data_3H2U
# 
_entry.id   3H2U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H2U         
RCSB  RCSB052621   
WWPDB D_1000052621 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RKE . unspecified 
PDB 1tr2 . unspecified 
PDB 3H2V . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H2U 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.H.'        1 
'Rangarajan, E.S.' 2 
'Yogesha, S.D.'    3 
'Izard, T.'        4 
# 
_citation.id                        primary 
_citation.title                     
'Raver1 interactions with vinculin and RNA suggest a feed-forward pathway in directing mRNA to focal adhesions' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            17 
_citation.page_first                833 
_citation.page_last                 842 
_citation.year                      2009 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19523901 
_citation.pdbx_database_id_DOI      10.1016/j.str.2009.04.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.H.'        1 
primary 'Rangarajan, E.S.' 2 
primary 'Yogesha, S.D.'    3 
primary 'Izard, T.'        4 
# 
_cell.entry_id           3H2U 
_cell.length_a           86.754 
_cell.length_b           94.906 
_cell.length_c           186.027 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H2U 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Vinculin 21222.484 2  ? ? 'C-terminal domain'               ? 
2 polymer man Raver-1  31375.662 2  ? ? 'RRM 1, RRM 2, and RRM 3 domains' ? 
3 water   nat water    18.015    41 ? ? ?                                 ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Ribonucleoprotein PTB-binding 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
A,C ? 
2 'polypeptide(L)' no no 
;LDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRL
RERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPL
GPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEA
QQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRG
;
;LDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRL
RERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPL
GPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEA
QQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRG
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLU n 
1 3   LYS n 
1 4   ASP n 
1 5   GLU n 
1 6   GLU n 
1 7   PHE n 
1 8   PRO n 
1 9   GLU n 
1 10  GLN n 
1 11  LYS n 
1 12  ALA n 
1 13  GLY n 
1 14  GLU n 
1 15  VAL n 
1 16  ILE n 
1 17  ASN n 
1 18  GLN n 
1 19  PRO n 
1 20  MET n 
1 21  MET n 
1 22  MET n 
1 23  ALA n 
1 24  ALA n 
1 25  ARG n 
1 26  GLN n 
1 27  LEU n 
1 28  HIS n 
1 29  ASP n 
1 30  GLU n 
1 31  ALA n 
1 32  ARG n 
1 33  LYS n 
1 34  TRP n 
1 35  SER n 
1 36  SER n 
1 37  LYS n 
1 38  GLY n 
1 39  ASN n 
1 40  ASP n 
1 41  ILE n 
1 42  ILE n 
1 43  ALA n 
1 44  ALA n 
1 45  ALA n 
1 46  LYS n 
1 47  ARG n 
1 48  MET n 
1 49  ALA n 
1 50  LEU n 
1 51  LEU n 
1 52  MET n 
1 53  ALA n 
1 54  GLU n 
1 55  MET n 
1 56  SER n 
1 57  ARG n 
1 58  LEU n 
1 59  VAL n 
1 60  ARG n 
1 61  GLY n 
1 62  GLY n 
1 63  SER n 
1 64  GLY n 
1 65  THR n 
1 66  LYS n 
1 67  ARG n 
1 68  ALA n 
1 69  LEU n 
1 70  ILE n 
1 71  GLN n 
1 72  CYS n 
1 73  ALA n 
1 74  LYS n 
1 75  ASP n 
1 76  ILE n 
1 77  ALA n 
1 78  LYS n 
1 79  ALA n 
1 80  SER n 
1 81  ASP n 
1 82  GLU n 
1 83  VAL n 
1 84  THR n 
1 85  ARG n 
1 86  LEU n 
1 87  ALA n 
1 88  LYS n 
1 89  GLU n 
1 90  VAL n 
1 91  ALA n 
1 92  LYS n 
1 93  GLN n 
1 94  CYS n 
1 95  THR n 
1 96  ASP n 
1 97  LYS n 
1 98  ARG n 
1 99  ILE n 
1 100 ARG n 
1 101 THR n 
1 102 ASN n 
1 103 LEU n 
1 104 LEU n 
1 105 GLN n 
1 106 VAL n 
1 107 CYS n 
1 108 GLU n 
1 109 ARG n 
1 110 ILE n 
1 111 PRO n 
1 112 THR n 
1 113 ILE n 
1 114 SER n 
1 115 THR n 
1 116 GLN n 
1 117 LEU n 
1 118 LYS n 
1 119 ILE n 
1 120 LEU n 
1 121 SER n 
1 122 THR n 
1 123 VAL n 
1 124 LYS n 
1 125 ALA n 
1 126 THR n 
1 127 MET n 
1 128 LEU n 
1 129 GLY n 
1 130 ARG n 
1 131 THR n 
1 132 ASN n 
1 133 ILE n 
1 134 SER n 
1 135 ASP n 
1 136 GLU n 
1 137 GLU n 
1 138 SER n 
1 139 GLU n 
1 140 GLN n 
1 141 ALA n 
1 142 THR n 
1 143 GLU n 
1 144 MET n 
1 145 LEU n 
1 146 VAL n 
1 147 HIS n 
1 148 ASN n 
1 149 ALA n 
1 150 GLN n 
1 151 ASN n 
1 152 LEU n 
1 153 MET n 
1 154 GLN n 
1 155 SER n 
1 156 VAL n 
1 157 LYS n 
1 158 GLU n 
1 159 THR n 
1 160 VAL n 
1 161 ARG n 
1 162 GLU n 
1 163 ALA n 
1 164 GLU n 
1 165 ALA n 
1 166 ALA n 
1 167 SER n 
1 168 ILE n 
1 169 LYS n 
1 170 ILE n 
1 171 ARG n 
1 172 THR n 
1 173 ASP n 
1 174 ALA n 
1 175 GLY n 
1 176 PHE n 
1 177 THR n 
1 178 LEU n 
1 179 ARG n 
1 180 TRP n 
1 181 VAL n 
1 182 ARG n 
1 183 LYS n 
1 184 THR n 
1 185 PRO n 
1 186 TRP n 
1 187 TYR n 
1 188 GLN n 
2 1   LEU n 
2 2   ASP n 
2 3   PRO n 
2 4   GLU n 
2 5   GLU n 
2 6   ILE n 
2 7   ARG n 
2 8   LYS n 
2 9   ARG n 
2 10  LEU n 
2 11  GLU n 
2 12  HIS n 
2 13  THR n 
2 14  GLU n 
2 15  ARG n 
2 16  GLN n 
2 17  PHE n 
2 18  ARG n 
2 19  ASN n 
2 20  ARG n 
2 21  ARG n 
2 22  LYS n 
2 23  ILE n 
2 24  LEU n 
2 25  ILE n 
2 26  ARG n 
2 27  GLY n 
2 28  LEU n 
2 29  PRO n 
2 30  GLY n 
2 31  ASP n 
2 32  VAL n 
2 33  THR n 
2 34  ASN n 
2 35  GLN n 
2 36  GLU n 
2 37  VAL n 
2 38  HIS n 
2 39  ASP n 
2 40  LEU n 
2 41  LEU n 
2 42  SER n 
2 43  ASP n 
2 44  TYR n 
2 45  GLU n 
2 46  LEU n 
2 47  LYS n 
2 48  TYR n 
2 49  CYS n 
2 50  PHE n 
2 51  VAL n 
2 52  ASP n 
2 53  LYS n 
2 54  TYR n 
2 55  LYS n 
2 56  GLY n 
2 57  THR n 
2 58  ALA n 
2 59  PHE n 
2 60  VAL n 
2 61  THR n 
2 62  LEU n 
2 63  LEU n 
2 64  ASN n 
2 65  GLY n 
2 66  GLU n 
2 67  GLN n 
2 68  ALA n 
2 69  GLU n 
2 70  ALA n 
2 71  ALA n 
2 72  ILE n 
2 73  ASN n 
2 74  ALA n 
2 75  PHE n 
2 76  HIS n 
2 77  GLN n 
2 78  SER n 
2 79  ARG n 
2 80  LEU n 
2 81  ARG n 
2 82  GLU n 
2 83  ARG n 
2 84  GLU n 
2 85  LEU n 
2 86  SER n 
2 87  VAL n 
2 88  GLN n 
2 89  LEU n 
2 90  GLN n 
2 91  PRO n 
2 92  THR n 
2 93  ASP n 
2 94  ALA n 
2 95  LEU n 
2 96  LEU n 
2 97  CYS n 
2 98  VAL n 
2 99  ALA n 
2 100 ASN n 
2 101 LEU n 
2 102 PRO n 
2 103 PRO n 
2 104 SER n 
2 105 LEU n 
2 106 THR n 
2 107 GLN n 
2 108 GLN n 
2 109 GLN n 
2 110 PHE n 
2 111 GLU n 
2 112 GLU n 
2 113 LEU n 
2 114 VAL n 
2 115 ARG n 
2 116 PRO n 
2 117 PHE n 
2 118 GLY n 
2 119 SER n 
2 120 LEU n 
2 121 GLU n 
2 122 ARG n 
2 123 CYS n 
2 124 PHE n 
2 125 LEU n 
2 126 VAL n 
2 127 TYR n 
2 128 SER n 
2 129 GLU n 
2 130 ARG n 
2 131 THR n 
2 132 GLY n 
2 133 GLN n 
2 134 SER n 
2 135 LYS n 
2 136 GLY n 
2 137 TYR n 
2 138 GLY n 
2 139 PHE n 
2 140 ALA n 
2 141 GLU n 
2 142 TYR n 
2 143 MET n 
2 144 LYS n 
2 145 LYS n 
2 146 ASP n 
2 147 SER n 
2 148 ALA n 
2 149 ALA n 
2 150 ARG n 
2 151 ALA n 
2 152 LYS n 
2 153 SER n 
2 154 ASP n 
2 155 LEU n 
2 156 LEU n 
2 157 GLY n 
2 158 LYS n 
2 159 PRO n 
2 160 LEU n 
2 161 GLY n 
2 162 PRO n 
2 163 ARG n 
2 164 THR n 
2 165 LEU n 
2 166 TYR n 
2 167 VAL n 
2 168 HIS n 
2 169 TRP n 
2 170 THR n 
2 171 ASP n 
2 172 ALA n 
2 173 GLY n 
2 174 GLN n 
2 175 LEU n 
2 176 THR n 
2 177 PRO n 
2 178 ALA n 
2 179 LEU n 
2 180 LEU n 
2 181 HIS n 
2 182 SER n 
2 183 ARG n 
2 184 CYS n 
2 185 LEU n 
2 186 CYS n 
2 187 VAL n 
2 188 ASP n 
2 189 ARG n 
2 190 LEU n 
2 191 PRO n 
2 192 PRO n 
2 193 GLY n 
2 194 PHE n 
2 195 ASN n 
2 196 ASP n 
2 197 VAL n 
2 198 ASP n 
2 199 ALA n 
2 200 LEU n 
2 201 CYS n 
2 202 ARG n 
2 203 ALA n 
2 204 LEU n 
2 205 SER n 
2 206 ALA n 
2 207 VAL n 
2 208 HIS n 
2 209 SER n 
2 210 PRO n 
2 211 THR n 
2 212 PHE n 
2 213 CYS n 
2 214 GLN n 
2 215 LEU n 
2 216 ALA n 
2 217 CYS n 
2 218 GLY n 
2 219 GLN n 
2 220 ASP n 
2 221 GLY n 
2 222 GLN n 
2 223 LEU n 
2 224 LYS n 
2 225 GLY n 
2 226 PHE n 
2 227 ALA n 
2 228 VAL n 
2 229 LEU n 
2 230 GLU n 
2 231 TYR n 
2 232 GLU n 
2 233 THR n 
2 234 ALA n 
2 235 GLU n 
2 236 MET n 
2 237 ALA n 
2 238 GLU n 
2 239 GLU n 
2 240 ALA n 
2 241 GLN n 
2 242 GLN n 
2 243 GLN n 
2 244 ALA n 
2 245 ASP n 
2 246 GLY n 
2 247 LEU n 
2 248 SER n 
2 249 LEU n 
2 250 GLY n 
2 251 GLY n 
2 252 SER n 
2 253 HIS n 
2 254 LEU n 
2 255 ARG n 
2 256 VAL n 
2 257 SER n 
2 258 PHE n 
2 259 CYS n 
2 260 ALA n 
2 261 PRO n 
2 262 GLY n 
2 263 PRO n 
2 264 PRO n 
2 265 GLY n 
2 266 ARG n 
2 267 SER n 
2 268 MET n 
2 269 LEU n 
2 270 ALA n 
2 271 ALA n 
2 272 LEU n 
2 273 ILE n 
2 274 ALA n 
2 275 ALA n 
2 276 GLN n 
2 277 ALA n 
2 278 THR n 
2 279 ALA n 
2 280 LEU n 
2 281 ASN n 
2 282 ARG n 
2 283 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ?                  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'RAVER1, KIAA1978' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B4DTM7_HUMAN B4DTM7 1 
;EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKAS
DEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETV
REAEAASIKIRTDAGFTLRWVRKTPWYQ
;
140 ? 
2 UNP RAVR1_HUMAN  Q8IY67 2 
;LDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRL
RERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPL
GPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEA
QQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRG
;
39  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H2U A 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
2 2 3H2U B 1 ? 283 ? Q8IY67 39  ? 321 ? 39  321  
3 1 3H2U C 1 ? 188 ? B4DTM7 140 ? 327 ? 879 1066 
4 2 3H2U D 1 ? 283 ? Q8IY67 39  ? 321 ? 39  321  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H2U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.64 
_exptl_crystal.density_percent_sol   66.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Tris (pH 7.5), 200 mM sodium nitrate, and 16% PEG-3,350, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-02-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3H2U 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.75 
_reflns.number_obs                   40684 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        77.504 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3H2U 
_refine.ls_number_reflns_obs                     40500 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.75 
_refine.ls_percent_reflns_obs                    99.65 
_refine.ls_R_factor_obs                          0.2270 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2245 
_refine.ls_R_factor_R_free                       0.2735 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  2024 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               63.91 
_refine.aniso_B[1][1]                            -8.84641202 
_refine.aniso_B[2][2]                            -6.46321735 
_refine.aniso_B[3][3]                            15.30962937 
_refine.aniso_B[1][2]                            0.00000000 
_refine.aniso_B[1][3]                            0.00000000 
_refine.aniso_B[2][3]                            0.00000000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1RKE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3H2U 
_refine_analyze.Luzzati_coordinate_error_obs    0.4835 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7126 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               7167 
_refine_hist.d_res_high                       2.75 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.011  ? 2.00  7234 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.335  ? 2.00  9714 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 26.788 ? 0.00  1561 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?      ? ?     ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?      ? ?     ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.008  ? 2.00  194  'X-RAY DIFFRACTION' ? 
t_gen_planes       0.016  ? 5.00  1047 'X-RAY DIFFRACTION' ? 
t_it               1.844  ? 20.00 7234 'X-RAY DIFFRACTION' ? 
t_nbd              0.053  ? 5.00  192  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.d_res_high                       2.75 
_refine_ls_shell.d_res_low                        2.92 
_refine_ls_shell.number_reflns_R_work             6031 
_refine_ls_shell.R_factor_R_work                  0.2701 
_refine_ls_shell.percent_reflns_obs               99.65 
_refine_ls_shell.R_factor_R_free                  0.2894 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.22 
_refine_ls_shell.number_reflns_R_free             332 
_refine_ls_shell.number_reflns_all                6363 
_refine_ls_shell.R_factor_all                     0.2711 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3H2U 
_struct.title                     'Human raver1 RRM1, RRM2, and RRM3 domains in complex with human vinculin tail domain Vt' 
_struct.pdbx_descriptor           'Vinculin, Raver-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H2U 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;focal adhesion, actin cytoskeleton, RNP motif, RNA binding, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, RNA-binding, CELL ADHESION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 17  ? LYS A 33  ? ASN A 895  LYS A 911  1 ? 17 
HELX_P HELX_P2  2  ASN A 39  ? VAL A 59  ? ASN A 917  VAL A 937  1 ? 21 
HELX_P HELX_P3  3  GLY A 64  ? CYS A 94  ? GLY A 942  CYS A 972  1 ? 31 
HELX_P HELX_P4  4  ASP A 96  ? ARG A 109 ? ASP A 974  ARG A 987  1 ? 14 
HELX_P HELX_P5  5  ARG A 109 ? LEU A 128 ? ARG A 987  LEU A 1006 1 ? 20 
HELX_P HELX_P6  6  SER A 134 ? SER A 167 ? SER A 1012 SER A 1045 1 ? 34 
HELX_P HELX_P7  7  ASP B 2   ? ASN B 19  ? ASP B 40   ASN B 57   1 ? 18 
HELX_P HELX_P8  8  THR B 33  ? LEU B 41  ? THR B 71   LEU B 79   1 ? 9  
HELX_P HELX_P9  9  ASN B 64  ? HIS B 76  ? ASN B 102  HIS B 114  1 ? 13 
HELX_P HELX_P10 10 THR B 106 ? ARG B 115 ? THR B 144  ARG B 153  1 ? 10 
HELX_P HELX_P11 11 LYS B 144 ? LEU B 156 ? LYS B 182  LEU B 194  1 ? 13 
HELX_P HELX_P12 12 ASP B 196 ? LEU B 204 ? ASP B 234  LEU B 242  1 ? 9  
HELX_P HELX_P13 13 THR B 233 ? ASP B 245 ? THR B 271  ASP B 283  1 ? 13 
HELX_P HELX_P14 14 PRO B 264 ? THR B 278 ? PRO B 302  THR B 316  1 ? 15 
HELX_P HELX_P15 15 ASN C 17  ? ARG C 32  ? ASN C 895  ARG C 910  1 ? 16 
HELX_P HELX_P16 16 ASN C 39  ? VAL C 59  ? ASN C 917  VAL C 937  1 ? 21 
HELX_P HELX_P17 17 GLY C 64  ? GLN C 93  ? GLY C 942  GLN C 971  1 ? 30 
HELX_P HELX_P18 18 ASP C 96  ? ARG C 109 ? ASP C 974  ARG C 987  1 ? 14 
HELX_P HELX_P19 19 ARG C 109 ? LEU C 128 ? ARG C 987  LEU C 1006 1 ? 20 
HELX_P HELX_P20 20 SER C 134 ? ALA C 166 ? SER C 1012 ALA C 1044 1 ? 33 
HELX_P HELX_P21 21 ASP D 2   ? ASN D 19  ? ASP D 40   ASN D 57   1 ? 18 
HELX_P HELX_P22 22 THR D 33  ? LEU D 41  ? THR D 71   LEU D 79   1 ? 9  
HELX_P HELX_P23 23 ASN D 64  ? HIS D 76  ? ASN D 102  HIS D 114  1 ? 13 
HELX_P HELX_P24 24 THR D 106 ? ARG D 115 ? THR D 144  ARG D 153  1 ? 10 
HELX_P HELX_P25 25 PRO D 116 ? GLY D 118 ? PRO D 154  GLY D 156  5 ? 3  
HELX_P HELX_P26 26 LYS D 144 ? LEU D 156 ? LYS D 182  LEU D 194  1 ? 13 
HELX_P HELX_P27 27 THR D 176 ? HIS D 181 ? THR D 214  HIS D 219  1 ? 6  
HELX_P HELX_P28 28 VAL D 197 ? LEU D 204 ? VAL D 235  LEU D 242  1 ? 8  
HELX_P HELX_P29 29 THR D 233 ? ASP D 245 ? THR D 271  ASP D 283  1 ? 13 
HELX_P HELX_P30 30 PRO D 264 ? THR D 278 ? PRO D 302  THR D 316  1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 201 SG ? ? ? 1_555 B CYS 213 SG ? ? B CYS 239 B CYS 251 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf2 disulf ? ? D CYS 201 SG ? ? ? 1_555 D CYS 213 SG ? ? D CYS 239 D CYS 251 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 12  A . ? ALA 890 A GLY 13  A ? GLY 891 A 1 -20.97 
2 GLY 13  A . ? GLY 891 A GLU 14  A ? GLU 892 A 1 -4.35  
3 ASP 171 B . ? ASP 209 B ALA 172 B ? ALA 210 B 1 19.73  
4 ASP 220 B . ? ASP 258 B GLY 221 B ? GLY 259 B 1 -8.57  
5 ALA 172 D . ? ALA 210 D GLY 173 D ? GLY 211 D 1 6.04   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 4 ? 
H ? 2 ? 
I ? 4 ? 
J ? 2 ? 
K ? 4 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU B 46  ? VAL B 51  ? LEU B 84  VAL B 89  
A 2 THR B 57  ? LEU B 62  ? THR B 95  LEU B 100 
A 3 LYS B 22  ? ARG B 26  ? LYS B 60  ARG B 64  
A 4 SER B 86  ? LEU B 89  ? SER B 124 LEU B 127 
B 1 ARG B 79  ? LEU B 80  ? ARG B 117 LEU B 118 
B 2 ARG B 83  ? GLU B 84  ? ARG B 121 GLU B 122 
C 1 LEU B 120 ? TYR B 127 ? LEU B 158 TYR B 165 
C 2 SER B 134 ? TYR B 142 ? SER B 172 TYR B 180 
C 3 LEU B 95  ? ALA B 99  ? LEU B 133 ALA B 137 
C 4 TYR B 166 ? THR B 170 ? TYR B 204 THR B 208 
D 1 PRO B 159 ? LEU B 160 ? PRO B 197 LEU B 198 
D 2 ARG B 163 ? THR B 164 ? ARG B 201 THR B 202 
E 1 PHE B 212 ? CYS B 217 ? PHE B 250 CYS B 255 
E 2 LEU B 223 ? GLU B 230 ? LEU B 261 GLU B 268 
E 3 CYS B 184 ? ASP B 188 ? CYS B 222 ASP B 226 
E 4 ARG B 255 ? PHE B 258 ? ARG B 293 PHE B 296 
F 1 SER B 248 ? LEU B 249 ? SER B 286 LEU B 287 
F 2 SER B 252 ? HIS B 253 ? SER B 290 HIS B 291 
G 1 TYR D 48  ? ASP D 52  ? TYR D 86  ASP D 90  
G 2 THR D 57  ? THR D 61  ? THR D 95  THR D 99  
G 3 LYS D 22  ? ARG D 26  ? LYS D 60  ARG D 64  
G 4 SER D 86  ? LEU D 89  ? SER D 124 LEU D 127 
H 1 ARG D 79  ? LEU D 80  ? ARG D 117 LEU D 118 
H 2 ARG D 83  ? GLU D 84  ? ARG D 121 GLU D 122 
I 1 LEU D 120 ? TYR D 127 ? LEU D 158 TYR D 165 
I 2 SER D 134 ? TYR D 142 ? SER D 172 TYR D 180 
I 3 LEU D 95  ? ALA D 99  ? LEU D 133 ALA D 137 
I 4 TYR D 166 ? TRP D 169 ? TYR D 204 TRP D 207 
J 1 PRO D 159 ? LEU D 160 ? PRO D 197 LEU D 198 
J 2 ARG D 163 ? THR D 164 ? ARG D 201 THR D 202 
K 1 PHE D 212 ? ALA D 216 ? PHE D 250 ALA D 254 
K 2 LYS D 224 ? GLU D 230 ? LYS D 262 GLU D 268 
K 3 CYS D 184 ? ASP D 188 ? CYS D 222 ASP D 226 
K 4 ARG D 255 ? PHE D 258 ? ARG D 293 PHE D 296 
L 1 SER D 248 ? LEU D 249 ? SER D 286 LEU D 287 
L 2 SER D 252 ? HIS D 253 ? SER D 290 HIS D 291 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS B 47  ? N LYS B 85  O THR B 61  ? O THR B 99  
A 2 3 O VAL B 60  ? O VAL B 98  N ILE B 23  ? N ILE B 61  
A 3 4 N LEU B 24  ? N LEU B 62  O GLN B 88  ? O GLN B 126 
B 1 2 N LEU B 80  ? N LEU B 118 O ARG B 83  ? O ARG B 121 
C 1 2 N GLU B 121 ? N GLU B 159 O GLU B 141 ? O GLU B 179 
C 2 3 O ALA B 140 ? O ALA B 178 N LEU B 96  ? N LEU B 134 
C 3 4 N ALA B 99  ? N ALA B 137 O TYR B 166 ? O TYR B 204 
D 1 2 N LEU B 160 ? N LEU B 198 O ARG B 163 ? O ARG B 201 
E 1 2 N ALA B 216 ? N ALA B 254 O LYS B 224 ? O LYS B 262 
E 2 3 O LEU B 229 ? O LEU B 267 N LEU B 185 ? N LEU B 223 
E 3 4 N CYS B 186 ? N CYS B 224 O SER B 257 ? O SER B 295 
F 1 2 N LEU B 249 ? N LEU B 287 O SER B 252 ? O SER B 290 
G 1 2 N TYR D 48  ? N TYR D 86  O THR D 61  ? O THR D 99  
G 2 3 O VAL D 60  ? O VAL D 98  N ILE D 23  ? N ILE D 61  
G 3 4 N LEU D 24  ? N LEU D 62  O GLN D 88  ? O GLN D 126 
H 1 2 N LEU D 80  ? N LEU D 118 O ARG D 83  ? O ARG D 121 
I 1 2 N GLU D 121 ? N GLU D 159 O GLU D 141 ? O GLU D 179 
I 2 3 O ALA D 140 ? O ALA D 178 N LEU D 96  ? N LEU D 134 
I 3 4 N ALA D 99  ? N ALA D 137 O TYR D 166 ? O TYR D 204 
J 1 2 N LEU D 160 ? N LEU D 198 O ARG D 163 ? O ARG D 201 
K 1 2 N ALA D 216 ? N ALA D 254 O LYS D 224 ? O LYS D 262 
K 2 3 O ALA D 227 ? O ALA D 265 N VAL D 187 ? N VAL D 225 
K 3 4 N CYS D 186 ? N CYS D 224 O SER D 257 ? O SER D 295 
L 1 2 N LEU D 249 ? N LEU D 287 O SER D 252 ? O SER D 290 
# 
_database_PDB_matrix.entry_id          3H2U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H2U 
_atom_sites.fract_transf_matrix[1][1]   0.011527 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005376 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 4   ? 52.152  23.387 105.098 1.00 87.05  ? 882  ASP A N   1 
ATOM   2    C CA  . ASP A 1 4   ? 53.294  23.792 104.269 1.00 88.09  ? 882  ASP A CA  1 
ATOM   3    C C   . ASP A 1 4   ? 54.680  23.456 104.859 1.00 92.26  ? 882  ASP A C   1 
ATOM   4    O O   . ASP A 1 4   ? 54.928  22.342 105.342 1.00 91.54  ? 882  ASP A O   1 
ATOM   5    C CB  . ASP A 1 4   ? 53.223  25.299 103.947 1.00 90.50  ? 882  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 4   ? 53.767  25.645 102.550 1.00 102.12 ? 882  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 4   ? 54.628  24.899 102.011 1.00 103.00 ? 882  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 4   ? 53.346  26.691 102.006 1.00 104.64 ? 882  ASP A OD2 1 
ATOM   9    N N   . GLU A 1 5   ? 55.565  24.454 104.771 1.00 89.65  ? 883  GLU A N   1 
ATOM   10   C CA  . GLU A 1 5   ? 56.967  24.455 105.244 1.00 89.52  ? 883  GLU A CA  1 
ATOM   11   C C   . GLU A 1 5   ? 57.334  23.701 106.538 1.00 91.00  ? 883  GLU A C   1 
ATOM   12   O O   . GLU A 1 5   ? 56.686  23.903 107.563 1.00 90.87  ? 883  GLU A O   1 
ATOM   13   C CB  . GLU A 1 5   ? 57.412  25.922 105.434 1.00 90.99  ? 883  GLU A CB  1 
ATOM   14   C CG  . GLU A 1 5   ? 56.340  26.886 106.067 1.00 103.22 ? 883  GLU A CG  1 
ATOM   15   C CD  . GLU A 1 5   ? 55.917  26.567 107.538 1.00 112.60 ? 883  GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 5   ? 56.769  26.608 108.466 1.00 96.98  ? 883  GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 5   ? 54.691  26.403 107.775 1.00 87.41  ? 883  GLU A OE2 1 
ATOM   18   N N   . GLU A 1 6   ? 58.461  22.980 106.542 1.00 84.23  ? 884  GLU A N   1 
ATOM   19   C CA  . GLU A 1 6   ? 58.923  22.351 107.788 1.00 82.22  ? 884  GLU A CA  1 
ATOM   20   C C   . GLU A 1 6   ? 59.241  23.390 108.877 1.00 80.92  ? 884  GLU A C   1 
ATOM   21   O O   . GLU A 1 6   ? 59.434  24.580 108.607 1.00 80.18  ? 884  GLU A O   1 
ATOM   22   C CB  . GLU A 1 6   ? 60.135  21.428 107.578 1.00 83.84  ? 884  GLU A CB  1 
ATOM   23   C CG  . GLU A 1 6   ? 59.958  19.980 108.138 1.00 97.08  ? 884  GLU A CG  1 
ATOM   24   C CD  . GLU A 1 6   ? 60.188  19.828 109.661 1.00 114.36 ? 884  GLU A CD  1 
ATOM   25   O OE1 . GLU A 1 6   ? 59.432  20.434 110.454 1.00 112.83 ? 884  GLU A OE1 1 
ATOM   26   O OE2 . GLU A 1 6   ? 61.045  19.000 110.065 1.00 96.65  ? 884  GLU A OE2 1 
ATOM   27   N N   . PHE A 1 7   ? 59.286  22.907 110.113 1.00 74.43  ? 885  PHE A N   1 
ATOM   28   C CA  . PHE A 1 7   ? 59.544  23.704 111.304 1.00 72.45  ? 885  PHE A CA  1 
ATOM   29   C C   . PHE A 1 7   ? 61.024  23.633 111.601 1.00 75.22  ? 885  PHE A C   1 
ATOM   30   O O   . PHE A 1 7   ? 61.517  22.587 112.031 1.00 76.11  ? 885  PHE A O   1 
ATOM   31   C CB  . PHE A 1 7   ? 58.876  23.011 112.484 1.00 73.51  ? 885  PHE A CB  1 
ATOM   32   C CG  . PHE A 1 7   ? 57.861  23.837 113.203 1.00 74.10  ? 885  PHE A CG  1 
ATOM   33   C CD1 . PHE A 1 7   ? 56.731  24.291 112.554 1.00 76.86  ? 885  PHE A CD1 1 
ATOM   34   C CD2 . PHE A 1 7   ? 57.947  23.996 114.573 1.00 75.11  ? 885  PHE A CD2 1 
ATOM   35   C CE1 . PHE A 1 7   ? 55.735  24.945 113.249 1.00 76.96  ? 885  PHE A CE1 1 
ATOM   36   C CE2 . PHE A 1 7   ? 56.955  24.638 115.269 1.00 77.28  ? 885  PHE A CE2 1 
ATOM   37   C CZ  . PHE A 1 7   ? 55.851  25.114 114.608 1.00 75.27  ? 885  PHE A CZ  1 
ATOM   38   N N   . PRO A 1 8   ? 61.735  24.757 111.468 1.00 69.91  ? 886  PRO A N   1 
ATOM   39   C CA  . PRO A 1 8   ? 63.162  24.853 111.768 1.00 69.99  ? 886  PRO A CA  1 
ATOM   40   C C   . PRO A 1 8   ? 63.476  24.415 113.203 1.00 76.58  ? 886  PRO A C   1 
ATOM   41   O O   . PRO A 1 8   ? 62.570  24.279 114.019 1.00 76.31  ? 886  PRO A O   1 
ATOM   42   C CB  . PRO A 1 8   ? 63.438  26.336 111.579 1.00 71.28  ? 886  PRO A CB  1 
ATOM   43   C CG  . PRO A 1 8   ? 62.118  27.019 111.830 1.00 75.70  ? 886  PRO A CG  1 
ATOM   44   C CD  . PRO A 1 8   ? 61.026  25.998 111.799 1.00 71.31  ? 886  PRO A CD  1 
ATOM   45   N N   . GLU A 1 9   ? 64.751  24.164 113.498 1.00 75.59  ? 887  GLU A N   1 
ATOM   46   C CA  . GLU A 1 9   ? 65.151  23.694 114.829 1.00 76.64  ? 887  GLU A CA  1 
ATOM   47   C C   . GLU A 1 9   ? 65.514  24.814 115.805 1.00 82.20  ? 887  GLU A C   1 
ATOM   48   O O   . GLU A 1 9   ? 65.548  25.984 115.418 1.00 81.21  ? 887  GLU A O   1 
ATOM   49   C CB  . GLU A 1 9   ? 66.276  22.662 114.718 1.00 78.20  ? 887  GLU A CB  1 
ATOM   50   C CG  . GLU A 1 9   ? 66.696  22.365 113.279 1.00 92.40  ? 887  GLU A CG  1 
ATOM   51   C CD  . GLU A 1 9   ? 68.188  22.608 113.024 1.00 117.26 ? 887  GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 9   ? 68.913  21.624 112.743 1.00 94.62  ? 887  GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 9   ? 68.629  23.781 113.079 1.00 116.56 ? 887  GLU A OE2 1 
ATOM   54   N N   . GLN A 1 10  ? 65.886  24.504 116.999 1.00 81.24  ? 888  GLN A N   1 
ATOM   55   C CA  . GLN A 1 10  ? 66.241  25.527 117.971 1.00 82.52  ? 888  GLN A CA  1 
ATOM   56   C C   . GLN A 1 10  ? 67.648  26.153 118.004 1.00 89.97  ? 888  GLN A C   1 
ATOM   57   O O   . GLN A 1 10  ? 68.466  25.789 117.329 1.00 91.01  ? 888  GLN A O   1 
ATOM   58   C CB  . GLN A 1 10  ? 65.961  24.972 119.292 1.00 83.74  ? 888  GLN A CB  1 
ATOM   59   C CG  . GLN A 1 10  ? 65.114  25.847 120.009 1.00 97.35  ? 888  GLN A CG  1 
ATOM   60   C CD  . GLN A 1 10  ? 65.487  25.951 121.380 1.00 112.85 ? 888  GLN A CD  1 
ATOM   61   O OE1 . GLN A 1 10  ? 65.371  26.939 122.049 1.00 108.42 ? 888  GLN A OE1 1 
ATOM   62   N NE2 . GLN A 1 10  ? 65.976  24.913 121.822 1.00 101.61 ? 888  GLN A NE2 1 
ATOM   63   N N   . LYS A 1 11  ? 67.958  27.025 118.903 1.00 87.32  ? 889  LYS A N   1 
ATOM   64   C CA  . LYS A 1 11  ? 69.100  27.883 118.835 1.00 87.08  ? 889  LYS A CA  1 
ATOM   65   C C   . LYS A 1 11  ? 69.411  28.662 120.114 1.00 94.62  ? 889  LYS A C   1 
ATOM   66   O O   . LYS A 1 11  ? 69.307  28.090 121.126 1.00 94.73  ? 889  LYS A O   1 
ATOM   67   C CB  . LYS A 1 11  ? 68.880  28.726 117.723 1.00 87.41  ? 889  LYS A CB  1 
ATOM   68   C CG  . LYS A 1 11  ? 68.357  28.009 116.769 1.00 84.85  ? 889  LYS A CG  1 
ATOM   69   C CD  . LYS A 1 11  ? 68.627  28.706 115.636 1.00 89.25  ? 889  LYS A CD  1 
ATOM   70   C CE  . LYS A 1 11  ? 68.056  29.947 115.736 1.00 95.51  ? 889  LYS A CE  1 
ATOM   71   N NZ  . LYS A 1 11  ? 68.694  30.746 116.670 1.00 92.80  ? 889  LYS A NZ  1 
ATOM   72   N N   . ALA A 1 12  ? 69.842  29.915 120.118 1.00 92.28  ? 890  ALA A N   1 
ATOM   73   C CA  . ALA A 1 12  ? 69.988  30.672 121.404 1.00 92.30  ? 890  ALA A CA  1 
ATOM   74   C C   . ALA A 1 12  ? 68.814  30.962 122.400 1.00 96.30  ? 890  ALA A C   1 
ATOM   75   O O   . ALA A 1 12  ? 68.941  30.716 123.525 1.00 95.74  ? 890  ALA A O   1 
ATOM   76   C CB  . ALA A 1 12  ? 70.545  31.925 121.087 1.00 92.82  ? 890  ALA A CB  1 
ATOM   77   N N   . GLY A 1 13  ? 67.652  31.403 121.961 1.00 92.52  ? 891  GLY A N   1 
ATOM   78   C CA  . GLY A 1 13  ? 67.597  32.034 120.685 1.00 92.00  ? 891  GLY A CA  1 
ATOM   79   C C   . GLY A 1 13  ? 66.701  33.169 120.644 1.00 92.70  ? 891  GLY A C   1 
ATOM   80   O O   . GLY A 1 13  ? 67.055  34.213 120.166 1.00 93.36  ? 891  GLY A O   1 
ATOM   81   N N   . GLU A 1 14  ? 65.473  32.911 120.971 1.00 82.95  ? 892  GLU A N   1 
ATOM   82   C CA  . GLU A 1 14  ? 65.032  31.630 121.247 1.00 79.59  ? 892  GLU A CA  1 
ATOM   83   C C   . GLU A 1 14  ? 65.037  31.688 122.668 1.00 75.39  ? 892  GLU A C   1 
ATOM   84   O O   . GLU A 1 14  ? 65.637  31.025 123.335 1.00 74.20  ? 892  GLU A O   1 
ATOM   85   C CB  . GLU A 1 14  ? 65.842  30.587 120.562 1.00 20.00  ? 892  GLU A CB  1 
ATOM   86   C CG  . GLU A 1 14  ? 65.096  29.501 119.943 1.00 20.00  ? 892  GLU A CG  1 
ATOM   87   C CD  . GLU A 1 14  ? 65.001  29.612 118.617 1.00 20.00  ? 892  GLU A CD  1 
ATOM   88   O OE1 . GLU A 1 14  ? 64.993  28.748 117.868 1.00 20.00  ? 892  GLU A OE1 1 
ATOM   89   O OE2 . GLU A 1 14  ? 64.938  30.644 118.295 1.00 20.00  ? 892  GLU A OE2 1 
ATOM   90   N N   . VAL A 1 15  ? 64.218  32.584 123.062 1.00 66.23  ? 893  VAL A N   1 
ATOM   91   C CA  . VAL A 1 15  ? 63.521  32.457 124.203 1.00 63.24  ? 893  VAL A CA  1 
ATOM   92   C C   . VAL A 1 15  ? 62.238  32.064 123.877 1.00 58.63  ? 893  VAL A C   1 
ATOM   93   O O   . VAL A 1 15  ? 61.560  32.767 123.456 1.00 55.42  ? 893  VAL A O   1 
ATOM   94   C CB  . VAL A 1 15  ? 63.313  33.702 124.649 1.00 67.34  ? 893  VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 15  ? 63.357  33.774 125.898 1.00 67.31  ? 893  VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 15  ? 64.326  34.363 124.480 1.00 67.25  ? 893  VAL A CG2 1 
ATOM   97   N N   . ILE A 1 16  ? 61.930  30.858 124.181 1.00 51.37  ? 894  ILE A N   1 
ATOM   98   C CA  . ILE A 1 16  ? 60.729  30.276 124.009 1.00 49.39  ? 894  ILE A CA  1 
ATOM   99   C C   . ILE A 1 16  ? 60.601  29.261 124.993 1.00 53.95  ? 894  ILE A C   1 
ATOM   100  O O   . ILE A 1 16  ? 61.410  29.060 125.654 1.00 55.15  ? 894  ILE A O   1 
ATOM   101  C CB  . ILE A 1 16  ? 60.697  29.690 122.851 1.00 50.81  ? 894  ILE A CB  1 
ATOM   102  C CG1 . ILE A 1 16  ? 61.611  28.663 122.927 1.00 50.61  ? 894  ILE A CG1 1 
ATOM   103  C CG2 . ILE A 1 16  ? 61.359  30.293 122.041 1.00 50.32  ? 894  ILE A CG2 1 
ATOM   104  C CD1 . ILE A 1 16  ? 61.651  28.022 121.826 1.00 47.42  ? 894  ILE A CD1 1 
ATOM   105  N N   . ASN A 1 17  ? 59.464  28.747 125.186 1.00 48.32  ? 895  ASN A N   1 
ATOM   106  C CA  . ASN A 1 17  ? 59.225  27.666 126.131 1.00 46.58  ? 895  ASN A CA  1 
ATOM   107  C C   . ASN A 1 17  ? 59.299  26.429 125.247 1.00 52.53  ? 895  ASN A C   1 
ATOM   108  O O   . ASN A 1 17  ? 58.512  26.280 124.292 1.00 52.87  ? 895  ASN A O   1 
ATOM   109  C CB  . ASN A 1 17  ? 57.846  27.772 126.751 1.00 40.67  ? 895  ASN A CB  1 
ATOM   110  C CG  . ASN A 1 17  ? 57.484  26.538 127.547 1.00 57.62  ? 895  ASN A CG  1 
ATOM   111  O OD1 . ASN A 1 17  ? 57.481  26.572 128.780 1.00 50.22  ? 895  ASN A OD1 1 
ATOM   112  N ND2 . ASN A 1 17  ? 57.229  25.420 126.854 1.00 45.28  ? 895  ASN A ND2 1 
ATOM   113  N N   . GLN A 1 18  ? 60.277  25.572 125.521 1.00 48.41  ? 896  GLN A N   1 
ATOM   114  C CA  . GLN A 1 18  ? 60.553  24.431 124.661 1.00 46.94  ? 896  GLN A CA  1 
ATOM   115  C C   . GLN A 1 18  ? 59.483  23.362 124.568 1.00 48.94  ? 896  GLN A C   1 
ATOM   116  O O   . GLN A 1 18  ? 59.166  22.856 123.479 1.00 47.63  ? 896  GLN A O   1 
ATOM   117  C CB  . GLN A 1 18  ? 61.917  23.836 124.997 1.00 48.28  ? 896  GLN A CB  1 
ATOM   118  C CG  . GLN A 1 18  ? 63.075  24.570 124.349 1.00 60.18  ? 896  GLN A CG  1 
ATOM   119  C CD  . GLN A 1 18  ? 64.242  24.775 125.289 1.00 91.78  ? 896  GLN A CD  1 
ATOM   120  O OE1 . GLN A 1 18  ? 64.552  25.911 125.670 1.00 99.78  ? 896  GLN A OE1 1 
ATOM   121  N NE2 . GLN A 1 18  ? 64.906  23.682 125.666 1.00 71.80  ? 896  GLN A NE2 1 
ATOM   122  N N   . PRO A 1 19  ? 58.937  22.966 125.725 1.00 44.68  ? 897  PRO A N   1 
ATOM   123  C CA  . PRO A 1 19  ? 57.901  21.919 125.716 1.00 43.32  ? 897  PRO A CA  1 
ATOM   124  C C   . PRO A 1 19  ? 56.723  22.337 124.871 1.00 45.13  ? 897  PRO A C   1 
ATOM   125  O O   . PRO A 1 19  ? 56.130  21.509 124.166 1.00 46.49  ? 897  PRO A O   1 
ATOM   126  C CB  . PRO A 1 19  ? 57.514  21.790 127.202 1.00 44.41  ? 897  PRO A CB  1 
ATOM   127  C CG  . PRO A 1 19  ? 58.754  22.132 127.925 1.00 47.24  ? 897  PRO A CG  1 
ATOM   128  C CD  . PRO A 1 19  ? 59.415  23.256 127.090 1.00 43.93  ? 897  PRO A CD  1 
ATOM   129  N N   . MET A 1 20  ? 56.424  23.632 124.892 1.00 39.38  ? 898  MET A N   1 
ATOM   130  C CA  . MET A 1 20  ? 55.349  24.182 124.067 1.00 38.81  ? 898  MET A CA  1 
ATOM   131  C C   . MET A 1 20  ? 55.713  24.217 122.577 1.00 41.55  ? 898  MET A C   1 
ATOM   132  O O   . MET A 1 20  ? 54.881  23.900 121.696 1.00 41.15  ? 898  MET A O   1 
ATOM   133  C CB  . MET A 1 20  ? 55.008  25.590 124.517 1.00 41.03  ? 898  MET A CB  1 
ATOM   134  C CG  . MET A 1 20  ? 53.668  25.692 125.198 1.00 43.23  ? 898  MET A CG  1 
ATOM   135  S SD  . MET A 1 20  ? 53.551  27.246 126.052 1.00 46.00  ? 898  MET A SD  1 
ATOM   136  C CE  . MET A 1 20  ? 51.855  27.378 126.173 1.00 42.89  ? 898  MET A CE  1 
ATOM   137  N N   . MET A 1 21  ? 56.943  24.606 122.271 1.00 37.46  ? 899  MET A N   1 
