 O  O   . HOH H 4 .   ? 24.480 5.146  8.681   1.00 27.93 ? 200  HOH A O   1 
HETATM 3121 O  O   . HOH H 4 .   ? 21.133 1.881  -7.167  1.00 30.47 ? 201  HOH A O   1 
HETATM 3122 O  O   . HOH H 4 .   ? 10.670 -0.293 17.105  1.00 20.64 ? 202  HOH A O   1 
HETATM 3123 O  O   . HOH H 4 .   ? 31.491 16.203 13.834  1.00 23.62 ? 203  HOH A O   1 
HETATM 3124 O  O   . HOH H 4 .   ? 1.982  16.695 28.673  1.00 18.53 ? 204  HOH A O   1 
HETATM 3125 O  O   . HOH H 4 .   ? 23.854 4.589  4.368   1.00 36.46 ? 205  HOH A O   1 
HETATM 3126 O  O   . HOH H 4 .   ? 24.610 11.317 23.508  1.00 29.49 ? 206  HOH A O   1 
HETATM 3127 O  O   . HOH H 4 .   ? 31.982 16.489 11.181  1.00 21.20 ? 207  HOH A O   1 
HETATM 3128 O  O   . HOH H 4 .   ? 22.605 26.544 5.846   1.00 21.71 ? 208  HOH A O   1 
HETATM 3129 O  O   . HOH H 4 .   ? 30.492 22.088 10.133  1.00 20.84 ? 209  HOH A O   1 
HETATM 3130 O  O   . HOH H 4 .   ? 20.881 17.230 -3.149  1.00 18.64 ? 210  HOH A O   1 
HETATM 3131 O  O   . HOH H 4 .   ? 19.940 33.619 -2.266  1.00 35.88 ? 211  HOH A O   1 
HETATM 3132 O  O   . HOH H 4 .   ? 13.822 -6.401 21.653  1.00 36.55 ? 212  HOH A O   1 
HETATM 3133 O  O   . HOH H 4 .   ? 29.759 12.266 5.179   1.00 19.15 ? 213  HOH A O   1 
HETATM 3134 O  O   . HOH H 4 .   ? 16.964 35.298 1.402   1.00 32.08 ? 214  HOH A O   1 
HETATM 3135 O  O   . HOH H 4 .   ? 19.891 6.551  28.416  1.00 39.47 ? 215  HOH A O   1 
HETATM 3136 O  O   . HOH H 4 .   ? 28.343 17.532 8.485   1.00 27.72 ? 216  HOH A O   1 
HETATM 3137 O  O   . HOH H 4 .   ? 12.631 30.318 7.420   1.00 21.81 ? 217  HOH A O   1 
HETATM 3138 O  O   . HOH H 4 .   ? 32.345 21.854 12.175  1.00 29.30 ? 218  HOH A O   1 
HETATM 3139 O  O   . HOH H 4 .   ? 12.039 21.844 22.409  1.00 22.57 ? 219  HOH A O   1 
HETATM 3140 O  O   . HOH H 4 .   ? 9.218  11.454 5.556   1.00 31.94 ? 220  HOH A O   1 
HETATM 3141 O  O   . HOH H 4 .   ? 26.676 10.948 22.316  1.00 30.47 ? 221  HOH A O   1 
HETATM 3142 O  O   . HOH H 4 .   ? 22.002 28.817 19.181  1.00 25.75 ? 222  HOH A O   1 
HETATM 3143 O  O   . HOH H 4 .   ? 30.878 18.624 9.792   1.00 21.49 ? 223  HOH A O   1 
HETATM 3144 O  O   . HOH H 4 .   ? 22.741 6.501  21.410  1.00 38.41 ? 224  HOH A O   1 
HETATM 3145 O  O   . HOH H 4 .   ? 29.523 26.583 18.285  1.00 23.86 ? 225  HOH A O   1 
HETATM 3146 O  O   . HOH H 4 .   ? 19.301 5.898  23.048  1.00 23.85 ? 226  HOH A O   1 
HETATM 3147 O  O   . HOH H 4 .   ? 7.745  32.586 12.594  1.00 34.88 ? 227  HOH A O   1 
HETATM 3148 O  O   . HOH H 4 .   ? 3.997  29.539 7.981   1.00 24.08 ? 228  HOH A O   1 
HETATM 3149 O  O   . HOH H 4 .   ? 23.866 5.388  16.834  1.00 32.05 ? 229  HOH A O   1 
HETATM 3150 O  O   . HOH H 4 .   ? 22.930 28.157 26.444  1.00 36.47 ? 230  HOH A O   1 
HETATM 3151 O  O   . HOH H 4 .   ? 19.778 2.926  9.982   1.00 30.24 ? 231  HOH A O   1 
HETATM 3152 O  O   . HOH H 4 .   ? 20.528 26.741 9.557   1.00 23.13 ? 232  HOH A O   1 
HETATM 3153 O  O   . HOH H 4 .   ? 24.834 8.226  -4.735  1.00 34.26 ? 233  HOH A O   1 
HETATM 3154 O  O   . HOH H 4 .   ? 21.368 3.446  20.183  1.00 37.26 ? 234  HOH A O   1 
HETATM 3155 O  O   . HOH H 4 .   ? 30.484 18.124 4.363   1.00 16.50 ? 235  HOH A O   1 
HETATM 3156 O  O   . HOH H 4 .   ? 21.016 16.070 4.352   1.00 23.98 ? 236  HOH A O   1 
HETATM 3157 O  O   . HOH H 4 .   ? 27.059 6.411  2.540   1.00 31.42 ? 237  HOH A O   1 
HETATM 3158 O  O   . HOH H 4 .   ? 23.128 3.178  17.840  1.00 34.14 ? 238  HOH A O   1 
HETATM 3159 O  O   . HOH H 4 .   ? 18.390 23.267 7.388   1.00 18.90 ? 239  HOH A O   1 
HETATM 3160 O  O   . HOH H 4 .   ? 5.673  21.529 10.762  1.00 19.13 ? 240  HOH A O   1 
HETATM 3161 O  O   . HOH H 4 .   ? 17.475 6.634  33.090  1.00 45.53 ? 241  HOH A O   1 
HETATM 3162 O  O   . HOH H 4 .   ? 9.496  23.337 20.235  1.00 36.85 ? 242  HOH A O   1 
HETATM 3163 O  O   . HOH H 4 .   ? 26.510 8.195  12.546  1.00 40.59 ? 243  HOH A O   1 
HETATM 3164 O  O   . HOH H 4 .   ? 11.102 21.196 25.103  1.00 45.22 ? 244  HOH A O   1 
HETATM 3165 O  O   . HOH H 4 .   ? 13.640 9.511  36.254  1.00 28.48 ? 245  HOH A O   1 
HETATM 3166 O  O   . HOH H 4 .   ? 19.956 1.367  14.448  1.00 24.86 ? 246  HOH A O   1 
HETATM 3167 O  O   . HOH H 4 .   ? 24.293 2.486  -7.155  1.00 38.57 ? 247  HOH A O   1 
HETATM 3168 O  O   . HOH H 4 .   ? 18.159 15.855 34.922  1.00 27.15 ? 248  HOH A O   1 
HETATM 3169 O  O   . HOH H 4 .   ? 19.511 21.528 29.557  1.00 35.68 ? 249  HOH A O   1 
HETATM 3170 O  O   . HOH H 4 .   ? 21.249 24.729 2.496   1.00 24.92 ? 250  HOH A O   1 
HETATM 3171 O  O   . HOH H 4 .   ? 26.054 33.366 4.551   1.00 31.13 ? 251  HOH A O   1 
HETATM 3172 O  O   . HOH H 4 .   ? 25.240 4.932  6.216   1.00 43.54 ? 252  HOH A O   1 
HETATM 3173 O  O   . HOH H 4 .   ? 7.333  12.755 7.118   1.00 38.13 ? 253  HOH A O   1 
HETATM 3174 O  O   . HOH H 4 .   ? 17.654 -0.613 1.754   1.00 27.37 ? 254  HOH A O   1 
HETATM 3175 O  O   . HOH H 4 .   ? 28.697 15.762 21.212  1.00 23.08 ? 255  HOH A O   1 
HETATM 3176 O  O   . HOH H 4 .   ? 24.374 6.660  2.600   1.00 25.29 ? 256  HOH A O   1 
HETATM 3177 O  O   . HOH H 4 .   ? 8.284  27.293 16.826  1.00 31.21 ? 257  HOH A O   1 
HETATM 3178 O  O   . HOH H 4 .   ? 15.823 27.201 23.273  1.00 62.91 ? 258  HOH A O   1 
HETATM 3179 O  O   . HOH H 4 .   ? 27.111 5.920  -0.288  1.00 36.14 ? 259  HOH A O   1 
HETATM 3180 O  O   . HOH H 4 .   ? 24.459 34.747 2.636   1.00 32.95 ? 260  HOH A O   1 
HETATM 3181 O  O   . HOH H 4 .   ? 11.408 30.770 16.995  1.00 41.37 ? 261  HOH A O   1 
HETATM 3182 O  O   . HOH H 4 .   ? 18.628 34.289 -0.017  1.00 38.55 ? 262  HOH A O   1 
HETATM 3183 O  O   . HOH H 4 .   ? 7.475  7.573  11.560  1.00 30.70 ? 263  HOH A O   1 
HETATM 3184 O  O   . HOH H 4 .   ? 8.456  12.687 -0.823  1.00 31.88 ? 264  HOH A O   1 
HETATM 3185 O  O   . HOH H 4 .   ? 1.980  13.085 12.138  1.00 30.88 ? 265  HOH A O   1 
HETATM 3186 O  O   . HOH H 4 .   ? 20.780 34.472 4.372   1.00 26.84 ? 266  HOH A O   1 
HETATM 3187 O  O   . HOH H 4 .   ? 26.521 9.425  19.936  1.00 35.60 ? 267  HOH A O   1 
HETATM 3188 O  O   . HOH H 4 .   ? 23.930 14.757 -1.593  1.00 21.11 ? 268  HOH A O   1 
HETATM 3189 O  O   . HOH H 4 .   ? 11.293 16.051 32.124  1.00 22.03 ? 269  HOH A O   1 
HETATM 3190 O  O   . HOH H 4 .   ? 26.401 33.083 8.722   1.00 33.29 ? 270  HOH A O   1 
HETATM 3191 O  O   . HOH H 4 .   ? 29.749 30.692 13.085  1.00 25.60 ? 271  HOH A O   1 
HETATM 3192 O  O   . HOH H 4 .   ? 29.930 9.858  13.910  1.00 24.82 ? 272  HOH A O   1 
HETATM 3193 O  O   . HOH H 4 .   ? 21.655 33.444 6.915   1.00 27.40 ? 273  HOH A O   1 
HETATM 3194 O  O   . HOH H 4 .   ? 1.520  20.462 20.880  1.00 28.13 ? 366  HOH A O   1 
HETATM 3195 O  O   . HOH I 4 .   ? 44.831 3.257  17.938  1.00 29.50 ? 194  HOH B O   1 
HETATM 3196 O  O   . HOH I 4 .   ? 36.986 6.042  2.923   1.00 17.45 ? 195  HOH B O   1 
HETATM 3197 O  O   . HOH I 4 .   ? 56.725 21.379 -11.871 1.00 31.70 ? 196  HOH B O   1 
HETATM 3198 O  O   . HOH I 4 .   ? 46.805 25.248 -11.894 1.00 25.06 ? 197  HOH B O   1 
HETATM 3199 O  O   . HOH I 4 .   ? 33.782 13.135 -20.577 1.00 76.64 ? 198  HOH B O   1 
HETATM 3200 O  O   . HOH I 4 .   ? 44.348 21.022 22.406  1.00 34.68 ? 199  HOH B O   1 
HETATM 3201 O  O   . HOH I 4 .   ? 35.037 14.878 16.114  1.00 36.39 ? 200  HOH B O   1 
HETATM 3202 O  O   . HOH I 4 .   ? 46.420 19.570 -21.296 1.00 39.11 ? 201  HOH B O   1 
HETATM 3203 O  O   . HOH I 4 .   ? 52.485 33.189 -2.683  1.00 32.26 ? 202  HOH B O   1 
HETATM 3204 O  O   . HOH I 4 .   ? 34.879 22.909 12.975  1.00 20.55 ? 203  HOH B O   1 
HETATM 3205 O  O   . HOH I 4 .   ? 30.123 14.502 -13.379 1.00 24.79 ? 204  HOH B O   1 
HETATM 3206 O  O   . HOH I 4 .   ? 41.852 33.136 -1.106  1.00 19.70 ? 205  HOH B O   1 
HETATM 3207 O  O   . HOH I 4 .   ? 50.659 18.963 11.858  1.00 33.25 ? 206  HOH B O   1 
HETATM 3208 O  O   . HOH I 4 .   ? 49.911 36.008 4.771   1.00 56.64 ? 207  HOH B O   1 
HETATM 3209 O  O   . HOH I 4 .   ? 25.094 19.307 -3.509  1.00 27.50 ? 208  HOH B O   1 
HETATM 3210 O  O   . HOH I 4 .   ? 31.057 10.146 2.770   1.00 18.89 ? 209  HOH B O   1 
HETATM 3211 O  O   . HOH I 4 .   ? 29.822 29.901 -14.056 1.00 45.90 ? 210  HOH B O   1 
HETATM 3212 O  O   . HOH I 4 .   ? 58.573 16.510 20.930  1.00 27.66 ? 211  HOH B O   1 
HETATM 3213 O  O   . HOH I 4 .   ? 52.620 4.139  2.738   1.00 30.75 ? 212  HOH B O   1 
HETATM 3214 O  O   . HOH I 4 .   ? 54.690 6.031  20.789  1.00 19.67 ? 213  HOH B O   1 
HETATM 3215 O  O   . HOH I 4 .   ? 39.792 4.662  -9.920  1.00 18.96 ? 214  HOH B O   1 
HETATM 3216 O  O   . HOH I 4 .   ? 54.834 29.039 0.288   1.00 35.23 ? 215  HOH B O   1 
HETATM 3217 O  O   . HOH I 4 .   ? 42.824 -1.026 0.256   1.00 29.72 ? 216  HOH B O   1 
HETATM 3218 O  O   . HOH I 4 .   ? 49.265 27.448 -13.662 1.00 29.87 ? 217  HOH B O   1 
HETATM 3219 O  O   . HOH I 4 .   ? 25.640 28.131 -6.509  1.00 25.64 ? 218  HOH B O   1 
HETATM 3220 O  O   . HOH I 4 .   ? 43.324 5.184  17.925  1.00 23.84 ? 219  HOH B O   1 
HETATM 3221 O  O   . HOH I 4 .   ? 45.397 32.186 -9.925  1.00 46.60 ? 220  HOH B O   1 
HETATM 3222 O  O   . HOH I 4 .   ? 35.848 9.251  -12.789 1.00 17.37 ? 221  HOH B O   1 
HETATM 3223 O  O   . HOH I 4 .   ? 42.857 2.585  8.814   1.00 21.67 ? 222  HOH B O   1 
HETATM 3224 O  O   . HOH I 4 .   ? 47.306 38.188 -1.778  1.00 36.15 ? 223  HOH B O   1 
HETATM 3225 O  O   . HOH I 4 .   ? 41.608 5.907  5.563   1.00 18.36 ? 224  HOH B O   1 
HETATM 3226 O  O   . HOH I 4 .   ? 53.550 4.655  -3.710  1.00 34.30 ? 225  HOH B O   1 
HETATM 3227 O  O   . HOH I 4 .   ? 32.996 9.105  -6.906  1.00 19.30 ? 226  HOH B O   1 
HETATM 3228 O  O   . HOH I 4 .   ? 54.439 14.585 12.318  1.00 15.92 ? 227  HOH B O   1 
HETATM 3229 O  O   . HOH I 4 .   ? 28.021 33.477 1.285   1.00 24.64 ? 228  HOH B O   1 
HETATM 3230 O  O   . HOH I 4 .   ? 30.573 8.156  -2.678  1.00 18.72 ? 229  HOH B O   1 
HETATM 3231 O  O   . HOH I 4 .   ? 32.802 35.922 1.248   1.00 21.19 ? 230  HOH B O   1 
HETATM 3232 O  O   . HOH I 4 .   ? 59.179 27.561 -8.323  1.00 42.75 ? 231  HOH B O   1 
HETATM 3233 O  O   . HOH I 4 .   ? 54.200 25.849 9.496   1.00 38.64 ? 232  HOH B O   1 
HETATM 3234 O  O   . HOH I 4 .   ? 55.743 8.092  22.132  1.00 35.16 ? 233  HOH B O   1 
HETATM 3235 O  O   . HOH I 4 .   ? 51.188 3.258  15.829  1.00 16.89 ? 234  HOH B O   1 
HETATM 3236 O  O   . HOH I 4 .   ? 52.900 4.857  -17.712 1.00 48.62 ? 235  HOH B O   1 
HETATM 3237 O  O   . HOH I 4 .   ? 50.543 -2.596 -11.989 1.00 34.59 ? 236  HOH B O   1 
HETATM 3238 O  O   . HOH I 4 .   ? 44.044 -0.830 4.432   1.00 37.71 ? 237  HOH B O   1 
HETATM 3239 O  O   . HOH I 4 .   ? 52.615 12.401 -0.812  1.00 18.12 ? 238  HOH B O   1 
HETATM 3240 O  O   . HOH I 4 .   ? 46.342 22.178 20.780  1.00 32.14 ? 239  HOH B O   1 
HETATM 3241 O  O   . HOH I 4 .   ? 34.896 26.751 5.173   1.00 20.72 ? 240  HOH B O   1 
HETATM 3242 O  O   . HOH I 4 .   ? 45.259 22.802 -13.757 1.00 23.62 ? 241  HOH B O   1 
HETATM 3243 O  O   . HOH I 4 .   ? 41.858 5.219  -11.678 1.00 26.75 ? 242  HOH B O   1 
HETATM 3244 O  O   . HOH I 4 .   ? 52.967 1.656  5.960   1.00 21.29 ? 243  HOH B O   1 
HETATM 3245 O  O   . HOH I 4 .   ? 30.847 34.794 8.091   1.00 29.74 ? 244  HOH B O   1 
HETATM 3246 O  O   . HOH I 4 .   ? 56.007 3.964  -5.720  1.00 43.16 ? 245  HOH B O   1 
HETATM 3247 O  O   . HOH I 4 .   ? 46.875 24.786 18.259  1.00 39.16 ? 246  HOH B O   1 
HETATM 3248 O  O   . HOH I 4 .   ? 44.286 3.963  10.611  1.00 11.31 ? 247  HOH B O   1 
HETATM 3249 O  O   . HOH I 4 .   ? 56.919 18.813 -2.366  1.00 25.04 ? 248  HOH B O   1 
HETATM 3250 O  O   . HOH I 4 .   ? 42.054 9.603  23.690  1.00 25.65 ? 249  HOH B O   1 
HETATM 3251 O  O   . HOH I 4 .   ? 36.490 9.162  8.905   1.00 18.19 ? 250  HOH B O   1 
HETATM 3252 O  O   . HOH I 4 .   ? 35.374 27.456 -2.236  1.00 17.29 ? 251  HOH B O   1 
HETATM 3253 O  O   . HOH I 4 .   ? 36.720 20.906 12.185  1.00 19.19 ? 252  HOH B O   1 
HETATM 3254 O  O   . HOH I 4 .   ? 51.356 17.975 2.696   1.00 24.40 ? 253  HOH B O   1 
HETATM 3255 O  O   . HOH I 4 .   ? 47.370 27.488 -11.894 1.00 34.58 ? 254  HOH B O   1 
HETATM 3256 O  O   . HOH I 4 .   ? 54.268 12.317 9.248   1.00 24.63 ? 255  HOH B O   1 
HETATM 3257 O  O   . HOH I 4 .   ? 52.389 31.954 4.069   1.00 48.82 ? 256  HOH B O   1 
HETATM 3258 O  O   . HOH I 4 .   ? 46.664 35.643 -5.941  1.00 31.03 ? 257  HOH B O   1 
HETATM 3259 O  O   . HOH I 4 .   ? 56.939 9.161  -16.000 1.00 25.41 ? 258  HOH B O   1 
HETATM 3260 O  O   . HOH I 4 .   ? 33.588 8.736  -11.639 1.00 26.17 ? 259  HOH B O   1 
HETATM 3261 O  O   . HOH I 4 .   ? 37.422 7.378  19.741  1.00 28.97 ? 260  HOH B O   1 
HETATM 3262 O  O   . HOH I 4 .   ? 56.422 11.277 8.519   1.00 32.44 ? 261  HOH B O   1 
HETATM 3263 O  O   . HOH I 4 .   ? 33.435 7.914  -8.790  1.00 28.46 ? 262  HOH B O   1 
HETATM 3264 O  O   . HOH I 4 .   ? 35.872 38.309 3.173   1.00 32.72 ? 263  HOH B O   1 
HETATM 3265 O  O   . HOH I 4 .   ? 39.622 5.785  3.143   1.00 20.43 ? 264  HOH B O   1 
HETATM 3266 O  O   . HOH I 4 .   ? 42.400 2.712  -2.728  1.00 15.70 ? 265  HOH B O   1 
HETATM 3267 O  O   . HOH I 4 .   ? 54.414 26.967 -6.570  1.00 46.94 ? 266  HOH B O   1 
HETATM 3268 O  O   . HOH I 4 .   ? 56.547 31.931 -7.577  1.00 37.16 ? 267  HOH B O   1 
HETATM 3269 O  O   . HOH I 4 .   ? 59.705 12.586 -11.583 1.00 35.72 ? 268  HOH B O   1 
HETATM 3270 O  O   . HOH I 4 .   ? 41.931 5.459  2.304   1.00 19.14 ? 269  HOH B O   1 
HETATM 3271 O  O   . HOH I 4 .   ? 49.552 -1.784 -9.643  1.00 23.90 ? 270  HOH B O   1 
HETATM 3272 O  O   . HOH I 4 .   ? 50.399 34.962 -1.155  1.00 25.35 ? 271  HOH B O   1 
HETATM 3273 O  O   . HOH I 4 .   ? 40.477 7.417  19.214  1.00 25.26 ? 272  HOH B O   1 
HETATM 3274 O  O   . HOH I 4 .   ? 49.908 16.569 4.745   1.00 19.03 ? 273  HOH B O   1 
HETATM 3275 O  O   . HOH I 4 .   ? 35.253 11.839 15.726  1.00 28.11 ? 274  HOH B O   1 
HETATM 3276 O  O   . HOH I 4 .   ? 50.115 0.725  -3.251  1.00 28.05 ? 275  HOH B O   1 
HETATM 3277 O  O   . HOH I 4 .   ? 22.471 19.358 -4.503  1.00 23.18 ? 276  HOH B O   1 
HETATM 3278 O  O   . HOH I 4 .   ? 45.661 16.901 -22.402 1.00 18.35 ? 277  HOH B O   1 
HETATM 3279 O  O   . HOH I 4 .   ? 46.333 -0.734 -5.928  1.00 22.90 ? 278  HOH B O   1 
HETATM 3280 O  O   . HOH I 4 .   ? 35.461 36.649 1.435   1.00 23.86 ? 279  HOH B O   1 
HETATM 3281 O  O   . HOH I 4 .   ? 34.984 30.696 -9.181  1.00 26.12 ? 280  HOH B O   1 
HETATM 3282 O  O   . HOH I 4 .   ? 39.425 32.203 11.149  1.00 26.46 ? 281  HOH B O   1 
HETATM 3283 O  O   . HOH I 4 .   ? 41.406 23.679 -16.537 1.00 27.32 ? 282  HOH B O   1 
HETATM 3284 O  O   . HOH I 4 .   ? 50.175 4.526  -13.910 1.00 21.95 ? 283  HOH B O   1 
HETATM 3285 O  O   . HOH I 4 .   ? 37.275 18.406 5.068   1.00 15.94 ? 284  HOH B O   1 
HETATM 3286 O  O   . HOH I 4 .   ? 47.016 -1.165 -1.163  1.00 30.95 ? 285  HOH B O   1 
HETATM 3287 O  O   . HOH I 4 .   ? 32.522 32.495 -5.775  1.00 35.29 ? 286  HOH B O   1 