ATOM   138  C CA  . MET A 1 21  ? 57.342  24.601 120.861 1.00 37.68  ? 899  MET A CA  1 
ATOM   139  C C   . MET A 1 21  ? 57.368  23.160 120.333 1.00 43.38  ? 899  MET A C   1 
ATOM   140  O O   . MET A 1 21  ? 57.044  22.887 119.194 1.00 43.79  ? 899  MET A O   1 
ATOM   141  C CB  . MET A 1 21  ? 58.671  25.306 120.654 1.00 39.21  ? 899  MET A CB  1 
ATOM   142  C CG  . MET A 1 21  ? 59.094  25.386 119.226 1.00 42.32  ? 899  MET A CG  1 
ATOM   143  S SD  . MET A 1 21  ? 58.127  26.523 118.193 1.00 47.15  ? 899  MET A SD  1 
ATOM   144  C CE  . MET A 1 21  ? 58.337  28.169 118.959 1.00 41.95  ? 899  MET A CE  1 
ATOM   145  N N   . MET A 1 22  ? 57.685  22.234 121.213 1.00 41.93  ? 900  MET A N   1 
ATOM   146  C CA  . MET A 1 22  ? 57.712  20.829 120.862 1.00 44.26  ? 900  MET A CA  1 
ATOM   147  C C   . MET A 1 22  ? 56.322  20.352 120.514 1.00 43.97  ? 900  MET A C   1 
ATOM   148  O O   . MET A 1 22  ? 56.112  19.712 119.490 1.00 43.60  ? 900  MET A O   1 
ATOM   149  C CB  . MET A 1 22  ? 58.252  20.020 122.044 1.00 49.40  ? 900  MET A CB  1 
ATOM   150  C CG  . MET A 1 22  ? 58.661  18.594 121.700 1.00 56.82  ? 900  MET A CG  1 
ATOM   151  S SD  . MET A 1 22  ? 59.969  18.586 120.411 1.00 65.09  ? 900  MET A SD  1 
ATOM   152  C CE  . MET A 1 22  ? 59.172  17.548 119.164 1.00 61.20  ? 900  MET A CE  1 
ATOM   153  N N   . ALA A 1 23  ? 55.377  20.635 121.406 1.00 38.20  ? 901  ALA A N   1 
ATOM   154  C CA  . ALA A 1 23  ? 53.974  20.287 121.214 1.00 36.07  ? 901  ALA A CA  1 
ATOM   155  C C   . ALA A 1 23  ? 53.487  20.855 119.883 1.00 43.14  ? 901  ALA A C   1 
ATOM   156  O O   . ALA A 1 23  ? 52.869  20.144 119.063 1.00 44.28  ? 901  ALA A O   1 
ATOM   157  C CB  . ALA A 1 23  ? 53.205  20.855 122.316 1.00 36.05  ? 901  ALA A CB  1 
ATOM   158  N N   . ALA A 1 24  ? 53.807  22.129 119.647 1.00 37.99  ? 902  ALA A N   1 
ATOM   159  C CA  . ALA A 1 24  ? 53.461  22.759 118.392 1.00 37.43  ? 902  ALA A CA  1 
ATOM   160  C C   . ALA A 1 24  ? 54.043  21.944 117.247 1.00 40.43  ? 902  ALA A C   1 
ATOM   161  O O   . ALA A 1 24  ? 53.341  21.589 116.302 1.00 38.16  ? 902  ALA A O   1 
ATOM   162  C CB  . ALA A 1 24  ? 54.035  24.152 118.353 1.00 38.71  ? 902  ALA A CB  1 
ATOM   163  N N   . ARG A 1 25  ? 55.343  21.660 117.332 1.00 38.72  ? 903  ARG A N   1 
ATOM   164  C CA  . ARG A 1 25  ? 56.028  20.897 116.291 1.00 38.05  ? 903  ARG A CA  1 
ATOM   165  C C   . ARG A 1 25  ? 55.395  19.511 116.026 1.00 42.50  ? 903  ARG A C   1 
ATOM   166  O O   . ARG A 1 25  ? 55.203  19.113 114.876 1.00 41.83  ? 903  ARG A O   1 
ATOM   167  C CB  . ARG A 1 25  ? 57.530  20.836 116.533 1.00 34.94  ? 903  ARG A CB  1 
ATOM   168  C CG  . ARG A 1 25  ? 58.291  19.963 115.504 1.00 53.51  ? 903  ARG A CG  1 
ATOM   169  C CD  . ARG A 1 25  ? 59.815  20.239 115.435 1.00 68.30  ? 903  ARG A CD  1 
ATOM   170  N NE  . ARG A 1 25  ? 60.274  21.109 116.520 1.00 79.68  ? 903  ARG A NE  1 
ATOM   171  C CZ  . ARG A 1 25  ? 61.153  22.096 116.376 1.00 85.28  ? 903  ARG A CZ  1 
ATOM   172  N NH1 . ARG A 1 25  ? 61.689  22.333 115.180 1.00 59.93  ? 903  ARG A NH1 1 
ATOM   173  N NH2 . ARG A 1 25  ? 61.490  22.838 117.435 1.00 67.00  ? 903  ARG A NH2 1 
ATOM   174  N N   . GLN A 1 26  ? 55.008  18.809 117.083 1.00 39.21  ? 904  GLN A N   1 
ATOM   175  C CA  . GLN A 1 26  ? 54.326  17.527 116.935 1.00 39.52  ? 904  GLN A CA  1 
ATOM   176  C C   . GLN A 1 26  ? 53.052  17.688 116.088 1.00 40.61  ? 904  GLN A C   1 
ATOM   177  O O   . GLN A 1 26  ? 52.750  16.857 115.240 1.00 38.86  ? 904  GLN A O   1 
ATOM   178  C CB  . GLN A 1 26  ? 53.914  17.013 118.313 1.00 42.45  ? 904  GLN A CB  1 
ATOM   179  C CG  . GLN A 1 26  ? 54.573  15.725 118.730 1.00 66.49  ? 904  GLN A CG  1 
ATOM   180  C CD  . GLN A 1 26  ? 55.897  15.944 119.409 1.00 77.04  ? 904  GLN A CD  1 
ATOM   181  O OE1 . GLN A 1 26  ? 55.958  16.083 120.627 1.00 66.05  ? 904  GLN A OE1 1 
ATOM   182  N NE2 . GLN A 1 26  ? 56.979  15.918 118.628 1.00 72.36  ? 904  GLN A NE2 1 
ATOM   183  N N   . LEU A 1 27  ? 52.261  18.724 116.362 1.00 36.59  ? 905  LEU A N   1 
ATOM   184  C CA  . LEU A 1 27  ? 51.040  18.896 115.595 1.00 34.71  ? 905  LEU A CA  1 
ATOM   185  C C   . LEU A 1 27  ? 51.403  19.260 114.191 1.00 39.17  ? 905  LEU A C   1 
ATOM   186  O O   . LEU A 1 27  ? 50.902  18.672 113.239 1.00 39.32  ? 905  LEU A O   1 
ATOM   187  C CB  . LEU A 1 27  ? 50.101  19.929 116.218 1.00 34.47  ? 905  LEU A CB  1 
ATOM   188  C CG  . LEU A 1 27  ? 48.750  20.183 115.499 1.00 37.37  ? 905  LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 27  ? 48.048  18.908 115.151 1.00 34.56  ? 905  LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 27  ? 47.822  21.126 116.270 1.00 38.91  ? 905  LEU A CD2 1 
ATOM   191  N N   . HIS A 1 28  ? 52.327  20.199 114.056 1.00 38.85  ? 906  HIS A N   1 
ATOM   192  C CA  . HIS A 1 28  ? 52.763  20.652 112.728 1.00 38.97  ? 906  HIS A CA  1 
ATOM   193  C C   . HIS A 1 28  ? 53.145  19.534 111.837 1.00 39.57  ? 906  HIS A C   1 
ATOM   194  O O   . HIS A 1 28  ? 52.728  19.467 110.695 1.00 39.53  ? 906  HIS A O   1 
ATOM   195  C CB  . HIS A 1 28  ? 53.955  21.564 112.804 1.00 41.23  ? 906  HIS A CB  1 
ATOM   196  C CG  . HIS A 1 28  ? 54.279  22.214 111.490 1.00 46.36  ? 906  HIS A CG  1 
ATOM   197  N ND1 . HIS A 1 28  ? 55.452  21.962 110.796 1.00 48.46  ? 906  HIS A ND1 1 
ATOM   198  C CD2 . HIS A 1 28  ? 53.575  23.101 110.736 1.00 48.08  ? 906  HIS A CD2 1 
ATOM   199  C CE1 . HIS A 1 28  ? 55.432  22.631 109.656 1.00 47.46  ? 906  HIS A CE1 1 
ATOM   200  N NE2 . HIS A 1 28  ? 54.323  23.356 109.612 1.00 47.66  ? 906  HIS A NE2 1 
ATOM   201  N N   . ASP A 1 29  ? 53.974  18.656 112.364 1.00 36.46  ? 907  ASP A N   1 
ATOM   202  C CA  . ASP A 1 29  ? 54.450  17.517 111.590 1.00 36.07  ? 907  ASP A CA  1 
ATOM   203  C C   . ASP A 1 29  ? 53.348  16.561 111.126 1.00 38.90  ? 907  ASP A C   1 
ATOM   204  O O   . ASP A 1 29  ? 53.490  15.914 110.115 1.00 40.02  ? 907  ASP A O   1 
ATOM   205  C CB  . ASP A 1 29  ? 55.534  16.750 112.345 1.00 36.81  ? 907  ASP A CB  1 
ATOM   206  C CG  . ASP A 1 29  ? 56.830  17.533 112.483 1.00 43.14  ? 907  ASP A CG  1 
ATOM   207  O OD1 . ASP A 1 29  ? 57.136  18.351 111.577 1.00 41.95  ? 907  ASP A OD1 1 
ATOM   208  O OD2 . ASP A 1 29  ? 57.547  17.299 113.490 1.00 48.97  ? 907  ASP A OD2 1 
ATOM   209  N N   . GLU A 1 30  ? 52.269  16.436 111.874 1.00 33.27  ? 908  GLU A N   1 
ATOM   210  C CA  . GLU A 1 30  ? 51.226  15.518 111.451 1.00 32.80  ? 908  GLU A CA  1 
ATOM   211  C C   . GLU A 1 30  ? 50.418  16.159 110.330 1.00 37.50  ? 908  GLU A C   1 
ATOM   212  O O   . GLU A 1 30  ? 50.288  15.610 109.221 1.00 36.73  ? 908  GLU A O   1 
ATOM   213  C CB  . GLU A 1 30  ? 50.328  15.140 112.627 1.00 33.73  ? 908  GLU A CB  1 
ATOM   214  C CG  . GLU A 1 30  ? 49.168  14.252 112.254 1.00 41.46  ? 908  GLU A CG  1 
ATOM   215  C CD  . GLU A 1 30  ? 49.572  12.858 111.836 1.00 67.02  ? 908  GLU A CD  1 
ATOM   216  O OE1 . GLU A 1 30  ? 50.639  12.374 112.276 1.00 54.84  ? 908  GLU A OE1 1 
ATOM   217  O OE2 . GLU A 1 30  ? 48.805  12.245 111.055 1.00 70.31  ? 908  GLU A OE2 1 
ATOM   218  N N   . ALA A 1 31  ? 49.921  17.353 110.617 1.00 33.84  ? 909  ALA A N   1 
ATOM   219  C CA  . ALA A 1 31  ? 49.106  18.114 109.681 1.00 33.05  ? 909  ALA A CA  1 
ATOM   220  C C   . ALA A 1 31  ? 49.863  18.397 108.390 1.00 38.21  ? 909  ALA A C   1 
ATOM   221  O O   . ALA A 1 31  ? 49.282  18.377 107.291 1.00 39.84  ? 909  ALA A O   1 
ATOM   222  C CB  . ALA A 1 31  ? 48.706  19.425 110.326 1.00 33.77  ? 909  ALA A CB  1 
ATOM   223  N N   . ARG A 1 32  ? 51.177  18.540 108.486 1.00 32.42  ? 910  ARG A N   1 
ATOM   224  C CA  . ARG A 1 32  ? 51.943  19.056 107.364 1.00 31.11  ? 910  ARG A CA  1 
ATOM   225  C C   . ARG A 1 32  ? 51.756  18.122 106.173 1.00 34.90  ? 910  ARG A C   1 
ATOM   226  O O   . ARG A 1 32  ? 51.651  18.573 105.032 1.00 37.70  ? 910  ARG A O   1 
ATOM   227  C CB  . ARG A 1 32  ? 53.424  19.164 107.726 1.00 20.00  ? 910  ARG A CB  1 
ATOM   228  C CG  . ARG A 1 32  ? 54.365  18.622 106.662 1.00 20.00  ? 910  ARG A CG  1 
ATOM   229  C CD  . ARG A 1 32  ? 55.788  19.109 106.883 1.00 20.00  ? 910  ARG A CD  1 
ATOM   230  N NE  . ARG A 1 32  ? 56.693  18.015 107.224 1.00 20.00  ? 910  ARG A NE  1 
ATOM   231  C CZ  . ARG A 1 32  ? 57.367  17.931 108.367 1.00 20.00  ? 910  ARG A CZ  1 
ATOM   232  N NH1 . ARG A 1 32  ? 57.239  18.879 109.285 1.00 20.00  ? 910  ARG A NH1 1 
ATOM   233  N NH2 . ARG A 1 32  ? 58.168  16.900 108.592 1.00 20.00  ? 910  ARG A NH2 1 
ATOM   234  N N   . LYS A 1 33  ? 51.716  16.821 106.442 1.00 32.05  ? 911  LYS A N   1 
ATOM   235  C CA  . LYS A 1 33  ? 51.795  15.821 105.388 1.00 30.56  ? 911  LYS A CA  1 
ATOM   236  C C   . LYS A 1 33  ? 50.642  15.925 104.482 1.00 35.61  ? 911  LYS A C   1 
ATOM   237  O O   . LYS A 1 33  ? 50.572  15.188 103.534 1.00 35.98  ? 911  LYS A O   1 
ATOM   238  C CB  . LYS A 1 33  ? 51.718  14.400 105.939 1.00 32.27  ? 911  LYS A CB  1 
ATOM   239  C CG  . LYS A 1 33  ? 51.973  14.165 107.411 1.00 39.97  ? 911  LYS A CG  1 
ATOM   240  C CD  . LYS A 1 33  ? 51.685  12.680 107.722 1.00 46.42  ? 911  LYS A CD  1 
ATOM   241  C CE  . LYS A 1 33  ? 52.127  12.256 109.125 1.00 64.35  ? 911  LYS A CE  1 
ATOM   242  N NZ  . LYS A 1 33  ? 51.129  11.365 109.804 1.00 76.68  ? 911  LYS A NZ  1 
ATOM   243  N N   . TRP A 1 34  ? 49.648  16.721 104.863 1.00 35.05  ? 912  TRP A N   1 
ATOM   244  C CA  . TRP A 1 34  ? 48.357  16.739 104.168 1.00 33.81  ? 912  TRP A CA  1 
ATOM   245  C C   . TRP A 1 34  ? 48.027  18.044 103.479 1.00 39.27  ? 912  TRP A C   1 
ATOM   246  O O   . TRP A 1 34  ? 48.350  19.124 103.981 1.00 41.87  ? 912  TRP A O   1 
ATOM   247  C CB  . TRP A 1 34  ? 47.217  16.456 105.189 1.00 31.28  ? 912  TRP A CB  1 
ATOM   248  C CG  . TRP A 1 34  ? 47.323  15.164 105.883 1.00 31.56  ? 912  TRP A CG  1 
ATOM   249  C CD1 . TRP A 1 34  ? 47.790  14.954 107.145 1.00 34.78  ? 912  TRP A CD1 1 
ATOM   250  C CD2 . TRP A 1 34  ? 47.126  13.869 105.308 1.00 31.36  ? 912  TRP A CD2 1 
ATOM   251  N NE1 . TRP A 1 34  ? 47.855  13.602 107.412 1.00 34.34  ? 912  TRP A NE1 1 
ATOM   252  C CE2 . TRP A 1 34  ? 47.465  12.920 106.287 1.00 34.46  ? 912  TRP A CE2 1 
ATOM   253  C CE3 . TRP A 1 34  ? 46.756  13.423 104.037 1.00 32.78  ? 912  TRP A CE3 1 
ATOM   254  C CZ2 . TRP A 1 34  ? 47.379  11.572 106.059 1.00 32.67  ? 912  TRP A CZ2 1 
ATOM   255  C CZ3 . TRP A 1 34  ? 46.640  12.095 103.823 1.00 34.13  ? 912  TRP A CZ3 1 
ATOM   256  C CH2 . TRP A 1 34  ? 46.969  11.177 104.823 1.00 34.48  ? 912  TRP A CH2 1 
ATOM   257  N N   . SER A 1 35  ? 47.229  17.940 102.423 1.00 32.46  ? 913  SER A N   1 
ATOM   258  C CA  . SER A 1 35  ? 46.665  19.092 101.753 1.00 31.22  ? 913  SER A CA  1 
ATOM   259  C C   . SER A 1 35  ? 45.471  19.653 102.564 1.00 38.36  ? 913  SER A C   1 
ATOM   260  O O   . SER A 1 35  ? 44.644  18.901 103.130 1.00 36.74  ? 913  SER A O   1 
ATOM   261  C CB  . SER A 1 35  ? 46.173  18.699 100.359 1.00 32.92  ? 913  SER A CB  1 
ATOM   262  O OG  . SER A 1 35  ? 45.467  19.781 99.748  1.00 38.92  ? 913  SER A OG  1 
ATOM   263  N N   . SER A 1 36  ? 45.329  20.980 102.550 1.00 36.58  ? 914  SER A N   1 
ATOM   264  C CA  . SER A 1 36  ? 44.240  21.620 103.268 1.00 34.01  ? 914  SER A CA  1 
ATOM   265  C C   . SER A 1 36  ? 43.072  21.684 102.313 1.00 42.23  ? 914  SER A C   1 
ATOM   266  O O   . SER A 1 36  ? 41.935  21.893 102.717 1.00 45.68  ? 914  SER A O   1 
ATOM   267  C CB  . SER A 1 36  ? 44.643  23.009 103.698 1.00 30.01  ? 914  SER A CB  1 
ATOM   268  O OG  . SER A 1 36  ? 45.882  22.981 104.372 1.00 31.86  ? 914  SER A OG  1 
ATOM   269  N N   . LYS A 1 37  ? 43.332  21.480 101.032 1.00 37.76  ? 915  LYS A N   1 
ATOM   270  C CA  . LYS A 1 37  ? 42.253  21.540 100.066 1.00 37.58  ? 915  LYS A CA  1 
ATOM   271  C C   . LYS A 1 37  ? 41.238  20.427 100.305 1.00 45.06  ? 915  LYS A C   1 
ATOM   272  O O   . LYS A 1 37  ? 41.541  19.229 100.151 1.00 46.31  ? 915  LYS A O   1 
ATOM   273  C CB  . LYS A 1 37  ? 42.810  21.412 98.661  1.00 40.55  ? 915  LYS A CB  1 
ATOM   274  C CG  . LYS A 1 37  ? 42.271  22.422 97.692  1.00 57.32  ? 915  LYS A CG  1 
ATOM   275  C CD  . LYS A 1 37  ? 41.039  21.928 96.964  1.00 60.17  ? 915  LYS A CD  1 
ATOM   276  C CE  . LYS A 1 37  ? 41.415  21.205 95.659  1.00 72.12  ? 915  LYS A CE  1 
ATOM   277  N NZ  . LYS A 1 37  ? 42.010  22.102 94.613  1.00 81.62  ? 915  LYS A NZ  1 
ATOM   278  N N   . GLY A 1 38  ? 40.029  20.810 100.700 1.00 40.41  ? 916  GLY A N   1 
ATOM   279  C CA  . GLY A 1 38  ? 38.943  19.866 100.916 1.00 37.31  ? 916  GLY A CA  1 
ATOM   280  C C   . GLY A 1 38  ? 38.984  19.302 102.302 1.00 38.10  ? 916  GLY A C   1 
ATOM   281  O O   . GLY A 1 38  ? 38.259  18.366 102.601 1.00 39.49  ? 916  GLY A O   1 
ATOM   282  N N   . ASN A 1 39  ? 39.834  19.880 103.148 1.00 32.39  ? 917  ASN A N   1 
ATOM   283  C CA  . ASN A 1 39  ? 40.013  19.400 104.520 1.00 32.90  ? 917  ASN A CA  1 
ATOM   284  C C   . ASN A 1 39  ? 40.273  20.511 105.543 1.00 36.81  ? 917  ASN A C   1 
ATOM   285  O O   . ASN A 1 39  ? 41.412  20.921 105.771 1.00 34.47  ? 917  ASN A O   1 
ATOM   286  C CB  . ASN A 1 39  ? 41.099  18.313 104.578 1.00 33.54  ? 917  ASN A CB  1 
ATOM   287  C CG  . ASN A 1 39  ? 41.163  17.615 105.914 1.00 41.17  ? 917  ASN A CG  1 
ATOM   288  O OD1 . ASN A 1 39  ? 40.756  18.159 106.932 1.00 32.46  ? 917  ASN A OD1 1 
ATOM   289  N ND2 . ASN A 1 39  ? 41.643  16.388 105.908 1.00 30.49  ? 917  ASN A ND2 1 
ATOM   290  N N   . ASP A 1 40  ? 39.193  20.959 106.190 1.00 34.08  ? 918  ASP A N   1 
ATOM   291  C CA  . ASP A 1 40  ? 39.263  22.063 107.131 1.00 31.94  ? 918  ASP A CA  1 
ATOM   292  C C   . ASP A 1 40  ? 39.837  21.706 108.465 1.00 33.63  ? 918  ASP A C   1 
ATOM   293  O O   . ASP A 1 40  ? 40.291  22.604 109.205 1.00 33.50  ? 918  ASP A O   1 
ATOM   294  C CB  . ASP A 1 40  ? 37.909  22.689 107.326 1.00 34.42  ? 918  ASP A CB  1 
ATOM   295  C CG  . ASP A 1 40  ? 37.504  23.616 106.201 1.00 39.18  ? 918  ASP A CG  1 
ATOM   296  O OD1 . ASP A 1 40  ? 38.345  24.040 105.411 1.00 42.05  ? 918  ASP A OD1 1 
ATOM   297  O OD2 . ASP A 1 40  ? 36.311  23.921 106.106 1.00 43.24  ? 918  ASP A OD2 1 
ATOM   298  N N   . ILE A 1 41  ? 39.812  20.420 108.808 1.00 27.93  ? 919  ILE A N   1 
ATOM   299  C CA  . ILE A 1 41  ? 40.463  20.001 110.047 1.00 27.67  ? 919  ILE A CA  1 
ATOM   300  C C   . ILE A 1 41  ? 41.957  20.224 109.887 1.00 32.80  ? 919  ILE A C   1 
ATOM   301  O O   . ILE A 1 41  ? 42.616  20.694 110.798 1.00 30.81  ? 919  ILE A O   1 
ATOM   302  C CB  . ILE A 1 41  ? 40.210  18.553 110.393 1.00 31.20  ? 919  ILE A CB  1 
ATOM   303  C CG1 . ILE A 1 41  ? 38.799  18.391 110.940 1.00 33.15  ? 919  ILE A CG1 1 
ATOM   304  C CG2 . ILE A 1 41  ? 41.152  18.122 111.468 1.00 29.42  ? 919  ILE A CG2 1 
ATOM   305  C CD1 . ILE A 1 41  ? 38.447  16.955 111.295 1.00 39.11  ? 919  ILE A CD1 1 
ATOM   306  N N   . ILE A 1 42  ? 42.485  19.907 108.700 1.00 31.65  ? 920  ILE A N   1 
ATOM   307  C CA  . ILE A 1 42  ? 43.917  20.071 108.407 1.00 30.40  ? 920  ILE A CA  1 
ATOM   308  C C   . ILE A 1 42  ? 44.309  21.528 108.355 1.00 34.11  ? 920  ILE A C   1 
ATOM   309  O O   . ILE A 1 42  ? 45.330  21.943 108.931 1.00 34.17  ? 920  ILE A O   1 
ATOM   310  C CB  . ILE A 1 42  ? 44.353  19.327 107.142 1.00 32.17  ? 920  ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 42  ? 44.436  17.839 107.416 1.00 30.09  ? 920  ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 42  ? 45.690  19.847 106.678 1.00 34.23  ? 920  ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 42  ? 45.284  17.485 108.624 1.00 24.34  ? 920  ILE A CD1 1 
ATOM   314  N N   . ALA A 1 43  ? 43.474  22.313 107.683 1.00 28.67  ? 921  ALA A N   1 
ATOM   315  C CA  . ALA A 1 43  ? 43.688  23.763 107.625 1.00 26.63  ? 921  ALA A CA  1 
ATOM   316  C C   . ALA A 1 43  ? 43.736  24.379 109.020 1.00 32.12  ? 921  ALA A C   1 
ATOM   317  O O   . ALA A 1 43  ? 44.632  25.168 109.324 1.00 31.96  ? 921  ALA A O   1 
ATOM   318  C CB  . ALA A 1 43  ? 42.645  24.392 106.844 1.00 26.17  ? 921  ALA A CB  1 
ATOM   319  N N   . ALA A 1 44  ? 42.768  24.010 109.862 1.00 29.30  ? 922  ALA A N   1 
ATOM   320  C CA  . ALA A 1 44  ? 42.683  24.536 111.224 1.00 28.48  ? 922  ALA A CA  1 
ATOM   321  C C   . ALA A 1 44  ? 43.794  24.061 112.122 1.00 33.06  ? 922  ALA A C   1 
ATOM   322  O O   . ALA A 1 44  ? 44.367  24.828 112.882 1.00 34.46  ? 922  ALA A O   1 
ATOM   323  C CB  . ALA A 1 44  ? 41.348  24.289 111.822 1.00 29.19  ? 922  ALA A CB  1 
ATOM   324  N N   . ALA A 1 45  ? 44.175  22.810 111.956 1.00 31.50  ? 923  ALA A N   1 
ATOM   325  C CA  . ALA A 1 45  ? 45.279  22.218 112.718 1.00 29.70  ? 923  ALA A CA  1 
ATOM   326  C C   . ALA A 1 45  ? 46.566  22.980 112.447 1.00 30.95  ? 923  ALA A C   1 
ATOM   327  O O   . ALA A 1 45  ? 47.393  23.138 113.320 1.00 31.32  ? 923  ALA A O   1 
ATOM   328  C CB  . ALA A 1 45  ? 45.452  20.773 112.289 1.00 30.21  ? 923  ALA A CB  1 
ATOM   329  N N   . LYS A 1 46  ? 46.762  23.380 111.201 1.00 26.65  ? 924  LYS A N   1 
ATOM   330  C CA  . LYS A 1 46  ? 47.988  24.058 110.793 1.00 26.41  ? 924  LYS A CA  1 
ATOM   331  C C   . LYS A 1 46  ? 48.079  25.412 111.442 1.00 31.40  ? 924  LYS A C   1 
ATOM   332  O O   . LYS A 1 46  ? 49.137  25.860 111.856 1.00 31.83  ? 924  LYS A O   1 
ATOM   333  C CB  . LYS A 1 46  ? 48.044  24.191 109.262 1.00 27.82  ? 924  LYS A CB  1 
ATOM   334  C CG  . LYS A 1 46  ? 48.166  22.857 108.521 1.00 24.94  ? 924  LYS A CG  1 
ATOM   335  C CD  . LYS A 1 46  ? 48.342  23.032 106.991 1.00 20.37  ? 924  LYS A CD  1 
ATOM   336  C CE  . LYS A 1 46  ? 48.469  21.668 106.282 1.00 27.50  ? 924  LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 46  ? 48.235  21.716 104.783 1.00 23.14  ? 924  LYS A NZ  1 
ATOM   338  N N   . ARG A 1 47  ? 46.927  26.053 111.542 1.00 30.39  ? 925  ARG A N   1 
ATOM   339  C CA  . ARG A 1 47  ? 46.795  27.353 112.188 1.00 29.38  ? 925  ARG A CA  1 
ATOM   340  C C   . ARG A 1 47  ? 47.077  27.193 113.690 1.00 33.76  ? 925  ARG A C   1 
ATOM   341  O O   . ARG A 1 47  ? 47.820  27.979 114.274 1.00 35.81  ? 925  ARG A O   1 
ATOM   342  C CB  . ARG A 1 47  ? 45.376  27.836 111.970 1.00 27.75  ? 925  ARG A CB  1 
ATOM   343  C CG  . ARG A 1 47  ? 45.125  28.711 110.723 1.00 23.43  ? 925  ARG A CG  1 
ATOM   344  C CD  . ARG A 1 47  ? 43.678  29.267 110.830 1.00 12.38  ? 925  ARG A CD  1 
ATOM   345  N NE  . ARG A 1 47  ? 42.809  28.538 109.917 1.00 20.81  ? 925  ARG A NE  1 
ATOM   346  C CZ  . ARG A 1 47  ? 41.672  27.961 110.266 1.00 35.29  ? 925  ARG A CZ  1 
ATOM   347  N NH1 . ARG A 1 47  ? 41.262  28.031 111.520 1.00 13.98  ? 925  ARG A NH1 1 
ATOM   348  N NH2 . ARG A 1 47  ? 40.969  27.282 109.364 1.00 42.25  ? 925  ARG A NH2 1 
ATOM   349  N N   . MET A 1 48  ? 46.525  26.154 114.314 1.00 27.45  ? 926  MET A N   1 
ATOM   350  C CA  . MET A 1 48  ? 46.775  25.912 115.733 1.00 25.65  ? 926  MET A CA  1 
ATOM   351  C C   . MET A 1 48  ? 48.206  25.717 116.080 1.00 29.65  ? 926  MET A C   1 
ATOM   352  O O   . MET A 1 48  ? 48.670  26.257 117.057 1.00 32.82  ? 926  MET A O   1 
ATOM   353  C CB  . MET A 1 48  ? 45.976  24.734 116.236 1.00 27.87  ? 926  MET A CB  1 
ATOM   354  C CG  . MET A 1 48  ? 44.492  25.009 116.227 1.00 31.99  ? 926  MET A CG  1 
ATOM   355  S SD  . MET A 1 48  ? 43.554  23.589 116.771 1.00 37.16  ? 926  MET A SD  1 
ATOM   356  C CE  . MET A 1 48  ? 44.033  23.533 118.565 1.00 33.63  ? 926  MET A CE  1 
ATOM   357  N N   . ALA A 1 49  ? 48.916  24.927 115.293 1.00 25.21  ? 927  ALA A N   1 
ATOM   358  C CA  . ALA A 1 49  ? 50.326  24.654 115.525 1.00 23.90  ? 927  ALA A CA  1 
ATOM   359  C C   . ALA A 1 49  ? 51.128  25.951 115.395 1.00 32.10  ? 927  ALA A C   1 
ATOM   360  O O   . ALA A 1 49  ? 51.921  26.291 116.265 1.00 33.99  ? 927  ALA A O   1 
ATOM   361  C CB  . ALA A 1 49  ? 50.792  23.653 114.508 1.00 24.88  ? 927  ALA A CB  1 
ATOM   362  N N   . LEU A 1 50  ? 50.921  26.702 114.314 1.00 29.83  ? 928  LEU A N   1 
ATOM   363  C CA  . LEU A 1 50  ? 51.619  27.987 114.156 1.00 29.20  ? 928  LEU A CA  1 
ATOM   364  C C   . LEU A 1 50  ? 51.292  28.924 115.305 1.00 32.96  ? 928  LEU A C   1 
ATOM   365  O O   . LEU A 1 50  ? 52.168  29.659 115.785 1.00 34.30  ? 928  LEU A O   1 
ATOM   366  C CB  . LEU A 1 50  ? 51.245  28.667 112.841 1.00 29.45  ? 928  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 50  ? 52.050  28.382 111.544 1.00 32.74  ? 928  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 50  ? 53.241  27.482 111.800 1.00 32.00  ? 928  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 50  ? 51.147  27.825 110.440 1.00 31.90  ? 928  LEU A CD2 1 
ATOM   370  N N   . LEU A 1 51  ? 50.038  28.900 115.770 1.00 28.28  ? 929  LEU A N   1 
ATOM   371  C CA  . LEU A 1 51  ? 49.640  29.770 116.908 1.00 27.40  ? 929  LEU A CA  1 
ATOM   372  C C   . LEU A 1 51  ? 50.290  29.303 118.217 1.00 33.48  ? 929  LEU A C   1 
ATOM   373  O O   . LEU A 1 51  ? 50.679  30.141 119.038 1.00 34.88  ? 929  LEU A O   1 
ATOM   374  C CB  . LEU A 1 51  ? 48.113  29.848 117.069 1.00 25.91  ? 929  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 51  ? 47.279  30.781 116.189 1.00 26.78  ? 929  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 51  ? 45.765  30.326 116.138 1.00 24.42  ? 929  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 51  ? 47.473  32.231 116.663 1.00 21.89  ? 929  LEU A CD2 1 
ATOM   378  N N   . MET A 1 52  ? 50.410  27.976 118.385 1.00 28.02  ? 930  MET A N   1 
ATOM   379  C CA  . MET A 1 52  ? 51.054  27.385 119.561 1.00 28.77  ? 930  MET A CA  1 
ATOM   380  C C   . MET A 1 52  ? 52.533  27.749 119.591 1.00 36.70  ? 930  MET A C   1 
ATOM   381  O O   . MET A 1 52  ? 53.121  27.944 120.658 1.00 40.45  ? 930  MET A O   1 
ATOM   382  C CB  . MET A 1 52  ? 50.892  25.852 119.578 1.00 30.73  ? 930  MET A CB  1 
ATOM   383  C CG  . MET A 1 52  ? 51.229  25.167 120.923 1.00 32.79  ? 930  MET A CG  1 
ATOM   384  S SD  . MET A 1 52  ? 50.824  26.149 122.371 1.00 35.81  ? 930  MET A SD  1 
ATOM   385  C CE  . MET A 1 52  ? 49.102  25.478 122.862 1.00 31.02  ? 930  MET A CE  1 
ATOM   386  N N   . ALA A 1 53  ? 53.114  27.884 118.407 1.00 31.95  ? 931  ALA A N   1 
ATOM   387  C CA  . ALA A 1 53  ? 54.503  28.305 118.252 1.00 30.49  ? 931  ALA A CA  1 
ATOM   388  C C   . ALA A 1 53  ? 54.601  29.723 118.753 1.00 32.59  ? 931  ALA A C   1 
ATOM   389  O O   . ALA A 1 53  ? 55.485  30.057 119.522 1.00 35.95  ? 931  ALA A O   1 
ATOM   390  C CB  . ALA A 1 53  ? 54.939  28.240 116.741 1.00 30.85  ? 931  ALA A CB  1 
ATOM   391  N N   . GLU A 1 54  ? 53.691  30.575 118.321 1.00 25.41  ? 932  GLU A N   1 
ATOM   392  C CA  . GLU A 1 54  ? 53.739  31.977 118.786 1.00 22.67  ? 932  GLU A CA  1 
ATOM   393  C C   . GLU A 1 54  ? 53.565  31.964 120.279 1.00 30.58  ? 932  GLU A C   1 
ATOM   394  O O   . GLU A 1 54  ? 54.231  32.719 120.971 1.00 31.39  ? 932  GLU A O   1 
ATOM   395  C CB  . GLU A 1 54  ? 52.633  32.841 118.135 1.00 22.19  ? 932  GLU A CB  1 
ATOM   396  C CG  . GLU A 1 54  ? 52.357  34.109 118.834 1.00 14.41  ? 932  GLU A CG  1 
ATOM   397  C CD  . GLU A 1 54  ? 51.114  34.852 118.361 1.00 38.84  ? 932  GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 54  ? 51.060  36.092 118.585 1.00 28.76  ? 932  GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 54  ? 50.171  34.215 117.836 1.00 23.71  ? 932  GLU A OE2 1 
ATOM   400  N N   . MET A 1 55  ? 52.690  31.089 120.794 1.00 30.25  ? 933  MET A N   1 
ATOM   401  C CA  . MET A 1 55  ? 52.462  31.054 122.237 1.00 31.18  ? 933  MET A CA  1 
ATOM   402  C C   . MET A 1 55  ? 53.712  30.732 122.977 1.00 37.69  ? 933  MET A C   1 
ATOM   403  O O   . MET A 1 55  ? 53.968  31.300 124.037 1.00 38.29  ? 933  MET A O   1 
ATOM   404  C CB  . MET A 1 55  ? 51.354  30.091 122.662 1.00 33.40  ? 933  MET A CB  1 
ATOM   405  C CG  . MET A 1 55  ? 50.672  30.506 123.994 1.00 35.40  ? 933  MET A CG  1 
ATOM   406  S SD  . MET A 1 55  ? 49.410  29.325 124.610 1.00 39.14  ? 933  MET A SD  1 
ATOM   407  C CE  . MET A 1 55  ? 47.970  30.280 124.394 1.00 35.24  ? 933  MET A CE  1 
ATOM   408  N N   . SER A 1 56  ? 54.503  29.826 122.414 1.00 36.05  ? 934  SER A N   1 
ATOM   409  C CA  . SER A 1 56  ? 55.754  29.433 123.062 1.00 36.25  ? 934  SER A CA  1 
ATOM   410  C C   . SER A 1 56  ? 56.770  30.577 123.224 1.00 41.94  ? 934  SER A C   1 
ATOM   411  O O   . SER A 1 56  ? 57.709  30.494 124.030 1.00 43.17  ? 934  SER A O   1 
ATOM   412  C CB  . SER A 1 56  ? 56.343  28.198 122.409 1.00 37.58  ? 934  SER A CB  1 
ATOM   413  O OG  . SER A 1 56  ? 57.455  28.543 121.646 1.00 45.44  ? 934  SER A OG  1 
ATOM   414  N N   . ARG A 1 57  ? 56.546  31.669 122.492 1.00 36.19  ? 935  ARG A N   1 
ATOM   415  C CA  . ARG A 1 57  ? 57.367  32.870 122.604 1.00 34.44  ? 935  ARG A CA  1 
ATOM   416  C C   . ARG A 1 57  ? 56.728  33.821 123.632 1.00 39.36  ? 935  ARG A C   1 
ATOM   417  O O   . ARG A 1 57  ? 57.408  34.418 124.473 1.00 39.60  ? 935  ARG A O   1 
ATOM   418  C CB  . ARG A 1 57  ? 57.281  33.628 121.288 1.00 34.25  ? 935  ARG A CB  1 
ATOM   419  C CG  . ARG A 1 57  ? 58.304  33.266 120.199 1.00 37.41  ? 935  ARG A CG  1 
ATOM   420  C CD  . ARG A 1 57  ? 57.837  33.823 118.840 1.00 30.66  ? 935  ARG A CD  1 
ATOM   421  N NE  . ARG A 1 57  ? 57.994  32.767 117.868 1.00 51.60  ? 935  ARG A NE  1 
ATOM   422  C CZ  . ARG A 1 57  ? 57.130  32.460 116.914 1.00 63.55  ? 935  ARG A CZ  1 
ATOM   423  N NH1 . ARG A 1 57  ? 56.011  33.172 116.749 1.00 41.03  ? 935  ARG A NH1 1 
ATOM   424  N NH2 . ARG A 1 57  ? 57.430  31.448 116.104 1.00 48.74  ? 935  ARG A NH2 1 
ATOM   425  N N   . LEU A 1 58  ? 55.434  34.084 123.426 1.00 33.94  ? 936  LEU A N   1 
ATOM   426  C CA  . LEU A 1 58  ? 54.687  35.055 124.207 1.00 30.90  ? 936  LEU A CA  1 
ATOM   427  C C   . LEU A 1 58  ? 54.817  34.753 125.673 1.00 38.22  ? 936  LEU A C   1 
ATOM   428  O O   . LEU A 1 58  ? 54.945  35.642 126.526 1.00 40.12  ? 936  LEU A O   1 
ATOM   429  C CB  . LEU A 1 58  ? 53.211  35.058 123.771 1.00 28.97  ? 936  LEU A CB  1 
ATOM   430  C CG  . LEU A 1 58  ? 53.040  35.584 122.339 1.00 29.11  ? 936  LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 58  ? 51.580  35.524 121.828 1.00 27.47  ? 936  LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 58  ? 53.598  37.043 122.273 1.00 21.65  ? 936  LEU A CD2 1 
ATOM   433  N N   . VAL A 1 59  ? 54.746  33.478 125.972 1.00 36.07  ? 937  VAL A N   1 
ATOM   434  C CA  . VAL A 1 59  ? 54.761  33.031 127.349 1.00 36.62  ? 937  VAL A CA  1 
ATOM   435  C C   . VAL A 1 59  ? 56.086  33.317 128.032 1.00 47.79  ? 937  VAL A C   1 
ATOM   436  O O   . VAL A 1 59  ? 56.223  33.151 129.224 1.00 49.95  ? 937  VAL A O   1 
ATOM   437  C CB  . VAL A 1 59  ? 54.440  31.562 127.374 1.00 38.45  ? 937  VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 59  ? 55.704  30.722 127.519 1.00 37.10  ? 937  VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 59  ? 53.425  31.308 128.410 1.00 38.64  ? 937  VAL A CG2 1 
ATOM   440  N N   . ARG A 1 60  ? 57.086  33.705 127.262 1.00 47.74  ? 938  ARG A N   1 
ATOM   441  C CA  . ARG A 1 60  ? 58.385  33.990 127.837 1.00 48.59  ? 938  ARG A CA  1 
ATOM   442  C C   . ARG A 1 60  ? 58.449  35.465 128.252 1.00 59.08  ? 938  ARG A C   1 
ATOM   443  O O   . ARG A 1 60  ? 59.516  35.969 128.607 1.00 61.19  ? 938  ARG A O   1 
ATOM   444  C CB  . ARG A 1 60  ? 59.515  33.616 126.867 1.00 43.34  ? 938  ARG A CB  1 
ATOM   445  C CG  . ARG A 1 60  ? 59.896  32.157 126.956 1.00 50.16  ? 938  ARG A CG  1 
ATOM   446  C CD  . ARG A 1 60  ? 60.383  31.799 128.368 1.00 54.73  ? 938  ARG A CD  1 
ATOM   447  N NE  . ARG A 1 60  ? 61.774  32.182 128.599 1.00 58.27  ? 938  ARG A NE  1 
ATOM   448  C CZ  . ARG A 1 60  ? 62.817  31.561 128.051 1.00 78.80  ? 938  ARG A CZ  1 
ATOM   449  N NH1 . ARG A 1 60  ? 62.620  30.492 127.281 1.00 72.94  ? 938  ARG A NH1 1 
ATOM   450  N NH2 . ARG A 1 60  ? 64.057  32.004 128.266 1.00 64.54  ? 938  ARG A NH2 1 
ATOM   451  N N   . GLY A 1 61  ? 57.297  36.130 128.270 1.00 57.22  ? 939  GLY A N   1 
ATOM   452  C CA  . GLY A 1 61  ? 57.190  37.522 128.696 1.00 57.88  ? 939  GLY A CA  1 
ATOM   453  C C   . GLY A 1 61  ? 57.647  38.446 127.603 1.00 64.06  ? 939  GLY A C   1 
ATOM   454  O O   . GLY A 1 61  ? 58.054  37.965 126.561 1.00 64.86  ? 939  GLY A O   1 
ATOM   455  N N   . GLY A 1 62  ? 57.588  39.757 127.820 1.00 61.95  ? 940  GLY A N   1 
ATOM   456  C CA  . GLY A 1 62  ? 58.036  40.711 126.811 1.00 62.23  ? 940  GLY A CA  1 
ATOM   457  C C   . GLY A 1 62  ? 57.095  41.888 126.553 1.00 70.06  ? 940  GLY A C   1 
ATOM   458  O O   . GLY A 1 62  ? 56.011  41.997 127.166 1.00 71.92  ? 940  GLY A O   1 
ATOM   459  N N   . SER A 1 63  ? 57.491  42.774 125.633 1.00 65.66  ? 941  SER A N   1 
ATOM   460  C CA  . SER A 1 63  ? 56.640  43.903 125.293 1.00 64.67  ? 941  SER A CA  1 
ATOM   461  C C   . SER A 1 63  ? 55.373  43.495 124.539 1.00 68.07  ? 941  SER A C   1 
ATOM   462  O O   . SER A 1 63  ? 55.421  42.825 123.487 1.00 65.87  ? 941  SER A O   1 
ATOM   463  C CB  . SER A 1 63  ? 57.385  45.019 124.561 1.00 67.19  ? 941  SER A CB  1 
ATOM   464  O OG  . SER A 1 63  ? 56.543  46.168 124.453 1.00 72.60  ? 941  SER A OG  1 
ATOM   465  N N   . GLY A 1 64  ? 54.248  43.915 125.122 1.00 64.53  ? 942  GLY A N   1 
ATOM   466  C CA  . GLY A 1 64  ? 52.894  43.698 124.649 1.00 62.62  ? 942  GLY A CA  1 
ATOM   467  C C   . GLY A 1 64  ? 52.435  42.262 124.734 1.00 61.25  ? 942  GLY A C   1 
ATOM   468  O O   . GLY A 1 64  ? 51.413  41.935 124.127 1.00 60.73  ? 942  GLY A O   1 
ATOM   469  N N   . THR A 1 65  ? 53.176  41.404 125.451 1.00 53.44  ? 943  THR A N   1 
ATOM   470  C CA  . THR A 1 65  ? 52.810  39.977 125.495 1.00 51.52  ? 943  THR A CA  1 
ATOM   471  C C   . THR A 1 65  ? 51.496  39.618 126.212 1.00 52.16  ? 943  THR A C   1 
ATOM   472  O O   . THR A 1 65  ? 50.822  38.626 125.845 1.00 51.27  ? 943  THR A O   1 
ATOM   473  C CB  . THR A 1 65  ? 53.959  39.046 125.894 1.00 57.67  ? 943  THR A CB  1 
ATOM   474  O OG1 . THR A 1 65  ? 54.341  39.348 127.232 1.00 63.49  ? 943  THR A OG1 1 
ATOM   475  C CG2 . THR A 1 65  ? 55.166  39.172 124.939 1.00 52.52  ? 943  THR A CG2 1 
ATOM   476  N N   . LYS A 1 66  ? 51.094  40.445 127.181 1.00 44.28  ? 944  LYS A N   1 
ATOM   477  C CA  . LYS A 1 66  ? 49.860  40.175 127.898 1.00 41.92  ? 944  LYS A CA  1 
ATOM   478  C C   . LYS A 1 66  ? 48.622  40.189 126.977 1.00 41.95  ? 944  LYS A C   1 
ATOM   479  O O   . LYS A 1 66  ? 47.915  39.190 126.836 1.00 41.98  ? 944  LYS A O   1 
ATOM   480  C CB  . LYS A 1 66  ? 49.717  41.124 129.094 1.00 44.92  ? 944  LYS A CB  1 
ATOM   481  C CG  . LYS A 1 66  ? 48.308  41.708 129.286 1.00 51.43  ? 944  LYS A CG  1 
ATOM   482  C CD  . LYS A 1 66  ? 48.128  42.317 130.670 1.00 51.44  ? 944  LYS A CD  1 
ATOM   483  C CE  . LYS A 1 66  ? 46.666  42.197 131.154 1.00 62.19  ? 944  LYS A CE  1 
ATOM   484  N NZ  . LYS A 1 66  ? 46.541  41.753 132.590 1.00 67.85  ? 944  LYS A NZ  1 
ATOM   485  N N   . ARG A 1 67  ? 48.358  41.310 126.333 1.00 35.60  ? 945  ARG A N   1 
ATOM   486  C CA  . ARG A 1 67  ? 47.211  41.373 125.423 1.00 35.47  ? 945  ARG A CA  1 
ATOM   487  C C   . ARG A 1 67  ? 47.334  40.265 124.365 1.00 39.98  ? 945  ARG A C   1 
ATOM   488  O O   . ARG A 1 67  ? 46.377  39.552 124.013 1.00 40.16  ? 945  ARG A O   1 