HETATM 3288 O  O   . HOH I 4 .   ? 38.163 25.309 0.577   1.00 20.50 ? 287  HOH B O   1 
HETATM 3289 O  O   . HOH I 4 .   ? 45.195 -0.910 -9.717  1.00 17.95 ? 288  HOH B O   1 
HETATM 3290 O  O   . HOH I 4 .   ? 34.876 6.645  -1.104  1.00 19.14 ? 289  HOH B O   1 
HETATM 3291 O  O   . HOH I 4 .   ? 33.729 8.188  9.172   1.00 30.86 ? 290  HOH B O   1 
HETATM 3292 O  O   . HOH I 4 .   ? 51.090 16.899 7.197   1.00 20.79 ? 291  HOH B O   1 
HETATM 3293 O  O   . HOH I 4 .   ? 46.436 4.604  21.916  1.00 32.80 ? 292  HOH B O   1 
HETATM 3294 O  O   . HOH I 4 .   ? 34.574 17.711 11.093  1.00 22.39 ? 293  HOH B O   1 
HETATM 3295 O  O   . HOH I 4 .   ? 47.311 29.538 -9.903  1.00 24.03 ? 294  HOH B O   1 
HETATM 3296 O  O   . HOH I 4 .   ? 48.090 15.471 -22.249 1.00 22.51 ? 295  HOH B O   1 
HETATM 3297 O  O   . HOH I 4 .   ? 26.699 20.406 -1.452  1.00 12.67 ? 296  HOH B O   1 
HETATM 3298 O  O   . HOH I 4 .   ? 59.054 17.443 -1.718  1.00 34.64 ? 297  HOH B O   1 
HETATM 3299 O  O   . HOH I 4 .   ? 36.691 16.590 14.805  1.00 32.96 ? 298  HOH B O   1 
HETATM 3300 O  O   . HOH I 4 .   ? 56.449 20.617 0.171   1.00 38.18 ? 299  HOH B O   1 
HETATM 3301 O  O   . HOH I 4 .   ? 26.666 14.474 -1.346  1.00 20.65 ? 300  HOH B O   1 
HETATM 3302 O  O   . HOH I 4 .   ? 48.948 16.036 22.992  1.00 32.37 ? 303  HOH B O   1 
HETATM 3303 O  O   . HOH I 4 .   ? 55.807 24.101 -12.300 1.00 26.65 ? 304  HOH B O   1 
HETATM 3304 O  O   . HOH I 4 .   ? 52.856 20.060 13.744  1.00 33.78 ? 305  HOH B O   1 
HETATM 3305 O  O   . HOH I 4 .   ? 51.071 26.009 -2.388  1.00 26.78 ? 306  HOH B O   1 
HETATM 3306 O  O   . HOH I 4 .   ? 32.053 34.284 -0.920  1.00 26.59 ? 307  HOH B O   1 
HETATM 3307 O  O   . HOH I 4 .   ? 40.932 39.773 -4.027  1.00 41.82 ? 308  HOH B O   1 
HETATM 3308 O  O   . HOH I 4 .   ? 30.314 12.874 -11.446 1.00 15.38 ? 309  HOH B O   1 
HETATM 3309 O  O   . HOH I 4 .   ? 61.304 16.783 -14.820 1.00 39.97 ? 310  HOH B O   1 
HETATM 3310 O  O   . HOH I 4 .   ? 56.626 14.305 -20.714 1.00 26.09 ? 311  HOH B O   1 
HETATM 3311 O  O   . HOH I 4 .   ? 33.596 26.995 -12.054 1.00 25.53 ? 312  HOH B O   1 
HETATM 3312 O  O   . HOH I 4 .   ? 37.696 7.128  -13.303 1.00 36.19 ? 313  HOH B O   1 
HETATM 3313 O  O   . HOH I 4 .   ? 49.981 18.675 9.070   1.00 14.64 ? 314  HOH B O   1 
HETATM 3314 O  O   . HOH I 4 .   ? 37.188 11.363 -19.891 1.00 34.49 ? 315  HOH B O   1 
HETATM 3315 O  O   . HOH I 4 .   ? 53.286 3.566  -0.980  1.00 43.12 ? 316  HOH B O   1 
HETATM 3316 O  O   . HOH I 4 .   ? 45.901 -2.891 -7.227  1.00 39.18 ? 317  HOH B O   1 
HETATM 3317 O  O   . HOH I 4 .   ? 60.098 18.410 -16.322 1.00 25.71 ? 318  HOH B O   1 
HETATM 3318 O  O   . HOH I 4 .   ? 52.358 28.266 -3.586  1.00 22.37 ? 319  HOH B O   1 
HETATM 3319 O  O   . HOH I 4 .   ? 44.359 3.772  -12.689 1.00 22.76 ? 320  HOH B O   1 
HETATM 3320 O  O   . HOH I 4 .   ? 33.513 8.280  12.294  1.00 30.67 ? 321  HOH B O   1 
HETATM 3321 O  O   . HOH I 4 .   ? 47.162 36.320 4.770   1.00 38.01 ? 322  HOH B O   1 
HETATM 3322 O  O   . HOH I 4 .   ? 56.993 13.064 -0.963  1.00 34.56 ? 323  HOH B O   1 
HETATM 3323 O  O   . HOH I 4 .   ? 52.686 14.938 7.976   1.00 32.26 ? 324  HOH B O   1 
HETATM 3324 O  O   . HOH I 4 .   ? 41.170 22.375 23.741  1.00 34.08 ? 325  HOH B O   1 
HETATM 3325 O  O   . HOH I 4 .   ? 52.598 11.819 1.860   1.00 42.19 ? 326  HOH B O   1 
HETATM 3326 O  O   . HOH I 4 .   ? 56.137 7.818  14.705  1.00 24.50 ? 327  HOH B O   1 
HETATM 3327 O  O   . HOH I 4 .   ? 57.639 14.509 -11.309 1.00 25.91 ? 328  HOH B O   1 
HETATM 3328 O  O   . HOH I 4 .   ? 29.267 35.511 3.125   1.00 29.99 ? 329  HOH B O   1 
HETATM 3329 O  O   . HOH I 4 .   ? 33.192 27.485 1.498   1.00 24.42 ? 330  HOH B O   1 
HETATM 3330 O  O   . HOH I 4 .   ? 56.067 22.701 -3.550  1.00 37.82 ? 331  HOH B O   1 
HETATM 3331 O  O   . HOH I 4 .   ? 27.790 12.862 -10.044 1.00 30.07 ? 332  HOH B O   1 
HETATM 3332 O  O   . HOH I 4 .   ? 39.151 39.597 -0.127  1.00 47.10 ? 333  HOH B O   1 
HETATM 3333 O  O   . HOH I 4 .   ? 47.491 1.482  7.710   1.00 24.06 ? 334  HOH B O   1 
HETATM 3334 O  O   . HOH I 4 .   ? 23.131 26.806 -6.800  1.00 29.61 ? 335  HOH B O   1 
HETATM 3335 O  O   . HOH I 4 .   ? 35.624 18.771 13.644  1.00 21.98 ? 336  HOH B O   1 
HETATM 3336 O  O   . HOH I 4 .   ? 58.919 9.747  -18.149 1.00 33.35 ? 337  HOH B O   1 
HETATM 3337 O  O   . HOH I 4 .   ? 37.063 3.485  14.696  1.00 36.64 ? 338  HOH B O   1 
HETATM 3338 O  O   . HOH I 4 .   ? 30.295 32.650 12.016  1.00 26.24 ? 339  HOH B O   1 
HETATM 3339 O  O   . HOH I 4 .   ? 60.433 12.918 -18.220 1.00 33.59 ? 340  HOH B O   1 
HETATM 3340 O  O   . HOH I 4 .   ? 39.081 29.956 -10.941 1.00 35.97 ? 341  HOH B O   1 
HETATM 3341 O  O   . HOH I 4 .   ? 38.007 21.715 19.586  1.00 23.82 ? 342  HOH B O   1 
HETATM 3342 O  O   . HOH I 4 .   ? 52.287 22.912 4.981   1.00 41.75 ? 343  HOH B O   1 
HETATM 3343 O  O   . HOH I 4 .   ? 48.377 7.070  -24.244 1.00 43.75 ? 344  HOH B O   1 
HETATM 3344 O  O   . HOH I 4 .   ? 52.824 5.836  -13.267 1.00 36.83 ? 345  HOH B O   1 
HETATM 3345 O  O   . HOH I 4 .   ? 32.821 6.313  -14.523 1.00 37.38 ? 346  HOH B O   1 
HETATM 3346 O  O   . HOH I 4 .   ? 38.985 18.767 21.723  1.00 29.21 ? 347  HOH B O   1 
HETATM 3347 O  O   . HOH I 4 .   ? 36.900 14.966 17.768  1.00 24.39 ? 348  HOH B O   1 
HETATM 3348 O  O   . HOH I 4 .   ? 29.861 16.931 0.876   1.00 24.72 ? 349  HOH B O   1 
HETATM 3349 O  O   . HOH I 4 .   ? 31.298 8.973  0.256   1.00 42.93 ? 350  HOH B O   1 
HETATM 3350 O  O   . HOH I 4 .   ? 34.933 32.968 -4.840  1.00 44.50 ? 351  HOH B O   1 
HETATM 3351 O  O   . HOH I 4 .   ? 30.935 6.148  1.767   1.00 35.67 ? 352  HOH B O   1 
HETATM 3352 O  O   . HOH I 4 .   ? 54.233 24.264 2.324   1.00 50.03 ? 353  HOH B O   1 
HETATM 3353 O  O   . HOH I 4 .   ? 44.138 1.113  16.734  1.00 34.92 ? 354  HOH B O   1 
HETATM 3354 O  O   . HOH I 4 .   ? 41.377 41.031 0.532   1.00 38.32 ? 355  HOH B O   1 
HETATM 3355 O  O   . HOH I 4 .   ? 32.874 8.012  -4.463  1.00 21.02 ? 356  HOH B O   1 
HETATM 3356 O  O   . HOH I 4 .   ? 28.203 16.617 -6.057  1.00 29.71 ? 357  HOH B O   1 
HETATM 3357 O  O   . HOH I 4 .   ? 37.350 6.978  12.711  1.00 28.34 ? 358  HOH B O   1 
HETATM 3358 O  O   . HOH I 4 .   ? 58.567 12.370 -4.281  1.00 34.78 ? 359  HOH B O   1 
HETATM 3359 O  O   . HOH I 4 .   ? 46.980 -2.892 -9.299  1.00 25.34 ? 360  HOH B O   1 
HETATM 3360 O  O   . HOH I 4 .   ? 42.313 13.908 -25.023 1.00 41.68 ? 361  HOH B O   1 
HETATM 3361 O  O   . HOH I 4 .   ? 52.440 30.729 -2.290  1.00 29.69 ? 362  HOH B O   1 
HETATM 3362 O  O   . HOH I 4 .   ? 55.927 5.580  -11.484 1.00 40.67 ? 363  HOH B O   1 
HETATM 3363 O  O   . HOH I 4 .   ? 27.541 17.091 -0.549  1.00 21.59 ? 364  HOH B O   1 
HETATM 3364 O  O   . HOH I 4 .   ? 30.890 27.415 -15.453 1.00 42.78 ? 365  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -2  ?   ?   ?   A . n 
A 1 2   ASN 2   -1  ?   ?   ?   A . n 
A 1 3   ALA 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   ?   ?   ?   A . n 
A 1 5   LYS 5   2   2   LYS LYS A . n 
A 1 6   PHE 6   3   3   PHE PHE A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   LEU 8   5   5   LEU LEU A . n 
A 1 9   PRO 9   6   6   PRO PRO A . n 
A 1 10  LYS 10  7   7   LYS LYS A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  PRO 12  9   9   PRO PRO A . n 
A 1 13  TYR 13  10  10  TYR TYR A . n 
A 1 14  ALA 14  11  11  ALA ALA A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  ALA 17  14  14  ALA ALA A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  GLU 19  16  16  GLU GLU A . n 
A 1 20  SER 20  17  17  SER SER A . n 
A 1 21  THR 21  18  18  THR THR A . n 
A 1 22  ILE 22  19  19  ILE ILE A . n 
A 1 23  SER 23  20  20  SER SER A . n 
A 1 24  LYS 24  21  21  LYS LYS A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  THR 26  23  23  THR THR A . n 
A 1 27  ILE 27  24  24  ILE ILE A . n 
A 1 28  GLU 28  25  25  GLU GLU A . n 
A 1 29  TYR 29  26  26  TYR TYR A . n 
A 1 30  HIS 30  27  27  HIS HIS A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  GLY 32  29  29  GLY GLY A . n 
A 1 33  LYS 33  30  30  LYS LYS A . n 
A 1 34  HIS 34  31  31  HIS HIS A . n 
A 1 35  HIS 35  32  32  HIS HIS A . n 
A 1 36  GLN 36  33  33  GLN GLN A . n 
A 1 37  THR 37  34  34  THR THR A . n 
A 1 38  TYR 38  35  35  TYR TYR A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  THR 40  37  37  THR THR A . n 
A 1 41  ASN 41  38  38  ASN ASN A . n 
A 1 42  LEU 42  39  39  LEU LEU A . n 
A 1 43  ASN 43  40  40  ASN ASN A . n 
A 1 44  ASN 44  41  41  ASN ASN A . n 
A 1 45  LEU 45  42  42  LEU LEU A . n 
A 1 46  VAL 46  43  43  VAL VAL A . n 
A 1 47  GLU 47  44  44  GLU GLU A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  THR 49  46  46  THR THR A . n 
A 1 50  GLU 50  47  47  GLU GLU A . n 
A 1 51  HIS 51  48  48  HIS HIS A . n 
A 1 52  ASP 52  49  49  ASP ASP A . n 
A 1 53  GLY 53  50  50  GLY GLY A . n 
A 1 54  ARG 54  51  51  ARG ARG A . n 
A 1 55  ASN 55  52  52  ASN ASN A . n 
A 1 56  LEU 56  53  53  LEU LEU A . n 
A 1 57  GLU 57  54  54  GLU GLU A . n 
A 1 58  GLU 58  55  55  GLU GLU A . n 
A 1 59  ILE 59  56  56  ILE ILE A . n 
A 1 60  VAL 60  57  57  VAL VAL A . n 
A 1 61  LYS 61  58  58  LYS LYS A . n 
A 1 62  THR 62  59  59  THR THR A . n 
A 1 63  SER 63  60  60  SER SER A . n 
A 1 64  ASN 64  61  61  ASN ASN A . n 
A 1 65  GLY 65  62  62  GLY GLY A . n 
A 1 66  GLY 66  63  63  GLY GLY A . n 
A 1 67  ILE 67  64  64  ILE ILE A . n 
A 1 68  PHE 68  65  65  PHE PHE A . n 
A 1 69  ASN 69  66  66  ASN ASN A . n 
A 1 70  ASN 70  67  67  ASN ASN A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  ALA 72  69  69  ALA ALA A . n 
A 1 73  GLN 73  70  70  GLN GLN A . n 
A 1 74  VAL 74  71  71  VAL VAL A . n 
A 1 75  PHE 75  72  72  PHE PHE A . n 
A 1 76  ASN 76  73  73  ASN ASN A . n 
A 1 77  HIS 77  74  74  HIS HIS A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  PHE 79  76  76  PHE PHE A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  TRP 81  78  78  TRP TRP A . n 
A 1 82  ASN 82  79  79  ASN ASN A . n 
A 1 83  CYS 83  80  80  CYS CYS A . n 
A 1 84  LEU 84  81  81  LEU LEU A . n 
A 1 85  THR 85  82  82  THR THR A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  LYS 88  85  85  LYS LYS A . n 
A 1 89  THR 89  86  86  THR THR A . n 
A 1 90  GLU 90  87  87  GLU GLU A . n 
A 1 91  ALA 91  88  88  ALA ALA A . n 
A 1 92  SER 92  89  89  SER SER A . n 
A 1 93  SER 93  90  90  SER SER A . n 
A 1 94  GLN 94  91  91  GLN GLN A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  LYS 96  93  93  LYS LYS A . n 
A 1 97  ALA 97  94  94  ALA ALA A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  LEU 99  96  96  LEU LEU A . n 
A 1 100 ILE 100 97  97  ILE ILE A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 THR 102 99  99  THR THR A . n 
A 1 103 PHE 103 100 100 PHE PHE A . n 
A 1 104 GLY 104 101 101 GLY GLY A . n 
A 1 105 SER 105 102 102 SER SER A . n 
A 1 106 VAL 106 103 103 VAL VAL A . n 
A 1 107 GLU 107 104 104 GLU GLU A . n 
A 1 108 ASN 108 105 105 ASN ASN A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 GLU 111 108 108 GLU GLU A . n 
A 1 112 GLN 112 109 109 GLN GLN A . n 
A 1 113 PHE 113 110 110 PHE PHE A . n 
A 1 114 SER 114 111 111 SER SER A . n 
A 1 115 LYS 115 112 112 LYS LYS A . n 
A 1 116 ALA 116 113 113 ALA ALA A . n 
A 1 117 ALA 117 114 114 ALA ALA A . n 
A 1 118 ILE 118 115 115 ILE ILE A . n 
A 1 119 ALA 119 116 116 ALA ALA A . n 
A 1 120 THR 120 117 117 THR THR A . n 
A 1 121 PHE 121 118 118 PHE PHE A . n 
A 1 122 GLY 122 119 119 GLY GLY A . n 
A 1 123 SER 123 120 120 SER SER A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 TRP 125 122 122 TRP TRP A . n 
A 1 126 ALA 126 123 123 ALA ALA A . n 
A 1 127 TRP 127 124 124 TRP TRP A . n 
A 1 128 LEU 128 125 125 LEU LEU A . n 
A 1 129 VAL 129 126 126 VAL VAL A . n 
A 1 130 LYS 130 127 127 LYS LYS A . n 
A 1 131 ASN 131 128 128 ASN ASN A . n 
A 1 132 THR 132 129 129 THR THR A . n 
A 1 133 GLU 133 130 130 GLU GLU A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 LYS 135 132 132 LYS LYS A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 GLU 137 134 134 GLU GLU A . n 
A 1 138 ILE 138 135 135 ILE ILE A . n 
A 1 139 VAL 139 136 136 VAL VAL A . n 
A 1 140 THR 140 137 137 THR THR A . n 
A 1 141 THR 141 138 138 THR THR A . n 
A 1 142 SER 142 139 139 SER SER A . n 
A 1 143 ASN 143 140 140 ASN ASN A . n 
A 1 144 ALA 144 141 141 ALA ALA A . n 
A 1 145 GLY 145 142 142 GLY GLY A . n 
A 1 146 CYS 146 143 143 CYS CYS A . n 
A 1 147 PRO 147 144 144 PRO PRO A . n 
A 1 148 LEU 148 145 145 LEU LEU A . n 
A 1 149 THR 149 146 146 THR THR A . n 
A 1 150 GLU 150 147 147 GLU GLU A . n 
A 1 151 ASN 151 148 148 ASN ASN A . n 
A 1 152 LYS 152 149 149 LYS LYS A . n 
A 1 153 LYS 153 150 150 LYS LYS A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 LEU 155 152 152 LEU LEU A . n 
A 1 156 LEU 156 153 153 LEU LEU A . n 
A 1 157 THR 157 154 154 THR THR A . n 
A 1 158 PHE 158 155 155 PHE PHE A . n 
A 1 159 ASP 159 156 156 ASP ASP A . n 
A 1 160 VAL 160 157 157 VAL VAL A . n 
A 1 161 TRP 161 158 158 TRP TRP A . n 
A 1 162 GLU 162 159 159 GLU GLU A . n 
A 1 163 HIS 163 160 160 HIS HIS A . n 
A 1 164 ALA 164 161 161 ALA ALA A . n 
A 1 165 TYR 165 162 162 TYR TYR A . n 
A 1 166 TYR 166 163 163 TYR TYR A . n 
A 1 167 ILE 167 164 164 ILE ILE A . n 
A 1 168 ASP 168 165 165 ASP ASP A . n 
A 1 169 TYR 169 166 166 TYR TYR A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 ASN 171 168 168 ASN ASN A . n 
A 1 172 ALA 172 169 169 ALA ALA A . n 
A 1 173 ARG 173 170 170 ARG ARG A . n 
A 1 174 PRO 174 171 171 PRO PRO A . n 
A 1 175 LYS 175 172 172 LYS LYS A . n 
A 1 176 TYR 176 173 173 TYR TYR A . n 
A 1 177 VAL 177 174 174 VAL VAL A . n 
A 1 178 GLU 178 175 175 GLU GLU A . n 
A 1 179 ALA 179 176 176 ALA ALA A . n 
A 1 180 LEU 180 177 177 LEU LEU A . n 
A 1 181 TRP 181 178 178 TRP TRP A . n 
A 1 182 ASP 182 179 179 ASP ASP A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 TRP 186 183 183 TRP TRP A . n 
A 1 187 GLN 187 184 184 GLN GLN A . n 
A 1 188 PHE 188 185 185 PHE PHE A . n 
A 1 189 VAL 189 186 186 VAL VAL A . n 
A 1 190 SER 190 187 187 SER SER A . n 
A 1 191 GLU 191 188 188 GLU GLU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 ALA 194 191 191 ALA ALA A . n 
A 1 195 ASP 195 192 ?   ?   ?   A . n 
B 1 1   SER 1   -2  ?   ?   ?   B . n 
B 1 2   ASN 2   -1  ?   ?   ?   B . n 
B 1 3   ALA 3   0   ?   ?   ?   B . n 
B 1 4   MET 4   1   1   MET MET B . n 
B 1 5   LYS 5   2   2   LYS LYS B . n 
B 1 6   PHE 6   3   3   PHE PHE B . n 
B 1 7   GLU 7   4   4   GLU GLU B . n 
B 1 8   LEU 8   5   5   LEU LEU B . n 
B 1 9   PRO 9   6   6   PRO PRO B . n 
B 1 10  LYS 10  7   7   LYS LYS B . n 
B 1 11  LEU 11  8   8   LEU LEU B . n 
B 1 12  PRO 12  9   9   PRO PRO B . n 
B 1 13  TYR 13  10  10  TYR TYR B . n 