ATOM   489  C CB  . ARG A 1 67  ? 47.235  42.722 124.703 1.00 34.09  ? 945  ARG A CB  1 
ATOM   490  C CG  . ARG A 1 67  ? 46.805  43.911 125.566 1.00 26.98  ? 945  ARG A CG  1 
ATOM   491  C CD  . ARG A 1 67  ? 45.794  44.741 124.780 1.00 31.02  ? 945  ARG A CD  1 
ATOM   492  N NE  . ARG A 1 67  ? 46.382  45.950 124.191 1.00 41.03  ? 945  ARG A NE  1 
ATOM   493  C CZ  . ARG A 1 67  ? 45.917  46.551 123.108 1.00 64.59  ? 945  ARG A CZ  1 
ATOM   494  N NH1 . ARG A 1 67  ? 44.882  46.049 122.461 1.00 50.10  ? 945  ARG A NH1 1 
ATOM   495  N NH2 . ARG A 1 67  ? 46.498  47.649 122.660 1.00 72.77  ? 945  ARG A NH2 1 
ATOM   496  N N   . ALA A 1 68  ? 48.548  40.153 123.851 1.00 36.45  ? 946  ALA A N   1 
ATOM   497  C CA  . ALA A 1 68  ? 48.863  39.191 122.803 1.00 35.85  ? 946  ALA A CA  1 
ATOM   498  C C   . ALA A 1 68  ? 48.573  37.755 123.194 1.00 37.35  ? 946  ALA A C   1 
ATOM   499  O O   . ALA A 1 68  ? 47.986  36.991 122.400 1.00 37.82  ? 946  ALA A O   1 
ATOM   500  C CB  . ALA A 1 68  ? 50.345  39.330 122.350 1.00 35.63  ? 946  ALA A CB  1 
ATOM   501  N N   . LEU A 1 69  ? 49.055  37.383 124.373 1.00 30.37  ? 947  LEU A N   1 
ATOM   502  C CA  . LEU A 1 69  ? 48.941  35.999 124.808 1.00 30.49  ? 947  LEU A CA  1 
ATOM   503  C C   . LEU A 1 69  ? 47.505  35.615 125.078 1.00 33.76  ? 947  LEU A C   1 
ATOM   504  O O   . LEU A 1 69  ? 47.087  34.488 124.821 1.00 36.94  ? 947  LEU A O   1 
ATOM   505  C CB  . LEU A 1 69  ? 49.862  35.695 125.997 1.00 30.54  ? 947  LEU A CB  1 
ATOM   506  C CG  . LEU A 1 69  ? 49.612  34.403 126.766 1.00 33.60  ? 947  LEU A CG  1 
ATOM   507  C CD1 . LEU A 1 69  ? 49.851  33.211 125.894 1.00 31.54  ? 947  LEU A CD1 1 
ATOM   508  C CD2 . LEU A 1 69  ? 50.428  34.338 128.092 1.00 35.39  ? 947  LEU A CD2 1 
ATOM   509  N N   . ILE A 1 70  ? 46.723  36.578 125.516 1.00 28.45  ? 948  ILE A N   1 
ATOM   510  C CA  . ILE A 1 70  ? 45.315  36.344 125.755 1.00 27.24  ? 948  ILE A CA  1 
ATOM   511  C C   . ILE A 1 70  ? 44.613  36.116 124.424 1.00 34.07  ? 948  ILE A C   1 
ATOM   512  O O   . ILE A 1 70  ? 43.798  35.194 124.296 1.00 38.56  ? 948  ILE A O   1 
ATOM   513  C CB  . ILE A 1 70  ? 44.665  37.512 126.544 1.00 29.02  ? 948  ILE A CB  1 
ATOM   514  C CG1 . ILE A 1 70  ? 45.102  37.459 128.025 1.00 29.56  ? 948  ILE A CG1 1 
ATOM   515  C CG2 . ILE A 1 70  ? 43.159  37.470 126.357 1.00 24.58  ? 948  ILE A CG2 1 
ATOM   516  C CD1 . ILE A 1 70  ? 45.283  38.867 128.754 1.00 20.90  ? 948  ILE A CD1 1 
ATOM   517  N N   . GLN A 1 71  ? 44.884  36.965 123.438 1.00 29.26  ? 949  GLN A N   1 
ATOM   518  C CA  . GLN A 1 71  ? 44.257  36.796 122.111 1.00 28.24  ? 949  GLN A CA  1 
ATOM   519  C C   . GLN A 1 71  ? 44.705  35.466 121.483 1.00 34.99  ? 949  GLN A C   1 
ATOM   520  O O   . GLN A 1 71  ? 43.922  34.766 120.870 1.00 36.42  ? 949  GLN A O   1 
ATOM   521  C CB  . GLN A 1 71  ? 44.688  37.944 121.212 1.00 28.35  ? 949  GLN A CB  1 
ATOM   522  C CG  . GLN A 1 71  ? 43.838  38.105 119.956 1.00 27.66  ? 949  GLN A CG  1 
ATOM   523  C CD  . GLN A 1 71  ? 42.346  38.045 120.224 1.00 37.37  ? 949  GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 71  ? 41.676  37.197 119.689 1.00 30.31  ? 949  GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 71  ? 41.814  38.995 120.989 1.00 37.69  ? 949  GLN A NE2 1 
ATOM   526  N N   . CYS A 1 72  ? 45.988  35.145 121.603 1.00 32.19  ? 950  CYS A N   1 
ATOM   527  C CA  . CYS A 1 72  ? 46.522  33.911 121.048 1.00 33.04  ? 950  CYS A CA  1 
ATOM   528  C C   . CYS A 1 72  ? 45.693  32.704 121.497 1.00 35.77  ? 950  CYS A C   1 
ATOM   529  O O   . CYS A 1 72  ? 45.260  31.870 120.670 1.00 34.64  ? 950  CYS A O   1 
ATOM   530  C CB  . CYS A 1 72  ? 47.985  33.741 121.452 1.00 34.58  ? 950  CYS A CB  1 
ATOM   531  S SG  . CYS A 1 72  ? 48.791  32.316 120.621 1.00 39.92  ? 950  CYS A SG  1 
ATOM   532  N N   . ALA A 1 73  ? 45.441  32.640 122.794 1.00 31.18  ? 951  ALA A N   1 
ATOM   533  C CA  . ALA A 1 73  ? 44.661  31.560 123.356 1.00 29.49  ? 951  ALA A CA  1 
ATOM   534  C C   . ALA A 1 73  ? 43.270  31.590 122.746 1.00 36.77  ? 951  ALA A C   1 
ATOM   535  O O   . ALA A 1 73  ? 42.672  30.541 122.505 1.00 39.59  ? 951  ALA A O   1 
ATOM   536  C CB  . ALA A 1 73  ? 44.584  31.691 124.868 1.00 29.81  ? 951  ALA A CB  1 
ATOM   537  N N   . LYS A 1 74  ? 42.742  32.788 122.509 1.00 30.95  ? 952  LYS A N   1 
ATOM   538  C CA  . LYS A 1 74  ? 41.386  32.886 121.971 1.00 29.41  ? 952  LYS A CA  1 
ATOM   539  C C   . LYS A 1 74  ? 41.344  32.344 120.560 1.00 34.20  ? 952  LYS A C   1 
ATOM   540  O O   . LYS A 1 74  ? 40.451  31.542 120.209 1.00 34.86  ? 952  LYS A O   1 
ATOM   541  C CB  . LYS A 1 74  ? 40.839  34.308 122.064 1.00 31.13  ? 952  LYS A CB  1 
ATOM   542  C CG  . LYS A 1 74  ? 40.372  34.694 123.483 1.00 26.46  ? 952  LYS A CG  1 
ATOM   543  C CD  . LYS A 1 74  ? 39.673  36.061 123.522 1.00 26.27  ? 952  LYS A CD  1 
ATOM   544  C CE  . LYS A 1 74  ? 39.874  36.815 124.854 1.00 30.73  ? 952  LYS A CE  1 
ATOM   545  N NZ  . LYS A 1 74  ? 40.322  38.220 124.560 1.00 53.71  ? 952  LYS A NZ  1 
ATOM   546  N N   . ASP A 1 75  ? 42.368  32.714 119.777 1.00 31.00  ? 953  ASP A N   1 
ATOM   547  C CA  . ASP A 1 75  ? 42.530  32.264 118.373 1.00 28.27  ? 953  ASP A CA  1 
ATOM   548  C C   . ASP A 1 75  ? 42.627  30.753 118.318 1.00 33.98  ? 953  ASP A C   1 
ATOM   549  O O   . ASP A 1 75  ? 41.903  30.089 117.545 1.00 35.14  ? 953  ASP A O   1 
ATOM   550  C CB  . ASP A 1 75  ? 43.772  32.865 117.745 1.00 27.56  ? 953  ASP A CB  1 
ATOM   551  C CG  . ASP A 1 75  ? 43.686  34.388 117.581 1.00 32.20  ? 953  ASP A CG  1 
ATOM   552  O OD1 . ASP A 1 75  ? 42.586  34.981 117.497 1.00 33.69  ? 953  ASP A OD1 1 
ATOM   553  O OD2 . ASP A 1 75  ? 44.758  35.017 117.527 1.00 36.41  ? 953  ASP A OD2 1 
ATOM   554  N N   . ILE A 1 76  ? 43.482  30.196 119.176 1.00 28.10  ? 954  ILE A N   1 
ATOM   555  C CA  . ILE A 1 76  ? 43.587  28.738 119.228 1.00 26.66  ? 954  ILE A CA  1 
ATOM   556  C C   . ILE A 1 76  ? 42.265  28.076 119.601 1.00 29.73  ? 954  ILE A C   1 
ATOM   557  O O   . ILE A 1 76  ? 41.836  27.106 118.985 1.00 30.94  ? 954  ILE A O   1 
ATOM   558  C CB  . ILE A 1 76  ? 44.629  28.295 120.199 1.00 28.75  ? 954  ILE A CB  1 
ATOM   559  C CG1 . ILE A 1 76  ? 46.029  28.775 119.772 1.00 26.97  ? 954  ILE A CG1 1 
ATOM   560  C CG2 . ILE A 1 76  ? 44.464  26.814 120.428 1.00 28.25  ? 954  ILE A CG2 1 
ATOM   561  C CD1 . ILE A 1 76  ? 47.011  28.639 120.843 1.00 25.70  ? 954  ILE A CD1 1 
ATOM   562  N N   . ALA A 1 77  ? 41.608  28.623 120.612 1.00 25.91  ? 955  ALA A N   1 
ATOM   563  C CA  . ALA A 1 77  ? 40.297  28.125 121.061 1.00 24.36  ? 955  ALA A CA  1 
ATOM   564  C C   . ALA A 1 77  ? 39.307  28.126 119.893 1.00 30.37  ? 955  ALA A C   1 
ATOM   565  O O   . ALA A 1 77  ? 38.585  27.151 119.648 1.00 31.77  ? 955  ALA A O   1 
ATOM   566  C CB  . ALA A 1 77  ? 39.788  29.016 122.187 1.00 24.21  ? 955  ALA A CB  1 
ATOM   567  N N   . LYS A 1 78  ? 39.259  29.220 119.151 1.00 27.02  ? 956  LYS A N   1 
ATOM   568  C CA  . LYS A 1 78  ? 38.317  29.253 118.040 1.00 26.62  ? 956  LYS A CA  1 
ATOM   569  C C   . LYS A 1 78  ? 38.631  28.167 117.029 1.00 31.90  ? 956  LYS A C   1 
ATOM   570  O O   . LYS A 1 78  ? 37.751  27.513 116.528 1.00 31.50  ? 956  LYS A O   1 
ATOM   571  C CB  . LYS A 1 78  ? 38.341  30.614 117.360 1.00 26.75  ? 956  LYS A CB  1 
ATOM   572  C CG  . LYS A 1 78  ? 37.203  30.827 116.355 1.00 38.26  ? 956  LYS A CG  1 
ATOM   573  C CD  . LYS A 1 78  ? 37.313  32.192 115.641 1.00 40.95  ? 956  LYS A CD  1 
ATOM   574  C CE  . LYS A 1 78  ? 36.498  32.254 114.365 1.00 49.80  ? 956  LYS A CE  1 
ATOM   575  N NZ  . LYS A 1 78  ? 36.832  33.481 113.572 1.00 70.38  ? 956  LYS A NZ  1 
ATOM   576  N N   . ALA A 1 79  ? 39.908  27.971 116.742 1.00 30.71  ? 957  ALA A N   1 
ATOM   577  C CA  . ALA A 1 79  ? 40.303  26.981 115.748 1.00 30.80  ? 957  ALA A CA  1 
ATOM   578  C C   . ALA A 1 79  ? 39.981  25.563 116.198 1.00 33.97  ? 957  ALA A C   1 
ATOM   579  O O   . ALA A 1 79  ? 39.562  24.760 115.404 1.00 33.50  ? 957  ALA A O   1 
ATOM   580  C CB  . ALA A 1 79  ? 41.788  27.138 115.412 1.00 31.61  ? 957  ALA A CB  1 
ATOM   581  N N   . SER A 1 80  ? 40.170  25.264 117.478 1.00 31.07  ? 958  SER A N   1 
ATOM   582  C CA  . SER A 1 80  ? 39.822  23.933 117.981 1.00 32.03  ? 958  SER A CA  1 
ATOM   583  C C   . SER A 1 80  ? 38.341  23.598 117.848 1.00 37.41  ? 958  SER A C   1 
ATOM   584  O O   . SER A 1 80  ? 38.005  22.435 117.695 1.00 37.91  ? 958  SER A O   1 
ATOM   585  C CB  . SER A 1 80  ? 40.253  23.746 119.435 1.00 33.70  ? 958  SER A CB  1 
ATOM   586  O OG  . SER A 1 80  ? 39.223  24.175 120.289 1.00 44.67  ? 958  SER A OG  1 
ATOM   587  N N   . ASP A 1 81  ? 37.467  24.610 117.946 1.00 34.19  ? 959  ASP A N   1 
ATOM   588  C CA  . ASP A 1 81  ? 36.009  24.447 117.827 1.00 33.10  ? 959  ASP A CA  1 
ATOM   589  C C   . ASP A 1 81  ? 35.693  23.873 116.451 1.00 38.32  ? 959  ASP A C   1 
ATOM   590  O O   . ASP A 1 81  ? 34.937  22.887 116.318 1.00 40.66  ? 959  ASP A O   1 
ATOM   591  C CB  . ASP A 1 81  ? 35.291  25.799 118.008 1.00 35.55  ? 959  ASP A CB  1 
ATOM   592  C CG  . ASP A 1 81  ? 35.201  26.252 119.493 1.00 53.36  ? 959  ASP A CG  1 
ATOM   593  O OD1 . ASP A 1 81  ? 35.123  25.398 120.412 1.00 50.93  ? 959  ASP A OD1 1 
ATOM   594  O OD2 . ASP A 1 81  ? 35.206  27.488 119.736 1.00 64.88  ? 959  ASP A OD2 1 
ATOM   595  N N   . GLU A 1 82  ? 36.270  24.485 115.424 1.00 32.21  ? 960  GLU A N   1 
ATOM   596  C CA  . GLU A 1 82  ? 36.145  23.993 114.053 1.00 32.42  ? 960  GLU A CA  1 
ATOM   597  C C   . GLU A 1 82  ? 36.599  22.502 113.982 1.00 37.46  ? 960  GLU A C   1 
ATOM   598  O O   . GLU A 1 82  ? 35.900  21.632 113.408 1.00 39.45  ? 960  GLU A O   1 
ATOM   599  C CB  . GLU A 1 82  ? 37.018  24.880 113.124 1.00 33.46  ? 960  GLU A CB  1 
ATOM   600  C CG  . GLU A 1 82  ? 36.515  25.093 111.704 1.00 36.95  ? 960  GLU A CG  1 
ATOM   601  C CD  . GLU A 1 82  ? 37.550  25.778 110.811 1.00 59.17  ? 960  GLU A CD  1 
ATOM   602  O OE1 . GLU A 1 82  ? 37.553  25.487 109.588 1.00 47.70  ? 960  GLU A OE1 1 
ATOM   603  O OE2 . GLU A 1 82  ? 38.361  26.600 111.325 1.00 44.15  ? 960  GLU A OE2 1 
ATOM   604  N N   . VAL A 1 83  ? 37.769  22.206 114.552 1.00 30.30  ? 961  VAL A N   1 
ATOM   605  C CA  . VAL A 1 83  ? 38.287  20.827 114.547 1.00 29.57  ? 961  VAL A CA  1 
ATOM   606  C C   . VAL A 1 83  ? 37.309  19.843 115.194 1.00 37.24  ? 961  VAL A C   1 
ATOM   607  O O   . VAL A 1 83  ? 37.041  18.783 114.654 1.00 37.81  ? 961  VAL A O   1 
ATOM   608  C CB  . VAL A 1 83  ? 39.695  20.726 115.209 1.00 30.43  ? 961  VAL A CB  1 
ATOM   609  C CG1 . VAL A 1 83  ? 40.024  19.298 115.544 1.00 28.25  ? 961  VAL A CG1 1 
ATOM   610  C CG2 . VAL A 1 83  ? 40.754  21.367 114.339 1.00 29.19  ? 961  VAL A CG2 1 
ATOM   611  N N   . THR A 1 84  ? 36.771  20.209 116.357 1.00 35.58  ? 962  THR A N   1 
ATOM   612  C CA  . THR A 1 84  ? 35.771  19.402 117.057 1.00 34.20  ? 962  THR A CA  1 
ATOM   613  C C   . THR A 1 84  ? 34.501  19.274 116.233 1.00 35.32  ? 962  THR A C   1 
ATOM   614  O O   . THR A 1 84  ? 33.981  18.187 116.034 1.00 30.99  ? 962  THR A O   1 
ATOM   615  C CB  . THR A 1 84  ? 35.453  20.034 118.411 1.00 43.17  ? 962  THR A CB  1 
ATOM   616  O OG1 . THR A 1 84  ? 36.673  20.326 119.092 1.00 42.55  ? 962  THR A OG1 1 
ATOM   617  C CG2 . THR A 1 84  ? 34.642  19.085 119.272 1.00 42.81  ? 962  THR A CG2 1 
ATOM   618  N N   . ARG A 1 85  ? 34.000  20.417 115.775 1.00 34.98  ? 963  ARG A N   1 
ATOM   619  C CA  . ARG A 1 85  ? 32.755  20.477 115.015 1.00 35.65  ? 963  ARG A CA  1 
ATOM   620  C C   . ARG A 1 85  ? 32.853  19.571 113.805 1.00 41.39  ? 963  ARG A C   1 
ATOM   621  O O   . ARG A 1 85  ? 32.041  18.659 113.632 1.00 40.72  ? 963  ARG A O   1 
ATOM   622  C CB  . ARG A 1 85  ? 32.420  21.943 114.669 1.00 36.20  ? 963  ARG A CB  1 
ATOM   623  C CG  . ARG A 1 85  ? 31.454  22.183 113.503 1.00 40.20  ? 963  ARG A CG  1 
ATOM   624  C CD  . ARG A 1 85  ? 31.355  23.671 113.185 1.00 47.76  ? 963  ARG A CD  1 
ATOM   625  N NE  . ARG A 1 85  ? 32.327  24.155 112.191 1.00 70.37  ? 963  ARG A NE  1 
ATOM   626  C CZ  . ARG A 1 85  ? 32.276  23.863 110.889 1.00 79.66  ? 963  ARG A CZ  1 
ATOM   627  N NH1 . ARG A 1 85  ? 31.326  23.049 110.422 1.00 66.43  ? 963  ARG A NH1 1 
ATOM   628  N NH2 . ARG A 1 85  ? 33.181  24.366 110.053 1.00 48.89  ? 963  ARG A NH2 1 
ATOM   629  N N   . LEU A 1 86  ? 33.910  19.780 113.018 1.00 39.27  ? 964  LEU A N   1 
ATOM   630  C CA  . LEU A 1 86  ? 34.185  18.982 111.809 1.00 38.21  ? 964  LEU A CA  1 
ATOM   631  C C   . LEU A 1 86  ? 34.467  17.509 112.139 1.00 41.10  ? 964  LEU A C   1 
ATOM   632  O O   . LEU A 1 86  ? 34.111  16.602 111.395 1.00 40.80  ? 964  LEU A O   1 
ATOM   633  C CB  . LEU A 1 86  ? 35.411  19.562 111.113 1.00 37.72  ? 964  LEU A CB  1 
ATOM   634  C CG  . LEU A 1 86  ? 35.301  20.903 110.395 1.00 40.21  ? 964  LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 86  ? 36.635  21.315 109.782 1.00 38.24  ? 964  LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 86  ? 34.244  20.773 109.315 1.00 39.76  ? 964  LEU A CD2 1 
ATOM   637  N N   . ALA A 1 87  ? 35.174  17.273 113.233 1.00 37.55  ? 965  ALA A N   1 
ATOM   638  C CA  . ALA A 1 87  ? 35.478  15.913 113.642 1.00 36.97  ? 965  ALA A CA  1 
ATOM   639  C C   . ALA A 1 87  ? 34.216  15.116 114.078 1.00 43.30  ? 965  ALA A C   1 
ATOM   640  O O   . ALA A 1 87  ? 34.157  13.917 113.887 1.00 44.02  ? 965  ALA A O   1 
ATOM   641  C CB  . ALA A 1 87  ? 36.591  15.902 114.699 1.00 37.07  ? 965  ALA A CB  1 
ATOM   642  N N   . LYS A 1 88  ? 33.171  15.781 114.575 1.00 40.09  ? 966  LYS A N   1 
ATOM   643  C CA  . LYS A 1 88  ? 31.921  15.077 114.924 1.00 38.98  ? 966  LYS A CA  1 
ATOM   644  C C   . LYS A 1 88  ? 31.087  14.772 113.677 1.00 44.32  ? 966  LYS A C   1 
ATOM   645  O O   . LYS A 1 88  ? 30.381  13.789 113.616 1.00 45.92  ? 966  LYS A O   1 
ATOM   646  C CB  . LYS A 1 88  ? 31.098  15.889 115.916 1.00 40.62  ? 966  LYS A CB  1 
ATOM   647  C CG  . LYS A 1 88  ? 31.741  16.017 117.292 1.00 53.04  ? 966  LYS A CG  1 
ATOM   648  C CD  . LYS A 1 88  ? 30.996  16.984 118.204 1.00 55.75  ? 966  LYS A CD  1 
ATOM   649  C CE  . LYS A 1 88  ? 31.603  16.983 119.611 1.00 68.86  ? 966  LYS A CE  1 
ATOM   650  N NZ  . LYS A 1 88  ? 30.779  17.703 120.638 1.00 75.86  ? 966  LYS A NZ  1 
ATOM   651  N N   . GLU A 1 89  ? 31.176  15.605 112.657 1.00 39.96  ? 967  GLU A N   1 
ATOM   652  C CA  . GLU A 1 89  ? 30.448  15.320 111.444 1.00 39.92  ? 967  GLU A CA  1 
ATOM   653  C C   . GLU A 1 89  ? 30.990  14.031 110.832 1.00 44.22  ? 967  GLU A C   1 
ATOM   654  O O   . GLU A 1 89  ? 30.247  13.231 110.287 1.00 45.13  ? 967  GLU A O   1 
ATOM   655  C CB  . GLU A 1 89  ? 30.628  16.469 110.454 1.00 41.82  ? 967  GLU A CB  1 
ATOM   656  C CG  . GLU A 1 89  ? 29.891  17.736 110.808 1.00 54.33  ? 967  GLU A CG  1 
ATOM   657  C CD  . GLU A 1 89  ? 28.438  17.477 111.168 1.00 82.53  ? 967  GLU A CD  1 
ATOM   658  O OE1 . GLU A 1 89  ? 27.892  16.415 110.762 1.00 77.20  ? 967  GLU A OE1 1 
ATOM   659  O OE2 . GLU A 1 89  ? 27.864  18.321 111.897 1.00 78.56  ? 967  GLU A OE2 1 
ATOM   660  N N   . VAL A 1 90  ? 32.305  13.854 110.911 1.00 40.10  ? 968  VAL A N   1 
ATOM   661  C CA  . VAL A 1 90  ? 32.985  12.673 110.375 1.00 38.34  ? 968  VAL A CA  1 
ATOM   662  C C   . VAL A 1 90  ? 32.530  11.447 111.166 1.00 42.62  ? 968  VAL A C   1 
ATOM   663  O O   . VAL A 1 90  ? 32.105  10.436 110.591 1.00 41.11  ? 968  VAL A O   1 
ATOM   664  C CB  . VAL A 1 90  ? 34.552  12.878 110.378 1.00 39.17  ? 968  VAL A CB  1 
ATOM   665  C CG1 . VAL A 1 90  ? 35.300  11.598 110.160 1.00 36.49  ? 968  VAL A CG1 1 
ATOM   666  C CG2 . VAL A 1 90  ? 34.974  13.972 109.387 1.00 38.49  ? 968  VAL A CG2 1 
ATOM   667  N N   . ALA A 1 91  ? 32.596  11.540 112.493 1.00 39.91  ? 969  ALA A N   1 
ATOM   668  C CA  . ALA A 1 91  ? 32.160  10.429 113.361 1.00 39.38  ? 969  ALA A CA  1 
ATOM   669  C C   . ALA A 1 91  ? 30.729  9.990  113.030 1.00 44.31  ? 969  ALA A C   1 
ATOM   670  O O   . ALA A 1 91  ? 30.405  8.798  113.043 1.00 43.07  ? 969  ALA A O   1 
ATOM   671  C CB  . ALA A 1 91  ? 32.279  10.810 114.827 1.00 39.39  ? 969  ALA A CB  1 
ATOM   672  N N   . LYS A 1 92  ? 29.885  10.971 112.736 1.00 42.34  ? 970  LYS A N   1 
ATOM   673  C CA  . LYS A 1 92  ? 28.482  10.763 112.395 1.00 44.25  ? 970  LYS A CA  1 
ATOM   674  C C   . LYS A 1 92  ? 28.303  9.910  111.149 1.00 49.76  ? 970  LYS A C   1 
ATOM   675  O O   . LYS A 1 92  ? 27.324  9.197  111.019 1.00 50.78  ? 970  LYS A O   1 
ATOM   676  C CB  . LYS A 1 92  ? 27.862  12.139 112.121 1.00 49.95  ? 970  LYS A CB  1 
ATOM   677  C CG  . LYS A 1 92  ? 26.371  12.299 112.318 1.00 70.22  ? 970  LYS A CG  1 
ATOM   678  C CD  . LYS A 1 92  ? 26.172  13.501 113.236 1.00 89.78  ? 970  LYS A CD  1 
ATOM   679  C CE  . LYS A 1 92  ? 24.958  14.346 112.907 1.00 111.18 ? 970  LYS A CE  1 
ATOM   680  N NZ  . LYS A 1 92  ? 23.894  14.238 113.961 1.00 122.16 ? 970  LYS A NZ  1 
ATOM   681  N N   . GLN A 1 93  ? 29.229  10.038 110.205 1.00 46.06  ? 971  GLN A N   1 
ATOM   682  C CA  . GLN A 1 93  ? 29.158  9.353  108.918 1.00 44.16  ? 971  GLN A CA  1 
ATOM   683  C C   . GLN A 1 93  ? 29.957  8.043  108.842 1.00 44.27  ? 971  GLN A C   1 
ATOM   684  O O   . GLN A 1 93  ? 29.943  7.330  107.833 1.00 41.63  ? 971  GLN A O   1 
ATOM   685  C CB  . GLN A 1 93  ? 29.612  10.332 107.822 1.00 45.14  ? 971  GLN A CB  1 
ATOM   686  C CG  . GLN A 1 93  ? 28.920  11.690 107.888 1.00 54.91  ? 971  GLN A CG  1 
ATOM   687  C CD  . GLN A 1 93  ? 27.623  11.720 107.102 1.00 71.52  ? 971  GLN A CD  1 
ATOM   688  O OE1 . GLN A 1 93  ? 27.405  10.912 106.211 1.00 59.31  ? 971  GLN A OE1 1 
ATOM   689  N NE2 . GLN A 1 93  ? 26.747  12.643 107.449 1.00 72.56  ? 971  GLN A NE2 1 
ATOM   690  N N   . CYS A 1 94  ? 30.660  7.732  109.918 1.00 41.38  ? 972  CYS A N   1 
ATOM   691  C CA  . CYS A 1 94  ? 31.543  6.568  109.979 1.00 40.98  ? 972  CYS A CA  1 
ATOM   692  C C   . CYS A 1 94  ? 30.843  5.304  110.489 1.00 45.22  ? 972  CYS A C   1 
ATOM   693  O O   . CYS A 1 94  ? 30.176  5.345  111.502 1.00 43.05  ? 972  CYS A O   1 
ATOM   694  C CB  . CYS A 1 94  ? 32.753  6.929  110.843 1.00 40.94  ? 972  CYS A CB  1 
ATOM   695  S SG  . CYS A 1 94  ? 33.961  5.651  111.167 1.00 44.02  ? 972  CYS A SG  1 
ATOM   696  N N   . THR A 1 95  ? 31.027  4.188  109.768 1.00 44.26  ? 973  THR A N   1 
ATOM   697  C CA  . THR A 1 95  ? 30.431  2.867  110.040 1.00 43.59  ? 973  THR A CA  1 
ATOM   698  C C   . THR A 1 95  ? 31.238  1.906  110.961 1.00 51.52  ? 973  THR A C   1 
ATOM   699  O O   . THR A 1 95  ? 30.816  0.792  111.211 1.00 54.18  ? 973  THR A O   1 
ATOM   700  C CB  . THR A 1 95  ? 30.098  2.135  108.699 1.00 49.13  ? 973  THR A CB  1 
ATOM   701  O OG1 . THR A 1 95  ? 31.302  1.922  107.944 1.00 50.69  ? 973  THR A OG1 1 
ATOM   702  C CG2 . THR A 1 95  ? 29.109  2.932  107.820 1.00 44.79  ? 973  THR A CG2 1 
ATOM   703  N N   . ASP A 1 96  ? 32.412  2.306  111.429 1.00 47.76  ? 974  ASP A N   1 
ATOM   704  C CA  . ASP A 1 96  ? 33.275  1.474  112.274 1.00 46.75  ? 974  ASP A CA  1 
ATOM   705  C C   . ASP A 1 96  ? 33.188  1.934  113.733 1.00 53.94  ? 974  ASP A C   1 
ATOM   706  O O   . ASP A 1 96  ? 33.519  3.074  114.067 1.00 54.78  ? 974  ASP A O   1 
ATOM   707  C CB  . ASP A 1 96  ? 34.706  1.565  111.765 1.00 48.08  ? 974  ASP A CB  1 
ATOM   708  C CG  . ASP A 1 96  ? 35.644  0.621  112.480 1.00 58.79  ? 974  ASP A CG  1 
ATOM   709  O OD1 . ASP A 1 96  ? 36.139  1.004  113.580 1.00 58.54  ? 974  ASP A OD1 1 
ATOM   710  O OD2 . ASP A 1 96  ? 35.919  -0.474 111.914 1.00 59.77  ? 974  ASP A OD2 1 
ATOM   711  N N   . LYS A 1 97  ? 32.650  1.075  114.590 1.00 51.29  ? 975  LYS A N   1 
ATOM   712  C CA  . LYS A 1 97  ? 32.402  1.447  115.971 1.00 51.50  ? 975  LYS A CA  1 
ATOM   713  C C   . LYS A 1 97  ? 33.665  1.829  116.705 1.00 53.34  ? 975  LYS A C   1 
ATOM   714  O O   . LYS A 1 97  ? 33.694  2.748  117.506 1.00 52.57  ? 975  LYS A O   1 
ATOM   715  C CB  . LYS A 1 97  ? 31.702  0.309  116.716 1.00 56.51  ? 975  LYS A CB  1 
ATOM   716  C CG  . LYS A 1 97  ? 30.374  0.708  117.396 1.00 83.60  ? 975  LYS A CG  1 
ATOM   717  C CD  . LYS A 1 97  ? 30.526  1.091  118.885 1.00 91.92  ? 975  LYS A CD  1 
ATOM   718  C CE  . LYS A 1 97  ? 29.159  1.149  119.622 1.00 99.01  ? 975  LYS A CE  1 
ATOM   719  N NZ  . LYS A 1 97  ? 28.371  2.431  119.488 1.00 97.71  ? 975  LYS A NZ  1 
ATOM   720  N N   . ARG A 1 98  ? 34.700  1.052  116.483 1.00 49.19  ? 976  ARG A N   1 
ATOM   721  C CA  . ARG A 1 98  ? 35.972  1.300  117.120 1.00 48.39  ? 976  ARG A CA  1 
ATOM   722  C C   . ARG A 1 98  ? 36.447  2.708  116.773 1.00 53.05  ? 976  ARG A C   1 
ATOM   723  O O   . ARG A 1 98  ? 36.680  3.505  117.684 1.00 52.02  ? 976  ARG A O   1 
ATOM   724  C CB  . ARG A 1 98  ? 36.990  0.261  116.670 1.00 46.37  ? 976  ARG A CB  1 
ATOM   725  C CG  . ARG A 1 98  ? 38.307  0.309  117.409 1.00 53.38  ? 976  ARG A CG  1 
ATOM   726  C CD  . ARG A 1 98  ? 39.442  -0.341 116.597 1.00 64.80  ? 976  ARG A CD  1 
ATOM   727  N NE  . ARG A 1 98  ? 40.338  0.666  116.031 1.00 74.80  ? 976  ARG A NE  1 
ATOM   728  C CZ  . ARG A 1 98  ? 40.584  0.798  114.735 1.00 90.49  ? 976  ARG A CZ  1 
ATOM   729  N NH1 . ARG A 1 98  ? 40.029  -0.039 113.858 1.00 66.73  ? 976  ARG A NH1 1 
ATOM   730  N NH2 . ARG A 1 98  ? 41.388  1.770  114.317 1.00 86.54  ? 976  ARG A NH2 1 
ATOM   731  N N   . ILE A 1 99  ? 36.549  3.021  115.463 1.00 47.62  ? 977  ILE A N   1 
ATOM   732  C CA  . ILE A 1 99  ? 37.013  4.348  115.014 1.00 44.78  ? 977  ILE A CA  1 
ATOM   733  C C   . ILE A 1 99  ? 36.097  5.500  115.383 1.00 45.39  ? 977  ILE A C   1 
ATOM   734  O O   . ILE A 1 99  ? 36.538  6.537  115.821 1.00 42.72  ? 977  ILE A O   1 
ATOM   735  C CB  . ILE A 1 99  ? 37.354  4.393  113.516 1.00 46.28  ? 977  ILE A CB  1 
ATOM   736  C CG1 . ILE A 1 99  ? 38.528  3.458  113.197 1.00 46.26  ? 977  ILE A CG1 1 
ATOM   737  C CG2 . ILE A 1 99  ? 37.730  5.790  113.137 1.00 43.05  ? 977  ILE A CG2 1 
ATOM   738  C CD1 . ILE A 1 99  ? 38.600  2.988  111.732 1.00 43.93  ? 977  ILE A CD1 1 
ATOM   739  N N   . ARG A 1 100 ? 34.806  5.301  115.181 1.00 43.61  ? 978  ARG A N   1 
ATOM   740  C CA  . ARG A 1 100 ? 33.796  6.303  115.484 1.00 43.16  ? 978  ARG A CA  1 
ATOM   741  C C   . ARG A 1 100 ? 33.849  6.663  116.957 1.00 50.00  ? 978  ARG A C   1 
ATOM   742  O O   . ARG A 1 100 ? 33.666  7.811  117.357 1.00 50.56  ? 978  ARG A O   1 
ATOM   743  C CB  . ARG A 1 100 ? 32.418  5.740  115.134 1.00 40.65  ? 978  ARG A CB  1 
ATOM   744  C CG  . ARG A 1 100 ? 31.323  6.800  115.138 1.00 46.85  ? 978  ARG A CG  1 
ATOM   745  C CD  . ARG A 1 100 ? 30.008  6.214  114.683 1.00 52.67  ? 978  ARG A CD  1 
ATOM   746  N NE  . ARG A 1 100 ? 29.535  5.158  115.574 1.00 54.97  ? 978  ARG A NE  1 
ATOM   747  C CZ  . ARG A 1 100 ? 29.441  3.877  115.241 1.00 73.16  ? 978  ARG A CZ  1 
ATOM   748  N NH1 . ARG A 1 100 ? 29.822  3.461  114.040 1.00 66.31  ? 978  ARG A NH1 1 
ATOM   749  N NH2 . ARG A 1 100 ? 28.982  3.001  116.115 1.00 53.82  ? 978  ARG A NH2 1 
ATOM   750  N N   . THR A 1 101 ? 34.127  5.650  117.763 1.00 47.63  ? 979  THR A N   1 
ATOM   751  C CA  . THR A 1 101 ? 34.229  5.784  119.206 1.00 47.06  ? 979  THR A CA  1 
ATOM   752  C C   . THR A 1 101 ? 35.521  6.502  119.615 1.00 47.75  ? 979  THR A C   1 
ATOM   753  O O   . THR A 1 101 ? 35.459  7.499  120.322 1.00 46.40  ? 979  THR A O   1 
ATOM   754  C CB  . THR A 1 101 ? 34.003  4.407  119.888 1.00 55.96  ? 979  THR A CB  1 
ATOM   755  O OG1 . THR A 1 101 ? 32.616  4.056  119.778 1.00 55.97  ? 979  THR A OG1 1 
ATOM   756  C CG2 . THR A 1 101 ? 34.394  4.450  121.329 1.00 49.35  ? 979  THR A CG2 1 
ATOM   757  N N   . ASN A 1 102 ? 36.679  6.035  119.141 1.00 43.56  ? 980  ASN A N   1 
ATOM   758  C CA  . ASN A 1 102 ? 37.929  6.740  119.417 1.00 43.03  ? 980  ASN A CA  1 
ATOM   759  C C   . ASN A 1 102 ? 37.753  8.190  118.919 1.00 47.21  ? 980  ASN A C   1 
ATOM   760  O O   . ASN A 1 102 ? 38.131  9.154  119.594 1.00 45.94  ? 980  ASN A O   1 
ATOM   761  C CB  . ASN A 1 102 ? 39.108  6.143  118.661 1.00 41.42  ? 980  ASN A CB  1 
ATOM   762  C CG  . ASN A 1 102 ? 39.238  4.665  118.838 1.00 76.80  ? 980  ASN A CG  1 
ATOM   763  O OD1 . ASN A 1 102 ? 39.866  3.982  118.012 1.00 81.65  ? 980  ASN A OD1 1 
ATOM   764  N ND2 . ASN A 1 102 ? 38.671  4.145  119.915 1.00 68.73  ? 980  ASN A ND2 1 
ATOM   765  N N   . LEU A 1 103 ? 37.171  8.356  117.738 1.00 42.80  ? 981  LEU A N   1 
ATOM   766  C CA  . LEU A 1 103 ? 37.002  9.701  117.226 1.00 43.04  ? 981  LEU A CA  1 
ATOM   767  C C   . LEU A 1 103 ? 36.182  10.595 118.131 1.00 52.96  ? 981  LEU A C   1 
ATOM   768  O O   . LEU A 1 103 ? 36.592  11.712 118.441 1.00 54.76  ? 981  LEU A O   1 
ATOM   769  C CB  . LEU A 1 103 ? 36.502  9.715  115.787 1.00 42.06  ? 981  LEU A CB  1 
ATOM   770  C CG  . LEU A 1 103 ? 36.650  11.000 114.982 1.00 44.42  ? 981  LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 103 ? 38.087  11.528 114.925 1.00 42.91  ? 981  LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 103 ? 36.111  10.689 113.600 1.00 45.76  ? 981  LEU A CD2 1 
ATOM   773  N N   . LEU A 1 104 ? 35.022  10.115 118.575 1.00 50.36  ? 982  LEU A N   1 
ATOM   774  C CA  . LEU A 1 104 ? 34.189  10.929 119.450 1.00 48.62  ? 982  LEU A CA  1 
ATOM   775  C C   . LEU A 1 104 ? 34.894  11.176 120.758 1.00 54.95  ? 982  LEU A C   1 
ATOM   776  O O   . LEU A 1 104 ? 34.951  12.287 121.223 1.00 54.81  ? 982  LEU A O   1 
ATOM   777  C CB  . LEU A 1 104 ? 32.839  10.277 119.683 1.00 47.49  ? 982  LEU A CB  1 
ATOM   778  C CG  . LEU A 1 104 ? 31.946  10.492 118.476 1.00 50.42  ? 982  LEU A CG  1 
ATOM   779  C CD1 . LEU A 1 104 ? 30.699  9.677  118.554 1.00 49.22  ? 982  LEU A CD1 1 
ATOM   780  C CD2 . LEU A 1 104 ? 31.603  11.938 118.366 1.00 52.18  ? 982  LEU A CD2 1 
ATOM   781  N N   . GLN A 1 105 ? 35.444  10.134 121.358 1.00 54.93  ? 983  GLN A N   1 
ATOM   782  C CA  . GLN A 1 105 ? 36.146  10.303 122.619 1.00 56.19  ? 983  GLN A CA  1 
ATOM   783  C C   . GLN A 1 105 ? 37.192  11.397 122.484 1.00 62.89  ? 983  GLN A C   1 
ATOM   784  O O   . GLN A 1 105 ? 37.028  12.478 123.040 1.00 61.97  ? 983  GLN A O   1 
ATOM   785  C CB  . GLN A 1 105 ? 36.843  9.011  123.038 1.00 57.68  ? 983  GLN A CB  1 
ATOM   786  C CG  . GLN A 1 105 ? 35.930  7.944  123.557 1.00 83.07  ? 983  GLN A CG  1 
ATOM   787  C CD  . GLN A 1 105 ? 36.678  6.654  123.805 1.00 108.79 ? 983  GLN A CD  1 
ATOM   788  O OE1 . GLN A 1 105 ? 36.077  5.605  124.050 1.00 101.94 ? 983  GLN A OE1 1 
ATOM   789  N NE2 . GLN A 1 105 ? 38.006  6.716  123.699 1.00 104.12 ? 983  GLN A NE2 1 
ATOM   790  N N   . VAL A 1 106 ? 38.262  11.083 121.748 1.00 61.77  ? 984  VAL A N   1 
ATOM   791  C CA  . VAL A 1 106 ? 39.427  11.959 121.549 1.00 62.78  ? 984  VAL A CA  1 
ATOM   792  C C   . VAL A 1 106 ? 39.133  13.384 121.159 1.00 64.25  ? 984  VAL A C   1 
ATOM   793  O O   . VAL A 1 106 ? 40.062  14.111 120.853 1.00 64.56  ? 984  VAL A O   1 
ATOM   794  C CB  . VAL A 1 106 ? 40.461  11.374 120.498 1.00 68.57  ? 984  VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 106 ? 40.676  9.839  120.671 1.00 68.64  ? 984  VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 106 ? 40.053  11.743 119.041 1.00 68.26  ? 984  VAL A CG2 1 
ATOM   797  N N   . CYS A 1 107 ? 37.860  13.753 121.097 1.00 59.00  ? 985  CYS A N   1 
ATOM   798  C CA  . CYS A 1 107 ? 37.463  15.072 120.629 1.00 57.84  ? 985  CYS A CA  1 
ATOM   799  C C   . CYS A 1 107 ? 36.316  15.704 121.398 1.00 63.48  ? 985  CYS A C   1 
ATOM   800  O O   . CYS A 1 107 ? 35.961  16.842 121.196 1.00 64.08  ? 985  CYS A O   1 
ATOM   801  C CB  . CYS A 1 107 ? 37.225  15.049 119.094 1.00 57.24  ? 985  CYS A CB  1 
ATOM   802  S SG  . CYS A 1 107 ? 35.514  14.969 118.423 1.00 60.15  ? 985  CYS A SG  1 
ATOM   803  N N   . GLU A 1 108 ? 35.750  14.977 122.332 1.00 62.85  ? 986  GLU A N   1 
ATOM   804  C CA  . GLU A 1 108 ? 34.709  15.559 123.155 1.00 63.05  ? 986  GLU A CA  1 
ATOM   805  C C   . GLU A 1 108 ? 35.397  16.260 124.323 1.00 63.55  ? 986  GLU A C   1 
ATOM   806  O O   . GLU A 1 108 ? 34.758  16.981 125.076 1.00 64.04  ? 986  GLU A O   1 
ATOM   807  C CB  . GLU A 1 108 ? 33.717  14.485 123.627 1.00 65.25  ? 986  GLU A CB  1 
ATOM   808  C CG  . GLU A 1 108 ? 32.270  14.710 123.100 1.00 82.73  ? 986  GLU A CG  1 
ATOM   809  C CD  . GLU A 1 108 ? 31.763  13.629 122.129 1.00 99.70  ? 986  GLU A CD  1 
ATOM   810  O OE1 . GLU A 1 108 ? 32.445  12.589 121.996 1.00 104.69 ? 986  GLU A OE1 1 
ATOM   811  O OE2 . GLU A 1 108 ? 30.666  13.806 121.530 1.00 78.90  ? 986  GLU A OE2 1 
ATOM   812  N N   . ARG A 1 109 ? 36.718  16.085 124.428 1.00 56.75  ? 987  ARG A N   1 
ATOM   813  C CA  . ARG A 1 109 ? 37.524  16.741 125.467 1.00 54.64  ? 987  ARG A CA  1 
ATOM   814  C C   . ARG A 1 109 ? 38.179  18.037 125.003 1.00 54.01  ? 987  ARG A C   1 
ATOM   815  O O   . ARG A 1 109 ? 38.557  18.896 125.801 1.00 53.74  ? 987  ARG A O   1 
ATOM   816  C CB  . ARG A 1 109 ? 38.596  15.822 126.064 1.00 53.21  ? 987  ARG A CB  1 
ATOM   817  C CG  . ARG A 1 109 ? 38.984  14.615 125.245 1.00 64.39  ? 987  ARG A CG  1 
ATOM   818  C CD  . ARG A 1 109 ? 39.462  13.491 126.162 1.00 71.07  ? 987  ARG A CD  1 
ATOM   819  N NE  . ARG A 1 109 ? 39.530  12.203 125.480 1.00 85.31  ? 987  ARG A NE  1 
ATOM   820  C CZ  . ARG A 1 109 ? 40.534  11.831 124.690 1.00 104.44 ? 987  ARG A CZ  1 
ATOM   821  N NH1 . ARG A 1 109 ? 41.564  12.658 124.482 1.00 98.86  ? 987  ARG A NH1 1 
ATOM   822  N NH2 . ARG A 1 109 ? 40.503  10.638 124.099 1.00 83.18  ? 987  ARG A NH2 1 
ATOM   823  N N   . ILE A 1 110 ? 38.298  18.172 123.695 1.00 46.95  ? 988  ILE A N   1 
ATOM   824  C CA  . ILE A 1 110 ? 38.932  19.338 123.097 1.00 44.01  ? 988  ILE A CA  1 
ATOM   825  C C   . ILE A 1 110 ? 38.462  20.688 123.640 1.00 46.52  ? 988  ILE A C   1 
ATOM   826  O O   . ILE A 1 110 ? 39.266  21.475 124.143 1.00 46.23  ? 988  ILE A O   1 
ATOM   827  C CB  . ILE A 1 110 ? 38.961  19.232 121.543 1.00 45.39  ? 988  ILE A CB  1 
ATOM   828  C CG1 . ILE A 1 110 ? 39.882  18.078 121.099 1.00 44.97  ? 988  ILE A CG1 1 
ATOM   829  C CG2 . ILE A 1 110 ? 39.370  20.529 120.925 1.00 44.64  ? 988  ILE A CG2 1 
ATOM   830  C CD1 . ILE A 1 110 ? 39.865  17.811 119.574 1.00 41.46  ? 988  ILE A CD1 1 
ATOM   831  N N   . PRO A 1 111 ? 37.145  20.961 123.574 1.00 43.36  ? 989  PRO A N   1 
ATOM   832  C CA  . PRO A 1 111 ? 36.531  22.211 124.039 1.00 41.77  ? 989  PRO A CA  1 
ATOM   833  C C   . PRO A 1 111 ? 36.878  22.505 125.495 1.00 44.91  ? 989  PRO A C   1 
ATOM   834  O O   . PRO A 1 111 ? 37.118  23.653 125.878 1.00 46.50  ? 989  PRO A O   1 
ATOM   835  C CB  . PRO A 1 111 ? 35.047  21.924 123.905 1.00 42.83  ? 989  PRO A CB  1 
ATOM   836  C CG  . PRO A 1 111 ? 34.957  20.821 122.918 1.00 47.87  ? 989  PRO A CG  1 
ATOM   837  C CD  . PRO A 1 111 ? 36.111  19.967 123.231 1.00 44.93  ? 989  PRO A CD  1 
ATOM   838  N N   . THR A 1 112 ? 36.953  21.457 126.299 1.00 38.62  ? 990  THR A N   1 
ATOM   839  C CA  . THR A 1 112 ? 37.332  21.624 127.681 1.00 37.91  ? 990  THR A CA  1 
ATOM   840  C C   . THR A 1 112 ? 38.782  22.090 127.775 1.00 40.38  ? 990  THR A C   1 
ATOM   841  O O   . THR A 1 112 ? 39.062  23.127 128.402 1.00 41.59  ? 990  THR A O   1 