B 1 14  ALA 14  11  11  ALA ALA B . n 
B 1 15  VAL 15  12  12  VAL VAL B . n 
B 1 16  ASP 16  13  13  ASP ASP B . n 
B 1 17  ALA 17  14  14  ALA ALA B . n 
B 1 18  LEU 18  15  15  LEU LEU B . n 
B 1 19  GLU 19  16  16  GLU GLU B . n 
B 1 20  SER 20  17  17  SER SER B . n 
B 1 21  THR 21  18  18  THR THR B . n 
B 1 22  ILE 22  19  19  ILE ILE B . n 
B 1 23  SER 23  20  20  SER SER B . n 
B 1 24  LYS 24  21  21  LYS LYS B . n 
B 1 25  GLU 25  22  22  GLU GLU B . n 
B 1 26  THR 26  23  23  THR THR B . n 
B 1 27  ILE 27  24  24  ILE ILE B . n 
B 1 28  GLU 28  25  25  GLU GLU B . n 
B 1 29  TYR 29  26  26  TYR TYR B . n 
B 1 30  HIS 30  27  27  HIS HIS B . n 
B 1 31  TYR 31  28  28  TYR TYR B . n 
B 1 32  GLY 32  29  29  GLY GLY B . n 
B 1 33  LYS 33  30  30  LYS LYS B . n 
B 1 34  HIS 34  31  31  HIS HIS B . n 
B 1 35  HIS 35  32  32  HIS HIS B . n 
B 1 36  GLN 36  33  33  GLN GLN B . n 
B 1 37  THR 37  34  34  THR THR B . n 
B 1 38  TYR 38  35  35  TYR TYR B . n 
B 1 39  VAL 39  36  36  VAL VAL B . n 
B 1 40  THR 40  37  37  THR THR B . n 
B 1 41  ASN 41  38  38  ASN ASN B . n 
B 1 42  LEU 42  39  39  LEU LEU B . n 
B 1 43  ASN 43  40  40  ASN ASN B . n 
B 1 44  ASN 44  41  41  ASN ASN B . n 
B 1 45  LEU 45  42  42  LEU LEU B . n 
B 1 46  VAL 46  43  43  VAL VAL B . n 
B 1 47  GLU 47  44  44  GLU GLU B . n 
B 1 48  GLY 48  45  45  GLY GLY B . n 
B 1 49  THR 49  46  46  THR THR B . n 
B 1 50  GLU 50  47  47  GLU GLU B . n 
B 1 51  HIS 51  48  48  HIS HIS B . n 
B 1 52  ASP 52  49  49  ASP ASP B . n 
B 1 53  GLY 53  50  50  GLY GLY B . n 
B 1 54  ARG 54  51  51  ARG ARG B . n 
B 1 55  ASN 55  52  52  ASN ASN B . n 
B 1 56  LEU 56  53  53  LEU LEU B . n 
B 1 57  GLU 57  54  54  GLU GLU B . n 
B 1 58  GLU 58  55  55  GLU GLU B . n 
B 1 59  ILE 59  56  56  ILE ILE B . n 
B 1 60  VAL 60  57  57  VAL VAL B . n 
B 1 61  LYS 61  58  58  LYS LYS B . n 
B 1 62  THR 62  59  59  THR THR B . n 
B 1 63  SER 63  60  60  SER SER B . n 
B 1 64  ASN 64  61  61  ASN ASN B . n 
B 1 65  GLY 65  62  62  GLY GLY B . n 
B 1 66  GLY 66  63  63  GLY GLY B . n 
B 1 67  ILE 67  64  64  ILE ILE B . n 
B 1 68  PHE 68  65  65  PHE PHE B . n 
B 1 69  ASN 69  66  66  ASN ASN B . n 
B 1 70  ASN 70  67  67  ASN ASN B . n 
B 1 71  ALA 71  68  68  ALA ALA B . n 
B 1 72  ALA 72  69  69  ALA ALA B . n 
B 1 73  GLN 73  70  70  GLN GLN B . n 
B 1 74  VAL 74  71  71  VAL VAL B . n 
B 1 75  PHE 75  72  72  PHE PHE B . n 
B 1 76  ASN 76  73  73  ASN ASN B . n 
B 1 77  HIS 77  74  74  HIS HIS B . n 
B 1 78  THR 78  75  75  THR THR B . n 
B 1 79  PHE 79  76  76  PHE PHE B . n 
B 1 80  TYR 80  77  77  TYR TYR B . n 
B 1 81  TRP 81  78  78  TRP TRP B . n 
B 1 82  ASN 82  79  79  ASN ASN B . n 
B 1 83  CYS 83  80  80  CYS CYS B . n 
B 1 84  LEU 84  81  81  LEU LEU B . n 
B 1 85  THR 85  82  82  THR THR B . n 
B 1 86  PRO 86  83  83  PRO PRO B . n 
B 1 87  ASN 87  84  84  ASN ASN B . n 
B 1 88  LYS 88  85  85  LYS LYS B . n 
B 1 89  THR 89  86  86  THR THR B . n 
B 1 90  GLU 90  87  87  GLU GLU B . n 
B 1 91  ALA 91  88  88  ALA ALA B . n 
B 1 92  SER 92  89  89  SER SER B . n 
B 1 93  SER 93  90  90  SER SER B . n 
B 1 94  GLN 94  91  91  GLN GLN B . n 
B 1 95  LEU 95  92  92  LEU LEU B . n 
B 1 96  LYS 96  93  93  LYS LYS B . n 
B 1 97  ALA 97  94  94  ALA ALA B . n 
B 1 98  ALA 98  95  95  ALA ALA B . n 
B 1 99  LEU 99  96  96  LEU LEU B . n 
B 1 100 ILE 100 97  97  ILE ILE B . n 
B 1 101 GLU 101 98  98  GLU GLU B . n 
B 1 102 THR 102 99  99  THR THR B . n 
B 1 103 PHE 103 100 100 PHE PHE B . n 
B 1 104 GLY 104 101 101 GLY GLY B . n 
B 1 105 SER 105 102 102 SER SER B . n 
B 1 106 VAL 106 103 103 VAL VAL B . n 
B 1 107 GLU 107 104 104 GLU GLU B . n 
B 1 108 ASN 108 105 105 ASN ASN B . n 
B 1 109 PHE 109 106 106 PHE PHE B . n 
B 1 110 LYS 110 107 107 LYS LYS B . n 
B 1 111 GLU 111 108 108 GLU GLU B . n 
B 1 112 GLN 112 109 109 GLN GLN B . n 
B 1 113 PHE 113 110 110 PHE PHE B . n 
B 1 114 SER 114 111 111 SER SER B . n 
B 1 115 LYS 115 112 112 LYS LYS B . n 
B 1 116 ALA 116 113 113 ALA ALA B . n 
B 1 117 ALA 117 114 114 ALA ALA B . n 
B 1 118 ILE 118 115 115 ILE ILE B . n 
B 1 119 ALA 119 116 116 ALA ALA B . n 
B 1 120 THR 120 117 117 THR THR B . n 
B 1 121 PHE 121 118 118 PHE PHE B . n 
B 1 122 GLY 122 119 119 GLY GLY B . n 
B 1 123 SER 123 120 120 SER SER B . n 
B 1 124 GLY 124 121 121 GLY GLY B . n 
B 1 125 TRP 125 122 122 TRP TRP B . n 
B 1 126 ALA 126 123 123 ALA ALA B . n 
B 1 127 TRP 127 124 124 TRP TRP B . n 
B 1 128 LEU 128 125 125 LEU LEU B . n 
B 1 129 VAL 129 126 126 VAL VAL B . n 
B 1 130 LYS 130 127 127 LYS LYS B . n 
B 1 131 ASN 131 128 128 ASN ASN B . n 
B 1 132 THR 132 129 129 THR THR B . n 
B 1 133 GLU 133 130 130 GLU GLU B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 LYS 135 132 132 LYS LYS B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 GLU 137 134 134 GLU GLU B . n 
B 1 138 ILE 138 135 135 ILE ILE B . n 
B 1 139 VAL 139 136 136 VAL VAL B . n 
B 1 140 THR 140 137 137 THR THR B . n 
B 1 141 THR 141 138 138 THR THR B . n 
B 1 142 SER 142 139 139 SER SER B . n 
B 1 143 ASN 143 140 140 ASN ASN B . n 
B 1 144 ALA 144 141 141 ALA ALA B . n 
B 1 145 GLY 145 142 142 GLY GLY B . n 
B 1 146 CYS 146 143 143 CYS CYS B . n 
B 1 147 PRO 147 144 144 PRO PRO B . n 
B 1 148 LEU 148 145 145 LEU LEU B . n 
B 1 149 THR 149 146 146 THR THR B . n 
B 1 150 GLU 150 147 147 GLU GLU B . n 
B 1 151 ASN 151 148 148 ASN ASN B . n 
B 1 152 LYS 152 149 149 LYS LYS B . n 
B 1 153 LYS 153 150 150 LYS LYS B . n 
B 1 154 PRO 154 151 151 PRO PRO B . n 
B 1 155 LEU 155 152 152 LEU LEU B . n 
B 1 156 LEU 156 153 153 LEU LEU B . n 
B 1 157 THR 157 154 154 THR THR B . n 
B 1 158 PHE 158 155 155 PHE PHE B . n 
B 1 159 ASP 159 156 156 ASP ASP B . n 
B 1 160 VAL 160 157 157 VAL VAL B . n 
B 1 161 TRP 161 158 158 TRP TRP B . n 
B 1 162 GLU 162 159 159 GLU GLU B . n 
B 1 163 HIS 163 160 160 HIS HIS B . n 
B 1 164 ALA 164 161 161 ALA ALA B . n 
B 1 165 TYR 165 162 162 TYR TYR B . n 
B 1 166 TYR 166 163 163 TYR TYR B . n 
B 1 167 ILE 167 164 164 ILE ILE B . n 
B 1 168 ASP 168 165 165 ASP ASP B . n 
B 1 169 TYR 169 166 166 TYR TYR B . n 
B 1 170 ARG 170 167 167 ARG ARG B . n 
B 1 171 ASN 171 168 168 ASN ASN B . n 
B 1 172 ALA 172 169 169 ALA ALA B . n 
B 1 173 ARG 173 170 170 ARG ARG B . n 
B 1 174 PRO 174 171 171 PRO PRO B . n 
B 1 175 LYS 175 172 172 LYS LYS B . n 
B 1 176 TYR 176 173 173 TYR TYR B . n 
B 1 177 VAL 177 174 174 VAL VAL B . n 
B 1 178 GLU 178 175 175 GLU GLU B . n 
B 1 179 ALA 179 176 176 ALA ALA B . n 
B 1 180 LEU 180 177 177 LEU LEU B . n 
B 1 181 TRP 181 178 178 TRP TRP B . n 
B 1 182 ASP 182 179 179 ASP ASP B . n 
B 1 183 ILE 183 180 180 ILE ILE B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ASN 185 182 182 ASN ASN B . n 
B 1 186 TRP 186 183 183 TRP TRP B . n 
B 1 187 GLN 187 184 184 GLN GLN B . n 
B 1 188 PHE 188 185 185 PHE PHE B . n 
B 1 189 VAL 189 186 186 VAL VAL B . n 
B 1 190 SER 190 187 187 SER SER B . n 
B 1 191 GLU 191 188 188 GLU GLU B . n 
B 1 192 GLN 192 189 189 GLN GLN B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 ALA 194 191 191 ALA ALA B . n 
B 1 195 ASP 195 192 192 ASP ASP B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Center for Structural Genomics of Infectious Diseases' 
_pdbx_SG_project.initial_of_center     CSGID 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FE  1   1001 1001 FE  FE  A . 
D 3 GOL 1   301  301  GOL GOL B . 