ATOM   842  C CB  . THR A 1 112 ? 37.087  20.337 128.474 1.00 45.99  ? 990  THR A CB  1 
ATOM   843  O OG1 . THR A 1 112 ? 35.716  19.933 128.312 1.00 51.75  ? 990  THR A OG1 1 
ATOM   844  C CG2 . THR A 1 112 ? 37.412  20.546 129.932 1.00 33.18  ? 990  THR A CG2 1 
ATOM   845  N N   . ILE A 1 113 ? 39.703  21.332 127.173 1.00 33.18  ? 991  ILE A N   1 
ATOM   846  C CA  . ILE A 1 113 ? 41.113  21.731 127.185 1.00 32.39  ? 991  ILE A CA  1 
ATOM   847  C C   . ILE A 1 113 ? 41.296  23.173 126.716 1.00 36.73  ? 991  ILE A C   1 
ATOM   848  O O   . ILE A 1 113 ? 42.164  23.893 127.217 1.00 36.39  ? 991  ILE A O   1 
ATOM   849  C CB  . ILE A 1 113 ? 41.962  20.833 126.302 1.00 34.90  ? 991  ILE A CB  1 
ATOM   850  C CG1 . ILE A 1 113 ? 41.763  19.362 126.663 1.00 34.41  ? 991  ILE A CG1 1 
ATOM   851  C CG2 . ILE A 1 113 ? 43.422  21.228 126.411 1.00 34.05  ? 991  ILE A CG2 1 
ATOM   852  C CD1 . ILE A 1 113 ? 42.351  18.445 125.656 1.00 32.48  ? 991  ILE A CD1 1 
ATOM   853  N N   . SER A 1 114 ? 40.499  23.568 125.722 1.00 33.05  ? 992  SER A N   1 
ATOM   854  C CA  . SER A 1 114 ? 40.560  24.909 125.121 1.00 33.00  ? 992  SER A CA  1 
ATOM   855  C C   . SER A 1 114 ? 40.136  25.991 126.090 1.00 38.78  ? 992  SER A C   1 
ATOM   856  O O   . SER A 1 114 ? 40.802  27.030 126.186 1.00 39.29  ? 992  SER A O   1 
ATOM   857  C CB  . SER A 1 114 ? 39.598  24.977 123.949 1.00 37.20  ? 992  SER A CB  1 
ATOM   858  O OG  . SER A 1 114 ? 40.065  24.206 122.884 1.00 44.58  ? 992  SER A OG  1 
ATOM   859  N N   . THR A 1 115 ? 38.979  25.790 126.738 1.00 35.05  ? 993  THR A N   1 
ATOM   860  C CA  . THR A 1 115 ? 38.491  26.736 127.745 1.00 33.53  ? 993  THR A CA  1 
ATOM   861  C C   . THR A 1 115 ? 39.582  26.888 128.788 1.00 35.02  ? 993  THR A C   1 
ATOM   862  O O   . THR A 1 115 ? 39.976  28.006 129.145 1.00 35.58  ? 993  THR A O   1 
ATOM   863  C CB  . THR A 1 115 ? 37.197  26.265 128.446 1.00 42.75  ? 993  THR A CB  1 
ATOM   864  O OG1 . THR A 1 115 ? 36.223  25.831 127.478 1.00 45.14  ? 993  THR A OG1 1 
ATOM   865  C CG2 . THR A 1 115 ? 36.642  27.404 129.320 1.00 35.24  ? 993  THR A CG2 1 
ATOM   866  N N   . GLN A 1 116 ? 40.083  25.771 129.296 1.00 29.69  ? 994  GLN A N   1 
ATOM   867  C CA  . GLN A 1 116 ? 41.122  25.902 130.305 1.00 30.94  ? 994  GLN A CA  1 
ATOM   868  C C   . GLN A 1 116 ? 42.331  26.699 129.789 1.00 39.59  ? 994  GLN A C   1 
ATOM   869  O O   . GLN A 1 116 ? 42.944  27.491 130.533 1.00 42.16  ? 994  GLN A O   1 
ATOM   870  C CB  . GLN A 1 116 ? 41.515  24.555 130.872 1.00 31.42  ? 994  GLN A CB  1 
ATOM   871  C CG  . GLN A 1 116 ? 40.318  23.664 131.181 1.00 34.08  ? 994  GLN A CG  1 
ATOM   872  C CD  . GLN A 1 116 ? 40.696  22.552 132.167 1.00 48.22  ? 994  GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 116 ? 41.874  22.189 132.293 1.00 39.01  ? 994  GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 116 ? 39.702  22.010 132.865 1.00 34.98  ? 994  GLN A NE2 1 
ATOM   875  N N   . LEU A 1 117 ? 42.617  26.549 128.500 1.00 33.74  ? 995  LEU A N   1 
ATOM   876  C CA  . LEU A 1 117 ? 43.710  27.271 127.873 1.00 33.10  ? 995  LEU A CA  1 
ATOM   877  C C   . LEU A 1 117 ? 43.492  28.770 127.963 1.00 36.33  ? 995  LEU A C   1 
ATOM   878  O O   . LEU A 1 117 ? 44.388  29.515 128.309 1.00 37.35  ? 995  LEU A O   1 
ATOM   879  C CB  . LEU A 1 117 ? 43.839  26.847 126.413 1.00 33.27  ? 995  LEU A CB  1 
ATOM   880  C CG  . LEU A 1 117 ? 45.110  27.307 125.688 1.00 38.13  ? 995  LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 117 ? 46.406  26.703 126.320 1.00 37.36  ? 995  LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 117 ? 45.003  27.057 124.149 1.00 38.68  ? 995  LEU A CD2 1 
ATOM   883  N N   . LYS A 1 118 ? 42.294  29.225 127.642 1.00 31.59  ? 996  LYS A N   1 
ATOM   884  C CA  . LYS A 1 118 ? 41.997  30.649 127.783 1.00 30.73  ? 996  LYS A CA  1 
ATOM   885  C C   . LYS A 1 118 ? 42.253  31.070 129.251 1.00 37.34  ? 996  LYS A C   1 
ATOM   886  O O   . LYS A 1 118 ? 43.060  31.979 129.515 1.00 37.45  ? 996  LYS A O   1 
ATOM   887  C CB  . LYS A 1 118 ? 40.542  30.976 127.338 1.00 30.07  ? 996  LYS A CB  1 
ATOM   888  C CG  . LYS A 1 118 ? 40.287  30.711 125.848 1.00 29.16  ? 996  LYS A CG  1 
ATOM   889  C CD  . LYS A 1 118 ? 38.930  31.202 125.366 1.00 33.35  ? 996  LYS A CD  1 
ATOM   890  C CE  . LYS A 1 118 ? 37.899  30.076 125.241 1.00 40.42  ? 996  LYS A CE  1 
ATOM   891  N NZ  . LYS A 1 118 ? 36.671  30.266 126.100 1.00 55.18  ? 996  LYS A NZ  1 
ATOM   892  N N   . ILE A 1 119 ? 41.557  30.416 130.193 1.00 32.98  ? 997  ILE A N   1 
ATOM   893  C CA  . ILE A 1 119 ? 41.726  30.689 131.628 1.00 31.69  ? 997  ILE A CA  1 
ATOM   894  C C   . ILE A 1 119 ? 43.213  30.767 132.033 1.00 34.59  ? 997  ILE A C   1 
ATOM   895  O O   . ILE A 1 119 ? 43.661  31.750 132.603 1.00 34.44  ? 997  ILE A O   1 
ATOM   896  C CB  . ILE A 1 119 ? 41.013  29.618 132.451 1.00 34.59  ? 997  ILE A CB  1 
ATOM   897  C CG1 . ILE A 1 119 ? 39.480  29.764 132.371 1.00 34.14  ? 997  ILE A CG1 1 
ATOM   898  C CG2 . ILE A 1 119 ? 41.516  29.641 133.850 1.00 35.23  ? 997  ILE A CG2 1 
ATOM   899  C CD1 . ILE A 1 119 ? 38.667  28.367 132.483 1.00 36.43  ? 997  ILE A CD1 1 
ATOM   900  N N   . LEU A 1 120 ? 43.981  29.731 131.702 1.00 32.13  ? 998  LEU A N   1 
ATOM   901  C CA  . LEU A 1 120 ? 45.417  29.685 132.001 1.00 30.65  ? 998  LEU A CA  1 
ATOM   902  C C   . LEU A 1 120 ? 46.247  30.764 131.291 1.00 38.01  ? 998  LEU A C   1 
ATOM   903  O O   . LEU A 1 120 ? 47.058  31.432 131.921 1.00 41.17  ? 998  LEU A O   1 
ATOM   904  C CB  . LEU A 1 120 ? 45.957  28.276 131.815 1.00 29.43  ? 998  LEU A CB  1 
ATOM   905  C CG  . LEU A 1 120 ? 45.201  27.193 132.651 1.00 34.79  ? 998  LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 120 ? 45.472  25.735 132.229 1.00 32.80  ? 998  LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 120 ? 45.416  27.312 134.218 1.00 38.82  ? 998  LEU A CD2 1 
ATOM   908  N N   . SER A 1 121 ? 46.060  30.940 129.991 1.00 34.54  ? 999  SER A N   1 
ATOM   909  C CA  . SER A 1 121 ? 46.745  31.999 129.230 1.00 33.90  ? 999  SER A CA  1 
ATOM   910  C C   . SER A 1 121 ? 46.579  33.324 129.926 1.00 37.76  ? 999  SER A C   1 
ATOM   911  O O   . SER A 1 121 ? 47.541  34.039 130.156 1.00 38.25  ? 999  SER A O   1 
ATOM   912  C CB  . SER A 1 121 ? 46.119  32.128 127.848 1.00 37.81  ? 999  SER A CB  1 
ATOM   913  O OG  . SER A 1 121 ? 46.254  30.887 127.160 1.00 53.70  ? 999  SER A OG  1 
ATOM   914  N N   . THR A 1 122 ? 45.338  33.648 130.247 1.00 35.72  ? 1000 THR A N   1 
ATOM   915  C CA  . THR A 1 122 ? 44.987  34.870 130.985 1.00 36.97  ? 1000 THR A CA  1 
ATOM   916  C C   . THR A 1 122 ? 45.666  35.003 132.361 1.00 42.82  ? 1000 THR A C   1 
ATOM   917  O O   . THR A 1 122 ? 46.092  36.098 132.774 1.00 43.66  ? 1000 THR A O   1 
ATOM   918  C CB  . THR A 1 122 ? 43.484  34.972 131.156 1.00 40.10  ? 1000 THR A CB  1 
ATOM   919  O OG1 . THR A 1 122 ? 42.872  34.832 129.869 1.00 40.47  ? 1000 THR A OG1 1 
ATOM   920  C CG2 . THR A 1 122 ? 43.135  36.305 131.739 1.00 34.30  ? 1000 THR A CG2 1 
ATOM   921  N N   . VAL A 1 123 ? 45.712  33.910 133.106 1.00 37.71  ? 1001 VAL A N   1 
ATOM   922  C CA  . VAL A 1 123 ? 46.427  33.964 134.384 1.00 36.62  ? 1001 VAL A CA  1 
ATOM   923  C C   . VAL A 1 123 ? 47.889  34.354 134.039 1.00 43.35  ? 1001 VAL A C   1 
ATOM   924  O O   . VAL A 1 123 ? 48.393  35.393 134.487 1.00 45.56  ? 1001 VAL A O   1 
ATOM   925  C CB  . VAL A 1 123 ? 46.375  32.594 135.126 1.00 37.05  ? 1001 VAL A CB  1 
ATOM   926  C CG1 . VAL A 1 123 ? 47.622  32.380 135.980 1.00 36.40  ? 1001 VAL A CG1 1 
ATOM   927  C CG2 . VAL A 1 123 ? 45.132  32.470 135.918 1.00 35.79  ? 1001 VAL A CG2 1 
ATOM   928  N N   . LYS A 1 124 ? 48.560  33.527 133.235 1.00 39.01  ? 1002 LYS A N   1 
ATOM   929  C CA  . LYS A 1 124 ? 49.954  33.775 132.865 1.00 38.59  ? 1002 LYS A CA  1 
ATOM   930  C C   . LYS A 1 124 ? 50.147  35.165 132.278 1.00 45.73  ? 1002 LYS A C   1 
ATOM   931  O O   . LYS A 1 124 ? 51.088  35.843 132.621 1.00 46.71  ? 1002 LYS A O   1 
ATOM   932  C CB  . LYS A 1 124 ? 50.468  32.684 131.934 1.00 39.57  ? 1002 LYS A CB  1 
ATOM   933  C CG  . LYS A 1 124 ? 51.958  32.797 131.610 1.00 46.47  ? 1002 LYS A CG  1 
ATOM   934  C CD  . LYS A 1 124 ? 52.821  32.637 132.837 1.00 57.60  ? 1002 LYS A CD  1 
ATOM   935  C CE  . LYS A 1 124 ? 54.158  33.330 132.618 1.00 67.25  ? 1002 LYS A CE  1 
ATOM   936  N NZ  . LYS A 1 124 ? 55.296  32.564 133.199 1.00 70.64  ? 1002 LYS A NZ  1 
ATOM   937  N N   . ALA A 1 125 ? 49.201  35.611 131.454 1.00 44.08  ? 1003 ALA A N   1 
ATOM   938  C CA  . ALA A 1 125 ? 49.212  36.948 130.882 1.00 43.77  ? 1003 ALA A CA  1 
ATOM   939  C C   . ALA A 1 125 ? 49.240  38.031 131.971 1.00 51.75  ? 1003 ALA A C   1 
ATOM   940  O O   . ALA A 1 125 ? 49.961  39.032 131.844 1.00 52.52  ? 1003 ALA A O   1 
ATOM   941  C CB  . ALA A 1 125 ? 47.986  37.132 129.999 1.00 44.16  ? 1003 ALA A CB  1 
ATOM   942  N N   . THR A 1 126 ? 48.441  37.850 133.026 1.00 50.63  ? 1004 THR A N   1 
ATOM   943  C CA  . THR A 1 126 ? 48.394  38.825 134.138 1.00 52.27  ? 1004 THR A CA  1 
ATOM   944  C C   . THR A 1 126 ? 49.691  38.817 134.929 1.00 60.07  ? 1004 THR A C   1 
ATOM   945  O O   . THR A 1 126 ? 50.087  39.828 135.483 1.00 61.53  ? 1004 THR A O   1 
ATOM   946  C CB  . THR A 1 126 ? 47.163  38.641 135.094 1.00 57.47  ? 1004 THR A CB  1 
ATOM   947  O OG1 . THR A 1 126 ? 47.426  37.573 136.025 1.00 60.90  ? 1004 THR A OG1 1 
ATOM   948  C CG2 . THR A 1 126 ? 45.862  38.350 134.285 1.00 53.79  ? 1004 THR A CG2 1 
ATOM   949  N N   . MET A 1 127 ? 50.358  37.676 134.980 1.00 57.78  ? 1005 MET A N   1 
ATOM   950  C CA  . MET A 1 127 ? 51.622  37.613 135.688 1.00 58.52  ? 1005 MET A CA  1 
ATOM   951  C C   . MET A 1 127 ? 52.787  38.248 134.917 1.00 68.46  ? 1005 MET A C   1 
ATOM   952  O O   . MET A 1 127 ? 53.686  38.831 135.524 1.00 68.56  ? 1005 MET A O   1 
ATOM   953  C CB  . MET A 1 127 ? 51.938  36.178 136.047 1.00 59.93  ? 1005 MET A CB  1 
ATOM   954  C CG  . MET A 1 127 ? 50.770  35.506 136.688 1.00 62.33  ? 1005 MET A CG  1 
ATOM   955  S SD  . MET A 1 127 ? 51.287  34.057 137.572 1.00 65.53  ? 1005 MET A SD  1 
ATOM   956  C CE  . MET A 1 127 ? 50.005  34.045 138.914 1.00 61.00  ? 1005 MET A CE  1 
ATOM   957  N N   . LEU A 1 128 ? 52.766  38.120 133.588 1.00 68.26  ? 1006 LEU A N   1 
ATOM   958  C CA  . LEU A 1 128 ? 53.806  38.675 132.712 1.00 68.43  ? 1006 LEU A CA  1 
ATOM   959  C C   . LEU A 1 128 ? 54.192  40.100 133.124 1.00 80.75  ? 1006 LEU A C   1 
ATOM   960  O O   . LEU A 1 128 ? 53.350  41.011 133.121 1.00 80.14  ? 1006 LEU A O   1 
ATOM   961  C CB  . LEU A 1 128 ? 53.347  38.644 131.250 1.00 66.59  ? 1006 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 128 ? 53.249  37.254 130.636 1.00 67.91  ? 1006 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 128 ? 53.033  37.322 129.143 1.00 66.56  ? 1006 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 128 ? 54.510  36.504 130.954 1.00 69.20  ? 1006 LEU A CD2 1 
ATOM   965  N N   . GLY A 1 129 ? 55.459  40.264 133.516 1.00 83.57  ? 1007 GLY A N   1 
ATOM   966  C CA  . GLY A 1 129 ? 56.019  41.537 133.951 1.00 86.16  ? 1007 GLY A CA  1 
ATOM   967  C C   . GLY A 1 129 ? 56.118  41.697 135.465 1.00 96.45  ? 1007 GLY A C   1 
ATOM   968  O O   . GLY A 1 129 ? 57.231  41.766 136.022 1.00 96.22  ? 1007 GLY A O   1 
ATOM   969  N N   . ARG A 1 130 ? 54.953  41.782 136.120 1.00 96.60  ? 1008 ARG A N   1 
ATOM   970  C CA  . ARG A 1 130 ? 54.850  41.946 137.576 1.00 97.60  ? 1008 ARG A CA  1 
ATOM   971  C C   . ARG A 1 130 ? 55.863  41.098 138.338 1.00 105.49 ? 1008 ARG A C   1 
ATOM   972  O O   . ARG A 1 130 ? 55.757  39.864 138.370 1.00 105.42 ? 1008 ARG A O   1 
ATOM   973  C CB  . ARG A 1 130 ? 53.435  41.602 138.071 1.00 96.33  ? 1008 ARG A CB  1 
ATOM   974  C CG  . ARG A 1 130 ? 52.354  41.673 137.005 1.00 103.79 ? 1008 ARG A CG  1 
ATOM   975  C CD  . ARG A 1 130 ? 51.104  42.349 137.535 1.00 112.53 ? 1008 ARG A CD  1 
ATOM   976  N NE  . ARG A 1 130 ? 50.850  43.617 136.850 1.00 124.84 ? 1008 ARG A NE  1 
ATOM   977  C CZ  . ARG A 1 130 ? 50.733  44.796 137.462 1.00 136.75 ? 1008 ARG A CZ  1 
ATOM   978  N NH1 . ARG A 1 130 ? 50.850  44.878 138.784 1.00 124.43 ? 1008 ARG A NH1 1 
ATOM   979  N NH2 . ARG A 1 130 ? 50.496  45.897 136.754 1.00 115.93 ? 1008 ARG A NH2 1 
ATOM   980  N N   . THR A 1 131 ? 56.824  41.767 138.975 1.00 104.56 ? 1009 THR A N   1 
ATOM   981  C CA  . THR A 1 131 ? 57.839  41.079 139.778 1.00 105.10 ? 1009 THR A CA  1 
ATOM   982  C C   . THR A 1 131 ? 57.370  40.943 141.233 1.00 108.55 ? 1009 THR A C   1 
ATOM   983  O O   . THR A 1 131 ? 58.095  40.434 142.096 1.00 108.61 ? 1009 THR A O   1 
ATOM   984  C CB  . THR A 1 131 ? 59.214  41.761 139.657 1.00 116.93 ? 1009 THR A CB  1 
ATOM   985  O OG1 . THR A 1 131 ? 59.180  42.680 138.556 1.00 119.64 ? 1009 THR A OG1 1 
ATOM   986  C CG2 . THR A 1 131 ? 60.309  40.719 139.405 1.00 115.73 ? 1009 THR A CG2 1 
ATOM   987  N N   . ASN A 1 132 ? 56.131  41.380 141.467 1.00 103.71 ? 1010 ASN A N   1 
ATOM   988  C CA  . ASN A 1 132 ? 55.458  41.323 142.771 1.00 102.11 ? 1010 ASN A CA  1 
ATOM   989  C C   . ASN A 1 132 ? 54.613  40.043 142.849 1.00 100.55 ? 1010 ASN A C   1 
ATOM   990  O O   . ASN A 1 132 ? 53.596  39.993 143.558 1.00 99.23  ? 1010 ASN A O   1 
ATOM   991  C CB  . ASN A 1 132 ? 54.540  42.545 142.908 1.00 104.48 ? 1010 ASN A CB  1 
ATOM   992  C CG  . ASN A 1 132 ? 53.956  42.990 141.565 1.00 129.56 ? 1010 ASN A CG  1 
ATOM   993  O OD1 . ASN A 1 132 ? 54.576  43.766 140.817 1.00 119.77 ? 1010 ASN A OD1 1 
ATOM   994  N ND2 . ASN A 1 132 ? 52.779  42.460 141.234 1.00 122.47 ? 1010 ASN A ND2 1 
ATOM   995  N N   . ILE A 1 133 ? 55.041  39.036 142.077 1.00 92.91  ? 1011 ILE A N   1 
ATOM   996  C CA  . ILE A 1 133 ? 54.384  37.730 141.979 1.00 89.74  ? 1011 ILE A CA  1 
ATOM   997  C C   . ILE A 1 133 ? 55.431  36.647 142.257 1.00 89.73  ? 1011 ILE A C   1 
ATOM   998  O O   . ILE A 1 133 ? 56.463  36.579 141.566 1.00 88.81  ? 1011 ILE A O   1 
ATOM   999  C CB  . ILE A 1 133 ? 53.699  37.530 140.583 1.00 91.32  ? 1011 ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 133 ? 52.709  36.367 140.637 1.00 90.37  ? 1011 ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 133 ? 54.746  37.308 139.471 1.00 91.19  ? 1011 ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 133 ? 53.365  35.011 140.565 1.00 91.44  ? 1011 ILE A CD1 1 
ATOM   1003 N N   . SER A 1 134 ? 55.169  35.824 143.277 1.00 83.07  ? 1012 SER A N   1 
ATOM   1004 C CA  . SER A 1 134 ? 56.100  34.766 143.663 1.00 81.37  ? 1012 SER A CA  1 
ATOM   1005 C C   . SER A 1 134 ? 56.606  34.003 142.461 1.00 83.35  ? 1012 SER A C   1 
ATOM   1006 O O   . SER A 1 134 ? 55.890  33.812 141.466 1.00 83.59  ? 1012 SER A O   1 
ATOM   1007 C CB  . SER A 1 134 ? 55.531  33.816 144.736 1.00 83.11  ? 1012 SER A CB  1 
ATOM   1008 O OG  . SER A 1 134 ? 54.309  33.210 144.350 1.00 86.24  ? 1012 SER A OG  1 
ATOM   1009 N N   . ASP A 1 135 ? 57.876  33.639 142.517 1.00 77.45  ? 1013 ASP A N   1 
ATOM   1010 C CA  . ASP A 1 135 ? 58.451  32.910 141.414 1.00 76.08  ? 1013 ASP A CA  1 
ATOM   1011 C C   . ASP A 1 135 ? 57.617  31.634 141.290 1.00 74.40  ? 1013 ASP A C   1 
ATOM   1012 O O   . ASP A 1 135 ? 57.147  31.294 140.203 1.00 74.25  ? 1013 ASP A O   1 
ATOM   1013 C CB  . ASP A 1 135 ? 59.941  32.613 141.680 1.00 78.67  ? 1013 ASP A CB  1 
ATOM   1014 C CG  . ASP A 1 135 ? 60.880  33.686 141.079 1.00 91.32  ? 1013 ASP A CG  1 
ATOM   1015 O OD1 . ASP A 1 135 ? 62.060  33.357 140.780 1.00 93.14  ? 1013 ASP A OD1 1 
ATOM   1016 O OD2 . ASP A 1 135 ? 60.429  34.843 140.879 1.00 93.44  ? 1013 ASP A OD2 1 
ATOM   1017 N N   . GLU A 1 136 ? 57.353  30.994 142.427 1.00 66.28  ? 1014 GLU A N   1 
ATOM   1018 C CA  . GLU A 1 136 ? 56.595  29.743 142.434 1.00 64.96  ? 1014 GLU A CA  1 
ATOM   1019 C C   . GLU A 1 136 ? 55.157  29.824 141.944 1.00 64.75  ? 1014 GLU A C   1 
ATOM   1020 O O   . GLU A 1 136 ? 54.565  28.812 141.551 1.00 63.03  ? 1014 GLU A O   1 
ATOM   1021 C CB  . GLU A 1 136 ? 56.624  29.068 143.806 1.00 66.48  ? 1014 GLU A CB  1 
ATOM   1022 C CG  . GLU A 1 136 ? 57.629  29.629 144.794 1.00 78.28  ? 1014 GLU A CG  1 
ATOM   1023 C CD  . GLU A 1 136 ? 57.088  29.564 146.206 1.00 111.36 ? 1014 GLU A CD  1 
ATOM   1024 O OE1 . GLU A 1 136 ? 57.093  30.613 146.890 1.00 120.46 ? 1014 GLU A OE1 1 
ATOM   1025 O OE2 . GLU A 1 136 ? 56.567  28.488 146.591 1.00 103.04 ? 1014 GLU A OE2 1 
ATOM   1026 N N   . GLU A 1 137 ? 54.573  31.010 142.017 1.00 59.30  ? 1015 GLU A N   1 
ATOM   1027 C CA  . GLU A 1 137 ? 53.209  31.157 141.555 1.00 58.46  ? 1015 GLU A CA  1 
ATOM   1028 C C   . GLU A 1 137 ? 53.200  31.250 140.032 1.00 61.49  ? 1015 GLU A C   1 
ATOM   1029 O O   . GLU A 1 137 ? 52.333  30.663 139.385 1.00 61.69  ? 1015 GLU A O   1 
ATOM   1030 C CB  . GLU A 1 137 ? 52.535  32.375 142.192 1.00 59.73  ? 1015 GLU A CB  1 
ATOM   1031 C CG  . GLU A 1 137 ? 51.746  32.040 143.470 1.00 64.63  ? 1015 GLU A CG  1 
ATOM   1032 C CD  . GLU A 1 137 ? 50.864  33.187 143.961 1.00 75.25  ? 1015 GLU A CD  1 
ATOM   1033 O OE1 . GLU A 1 137 ? 50.628  34.150 143.188 1.00 72.29  ? 1015 GLU A OE1 1 
ATOM   1034 O OE2 . GLU A 1 137 ? 50.381  33.110 145.122 1.00 60.05  ? 1015 GLU A OE2 1 
ATOM   1035 N N   . SER A 1 138 ? 54.176  31.960 139.469 1.00 56.26  ? 1016 SER A N   1 
ATOM   1036 C CA  . SER A 1 138 ? 54.264  32.111 138.023 1.00 56.01  ? 1016 SER A CA  1 
ATOM   1037 C C   . SER A 1 138 ? 54.738  30.807 137.381 1.00 59.94  ? 1016 SER A C   1 
ATOM   1038 O O   . SER A 1 138 ? 54.228  30.368 136.342 1.00 59.80  ? 1016 SER A O   1 
ATOM   1039 C CB  . SER A 1 138 ? 55.249  33.223 137.665 1.00 60.31  ? 1016 SER A CB  1 
ATOM   1040 O OG  . SER A 1 138 ? 56.584  32.785 137.862 1.00 71.52  ? 1016 SER A OG  1 
ATOM   1041 N N   . GLU A 1 139 ? 55.757  30.210 137.978 1.00 55.96  ? 1017 GLU A N   1 
ATOM   1042 C CA  . GLU A 1 139 ? 56.316  28.985 137.436 1.00 55.07  ? 1017 GLU A CA  1 
ATOM   1043 C C   . GLU A 1 139 ? 55.195  27.953 137.359 1.00 55.34  ? 1017 GLU A C   1 
ATOM   1044 O O   . GLU A 1 139 ? 55.018  27.273 136.340 1.00 57.47  ? 1017 GLU A O   1 
ATOM   1045 C CB  . GLU A 1 139 ? 57.520  28.519 138.288 1.00 57.09  ? 1017 GLU A CB  1 
ATOM   1046 C CG  . GLU A 1 139 ? 57.665  27.006 138.488 1.00 75.52  ? 1017 GLU A CG  1 
ATOM   1047 C CD  . GLU A 1 139 ? 58.580  26.353 137.449 1.00 106.18 ? 1017 GLU A CD  1 
ATOM   1048 O OE1 . GLU A 1 139 ? 59.034  27.061 136.515 1.00 111.72 ? 1017 GLU A OE1 1 
ATOM   1049 O OE2 . GLU A 1 139 ? 58.815  25.124 137.549 1.00 91.60  ? 1017 GLU A OE2 1 
ATOM   1050 N N   . GLN A 1 140 ? 54.397  27.879 138.412 1.00 46.77  ? 1018 GLN A N   1 
ATOM   1051 C CA  . GLN A 1 140 ? 53.285  26.923 138.440 1.00 45.21  ? 1018 GLN A CA  1 
ATOM   1052 C C   . GLN A 1 140 ? 52.236  27.325 137.393 1.00 45.84  ? 1018 GLN A C   1 
ATOM   1053 O O   . GLN A 1 140 ? 51.545  26.498 136.821 1.00 46.83  ? 1018 GLN A O   1 
ATOM   1054 C CB  . GLN A 1 140 ? 52.650  26.964 139.832 1.00 46.78  ? 1018 GLN A CB  1 
ATOM   1055 C CG  . GLN A 1 140 ? 51.923  25.695 140.333 1.00 54.79  ? 1018 GLN A CG  1 
ATOM   1056 C CD  . GLN A 1 140 ? 52.530  24.410 139.848 1.00 64.84  ? 1018 GLN A CD  1 
ATOM   1057 O OE1 . GLN A 1 140 ? 51.824  23.586 139.261 1.00 57.92  ? 1018 GLN A OE1 1 
ATOM   1058 N NE2 . GLN A 1 140 ? 53.831  24.197 140.131 1.00 55.25  ? 1018 GLN A NE2 1 
ATOM   1059 N N   . ALA A 1 141 ? 52.074  28.612 137.173 1.00 40.13  ? 1019 ALA A N   1 
ATOM   1060 C CA  . ALA A 1 141 ? 51.086  29.058 136.202 1.00 39.67  ? 1019 ALA A CA  1 
ATOM   1061 C C   . ALA A 1 141 ? 51.549  28.531 134.808 1.00 44.67  ? 1019 ALA A C   1 
ATOM   1062 O O   . ALA A 1 141 ? 50.779  27.906 134.043 1.00 43.07  ? 1019 ALA A O   1 
ATOM   1063 C CB  . ALA A 1 141 ? 50.990  30.623 136.234 1.00 39.57  ? 1019 ALA A CB  1 
ATOM   1064 N N   . THR A 1 142 ? 52.831  28.765 134.532 1.00 39.71  ? 1020 THR A N   1 
ATOM   1065 C CA  . THR A 1 142 ? 53.462  28.343 133.310 1.00 38.84  ? 1020 THR A CA  1 
ATOM   1066 C C   . THR A 1 142 ? 53.277  26.845 133.112 1.00 43.25  ? 1020 THR A C   1 
ATOM   1067 O O   . THR A 1 142 ? 53.059  26.370 131.971 1.00 44.39  ? 1020 THR A O   1 
ATOM   1068 C CB  . THR A 1 142 ? 54.975  28.629 133.366 1.00 43.38  ? 1020 THR A CB  1 
ATOM   1069 O OG1 . THR A 1 142 ? 55.211  30.043 133.355 1.00 47.71  ? 1020 THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 142 ? 55.636  28.025 132.161 1.00 40.92  ? 1020 THR A CG2 1 
ATOM   1071 N N   . GLU A 1 143 ? 53.454  26.100 134.197 1.00 36.06  ? 1021 GLU A N   1 
ATOM   1072 C CA  . GLU A 1 143 ? 53.398  24.653 134.110 1.00 36.65  ? 1021 GLU A CA  1 
ATOM   1073 C C   . GLU A 1 143 ? 52.027  24.146 133.824 1.00 39.92  ? 1021 GLU A C   1 
ATOM   1074 O O   . GLU A 1 143 ? 51.850  23.101 133.201 1.00 39.96  ? 1021 GLU A O   1 
ATOM   1075 C CB  . GLU A 1 143 ? 53.926  23.976 135.377 1.00 38.97  ? 1021 GLU A CB  1 
ATOM   1076 C CG  . GLU A 1 143 ? 55.424  24.167 135.577 1.00 59.12  ? 1021 GLU A CG  1 
ATOM   1077 C CD  . GLU A 1 143 ? 56.222  23.066 134.896 1.00 91.57  ? 1021 GLU A CD  1 
ATOM   1078 O OE1 . GLU A 1 143 ? 56.774  23.339 133.794 1.00 80.35  ? 1021 GLU A OE1 1 
ATOM   1079 O OE2 . GLU A 1 143 ? 56.202  21.916 135.416 1.00 87.92  ? 1021 GLU A OE2 1 
ATOM   1080 N N   . MET A 1 144 ? 51.037  24.869 134.302 1.00 36.55  ? 1022 MET A N   1 
ATOM   1081 C CA  . MET A 1 144 ? 49.662  24.430 134.082 1.00 35.83  ? 1022 MET A CA  1 
ATOM   1082 C C   . MET A 1 144 ? 49.344  24.634 132.617 1.00 38.39  ? 1022 MET A C   1 
ATOM   1083 O O   . MET A 1 144 ? 48.778  23.765 131.939 1.00 38.93  ? 1022 MET A O   1 
ATOM   1084 C CB  . MET A 1 144 ? 48.733  25.241 134.972 1.00 37.33  ? 1022 MET A CB  1 
ATOM   1085 C CG  . MET A 1 144 ? 49.100  25.106 136.461 1.00 39.09  ? 1022 MET A CG  1 
ATOM   1086 S SD  . MET A 1 144 ? 47.746  25.702 137.462 1.00 42.61  ? 1022 MET A SD  1 
ATOM   1087 C CE  . MET A 1 144 ? 48.479  27.121 138.044 1.00 38.54  ? 1022 MET A CE  1 
ATOM   1088 N N   . LEU A 1 145 ? 49.801  25.770 132.132 1.00 33.58  ? 1023 LEU A N   1 
ATOM   1089 C CA  . LEU A 1 145 ? 49.631  26.157 130.744 1.00 34.21  ? 1023 LEU A CA  1 
ATOM   1090 C C   . LEU A 1 145 ? 50.393  25.195 129.758 1.00 41.79  ? 1023 LEU A C   1 
ATOM   1091 O O   . LEU A 1 145 ? 49.821  24.737 128.720 1.00 41.93  ? 1023 LEU A O   1 
ATOM   1092 C CB  . LEU A 1 145 ? 50.107  27.610 130.599 1.00 33.09  ? 1023 LEU A CB  1 
ATOM   1093 C CG  . LEU A 1 145 ? 49.939  28.333 129.273 1.00 35.72  ? 1023 LEU A CG  1 
ATOM   1094 C CD1 . LEU A 1 145 ? 48.548  28.117 128.725 1.00 37.71  ? 1023 LEU A CD1 1 
ATOM   1095 C CD2 . LEU A 1 145 ? 50.206  29.751 129.511 1.00 29.45  ? 1023 LEU A CD2 1 
ATOM   1096 N N   . VAL A 1 146 ? 51.665  24.900 130.069 1.00 36.28  ? 1024 VAL A N   1 
ATOM   1097 C CA  . VAL A 1 146 ? 52.477  23.995 129.227 1.00 33.81  ? 1024 VAL A CA  1 
ATOM   1098 C C   . VAL A 1 146 ? 51.765  22.649 129.159 1.00 41.71  ? 1024 VAL A C   1 
ATOM   1099 O O   . VAL A 1 146 ? 51.582  22.079 128.109 1.00 42.35  ? 1024 VAL A O   1 
ATOM   1100 C CB  . VAL A 1 146 ? 53.922  23.844 129.799 1.00 33.40  ? 1024 VAL A CB  1 
ATOM   1101 C CG1 . VAL A 1 146 ? 54.654  22.696 129.177 1.00 30.98  ? 1024 VAL A CG1 1 
ATOM   1102 C CG2 . VAL A 1 146 ? 54.694  25.144 129.645 1.00 32.80  ? 1024 VAL A CG2 1 
ATOM   1103 N N   . HIS A 1 147 ? 51.318  22.155 130.292 1.00 42.03  ? 1025 HIS A N   1 
ATOM   1104 C CA  . HIS A 1 147 ? 50.658  20.869 130.299 1.00 43.80  ? 1025 HIS A CA  1 
ATOM   1105 C C   . HIS A 1 147 ? 49.337  20.937 129.547 1.00 43.85  ? 1025 HIS A C   1 
ATOM   1106 O O   . HIS A 1 147 ? 48.970  20.008 128.845 1.00 42.90  ? 1025 HIS A O   1 
ATOM   1107 C CB  . HIS A 1 147 ? 50.489  20.378 131.741 1.00 47.12  ? 1025 HIS A CB  1 
ATOM   1108 C CG  . HIS A 1 147 ? 49.380  19.391 131.926 1.00 53.84  ? 1025 HIS A CG  1 
ATOM   1109 N ND1 . HIS A 1 147 ? 49.590  18.024 131.912 1.00 57.63  ? 1025 HIS A ND1 1 
ATOM   1110 C CD2 . HIS A 1 147 ? 48.057  19.568 132.190 1.00 58.25  ? 1025 HIS A CD2 1 
ATOM   1111 C CE1 . HIS A 1 147 ? 48.432  17.402 132.105 1.00 58.21  ? 1025 HIS A CE1 1 
ATOM   1112 N NE2 . HIS A 1 147 ? 47.485  18.316 132.278 1.00 58.61  ? 1025 HIS A NE2 1 
ATOM   1113 N N   . ASN A 1 148 ? 48.631  22.055 129.655 1.00 38.57  ? 1026 ASN A N   1 
ATOM   1114 C CA  . ASN A 1 148 ? 47.359  22.179 128.947 1.00 37.07  ? 1026 ASN A CA  1 
ATOM   1115 C C   . ASN A 1 148 ? 47.632  22.210 127.442 1.00 38.76  ? 1026 ASN A C   1 
ATOM   1116 O O   . ASN A 1 148 ? 47.016  21.463 126.663 1.00 37.04  ? 1026 ASN A O   1 
ATOM   1117 C CB  . ASN A 1 148 ? 46.651  23.444 129.393 1.00 39.09  ? 1026 ASN A CB  1 
ATOM   1118 C CG  . ASN A 1 148 ? 45.182  23.451 129.023 1.00 70.63  ? 1026 ASN A CG  1 
ATOM   1119 O OD1 . ASN A 1 148 ? 44.802  24.029 127.996 1.00 61.32  ? 1026 ASN A OD1 1 
ATOM   1120 N ND2 . ASN A 1 148 ? 44.335  22.847 129.882 1.00 64.48  ? 1026 ASN A ND2 1 
ATOM   1121 N N   . ALA A 1 149 ? 48.623  23.015 127.054 1.00 34.33  ? 1027 ALA A N   1 
ATOM   1122 C CA  . ALA A 1 149 ? 49.048  23.109 125.657 1.00 34.07  ? 1027 ALA A CA  1 
ATOM   1123 C C   . ALA A 1 149 ? 49.406  21.712 125.036 1.00 40.43  ? 1027 ALA A C   1 
ATOM   1124 O O   . ALA A 1 149 ? 48.949  21.332 123.918 1.00 39.11  ? 1027 ALA A O   1 
ATOM   1125 C CB  . ALA A 1 149 ? 50.195  24.079 125.544 1.00 33.86  ? 1027 ALA A CB  1 
ATOM   1126 N N   . GLN A 1 150 ? 50.155  20.921 125.805 1.00 35.12  ? 1028 GLN A N   1 
ATOM   1127 C CA  . GLN A 1 150 ? 50.510  19.583 125.380 1.00 32.61  ? 1028 GLN A CA  1 
ATOM   1128 C C   . GLN A 1 150 ? 49.287  18.735 125.109 1.00 38.25  ? 1028 GLN A C   1 
ATOM   1129 O O   . GLN A 1 150 ? 49.161  18.194 124.020 1.00 39.41  ? 1028 GLN A O   1 
ATOM   1130 C CB  . GLN A 1 150 ? 51.396  18.940 126.402 1.00 32.90  ? 1028 GLN A CB  1 
ATOM   1131 C CG  . GLN A 1 150 ? 52.753  19.624 126.488 1.00 37.25  ? 1028 GLN A CG  1 
ATOM   1132 C CD  . GLN A 1 150 ? 53.595  19.122 127.650 1.00 47.92  ? 1028 GLN A CD  1 
ATOM   1133 O OE1 . GLN A 1 150 ? 53.081  18.568 128.639 1.00 43.38  ? 1028 GLN A OE1 1 
ATOM   1134 N NE2 . GLN A 1 150 ? 54.898  19.322 127.538 1.00 32.63  ? 1028 GLN A NE2 1 
ATOM   1135 N N   . ASN A 1 151 ? 48.339  18.671 126.048 1.00 35.98  ? 1029 ASN A N   1 
ATOM   1136 C CA  . ASN A 1 151 ? 47.098  17.881 125.829 1.00 34.67  ? 1029 ASN A CA  1 
ATOM   1137 C C   . ASN A 1 151 ? 46.429  18.318 124.546 1.00 33.70  ? 1029 ASN A C   1 
ATOM   1138 O O   . ASN A 1 151 ? 46.008  17.496 123.743 1.00 32.26  ? 1029 ASN A O   1 
ATOM   1139 C CB  . ASN A 1 151 ? 46.060  18.063 126.964 1.00 37.47  ? 1029 ASN A CB  1 
ATOM   1140 C CG  . ASN A 1 151 ? 46.531  17.544 128.316 1.00 73.19  ? 1029 ASN A CG  1 
ATOM   1141 O OD1 . ASN A 1 151 ? 45.852  17.773 129.327 1.00 79.46  ? 1029 ASN A OD1 1 
ATOM   1142 N ND2 . ASN A 1 151 ? 47.718  16.924 128.365 1.00 59.98  ? 1029 ASN A ND2 1 
ATOM   1143 N N   . LEU A 1 152 ? 46.275  19.630 124.397 1.00 29.82  ? 1030 LEU A N   1 
ATOM   1144 C CA  . LEU A 1 152 ? 45.597  20.194 123.214 1.00 29.19  ? 1030 LEU A CA  1 
ATOM   1145 C C   . LEU A 1 152 ? 46.302  19.826 121.913 1.00 36.48  ? 1030 LEU A C   1 
ATOM   1146 O O   . LEU A 1 152 ? 45.681  19.360 120.943 1.00 37.56  ? 1030 LEU A O   1 
ATOM   1147 C CB  . LEU A 1 152 ? 45.439  21.715 123.330 1.00 27.31  ? 1030 LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 152 ? 44.501  22.291 122.273 1.00 28.42  ? 1030 LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 152 ? 43.122  21.652 122.332 1.00 26.45  ? 1030 LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 152 ? 44.448  23.851 122.358 1.00 27.84  ? 1030 LEU A CD2 1 
ATOM   1151 N N   . MET A 1 153 ? 47.622  19.974 121.912 1.00 32.25  ? 1031 MET A N   1 
ATOM   1152 C CA  . MET A 1 153 ? 48.378  19.591 120.745 1.00 29.01  ? 1031 MET A CA  1 
ATOM   1153 C C   . MET A 1 153 ? 48.227  18.120 120.473 1.00 32.15  ? 1031 MET A C   1 
ATOM   1154 O O   . MET A 1 153 ? 47.941  17.730 119.369 1.00 34.80  ? 1031 MET A O   1 
ATOM   1155 C CB  . MET A 1 153 ? 49.819  20.049 120.883 1.00 30.45  ? 1031 MET A CB  1 
ATOM   1156 C CG  . MET A 1 153 ? 49.944  21.571 120.899 1.00 33.44  ? 1031 MET A CG  1 
ATOM   1157 S SD  . MET A 1 153 ? 49.405  22.436 119.373 1.00 37.57  ? 1031 MET A SD  1 
ATOM   1158 C CE  . MET A 1 153 ? 47.775  22.959 119.726 1.00 32.63  ? 1031 MET A CE  1 
ATOM   1159 N N   . GLN A 1 154 ? 48.320  17.293 121.493 1.00 30.13  ? 1032 GLN A N   1 
ATOM   1160 C CA  . GLN A 1 154 ? 48.160  15.835 121.306 1.00 31.26  ? 1032 GLN A CA  1 
ATOM   1161 C C   . GLN A 1 154 ? 46.765  15.416 120.868 1.00 33.83  ? 1032 GLN A C   1 
ATOM   1162 O O   . GLN A 1 154 ? 46.601  14.587 119.967 1.00 31.36  ? 1032 GLN A O   1 
ATOM   1163 C CB  . GLN A 1 154 ? 48.490  15.092 122.611 1.00 33.01  ? 1032 GLN A CB  1 
ATOM   1164 C CG  . GLN A 1 154 ? 48.331  13.574 122.505 1.00 53.95  ? 1032 GLN A CG  1 
ATOM   1165 C CD  . GLN A 1 154 ? 49.431  12.922 121.664 1.00 77.37  ? 1032 GLN A CD  1 
ATOM   1166 O OE1 . GLN A 1 154 ? 50.506  13.494 121.466 1.00 72.18  ? 1032 GLN A OE1 1 
ATOM   1167 N NE2 . GLN A 1 154 ? 49.165  11.716 121.177 1.00 71.85  ? 1032 GLN A NE2 1 
ATOM   1168 N N   . SER A 1 155 ? 45.777  15.952 121.581 1.00 29.97  ? 1033 SER A N   1 
ATOM   1169 C CA  . SER A 1 155 ? 44.385  15.664 121.338 1.00 30.84  ? 1033 SER A CA  1 
ATOM   1170 C C   . SER A 1 155 ? 43.972  15.929 119.880 1.00 35.26  ? 1033 SER A C   1 
ATOM   1171 O O   . SER A 1 155 ? 43.250  15.127 119.238 1.00 34.55  ? 1033 SER A O   1 
ATOM   1172 C CB  . SER A 1 155 ? 43.527  16.482 122.306 1.00 35.18  ? 1033 SER A CB  1 
ATOM   1173 O OG  . SER A 1 155 ? 43.646  15.975 123.635 1.00 41.35  ? 1033 SER A OG  1 
ATOM   1174 N N   . VAL A 1 156 ? 44.473  17.039 119.349 1.00 29.66  ? 1034 VAL A N   1 
ATOM   1175 C CA  . VAL A 1 156 ? 44.178  17.423 117.983 1.00 27.80  ? 1034 VAL A CA  1 
ATOM   1176 C C   . VAL A 1 156 ? 44.943  16.573 116.995 1.00 35.37  ? 1034 VAL A C   1 
ATOM   1177 O O   . VAL A 1 156 ? 44.475  16.311 115.885 1.00 36.07  ? 1034 VAL A O   1 
ATOM   1178 C CB  . VAL A 1 156 ? 44.482  18.885 117.761 1.00 28.60  ? 1034 VAL A CB  1 
ATOM   1179 C CG1 . VAL A 1 156 ? 44.442  19.190 116.263 1.00 27.34  ? 1034 VAL A CG1 1 
ATOM   1180 C CG2 . VAL A 1 156 ? 43.536  19.738 118.574 1.00 27.68  ? 1034 VAL A CG2 1 
ATOM   1181 N N   . LYS A 1 157 ? 46.152  16.194 117.365 1.00 33.53  ? 1035 LYS A N   1 
ATOM   1182 C CA  . LYS A 1 157 ? 46.952  15.336 116.495 1.00 36.31  ? 1035 LYS A CA  1 
ATOM   1183 C C   . LYS A 1 157 ? 46.229  13.967 116.341 1.00 42.71  ? 1035 LYS A C   1 
ATOM   1184 O O   . LYS A 1 157 ? 46.149  13.391 115.244 1.00 42.09  ? 1035 LYS A O   1 
ATOM   1185 C CB  . LYS A 1 157 ? 48.347  15.170 117.121 1.00 39.83  ? 1035 LYS A CB  1 
ATOM   1186 C CG  . LYS A 1 157 ? 49.332  14.347 116.360 1.00 47.94  ? 1035 LYS A CG  1 
ATOM   1187 C CD  . LYS A 1 157 ? 50.658  14.423 117.086 1.00 66.54  ? 1035 LYS A CD  1 
ATOM   1188 C CE  . LYS A 1 157 ? 51.174  13.035 117.452 1.00 82.21  ? 1035 LYS A CE  1 
ATOM   1189 N NZ  . LYS A 1 157 ? 51.819  12.359 116.290 1.00 86.76  ? 1035 LYS A NZ  1 
ATOM   1190 N N   . GLU A 1 158 ? 45.641  13.491 117.437 1.00 39.87  ? 1036 GLU A N   1 
ATOM   1191 C CA  . GLU A 1 158 ? 44.937  12.216 117.437 1.00 38.88  ? 1036 GLU A CA  1 
ATOM   1192 C C   . GLU A 1 158 ? 43.651  12.289 116.636 1.00 40.63  ? 1036 GLU A C   1 
ATOM   1193 O O   . GLU A 1 158 ? 43.225  11.293 116.006 1.00 41.22  ? 1036 GLU A O   1 
ATOM   1194 C CB  . GLU A 1 158 ? 44.660  11.786 118.867 1.00 40.43  ? 1036 GLU A CB  1 
ATOM   1195 C CG  . GLU A 1 158 ? 45.913  11.302 119.605 1.00 53.14  ? 1036 GLU A CG  1 
ATOM   1196 C CD  . GLU A 1 158 ? 45.688  11.062 121.110 1.00 80.90  ? 1036 GLU A CD  1 
ATOM   1197 O OE1 . GLU A 1 158 ? 44.524  11.080 121.576 1.00 73.54  ? 1036 GLU A OE1 1 
ATOM   1198 O OE2 . GLU A 1 158 ? 46.693  10.862 121.831 1.00 77.18  ? 1036 GLU A OE2 1 
ATOM   1199 N N   . THR A 1 159 ? 43.024  13.465 116.670 1.00 33.62  ? 1037 THR A N   1 
ATOM   1200 C CA  . THR A 1 159 ? 41.771  13.728 115.942 1.00 31.41  ? 1037 THR A CA  1 
ATOM   1201 C C   . THR A 1 159 ? 42.087  13.674 114.444 1.00 35.70  ? 1037 THR A C   1 
ATOM   1202 O O   . THR A 1 159 ? 41.330  13.085 113.660 1.00 34.90  ? 1037 THR A O   1 
ATOM   1203 C CB  . THR A 1 159 ? 41.189  15.093 116.372 1.00 34.78  ? 1037 THR A CB  1 
ATOM   1204 O OG1 . THR A 1 159 ? 41.069  15.130 117.798 1.00 36.48  ? 1037 THR A OG1 1 
ATOM   1205 C CG2 . THR A 1 159 ? 39.848  15.392 115.716 1.00 31.64  ? 1037 THR A CG2 1 
ATOM   1206 N N   . VAL A 1 160 ? 43.238  14.246 114.060 1.00 31.48  ? 1038 VAL A N   1 
ATOM   1207 C CA  . VAL A 1 160 ? 43.687  14.220 112.666 1.00 30.71  ? 1038 VAL A CA  1 
ATOM   1208 C C   . VAL A 1 160 ? 43.841  12.760 112.243 1.00 34.10  ? 1038 VAL A C   1 
ATOM   1209 O O   . VAL A 1 160 ? 43.130  12.296 111.374 1.00 34.01  ? 1038 VAL A O   1 
ATOM   1210 C CB  . VAL A 1 160 ? 44.966  15.079 112.458 1.00 34.63  ? 1038 VAL A CB  1 
ATOM   1211 C CG1 . VAL A 1 160 ? 45.537  14.881 111.116 1.00 33.99  ? 1038 VAL A CG1 1 
ATOM   1212 C CG2 . VAL A 1 160 ? 44.667  16.561 112.654 1.00 34.59  ? 1038 VAL A CG2 1 
ATOM   1213 N N   . ARG A 1 161 ? 44.698  12.013 112.931 1.00 31.31  ? 1039 ARG A N   1 
ATOM   1214 C CA  . ARG A 1 161 ? 44.875  10.560 112.688 1.00 31.63  ? 1039 ARG A CA  1 
ATOM   1215 C C   . ARG A 1 161 ? 43.600  9.692  112.700 1.00 34.76  ? 1039 ARG A C   1 
ATOM   1216 O O   . ARG A 1 161 ? 43.445  8.848  111.830 1.00 33.48  ? 1039 ARG A O   1 
ATOM   1217 C CB  . ARG A 1 161 ? 45.973  9.965  113.593 1.00 34.00  ? 1039 ARG A CB  1 
ATOM   1218 C CG  . ARG A 1 161 ? 47.294  10.805 113.620 1.00 44.25  ? 1039 ARG A CG  1 
ATOM   1219 C CD  . ARG A 1 161 ? 48.455  10.034 114.234 1.00 60.64  ? 1039 ARG A CD  1 
ATOM   1220 N NE  . ARG A 1 161 ? 48.059  9.387  115.489 1.00 88.12  ? 1039 ARG A NE  1 
ATOM   1221 C CZ  . ARG A 1 161 ? 48.502  9.738  116.700 1.00 106.54 ? 1039 ARG A CZ  1 
ATOM   1222 N NH1 . ARG A 1 161 ? 49.375  10.733 116.825 1.00 98.89  ? 1039 ARG A NH1 1 
ATOM   1223 N NH2 . ARG A 1 161 ? 48.077  9.095  117.787 1.00 84.88  ? 1039 ARG A NH2 1 
ATOM   1224 N N   . GLU A 1 162 ? 42.660  9.919  113.630 1.00 31.39  ? 1040 GLU A N   1 
ATOM   1225 C CA  . GLU A 1 162 ? 41.408  9.147  113.605 1.00 31.65  ? 1040 GLU A CA  1 
ATOM   1226 C C   . GLU A 1 162 ? 40.494  9.557  112.477 1.00 36.34  ? 1040 GLU A C   1 
ATOM   1227 O O   . GLU A 1 162 ? 39.784  8.715  111.919 1.00 36.47  ? 1040 GLU A O   1 
ATOM   1228 C CB  . GLU A 1 162 ? 40.613  9.279  114.894 1.00 33.60  ? 1040 GLU A CB  1 
ATOM   1229 C CG  . GLU A 1 162 ? 41.246  8.638  116.085 1.00 42.68  ? 1040 GLU A CG  1 
ATOM   1230 C CD  . GLU A 1 162 ? 41.285  7.164  115.975 1.00 53.97  ? 1040 GLU A CD  1 
ATOM   1231 O OE1 . GLU A 1 162 ? 42.172  6.573  116.595 1.00 62.10  ? 1040 GLU A OE1 1 
ATOM   1232 O OE2 . GLU A 1 162 ? 40.522  6.599  115.180 1.00 49.69  ? 1040 GLU A OE2 1 
ATOM   1233 N N   . ALA A 1 163 ? 40.421  10.866 112.208 1.00 31.57  ? 1041 ALA A N   1 
ATOM   1234 C CA  . ALA A 1 163 ? 39.562  11.352 111.147 1.00 28.91  ? 1041 ALA A CA  1 
ATOM   1235 C C   . ALA A 1 163 ? 40.008  10.699 109.867 1.00 35.09  ? 1041 ALA A C   1 
ATOM   1236 O O   . ALA A 1 163 ? 39.197  10.280 109.058 1.00 36.56  ? 1041 ALA A O   1 
ATOM   1237 C CB  . ALA A 1 163 ? 39.671  12.818 111.021 1.00 29.14  ? 1041 ALA A CB  1 
ATOM   1238 N N   . GLU A 1 164 ? 41.314  10.650 109.655 1.00 30.80  ? 1042 GLU A N   1 
ATOM   1239 C CA  . GLU A 1 164 ? 41.836  10.121 108.418 1.00 30.50  ? 1042 GLU A CA  1 
ATOM   1240 C C   . GLU A 1 164 ? 41.499  8.628  108.294 1.00 31.91  ? 1042 GLU A C   1 
ATOM   1241 O O   . GLU A 1 164 ? 41.152  8.126  107.239 1.00 30.86  ? 1042 GLU A O   1 
ATOM   1242 C CB  . GLU A 1 164 ? 43.340  10.421 108.340 1.00 32.30  ? 1042 GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 164 ? 44.006  10.053 107.020 1.00 41.79  ? 1042 GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 164 ? 44.578  8.646  107.020 1.00 57.64  ? 1042 GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 164 ? 44.823  8.089  108.119 1.00 46.19  ? 1042 GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 164 ? 44.832  8.130  105.911 1.00 42.47  ? 1042 GLU A OE2 1 
ATOM   1247 N N   . ALA A 1 165 ? 41.606  7.928  109.406 1.00 27.67  ? 1043 ALA A N   1 
ATOM   1248 C CA  . ALA A 1 165 ? 41.259  6.518  109.485 1.00 25.29  ? 1043 ALA A CA  1 
ATOM   1249 C C   . ALA A 1 165 ? 39.798  6.287  109.084 1.00 32.65  ? 1043 ALA A C   1 
ATOM   1250 O O   . ALA A 1 165 ? 39.506  5.421  108.275 1.00 35.24  ? 1043 ALA A O   1 
ATOM   1251 C CB  . ALA A 1 165 ? 41.536  6.006  110.894 1.00 24.31  ? 1043 ALA A CB  1 
ATOM   1252 N N   . ALA A 1 166 ? 38.889  7.090  109.627 1.00 29.32  ? 1044 ALA A N   1 
ATOM   1253 C CA  . ALA A 1 166 ? 37.468  7.004  109.321 1.00 28.54  ? 1044 ALA A CA  1 
ATOM   1254 C C   . ALA A 1 166 ? 37.160  7.229  107.851 1.00 35.28  ? 1044 ALA A C   1 
ATOM   1255 O O   . ALA A 1 166 ? 36.095  6.865  107.400 1.00 38.18  ? 1044 ALA A O   1 
ATOM   1256 C CB  . ALA A 1 166 ? 36.729  8.058  110.125 1.00 29.44  ? 1044 ALA A CB  1 
ATOM   1257 N N   . SER A 1 167 ? 38.065  7.862  107.108 1.00 30.42  ? 1045 SER A N   1 
ATOM   1258 C CA  . SER A 1 167 ? 37.838  8.213  105.711 1.00 29.30  ? 1045 SER A CA  1 
ATOM   1259 C C   . SER A 1 167 ? 37.618  7.027  104.814 1.00 36.96  ? 1045 SER A C   1 
ATOM   1260 O O   . SER A 1 167 ? 37.069  7.113  103.725 1.00 36.83  ? 1045 SER A O   1 
ATOM   1261 C CB  . SER A 1 167 ? 38.966  9.128  105.206 1.00 30.60  ? 1045 SER A CB  1 
ATOM   1262 O OG  . SER A 1 167 ? 40.159  8.450  104.855 1.00 36.62  ? 1045 SER A OG  1 
ATOM   1263 N N   . ILE A 1 168 ? 38.036  5.895  105.322 1.00 36.58  ? 1046 ILE A N   1 
ATOM   1264 C CA  . ILE A 1 168 ? 38.041  4.662  104.597 1.00 37.12  ? 1046 ILE A CA  1 
ATOM   1265 C C   . ILE A 1 168 ? 36.995  3.736  105.201 1.00 41.81  ? 1046 ILE A C   1 
ATOM   1266 O O   . ILE A 1 168 ? 36.851  2.599  104.789 1.00 40.37  ? 1046 ILE A O   1 
ATOM   1267 C CB  . ILE A 1 168 ? 39.517  4.172  104.556 1.00 40.61  ? 1046 ILE A CB  1 
ATOM   1268 C CG1 . ILE A 1 168 ? 39.974  4.090  103.154 1.00 42.69  ? 1046 ILE A CG1 1 
ATOM   1269 C CG2 . ILE A 1 168 ? 39.937  3.029  105.494 1.00 39.29  ? 1046 ILE A CG2 1 
ATOM   1270 C CD1 . ILE A 1 168 ? 40.080  5.448  102.565 1.00 63.22  ? 1046 ILE A CD1 1 
ATOM   1271 N N   . LYS A 1 169 ? 36.224  4.287  106.142 1.00 39.07  ? 1047 LYS A N   1 
ATOM   1272 C CA  . LYS A 1 169 ? 35.134  3.589  106.812 1.00 39.03  ? 1047 LYS A CA  1 
ATOM   1273 C C   . LYS A 1 169 ? 33.899  4.458  107.008 1.00 42.24  ? 1047 LYS A C   1 
ATOM   1274 O O   . LYS A 1 169 ? 33.289  4.458  108.076 1.00 41.80  ? 1047 LYS A O   1 
ATOM   1275 C CB  . LYS A 1 169 ? 35.565  2.931  108.129 1.00 41.19  ? 1047 LYS A CB  1 
ATOM   1276 C CG  . LYS A 1 169 ? 36.791  2.066  107.975 1.00 52.01  ? 1047 LYS A CG  1 
ATOM   1277 C CD  . LYS A 1 169 ? 36.647  0.733  108.652 1.00 62.89  ? 1047 LYS A CD  1 
ATOM   1278 C CE  . LYS A 1 169 ? 36.451  -0.409 107.680 1.00 79.53  ? 1047 LYS A CE  1 
ATOM   1279 N NZ  . LYS A 1 169 ? 35.232  -1.230 108.003 1.00 90.13  ? 1047 LYS A NZ  1 
ATOM   1280 N N   . ILE A 1 170 ? 33.501  5.110  105.923 1.00 37.64  ? 1048 ILE A N   1 
ATOM   1281 C CA  . ILE A 1 170 ? 32.361  5.995  105.859 1.00 36.24  ? 1048 ILE A CA  1 
ATOM   1282 C C   . ILE A 1 170 ? 31.168  5.340  105.143 1.00 44.25  ? 1048 ILE A C   1 
ATOM   1283 O O   . ILE A 1 170 ? 31.310  4.501  104.258 1.00 42.20  ? 1048 ILE A O   1 
ATOM   1284 C CB  . ILE A 1 170 ? 32.796  7.309  105.204 1.00 37.21  ? 1048 ILE A CB  1 
ATOM   1285 C CG1 . ILE A 1 170 ? 33.944  7.903  105.996 1.00 35.45  ? 1048 ILE A CG1 1 
ATOM   1286 C CG2 . ILE A 1 170 ? 31.647  8.287  105.059 1.00 39.40  ? 1048 ILE A CG2 1 
ATOM   1287 C CD1 . ILE A 1 170 ? 33.617  8.431  107.406 1.00 29.23  ? 1048 ILE A CD1 1 
ATOM   1288 N N   . ARG A 1 171 ? 29.971  5.708  105.568 1.00 44.81  ? 1049 ARG A N   1 
ATOM   1289 C CA  . ARG A 1 171 ? 28.762  5.106  105.028 1.00 44.38  ? 1049 ARG A CA  1 
ATOM   1290 C C   . ARG A 1 171 ? 28.659  5.386  103.554 1.00 52.20  ? 1049 ARG A C   1 
ATOM   1291 O O   . ARG A 1 171 ? 29.202  6.356  103.063 1.00 54.15  ? 1049 ARG A O   1 
ATOM   1292 C CB  . ARG A 1 171 ? 27.505  5.594  105.787 1.00 40.08  ? 1049 ARG A CB  1 
ATOM   1293 C CG  . ARG A 1 171 ? 27.275  7.082  105.906 1.00 41.68  ? 1049 ARG A CG  1 
ATOM   1294 C CD  . ARG A 1 171 ? 25.808  7.416  105.657 1.00 61.66  ? 1049 ARG A CD  1 
ATOM   1295 N NE  . ARG A 1 171 ? 25.355  8.652  106.303 1.00 78.10  ? 1049 ARG A NE  1 
ATOM   1296 C CZ  . ARG A 1 171 ? 24.996  8.752  107.585 1.00 99.46  ? 1049 ARG A CZ  1 
ATOM   1297 N NH1 . ARG A 1 171 ? 25.045  7.690  108.389 1.00 84.86  ? 1049 ARG A NH1 1 
ATOM   1298 N NH2 . ARG A 1 171 ? 24.595  9.923  108.074 1.00 89.29  ? 1049 ARG A NH2 1 
ATOM   1299 N N   . THR A 1 172 ? 27.946  4.548  102.831 1.00 47.40  ? 1050 THR A N   1 
ATOM   1300 C CA  . THR A 1 172 ? 27.789  4.808  101.435 1.00 46.77  ? 1050 THR A CA  1 
ATOM   1301 C C   . THR A 1 172 ? 26.948  6.080  101.231 1.00 52.49  ? 1050 THR A C   1 
ATOM   1302 O O   . THR A 1 172 ? 26.064  6.387  102.042 1.00 52.61  ? 1050 THR A O   1 
ATOM   1303 C CB  . THR A 1 172 ? 27.292  3.576  100.697 1.00 55.09  ? 1050 THR A CB  1 
ATOM   1304 O OG1 . THR A 1 172 ? 26.267  3.950  99.774  1.00 49.66  ? 1050 THR A OG1 1 
ATOM   1305 C CG2 . THR A 1 172 ? 26.822  2.509  101.674 1.00 57.91  ? 1050 THR A CG2 1 
ATOM   1306 N N   . ASP A 1 173 ? 27.304  6.875  100.215 1.00 47.99  ? 1051 ASP A N   1 
ATOM   1307 C CA  . ASP A 1 173 ? 26.596  8.114  99.938  1.00 45.83  ? 1051 ASP A CA  1 
ATOM   1308 C C   . ASP A 1 173 ? 26.477  9.003  101.175 1.00 46.29  ? 1051 ASP A C   1 
ATOM   1309 O O   . ASP A 1 173 ? 25.386  9.417  101.553 1.00 43.27  ? 1051 ASP A O   1 
ATOM   1310 C CB  . ASP A 1 173 ? 25.214  7.785  99.401  1.00 47.82  ? 1051 ASP A CB  1 
ATOM   1311 C CG  . ASP A 1 173 ? 24.543  8.972  98.749  1.00 55.84  ? 1051 ASP A CG  1 
ATOM   1312 O OD1 . ASP A 1 173 ? 25.243  9.936  98.358  1.00 53.51  ? 1051 ASP A OD1 1 
ATOM   1313 O OD2 . ASP A 1 173 ? 23.299  8.938  98.652  1.00 63.65  ? 1051 ASP A OD2 1 
ATOM   1314 N N   . ALA A 1 174 ? 27.617  9.325  101.781 1.00 44.02  ? 1052 ALA A N   1 
ATOM   1315 C CA  . ALA A 1 174 ? 27.667  10.167 102.983 1.00 41.84  ? 1052 ALA A CA  1 
ATOM   1316 C C   . ALA A 1 174 ? 27.382  11.653 102.691 1.00 48.22  ? 1052 ALA A C   1 
ATOM   1317 O O   . ALA A 1 174 ? 27.675  12.168 101.599 1.00 46.95  ? 1052 ALA A O   1 
ATOM   1318 C CB  . ALA A 1 174 ? 28.990  9.993  103.684 1.00 40.87  ? 1052 ALA A CB  1 
ATOM   1319 N N   . GLY A 1 175 ? 26.819  12.345 103.680 1.00 47.81  ? 1053 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 175 ? 26.502  13.762 103.555 1.00 48.15  ? 1053 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 175 ? 27.662  14.709 103.869 1.00 52.53  ? 1053 GLY A C   1 
ATOM   1322 O O   . GLY A 1 175 ? 27.590  15.924 103.606 1.00 51.62  ? 1053 GLY A O   1 
ATOM   1323 N N   . PHE A 1 176 ? 28.756  14.140 104.395 1.00 46.65  ? 1054 PHE A N   1 
ATOM   1324 C CA  . PHE A 1 176 ? 29.944  14.914 104.728 1.00 42.46  ? 1054 PHE A CA  1 
ATOM   1325 C C   . PHE A 1 176 ? 31.167  13.993 104.654 1.00 45.66  ? 1054 PHE A C   1 
ATOM   1326 O O   . PHE A 1 176 ? 31.133  12.871 105.158 1.00 45.53  ? 1054 PHE A O   1 
ATOM   1327 C CB  . PHE A 1 176 ? 29.775  15.557 106.123 1.00 41.01  ? 1054 PHE A CB  1 
ATOM   1328 C CG  . PHE A 1 176 ? 30.987  16.295 106.608 1.00 40.98  ? 1054 PHE A CG  1 
ATOM   1329 C CD1 . PHE A 1 176 ? 31.278  17.579 106.146 1.00 40.77  ? 1054 PHE A CD1 1 
ATOM   1330 C CD2 . PHE A 1 176 ? 31.870  15.698 107.517 1.00 43.43  ? 1054 PHE A CD2 1 
ATOM   1331 C CE1 . PHE A 1 176 ? 32.416  18.267 106.575 1.00 40.29  ? 1054 PHE A CE1 1 
ATOM   1332 C CE2 . PHE A 1 176 ? 33.007  16.401 107.980 1.00 44.33  ? 1054 PHE A CE2 1 
ATOM   1333 C CZ  . PHE A 1 176 ? 33.283  17.686 107.486 1.00 40.36  ? 1054 PHE A CZ  1 
ATOM   1334 N N   . THR A 1 177 ? 32.238  14.482 104.019 1.00 39.40  ? 1055 THR A N   1 
ATOM   1335 C CA  . THR A 1 177 ? 33.523  13.771 103.896 1.00 35.73  ? 1055 THR A CA  1 
ATOM   1336 C C   . THR A 1 177 ? 34.659  14.785 103.959 1.00 34.41  ? 1055 THR A C   1 
ATOM   1337 O O   . THR A 1 177 ? 34.498  15.908 103.510 1.00 34.63  ? 1055 THR A O   1 
ATOM   1338 C CB  . THR A 1 177 ? 33.632  13.045 102.539 1.00 36.22  ? 1055 THR A CB  1 
ATOM   1339 O OG1 . THR A 1 177 ? 33.280  13.941 101.469 1.00 38.52  ? 1055 THR A OG1 1 
ATOM   1340 C CG2 . THR A 1 177 ? 32.783  11.765 102.501 1.00 26.93  ? 1055 THR A CG2 1 
ATOM   1341 N N   . LEU A 1 178 ? 35.835  14.381 104.450 1.00 26.02  ? 1056 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 178 ? 37.018  15.243 104.410 1.00 21.02  ? 1056 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 178 ? 37.985  14.572 103.412 1.00 27.48  ? 1056 LEU A C   1 
ATOM   1344 O O   . LEU A 1 178 ? 38.002  13.326 103.314 1.00 23.46  ? 1056 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 178 ? 37.651  15.306 105.763 1.00 19.51  ? 1056 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 178 ? 36.914  16.011 106.894 1.00 22.97  ? 1056 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 178 ? 37.592  15.716 108.236 1.00 22.11  ? 1056 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 178 ? 36.843  17.530 106.662 1.00 24.33  ? 1056 LEU A CD2 1 
ATOM   1349 N N   . ARG A 1 179 ? 38.732  15.382 102.629 1.00 26.97  ? 1057 ARG A N   1 
ATOM   1350 C CA  . ARG A 1 179 ? 39.720  14.879 101.628 1.00 25.96  ? 1057 ARG A CA  1 
ATOM   1351 C C   . ARG A 1 179 ? 41.104  14.641 102.232 1.00 34.23  ? 1057 ARG A C   1 
ATOM   1352 O O   . ARG A 1 179 ? 41.688  15.543 102.824 1.00 38.47  ? 1057 ARG A O   1 
ATOM   1353 C CB  . ARG A 1 179 ? 39.862  15.897 100.507 1.00 23.88  ? 1057 ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 179 ? 41.057  15.707 99.531  1.00 29.22  ? 1057 ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 179 ? 40.798  16.638 98.339  1.00 32.23  ? 1057 ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 179 ? 41.793  16.601 97.286  1.00 31.47  ? 1057 ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 179 ? 42.980  17.191 97.336  1.00 52.06  ? 1057 ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 179 ? 43.356  17.890 98.406  1.00 37.11  ? 1057 ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 179 ? 43.800  17.065 96.305  1.00 43.55  ? 1057 ARG A NH2 1 
ATOM   1360 N N   . TRP A 1 180 ? 41.652  13.440 102.089 1.00 30.05  ? 1058 TRP A N   1 
ATOM   1361 C CA  . TRP A 1 180 ? 42.979  13.139 102.680 1.00 27.59  ? 1058 TRP A CA  1 
ATOM   1362 C C   . TRP A 1 180 ? 43.967  12.843 101.580 1.00 32.47  ? 1058 TRP A C   1 
ATOM   1363 O O   . TRP A 1 180 ? 44.004  11.745 101.059 1.00 31.74  ? 1058 TRP A O   1 
ATOM   1364 C CB  . TRP A 1 180 ? 42.868  11.960 103.636 1.00 24.14  ? 1058 TRP A CB  1 
ATOM   1365 C CG  . TRP A 1 180 ? 42.015  12.295 104.830 1.00 24.51  ? 1058 TRP A CG  1 
ATOM   1366 C CD1 . TRP A 1 180 ? 40.652  12.050 104.994 1.00 26.79  ? 1058 TRP A CD1 1 
ATOM   1367 C CD2 . TRP A 1 180 ? 42.431  13.044 105.992 1.00 22.71  ? 1058 TRP A CD2 1 
ATOM   1368 N NE1 . TRP A 1 180 ? 40.250  12.560 106.208 1.00 26.28  ? 1058 TRP A NE1 1 
ATOM   1369 C CE2 . TRP A 1 180 ? 41.314  13.167 106.829 1.00 25.91  ? 1058 TRP A CE2 1 
ATOM   1370 C CE3 . TRP A 1 180 ? 43.648  13.602 106.399 1.00 22.59  ? 1058 TRP A CE3 1 
ATOM   1371 C CZ2 . TRP A 1 180 ? 41.367  13.853 108.015 1.00 25.00  ? 1058 TRP A CZ2 1 
ATOM   1372 C CZ3 . TRP A 1 180 ? 43.726  14.214 107.615 1.00 23.49  ? 1058 TRP A CZ3 1 
ATOM   1373 C CH2 . TRP A 1 180 ? 42.589  14.362 108.406 1.00 24.82  ? 1058 TRP A CH2 1 
ATOM   1374 N N   . VAL A 1 181 ? 44.648  13.878 101.116 1.00 31.94  ? 1059 VAL A N   1 
ATOM   1375 C CA  . VAL A 1 181 ? 45.565  13.756 99.965  1.00 30.57  ? 1059 VAL A CA  1 
ATOM   1376 C C   . VAL A 1 181 ? 46.948  14.263 100.362 1.00 37.36  ? 1059 VAL A C   1 
ATOM   1377 O O   . VAL A 1 181 ? 47.072  15.273 101.023 1.00 40.05  ? 1059 VAL A O   1 
ATOM   1378 C CB  . VAL A 1 181 ? 44.948  14.448 98.714  1.00 31.37  ? 1059 VAL A CB  1 
ATOM   1379 C CG1 . VAL A 1 181 ? 46.019  14.791 97.715  1.00 30.76  ? 1059 VAL A CG1 1 
ATOM   1380 C CG2 . VAL A 1 181 ? 43.814  13.568 98.110  1.00 29.63  ? 1059 VAL A CG2 1 
ATOM   1381 N N   . ARG A 1 182 ? 47.965  13.461 100.144 1.00 38.04  ? 1060 ARG A N   1 
ATOM   1382 C CA  . ARG A 1 182 ? 49.309  13.796 100.612 1.00 41.49  ? 1060 ARG A CA  1 
ATOM   1383 C C   . ARG A 1 182 ? 49.900  15.019 99.958  1.00 49.82  ? 1060 ARG A C   1 
ATOM   1384 O O   . ARG A 1 182 ? 49.600  15.327 98.812  1.00 49.88  ? 1060 ARG A O   1 
ATOM   1385 C CB  . ARG A 1 182 ? 50.258  12.609 100.393 1.00 48.80  ? 1060 ARG A CB  1 
ATOM   1386 C CG  . ARG A 1 182 ? 50.649  11.849 101.677 1.00 70.29  ? 1060 ARG A CG  1 
ATOM   1387 C CD  . ARG A 1 182 ? 51.457  12.724 102.635 1.00 90.40  ? 1060 ARG A CD  1 
ATOM   1388 N NE  . ARG A 1 182 ? 52.405  11.972 103.463 1.00 98.99  ? 1060 ARG A NE  1 
ATOM   1389 C CZ  . ARG A 1 182 ? 52.072  10.980 104.289 1.00 107.10 ? 1060 ARG A CZ  1 
ATOM   1390 N NH1 . ARG A 1 182 ? 50.808  10.583 104.403 1.00 67.40  ? 1060 ARG A NH1 1 
ATOM   1391 N NH2 . ARG A 1 182 ? 53.012  10.378 105.007 1.00 106.38 ? 1060 ARG A NH2 1 
ATOM   1392 N N   . LYS A 1 183 ? 50.784  15.684 100.682 1.00 51.19  ? 1061 LYS A N   1 
ATOM   1393 C CA  . LYS A 1 183 ? 51.479  16.882 100.192 1.00 54.39  ? 1061 LYS A CA  1 
ATOM   1394 C C   . LYS A 1 183 ? 52.957  16.515 100.194 1.00 69.49  ? 1061 LYS A C   1 
ATOM   1395 O O   . LYS A 1 183 ? 53.725  17.047 100.971 1.00 72.24  ? 1061 LYS A O   1 
ATOM   1396 C CB  . LYS A 1 183 ? 51.279  18.020 101.207 1.00 55.22  ? 1061 LYS A CB  1 
ATOM   1397 C CG  . LYS A 1 183 ? 50.832  19.348 100.641 1.00 58.53  ? 1061 LYS A CG  1 
ATOM   1398 C CD  . LYS A 1 183 ? 51.290  20.493 101.545 1.00 65.05  ? 1061 LYS A CD  1 
ATOM   1399 C CE  . LYS A 1 183 ? 50.968  21.841 100.931 1.00 69.52  ? 1061 LYS A CE  1 
ATOM   1400 N NZ  . LYS A 1 183 ? 49.747  21.758 100.074 1.00 84.75  ? 1061 LYS A NZ  1 
ATOM   1401 N N   . THR A 1 184 ? 53.302  15.542 99.345  1.00 72.33  ? 1062 THR A N   1 
ATOM   1402 C CA  . THR A 1 184 ? 54.652  14.973 99.227  1.00 75.41  ? 1062 THR A CA  1 
ATOM   1403 C C   . THR A 1 184 ? 55.075  14.725 97.772  1.00 87.57  ? 1062 THR A C   1 
ATOM   1404 O O   . THR A 1 184 ? 54.238  14.729 96.869  1.00 88.74  ? 1062 THR A O   1 
ATOM   1405 C CB  . THR A 1 184 ? 54.778  13.656 100.017 1.00 83.05  ? 1062 THR A CB  1 
ATOM   1406 O OG1 . THR A 1 184 ? 53.849  12.695 99.501  1.00 90.97  ? 1062 THR A OG1 1 
ATOM   1407 C CG2 . THR A 1 184 ? 54.491  13.890 101.493 1.00 74.94  ? 1062 THR A CG2 1 
ATOM   1408 N N   . PRO A 1 185 ? 56.375  14.526 97.551  1.00 86.69  ? 1063 PRO A N   1 
ATOM   1409 C CA  . PRO A 1 185 ? 56.911  14.338 96.199  1.00 92.99  ? 1063 PRO A CA  1 
ATOM   1410 C C   . PRO A 1 185 ? 55.879  14.675 95.128  1.00 150.67 ? 1063 PRO A C   1 
ATOM   1411 O O   . PRO A 1 185 ? 55.666  15.856 94.856  1.00 113.38 ? 1063 PRO A O   1 
ATOM   1412 C CB  . PRO A 1 185 ? 57.238  12.844 96.163  1.00 93.86  ? 1063 PRO A CB  1 
ATOM   1413 C CG  . PRO A 1 185 ? 57.519  12.493 97.580  1.00 95.95  ? 1063 PRO A CG  1 
ATOM   1414 C CD  . PRO A 1 185 ? 56.601  13.349 98.407  1.00 89.86  ? 1063 PRO A CD  1 
ATOM   1415 N N   . LEU B 2 1   ? 89.960  67.177 88.632  1.00 80.44  ? 39   LEU B N   1 
ATOM   1416 C CA  . LEU B 2 1   ? 88.637  66.818 89.177  1.00 80.32  ? 39   LEU B CA  1 
ATOM   1417 C C   . LEU B 2 1   ? 87.775  68.008 89.626  1.00 81.86  ? 39   LEU B C   1 
ATOM   1418 O O   . LEU B 2 1   ? 88.016  68.616 90.666  1.00 80.26  ? 39   LEU B O   1 
ATOM   1419 C CB  . LEU B 2 1   ? 88.752  65.769 90.309  1.00 80.42  ? 39   LEU B CB  1 
ATOM   1420 C CG  . LEU B 2 1   ? 87.942  64.452 90.231  1.00 84.61  ? 39   LEU B CG  1 
ATOM   1421 C CD1 . LEU B 2 1   ? 86.832  64.394 91.275  1.00 84.77  ? 39   LEU B CD1 1 
ATOM   1422 C CD2 . LEU B 2 1   ? 87.408  64.099 88.841  1.00 85.01  ? 39   LEU B CD2 1 
ATOM   1423 N N   . ASP B 2 2   ? 86.746  68.305 88.843  1.00 78.98  ? 40   ASP B N   1 
ATOM   1424 C CA  . ASP B 2 2   ? 85.808  69.385 89.155  1.00 79.10  ? 40   ASP B CA  1 
ATOM   1425 C C   . ASP B 2 2   ? 85.197  69.197 90.551  1.00 82.90  ? 40   ASP B C   1 
ATOM   1426 O O   . ASP B 2 2   ? 85.269  68.115 91.140  1.00 82.94  ? 40   ASP B O   1 
ATOM   1427 C CB  . ASP B 2 2   ? 84.681  69.370 88.127  1.00 81.31  ? 40   ASP B CB  1 
ATOM   1428 C CG  . ASP B 2 2   ? 84.193  70.754 87.774  1.00 95.23  ? 40   ASP B CG  1 
ATOM   1429 O OD1 . ASP B 2 2   ? 83.013  71.081 88.073  1.00 98.34  ? 40   ASP B OD1 1 
ATOM   1430 O OD2 . ASP B 2 2   ? 84.974  71.499 87.149  1.00 98.09  ? 40   ASP B OD2 1 
ATOM   1431 N N   . PRO B 2 3   ? 84.540  70.240 91.078  1.00 78.80  ? 41   PRO B N   1 
ATOM   1432 C CA  . PRO B 2 3   ? 83.952  70.000 92.392  1.00 76.91  ? 41   PRO B CA  1 
ATOM   1433 C C   . PRO B 2 3   ? 82.462  69.746 92.191  1.00 77.71  ? 41   PRO B C   1 
ATOM   1434 O O   . PRO B 2 3   ? 81.751  69.373 93.117  1.00 77.26  ? 41   PRO B O   1 
ATOM   1435 C CB  . PRO B 2 3   ? 84.184  71.332 93.100  1.00 78.28  ? 41   PRO B CB  1 
ATOM   1436 C CG  . PRO B 2 3   ? 83.954  72.329 92.014  1.00 83.76  ? 41   PRO B CG  1 
ATOM   1437 C CD  . PRO B 2 3   ? 84.356  71.653 90.690  1.00 80.47  ? 41   PRO B CD  1 
ATOM   1438 N N   . GLU B 2 4   ? 81.986  69.953 90.972  1.00 72.11  ? 42   GLU B N   1 
ATOM   1439 C CA  . GLU B 2 4   ? 80.595  69.659 90.703  1.00 72.09  ? 42   GLU B CA  1 
ATOM   1440 C C   . GLU B 2 4   ? 80.476  68.172 90.342  1.00 75.63  ? 42   GLU B C   1 
ATOM   1441 O O   . GLU B 2 4   ? 79.405  67.560 90.502  1.00 75.65  ? 42   GLU B O   1 
ATOM   1442 C CB  . GLU B 2 4   ? 79.995  70.563 89.628  1.00 73.31  ? 42   GLU B CB  1 
ATOM   1443 C CG  . GLU B 2 4   ? 78.493  70.824 89.829  1.00 87.74  ? 42   GLU B CG  1 
ATOM   1444 C CD  . GLU B 2 4   ? 78.128  71.195 91.278  1.00 126.57 ? 42   GLU B CD  1 
ATOM   1445 O OE1 . GLU B 2 4   ? 76.917  71.165 91.604  1.00 127.21 ? 42   GLU B OE1 1 
ATOM   1446 O OE2 . GLU B 2 4   ? 79.036  71.521 92.090  1.00 124.49 ? 42   GLU B OE2 1 
ATOM   1447 N N   . GLU B 2 5   ? 81.588  67.595 89.883  1.00 69.04  ? 43   GLU B N   1 
ATOM   1448 C CA  . GLU B 2 5   ? 81.609  66.185 89.586  1.00 67.17  ? 43   GLU B CA  1 
ATOM   1449 C C   . GLU B 2 5   ? 81.877  65.442 90.890  1.00 69.09  ? 43   GLU B C   1 
ATOM   1450 O O   . GLU B 2 5   ? 81.165  64.480 91.205  1.00 70.23  ? 43   GLU B O   1 
ATOM   1451 C CB  . GLU B 2 5   ? 82.649  65.826 88.543  1.00 67.99  ? 43   GLU B CB  1 
ATOM   1452 C CG  . GLU B 2 5   ? 82.910  64.326 88.466  1.00 73.93  ? 43   GLU B CG  1 
ATOM   1453 C CD  . GLU B 2 5   ? 81.824  63.531 87.724  1.00 87.94  ? 43   GLU B CD  1 
ATOM   1454 O OE1 . GLU B 2 5   ? 80.882  64.137 87.137  1.00 74.33  ? 43   GLU B OE1 1 
ATOM   1455 O OE2 . GLU B 2 5   ? 81.955  62.281 87.702  1.00 73.25  ? 43   GLU B OE2 1 
ATOM   1456 N N   . ILE B 2 6   ? 82.860  65.904 91.665  1.00 60.22  ? 44   ILE B N   1 
ATOM   1457 C CA  . ILE B 2 6   ? 83.127  65.282 92.947  1.00 58.14  ? 44   ILE B CA  1 
ATOM   1458 C C   . ILE B 2 6   ? 81.844  65.165 93.742  1.00 66.19  ? 44   ILE B C   1 
ATOM   1459 O O   . ILE B 2 6   ? 81.534  64.113 94.287  1.00 67.50  ? 44   ILE B O   1 
ATOM   1460 C CB  . ILE B 2 6   ? 84.029  66.116 93.799  1.00 59.88  ? 44   ILE B CB  1 
ATOM   1461 C CG1 . ILE B 2 6   ? 85.452  66.153 93.241  1.00 60.68  ? 44   ILE B CG1 1 
ATOM   1462 C CG2 . ILE B 2 6   ? 83.956  65.619 95.227  1.00 57.51  ? 44   ILE B CG2 1 
ATOM   1463 C CD1 . ILE B 2 6   ? 86.487  66.706 94.238  1.00 58.51  ? 44   ILE B CD1 1 
ATOM   1464 N N   . ARG B 2 7   ? 81.121  66.271 93.870  1.00 63.88  ? 45   ARG B N   1 
ATOM   1465 C CA  . ARG B 2 7   ? 79.916  66.261 94.686  1.00 62.68  ? 45   ARG B CA  1 
ATOM   1466 C C   . ARG B 2 7   ? 78.829  65.350 94.146  1.00 64.55  ? 45   ARG B C   1 
ATOM   1467 O O   . ARG B 2 7   ? 78.183  64.644 94.917  1.00 65.61  ? 45   ARG B O   1 
ATOM   1468 C CB  . ARG B 2 7   ? 79.444  67.675 95.094  1.00 62.46  ? 45   ARG B CB  1 
ATOM   1469 C CG  . ARG B 2 7   ? 78.542  68.409 94.100  1.00 75.89  ? 45   ARG B CG  1 
ATOM   1470 C CD  . ARG B 2 7   ? 77.467  69.237 94.812  1.00 85.13  ? 45   ARG B CD  1 
ATOM   1471 N NE  . ARG B 2 7   ? 76.113  68.816 94.440  1.00 99.51  ? 45   ARG B NE  1 
ATOM   1472 C CZ  . ARG B 2 7   ? 75.708  68.598 93.188  1.00 118.18 ? 45   ARG B CZ  1 
ATOM   1473 N NH1 . ARG B 2 7   ? 74.456  68.213 92.953  1.00 100.03 ? 45   ARG B NH1 1 
ATOM   1474 N NH2 . ARG B 2 7   ? 76.553  68.760 92.168  1.00 108.73 ? 45   ARG B NH2 1 
ATOM   1475 N N   . LYS B 2 8   ? 78.702  65.290 92.823  1.00 58.24  ? 46   LYS B N   1 
ATOM   1476 C CA  . LYS B 2 8   ? 77.688  64.451 92.181  1.00 57.15  ? 46   LYS B CA  1 
ATOM   1477 C C   . LYS B 2 8   ? 77.955  62.939 92.414  1.00 61.11  ? 46   LYS B C   1 
ATOM   1478 O O   . LYS B 2 8   ? 77.024  62.142 92.648  1.00 60.82  ? 46   LYS B O   1 
ATOM   1479 C CB  . LYS B 2 8   ? 77.573  64.789 90.684  1.00 57.69  ? 46   LYS B CB  1 
ATOM   1480 C CG  . LYS B 2 8   ? 78.388  63.870 89.783  1.00 70.89  ? 46   LYS B CG  1 
ATOM   1481 C CD  . LYS B 2 8   ? 77.493  62.973 88.909  1.00 82.31  ? 46   LYS B CD  1 
ATOM   1482 C CE  . LYS B 2 8   ? 77.332  63.511 87.487  1.00 89.61  ? 46   LYS B CE  1 
ATOM   1483 N NZ  . LYS B 2 8   ? 77.081  64.989 87.494  1.00 102.23 ? 46   LYS B NZ  1 
ATOM   1484 N N   . ARG B 2 9   ? 79.237  62.582 92.363  1.00 55.16  ? 47   ARG B N   1 
ATOM   1485 C CA  . ARG B 2 9   ? 79.720  61.239 92.620  1.00 53.35  ? 47   ARG B CA  1 
ATOM   1486 C C   . ARG B 2 9   ? 79.363  60.872 94.070  1.00 59.75  ? 47   ARG B C   1 
ATOM   1487 O O   . ARG B 2 9   ? 78.510  60.002 94.324  1.00 61.23  ? 47   ARG B O   1 
ATOM   1488 C CB  . ARG B 2 9   ? 81.244  61.221 92.449  1.00 47.82  ? 47   ARG B CB  1 
ATOM   1489 C CG  . ARG B 2 9   ? 81.733  61.100 91.002  1.00 47.83  ? 47   ARG B CG  1 
ATOM   1490 C CD  . ARG B 2 9   ? 83.261  60.916 90.950  1.00 50.00  ? 47   ARG B CD  1 
ATOM   1491 N NE  . ARG B 2 9   ? 83.784  60.799 89.581  1.00 42.48  ? 47   ARG B NE  1 
ATOM   1492 C CZ  . ARG B 2 9   ? 84.979  60.291 89.273  1.00 50.87  ? 47   ARG B CZ  1 
ATOM   1493 N NH1 . ARG B 2 9   ? 85.382  60.199 88.020  1.00 47.93  ? 47   ARG B NH1 1 
ATOM   1494 N NH2 . ARG B 2 9   ? 85.781  59.841 90.202  1.00 35.36  ? 47   ARG B NH2 1 
ATOM   1495 N N   . LEU B 2 10  ? 80.012  61.551 95.014  1.00 54.88  ? 48   LEU B N   1 
ATOM   1496 C CA  . LEU B 2 10  ? 79.760  61.372 96.436  1.00 53.38  ? 48   LEU B CA  1 
ATOM   1497 C C   . LEU B 2 10  ? 78.265  61.346 96.745  1.00 57.57  ? 48   LEU B C   1 
ATOM   1498 O O   . LEU B 2 10  ? 77.821  60.641 97.632  1.00 57.25  ? 48   LEU B O   1 
ATOM   1499 C CB  . LEU B 2 10  ? 80.391  62.530 97.188  1.00 52.84  ? 48   LEU B CB  1 
ATOM   1500 C CG  . LEU B 2 10  ? 81.899  62.385 97.189  1.00 56.84  ? 48   LEU B CG  1 
ATOM   1501 C CD1 . LEU B 2 10  ? 82.540  63.178 98.310  1.00 57.63  ? 48   LEU B CD1 1 
ATOM   1502 C CD2 . LEU B 2 10  ? 82.178  60.943 97.361  1.00 56.83  ? 48   LEU B CD2 1 
ATOM   1503 N N   . GLU B 2 11  ? 77.506  62.148 96.022  1.00 55.69  ? 49   GLU B N   1 
ATOM   1504 C CA  . GLU B 2 11  ? 76.066  62.245 96.207  1.00 56.91  ? 49   GLU B CA  1 
ATOM   1505 C C   . GLU B 2 11  ? 75.392  60.932 95.833  1.00 59.19  ? 49   GLU B C   1 
ATOM   1506 O O   . GLU B 2 11  ? 74.592  60.405 96.619  1.00 58.78  ? 49   GLU B O   1 
ATOM   1507 C CB  . GLU B 2 11  ? 75.532  63.355 95.304  1.00 59.19  ? 49   GLU B CB  1 
ATOM   1508 C CG  . GLU B 2 11  ? 74.100  63.773 95.514  1.00 75.49  ? 49   GLU B CG  1 
ATOM   1509 C CD  . GLU B 2 11  ? 73.801  65.051 94.747  1.00 103.06 ? 49   GLU B CD  1 
ATOM   1510 O OE1 . GLU B 2 11  ? 73.055  64.988 93.735  1.00 94.02  ? 49   GLU B OE1 1 
ATOM   1511 O OE2 . GLU B 2 11  ? 74.412  66.092 95.099  1.00 99.58  ? 49   GLU B OE2 1 
ATOM   1512 N N   . HIS B 2 12  ? 75.721  60.423 94.632  1.00 52.80  ? 50   HIS B N   1 
ATOM   1513 C CA  . HIS B 2 12  ? 75.166  59.172 94.096  1.00 50.12  ? 50   HIS B CA  1 
ATOM   1514 C C   . HIS B 2 12  ? 75.434  58.010 95.027  1.00 53.37  ? 50   HIS B C   1 
ATOM   1515 O O   . HIS B 2 12  ? 74.549  57.190 95.315  1.00 51.69  ? 50   HIS B O   1 
ATOM   1516 C CB  . HIS B 2 12  ? 75.787  58.853 92.754  1.00 49.63  ? 50   HIS B CB  1 
ATOM   1517 C CG  . HIS B 2 12  ? 75.126  57.715 92.049  1.00 52.80  ? 50   HIS B CG  1 
ATOM   1518 N ND1 . HIS B 2 12  ? 75.327  56.399 92.410  1.00 54.58  ? 50   HIS B ND1 1 
ATOM   1519 C CD2 . HIS B 2 12  ? 74.267  57.694 91.000  1.00 54.38  ? 50   HIS B CD2 1 
ATOM   1520 C CE1 . HIS B 2 12  ? 74.615  55.618 91.617  1.00 54.04  ? 50   HIS B CE1 1 
ATOM   1521 N NE2 . HIS B 2 12  ? 73.974  56.378 90.743  1.00 54.10  ? 50   HIS B NE2 1 
ATOM   1522 N N   . THR B 2 13  ? 76.677  57.946 95.485  1.00 50.51  ? 51   THR B N   1 
ATOM   1523 C CA  . THR B 2 13  ? 77.109  56.909 96.407  1.00 50.51  ? 51   THR B CA  1 
ATOM   1524 C C   . THR B 2 13  ? 76.238  56.883 97.664  1.00 58.09  ? 51   THR B C   1 
ATOM   1525 O O   . THR B 2 13  ? 75.867  55.820 98.167  1.00 59.66  ? 51   THR B O   1 
ATOM   1526 C CB  . THR B 2 13  ? 78.625  57.040 96.714  1.00 48.83  ? 51   THR B CB  1 
ATOM   1527 O OG1 . THR B 2 13  ? 79.374  56.430 95.658  1.00 50.60  ? 51   THR B OG1 1 
ATOM   1528 C CG2 . THR B 2 13  ? 78.979  56.341 97.977  1.00 43.49  ? 51   THR B CG2 1 
ATOM   1529 N N   . GLU B 2 14  ? 75.863  58.057 98.144  1.00 55.89  ? 52   GLU B N   1 
ATOM   1530 C CA  . GLU B 2 14  ? 75.052  58.160 99.352  1.00 55.82  ? 52   GLU B CA  1 
ATOM   1531 C C   . GLU B 2 14  ? 73.643  57.673 99.101  1.00 56.63  ? 52   GLU B C   1 
ATOM   1532 O O   . GLU B 2 14  ? 73.105  56.888 99.870  1.00 55.51  ? 52   GLU B O   1 
ATOM   1533 C CB  . GLU B 2 14  ? 75.037  59.602 99.846  1.00 57.85  ? 52   GLU B CB  1 
ATOM   1534 C CG  . GLU B 2 14  ? 76.137  59.892 100.850 1.00 74.37  ? 52   GLU B CG  1 
ATOM   1535 C CD  . GLU B 2 14  ? 75.865  59.248 102.190 1.00 113.09 ? 52   GLU B CD  1 
ATOM   1536 O OE1 . GLU B 2 14  ? 76.620  58.314 102.547 1.00 118.14 ? 52   GLU B OE1 1 
ATOM   1537 O OE2 . GLU B 2 14  ? 74.890  59.660 102.872 1.00 111.08 ? 52   GLU B OE2 1 
ATOM   1538 N N   . ARG B 2 15  ? 73.041  58.171 98.033  1.00 52.83  ? 53   ARG B N   1 
ATOM   1539 C CA  . ARG B 2 15  ? 71.708  57.746 97.643  1.00 54.02  ? 53   ARG B CA  1 
ATOM   1540 C C   . ARG B 2 15  ? 71.647  56.198 97.642  1.00 60.94  ? 53   ARG B C   1 
ATOM   1541 O O   . ARG B 2 15  ? 70.654  55.597 98.101  1.00 61.78  ? 53   ARG B O   1 
ATOM   1542 C CB  . ARG B 2 15  ? 71.420  58.242 96.222  1.00 54.81  ? 53   ARG B CB  1 
ATOM   1543 C CG  . ARG B 2 15  ? 70.909  59.639 96.146  1.00 63.74  ? 53   ARG B CG  1 