E 3 GOL 1   302  302  GOL GOL B . 
F 2 FE  1   1001 1001 FE  FE  B . 
G 3 GOL 1   193  301  GOL GOL B . 
H 4 HOH 1   193  4    HOH HOH A . 
H 4 HOH 2   194  17   HOH HOH A . 
H 4 HOH 3   195  19   HOH HOH A . 
H 4 HOH 4   196  22   HOH HOH A . 
H 4 HOH 5   197  197  HOH HOH A . 
H 4 HOH 6   198  27   HOH HOH A . 
H 4 HOH 7   199  30   HOH HOH A . 
H 4 HOH 8   200  33   HOH HOH A . 
H 4 HOH 9   201  38   HOH HOH A . 
H 4 HOH 10  202  41   HOH HOH A . 
H 4 HOH 11  203  45   HOH HOH A . 
H 4 HOH 12  204  47   HOH HOH A . 
H 4 HOH 13  205  205  HOH HOH A . 
H 4 HOH 14  206  49   HOH HOH A . 
H 4 HOH 15  207  51   HOH HOH A . 
H 4 HOH 16  208  54   HOH HOH A . 
H 4 HOH 17  209  59   HOH HOH A . 
H 4 HOH 18  210  60   HOH HOH A . 
H 4 HOH 19  211  61   HOH HOH A . 
H 4 HOH 20  212  212  HOH HOH A . 
H 4 HOH 21  213  62   HOH HOH A . 
H 4 HOH 22  214  64   HOH HOH A . 
H 4 HOH 23  215  66   HOH HOH A . 
H 4 HOH 24  216  68   HOH HOH A . 
H 4 HOH 25  217  75   HOH HOH A . 
H 4 HOH 26  218  76   HOH HOH A . 
H 4 HOH 27  219  80   HOH HOH A . 
H 4 HOH 28  220  83   HOH HOH A . 
H 4 HOH 29  221  84   HOH HOH A . 
H 4 HOH 30  222  85   HOH HOH A . 
H 4 HOH 31  223  88   HOH HOH A . 
H 4 HOH 32  224  224  HOH HOH A . 
H 4 HOH 33  225  89   HOH HOH A . 
H 4 HOH 34  226  226  HOH HOH A . 
H 4 HOH 35  227  227  HOH HOH A . 
H 4 HOH 36  228  93   HOH HOH A . 
H 4 HOH 37  229  229  HOH HOH A . 
H 4 HOH 38  230  230  HOH HOH A . 
H 4 HOH 39  231  96   HOH HOH A . 
H 4 HOH 40  232  97   HOH HOH A . 
H 4 HOH 41  233  104  HOH HOH A . 
H 4 HOH 42  234  234  HOH HOH A . 
H 4 HOH 43  235  108  HOH HOH A . 
H 4 HOH 44  236  110  HOH HOH A . 
H 4 HOH 45  237  114  HOH HOH A . 
H 4 HOH 46  238  238  HOH HOH A . 
H 4 HOH 47  239  117  HOH HOH A . 
H 4 HOH 48  240  118  HOH HOH A . 
H 4 HOH 49  241  241  HOH HOH A . 
H 4 HOH 50  242  242  HOH HOH A . 
H 4 HOH 51  243  243  HOH HOH A . 
H 4 HOH 52  244  121  HOH HOH A . 
H 4 HOH 53  245  123  HOH HOH A . 
H 4 HOH 54  246  134  HOH HOH A . 
H 4 HOH 55  247  247  HOH HOH A . 
H 4 HOH 56  248  248  HOH HOH A . 
H 4 HOH 57  249  136  HOH HOH A . 
H 4 HOH 58  250  139  HOH HOH A . 
H 4 HOH 59  251  251  HOH HOH A . 
H 4 HOH 60  252  252  HOH HOH A . 
H 4 HOH 61  253  253  HOH HOH A . 
H 4 HOH 62  254  151  HOH HOH A . 
H 4 HOH 63  255  153  HOH HOH A . 
H 4 HOH 64  256  159  HOH HOH A . 
H 4 HOH 65  257  162  HOH HOH A . 
H 4 HOH 66  258  258  HOH HOH A . 
H 4 HOH 67  259  163  HOH HOH A . 
H 4 HOH 68  260  164  HOH HOH A . 
H 4 HOH 69  261  165  HOH HOH A . 
H 4 HOH 70  262  168  HOH HOH A . 
H 4 HOH 71  263  169  HOH HOH A . 
H 4 HOH 72  264  170  HOH HOH A . 
H 4 HOH 73  265  171  HOH HOH A . 
H 4 HOH 74  266  174  HOH HOH A . 
H 4 HOH 75  267  176  HOH HOH A . 
H 4 HOH 76  268  177  HOH HOH A . 
H 4 HOH 77  269  181  HOH HOH A . 
H 4 HOH 78  270  183  HOH HOH A . 
H 4 HOH 79  271  185  HOH HOH A . 
H 4 HOH 80  272  187  HOH HOH A . 
H 4 HOH 81  273  191  HOH HOH A . 
H 4 HOH 82  366  193  HOH HOH A . 
I 4 HOH 1   194  1    HOH HOH B . 
I 4 HOH 2   195  2    HOH HOH B . 
I 4 HOH 3   196  196  HOH HOH B . 
I 4 HOH 4   197  3    HOH HOH B . 
I 4 HOH 5   198  198  HOH HOH B . 
I 4 HOH 6   199  199  HOH HOH B . 
I 4 HOH 7   200  200  HOH HOH B . 
I 4 HOH 8   201  201  HOH HOH B . 
I 4 HOH 9   202  202  HOH HOH B . 
I 4 HOH 10  203  203  HOH HOH B . 
I 4 HOH 11  204  204  HOH HOH B . 
I 4 HOH 12  205  5    HOH HOH B . 
I 4 HOH 13  206  206  HOH HOH B . 
I 4 HOH 14  207  207  HOH HOH B . 
I 4 HOH 15  208  208  HOH HOH B . 
I 4 HOH 16  209  7    HOH HOH B . 
I 4 HOH 17  210  210  HOH HOH B . 
I 4 HOH 18  211  211  HOH HOH B . 
I 4 HOH 19  212  8    HOH HOH B . 
I 4 HOH 20  213  213  HOH HOH B . 
I 4 HOH 21  214  214  HOH HOH B . 
I 4 HOH 22  215  215  HOH HOH B . 
I 4 HOH 23  216  216  HOH HOH B . 
I 4 HOH 24  217  217  HOH HOH B . 
I 4 HOH 25  218  218  HOH HOH B . 
I 4 HOH 26  219  219  HOH HOH B . 
I 4 HOH 27  220  220  HOH HOH B . 
I 4 HOH 28  221  221  HOH HOH B . 
I 4 HOH 29  222  222  HOH HOH B . 
I 4 HOH 30  223  223  HOH HOH B . 
I 4 HOH 31  224  9    HOH HOH B . 
I 4 HOH 32  225  225  HOH HOH B . 
I 4 HOH 33  226  10   HOH HOH B . 
I 4 HOH 34  227  11   HOH HOH B . 
I 4 HOH 35  228  228  HOH HOH B . 
I 4 HOH 36  229  12   HOH HOH B . 
I 4 HOH 37  230  13   HOH HOH B . 
I 4 HOH 38  231  231  HOH HOH B . 
I 4 HOH 39  232  232  HOH HOH B . 
I 4 HOH 40  233  233  HOH HOH B . 
I 4 HOH 41  234  14   HOH HOH B . 
I 4 HOH 42  235  235  HOH HOH B . 
I 4 HOH 43  236  236  HOH HOH B . 
I 4 HOH 44  237  237  HOH HOH B . 
I 4 HOH 45  238  15   HOH HOH B . 
I 4 HOH 46  239  239  HOH HOH B . 
I 4 HOH 47  240  240  HOH HOH B . 
I 4 HOH 48  241  16   HOH HOH B . 
I 4 HOH 49  242  18   HOH HOH B . 
I 4 HOH 50  243  20   HOH HOH B . 
I 4 HOH 51  244  244  HOH HOH B . 
I 4 HOH 52  245  245  HOH HOH B . 
I 4 HOH 53  246  246  HOH HOH B . 
I 4 HOH 54  247  21   HOH HOH B . 
I 4 HOH 55  248  23   HOH HOH B . 
I 4 HOH 56  249  249  HOH HOH B . 
I 4 HOH 57  250  24   HOH HOH B . 
I 4 HOH 58  251  25   HOH HOH B . 
I 4 HOH 59  252  26   HOH HOH B . 
I 4 HOH 60  253  28   HOH HOH B . 
I 4 HOH 61  254  254  HOH HOH B . 
I 4 HOH 62  255  255  HOH HOH B . 
I 4 HOH 63  256  256  HOH HOH B . 
I 4 HOH 64  257  257  HOH HOH B . 
I 4 HOH 65  258  29   HOH HOH B . 
I 4 HOH 66  259  259  HOH HOH B . 
I 4 HOH 67  260  31   HOH HOH B . 
I 4 HOH 68  261  261  HOH HOH B . 
I 4 HOH 69  262  262  HOH HOH B . 
I 4 HOH 70  263  263  HOH HOH B . 
I 4 HOH 71  264  264  HOH HOH B . 
I 4 HOH 72  265  32   HOH HOH B . 
I 4 HOH 73  266  266  HOH HOH B . 
I 4 HOH 74  267  267  HOH HOH B . 
I 4 HOH 75  268  268  HOH HOH B . 
I 4 HOH 76  269  269  HOH HOH B . 
I 4 HOH 77  270  270  HOH HOH B . 
I 4 HOH 78  271  34   HOH HOH B . 
I 4 HOH 79  272  35   HOH HOH B . 
I 4 HOH 80  273  37   HOH HOH B . 
I 4 HOH 81  274  39   HOH HOH B . 
I 4 HOH 82  275  40   HOH HOH B . 
I 4 HOH 83  276  42   HOH HOH B . 
I 4 HOH 84  277  43   HOH HOH B . 
I 4 HOH 85  278  44   HOH HOH B . 
I 4 HOH 86  279  46   HOH HOH B . 
I 4 HOH 87  280  48   HOH HOH B . 
I 4 HOH 88  281  50   HOH HOH B . 
I 4 HOH 89  282  52   HOH HOH B . 
I 4 HOH 90  283  53   HOH HOH B . 
I 4 HOH 91  284  55   HOH HOH B . 
I 4 HOH 92  285  56   HOH HOH B . 
I 4 HOH 93  286  57   HOH HOH B . 
I 4 HOH 94  287  58   HOH HOH B . 
I 4 HOH 95  288  63   HOH HOH B . 
I 4 HOH 96  289  65   HOH HOH B . 
I 4 HOH 97  290  67   HOH HOH B . 
I 4 HOH 98  291  69   HOH HOH B . 
I 4 HOH 99  292  70   HOH HOH B . 
I 4 HOH 100 293  72   HOH HOH B . 
I 4 HOH 101 294  73   HOH HOH B . 
I 4 HOH 102 295  74   HOH HOH B . 
I 4 HOH 103 296  77   HOH HOH B . 
I 4 HOH 104 297  78   HOH HOH B . 
I 4 HOH 105 298  79   HOH HOH B . 
I 4 HOH 106 299  82   HOH HOH B . 
I 4 HOH 107 300  86   HOH HOH B . 
I 4 HOH 108 303  87   HOH HOH B . 
I 4 HOH 109 304  90   HOH HOH B . 
I 4 HOH 110 305  91   HOH HOH B . 
I 4 HOH 111 306  92   HOH HOH B . 
I 4 HOH 112 307  94   HOH HOH B . 
I 4 HOH 113 308  95   HOH HOH B . 
I 4 HOH 114 309  98   HOH HOH B . 