ATOM   1544 C CD  . ARG B 2 15  ? 69.933  59.751 95.012  1.00 73.95  ? 53   ARG B CD  1 
ATOM   1545 N NE  . ARG B 2 15  ? 70.611  59.713 93.723  1.00 92.04  ? 53   ARG B NE  1 
ATOM   1546 C CZ  . ARG B 2 15  ? 71.615  60.514 93.378  1.00 102.87 ? 53   ARG B CZ  1 
ATOM   1547 N NH1 . ARG B 2 15  ? 72.090  61.407 94.237  1.00 89.53  ? 53   ARG B NH1 1 
ATOM   1548 N NH2 . ARG B 2 15  ? 72.153  60.410 92.172  1.00 84.67  ? 53   ARG B NH2 1 
ATOM   1549 N N   . GLN B 2 16  ? 72.709  55.581 97.101  1.00 56.67  ? 54   GLN B N   1 
ATOM   1550 C CA  . GLN B 2 16  ? 72.854  54.122 97.022  1.00 55.02  ? 54   GLN B CA  1 
ATOM   1551 C C   . GLN B 2 16  ? 73.034  53.523 98.412  1.00 56.84  ? 54   GLN B C   1 
ATOM   1552 O O   . GLN B 2 16  ? 72.296  52.632 98.825  1.00 56.65  ? 54   GLN B O   1 
ATOM   1553 C CB  . GLN B 2 16  ? 74.057  53.734 96.154  1.00 55.16  ? 54   GLN B CB  1 
ATOM   1554 C CG  . GLN B 2 16  ? 73.838  53.974 94.699  1.00 41.32  ? 54   GLN B CG  1 
ATOM   1555 C CD  . GLN B 2 16  ? 72.697  53.137 94.148  1.00 52.61  ? 54   GLN B CD  1 
ATOM   1556 O OE1 . GLN B 2 16  ? 71.734  53.679 93.572  1.00 42.87  ? 54   GLN B OE1 1 
ATOM   1557 N NE2 . GLN B 2 16  ? 72.863  51.804 94.186  1.00 46.85  ? 54   GLN B NE2 1 
ATOM   1558 N N   . PHE B 2 17  ? 74.033  53.993 99.131  1.00 52.13  ? 55   PHE B N   1 
ATOM   1559 C CA  . PHE B 2 17  ? 74.272  53.453 100.465 1.00 52.53  ? 55   PHE B CA  1 
ATOM   1560 C C   . PHE B 2 17  ? 73.020  53.535 101.391 1.00 61.28  ? 55   PHE B C   1 
ATOM   1561 O O   . PHE B 2 17  ? 72.832  52.712 102.306 1.00 62.31  ? 55   PHE B O   1 
ATOM   1562 C CB  . PHE B 2 17  ? 75.431  54.194 101.098 1.00 52.91  ? 55   PHE B CB  1 
ATOM   1563 C CG  . PHE B 2 17  ? 75.646  53.839 102.513 1.00 54.05  ? 55   PHE B CG  1 
ATOM   1564 C CD1 . PHE B 2 17  ? 75.427  54.759 103.508 1.00 58.83  ? 55   PHE B CD1 1 
ATOM   1565 C CD2 . PHE B 2 17  ? 76.001  52.567 102.857 1.00 56.25  ? 55   PHE B CD2 1 
ATOM   1566 C CE1 . PHE B 2 17  ? 75.615  54.413 104.836 1.00 60.03  ? 55   PHE B CE1 1 
ATOM   1567 C CE2 . PHE B 2 17  ? 76.200  52.216 104.170 1.00 59.59  ? 55   PHE B CE2 1 
ATOM   1568 C CZ  . PHE B 2 17  ? 75.991  53.126 105.162 1.00 58.54  ? 55   PHE B CZ  1 
ATOM   1569 N N   . ARG B 2 18  ? 72.154  54.516 101.140 1.00 57.40  ? 56   ARG B N   1 
ATOM   1570 C CA  . ARG B 2 18  ? 70.990  54.711 101.983 1.00 56.76  ? 56   ARG B CA  1 
ATOM   1571 C C   . ARG B 2 18  ? 69.679  54.221 101.435 1.00 60.49  ? 56   ARG B C   1 
ATOM   1572 O O   . ARG B 2 18  ? 68.679  54.279 102.135 1.00 60.95  ? 56   ARG B O   1 
ATOM   1573 C CB  . ARG B 2 18  ? 70.873  56.164 102.432 1.00 57.90  ? 56   ARG B CB  1 
ATOM   1574 C CG  . ARG B 2 18  ? 72.225  56.884 102.518 1.00 71.56  ? 56   ARG B CG  1 
ATOM   1575 C CD  . ARG B 2 18  ? 72.297  57.859 103.680 1.00 82.27  ? 56   ARG B CD  1 
ATOM   1576 N NE  . ARG B 2 18  ? 72.753  57.212 104.912 1.00 96.54  ? 56   ARG B NE  1 
ATOM   1577 C CZ  . ARG B 2 18  ? 73.542  57.785 105.820 1.00 113.66 ? 56   ARG B CZ  1 
ATOM   1578 N NH1 . ARG B 2 18  ? 73.972  59.027 105.640 1.00 104.37 ? 56   ARG B NH1 1 
ATOM   1579 N NH2 . ARG B 2 18  ? 73.888  57.123 106.920 1.00 97.20  ? 56   ARG B NH2 1 
ATOM   1580 N N   . ASN B 2 19  ? 69.662  53.728 100.203 1.00 57.39  ? 57   ASN B N   1 
ATOM   1581 C CA  . ASN B 2 19  ? 68.419  53.184 99.672  1.00 57.44  ? 57   ASN B CA  1 
ATOM   1582 C C   . ASN B 2 19  ? 68.195  51.787 100.237 1.00 63.22  ? 57   ASN B C   1 
ATOM   1583 O O   . ASN B 2 19  ? 68.289  50.771 99.517  1.00 61.88  ? 57   ASN B O   1 
ATOM   1584 C CB  . ASN B 2 19  ? 68.367  53.171 98.147  1.00 58.14  ? 57   ASN B CB  1 
ATOM   1585 C CG  . ASN B 2 19  ? 66.935  53.038 97.616  1.00 75.51  ? 57   ASN B CG  1 
ATOM   1586 O OD1 . ASN B 2 19  ? 66.028  53.802 97.991  1.00 68.45  ? 57   ASN B OD1 1 
ATOM   1587 N ND2 . ASN B 2 19  ? 66.725  52.062 96.751  1.00 67.49  ? 57   ASN B ND2 1 
ATOM   1588 N N   . ARG B 2 20  ? 67.971  51.763 101.558 1.00 61.39  ? 58   ARG B N   1 
ATOM   1589 C CA  . ARG B 2 20  ? 67.666  50.561 102.336 1.00 60.48  ? 58   ARG B CA  1 
ATOM   1590 C C   . ARG B 2 20  ? 66.116  50.553 102.419 1.00 62.33  ? 58   ARG B C   1 
ATOM   1591 O O   . ARG B 2 20  ? 65.499  51.308 103.187 1.00 60.35  ? 58   ARG B O   1 
ATOM   1592 C CB  . ARG B 2 20  ? 68.304  50.662 103.727 1.00 59.20  ? 58   ARG B CB  1 
ATOM   1593 C CG  . ARG B 2 20  ? 69.840  50.633 103.732 1.00 72.30  ? 58   ARG B CG  1 
ATOM   1594 C CD  . ARG B 2 20  ? 70.428  49.213 103.862 1.00 78.76  ? 58   ARG B CD  1 
ATOM   1595 N NE  . ARG B 2 20  ? 70.338  48.668 105.223 1.00 83.39  ? 58   ARG B NE  1 
ATOM   1596 C CZ  . ARG B 2 20  ? 70.174  47.373 105.515 1.00 100.86 ? 58   ARG B CZ  1 
ATOM   1597 N NH1 . ARG B 2 20  ? 70.110  46.459 104.537 1.00 91.84  ? 58   ARG B NH1 1 
ATOM   1598 N NH2 . ARG B 2 20  ? 70.075  46.987 106.791 1.00 82.89  ? 58   ARG B NH2 1 
ATOM   1599 N N   . ARG B 2 21  ? 65.518  49.767 101.528 1.00 58.22  ? 59   ARG B N   1 
ATOM   1600 C CA  . ARG B 2 21  ? 64.074  49.676 101.353 1.00 57.48  ? 59   ARG B CA  1 
ATOM   1601 C C   . ARG B 2 21  ? 63.532  48.285 101.767 1.00 59.36  ? 59   ARG B C   1 
ATOM   1602 O O   . ARG B 2 21  ? 62.398  47.928 101.443 1.00 58.34  ? 59   ARG B O   1 
ATOM   1603 C CB  . ARG B 2 21  ? 63.734  49.997 99.869  1.00 56.46  ? 59   ARG B CB  1 
ATOM   1604 C CG  . ARG B 2 21  ? 64.069  48.868 98.877  1.00 57.09  ? 59   ARG B CG  1 
ATOM   1605 C CD  . ARG B 2 21  ? 64.210  49.280 97.378  1.00 48.60  ? 59   ARG B CD  1 
ATOM   1606 N NE  . ARG B 2 21  ? 64.340  48.043 96.596  1.00 51.44  ? 59   ARG B NE  1 
ATOM   1607 C CZ  . ARG B 2 21  ? 63.636  47.752 95.504  1.00 68.00  ? 59   ARG B CZ  1 
ATOM   1608 N NH1 . ARG B 2 21  ? 62.786  48.640 94.985  1.00 57.48  ? 59   ARG B NH1 1 
ATOM   1609 N NH2 . ARG B 2 21  ? 63.790  46.569 94.918  1.00 47.95  ? 59   ARG B NH2 1 
ATOM   1610 N N   . LYS B 2 22  ? 64.355  47.507 102.478 1.00 53.74  ? 60   LYS B N   1 
ATOM   1611 C CA  . LYS B 2 22  ? 63.942  46.188 102.938 1.00 51.68  ? 60   LYS B CA  1 
ATOM   1612 C C   . LYS B 2 22  ? 63.641  46.268 104.459 1.00 52.77  ? 60   LYS B C   1 
ATOM   1613 O O   . LYS B 2 22  ? 64.481  46.701 105.269 1.00 50.95  ? 60   LYS B O   1 
ATOM   1614 C CB  . LYS B 2 22  ? 64.988  45.092 102.572 1.00 53.41  ? 60   LYS B CB  1 
ATOM   1615 C CG  . LYS B 2 22  ? 64.867  44.439 101.144 1.00 59.42  ? 60   LYS B CG  1 
ATOM   1616 C CD  . LYS B 2 22  ? 65.383  42.947 101.104 1.00 63.22  ? 60   LYS B CD  1 
ATOM   1617 C CE  . LYS B 2 22  ? 65.758  42.428 99.672  1.00 63.91  ? 60   LYS B CE  1 
ATOM   1618 N NZ  . LYS B 2 22  ? 65.020  41.201 99.088  1.00 57.68  ? 60   LYS B NZ  1 
ATOM   1619 N N   . ILE B 2 23  ? 62.412  45.896 104.835 1.00 47.32  ? 61   ILE B N   1 
ATOM   1620 C CA  . ILE B 2 23  ? 61.983  45.933 106.247 1.00 44.54  ? 61   ILE B CA  1 
ATOM   1621 C C   . ILE B 2 23  ? 61.634  44.555 106.801 1.00 44.78  ? 61   ILE B C   1 
ATOM   1622 O O   . ILE B 2 23  ? 61.334  43.633 106.050 1.00 42.81  ? 61   ILE B O   1 
ATOM   1623 C CB  . ILE B 2 23  ? 60.834  46.941 106.459 1.00 46.11  ? 61   ILE B CB  1 
ATOM   1624 C CG1 . ILE B 2 23  ? 59.485  46.330 106.073 1.00 44.74  ? 61   ILE B CG1 1 
ATOM   1625 C CG2 . ILE B 2 23  ? 61.040  48.134 105.548 1.00 47.49  ? 61   ILE B CG2 1 
ATOM   1626 C CD1 . ILE B 2 23  ? 58.247  47.074 106.671 1.00 38.41  ? 61   ILE B CD1 1 
ATOM   1627 N N   . LEU B 2 24  ? 61.685  44.442 108.123 1.00 41.29  ? 62   LEU B N   1 
ATOM   1628 C CA  . LEU B 2 24  ? 61.357  43.212 108.832 1.00 41.89  ? 62   LEU B CA  1 
ATOM   1629 C C   . LEU B 2 24  ? 60.262  43.512 109.861 1.00 45.76  ? 62   LEU B C   1 
ATOM   1630 O O   . LEU B 2 24  ? 60.413  44.406 110.688 1.00 45.01  ? 62   LEU B O   1 
ATOM   1631 C CB  . LEU B 2 24  ? 62.597  42.703 109.579 1.00 42.06  ? 62   LEU B CB  1 
ATOM   1632 C CG  . LEU B 2 24  ? 62.666  41.400 110.399 1.00 46.88  ? 62   LEU B CG  1 
ATOM   1633 C CD1 . LEU B 2 24  ? 61.977  40.171 109.735 1.00 48.05  ? 62   LEU B CD1 1 
ATOM   1634 C CD2 . LEU B 2 24  ? 64.132  41.085 110.690 1.00 45.66  ? 62   LEU B CD2 1 
ATOM   1635 N N   . ILE B 2 25  ? 59.175  42.746 109.826 1.00 41.22  ? 63   ILE B N   1 
ATOM   1636 C CA  . ILE B 2 25  ? 58.105  42.885 110.810 1.00 39.67  ? 63   ILE B CA  1 
ATOM   1637 C C   . ILE B 2 25  ? 58.100  41.644 111.686 1.00 45.35  ? 63   ILE B C   1 
ATOM   1638 O O   . ILE B 2 25  ? 57.840  40.561 111.200 1.00 47.89  ? 63   ILE B O   1 
ATOM   1639 C CB  . ILE B 2 25  ? 56.756  42.949 110.131 1.00 40.96  ? 63   ILE B CB  1 
ATOM   1640 C CG1 . ILE B 2 25  ? 56.686  44.097 109.152 1.00 39.50  ? 63   ILE B CG1 1 
ATOM   1641 C CG2 . ILE B 2 25  ? 55.646  42.979 111.132 1.00 39.77  ? 63   ILE B CG2 1 
ATOM   1642 C CD1 . ILE B 2 25  ? 55.418  44.026 108.343 1.00 35.75  ? 63   ILE B CD1 1 
ATOM   1643 N N   . ARG B 2 26  ? 58.347  41.779 112.976 1.00 41.63  ? 64   ARG B N   1 
ATOM   1644 C CA  . ARG B 2 26  ? 58.272  40.620 113.865 1.00 41.69  ? 64   ARG B CA  1 
ATOM   1645 C C   . ARG B 2 26  ? 57.094  40.845 114.814 1.00 43.48  ? 64   ARG B C   1 
ATOM   1646 O O   . ARG B 2 26  ? 56.678  41.983 115.027 1.00 42.94  ? 64   ARG B O   1 
ATOM   1647 C CB  . ARG B 2 26  ? 59.569  40.397 114.680 1.00 42.25  ? 64   ARG B CB  1 
ATOM   1648 C CG  . ARG B 2 26  ? 60.762  41.265 114.270 1.00 59.94  ? 64   ARG B CG  1 
ATOM   1649 C CD  . ARG B 2 26  ? 62.084  40.811 114.906 1.00 70.69  ? 64   ARG B CD  1 
ATOM   1650 N NE  . ARG B 2 26  ? 62.571  39.570 114.299 1.00 87.24  ? 64   ARG B NE  1 
ATOM   1651 C CZ  . ARG B 2 26  ? 63.846  39.306 114.005 1.00 96.71  ? 64   ARG B CZ  1 
ATOM   1652 N NH1 . ARG B 2 26  ? 64.789  40.208 114.258 1.00 74.11  ? 64   ARG B NH1 1 
ATOM   1653 N NH2 . ARG B 2 26  ? 64.177  38.137 113.445 1.00 79.54  ? 64   ARG B NH2 1 
ATOM   1654 N N   . GLY B 2 27  ? 56.571  39.751 115.374 1.00 36.96  ? 65   GLY B N   1 
ATOM   1655 C CA  . GLY B 2 27  ? 55.516  39.765 116.356 1.00 34.22  ? 65   GLY B CA  1 
ATOM   1656 C C   . GLY B 2 27  ? 54.167  39.487 115.792 1.00 38.17  ? 65   GLY B C   1 
ATOM   1657 O O   . GLY B 2 27  ? 53.175  39.648 116.485 1.00 39.12  ? 65   GLY B O   1 
ATOM   1658 N N   . LEU B 2 28  ? 54.118  39.131 114.514 1.00 35.65  ? 66   LEU B N   1 
ATOM   1659 C CA  . LEU B 2 28  ? 52.832  38.906 113.839 1.00 35.23  ? 66   LEU B CA  1 
ATOM   1660 C C   . LEU B 2 28  ? 52.076  37.730 114.434 1.00 39.23  ? 66   LEU B C   1 
ATOM   1661 O O   . LEU B 2 28  ? 52.676  36.851 115.051 1.00 40.66  ? 66   LEU B O   1 
ATOM   1662 C CB  . LEU B 2 28  ? 53.043  38.707 112.341 1.00 34.38  ? 66   LEU B CB  1 
ATOM   1663 C CG  . LEU B 2 28  ? 53.429  39.971 111.581 1.00 37.68  ? 66   LEU B CG  1 
ATOM   1664 C CD1 . LEU B 2 28  ? 53.992  39.545 110.291 1.00 36.98  ? 66   LEU B CD1 1 
ATOM   1665 C CD2 . LEU B 2 28  ? 52.254  40.885 111.331 1.00 40.19  ? 66   LEU B CD2 1 
ATOM   1666 N N   . PRO B 2 29  ? 50.751  37.707 114.276 1.00 33.94  ? 67   PRO B N   1 
ATOM   1667 C CA  . PRO B 2 29  ? 50.019  36.566 114.854 1.00 34.24  ? 67   PRO B CA  1 
ATOM   1668 C C   . PRO B 2 29  ? 50.408  35.255 114.156 1.00 41.61  ? 67   PRO B C   1 
ATOM   1669 O O   . PRO B 2 29  ? 50.603  35.222 112.926 1.00 44.88  ? 67   PRO B O   1 
ATOM   1670 C CB  . PRO B 2 29  ? 48.542  36.891 114.523 1.00 35.87  ? 67   PRO B CB  1 
ATOM   1671 C CG  . PRO B 2 29  ? 48.517  38.373 114.322 1.00 39.61  ? 67   PRO B CG  1 
ATOM   1672 C CD  . PRO B 2 29  ? 49.848  38.720 113.705 1.00 34.60  ? 67   PRO B CD  1 
ATOM   1673 N N   . GLY B 2 30  ? 50.455  34.158 114.903 1.00 35.66  ? 68   GLY B N   1 
ATOM   1674 C CA  . GLY B 2 30  ? 50.811  32.878 114.309 1.00 34.21  ? 68   GLY B CA  1 
ATOM   1675 C C   . GLY B 2 30  ? 50.020  32.510 113.075 1.00 37.90  ? 68   GLY B C   1 
ATOM   1676 O O   . GLY B 2 30  ? 50.495  31.790 112.194 1.00 37.46  ? 68   GLY B O   1 
ATOM   1677 N N   . ASP B 2 31  ? 48.793  33.001 113.017 1.00 36.17  ? 69   ASP B N   1 
ATOM   1678 C CA  . ASP B 2 31  ? 47.910  32.689 111.909 1.00 35.88  ? 69   ASP B CA  1 
ATOM   1679 C C   . ASP B 2 31  ? 47.757  33.865 110.932 1.00 42.33  ? 69   ASP B C   1 
ATOM   1680 O O   . ASP B 2 31  ? 46.777  33.934 110.153 1.00 43.16  ? 69   ASP B O   1 
ATOM   1681 C CB  . ASP B 2 31  ? 46.559  32.205 112.428 1.00 35.74  ? 69   ASP B CB  1 
ATOM   1682 C CG  . ASP B 2 31  ? 45.798  33.274 113.132 1.00 40.74  ? 69   ASP B CG  1 
ATOM   1683 O OD1 . ASP B 2 31  ? 46.348  34.395 113.254 1.00 43.82  ? 69   ASP B OD1 1 
ATOM   1684 O OD2 . ASP B 2 31  ? 44.614  33.021 113.447 1.00 42.87  ? 69   ASP B OD2 1 
ATOM   1685 N N   . VAL B 2 32  ? 48.746  34.756 110.943 1.00 36.34  ? 70   VAL B N   1 
ATOM   1686 C CA  . VAL B 2 32  ? 48.720  35.868 110.006 1.00 37.06  ? 70   VAL B CA  1 
ATOM   1687 C C   . VAL B 2 32  ? 48.727  35.358 108.548 1.00 45.98  ? 70   VAL B C   1 
ATOM   1688 O O   . VAL B 2 32  ? 49.329  34.338 108.243 1.00 46.27  ? 70   VAL B O   1 
ATOM   1689 C CB  . VAL B 2 32  ? 49.871  36.852 110.278 1.00 38.09  ? 70   VAL B CB  1 
ATOM   1690 C CG1 . VAL B 2 32  ? 51.197  36.211 109.948 1.00 35.96  ? 70   VAL B CG1 1 
ATOM   1691 C CG2 . VAL B 2 32  ? 49.637  38.169 109.525 1.00 37.56  ? 70   VAL B CG2 1 
ATOM   1692 N N   . THR B 2 33  ? 48.047  36.056 107.649 1.00 44.49  ? 71   THR B N   1 
ATOM   1693 C CA  . THR B 2 33  ? 48.067  35.668 106.244 1.00 43.96  ? 71   THR B CA  1 
ATOM   1694 C C   . THR B 2 33  ? 48.735  36.788 105.453 1.00 48.61  ? 71   THR B C   1 
ATOM   1695 O O   . THR B 2 33  ? 48.720  37.941 105.883 1.00 49.10  ? 71   THR B O   1 
ATOM   1696 C CB  . THR B 2 33  ? 46.669  35.482 105.718 1.00 44.27  ? 71   THR B CB  1 
ATOM   1697 O OG1 . THR B 2 33  ? 46.061  36.763 105.585 1.00 44.18  ? 71   THR B OG1 1 
ATOM   1698 C CG2 . THR B 2 33  ? 45.874  34.704 106.661 1.00 47.30  ? 71   THR B CG2 1 
ATOM   1699 N N   . ASN B 2 34  ? 49.281  36.467 104.286 1.00 44.93  ? 72   ASN B N   1 
ATOM   1700 C CA  . ASN B 2 34  ? 49.859  37.497 103.434 1.00 45.27  ? 72   ASN B CA  1 
ATOM   1701 C C   . ASN B 2 34  ? 48.865  38.630 103.159 1.00 46.85  ? 72   ASN B C   1 
ATOM   1702 O O   . ASN B 2 34  ? 49.215  39.801 103.279 1.00 48.99  ? 72   ASN B O   1 
ATOM   1703 C CB  . ASN B 2 34  ? 50.344  36.901 102.130 1.00 50.00  ? 72   ASN B CB  1 
ATOM   1704 C CG  . ASN B 2 34  ? 51.553  36.023 102.318 1.00 74.44  ? 72   ASN B CG  1 
ATOM   1705 O OD1 . ASN B 2 34  ? 52.700  36.499 102.343 1.00 77.69  ? 72   ASN B OD1 1 
ATOM   1706 N ND2 . ASN B 2 34  ? 51.311  34.730 102.454 1.00 59.91  ? 72   ASN B ND2 1 
ATOM   1707 N N   . GLN B 2 35  ? 47.621  38.289 102.854 1.00 38.69  ? 73   GLN B N   1 
ATOM   1708 C CA  . GLN B 2 35  ? 46.607  39.302 102.651 1.00 37.31  ? 73   GLN B CA  1 
ATOM   1709 C C   . GLN B 2 35  ? 46.652  40.303 103.826 1.00 45.39  ? 73   GLN B C   1 
ATOM   1710 O O   . GLN B 2 35  ? 46.516  41.516 103.663 1.00 47.71  ? 73   GLN B O   1 
ATOM   1711 C CB  . GLN B 2 35  ? 45.242  38.629 102.616 1.00 37.43  ? 73   GLN B CB  1 
ATOM   1712 C CG  . GLN B 2 35  ? 44.127  39.499 102.117 1.00 60.52  ? 73   GLN B CG  1 
ATOM   1713 C CD  . GLN B 2 35  ? 44.556  40.360 100.946 1.00 84.20  ? 73   GLN B CD  1 
ATOM   1714 O OE1 . GLN B 2 35  ? 44.323  41.578 100.939 1.00 82.51  ? 73   GLN B OE1 1 
ATOM   1715 N NE2 . GLN B 2 35  ? 45.238  39.747 99.972  1.00 65.03  ? 73   GLN B NE2 1 
ATOM   1716 N N   . GLU B 2 36  ? 46.871  39.793 105.022 1.00 41.66  ? 74   GLU B N   1 
ATOM   1717 C CA  . GLU B 2 36  ? 46.874  40.659 106.173 1.00 41.27  ? 74   GLU B CA  1 
ATOM   1718 C C   . GLU B 2 36  ? 47.999  41.660 106.145 1.00 47.99  ? 74   GLU B C   1 
ATOM   1719 O O   . GLU B 2 36  ? 47.804  42.817 106.552 1.00 51.43  ? 74   GLU B O   1 
ATOM   1720 C CB  . GLU B 2 36  ? 46.936  39.846 107.440 1.00 42.17  ? 74   GLU B CB  1 
ATOM   1721 C CG  . GLU B 2 36  ? 45.595  39.384 107.913 1.00 50.90  ? 74   GLU B CG  1 
ATOM   1722 C CD  . GLU B 2 36  ? 45.655  38.849 109.327 1.00 61.59  ? 74   GLU B CD  1 
ATOM   1723 O OE1 . GLU B 2 36  ? 45.319  39.610 110.261 1.00 48.10  ? 74   GLU B OE1 1 
ATOM   1724 O OE2 . GLU B 2 36  ? 46.086  37.688 109.500 1.00 48.43  ? 74   GLU B OE2 1 
ATOM   1725 N N   . VAL B 2 37  ? 49.168  41.224 105.672 1.00 41.39  ? 75   VAL B N   1 
ATOM   1726 C CA  . VAL B 2 37  ? 50.344  42.089 105.612 1.00 39.79  ? 75   VAL B CA  1 
ATOM   1727 C C   . VAL B 2 37  ? 50.191  43.069 104.487 1.00 45.45  ? 75   VAL B C   1 
ATOM   1728 O O   . VAL B 2 37  ? 50.439  44.246 104.632 1.00 45.14  ? 75   VAL B O   1 
ATOM   1729 C CB  . VAL B 2 37  ? 51.638  41.282 105.502 1.00 40.52  ? 75   VAL B CB  1 
ATOM   1730 C CG1 . VAL B 2 37  ? 52.817  42.169 105.625 1.00 38.71  ? 75   VAL B CG1 1 
ATOM   1731 C CG2 . VAL B 2 37  ? 51.662  40.254 106.591 1.00 39.84  ? 75   VAL B CG2 1 
ATOM   1732 N N   . HIS B 2 38  ? 49.724  42.585 103.364 1.00 44.54  ? 76   HIS B N   1 
ATOM   1733 C CA  . HIS B 2 38  ? 49.515  43.475 102.256 1.00 46.20  ? 76   HIS B CA  1 
ATOM   1734 C C   . HIS B 2 38  ? 48.517  44.569 102.638 1.00 47.48  ? 76   HIS B C   1 
ATOM   1735 O O   . HIS B 2 38  ? 48.726  45.739 102.332 1.00 47.83  ? 76   HIS B O   1 
ATOM   1736 C CB  . HIS B 2 38  ? 49.102  42.687 101.019 1.00 48.66  ? 76   HIS B CB  1 
ATOM   1737 C CG  . HIS B 2 38  ? 50.189  41.792 100.486 1.00 54.56  ? 76   HIS B CG  1 
ATOM   1738 N ND1 . HIS B 2 38  ? 50.702  41.905 99.208  1.00 57.21  ? 76   HIS B ND1 1 
ATOM   1739 C CD2 . HIS B 2 38  ? 50.866  40.766 101.069 1.00 58.42  ? 76   HIS B CD2 1 
ATOM   1740 C CE1 . HIS B 2 38  ? 51.621  40.970 99.018  1.00 57.47  ? 76   HIS B CE1 1 
ATOM   1741 N NE2 . HIS B 2 38  ? 51.724  40.251 100.126 1.00 58.12  ? 76   HIS B NE2 1 
ATOM   1742 N N   . ASP B 2 39  ? 47.473  44.202 103.369 1.00 41.52  ? 77   ASP B N   1 
ATOM   1743 C CA  . ASP B 2 39  ? 46.501  45.190 103.817 1.00 40.91  ? 77   ASP B CA  1 
ATOM   1744 C C   . ASP B 2 39  ? 47.154  46.227 104.708 1.00 44.36  ? 77   ASP B C   1 
ATOM   1745 O O   . ASP B 2 39  ? 47.036  47.434 104.462 1.00 44.88  ? 77   ASP B O   1 
ATOM   1746 C CB  . ASP B 2 39  ? 45.330  44.549 104.544 1.00 42.09  ? 77   ASP B CB  1 
ATOM   1747 C CG  . ASP B 2 39  ? 44.440  43.753 103.612 1.00 57.23  ? 77   ASP B CG  1 
ATOM   1748 O OD1 . ASP B 2 39  ? 44.546  43.952 102.389 1.00 55.24  ? 77   ASP B OD1 1 
ATOM   1749 O OD2 . ASP B 2 39  ? 43.754  42.822 104.091 1.00 69.03  ? 77   ASP B OD2 1 
ATOM   1750 N N   . LEU B 2 40  ? 47.820  45.736 105.748 1.00 38.23  ? 78   LEU B N   1 
ATOM   1751 C CA  . LEU B 2 40  ? 48.550  46.571 106.690 1.00 37.50  ? 78   LEU B CA  1 
ATOM   1752 C C   . LEU B 2 40  ? 49.436  47.604 105.959 1.00 43.68  ? 78   LEU B C   1 
ATOM   1753 O O   . LEU B 2 40  ? 49.504  48.776 106.366 1.00 45.59  ? 78   LEU B O   1 
ATOM   1754 C CB  . LEU B 2 40  ? 49.431  45.674 107.562 1.00 36.46  ? 78   LEU B CB  1 
ATOM   1755 C CG  . LEU B 2 40  ? 50.310  46.387 108.558 1.00 38.20  ? 78   LEU B CG  1 
ATOM   1756 C CD1 . LEU B 2 40  ? 49.426  46.849 109.675 1.00 36.52  ? 78   LEU B CD1 1 
ATOM   1757 C CD2 . LEU B 2 40  ? 51.395  45.472 109.079 1.00 38.70  ? 78   LEU B CD2 1 
ATOM   1758 N N   . LEU B 2 41  ? 50.069  47.188 104.865 1.00 38.89  ? 79   LEU B N   1 
ATOM   1759 C CA  . LEU B 2 41  ? 50.963  48.075 104.124 1.00 40.40  ? 79   LEU B CA  1 
ATOM   1760 C C   . LEU B 2 41  ? 50.385  48.565 102.810 1.00 45.17  ? 79   LEU B C   1 
ATOM   1761 O O   . LEU B 2 41  ? 51.120  48.834 101.854 1.00 43.92  ? 79   LEU B O   1 
ATOM   1762 C CB  . LEU B 2 41  ? 52.332  47.419 103.870 1.00 40.73  ? 79   LEU B CB  1 
ATOM   1763 C CG  . LEU B 2 41  ? 53.068  46.846 105.089 1.00 44.62  ? 79   LEU B CG  1 
ATOM   1764 C CD1 . LEU B 2 41  ? 54.260  46.054 104.635 1.00 42.83  ? 79   LEU B CD1 1 
ATOM   1765 C CD2 . LEU B 2 41  ? 53.479  47.984 106.048 1.00 46.26  ? 79   LEU B CD2 1 
ATOM   1766 N N   . SER B 2 42  ? 49.073  48.747 102.796 1.00 42.09  ? 80   SER B N   1 
ATOM   1767 C CA  . SER B 2 42  ? 48.365  49.181 101.602 1.00 41.76  ? 80   SER B CA  1 
ATOM   1768 C C   . SER B 2 42  ? 48.665  50.593 101.091 1.00 48.74  ? 80   SER B C   1 
ATOM   1769 O O   . SER B 2 42  ? 48.476  50.867 99.911  1.00 50.89  ? 80   SER B O   1 
ATOM   1770 C CB  . SER B 2 42  ? 46.849  48.894 101.715 1.00 44.97  ? 80   SER B CB  1 
ATOM   1771 O OG  . SER B 2 42  ? 46.231  49.583 102.803 1.00 54.39  ? 80   SER B OG  1 
ATOM   1772 N N   . ASP B 2 43  ? 49.146  51.490 101.948 1.00 43.97  ? 81   ASP B N   1 
ATOM   1773 C CA  . ASP B 2 43  ? 49.494  52.828 101.493 1.00 42.15  ? 81   ASP B CA  1 
ATOM   1774 C C   . ASP B 2 43  ? 50.871  52.801 100.838 1.00 47.52  ? 81   ASP B C   1 
ATOM   1775 O O   . ASP B 2 43  ? 51.364  53.846 100.351 1.00 49.76  ? 81   ASP B O   1 
ATOM   1776 C CB  . ASP B 2 43  ? 49.578  53.778 102.685 1.00 44.78  ? 81   ASP B CB  1 
ATOM   1777 C CG  . ASP B 2 43  ? 48.239  53.984 103.355 1.00 60.95  ? 81   ASP B CG  1 
ATOM   1778 O OD1 . ASP B 2 43  ? 48.233  54.274 104.600 1.00 61.68  ? 81   ASP B OD1 1 
ATOM   1779 O OD2 . ASP B 2 43  ? 47.214  53.781 102.633 1.00 62.01  ? 81   ASP B OD2 1 
ATOM   1780 N N   . TYR B 2 44  ? 51.534  51.648 100.873 1.00 42.04  ? 82   TYR B N   1 
ATOM   1781 C CA  . TYR B 2 44  ? 52.881  51.578 100.322 1.00 41.43  ? 82   TYR B CA  1 
ATOM   1782 C C   . TYR B 2 44  ? 52.939  50.721 99.080  1.00 45.84  ? 82   TYR B C   1 
ATOM   1783 O O   . TYR B 2 44  ? 52.054  49.903 98.832  1.00 46.32  ? 82   TYR B O   1 
ATOM   1784 C CB  . TYR B 2 44  ? 53.873  51.071 101.390 1.00 41.87  ? 82   TYR B CB  1 
ATOM   1785 C CG  . TYR B 2 44  ? 53.835  51.918 102.629 1.00 43.54  ? 82   TYR B CG  1 
ATOM   1786 C CD1 . TYR B 2 44  ? 54.736  52.982 102.803 1.00 47.17  ? 82   TYR B CD1 1 
ATOM   1787 C CD2 . TYR B 2 44  ? 52.806  51.776 103.548 1.00 42.54  ? 82   TYR B CD2 1 
ATOM   1788 C CE1 . TYR B 2 44  ? 54.672  53.807 103.938 1.00 47.20  ? 82   TYR B CE1 1 
ATOM   1789 C CE2 . TYR B 2 44  ? 52.714  52.599 104.640 1.00 42.84  ? 82   TYR B CE2 1 
ATOM   1790 C CZ  . TYR B 2 44  ? 53.654  53.596 104.853 1.00 51.71  ? 82   TYR B CZ  1 
ATOM   1791 O OH  . TYR B 2 44  ? 53.531  54.409 105.964 1.00 56.81  ? 82   TYR B OH  1 
ATOM   1792 N N   . GLU B 2 45  ? 54.014  50.862 98.324  1.00 42.48  ? 83   GLU B N   1 
ATOM   1793 C CA  . GLU B 2 45  ? 54.200  50.017 97.167  1.00 42.39  ? 83   GLU B CA  1 
ATOM   1794 C C   . GLU B 2 45  ? 55.070  48.860 97.601  1.00 48.37  ? 83   GLU B C   1 
ATOM   1795 O O   . GLU B 2 45  ? 56.219  49.065 97.951  1.00 48.64  ? 83   GLU B O   1 
ATOM   1796 C CB  . GLU B 2 45  ? 54.893  50.803 96.070  1.00 43.63  ? 83   GLU B CB  1 
ATOM   1797 C CG  . GLU B 2 45  ? 54.007  51.058 94.900  1.00 52.96  ? 83   GLU B CG  1 
ATOM   1798 C CD  . GLU B 2 45  ? 54.353  52.340 94.213  1.00 74.63  ? 83   GLU B CD  1 
ATOM   1799 O OE1 . GLU B 2 45  ? 54.253  52.411 92.958  1.00 74.94  ? 83   GLU B OE1 1 
ATOM   1800 O OE2 . GLU B 2 45  ? 54.801  53.245 94.941  1.00 67.40  ? 83   GLU B OE2 1 
ATOM   1801 N N   . LEU B 2 46  ? 54.503  47.657 97.630  1.00 47.48  ? 84   LEU B N   1 
ATOM   1802 C CA  . LEU B 2 46  ? 55.234  46.444 98.043  1.00 47.30  ? 84   LEU B CA  1 
ATOM   1803 C C   . LEU B 2 46  ? 55.865  45.857 96.807  1.00 52.52  ? 84   LEU B C   1 
ATOM   1804 O O   . LEU B 2 46  ? 55.174  45.464 95.851  1.00 52.47  ? 84   LEU B O   1 
ATOM   1805 C CB  . LEU B 2 46  ? 54.307  45.342 98.615  1.00 46.51  ? 84   LEU B CB  1 
ATOM   1806 C CG  . LEU B 2 46  ? 53.488  45.624 99.863  1.00 51.98  ? 84   LEU B CG  1 
ATOM   1807 C CD1 . LEU B 2 46  ? 53.343  44.362 100.720 1.00 53.02  ? 84   LEU B CD1 1 
ATOM   1808 C CD2 . LEU B 2 46  ? 54.193  46.738 100.614 1.00 56.82  ? 84   LEU B CD2 1 
ATOM   1809 N N   . LYS B 2 47  ? 57.170  45.696 96.845  1.00 48.23  ? 85   LYS B N   1 
ATOM   1810 C CA  . LYS B 2 47  ? 57.768  45.050 95.719  1.00 48.38  ? 85   LYS B CA  1 
ATOM   1811 C C   . LYS B 2 47  ? 57.891  43.577 96.029  1.00 53.91  ? 85   LYS B C   1 
ATOM   1812 O O   . LYS B 2 47  ? 57.847  42.752 95.134  1.00 55.00  ? 85   LYS B O   1 
ATOM   1813 C CB  . LYS B 2 47  ? 59.089  45.736 95.331  1.00 50.62  ? 85   LYS B CB  1 
ATOM   1814 C CG  . LYS B 2 47  ? 58.852  46.996 94.462  1.00 59.02  ? 85   LYS B CG  1 
ATOM   1815 C CD  . LYS B 2 47  ? 58.148  46.640 93.134  1.00 55.77  ? 85   LYS B CD  1 
ATOM   1816 C CE  . LYS B 2 47  ? 57.180  47.699 92.700  1.00 66.83  ? 85   LYS B CE  1 
ATOM   1817 N NZ  . LYS B 2 47  ? 57.244  47.963 91.216  1.00 83.63  ? 85   LYS B NZ  1 
ATOM   1818 N N   . TYR B 2 48  ? 57.981  43.230 97.310  1.00 52.15  ? 86   TYR B N   1 
ATOM   1819 C CA  . TYR B 2 48  ? 58.146  41.814 97.694  1.00 52.08  ? 86   TYR B CA  1 
ATOM   1820 C C   . TYR B 2 48  ? 57.708  41.570 99.121  1.00 52.76  ? 86   TYR B C   1 
ATOM   1821 O O   . TYR B 2 48  ? 58.027  42.338 100.021 1.00 51.73  ? 86   TYR B O   1 
ATOM   1822 C CB  . TYR B 2 48  ? 59.627  41.402 97.577  1.00 53.84  ? 86   TYR B CB  1 
ATOM   1823 C CG  . TYR B 2 48  ? 59.959  40.002 98.094  1.00 54.98  ? 86   TYR B CG  1 
ATOM   1824 C CD1 . TYR B 2 48  ? 59.740  38.889 97.295  1.00 56.37  ? 86   TYR B CD1 1 
ATOM   1825 C CD2 . TYR B 2 48  ? 60.521  39.796 99.367  1.00 54.81  ? 86   TYR B CD2 1 
ATOM   1826 C CE1 . TYR B 2 48  ? 60.068  37.622 97.727  1.00 56.32  ? 86   TYR B CE1 1 
ATOM   1827 C CE2 . TYR B 2 48  ? 60.863  38.509 99.805  1.00 54.69  ? 86   TYR B CE2 1 
ATOM   1828 C CZ  . TYR B 2 48  ? 60.637  37.427 98.968  1.00 59.96  ? 86   TYR B CZ  1 
ATOM   1829 O OH  . TYR B 2 48  ? 60.951  36.131 99.330  1.00 58.63  ? 86   TYR B OH  1 
ATOM   1830 N N   . CYS B 2 49  ? 57.029  40.457 99.323  1.00 48.54  ? 87   CYS B N   1 
ATOM   1831 C CA  . CYS B 2 49  ? 56.542  40.090 100.636 1.00 48.42  ? 87   CYS B CA  1 
ATOM   1832 C C   . CYS B 2 49  ? 56.633  38.603 100.884 1.00 51.51  ? 87   CYS B C   1 
ATOM   1833 O O   . CYS B 2 49  ? 56.020  37.809 100.188 1.00 52.01  ? 87   CYS B O   1 
ATOM   1834 C CB  . CYS B 2 49  ? 55.080  40.522 100.808 1.00 49.68  ? 87   CYS B CB  1 
ATOM   1835 S SG  . CYS B 2 49  ? 54.492  40.434 102.529 1.00 54.57  ? 87   CYS B SG  1 
ATOM   1836 N N   . PHE B 2 50  ? 57.395  38.230 101.896 1.00 49.07  ? 88   PHE B N   1 
ATOM   1837 C CA  . PHE B 2 50  ? 57.459  36.851 102.339 1.00 49.07  ? 88   PHE B CA  1 
ATOM   1838 C C   . PHE B 2 50  ? 57.250  36.715 103.843 1.00 50.25  ? 88   PHE B C   1 
ATOM   1839 O O   . PHE B 2 50  ? 57.988  37.307 104.636 1.00 47.60  ? 88   PHE B O   1 
ATOM   1840 C CB  . PHE B 2 50  ? 58.743  36.167 101.974 1.00 51.33  ? 88   PHE B CB  1 
ATOM   1841 C CG  . PHE B 2 50  ? 58.802  34.778 102.493 1.00 53.86  ? 88   PHE B CG  1 
ATOM   1842 C CD1 . PHE B 2 50  ? 59.505  34.490 103.646 1.00 57.58  ? 88   PHE B CD1 1 
ATOM   1843 C CD2 . PHE B 2 50  ? 57.974  33.803 101.948 1.00 57.50  ? 88   PHE B CD2 1 
ATOM   1844 C CE1 . PHE B 2 50  ? 59.523  33.197 104.158 1.00 58.85  ? 88   PHE B CE1 1 
ATOM   1845 C CE2 . PHE B 2 50  ? 57.956  32.521 102.463 1.00 60.70  ? 88   PHE B CE2 1 
ATOM   1846 C CZ  . PHE B 2 50  ? 58.741  32.211 103.579 1.00 58.22  ? 88   PHE B CZ  1 
ATOM   1847 N N   . VAL B 2 51  ? 56.239  35.934 104.218 1.00 46.00  ? 89   VAL B N   1 
ATOM   1848 C CA  . VAL B 2 51  ? 55.888  35.745 105.618 1.00 43.89  ? 89   VAL B CA  1 
ATOM   1849 C C   . VAL B 2 51  ? 56.385  34.416 106.151 1.00 47.99  ? 89   VAL B C   1 
ATOM   1850 O O   . VAL B 2 51  ? 55.952  33.342 105.700 1.00 48.48  ? 89   VAL B O   1 
ATOM   1851 C CB  . VAL B 2 51  ? 54.360  35.836 105.849 1.00 46.03  ? 89   VAL B CB  1 
ATOM   1852 C CG1 . VAL B 2 51  ? 54.051  35.522 107.280 1.00 46.20  ? 89   VAL B CG1 1 
ATOM   1853 C CG2 . VAL B 2 51  ? 53.800  37.182 105.486 1.00 45.13  ? 89   VAL B CG2 1 
ATOM   1854 N N   . ASP B 2 52  ? 57.269  34.479 107.137 1.00 42.91  ? 90   ASP B N   1 
ATOM   1855 C CA  . ASP B 2 52  ? 57.728  33.266 107.810 1.00 41.66  ? 90   ASP B CA  1 
ATOM   1856 C C   . ASP B 2 52  ? 56.726  32.928 108.917 1.00 45.04  ? 90   ASP B C   1 
ATOM   1857 O O   . ASP B 2 52  ? 56.834  33.397 110.060 1.00 43.00  ? 90   ASP B O   1 
ATOM   1858 C CB  . ASP B 2 52  ? 59.068  33.528 108.448 1.00 43.56  ? 90   ASP B CB  1 
ATOM   1859 C CG  . ASP B 2 52  ? 59.669  32.280 109.040 1.00 55.91  ? 90   ASP B CG  1 
ATOM   1860 O OD1 . ASP B 2 52  ? 60.880  32.335 109.383 1.00 58.67  ? 90   ASP B OD1 1 
ATOM   1861 O OD2 . ASP B 2 52  ? 58.953  31.244 109.119 1.00 55.11  ? 90   ASP B OD2 1 
ATOM   1862 N N   . LYS B 2 53  ? 55.723  32.146 108.557 1.00 43.09  ? 91   LYS B N   1 
ATOM   1863 C CA  . LYS B 2 53  ? 54.657  31.810 109.475 1.00 43.02  ? 91   LYS B CA  1 
ATOM   1864 C C   . LYS B 2 53  ? 55.070  31.172 110.806 1.00 48.80  ? 91   LYS B C   1 
ATOM   1865 O O   . LYS B 2 53  ? 54.533  31.497 111.864 1.00 48.85  ? 91   LYS B O   1 
ATOM   1866 C CB  . LYS B 2 53  ? 53.477  31.156 108.748 1.00 44.42  ? 91   LYS B CB  1 
ATOM   1867 C CG  . LYS B 2 53  ? 52.448  32.191 108.232 1.00 54.44  ? 91   LYS B CG  1 
ATOM   1868 C CD  . LYS B 2 53  ? 51.173  31.566 107.654 1.00 64.42  ? 91   LYS B CD  1 
ATOM   1869 C CE  . LYS B 2 53  ? 50.824  32.101 106.228 1.00 62.24  ? 91   LYS B CE  1 
ATOM   1870 N NZ  . LYS B 2 53  ? 49.430  31.672 105.855 1.00 59.57  ? 91   LYS B NZ  1 
ATOM   1871 N N   . TYR B 2 54  ? 56.126  30.383 110.772 1.00 48.82  ? 92   TYR B N   1 
ATOM   1872 C CA  . TYR B 2 54  ? 56.651  29.755 111.985 1.00 50.58  ? 92   TYR B CA  1 
ATOM   1873 C C   . TYR B 2 54  ? 57.361  30.741 112.932 1.00 52.78  ? 92   TYR B C   1 
ATOM   1874 O O   . TYR B 2 54  ? 57.564  30.448 114.112 1.00 51.35  ? 92   TYR B O   1 
ATOM   1875 C CB  . TYR B 2 54  ? 57.602  28.601 111.637 1.00 54.15  ? 92   TYR B CB  1 
ATOM   1876 C CG  . TYR B 2 54  ? 58.508  28.223 112.805 1.00 59.75  ? 92   TYR B CG  1 
ATOM   1877 C CD1 . TYR B 2 54  ? 58.053  27.408 113.834 1.00 62.77  ? 92   TYR B CD1 1 
ATOM   1878 C CD2 . TYR B 2 54  ? 59.782  28.786 112.946 1.00 60.99  ? 92   TYR B CD2 1 
ATOM   1879 C CE1 . TYR B 2 54  ? 58.887  27.093 114.929 1.00 63.78  ? 92   TYR B CE1 1 
ATOM   1880 C CE2 . TYR B 2 54  ? 60.591  28.512 114.051 1.00 61.16  ? 92   TYR B CE2 1 
ATOM   1881 C CZ  . TYR B 2 54  ? 60.147  27.659 115.024 1.00 67.84  ? 92   TYR B CZ  1 
ATOM   1882 O OH  . TYR B 2 54  ? 60.969  27.374 116.092 1.00 69.98  ? 92   TYR B OH  1 
ATOM   1883 N N   . LYS B 2 55  ? 57.737  31.906 112.410 1.00 48.59  ? 93   LYS B N   1 
ATOM   1884 C CA  . LYS B 2 55  ? 58.454  32.920 113.189 1.00 47.36  ? 93   LYS B CA  1 
ATOM   1885 C C   . LYS B 2 55  ? 57.633  34.165 113.473 1.00 50.33  ? 93   LYS B C   1 
ATOM   1886 O O   . LYS B 2 55  ? 58.023  34.981 114.300 1.00 50.84  ? 93   LYS B O   1 
ATOM   1887 C CB  . LYS B 2 55  ? 59.730  33.339 112.451 1.00 49.42  ? 93   LYS B CB  1 
ATOM   1888 C CG  . LYS B 2 55  ? 60.720  32.199 112.251 1.00 56.12  ? 93   LYS B CG  1 
ATOM   1889 C CD  . LYS B 2 55  ? 62.090  32.562 112.798 1.00 70.58  ? 93   LYS B CD  1 
ATOM   1890 C CE  . LYS B 2 55  ? 61.965  33.276 114.153 1.00 86.98  ? 93   LYS B CE  1 
ATOM   1891 N NZ  . LYS B 2 55  ? 62.968  34.372 114.395 1.00 88.64  ? 93   LYS B NZ  1 
ATOM   1892 N N   . GLY B 2 56  ? 56.519  34.337 112.768 1.00 44.99  ? 94   GLY B N   1 
ATOM   1893 C CA  . GLY B 2 56  ? 55.700  35.503 112.980 1.00 43.40  ? 94   GLY B CA  1 
ATOM   1894 C C   . GLY B 2 56  ? 56.444  36.725 112.511 1.00 47.09  ? 94   GLY B C   1 
ATOM   1895 O O   . GLY B 2 56  ? 56.317  37.785 113.083 1.00 46.60  ? 94   GLY B O   1 
ATOM   1896 N N   . THR B 2 57  ? 57.245  36.571 111.461 1.00 45.41  ? 95   THR B N   1 
ATOM   1897 C CA  . THR B 2 57  ? 57.978  37.701 110.879 1.00 44.33  ? 95   THR B CA  1 
ATOM   1898 C C   . THR B 2 57  ? 57.603  37.787 109.407 1.00 47.10  ? 95   THR B C   1 
ATOM   1899 O O   . THR B 2 57  ? 57.288  36.780 108.784 1.00 47.97  ? 95   THR B O   1 
ATOM   1900 C CB  . THR B 2 57  ? 59.471  37.498 110.954 1.00 49.66  ? 95   THR B CB  1 
ATOM   1901 O OG1 . THR B 2 57  ? 59.794  36.443 110.068 1.00 57.45  ? 95   THR B OG1 1 
ATOM   1902 C CG2 . THR B 2 57  ? 59.897  37.088 112.341 1.00 46.89  ? 95   THR B CG2 1 
ATOM   1903 N N   . ALA B 2 58  ? 57.711  38.978 108.840 1.00 42.21  ? 96   ALA B N   1 
ATOM   1904 C CA  . ALA B 2 58  ? 57.452  39.191 107.433 1.00 41.64  ? 96   ALA B CA  1 
ATOM   1905 C C   . ALA B 2 58  ? 58.594  40.026 106.822 1.00 47.51  ? 96   ALA B C   1 
ATOM   1906 O O   . ALA B 2 58  ? 58.949  41.103 107.321 1.00 44.85  ? 96   ALA B O   1 
ATOM   1907 C CB  . ALA B 2 58  ? 56.123  39.885 107.252 1.00 42.05  ? 96   ALA B CB  1 
ATOM   1908 N N   . PHE B 2 59  ? 59.191  39.497 105.760 1.00 47.38  ? 97   PHE B N   1 
ATOM   1909 C CA  . PHE B 2 59  ? 60.260  40.195 105.048 1.00 47.70  ? 97   PHE B CA  1 
ATOM   1910 C C   . PHE B 2 59  ? 59.603  40.885 103.874 1.00 47.78  ? 97   PHE B C   1 
ATOM   1911 O O   . PHE B 2 59  ? 59.067  40.220 102.994 1.00 47.17  ? 97   PHE B O   1 
ATOM   1912 C CB  . PHE B 2 59  ? 61.313  39.192 104.575 1.00 51.18  ? 97   PHE B CB  1 
ATOM   1913 C CG  . PHE B 2 59  ? 61.792  38.268 105.662 1.00 54.15  ? 97   PHE B CG  1 
ATOM   1914 C CD1 . PHE B 2 59  ? 60.971  37.237 106.137 1.00 56.80  ? 97   PHE B CD1 1 
ATOM   1915 C CD2 . PHE B 2 59  ? 63.038  38.472 106.267 1.00 57.57  ? 97   PHE B CD2 1 
ATOM   1916 C CE1 . PHE B 2 59  ? 61.394  36.388 107.165 1.00 57.52  ? 97   PHE B CE1 1 
ATOM   1917 C CE2 . PHE B 2 59  ? 63.464  37.633 107.315 1.00 60.20  ? 97   PHE B CE2 1 
ATOM   1918 C CZ  . PHE B 2 59  ? 62.628  36.585 107.762 1.00 57.16  ? 97   PHE B CZ  1 
ATOM   1919 N N   . VAL B 2 60  ? 59.598  42.218 103.909 1.00 43.40  ? 98   VAL B N   1 
ATOM   1920 C CA  . VAL B 2 60  ? 58.909  43.089 102.938 1.00 42.12  ? 98   VAL B CA  1 
ATOM   1921 C C   . VAL B 2 60  ? 59.853  44.103 102.276 1.00 47.02  ? 98   VAL B C   1 
ATOM   1922 O O   . VAL B 2 60  ? 60.548  44.877 102.935 1.00 43.86  ? 98   VAL B O   1 
ATOM   1923 C CB  . VAL B 2 60  ? 57.787  43.890 103.650 1.00 46.77  ? 98   VAL B CB  1 
ATOM   1924 C CG1 . VAL B 2 60  ? 56.996  44.768 102.662 1.00 46.71  ? 98   VAL B CG1 1 
ATOM   1925 C CG2 . VAL B 2 60  ? 56.850  42.961 104.425 1.00 47.01  ? 98   VAL B CG2 1 
ATOM   1926 N N   . THR B 2 61  ? 59.818  44.133 100.951 1.00 47.74  ? 99   THR B N   1 
ATOM   1927 C CA  . THR B 2 61  ? 60.606  45.070 100.169 1.00 47.01  ? 99   THR B CA  1 
ATOM   1928 C C   . THR B 2 61  ? 59.657  46.116 99.646  1.00 49.06  ? 99   THR B C   1 
ATOM   1929 O O   . THR B 2 61  ? 58.726  45.797 98.890  1.00 50.32  ? 99   THR B O   1 
ATOM   1930 C CB  . THR B 2 61  ? 61.271  44.359 98.991  1.00 56.29  ? 99   THR B CB  1 
ATOM   1931 O OG1 . THR B 2 61  ? 61.929  43.181 99.469  1.00 59.08  ? 99   THR B OG1 1 
ATOM   1932 C CG2 . THR B 2 61  ? 62.271  45.307 98.303  1.00 52.33  ? 99   THR B CG2 1 
ATOM   1933 N N   . LEU B 2 62  ? 59.862  47.352 100.076 1.00 43.81  ? 100  LEU B N   1 
ATOM   1934 C CA  . LEU B 2 62  ? 59.024  48.458 99.624  1.00 44.43  ? 100  LEU B CA  1 
ATOM   1935 C C   . LEU B 2 62  ? 59.655  49.144 98.408  1.00 53.86  ? 100  LEU B C   1 
ATOM   1936 O O   . LEU B 2 62  ? 60.748  48.769 97.950  1.00 54.71  ? 100  LEU B O   1 
ATOM   1937 C CB  . LEU B 2 62  ? 58.735  49.457 100.753 1.00 44.06  ? 100  LEU B CB  1 
ATOM   1938 C CG  . LEU B 2 62  ? 57.894  48.915 101.938 1.00 48.03  ? 100  LEU B CG  1 
ATOM   1939 C CD1 . LEU B 2 62  ? 57.523  50.017 102.861 1.00 48.11  ? 100  LEU B CD1 1 
ATOM   1940 C CD2 . LEU B 2 62  ? 56.623  48.205 101.497 1.00 48.16  ? 100  LEU B CD2 1 
ATOM   1941 N N   . LEU B 2 63  ? 58.941  50.101 97.828  1.00 51.69  ? 101  LEU B N   1 
ATOM   1942 C CA  . LEU B 2 63  ? 59.447  50.742 96.626  1.00 50.99  ? 101  LEU B CA  1 
ATOM   1943 C C   . LEU B 2 63  ? 60.851  51.314 96.831  1.00 56.03  ? 101  LEU B C   1 
ATOM   1944 O O   . LEU B 2 63  ? 61.740  51.136 95.974  1.00 55.79  ? 101  LEU B O   1 
ATOM   1945 C CB  . LEU B 2 63  ? 58.515  51.847 96.180  1.00 50.34  ? 101  LEU B CB  1 
ATOM   1946 C CG  . LEU B 2 63  ? 59.049  52.503 94.909  1.00 52.88  ? 101  LEU B CG  1 
ATOM   1947 C CD1 . LEU B 2 63  ? 59.055  51.494 93.752  1.00 51.48  ? 101  LEU B CD1 1 
ATOM   1948 C CD2 . LEU B 2 63  ? 58.254  53.755 94.594  1.00 53.16  ? 101  LEU B CD2 1 
ATOM   1949 N N   . ASN B 2 64  ? 61.036  51.982 97.976  1.00 50.33  ? 102  ASN B N   1 
ATOM   1950 C CA  . ASN B 2 64  ? 62.295  52.606 98.295  1.00 48.47  ? 102  ASN B CA  1 
ATOM   1951 C C   . ASN B 2 64  ? 62.450  52.908 99.772  1.00 53.38  ? 102  ASN B C   1 
ATOM   1952 O O   . ASN B 2 64  ? 61.494  52.793 100.537 1.00 53.39  ? 102  ASN B O   1 
ATOM   1953 C CB  . ASN B 2 64  ? 62.374  53.881 97.509  1.00 43.94  ? 102  ASN B CB  1 
ATOM   1954 C CG  . ASN B 2 64  ? 61.293  54.867 97.895  1.00 56.05  ? 102  ASN B CG  1 
ATOM   1955 O OD1 . ASN B 2 64  ? 61.025  55.095 99.083  1.00 48.74  ? 102  ASN B OD1 1 
ATOM   1956 N ND2 . ASN B 2 64  ? 60.680  55.487 96.884  1.00 38.89  ? 102  ASN B ND2 1 
ATOM   1957 N N   . GLY B 2 65  ? 63.627  53.404 100.153 1.00 50.01  ? 103  GLY B N   1 
ATOM   1958 C CA  . GLY B 2 65  ? 63.935  53.707 101.543 1.00 48.37  ? 103  GLY B CA  1 
ATOM   1959 C C   . GLY B 2 65  ? 63.013  54.696 102.207 1.00 50.45  ? 103  GLY B C   1 
ATOM   1960 O O   . GLY B 2 65  ? 62.836  54.680 103.421 1.00 50.45  ? 103  GLY B O   1 
ATOM   1961 N N   . GLU B 2 66  ? 62.480  55.622 101.427 1.00 46.96  ? 104  GLU B N   1 
ATOM   1962 C CA  . GLU B 2 66  ? 61.614  56.643 101.980 1.00 47.08  ? 104  GLU B CA  1 
ATOM   1963 C C   . GLU B 2 66  ? 60.349  55.978 102.488 1.00 52.99  ? 104  GLU B C   1 
ATOM   1964 O O   . GLU B 2 66  ? 59.893  56.283 103.586 1.00 54.70  ? 104  GLU B O   1 
ATOM   1965 C CB  . GLU B 2 66  ? 61.329  57.722 100.941 1.00 48.68  ? 104  GLU B CB  1 
ATOM   1966 C CG  . GLU B 2 66  ? 62.504  58.699 100.757 1.00 65.51  ? 104  GLU B CG  1 
ATOM   1967 C CD  . GLU B 2 66  ? 63.245  58.571 99.402  1.00 101.87 ? 104  GLU B CD  1 
ATOM   1968 O OE1 . GLU B 2 66  ? 63.507  59.632 98.776  1.00 98.78  ? 104  GLU B OE1 1 
ATOM   1969 O OE2 . GLU B 2 66  ? 63.628  57.435 98.998  1.00 92.68  ? 104  GLU B OE2 1 
ATOM   1970 N N   . GLN B 2 67  ? 59.854  54.990 101.740 1.00 48.31  ? 105  GLN B N   1 
ATOM   1971 C CA  . GLN B 2 67  ? 58.679  54.206 102.135 1.00 47.25  ? 105  GLN B CA  1 
ATOM   1972 C C   . GLN B 2 67  ? 58.980  53.253 103.279 1.00 52.48  ? 105  GLN B C   1 
ATOM   1973 O O   . GLN B 2 67  ? 58.158  53.066 104.193 1.00 52.53  ? 105  GLN B O   1 
ATOM   1974 C CB  . GLN B 2 67  ? 58.150  53.420 100.949 1.00 47.96  ? 105  GLN B CB  1 
ATOM   1975 C CG  . GLN B 2 67  ? 57.352  54.279 99.997  1.00 50.71  ? 105  GLN B CG  1 
ATOM   1976 C CD  . GLN B 2 67  ? 56.829  53.514 98.807  1.00 68.59  ? 105  GLN B CD  1 
ATOM   1977 O OE1 . GLN B 2 67  ? 56.393  52.368 98.926  1.00 67.82  ? 105  GLN B OE1 1 
ATOM   1978 N NE2 . GLN B 2 67  ? 56.853  54.150 97.651  1.00 52.96  ? 105  GLN B NE2 1 
ATOM   1979 N N   . ALA B 2 68  ? 60.154  52.636 103.224 1.00 49.09  ? 106  ALA B N   1 
ATOM   1980 C CA  . ALA B 2 68  ? 60.606  51.794 104.319 1.00 48.79  ? 106  ALA B CA  1 
ATOM   1981 C C   . ALA B 2 68  ? 60.540  52.630 105.595 1.00 54.90  ? 106  ALA B C   1 
ATOM   1982 O O   . ALA B 2 68  ? 59.826  52.279 106.540 1.00 55.49  ? 106  ALA B O   1 
ATOM   1983 C CB  . ALA B 2 68  ? 62.012  51.314 104.067 1.00 49.35  ? 106  ALA B CB  1 
ATOM   1984 N N   . GLU B 2 69  ? 61.206  53.784 105.590 1.00 52.18  ? 107  GLU B N   1 
ATOM   1985 C CA  . GLU B 2 69  ? 61.200  54.654 106.766 1.00 52.41  ? 107  GLU B CA  1 
ATOM   1986 C C   . GLU B 2 69  ? 59.785  54.971 107.215 1.00 54.13  ? 107  GLU B C   1 
ATOM   1987 O O   . GLU B 2 69  ? 59.442  54.908 108.393 1.00 53.47  ? 107  GLU B O   1 
ATOM   1988 C CB  . GLU B 2 69  ? 61.971  55.942 106.503 1.00 54.32  ? 107  GLU B CB  1 
ATOM   1989 C CG  . GLU B 2 69  ? 63.113  56.285 107.511 1.00 71.11  ? 107  GLU B CG  1 
ATOM   1990 C CD  . GLU B 2 69  ? 63.504  55.137 108.471 1.00 101.07 ? 107  GLU B CD  1 
ATOM   1991 O OE1 . GLU B 2 69  ? 63.161  55.218 109.683 1.00 92.00  ? 107  GLU B OE1 1 
ATOM   1992 O OE2 . GLU B 2 69  ? 64.240  54.214 108.034 1.00 92.32  ? 107  GLU B OE2 1 
ATOM   1993 N N   . ALA B 2 70  ? 58.936  55.297 106.271 1.00 50.47  ? 108  ALA B N   1 
ATOM   1994 C CA  . ALA B 2 70  ? 57.568  55.620 106.646 1.00 51.03  ? 108  ALA B CA  1 
ATOM   1995 C C   . ALA B 2 70  ? 56.784  54.433 107.237 1.00 56.44  ? 108  ALA B C   1 
ATOM   1996 O O   . ALA B 2 70  ? 55.930  54.639 108.119 1.00 57.49  ? 108  ALA B O   1 
ATOM   1997 C CB  . ALA B 2 70  ? 56.815  56.270 105.472 1.00 51.70  ? 108  ALA B CB  1 
ATOM   1998 N N   . ALA B 2 71  ? 57.073  53.206 106.772 1.00 49.63  ? 109  ALA B N   1 
ATOM   1999 C CA  . ALA B 2 71  ? 56.421  51.997 107.312 1.00 47.31  ? 109  ALA B CA  1 
ATOM   2000 C C   . ALA B 2 71  ? 56.913  51.771 108.729 1.00 50.83  ? 109  ALA B C   1 
ATOM   2001 O O   . ALA B 2 71  ? 56.113  51.611 109.647 1.00 51.70  ? 109  ALA B O   1 
ATOM   2002 C CB  . ALA B 2 71  ? 56.735  50.766 106.445 1.00 47.36  ? 109  ALA B CB  1 
ATOM   2003 N N   . ILE B 2 72  ? 58.240  51.767 108.890 1.00 46.63  ? 110  ILE B N   1 
ATOM   2004 C CA  . ILE B 2 72  ? 58.914  51.624 110.189 1.00 46.03  ? 110  ILE B CA  1 
ATOM   2005 C C   . ILE B 2 72  ? 58.347  52.636 111.224 1.00 50.16  ? 110  ILE B C   1 
ATOM   2006 O O   . ILE B 2 72  ? 57.842  52.268 112.294 1.00 47.36  ? 110  ILE B O   1 
ATOM   2007 C CB  . ILE B 2 72  ? 60.456  51.807 110.032 1.00 48.45  ? 110  ILE B CB  1 
ATOM   2008 C CG1 . ILE B 2 72  ? 61.034  50.843 108.994 1.00 48.76  ? 110  ILE B CG1 1 
ATOM   2009 C CG2 . ILE B 2 72  ? 61.152  51.636 111.346 1.00 47.32  ? 110  ILE B CG2 1 
ATOM   2010 C CD1 . ILE B 2 72  ? 62.532  50.532 109.207 1.00 53.63  ? 110  ILE B CD1 1 
ATOM   2011 N N   . ASN B 2 73  ? 58.384  53.920 110.883 1.00 49.03  ? 111  ASN B N   1 
ATOM   2012 C CA  . ASN B 2 73  ? 57.857  54.929 111.816 1.00 49.87  ? 111  ASN B CA  1 
ATOM   2013 C C   . ASN B 2 73  ? 56.378  54.695 112.139 1.00 50.82  ? 111  ASN B C   1 
ATOM   2014 O O   . ASN B 2 73  ? 55.994  54.649 113.297 1.00 52.10  ? 111  ASN B O   1 
ATOM   2015 C CB  . ASN B 2 73  ? 58.096  56.381 111.328 1.00 54.83  ? 111  ASN B CB  1 
ATOM   2016 C CG  . ASN B 2 73  ? 59.546  56.642 110.894 1.00 89.86  ? 111  ASN B CG  1 
ATOM   2017 O OD1 . ASN B 2 73  ? 60.500  56.001 111.372 1.00 82.77  ? 111  ASN B OD1 1 
ATOM   2018 N ND2 . ASN B 2 73  ? 59.714  57.624 110.006 1.00 86.68  ? 111  ASN B ND2 1 
ATOM   2019 N N   . ALA B 2 74  ? 55.575  54.536 111.095 1.00 44.82  ? 112  ALA B N   1 
ATOM   2020 C CA  . ALA B 2 74  ? 54.122  54.277 111.175 1.00 43.48  ? 112  ALA B CA  1 
ATOM   2021 C C   . ALA B 2 74  ? 53.643  52.998 111.876 1.00 46.48  ? 112  ALA B C   1 
ATOM   2022 O O   . ALA B 2 74  ? 52.521  52.969 112.361 1.00 46.68  ? 112  ALA B O   1 
ATOM   2023 C CB  . ALA B 2 74  ? 53.519  54.284 109.750 1.00 43.55  ? 112  ALA B CB  1 
ATOM   2024 N N   . PHE B 2 75  ? 54.411  51.913 111.814 1.00 41.43  ? 113  PHE B N   1 
ATOM   2025 C CA  . PHE B 2 75  ? 53.918  50.650 112.362 1.00 41.26  ? 113  PHE B CA  1 
ATOM   2026 C C   . PHE B 2 75  ? 54.759  49.995 113.436 1.00 45.62  ? 113  PHE B C   1 
ATOM   2027 O O   . PHE B 2 75  ? 54.311  49.036 114.033 1.00 45.33  ? 113  PHE B O   1 
ATOM   2028 C CB  . PHE B 2 75  ? 53.751  49.619 111.238 1.00 42.34  ? 113  PHE B CB  1 
ATOM   2029 C CG  . PHE B 2 75  ? 52.727  49.984 110.220 1.00 40.66  ? 113  PHE B CG  1 
ATOM   2030 C CD1 . PHE B 2 75  ? 53.104  50.290 108.915 1.00 42.90  ? 113  PHE B CD1 1 
ATOM   2031 C CD2 . PHE B 2 75  ? 51.388  49.958 110.546 1.00 39.64  ? 113  PHE B CD2 1 
ATOM   2032 C CE1 . PHE B 2 75  ? 52.144  50.648 107.955 1.00 42.78  ? 113  PHE B CE1 1 
ATOM   2033 C CE2 . PHE B 2 75  ? 50.420  50.337 109.614 1.00 42.18  ? 113  PHE B CE2 1 
ATOM   2034 C CZ  . PHE B 2 75  ? 50.796  50.682 108.311 1.00 40.05  ? 113  PHE B CZ  1 
ATOM   2035 N N   . HIS B 2 76  ? 56.001  50.424 113.605 1.00 43.32  ? 114  HIS B N   1 
ATOM   2036 C CA  . HIS B 2 76  ? 56.831  49.831 114.644 1.00 43.82  ? 114  HIS B CA  1 
ATOM   2037 C C   . HIS B 2 76  ? 56.039  50.118 115.902 1.00 45.95  ? 114  HIS B C   1 
ATOM   2038 O O   . HIS B 2 76  ? 55.538  51.231 116.084 1.00 45.40  ? 114  HIS B O   1 
ATOM   2039 C CB  . HIS B 2 76  ? 58.239  50.489 114.728 1.00 44.86  ? 114  HIS B CB  1 
ATOM   2040 C CG  . HIS B 2 76  ? 59.096  49.955 115.842 1.00 48.47  ? 114  HIS B CG  1 
ATOM   2041 N ND1 . HIS B 2 76  ? 59.420  48.618 115.958 1.00 50.48  ? 114  HIS B ND1 1 
ATOM   2042 C CD2 . HIS B 2 76  ? 59.661  50.571 116.908 1.00 49.58  ? 114  HIS B CD2 1 
ATOM   2043 C CE1 . HIS B 2 76  ? 60.204  48.450 117.009 1.00 49.52  ? 114  HIS B CE1 1 
ATOM   2044 N NE2 . HIS B 2 76  ? 60.354  49.617 117.610 1.00 49.45  ? 114  HIS B NE2 1 
ATOM   2045 N N   . GLN B 2 77  ? 55.835  49.102 116.734 1.00 42.41  ? 115  GLN B N   1 
ATOM   2046 C CA  . GLN B 2 77  ? 55.200  49.301 118.035 1.00 41.74  ? 115  GLN B CA  1 
ATOM   2047 C C   . GLN B 2 77  ? 53.690  49.535 117.917 1.00 45.44  ? 115  GLN B C   1 
ATOM   2048 O O   . GLN B 2 77  ? 53.039  49.942 118.880 1.00 46.12  ? 115  GLN B O   1 
ATOM   2049 C CB  . GLN B 2 77  ? 55.855  50.469 118.777 1.00 41.53  ? 115  GLN B CB  1 
ATOM   2050 C CG  . GLN B 2 77  ? 57.321  50.247 119.112 1.00 57.97  ? 115  GLN B CG  1 
ATOM   2051 C CD  . GLN B 2 77  ? 57.748  50.978 120.370 1.00 69.51  ? 115  GLN B CD  1 
ATOM   2052 O OE1 . GLN B 2 77  ? 57.230  52.049 120.685 1.00 54.00  ? 115  GLN B OE1 1 
ATOM   2053 N NE2 . GLN B 2 77  ? 58.698  50.400 121.096 1.00 55.24  ? 115  GLN B NE2 1 
ATOM   2054 N N   . SER B 2 78  ? 53.144  49.276 116.733 1.00 37.07  ? 116  SER B N   1 
ATOM   2055 C CA  . SER B 2 78  ? 51.693  49.219 116.523 1.00 35.18  ? 116  SER B CA  1 
ATOM   2056 C C   . SER B 2 78  ? 51.150  47.840 116.924 1.00 41.56  ? 116  SER B C   1 
ATOM   2057 O O   . SER B 2 78  ? 51.900  46.946 117.337 1.00 44.08  ? 116  SER B O   1 
ATOM   2058 C CB  . SER B 2 78  ? 51.278  49.582 115.083 1.00 35.23  ? 116  SER B CB  1 
ATOM   2059 O OG  . SER B 2 78  ? 51.898  48.784 114.095 1.00 41.83  ? 116  SER B OG  1 
ATOM   2060 N N   . ARG B 2 79  ? 49.838  47.685 116.873 1.00 36.92  ? 117  ARG B N   1 
ATOM   2061 C CA  . ARG B 2 79  ? 49.206  46.441 117.298 1.00 36.31  ? 117  ARG B CA  1 
ATOM   2062 C C   . ARG B 2 79  ? 48.419  45.881 116.131 1.00 42.31  ? 117  ARG B C   1 
ATOM   2063 O O   . ARG B 2 79  ? 47.638  46.600 115.494 1.00 43.15  ? 117  ARG B O   1 
ATOM   2064 C CB  . ARG B 2 79  ? 48.193  46.702 118.441 1.00 35.53  ? 117  ARG B CB  1 
ATOM   2065 C CG  . ARG B 2 79  ? 48.787  47.049 119.823 1.00 36.94  ? 117  ARG B CG  1 
ATOM   2066 C CD  . ARG B 2 79  ? 48.591  45.982 120.921 1.00 45.59  ? 117  ARG B CD  1 
ATOM   2067 N NE  . ARG B 2 79  ? 49.443  46.278 122.089 1.00 51.67  ? 117  ARG B NE  1 
ATOM   2068 C CZ  . ARG B 2 79  ? 49.972  45.381 122.927 1.00 64.17  ? 117  ARG B CZ  1 
ATOM   2069 N NH1 . ARG B 2 79  ? 49.735  44.078 122.790 1.00 45.44  ? 117  ARG B NH1 1 
ATOM   2070 N NH2 . ARG B 2 79  ? 50.754  45.798 123.923 1.00 53.06  ? 117  ARG B NH2 1 
ATOM   2071 N N   . LEU B 2 80  ? 48.566  44.584 115.875 1.00 38.02  ? 118  LEU B N   1 
ATOM   2072 C CA  . LEU B 2 80  ? 47.772  43.918 114.818 1.00 36.24  ? 118  LEU B CA  1 
ATOM   2073 C C   . LEU B 2 80  ? 47.082  42.736 115.490 1.00 38.70  ? 118  LEU B C   1 
ATOM   2074 O O   . LEU B 2 80  ? 47.744  41.817 115.973 1.00 38.39  ? 118  LEU B O   1 
ATOM   2075 C CB  . LEU B 2 80  ? 48.673  43.386 113.690 1.00 35.86  ? 118  LEU B CB  1 
ATOM   2076 C CG  . LEU B 2 80  ? 47.971  42.576 112.590 1.00 37.69  ? 118  LEU B CG  1 
ATOM   2077 C CD1 . LEU B 2 80  ? 47.118  43.524 111.756 1.00 35.44  ? 118  LEU B CD1 1 
ATOM   2078 C CD2 . LEU B 2 80  ? 49.003  41.917 111.736 1.00 36.65  ? 118  LEU B CD2 1 
ATOM   2079 N N   . ARG B 2 81  ? 45.767  42.819 115.630 1.00 32.90  ? 119  ARG B N   1 
ATOM   2080 C CA  . ARG B 2 81  ? 45.025  41.753 116.303 1.00 30.40  ? 119  ARG B CA  1 
ATOM   2081 C C   . ARG B 2 81  ? 45.551  41.429 117.691 1.00 36.03  ? 119  ARG B C   1 
ATOM   2082 O O   . ARG B 2 81  ? 45.684  40.261 118.105 1.00 38.05  ? 119  ARG B O   1 
ATOM   2083 C CB  . ARG B 2 81  ? 44.932  40.525 115.424 1.00 24.05  ? 119  ARG B CB  1 
ATOM   2084 C CG  . ARG B 2 81  ? 43.920  40.678 114.262 1.00 24.32  ? 119  ARG B CG  1 
ATOM   2085 C CD  . ARG B 2 81  ? 44.038  39.527 113.233 1.00 30.44  ? 119  ARG B CD  1 
ATOM   2086 N NE  . ARG B 2 81  ? 44.520  38.313 113.906 1.00 50.11  ? 119  ARG B NE  1 
ATOM   2087 C CZ  . ARG B 2 81  ? 45.158  37.297 113.330 1.00 52.96  ? 119  ARG B CZ  1 
ATOM   2088 N NH1 . ARG B 2 81  ? 45.433  37.286 112.045 1.00 33.24  ? 119  ARG B NH1 1 
ATOM   2089 N NH2 . ARG B 2 81  ? 45.545  36.294 114.062 1.00 42.73  ? 119  ARG B NH2 1 
ATOM   2090 N N   . GLU B 2 82  ? 45.818  42.501 118.415 1.00 32.01  ? 120  GLU B N   1 
ATOM   2091 C CA  . GLU B 2 82  ? 46.236  42.458 119.801 1.00 30.07  ? 120  GLU B CA  1 
ATOM   2092 C C   . GLU B 2 82  ? 47.679  42.196 119.976 1.00 34.58  ? 120  GLU B C   1 
ATOM   2093 O O   . GLU B 2 82  ? 48.136  42.175 121.097 1.00 34.61  ? 120  GLU B O   1 
ATOM   2094 C CB  . GLU B 2 82  ? 45.397  41.471 120.581 1.00 30.67  ? 120  GLU B CB  1 
ATOM   2095 C CG  . GLU B 2 82  ? 44.027  41.975 120.889 1.00 36.45  ? 120  GLU B CG  1 
ATOM   2096 C CD  . GLU B 2 82  ? 44.100  43.277 121.639 1.00 59.91  ? 120  GLU B CD  1 
ATOM   2097 O OE1 . GLU B 2 82  ? 44.479  43.210 122.850 1.00 38.71  ? 120  GLU B OE1 1 
ATOM   2098 O OE2 . GLU B 2 82  ? 43.928  44.335 120.966 1.00 52.54  ? 120  GLU B OE2 1 
ATOM   2099 N N   . ARG B 2 83  ? 48.389  41.970 118.871 1.00 34.20  ? 121  ARG B N   1 
ATOM   2100 C CA  . ARG B 2 83  ? 49.856  41.728 118.895 1.00 34.15  ? 121  ARG B CA  1 
ATOM   2101 C C   . ARG B 2 83  ? 50.625  43.029 118.680 1.00 38.99  ? 121  ARG B C   1 
ATOM   2102 O O   . ARG B 2 83  ? 50.182  43.888 117.897 1.00 41.04  ? 121  ARG B O   1 
ATOM   2103 C CB  . ARG B 2 83  ? 50.284  40.774 117.771 1.00 30.56  ? 121  ARG B CB  1 
ATOM   2104 C CG  . ARG B 2 83  ? 50.279  39.307 118.184 1.00 33.21  ? 121  ARG B CG  1 
ATOM   2105 C CD  . ARG B 2 83  ? 48.851  38.771 118.119 1.00 31.74  ? 121  ARG B CD  1 
ATOM   2106 N NE  . ARG B 2 83  ? 48.735  37.305 118.107 1.00 27.24  ? 121  ARG B NE  1 
ATOM   2107 C CZ  . ARG B 2 83  ? 47.589  36.681 117.823 1.00 39.84  ? 121  ARG B CZ  1 
ATOM   2108 N NH1 . ARG B 2 83  ? 46.483  37.380 117.566 1.00 28.65  ? 121  ARG B NH1 1 
ATOM   2109 N NH2 . ARG B 2 83  ? 47.528  35.371 117.813 1.00 25.34  ? 121  ARG B NH2 1 
ATOM   2110 N N   . GLU B 2 84  ? 51.795  43.145 119.308 1.00 32.81  ? 122  GLU B N   1 
ATOM   2111 C CA  . GLU B 2 84  ? 52.623  44.317 119.134 1.00 32.01  ? 122  GLU B CA  1 
ATOM   2112 C C   . GLU B 2 84  ? 53.664  43.996 118.115 1.00 39.00  ? 122  GLU B C   1 
ATOM   2113 O O   . GLU B 2 84  ? 54.490  43.093 118.317 1.00 39.45  ? 122  GLU B O   1 
ATOM   2114 C CB  . GLU B 2 84  ? 53.321  44.707 120.436 1.00 33.16  ? 122  GLU B CB  1 
ATOM   2115 C CG  . GLU B 2 84  ? 54.028  46.048 120.352 1.00 39.82  ? 122  GLU B CG  1 
ATOM   2116 C CD  . GLU B 2 84  ? 54.960  46.279 121.508 1.00 56.20  ? 122  GLU B CD  1 
ATOM   2117 O OE1 . GLU B 2 84  ? 54.694  47.184 122.313 1.00 55.98  ? 122  GLU B OE1 1 
ATOM   2118 O OE2 . GLU B 2 84  ? 55.981  45.570 121.592 1.00 61.07  ? 122  GLU B OE2 1 
ATOM   2119 N N   . LEU B 2 85  ? 53.665  44.762 117.029 1.00 36.30  ? 123  LEU B N   1 
ATOM   2120 C CA  . LEU B 2 85  ? 54.650  44.544 115.970 1.00 35.73  ? 123  LEU B CA  1 
ATOM   2121 C C   . LEU B 2 85  ? 55.945  45.322 116.178 1.00 41.76  ? 123  LEU B C   1 
ATOM   2122 O O   . LEU B 2 85  ? 55.940  46.398 116.738 1.00 41.19  ? 123  LEU B O   1 
ATOM   2123 C CB  . LEU B 2 85  ? 54.051  44.916 114.631 1.00 34.88  ? 123  LEU B CB  1 
ATOM   2124 C CG  . LEU B 2 85  ? 52.657  44.320 114.439 1.00 38.73  ? 123  LEU B CG  1 
ATOM   2125 C CD1 . LEU B 2 85  ? 52.020  44.809 113.162 1.00 37.97  ? 123  LEU B CD1 1 
ATOM   2126 C CD2 . LEU B 2 85  ? 52.697  42.797 114.482 1.00 39.94  ? 123  LEU B CD2 1 
ATOM   2127 N N   . SER B 2 86  ? 57.053  44.746 115.739 1.00 40.69  ? 124  SER B N   1 
ATOM   2128 C CA  . SER B 2 86  ? 58.332  45.414 115.730 1.00 40.45  ? 124  SER B CA  1 
ATOM   2129 C C   . SER B 2 86  ? 58.559  45.582 114.234 1.00 45.87  ? 124  SER B C   1 
ATOM   2130 O O   . SER B 2 86  ? 58.555  44.607 113.511 1.00 46.18  ? 124  SER B O   1 
ATOM   2131 C CB  . SER B 2 86  ? 59.422  44.502 116.275 1.00 43.50  ? 124  SER B CB  1 
ATOM   2132 O OG  . SER B 2 86  ? 60.526  44.454 115.375 1.00 54.47  ? 124  SER B OG  1 
ATOM   2133 N N   . VAL B 2 87  ? 58.732  46.808 113.757 1.00 43.43  ? 125  VAL B N   1 
ATOM   2134 C CA  . VAL B 2 87  ? 59.009  47.030 112.341 1.00 43.00  ? 125  VAL B CA  1 
ATOM   2135 C C   . VAL B 2 87  ? 60.381  47.683 112.253 1.00 50.47  ? 125  VAL B C   1 
ATOM   2136 O O   . VAL B 2 87  ? 60.624  48.665 112.954 1.00 50.83  ? 125  VAL B O   1 
ATOM   2137 C CB  . VAL B 2 87  ? 57.954  47.930 111.739 1.00 45.44  ? 125  VAL B CB  1 
ATOM   2138 C CG1 . VAL B 2 87  ? 58.264  48.159 110.257 1.00 44.62  ? 125  VAL B CG1 1 
ATOM   2139 C CG2 . VAL B 2 87  ? 56.532  47.343 111.989 1.00 44.50  ? 125  VAL B CG2 1 
ATOM   2140 N N   . GLN B 2 88  ? 61.279  47.132 111.428 1.00 48.02  ? 126  GLN B N   1 
ATOM   2141 C CA  . GLN B 2 88  ? 62.653  47.623 111.316 1.00 47.49  ? 126  GLN B CA  1 
ATOM   2142 C C   . GLN B 2 88  ? 63.343  47.107 110.062 1.00 54.91  ? 126  GLN B C   1 
ATOM   2143 O O   . GLN B 2 88  ? 62.936  46.070 109.506 1.00 54.99  ? 126  GLN B O   1 
ATOM   2144 C CB  . GLN B 2 88  ? 63.430  47.141 112.529 1.00 48.62  ? 126  GLN B CB  1 
ATOM   2145 C CG  . GLN B 2 88  ? 63.188  47.984 113.756 1.00 65.10  ? 126  GLN B CG  1 
ATOM   2146 C CD  . GLN B 2 88  ? 63.798  47.366 114.966 1.00 102.65 ? 126  GLN B CD  1 
ATOM   2147 O OE1 . GLN B 2 88  ? 63.892  46.134 115.066 1.00 104.26 ? 126  GLN B OE1 1 
ATOM   2148 N NE2 . GLN B 2 88  ? 64.262  48.206 115.889 1.00 98.34  ? 126  GLN B NE2 1 
ATOM   2149 N N   . LEU B 2 89  ? 64.411  47.789 109.634 1.00 53.12  ? 127  LEU B N   1 
ATOM   2150 C CA  . LEU B 2 89  ? 65.129  47.379 108.407 1.00 53.05  ? 127  LEU B CA  1 
ATOM   2151 C C   . LEU B 2 89  ? 65.708  45.986 108.424 1.00 58.22  ? 127  LEU B C   1 
ATOM   2152 O O   . LEU B 2 89  ? 66.422  45.632 109.352 1.00 57.35  ? 127  LEU B O   1 
ATOM   2153 C CB  . LEU B 2 89  ? 66.246  48.351 108.075 1.00 52.83  ? 127  LEU B CB  1 
ATOM   2154 C CG  . LEU B 2 89  ? 65.818  49.751 107.664 1.00 57.19  ? 127  LEU B CG  1 
ATOM   2155 C CD1 . LEU B 2 89  ? 67.042  50.623 107.600 1.00 57.40  ? 127  LEU B CD1 1 
ATOM   2156 C CD2 . LEU B 2 89  ? 65.115  49.716 106.324 1.00 57.50  ? 127  LEU B CD2 1 
ATOM   2157 N N   . GLN B 2 90  ? 65.439  45.216 107.370 1.00 57.55  ? 128  GLN B N   1 
ATOM   2158 C CA  . GLN B 2 90  ? 65.978  43.856 107.258 1.00 58.76  ? 128  GLN B CA  1 
ATOM   2159 C C   . GLN B 2 90  ? 67.510  43.896 107.446 1.00 72.34  ? 128  GLN B C   1 
ATOM   2160 O O   . GLN B 2 90  ? 68.161  44.925 107.257 1.00 72.26  ? 128  GLN B O   1 
ATOM   2161 C CB  . GLN B 2 90  ? 65.642  43.298 105.881 1.00 58.81  ? 128  GLN B CB  1 
ATOM   2162 C CG  . GLN B 2 90  ? 65.400  41.816 105.792 1.00 56.63  ? 128  GLN B CG  1 
ATOM   2163 C CD  . GLN B 2 90  ? 64.476  41.460 104.617 1.00 74.94  ? 128  GLN B CD  1 
ATOM   2164 O OE1 . GLN B 2 90  ? 63.629  42.265 104.182 1.00 60.12  ? 128  GLN B OE1 1 
ATOM   2165 N NE2 . GLN B 2 90  ? 64.653  40.256 104.086 1.00 74.42  ? 128  GLN B NE2 1 
ATOM   2166 N N   . PRO B 2 91  ? 68.103  42.768 107.840 1.00 75.45  ? 129  PRO B N   1 
ATOM   2167 C CA  . PRO B 2 91  ? 69.564  42.750 107.974 1.00 76.36  ? 129  PRO B CA  1 
ATOM   2168 C C   . PRO B 2 91  ? 70.215  42.573 106.592 1.00 81.16  ? 129  PRO B C   1 
ATOM   2169 O O   . PRO B 2 91  ? 69.527  42.252 105.626 1.00 80.49  ? 129  PRO B O   1 
ATOM   2170 C CB  . PRO B 2 91  ? 69.809  41.500 108.832 1.00 78.42  ? 129  PRO B CB  1 
ATOM   2171 C CG  . PRO B 2 91  ? 68.661  40.569 108.469 1.00 83.23  ? 129  PRO B CG  1 
ATOM   2172 C CD  . PRO B 2 91  ? 67.477  41.513 108.310 1.00 78.62  ? 129  PRO B CD  1 
ATOM   2173 N N   . THR B 2 92  ? 71.539  42.749 106.524 1.00 79.38  ? 130  THR B N   1 
ATOM   2174 C CA  . THR B 2 92  ? 72.331  42.602 105.289 1.00 79.45  ? 130  THR B CA  1 
ATOM   2175 C C   . THR B 2 92  ? 72.562  41.147 104.834 1.00 83.19  ? 130  THR B C   1 
ATOM   2176 O O   . THR B 2 92  ? 73.230  40.349 105.501 1.00 82.84  ? 130  THR B O   1 
ATOM   2177 C CB  . THR B 2 92  ? 73.651  43.401 105.378 1.00 89.02  ? 130  THR B CB  1 
ATOM   2178 O OG1 . THR B 2 92  ? 73.400  44.772 105.029 1.00 87.88  ? 130  THR B OG1 1 
ATOM   2179 C CG2 . THR B 2 92  ? 74.741  42.791 104.461 1.00 86.65  ? 130  THR B CG2 1 
ATOM   2180 N N   . ASP B 2 93  ? 72.000  40.807 103.684 1.00 79.60  ? 131  ASP B N   1 
ATOM   2181 C CA  . ASP B 2 93  ? 72.103  39.449 103.157 1.00 78.92  ? 131  ASP B CA  1 
ATOM   2182 C C   . ASP B 2 93  ? 73.281  39.382 102.177 1.00 75.48  ? 131  ASP B C   1 
ATOM   2183 O O   . ASP B 2 93  ? 74.445  39.239 102.567 1.00 75.20  ? 131  ASP B O   1 
ATOM   2184 C CB  . ASP B 2 93  ? 70.789  39.113 102.423 1.00 82.21  ? 131  ASP B CB  1 
ATOM   2185 C CG  . ASP B 2 93  ? 70.210  37.761 102.816 1.00 101.05 ? 131  ASP B CG  1 
ATOM   2186 O OD1 . ASP B 2 93  ? 69.173  37.363 102.219 1.00 103.16 ? 131  ASP B OD1 1 
ATOM   2187 O OD2 . ASP B 2 93  ? 70.790  37.093 103.704 1.00 109.77 ? 131  ASP B OD2 1 
ATOM   2188 N N   . ALA B 2 94  ? 72.947  39.572 100.906 1.00 66.17  ? 132  ALA B N   1 
ATOM   2189 C CA  . ALA B 2 94  ? 73.903  39.557 99.806  1.00 63.68  ? 132  ALA B CA  1 
ATOM   2190 C C   . ALA B 2 94  ? 74.633  40.877 99.568  1.00 58.51  ? 132  ALA B C   1 
ATOM   2191 O O   . ALA B 2 94  ? 74.357  41.524 98.562  1.00 56.55  ? 132  ALA B O   1 
ATOM   2192 C CB  . ALA B 2 94  ? 73.183  39.150 98.516  1.00 64.71  ? 132  ALA B CB  1 
ATOM   2193 N N   . LEU B 2 95  ? 75.567  41.245 100.457 1.00 50.15  ? 133  LEU B N   1 
ATOM   2194 C CA  . LEU B 2 95  ? 76.385  42.471 100.319 1.00 46.97  ? 133  LEU B CA  1 
ATOM   2195 C C   . LEU B 2 95  ? 77.846  42.112 100.120 1.00 46.04  ? 133  LEU B C   1 
ATOM   2196 O O   . LEU B 2 95  ? 78.510  41.624 101.017 1.00 45.73  ? 133  LEU B O   1 
ATOM   2197 C CB  . LEU B 2 95  ? 76.277  43.370 101.550 1.00 46.96  ? 133  LEU B CB  1 
ATOM   2198 C CG  . LEU B 2 95  ? 76.264  44.891 101.348 1.00 51.58  ? 133  LEU B CG  1 
ATOM   2199 C CD1 . LEU B 2 95  ? 77.318  45.563 102.186 1.00 51.03  ? 133  LEU B CD1 1 
ATOM   2200 C CD2 . LEU B 2 95  ? 76.403  45.303 99.881  1.00 54.16  ? 133  LEU B CD2 1 
ATOM   2201 N N   . LEU B 2 96  ? 78.317  42.309 98.903  1.00 40.37  ? 134  LEU B N   1 
ATOM   2202 C CA  . LEU B 2 96  ? 79.686  42.003 98.511  1.00 38.13  ? 134  LEU B CA  1 
ATOM   2203 C C   . LEU B 2 96  ? 80.488  43.301 98.426  1.00 39.61  ? 134  LEU B C   1 
ATOM   2204 O O   . LEU B 2 96  ? 79.946  44.388 98.131  1.00 35.91  ? 134  LEU B O   1 
ATOM   2205 C CB  . LEU B 2 96  ? 79.699  41.367 97.101  1.00 36.92  ? 134  LEU B CB  1 
ATOM   2206 C CG  . LEU B 2 96  ? 79.062  40.003 96.882  1.00 39.70  ? 134  LEU B CG  1 
ATOM   2207 C CD1 . LEU B 2 96  ? 79.638  39.390 95.630  1.00 38.88  ? 134  LEU B CD1 1 
ATOM   2208 C CD2 . LEU B 2 96  ? 79.370  39.119 98.054  1.00 41.79  ? 134  LEU B CD2 1 
ATOM   2209 N N   . CYS B 2 97  ? 81.794  43.138 98.586  1.00 36.31  ? 135  CYS B N   1 
ATOM   2210 C CA  . CYS B 2 97  ? 82.734  44.208 98.400  1.00 36.51  ? 135  CYS B CA  1 
ATOM   2211 C C   . CYS B 2 97  ? 83.682  43.696 97.349  1.00 36.16  ? 135  CYS B C   1 
ATOM   2212 O O   . CYS B 2 97  ? 84.383  42.722 97.572  1.00 35.15  ? 135  CYS B O   1 
ATOM   2213 C CB  . CYS B 2 97  ? 83.523  44.520 99.671  1.00 38.73  ? 135  CYS B CB  1 
ATOM   2214 S SG  . CYS B 2 97  ? 84.754  45.883 99.436  1.00 44.22  ? 135  CYS B SG  1 
ATOM   2215 N N   . VAL B 2 98  ? 83.716  44.370 96.208  1.00 32.12  ? 136  VAL B N   1 
ATOM   2216 C CA  . VAL B 2 98  ? 84.625  44.013 95.116  1.00 31.88  ? 136  VAL B CA  1 
ATOM   2217 C C   . VAL B 2 98  ? 85.763  45.031 95.181  1.00 35.31  ? 136  VAL B C   1 
ATOM   2218 O O   . VAL B 2 98  ? 85.548  46.236 95.157  1.00 36.80  ? 136  VAL B O   1 
ATOM   2219 C CB  . VAL B 2 98  ? 83.904  44.030 93.740  1.00 34.84  ? 136  VAL B CB  1 
ATOM   2220 C CG1 . VAL B 2 98  ? 84.769  43.411 92.650  1.00 33.76  ? 136  VAL B CG1 1 
ATOM   2221 C CG2 . VAL B 2 98  ? 82.565  43.332 93.817  1.00 34.64  ? 136  VAL B CG2 1 
ATOM   2222 N N   . ALA B 2 99  ? 86.962  44.540 95.386  1.00 30.77  ? 137  ALA B N   1 
ATOM   2223 C CA  . ALA B 2 99  ? 88.111  45.410 95.575  1.00 30.24  ? 137  ALA B CA  1 
ATOM   2224 C C   . ALA B 2 99  ? 89.205  45.100 94.581  1.00 37.52  ? 137  ALA B C   1 
ATOM   2225 O O   . ALA B 2 99  ? 89.127  44.163 93.771  1.00 38.85  ? 137  ALA B O   1 
ATOM   2226 C CB  . ALA B 2 99  ? 88.655  45.313 96.988  1.00 30.17  ? 137  ALA B CB  1 
ATOM   2227 N N   . ASN B 2 100 ? 90.226  45.926 94.643  1.00 34.29  ? 138  ASN B N   1 
ATOM   2228 C CA  . ASN B 2 100 ? 91.287  45.907 93.666  1.00 32.12  ? 138  ASN B CA  1 
ATOM   2229 C C   . ASN B 2 100 ? 90.773  46.237 92.256  1.00 36.11  ? 138  ASN B C   1 
ATOM   2230 O O   . ASN B 2 100 ? 91.372  45.840 91.264  1.00 36.27  ? 138  ASN B O   1 
ATOM   2231 C CB  . ASN B 2 100 ? 92.070  44.631 93.710  1.00 22.16  ? 138  ASN B CB  1 
ATOM   2232 C CG  . ASN B 2 100 ? 93.436  44.806 93.165  1.00 45.26  ? 138  ASN B CG  1 
ATOM   2233 O OD1 . ASN B 2 100 ? 94.077  45.818 93.433  1.00 36.47  ? 138  ASN B OD1 1 
ATOM   2234 N ND2 . ASN B 2 100 ? 93.907  43.832 92.387  1.00 38.00  ? 138  ASN B ND2 1 
ATOM   2235 N N   . LEU B 2 101 ? 89.714  47.040 92.172  1.00 33.11  ? 139  LEU B N   1 
ATOM   2236 C CA  . LEU B 2 101 ? 89.214  47.477 90.864  1.00 34.15  ? 139  LEU B CA  1 
ATOM   2237 C C   . LEU B 2 101 ? 90.230  48.402 90.202  1.00 38.54  ? 139  LEU B C   1 
ATOM   2238 O O   . LEU B 2 101 ? 91.055  49.006 90.872  1.00 38.45  ? 139  LEU B O   1 
ATOM   2239 C CB  . LEU B 2 101 ? 87.903  48.256 91.022  1.00 33.88  ? 139  LEU B CB  1 
ATOM   2240 C CG  . LEU B 2 101 ? 86.728  47.528 91.677  1.00 38.40  ? 139  LEU B CG  1 
ATOM   2241 C CD1 . LEU B 2 101 ? 85.683  48.522 92.146  1.00 38.24  ? 139  LEU B CD1 1 
ATOM   2242 C CD2 . LEU B 2 101 ? 86.144  46.480 90.751  1.00 39.04  ? 139  LEU B CD2 1 
ATOM   2243 N N   . PRO B 2 102 ? 90.138  48.578 88.877  1.00 36.83  ? 140  PRO B N   1 
ATOM   2244 C CA  . PRO B 2 102 ? 91.052  49.601 88.363  1.00 36.29  ? 140  PRO B CA  1 
ATOM   2245 C C   . PRO B 2 102 ? 90.612  50.961 88.931  1.00 41.57  ? 140  PRO B C   1 
ATOM   2246 O O   . PRO B 2 102 ? 89.408  51.262 89.029  1.00 40.87  ? 140  PRO B O   1 
ATOM   2247 C CB  . PRO B 2 102 ? 90.803  49.526 86.855  1.00 36.15  ? 140  PRO B CB  1 
ATOM   2248 C CG  . PRO B 2 102 ? 90.553  48.142 86.634  1.00 39.63  ? 140  PRO B CG  1 
ATOM   2249 C CD  . PRO B 2 102 ? 89.719  47.681 87.789  1.00 36.77  ? 140  PRO B CD  1 
ATOM   2250 N N   . PRO B 2 103 ? 91.583  51.771 89.380  1.00 40.87  ? 141  PRO B N   1 