I 4 HOH 115 310  99   HOH HOH B . 
I 4 HOH 116 311  100  HOH HOH B . 
I 4 HOH 117 312  101  HOH HOH B . 
I 4 HOH 118 313  102  HOH HOH B . 
I 4 HOH 119 314  103  HOH HOH B . 
I 4 HOH 120 315  105  HOH HOH B . 
I 4 HOH 121 316  107  HOH HOH B . 
I 4 HOH 122 317  109  HOH HOH B . 
I 4 HOH 123 318  111  HOH HOH B . 
I 4 HOH 124 319  112  HOH HOH B . 
I 4 HOH 125 320  113  HOH HOH B . 
I 4 HOH 126 321  115  HOH HOH B . 
I 4 HOH 127 322  116  HOH HOH B . 
I 4 HOH 128 323  119  HOH HOH B . 
I 4 HOH 129 324  120  HOH HOH B . 
I 4 HOH 130 325  122  HOH HOH B . 
I 4 HOH 131 326  125  HOH HOH B . 
I 4 HOH 132 327  127  HOH HOH B . 
I 4 HOH 133 328  128  HOH HOH B . 
I 4 HOH 134 329  129  HOH HOH B . 
I 4 HOH 135 330  130  HOH HOH B . 
I 4 HOH 136 331  131  HOH HOH B . 
I 4 HOH 137 332  132  HOH HOH B . 
I 4 HOH 138 333  133  HOH HOH B . 
I 4 HOH 139 334  137  HOH HOH B . 
I 4 HOH 140 335  138  HOH HOH B . 
I 4 HOH 141 336  140  HOH HOH B . 
I 4 HOH 142 337  141  HOH HOH B . 
I 4 HOH 143 338  142  HOH HOH B . 
I 4 HOH 144 339  143  HOH HOH B . 
I 4 HOH 145 340  144  HOH HOH B . 
I 4 HOH 146 341  145  HOH HOH B . 
I 4 HOH 147 342  146  HOH HOH B . 
I 4 HOH 148 343  147  HOH HOH B . 
I 4 HOH 149 344  148  HOH HOH B . 
I 4 HOH 150 345  149  HOH HOH B . 
I 4 HOH 151 346  150  HOH HOH B . 
I 4 HOH 152 347  152  HOH HOH B . 
I 4 HOH 153 348  155  HOH HOH B . 
I 4 HOH 154 349  156  HOH HOH B . 
I 4 HOH 155 350  157  HOH HOH B . 
I 4 HOH 156 351  158  HOH HOH B . 
I 4 HOH 157 352  160  HOH HOH B . 
I 4 HOH 158 353  166  HOH HOH B . 
I 4 HOH 159 354  167  HOH HOH B . 
I 4 HOH 160 355  172  HOH HOH B . 
I 4 HOH 161 356  175  HOH HOH B . 
I 4 HOH 162 357  178  HOH HOH B . 
I 4 HOH 163 358  179  HOH HOH B . 
I 4 HOH 164 359  180  HOH HOH B . 
I 4 HOH 165 360  184  HOH HOH B . 
I 4 HOH 166 361  186  HOH HOH B . 
I 4 HOH 167 362  188  HOH HOH B . 
I 4 HOH 168 363  189  HOH HOH B . 
I 4 HOH 169 364  190  HOH HOH B . 
I 4 HOH 170 365  192  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2450  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  17330 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 30  ? A HIS 27  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 NE2 ? A HIS 77  ? A HIS 74  ? 1_555 95.7  ? 
2  NE2 ? A HIS 30  ? A HIS 27  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 OD2 ? A ASP 159 ? A ASP 156 ? 1_555 85.6  ? 
3  NE2 ? A HIS 77  ? A HIS 74  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 OD2 ? A ASP 159 ? A ASP 156 ? 1_555 112.7 ? 
4  NE2 ? A HIS 30  ? A HIS 27  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 NE2 ? A HIS 163 ? A HIS 160 ? 1_555 91.5  ? 
5  NE2 ? A HIS 77  ? A HIS 74  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 NE2 ? A HIS 163 ? A HIS 160 ? 1_555 124.6 ? 
6  OD2 ? A ASP 159 ? A ASP 156 ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 NE2 ? A HIS 163 ? A HIS 160 ? 1_555 122.6 ? 
7  NE2 ? A HIS 30  ? A HIS 27  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 O   ? H HOH .   ? A HOH 236 ? 1_555 171.6 ? 
8  NE2 ? A HIS 77  ? A HIS 74  ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 O   ? H HOH .   ? A HOH 236 ? 1_555 88.7  ? 
9  OD2 ? A ASP 159 ? A ASP 156 ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 O   ? H HOH .   ? A HOH 236 ? 1_555 86.1  ? 
10 NE2 ? A HIS 163 ? A HIS 160 ? 1_555 FE ? C FE . ? A FE 1001 ? 1_555 O   ? H HOH .   ? A HOH 236 ? 1_555 92.0  ? 
11 NE2 ? B HIS 30  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 NE2 ? B HIS 77  ? B HIS 74  ? 1_555 89.5  ? 
12 NE2 ? B HIS 30  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 OD2 ? B ASP 159 ? B ASP 156 ? 1_555 86.1  ? 
13 NE2 ? B HIS 77  ? B HIS 74  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 OD2 ? B ASP 159 ? B ASP 156 ? 1_555 110.8 ? 
14 NE2 ? B HIS 30  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 NE2 ? B HIS 163 ? B HIS 160 ? 1_555 94.3  ? 
15 NE2 ? B HIS 77  ? B HIS 74  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 NE2 ? B HIS 163 ? B HIS 160 ? 1_555 122.7 ? 
16 OD2 ? B ASP 159 ? B ASP 156 ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 NE2 ? B HIS 163 ? B HIS 160 ? 1_555 126.4 ? 
17 NE2 ? B HIS 30  ? B HIS 27  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 O   ? I HOH .   ? B HOH 284 ? 1_555 175.9 ? 
18 NE2 ? B HIS 77  ? B HIS 74  ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 O   ? I HOH .   ? B HOH 284 ? 1_555 91.4  ? 
19 OD2 ? B ASP 159 ? B ASP 156 ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 O   ? I HOH .   ? B HOH 284 ? 1_555 89.9  ? 
20 NE2 ? B HIS 163 ? B HIS 160 ? 1_555 FE ? F FE . ? B FE 1001 ? 1_555 O   ? I HOH .   ? B HOH 284 ? 1_555 88.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-05 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            audit_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_audit_author.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 6.7154  17.3256 -2.2622  0.1288 0.5359 0.6715 0.1158  -0.0772 -0.0604 2.9579 3.3426 6.5929 
-0.2390 -0.7931 0.9018  0.1877  -0.2488 0.0611  0.8347  0.0214  0.8534  -0.0267 0.0852  -0.7997 
'X-RAY DIFFRACTION' 2  ? refined 11.1377 30.0539 8.7147   0.2558 0.2186 0.6589 0.1859  0.0470  -0.0675 9.1307 7.1052 2.4335 
-0.6741 0.8634  -4.1289 -0.4299 0.3342  0.0958  0.0840  0.2694  -0.0825 0.3928  -0.2843 -0.2302 
'X-RAY DIFFRACTION' 3  ? refined 16.7546 27.5372 2.3379   0.2168 0.2089 0.4400 0.0780  -0.0059 0.0008  3.0453 2.2581 4.0197 
-0.3587 -2.4139 0.7231  0.1190  -0.0429 -0.0761 0.3881  0.1507  0.5903  -0.1136 -0.3990 -0.3352 
'X-RAY DIFFRACTION' 4  ? refined 16.5987 17.9135 -4.2834  0.1608 0.4568 0.4565 0.0966  -0.0701 -0.0851 4.0782 5.4816 3.4719 
-1.8946 1.1495  2.0226  -0.0807 -0.0272 0.1079  0.8005  -0.4864 0.7239  -0.5279 -0.4848 0.0604  
'X-RAY DIFFRACTION' 5  ? refined 14.6030 5.4959  -11.1049 0.2266 0.4305 0.4421 -0.0058 -0.1809 -0.2097 8.7541 6.5955 4.2706 2.4756 
2.0119  0.7566  0.0651  -0.0860 0.0209  0.6384  -0.4931 0.3058  -0.7968 0.0780  -0.3878 
'X-RAY DIFFRACTION' 6  ? refined 9.1192  1.9999  -5.6816  0.3475 0.4011 0.6047 -0.1193 -0.1941 -0.1655 9.5793 6.3947 4.4334 
-3.9265 -4.5333 5.1667  0.0435  -0.2217 0.1783  0.3822  -0.8510 0.0242  0.2076  0.1466  -0.2407 
'X-RAY DIFFRACTION' 7  ? refined 11.4699 0.9546  1.0193   0.1456 0.2680 0.8388 -0.0891 -0.0242 -0.2160 9.5258 6.7325 4.4284 
-2.5910 2.9199  -5.4044 0.1275  0.3536  -0.4811 0.4633  -0.9658 0.6299  -0.5920 0.4744  -0.2276 
'X-RAY DIFFRACTION' 8  ? refined 16.4096 9.4073  1.7103   0.0358 0.1804 0.4793 0.0406  -0.0298 -0.1961 2.4532 1.3361 1.3447 0.5858 
0.4359  -0.9765 0.0726  0.0612  -0.1338 0.4071  -0.1874 0.3907  -0.0574 0.0581  -0.0590 
'X-RAY DIFFRACTION' 9  ? refined 6.0827  18.8244 18.8710  0.1634 0.1785 0.6208 0.0507  0.1635  -0.1269 1.6826 2.2064 5.8933 
-0.3026 -1.0582 -2.7977 -0.2455 0.0281  0.2174  0.0592  0.0291  0.3121  0.2500  -0.0760 -0.4449 
'X-RAY DIFFRACTION' 10 ? refined 13.9170 11.4660 29.6450  0.4034 0.3635 0.4730 0.0978  0.3396  0.0266  5.2702 6.2824 4.7670 1.3129 
2.9458  -1.7027 -0.0178 -0.2346 0.2524  -0.8549 -0.0172 0.2092  0.9541  -0.1753 -0.2677 
'X-RAY DIFFRACTION' 11 ? refined 22.4260 15.1569 21.7257  0.2410 0.1281 0.2758 0.0461  0.1452  -0.0562 6.9039 6.7891 5.5259 
-0.4528 -4.0439 -0.6377 -0.2954 0.1732  0.1222  -0.4208 0.1636  0.5147  0.6576  -0.0882 0.3614  
'X-RAY DIFFRACTION' 12 ? refined 18.5793 6.9923  15.6583  0.1613 0.0897 0.3672 0.0281  0.1606  -0.0387 1.7981 0.9458 1.5030 0.2063 
0.6317  0.0815  -0.0516 -0.0127 0.0643  -0.0812 -0.3048 0.4256  0.2842  0.1026  -0.1685 
'X-RAY DIFFRACTION' 13 ? refined 17.0377 3.2492  8.0509   0.0848 0.2428 0.6868 0.0181  0.1185  -0.1982 8.8435 9.2014 4.1931 5.6563 
-5.6720 -2.4532 0.1350  -0.3623 0.2273  0.0836  -0.5349 0.6786  0.1530  -0.1142 0.0611  
'X-RAY DIFFRACTION' 14 ? refined 11.8197 5.1835  14.3449  0.1328 0.1909 0.3878 0.0052  0.0904  -0.0345 7.8004 9.2318 8.8263 
-1.3945 -4.7636 2.6827  -0.2634 -0.2111 0.4746  0.2789  -0.6629 0.6352  0.1792  0.6779  -0.3707 
'X-RAY DIFFRACTION' 15 ? refined 23.3945 21.3295 8.1798   0.1574 0.1162 0.3961 0.0410  0.0219  -0.0060 1.1161 0.4286 0.9242 
-0.6010 -0.4550 0.3779  -0.0862 -0.0751 0.1613  0.1568  0.0324  0.1809  0.0477  -0.1125 -0.0427 
'X-RAY DIFFRACTION' 16 ? refined 27.4422 26.2743 13.5387  0.2578 0.0975 0.3467 -0.0259 0.0988  -0.0881 3.6071 0.9909 5.6771 1.6321 
-3.3311 -2.2521 0.1726  -0.1522 -0.0204 -0.1296 0.3044  0.1603  0.2248  -0.4275 0.3234  
'X-RAY DIFFRACTION' 17 ? refined 15.0952 22.6221 18.1673  0.1801 0.0933 0.5243 0.0439  0.1675  -0.1024 9.8395 1.8899 3.1297 
-3.0094 -0.6303 -1.5307 -0.3367 0.1335  0.2033  -0.2789 -0.3551 0.0806  0.3347  -0.3431 -0.0615 
'X-RAY DIFFRACTION' 18 ? refined 4.0812  12.2127 16.8000  0.1275 0.2730 0.6828 0.0313  0.2530  -0.1013 2.4726 7.9096 5.7149 0.0499 
3.2500  -3.2995 0.0494  -0.0127 -0.0366 -0.2467 0.0572  0.3939  0.0346  0.0775  -0.3681 
'X-RAY DIFFRACTION' 19 ? refined 50.7234 23.6435 12.4415  0.2012 0.1010 0.2246 -0.0845 -0.0960 -0.0142 1.5278 3.9776 5.4167 
-0.5083 -0.5530 -3.5245 -0.1358 -0.0324 0.1682  -0.0924 0.4020  -0.4916 0.4781  -0.4668 0.3579  
'X-RAY DIFFRACTION' 20 ? refined 43.0323 32.8636 -2.1439  0.3174 0.0807 0.2972 -0.0420 0.0058  0.1166  6.1979 1.3386 2.1133 0.3573 
2.0172  1.3864  -0.0727 -0.0670 0.1397  0.2985  0.5849  0.1321  -0.1074 -0.3471 0.0029  
'X-RAY DIFFRACTION' 21 ? refined 37.7932 32.9709 3.8505   0.2498 0.0184 0.2703 -0.0205 -0.0198 0.0564  6.1770 9.7301 7.7394 
-3.8402 -0.1071 -5.0806 0.0159  0.0434  -0.0593 0.0940  0.6062  -0.0225 0.4397  -0.8532 0.1272  
'X-RAY DIFFRACTION' 22 ? refined 39.7868 25.0603 10.4320  0.2830 0.1201 0.2211 -0.0218 -0.0095 -0.0254 1.8781 2.3422 0.8515 
-0.2148 0.1977  -1.4070 -0.1432 0.1424  0.0008  -0.1110 0.3189  0.0131  0.3581  -0.2369 -0.0686 
'X-RAY DIFFRACTION' 23 ? refined 44.6510 16.1442 20.9607  0.3035 0.1952 0.1256 0.0364  -0.0024 -0.0544 2.5748 8.4175 0.7762 
-3.4386 0.6246  -0.1514 -0.3297 0.3221  0.0075  -0.1375 0.1271  0.0492  0.8754  -0.0417 0.1798  
'X-RAY DIFFRACTION' 24 ? refined 51.3903 8.8125  18.7286  0.2051 0.1285 0.1049 -0.0114 -0.0170 -0.0218 3.7084 3.5862 7.9949 
-0.8759 -1.0001 -4.8722 -0.1017 -0.0175 0.1192  -0.1235 0.2018  -0.1536 0.3900  -0.5082 0.1086  
'X-RAY DIFFRACTION' 25 ? refined 50.2758 7.3894  10.6207  0.1861 0.1721 0.1055 -0.0124 0.0217  0.0166  9.4119 6.1311 2.6829 
-1.6830 3.4755  1.0621  -0.0634 -0.1817 0.2450  0.2807  0.2193  -0.3308 -0.1230 0.0130  0.0364  
'X-RAY DIFFRACTION' 26 ? refined 43.5334 13.2734 9.1602   0.1592 0.1385 0.1192 -0.0148 0.0027  0.0077  0.5942 2.2401 1.3652 
-0.3676 -0.0688 -0.1750 -0.1241 0.0715  0.0526  -0.0281 0.1362  0.0896  0.1564  -0.1068 0.0368  
'X-RAY DIFFRACTION' 27 ? refined 49.7884 25.6449 -6.8120  0.2072 0.1451 0.1790 -0.0660 -0.0188 0.1124  1.7224 2.3047 2.2540 
-0.5470 -0.0566 0.1466  0.0798  -0.0752 -0.0046 0.1841  0.4020  -0.1505 -0.0865 -0.2516 0.1620  
'X-RAY DIFFRACTION' 28 ? refined 51.6471 11.2709 -17.4971 0.2227 0.2255 0.1544 -0.0044 0.0694  0.1130  2.5064 1.6867 2.2600 1.3731 
0.0984  1.0899  -0.1833 0.1204  0.0629  0.4067  -0.0697 -0.2285 -0.3987 -0.1224 0.1929  
'X-RAY DIFFRACTION' 29 ? refined 41.8755 14.3329 -17.6532 0.2727 0.1911 0.1201 0.0005  -0.0292 0.0708  4.5638 2.3361 7.7130 
-1.3196 -1.7844 1.0318  0.2000  -0.1594 -0.0407 0.3049  0.0919  -0.0452 -0.4476 -0.4530 -0.2254 
'X-RAY DIFFRACTION' 30 ? refined 33.2264 13.0127 -7.8019  0.1856 0.2354 0.1864 0.0091  -0.0665 0.0167  5.5187 2.8433 6.9453 
-0.7981 -5.5852 0.4186  -0.2901 -0.1126 0.4027  0.2436  -0.1338 0.1215  -0.2685 0.2784  -0.2741 
'X-RAY DIFFRACTION' 31 ? refined 40.2801 12.5143 -1.6942  0.1748 0.1585 0.1531 -0.0127 0.0012  0.0239  3.2492 0.8985 0.7886 
-1.4632 -1.0998 0.7349  -0.1243 -0.0078 0.1321  0.0989  0.0541  0.1425  -0.0347 -0.0332 -0.0196 
'X-RAY DIFFRACTION' 32 ? refined 47.7756 4.3080  -7.7987  0.1666 0.1875 0.1006 -0.0039 -0.0151 0.0179  7.0126 3.0754 3.8095 
-1.3144 -1.3264 1.2318  0.0067  -0.0651 0.0584  0.1815  -0.2767 -0.1888 -0.0489 0.1307  0.2928  
'X-RAY DIFFRACTION' 33 ? refined 43.6367 10.2556 0.0786   0.1643 0.1598 0.1015 -0.0217 -0.0033 0.0160  1.5344 2.1174 0.9557 
-0.3511 0.2970  -0.3737 -0.0474 -0.0348 0.0823  0.0843  0.0166  0.0566  0.0213  -0.0612 0.0462  
'X-RAY DIFFRACTION' 34 ? refined 31.4775 22.8488 1.9967   0.2567 0.1567 0.2299 0.0500  0.0057  0.0278  3.2712 3.2766 0.6536 1.0501 
1.4332  0.2179  -0.0506 -0.0291 0.0797  0.0054  0.2159  0.2597  0.0876  -0.0680 -0.0129 
'X-RAY DIFFRACTION' 35 ? refined 36.6934 24.0638 -8.0323  0.2179 0.1193 0.1537 0.0209  -0.0578 0.0958  5.4668 1.3615 1.7990 
-0.4511 -1.7585 0.5622  -0.0088 -0.0981 0.1068  0.4066  0.1551  0.1250  -0.2388 -0.2881 -0.1813 
'X-RAY DIFFRACTION' 36 ? refined 55.0951 16.4806 -6.8514  0.1395 0.1735 0.1582 -0.0596 -0.0032 0.0966  5.4618 5.1244 4.1770 
-1.2322 0.5665  -0.1342 -0.0891 -0.1457 0.2349  0.2178  0.1282  -0.3681 -0.0333 -0.3106 0.3690  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 2   A 9   ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 10  A 18  ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 19  A 28  ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 29  A 37  ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 38  A 47  ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 48  A 53  ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  A 54  A 59  ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  A 60  A 77  ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  A 78  A 94  ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 A 95  A 105 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 A 106 A 117 ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 A 118 A 140 ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 A 141 A 147 ? . . . . ? 
'X-RAY DIFFRACTION' 14 14 A 148 A 153 ? . . . . ? 
'X-RAY DIFFRACTION' 15 15 A 154 A 165 ? . . . . ? 
'X-RAY DIFFRACTION' 16 16 A 166 A 172 ? . . . . ? 
'X-RAY DIFFRACTION' 17 17 A 173 A 183 ? . . . . ? 
'X-RAY DIFFRACTION' 18 18 A 184 A 191 ? . . . . ? 
'X-RAY DIFFRACTION' 19 19 B 1   B 9   ? . . . . ? 
'X-RAY DIFFRACTION' 20 20 B 10  B 19  ? . . . . ? 
'X-RAY DIFFRACTION' 21 21 B 20  B 25  ? . . . . ? 
'X-RAY DIFFRACTION' 22 22 B 26  B 35  ? . . . . ? 
'X-RAY DIFFRACTION' 23 23 B 36  B 45  ? . . . . ? 
'X-RAY DIFFRACTION' 24 24 B 46  B 53  ? . . . . ? 
'X-RAY DIFFRACTION' 25 25 B 54  B 58  ? . . . . ? 
'X-RAY DIFFRACTION' 26 26 B 59  B 77  ? . . . . ? 
'X-RAY DIFFRACTION' 27 27 B 78  B 88  ? . . . . ? 
'X-RAY DIFFRACTION' 28 28 B 89  B 101 ? . . . . ? 
'X-RAY DIFFRACTION' 29 29 B 102 B 109 ? . . . . ? 
'X-RAY DIFFRACTION' 30 30 B 110 B 118 ? . . . . ? 
'X-RAY DIFFRACTION' 31 31 B 119 B 126 ? . . . . ? 
'X-RAY DIFFRACTION' 32 32 B 127 B 137 ? . . . . ? 
'X-RAY DIFFRACTION' 33 33 B 138 B 157 ? . . . . ? 
'X-RAY DIFFRACTION' 34 34 B 158 B 164 ? . . . . ? 
'X-RAY DIFFRACTION' 35 35 B 165 B 183 ? . . . . ? 
'X-RAY DIFFRACTION' 36 36 B 184 B 191 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SBC-Collect 'data collection' .        ? 1 
MOLREP      phasing           .        ? 2 
REFMAC      refinement        5.5.0054 ? 3 
HKL-3000    'data reduction'  .        ? 4 
HKL-3000    'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLU 98  ? ? O B HOH 235 ? ? 2.15 
2 1 O   B ALA 191 ? ? O B HOH 359 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 140 ? ? 59.00 -107.29 
2 1 ARG A 167 ? ? 51.98 -126.04 
3 1 ASN B 140 ? ? 60.03 -110.11 
4 1 ARG B 167 ? ? 45.73 -129.13 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER -2  ? A SER 1   
2 1 Y 1 A ASN -1  ? A ASN 2   
3 1 Y 1 A ALA 0   ? A ALA 3   
4 1 Y 1 A MET 1   ? A MET 4   
5 1 Y 1 A ASP 192 ? A ASP 195 
6 1 Y 1 B SER -2  ? B SER 1   
7 1 Y 1 B ASN -1  ? B ASN 2   
8 1 Y 1 B ALA 0   ? B ALA 3   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 GLYCEROL       GOL 
4 water          HOH 
#