ATOM   2251 C CA  . PRO B 2 103 ? 91.300  53.087 89.988  1.00 40.25  ? 141  PRO B CA  1 
ATOM   2252 C C   . PRO B 2 103 ? 90.508  54.007 89.059  1.00 40.45  ? 141  PRO B C   1 
ATOM   2253 O O   . PRO B 2 103 ? 89.842  54.912 89.518  1.00 39.90  ? 141  PRO B O   1 
ATOM   2254 C CB  . PRO B 2 103 ? 92.696  53.655 90.241  1.00 41.34  ? 141  PRO B CB  1 
ATOM   2255 C CG  . PRO B 2 103 ? 93.534  52.502 90.429  1.00 45.45  ? 141  PRO B CG  1 
ATOM   2256 C CD  . PRO B 2 103 ? 93.028  51.472 89.427  1.00 42.70  ? 141  PRO B CD  1 
ATOM   2257 N N   . SER B 2 104 ? 90.538  53.712 87.764  1.00 35.04  ? 142  SER B N   1 
ATOM   2258 C CA  . SER B 2 104 ? 89.807  54.478 86.745  1.00 34.94  ? 142  SER B CA  1 
ATOM   2259 C C   . SER B 2 104 ? 88.394  53.925 86.400  1.00 40.34  ? 142  SER B C   1 
ATOM   2260 O O   . SER B 2 104 ? 87.595  54.579 85.706  1.00 40.17  ? 142  SER B O   1 
ATOM   2261 C CB  . SER B 2 104 ? 90.637  54.492 85.463  1.00 37.04  ? 142  SER B CB  1 
ATOM   2262 O OG  . SER B 2 104 ? 90.748  53.159 84.957  1.00 44.11  ? 142  SER B OG  1 
ATOM   2263 N N   . LEU B 2 105 ? 88.111  52.697 86.819  1.00 36.44  ? 143  LEU B N   1 
ATOM   2264 C CA  . LEU B 2 105 ? 86.805  52.120 86.562  1.00 34.84  ? 143  LEU B CA  1 
ATOM   2265 C C   . LEU B 2 105 ? 85.732  53.092 87.054  1.00 41.78  ? 143  LEU B C   1 
ATOM   2266 O O   . LEU B 2 105 ? 85.778  53.535 88.221  1.00 43.70  ? 143  LEU B O   1 
ATOM   2267 C CB  . LEU B 2 105 ? 86.666  50.805 87.310  1.00 33.51  ? 143  LEU B CB  1 
ATOM   2268 C CG  . LEU B 2 105 ? 85.581  49.925 86.701  1.00 36.88  ? 143  LEU B CG  1 
ATOM   2269 C CD1 . LEU B 2 105 ? 86.014  49.526 85.298  1.00 34.35  ? 143  LEU B CD1 1 
ATOM   2270 C CD2 . LEU B 2 105 ? 85.111  48.708 87.569  1.00 34.84  ? 143  LEU B CD2 1 
ATOM   2271 N N   . THR B 2 106 ? 84.771  53.410 86.184  1.00 36.62  ? 144  THR B N   1 
ATOM   2272 C CA  . THR B 2 106 ? 83.680  54.278 86.570  1.00 35.86  ? 144  THR B CA  1 
ATOM   2273 C C   . THR B 2 106 ? 82.580  53.559 87.299  1.00 42.82  ? 144  THR B C   1 
ATOM   2274 O O   . THR B 2 106 ? 82.522  52.333 87.316  1.00 44.23  ? 144  THR B O   1 
ATOM   2275 C CB  . THR B 2 106 ? 83.115  54.980 85.403  1.00 32.96  ? 144  THR B CB  1 
ATOM   2276 O OG1 . THR B 2 106 ? 82.412  54.034 84.596  1.00 39.06  ? 144  THR B OG1 1 
ATOM   2277 C CG2 . THR B 2 106 ? 84.216  55.554 84.628  1.00 26.57  ? 144  THR B CG2 1 
ATOM   2278 N N   . GLN B 2 107 ? 81.671  54.352 87.855  1.00 39.16  ? 145  GLN B N   1 
ATOM   2279 C CA  . GLN B 2 107 ? 80.543  53.825 88.568  1.00 37.82  ? 145  GLN B CA  1 
ATOM   2280 C C   . GLN B 2 107 ? 79.666  53.037 87.624  1.00 42.40  ? 145  GLN B C   1 
ATOM   2281 O O   . GLN B 2 107 ? 79.141  51.993 87.996  1.00 45.04  ? 145  GLN B O   1 
ATOM   2282 C CB  . GLN B 2 107 ? 79.770  54.946 89.240  1.00 38.35  ? 145  GLN B CB  1 
ATOM   2283 C CG  . GLN B 2 107 ? 78.334  54.548 89.701  1.00 41.62  ? 145  GLN B CG  1 
ATOM   2284 C CD  . GLN B 2 107 ? 78.292  53.411 90.712  1.00 44.73  ? 145  GLN B CD  1 
ATOM   2285 O OE1 . GLN B 2 107 ? 77.520  52.477 90.553  1.00 40.99  ? 145  GLN B OE1 1 
ATOM   2286 N NE2 . GLN B 2 107 ? 79.056  53.529 91.792  1.00 30.14  ? 145  GLN B NE2 1 
ATOM   2287 N N   . GLN B 2 108 ? 79.538  53.500 86.386  1.00 36.96  ? 146  GLN B N   1 
ATOM   2288 C CA  . GLN B 2 108 ? 78.736  52.771 85.406  1.00 37.33  ? 146  GLN B CA  1 
ATOM   2289 C C   . GLN B 2 108 ? 79.430  51.474 84.985  1.00 43.54  ? 146  GLN B C   1 
ATOM   2290 O O   . GLN B 2 108 ? 78.784  50.472 84.713  1.00 44.57  ? 146  GLN B O   1 
ATOM   2291 C CB  . GLN B 2 108 ? 78.421  53.620 84.165  1.00 38.11  ? 146  GLN B CB  1 
ATOM   2292 C CG  . GLN B 2 108 ? 77.494  52.951 83.166  1.00 61.88  ? 146  GLN B CG  1 
ATOM   2293 C CD  . GLN B 2 108 ? 77.561  53.620 81.802  1.00 91.61  ? 146  GLN B CD  1 
ATOM   2294 O OE1 . GLN B 2 108 ? 78.050  53.037 80.824  1.00 86.99  ? 146  GLN B OE1 1 
ATOM   2295 N NE2 . GLN B 2 108 ? 77.114  54.872 81.738  1.00 85.91  ? 146  GLN B NE2 1 
ATOM   2296 N N   . GLN B 2 109 ? 80.751  51.494 84.888  1.00 38.10  ? 147  GLN B N   1 
ATOM   2297 C CA  . GLN B 2 109 ? 81.441  50.289 84.498  1.00 35.09  ? 147  GLN B CA  1 
ATOM   2298 C C   . GLN B 2 109 ? 81.326  49.289 85.625  1.00 36.08  ? 147  GLN B C   1 
ATOM   2299 O O   . GLN B 2 109 ? 81.264  48.069 85.392  1.00 34.51  ? 147  GLN B O   1 
ATOM   2300 C CB  . GLN B 2 109 ? 82.882  50.596 84.249  1.00 35.55  ? 147  GLN B CB  1 
ATOM   2301 C CG  . GLN B 2 109 ? 83.046  51.398 83.025  1.00 38.70  ? 147  GLN B CG  1 
ATOM   2302 C CD  . GLN B 2 109 ? 84.431  51.992 82.903  1.00 50.77  ? 147  GLN B CD  1 
ATOM   2303 O OE1 . GLN B 2 109 ? 85.048  52.371 83.887  1.00 47.66  ? 147  GLN B OE1 1 
ATOM   2304 N NE2 . GLN B 2 109 ? 84.907  52.109 81.682  1.00 44.16  ? 147  GLN B NE2 1 
ATOM   2305 N N   . PHE B 2 110 ? 81.334  49.804 86.851  1.00 31.17  ? 148  PHE B N   1 
ATOM   2306 C CA  . PHE B 2 110 ? 81.189  48.946 88.021  1.00 30.55  ? 148  PHE B CA  1 
ATOM   2307 C C   . PHE B 2 110 ? 79.809  48.248 88.015  1.00 37.92  ? 148  PHE B C   1 
ATOM   2308 O O   . PHE B 2 110 ? 79.722  47.042 88.259  1.00 39.21  ? 148  PHE B O   1 
ATOM   2309 C CB  . PHE B 2 110 ? 81.337  49.755 89.289  1.00 30.99  ? 148  PHE B CB  1 
ATOM   2310 C CG  . PHE B 2 110 ? 81.310  48.921 90.541  1.00 31.49  ? 148  PHE B CG  1 
ATOM   2311 C CD1 . PHE B 2 110 ? 82.226  47.891 90.719  1.00 31.85  ? 148  PHE B CD1 1 
ATOM   2312 C CD2 . PHE B 2 110 ? 80.360  49.158 91.540  1.00 33.20  ? 148  PHE B CD2 1 
ATOM   2313 C CE1 . PHE B 2 110 ? 82.219  47.127 91.857  1.00 31.35  ? 148  PHE B CE1 1 
ATOM   2314 C CE2 . PHE B 2 110 ? 80.322  48.375 92.664  1.00 35.69  ? 148  PHE B CE2 1 
ATOM   2315 C CZ  . PHE B 2 110 ? 81.285  47.366 92.829  1.00 32.64  ? 148  PHE B CZ  1 
ATOM   2316 N N   . GLU B 2 111 ? 78.744  48.999 87.738  1.00 32.79  ? 149  GLU B N   1 
ATOM   2317 C CA  . GLU B 2 111 ? 77.430  48.417 87.732  1.00 33.24  ? 149  GLU B CA  1 
ATOM   2318 C C   . GLU B 2 111 ? 77.383  47.333 86.666  1.00 38.58  ? 149  GLU B C   1 
ATOM   2319 O O   . GLU B 2 111 ? 76.859  46.223 86.881  1.00 40.17  ? 149  GLU B O   1 
ATOM   2320 C CB  . GLU B 2 111 ? 76.387  49.476 87.414  1.00 35.36  ? 149  GLU B CB  1 
ATOM   2321 C CG  . GLU B 2 111 ? 75.030  49.242 88.064  1.00 47.14  ? 149  GLU B CG  1 
ATOM   2322 C CD  . GLU B 2 111 ? 73.911  49.145 87.060  1.00 74.31  ? 149  GLU B CD  1 
ATOM   2323 O OE1 . GLU B 2 111 ? 74.070  48.439 86.046  1.00 86.74  ? 149  GLU B OE1 1 
ATOM   2324 O OE2 . GLU B 2 111 ? 72.862  49.774 87.282  1.00 64.68  ? 149  GLU B OE2 1 
ATOM   2325 N N   . GLU B 2 112 ? 77.952  47.645 85.512  1.00 33.39  ? 150  GLU B N   1 
ATOM   2326 C CA  . GLU B 2 112 ? 77.976  46.702 84.408  1.00 31.59  ? 150  GLU B CA  1 
ATOM   2327 C C   . GLU B 2 112 ? 78.655  45.379 84.750  1.00 37.60  ? 150  GLU B C   1 
ATOM   2328 O O   . GLU B 2 112 ? 78.286  44.303 84.284  1.00 41.46  ? 150  GLU B O   1 
ATOM   2329 C CB  . GLU B 2 112 ? 78.671  47.330 83.239  1.00 31.80  ? 150  GLU B CB  1 
ATOM   2330 C CG  . GLU B 2 112 ? 77.793  48.302 82.468  1.00 37.26  ? 150  GLU B CG  1 
ATOM   2331 C CD  . GLU B 2 112 ? 78.588  49.148 81.493  1.00 47.26  ? 150  GLU B CD  1 
ATOM   2332 O OE1 . GLU B 2 112 ? 79.822  48.996 81.389  1.00 51.63  ? 150  GLU B OE1 1 
ATOM   2333 O OE2 . GLU B 2 112 ? 77.967  49.930 80.785  1.00 39.34  ? 150  GLU B OE2 1 
ATOM   2334 N N   . LEU B 2 113 ? 79.653  45.484 85.588  1.00 32.77  ? 151  LEU B N   1 
ATOM   2335 C CA  . LEU B 2 113 ? 80.506  44.392 85.957  1.00 31.26  ? 151  LEU B CA  1 
ATOM   2336 C C   . LEU B 2 113 ? 79.784  43.404 86.844  1.00 37.84  ? 151  LEU B C   1 
ATOM   2337 O O   . LEU B 2 113 ? 79.962  42.194 86.751  1.00 37.35  ? 151  LEU B O   1 
ATOM   2338 C CB  . LEU B 2 113 ? 81.683  44.999 86.768  1.00 30.06  ? 151  LEU B CB  1 
ATOM   2339 C CG  . LEU B 2 113 ? 82.572  43.965 87.460  1.00 32.62  ? 151  LEU B CG  1 
ATOM   2340 C CD1 . LEU B 2 113 ? 83.462  43.383 86.410  1.00 30.85  ? 151  LEU B CD1 1 
ATOM   2341 C CD2 . LEU B 2 113 ? 83.395  44.584 88.550  1.00 33.88  ? 151  LEU B CD2 1 
ATOM   2342 N N   . VAL B 2 114 ? 78.976  43.972 87.715  1.00 36.34  ? 152  VAL B N   1 
ATOM   2343 C CA  . VAL B 2 114 ? 78.420  43.330 88.881  1.00 36.71  ? 152  VAL B CA  1 
ATOM   2344 C C   . VAL B 2 114 ? 76.934  43.021 88.774  1.00 41.44  ? 152  VAL B C   1 
ATOM   2345 O O   . VAL B 2 114 ? 76.399  42.242 89.558  1.00 41.87  ? 152  VAL B O   1 
ATOM   2346 C CB  . VAL B 2 114 ? 78.711  44.331 90.046  1.00 40.20  ? 152  VAL B CB  1 
ATOM   2347 C CG1 . VAL B 2 114 ? 77.498  44.864 90.728  1.00 38.83  ? 152  VAL B CG1 1 
ATOM   2348 C CG2 . VAL B 2 114 ? 79.973  44.017 90.888  1.00 39.57  ? 152  VAL B CG2 1 
ATOM   2349 N N   . ARG B 2 115 ? 76.286  43.633 87.793  1.00 36.98  ? 153  ARG B N   1 
ATOM   2350 C CA  . ARG B 2 115 ? 74.854  43.505 87.556  1.00 36.39  ? 153  ARG B CA  1 
ATOM   2351 C C   . ARG B 2 115 ? 74.286  42.207 86.966  1.00 41.62  ? 153  ARG B C   1 
ATOM   2352 O O   . ARG B 2 115 ? 73.142  41.845 87.233  1.00 42.03  ? 153  ARG B O   1 
ATOM   2353 C CB  . ARG B 2 115 ? 74.390  44.683 86.715  1.00 35.87  ? 153  ARG B CB  1 
ATOM   2354 C CG  . ARG B 2 115 ? 74.244  44.378 85.259  1.00 38.61  ? 153  ARG B CG  1 
ATOM   2355 C CD  . ARG B 2 115 ? 74.176  45.627 84.446  1.00 36.93  ? 153  ARG B CD  1 
ATOM   2356 N NE  . ARG B 2 115 ? 74.604  45.400 83.072  1.00 44.82  ? 153  ARG B NE  1 
ATOM   2357 C CZ  . ARG B 2 115 ? 74.540  46.324 82.118  1.00 59.90  ? 153  ARG B CZ  1 
ATOM   2358 N NH1 . ARG B 2 115 ? 74.094  47.520 82.410  1.00 46.74  ? 153  ARG B NH1 1 
ATOM   2359 N NH2 . ARG B 2 115 ? 74.909  46.062 80.876  1.00 46.42  ? 153  ARG B NH2 1 
ATOM   2360 N N   . PRO B 2 116 ? 75.060  41.499 86.144  1.00 37.85  ? 154  PRO B N   1 
ATOM   2361 C CA  . PRO B 2 116 ? 74.505  40.264 85.566  1.00 37.72  ? 154  PRO B CA  1 
ATOM   2362 C C   . PRO B 2 116 ? 74.008  39.145 86.544  1.00 42.53  ? 154  PRO B C   1 
ATOM   2363 O O   . PRO B 2 116 ? 73.120  38.349 86.216  1.00 42.65  ? 154  PRO B O   1 
ATOM   2364 C CB  . PRO B 2 116 ? 75.661  39.733 84.696  1.00 38.16  ? 154  PRO B CB  1 
ATOM   2365 C CG  . PRO B 2 116 ? 76.854  40.463 85.137  1.00 43.05  ? 154  PRO B CG  1 
ATOM   2366 C CD  . PRO B 2 116 ? 76.385  41.804 85.600  1.00 39.10  ? 154  PRO B CD  1 
ATOM   2367 N N   . PHE B 2 117 ? 74.640  39.050 87.703  1.00 38.36  ? 155  PHE B N   1 
ATOM   2368 C CA  . PHE B 2 117 ? 74.408  37.988 88.695  1.00 37.21  ? 155  PHE B CA  1 
ATOM   2369 C C   . PHE B 2 117 ? 73.063  37.963 89.382  1.00 44.46  ? 155  PHE B C   1 
ATOM   2370 O O   . PHE B 2 117 ? 72.754  37.052 90.135  1.00 44.82  ? 155  PHE B O   1 
ATOM   2371 C CB  . PHE B 2 117 ? 75.582  37.952 89.692  1.00 37.52  ? 155  PHE B CB  1 
ATOM   2372 C CG  . PHE B 2 117 ? 76.922  37.962 88.992  1.00 38.43  ? 155  PHE B CG  1 
ATOM   2373 C CD1 . PHE B 2 117 ? 77.696  39.099 88.979  1.00 39.73  ? 155  PHE B CD1 1 
ATOM   2374 C CD2 . PHE B 2 117 ? 77.307  36.876 88.180  1.00 37.93  ? 155  PHE B CD2 1 
ATOM   2375 C CE1 . PHE B 2 117 ? 78.860  39.135 88.233  1.00 40.74  ? 155  PHE B CE1 1 
ATOM   2376 C CE2 . PHE B 2 117 ? 78.459  36.913 87.451  1.00 40.02  ? 155  PHE B CE2 1 
ATOM   2377 C CZ  . PHE B 2 117 ? 79.231  38.061 87.458  1.00 38.70  ? 155  PHE B CZ  1 
ATOM   2378 N N   . GLY B 2 118 ? 72.251  38.962 89.096  1.00 43.54  ? 156  GLY B N   1 
ATOM   2379 C CA  . GLY B 2 118 ? 70.941  39.118 89.679  1.00 43.64  ? 156  GLY B CA  1 
ATOM   2380 C C   . GLY B 2 118 ? 70.602  40.595 89.817  1.00 51.55  ? 156  GLY B C   1 
ATOM   2381 O O   . GLY B 2 118 ? 71.413  41.485 89.519  1.00 53.78  ? 156  GLY B O   1 
ATOM   2382 N N   . SER B 2 119 ? 69.394  40.873 90.291  1.00 46.98  ? 157  SER B N   1 
ATOM   2383 C CA  . SER B 2 119 ? 68.957  42.253 90.459  1.00 46.04  ? 157  SER B CA  1 
ATOM   2384 C C   . SER B 2 119 ? 69.638  42.929 91.642  1.00 45.95  ? 157  SER B C   1 
ATOM   2385 O O   . SER B 2 119 ? 69.679  42.400 92.750  1.00 46.02  ? 157  SER B O   1 
ATOM   2386 C CB  . SER B 2 119 ? 67.424  42.341 90.561  1.00 50.14  ? 157  SER B CB  1 
ATOM   2387 O OG  . SER B 2 119 ? 66.847  43.112 89.506  1.00 56.45  ? 157  SER B OG  1 
ATOM   2388 N N   . LEU B 2 120 ? 70.193  44.103 91.395  1.00 39.88  ? 158  LEU B N   1 
ATOM   2389 C CA  . LEU B 2 120 ? 70.906  44.827 92.439  1.00 38.22  ? 158  LEU B CA  1 
ATOM   2390 C C   . LEU B 2 120 ? 69.984  45.655 93.291  1.00 44.11  ? 158  LEU B C   1 
ATOM   2391 O O   . LEU B 2 120 ? 69.032  46.230 92.818  1.00 47.19  ? 158  LEU B O   1 
ATOM   2392 C CB  . LEU B 2 120 ? 71.974  45.736 91.828  1.00 36.96  ? 158  LEU B CB  1 
ATOM   2393 C CG  . LEU B 2 120 ? 73.202  45.043 91.225  1.00 37.63  ? 158  LEU B CG  1 
ATOM   2394 C CD1 . LEU B 2 120 ? 73.700  45.829 90.052  1.00 35.84  ? 158  LEU B CD1 1 
ATOM   2395 C CD2 . LEU B 2 120 ? 74.275  44.882 92.268  1.00 34.58  ? 158  LEU B CD2 1 
ATOM   2396 N N   . GLU B 2 121 ? 70.308  45.739 94.557  1.00 39.20  ? 159  GLU B N   1 
ATOM   2397 C CA  . GLU B 2 121 ? 69.544  46.501 95.494  1.00 38.75  ? 159  GLU B CA  1 
ATOM   2398 C C   . GLU B 2 121 ? 70.279  47.828 95.679  1.00 45.90  ? 159  GLU B C   1 
ATOM   2399 O O   . GLU B 2 121 ? 69.661  48.883 95.818  1.00 47.51  ? 159  GLU B O   1 
ATOM   2400 C CB  . GLU B 2 121 ? 69.556  45.765 96.836  1.00 39.99  ? 159  GLU B CB  1 
ATOM   2401 C CG  . GLU B 2 121 ? 68.397  44.815 97.017  1.00 54.59  ? 159  GLU B CG  1 
ATOM   2402 C CD  . GLU B 2 121 ? 67.052  45.533 97.011  1.00 79.55  ? 159  GLU B CD  1 
ATOM   2403 O OE1 . GLU B 2 121 ? 66.058  44.888 96.597  1.00 60.60  ? 159  GLU B OE1 1 
ATOM   2404 O OE2 . GLU B 2 121 ? 66.998  46.730 97.421  1.00 70.13  ? 159  GLU B OE2 1 
ATOM   2405 N N   . ARG B 2 122 ? 71.596  47.732 95.835  1.00 41.32  ? 160  ARG B N   1 
ATOM   2406 C CA  . ARG B 2 122 ? 72.453  48.888 96.040  1.00 40.59  ? 160  ARG B CA  1 
ATOM   2407 C C   . ARG B 2 122 ? 73.755  48.552 95.350  1.00 44.32  ? 160  ARG B C   1 
ATOM   2408 O O   . ARG B 2 122 ? 74.230  47.426 95.433  1.00 42.86  ? 160  ARG B O   1 
ATOM   2409 C CB  . ARG B 2 122 ? 72.757  49.113 97.530  1.00 40.23  ? 160  ARG B CB  1 
ATOM   2410 C CG  . ARG B 2 122 ? 71.527  49.430 98.387  1.00 39.90  ? 160  ARG B CG  1 
ATOM   2411 C CD  . ARG B 2 122 ? 71.930  49.772 99.829  1.00 35.47  ? 160  ARG B CD  1 
ATOM   2412 N NE  . ARG B 2 122 ? 72.416  48.603 100.548 1.00 41.71  ? 160  ARG B NE  1 
ATOM   2413 C CZ  . ARG B 2 122 ? 73.063  48.633 101.716 1.00 57.78  ? 160  ARG B CZ  1 
ATOM   2414 N NH1 . ARG B 2 122 ? 73.324  49.772 102.341 1.00 41.75  ? 160  ARG B NH1 1 
ATOM   2415 N NH2 . ARG B 2 122 ? 73.465  47.506 102.274 1.00 50.54  ? 160  ARG B NH2 1 
ATOM   2416 N N   . CYS B 2 123 ? 74.364  49.560 94.736  1.00 41.13  ? 161  CYS B N   1 
ATOM   2417 C CA  . CYS B 2 123 ? 75.607  49.377 94.029  1.00 40.32  ? 161  CYS B CA  1 
ATOM   2418 C C   . CYS B 2 123 ? 76.376  50.692 94.006  1.00 45.19  ? 161  CYS B C   1 
ATOM   2419 O O   . CYS B 2 123 ? 75.964  51.653 93.342  1.00 48.06  ? 161  CYS B O   1 
ATOM   2420 C CB  . CYS B 2 123 ? 75.276  48.980 92.602  1.00 40.63  ? 161  CYS B CB  1 
ATOM   2421 S SG  . CYS B 2 123 ? 76.673  49.013 91.561  1.00 44.48  ? 161  CYS B SG  1 
ATOM   2422 N N   . PHE B 2 124 ? 77.520  50.745 94.666  1.00 37.49  ? 162  PHE B N   1 
ATOM   2423 C CA  . PHE B 2 124 ? 78.254  51.997 94.651  1.00 35.28  ? 162  PHE B CA  1 
ATOM   2424 C C   . PHE B 2 124 ? 79.758  51.860 94.811  1.00 37.12  ? 162  PHE B C   1 
ATOM   2425 O O   . PHE B 2 124 ? 80.260  51.106 95.633  1.00 36.56  ? 162  PHE B O   1 
ATOM   2426 C CB  . PHE B 2 124 ? 77.704  52.914 95.763  1.00 37.14  ? 162  PHE B CB  1 
ATOM   2427 C CG  . PHE B 2 124 ? 77.749  52.310 97.154  1.00 36.69  ? 162  PHE B CG  1 
ATOM   2428 C CD1 . PHE B 2 124 ? 78.857  52.485 97.977  1.00 36.40  ? 162  PHE B CD1 1 
ATOM   2429 C CD2 . PHE B 2 124 ? 76.685  51.551 97.635  1.00 38.13  ? 162  PHE B CD2 1 
ATOM   2430 C CE1 . PHE B 2 124 ? 78.902  51.927 99.277  1.00 36.50  ? 162  PHE B CE1 1 
ATOM   2431 C CE2 . PHE B 2 124 ? 76.735  50.967 98.946  1.00 39.23  ? 162  PHE B CE2 1 
ATOM   2432 C CZ  . PHE B 2 124 ? 77.820  51.191 99.769  1.00 35.62  ? 162  PHE B CZ  1 
ATOM   2433 N N   . LEU B 2 125 ? 80.493  52.628 94.037  1.00 34.03  ? 163  LEU B N   1 
ATOM   2434 C CA  . LEU B 2 125 ? 81.935  52.676 94.206  1.00 34.25  ? 163  LEU B CA  1 
ATOM   2435 C C   . LEU B 2 125 ? 82.168  53.510 95.493  1.00 41.49  ? 163  LEU B C   1 
ATOM   2436 O O   . LEU B 2 125 ? 81.288  54.281 95.943  1.00 39.75  ? 163  LEU B O   1 
ATOM   2437 C CB  . LEU B 2 125 ? 82.534  53.443 93.024  1.00 33.49  ? 163  LEU B CB  1 
ATOM   2438 C CG  . LEU B 2 125 ? 83.414  52.819 91.941  1.00 37.63  ? 163  LEU B CG  1 
ATOM   2439 C CD1 . LEU B 2 125 ? 83.629  51.294 92.047  1.00 36.81  ? 163  LEU B CD1 1 
ATOM   2440 C CD2 . LEU B 2 125 ? 82.905  53.203 90.569  1.00 38.96  ? 163  LEU B CD2 1 
ATOM   2441 N N   . VAL B 2 126 ? 83.362  53.401 96.059  1.00 39.03  ? 164  VAL B N   1 
ATOM   2442 C CA  . VAL B 2 126 ? 83.706  54.262 97.180  1.00 38.64  ? 164  VAL B CA  1 
ATOM   2443 C C   . VAL B 2 126 ? 84.818  55.265 96.795  1.00 45.06  ? 164  VAL B C   1 
ATOM   2444 O O   . VAL B 2 126 ? 85.968  54.884 96.506  1.00 41.34  ? 164  VAL B O   1 
ATOM   2445 C CB  . VAL B 2 126 ? 84.040  53.527 98.418  1.00 41.71  ? 164  VAL B CB  1 
ATOM   2446 C CG1 . VAL B 2 126 ? 84.575  54.522 99.471  1.00 40.99  ? 164  VAL B CG1 1 
ATOM   2447 C CG2 . VAL B 2 126 ? 82.814  52.816 98.910  1.00 41.96  ? 164  VAL B CG2 1 
ATOM   2448 N N   . TYR B 2 127 ? 84.442  56.545 96.776  1.00 44.33  ? 165  TYR B N   1 
ATOM   2449 C CA  . TYR B 2 127 ? 85.354  57.608 96.411  1.00 44.74  ? 165  TYR B CA  1 
ATOM   2450 C C   . TYR B 2 127 ? 85.929  58.344 97.631  1.00 54.50  ? 165  TYR B C   1 
ATOM   2451 O O   . TYR B 2 127 ? 85.361  58.306 98.716  1.00 55.78  ? 165  TYR B O   1 
ATOM   2452 C CB  . TYR B 2 127 ? 84.616  58.615 95.562  1.00 43.53  ? 165  TYR B CB  1 
ATOM   2453 C CG  . TYR B 2 127 ? 83.791  58.073 94.446  1.00 40.27  ? 165  TYR B CG  1 
ATOM   2454 C CD1 . TYR B 2 127 ? 82.414  58.037 94.542  1.00 40.71  ? 165  TYR B CD1 1 
ATOM   2455 C CD2 . TYR B 2 127 ? 84.368  57.808 93.216  1.00 39.33  ? 165  TYR B CD2 1 
ATOM   2456 C CE1 . TYR B 2 127 ? 81.641  57.597 93.464  1.00 40.29  ? 165  TYR B CE1 1 
ATOM   2457 C CE2 . TYR B 2 127 ? 83.594  57.431 92.125  1.00 38.82  ? 165  TYR B CE2 1 
ATOM   2458 C CZ  . TYR B 2 127 ? 82.243  57.334 92.246  1.00 41.83  ? 165  TYR B CZ  1 
ATOM   2459 O OH  . TYR B 2 127 ? 81.518  56.972 91.130  1.00 43.88  ? 165  TYR B OH  1 
ATOM   2460 N N   . SER B 2 128 ? 87.059  59.016 97.436  1.00 54.42  ? 166  SER B N   1 
ATOM   2461 C CA  . SER B 2 128 ? 87.688  59.844 98.475  1.00 55.87  ? 166  SER B CA  1 
ATOM   2462 C C   . SER B 2 128 ? 86.835  61.100 98.701  1.00 63.00  ? 166  SER B C   1 
ATOM   2463 O O   . SER B 2 128 ? 86.366  61.733 97.735  1.00 60.55  ? 166  SER B O   1 
ATOM   2464 C CB  . SER B 2 128 ? 89.106  60.263 98.044  1.00 58.01  ? 166  SER B CB  1 
ATOM   2465 O OG  . SER B 2 128 ? 89.387  61.595 98.420  1.00 62.65  ? 166  SER B OG  1 
ATOM   2466 N N   . GLU B 2 129 ? 86.620  61.459 99.966  1.00 63.21  ? 167  GLU B N   1 
ATOM   2467 C CA  . GLU B 2 129 ? 85.778  62.618 100.230 1.00 65.08  ? 167  GLU B CA  1 
ATOM   2468 C C   . GLU B 2 129 ? 86.319  63.888 99.542  1.00 71.95  ? 167  GLU B C   1 
ATOM   2469 O O   . GLU B 2 129 ? 85.541  64.673 98.967  1.00 71.59  ? 167  GLU B O   1 
ATOM   2470 C CB  . GLU B 2 129 ? 85.590  62.834 101.725 1.00 66.87  ? 167  GLU B CB  1 
ATOM   2471 C CG  . GLU B 2 129 ? 84.796  61.747 102.436 1.00 79.55  ? 167  GLU B CG  1 
ATOM   2472 C CD  . GLU B 2 129 ? 83.324  62.078 102.518 1.00 97.20  ? 167  GLU B CD  1 
ATOM   2473 O OE1 . GLU B 2 129 ? 82.931  63.165 102.021 1.00 84.13  ? 167  GLU B OE1 1 
ATOM   2474 O OE2 . GLU B 2 129 ? 82.568  61.249 103.073 1.00 89.34  ? 167  GLU B OE2 1 
ATOM   2475 N N   . ARG B 2 130 ? 87.651  64.053 99.575  1.00 68.33  ? 168  ARG B N   1 
ATOM   2476 C CA  . ARG B 2 130 ? 88.339  65.213 98.991  1.00 67.62  ? 168  ARG B CA  1 
ATOM   2477 C C   . ARG B 2 130 ? 88.514  65.159 97.472  1.00 69.39  ? 168  ARG B C   1 
ATOM   2478 O O   . ARG B 2 130 ? 87.864  65.915 96.739  1.00 70.47  ? 168  ARG B O   1 
ATOM   2479 C CB  . ARG B 2 130 ? 89.711  65.412 99.638  1.00 69.79  ? 168  ARG B CB  1 
ATOM   2480 C CG  . ARG B 2 130 ? 90.095  64.339 100.633 1.00 85.15  ? 168  ARG B CG  1 
ATOM   2481 C CD  . ARG B 2 130 ? 91.602  64.173 100.691 1.00 106.32 ? 168  ARG B CD  1 
ATOM   2482 N NE  . ARG B 2 130 ? 92.284  65.416 101.035 1.00 127.32 ? 168  ARG B NE  1 
ATOM   2483 C CZ  . ARG B 2 130 ? 93.495  65.479 101.584 1.00 147.71 ? 168  ARG B CZ  1 
ATOM   2484 N NH1 . ARG B 2 130 ? 94.165  64.361 101.849 1.00 136.51 ? 168  ARG B NH1 1 
ATOM   2485 N NH2 . ARG B 2 130 ? 94.038  66.660 101.868 1.00 133.75 ? 168  ARG B NH2 1 
ATOM   2486 N N   . THR B 2 131 ? 89.410  64.285 97.006  1.00 61.12  ? 169  THR B N   1 
ATOM   2487 C CA  . THR B 2 131 ? 89.692  64.121 95.575  1.00 57.56  ? 169  THR B CA  1 
ATOM   2488 C C   . THR B 2 131 ? 88.487  63.769 94.726  1.00 56.68  ? 169  THR B C   1 
ATOM   2489 O O   . THR B 2 131 ? 88.370  64.215 93.599  1.00 55.60  ? 169  THR B O   1 
ATOM   2490 C CB  . THR B 2 131 ? 90.785  63.104 95.378  1.00 66.79  ? 169  THR B CB  1 
ATOM   2491 O OG1 . THR B 2 131 ? 90.234  61.787 95.506  1.00 70.95  ? 169  THR B OG1 1 
ATOM   2492 C CG2 . THR B 2 131 ? 91.820  63.274 96.453  1.00 65.47  ? 169  THR B CG2 1 
ATOM   2493 N N   . GLY B 2 132 ? 87.593  62.942 95.245  1.00 53.17  ? 170  GLY B N   1 
ATOM   2494 C CA  . GLY B 2 132 ? 86.435  62.518 94.464  1.00 53.02  ? 170  GLY B CA  1 
ATOM   2495 C C   . GLY B 2 132 ? 86.757  61.330 93.551  1.00 55.28  ? 170  GLY B C   1 
ATOM   2496 O O   . GLY B 2 132 ? 85.943  60.943 92.711  1.00 56.79  ? 170  GLY B O   1 
ATOM   2497 N N   . GLN B 2 133 ? 87.935  60.742 93.752  1.00 47.36  ? 171  GLN B N   1 
ATOM   2498 C CA  . GLN B 2 133 ? 88.424  59.629 92.970  1.00 47.21  ? 171  GLN B CA  1 
ATOM   2499 C C   . GLN B 2 133 ? 88.082  58.266 93.604  1.00 50.53  ? 171  GLN B C   1 
ATOM   2500 O O   . GLN B 2 133 ? 88.193  58.090 94.835  1.00 48.05  ? 171  GLN B O   1 
ATOM   2501 C CB  . GLN B 2 133 ? 89.966  59.718 92.825  1.00 48.73  ? 171  GLN B CB  1 
ATOM   2502 C CG  . GLN B 2 133 ? 90.531  60.973 92.146  1.00 49.61  ? 171  GLN B CG  1 
ATOM   2503 C CD  . GLN B 2 133 ? 90.325  60.996 90.637  1.00 65.91  ? 171  GLN B CD  1 
ATOM   2504 O OE1 . GLN B 2 133 ? 90.036  62.040 90.068  1.00 65.25  ? 171  GLN B OE1 1 
ATOM   2505 N NE2 . GLN B 2 133 ? 90.427  59.839 89.993  1.00 58.44  ? 171  GLN B NE2 1 
ATOM   2506 N N   . SER B 2 134 ? 87.758  57.290 92.742  1.00 44.87  ? 172  SER B N   1 
ATOM   2507 C CA  . SER B 2 134 ? 87.436  55.931 93.194  1.00 42.06  ? 172  SER B CA  1 
ATOM   2508 C C   . SER B 2 134 ? 88.584  55.418 94.037  1.00 42.66  ? 172  SER B C   1 
ATOM   2509 O O   . SER B 2 134 ? 89.729  55.662 93.701  1.00 43.66  ? 172  SER B O   1 
ATOM   2510 C CB  . SER B 2 134 ? 87.156  54.991 91.992  1.00 42.50  ? 172  SER B CB  1 
ATOM   2511 O OG  . SER B 2 134 ? 87.332  53.599 92.287  1.00 43.64  ? 172  SER B OG  1 
ATOM   2512 N N   . LYS B 2 135 ? 88.273  54.747 95.147  1.00 37.97  ? 173  LYS B N   1 
ATOM   2513 C CA  . LYS B 2 135 ? 89.281  54.153 96.048  1.00 36.51  ? 173  LYS B CA  1 
ATOM   2514 C C   . LYS B 2 135 ? 89.603  52.713 95.572  1.00 42.15  ? 173  LYS B C   1 
ATOM   2515 O O   . LYS B 2 135 ? 90.320  51.956 96.255  1.00 41.45  ? 173  LYS B O   1 
ATOM   2516 C CB  . LYS B 2 135 ? 88.738  54.087 97.477  1.00 38.70  ? 173  LYS B CB  1 
ATOM   2517 C CG  . LYS B 2 135 ? 88.578  55.432 98.235  1.00 44.95  ? 173  LYS B CG  1 
ATOM   2518 C CD  . LYS B 2 135 ? 88.959  55.248 99.751  1.00 41.31  ? 173  LYS B CD  1 
ATOM   2519 C CE  . LYS B 2 135 ? 88.780  56.550 100.558 1.00 43.95  ? 173  LYS B CE  1 
ATOM   2520 N NZ  . LYS B 2 135 ? 88.859  56.351 102.068 1.00 50.91  ? 173  LYS B NZ  1 
ATOM   2521 N N   . GLY B 2 136 ? 89.050  52.324 94.412  1.00 37.78  ? 174  GLY B N   1 
ATOM   2522 C CA  . GLY B 2 136 ? 89.343  51.041 93.822  1.00 36.52  ? 174  GLY B CA  1 
ATOM   2523 C C   . GLY B 2 136 ? 88.486  49.915 94.347  1.00 41.06  ? 174  GLY B C   1 
ATOM   2524 O O   . GLY B 2 136 ? 88.752  48.729 94.092  1.00 41.11  ? 174  GLY B O   1 
ATOM   2525 N N   . TYR B 2 137 ? 87.450  50.274 95.087  1.00 35.82  ? 175  TYR B N   1 
ATOM   2526 C CA  . TYR B 2 137 ? 86.519  49.271 95.542  1.00 35.09  ? 175  TYR B CA  1 
ATOM   2527 C C   . TYR B 2 137 ? 85.102  49.818 95.545  1.00 39.62  ? 175  TYR B C   1 
ATOM   2528 O O   . TYR B 2 137 ? 84.891  51.043 95.413  1.00 39.29  ? 175  TYR B O   1 
ATOM   2529 C CB  . TYR B 2 137 ? 86.951  48.607 96.839  1.00 36.02  ? 175  TYR B CB  1 
ATOM   2530 C CG  . TYR B 2 137 ? 86.997  49.529 98.010  1.00 39.36  ? 175  TYR B CG  1 
ATOM   2531 C CD1 . TYR B 2 137 ? 88.179  50.195 98.356  1.00 40.24  ? 175  TYR B CD1 1 
ATOM   2532 C CD2 . TYR B 2 137 ? 85.847  49.770 98.777  1.00 41.53  ? 175  TYR B CD2 1 
ATOM   2533 C CE1 . TYR B 2 137 ? 88.217  51.067 99.441  1.00 39.62  ? 175  TYR B CE1 1 
ATOM   2534 C CE2 . TYR B 2 137 ? 85.875  50.660 99.858  1.00 42.50  ? 175  TYR B CE2 1 
ATOM   2535 C CZ  . TYR B 2 137 ? 87.065  51.306 100.173 1.00 49.81  ? 175  TYR B CZ  1 
ATOM   2536 O OH  . TYR B 2 137 ? 87.107  52.186 101.236 1.00 56.23  ? 175  TYR B OH  1 
ATOM   2537 N N   . GLY B 2 138 ? 84.142  48.896 95.523  1.00 35.70  ? 176  GLY B N   1 
ATOM   2538 C CA  . GLY B 2 138 ? 82.721  49.191 95.482  1.00 33.88  ? 176  GLY B CA  1 
ATOM   2539 C C   . GLY B 2 138 ? 81.994  48.095 96.239  1.00 38.11  ? 176  GLY B C   1 
ATOM   2540 O O   . GLY B 2 138 ? 82.591  47.112 96.700  1.00 36.80  ? 176  GLY B O   1 
ATOM   2541 N N   . PHE B 2 139 ? 80.686  48.287 96.351  1.00 35.80  ? 177  PHE B N   1 
ATOM   2542 C CA  . PHE B 2 139 ? 79.791  47.415 97.088  1.00 35.16  ? 177  PHE B CA  1 
ATOM   2543 C C   . PHE B 2 139 ? 78.616  47.075 96.205  1.00 39.07  ? 177  PHE B C   1 
ATOM   2544 O O   . PHE B 2 139 ? 78.047  47.969 95.577  1.00 38.93  ? 177  PHE B O   1 
ATOM   2545 C CB  . PHE B 2 139 ? 79.256  48.159 98.331  1.00 35.88  ? 177  PHE B CB  1 
ATOM   2546 C CG  . PHE B 2 139 ? 80.242  48.223 99.450  1.00 36.20  ? 177  PHE B CG  1 
ATOM   2547 C CD1 . PHE B 2 139 ? 80.277  47.231 100.436 1.00 38.90  ? 177  PHE B CD1 1 
ATOM   2548 C CD2 . PHE B 2 139 ? 81.205  49.199 99.458  1.00 39.04  ? 177  PHE B CD2 1 
ATOM   2549 C CE1 . PHE B 2 139 ? 81.273  47.210 101.409 1.00 39.62  ? 177  PHE B CE1 1 
ATOM   2550 C CE2 . PHE B 2 139 ? 82.194  49.210 100.452 1.00 42.73  ? 177  PHE B CE2 1 
ATOM   2551 C CZ  . PHE B 2 139 ? 82.244  48.204 101.412 1.00 39.60  ? 177  PHE B CZ  1 
ATOM   2552 N N   . ALA B 2 140 ? 78.234  45.795 96.208  1.00 34.73  ? 178  ALA B N   1 
ATOM   2553 C CA  . ALA B 2 140 ? 77.089  45.319 95.419  1.00 32.38  ? 178  ALA B CA  1 
ATOM   2554 C C   . ALA B 2 140 ? 76.200  44.489 96.352  1.00 38.53  ? 178  ALA B C   1 
ATOM   2555 O O   . ALA B 2 140 ? 76.700  43.652 97.099  1.00 36.45  ? 178  ALA B O   1 
ATOM   2556 C CB  . ALA B 2 140 ? 77.567  44.479 94.247  1.00 31.07  ? 178  ALA B CB  1 
ATOM   2557 N N   . GLU B 2 141 ? 74.909  44.817 96.393  1.00 36.34  ? 179  GLU B N   1 
ATOM   2558 C CA  . GLU B 2 141 ? 73.938  44.056 97.160  1.00 35.53  ? 179  GLU B CA  1 
ATOM   2559 C C   . GLU B 2 141 ? 72.887  43.593 96.198  1.00 40.30  ? 179  GLU B C   1 
ATOM   2560 O O   . GLU B 2 141 ? 72.497  44.348 95.299  1.00 40.50  ? 179  GLU B O   1 
ATOM   2561 C CB  . GLU B 2 141 ? 73.283  44.857 98.262  1.00 36.59  ? 179  GLU B CB  1 
ATOM   2562 C CG  . GLU B 2 141 ? 72.647  43.921 99.264  1.00 36.55  ? 179  GLU B CG  1 
ATOM   2563 C CD  . GLU B 2 141 ? 71.976  44.624 100.362 1.00 58.21  ? 179  GLU B CD  1 
ATOM   2564 O OE1 . GLU B 2 141 ? 71.552  43.925 101.314 1.00 81.28  ? 179  GLU B OE1 1 
ATOM   2565 O OE2 . GLU B 2 141 ? 71.830  45.862 100.247 1.00 39.66  ? 179  GLU B OE2 1 
ATOM   2566 N N   . TYR B 2 142 ? 72.461  42.338 96.344  1.00 36.75  ? 180  TYR B N   1 
ATOM   2567 C CA  . TYR B 2 142 ? 71.520  41.750 95.397  1.00 35.20  ? 180  TYR B CA  1 
ATOM   2568 C C   . TYR B 2 142 ? 70.222  41.511 96.096  1.00 43.12  ? 180  TYR B C   1 
ATOM   2569 O O   . TYR B 2 142 ? 70.188  41.526 97.312  1.00 41.27  ? 180  TYR B O   1 
ATOM   2570 C CB  . TYR B 2 142 ? 72.114  40.435 94.885  1.00 34.20  ? 180  TYR B CB  1 
ATOM   2571 C CG  . TYR B 2 142 ? 73.374  40.643 94.067  1.00 32.36  ? 180  TYR B CG  1 
ATOM   2572 C CD1 . TYR B 2 142 ? 74.642  40.694 94.672  1.00 31.74  ? 180  TYR B CD1 1 
ATOM   2573 C CD2 . TYR B 2 142 ? 73.295  40.870 92.708  1.00 33.00  ? 180  TYR B CD2 1 
ATOM   2574 C CE1 . TYR B 2 142 ? 75.785  40.834 93.914  1.00 25.92  ? 180  TYR B CE1 1 
ATOM   2575 C CE2 . TYR B 2 142 ? 74.430  41.133 91.971  1.00 33.52  ? 180  TYR B CE2 1 
ATOM   2576 C CZ  . TYR B 2 142 ? 75.656  41.118 92.581  1.00 35.50  ? 180  TYR B CZ  1 
ATOM   2577 O OH  . TYR B 2 142 ? 76.755  41.340 91.803  1.00 43.97  ? 180  TYR B OH  1 
ATOM   2578 N N   . MET B 2 143 ? 69.145  41.278 95.348  1.00 47.03  ? 181  MET B N   1 
ATOM   2579 C CA  . MET B 2 143 ? 67.868  40.933 96.003  1.00 49.44  ? 181  MET B CA  1 
ATOM   2580 C C   . MET B 2 143 ? 67.949  39.541 96.619  1.00 53.87  ? 181  MET B C   1 
ATOM   2581 O O   . MET B 2 143 ? 67.506  39.354 97.741  1.00 53.82  ? 181  MET B O   1 
ATOM   2582 C CB  . MET B 2 143 ? 66.646  41.120 95.100  1.00 52.87  ? 181  MET B CB  1 
ATOM   2583 C CG  . MET B 2 143 ? 66.885  42.141 93.974  1.00 58.65  ? 181  MET B CG  1 
ATOM   2584 S SD  . MET B 2 143 ? 66.042  43.803 93.981  1.00 65.07  ? 181  MET B SD  1 
ATOM   2585 C CE  . MET B 2 143 ? 65.463  43.916 92.120  1.00 60.99  ? 181  MET B CE  1 
ATOM   2586 N N   . LYS B 2 144 ? 68.675  38.633 95.959  1.00 51.61  ? 182  LYS B N   1 
ATOM   2587 C CA  . LYS B 2 144 ? 68.893  37.254 96.436  1.00 51.31  ? 182  LYS B CA  1 
ATOM   2588 C C   . LYS B 2 144 ? 70.337  36.964 96.892  1.00 56.17  ? 182  LYS B C   1 
ATOM   2589 O O   . LYS B 2 144 ? 71.303  37.425 96.259  1.00 56.16  ? 182  LYS B O   1 
ATOM   2590 C CB  . LYS B 2 144 ? 68.529  36.250 95.323  1.00 53.18  ? 182  LYS B CB  1 
ATOM   2591 C CG  . LYS B 2 144 ? 67.080  36.264 94.901  1.00 63.63  ? 182  LYS B CG  1 
ATOM   2592 C CD  . LYS B 2 144 ? 66.190  36.619 96.101  1.00 84.42  ? 182  LYS B CD  1 
ATOM   2593 C CE  . LYS B 2 144 ? 65.617  35.376 96.797  1.00 100.56 ? 182  LYS B CE  1 
ATOM   2594 N NZ  . LYS B 2 144 ? 64.269  35.622 97.381  1.00 103.62 ? 182  LYS B NZ  1 
ATOM   2595 N N   . LYS B 2 145 ? 70.471  36.130 97.930  1.00 52.51  ? 183  LYS B N   1 
ATOM   2596 C CA  . LYS B 2 145 ? 71.772  35.700 98.452  1.00 52.19  ? 183  LYS B CA  1 
ATOM   2597 C C   . LYS B 2 145 ? 72.468  34.784 97.440  1.00 57.97  ? 183  LYS B C   1 
ATOM   2598 O O   . LYS B 2 145 ? 73.721  34.647 97.412  1.00 58.03  ? 183  LYS B O   1 
ATOM   2599 C CB  . LYS B 2 145 ? 71.579  34.938 99.759  1.00 53.93  ? 183  LYS B CB  1 
ATOM   2600 C CG  . LYS B 2 145 ? 72.493  35.388 100.883 1.00 76.92  ? 183  LYS B CG  1 
ATOM   2601 C CD  . LYS B 2 145 ? 73.055  34.214 101.668 1.00 87.26  ? 183  LYS B CD  1 
ATOM   2602 C CE  . LYS B 2 145 ? 73.443  34.630 103.079 1.00 94.99  ? 183  LYS B CE  1 
ATOM   2603 N NZ  . LYS B 2 145 ? 74.680  35.466 103.101 1.00 103.45 ? 183  LYS B NZ  1 
ATOM   2604 N N   . ASP B 2 146 ? 71.631  34.139 96.630  1.00 53.36  ? 184  ASP B N   1 
ATOM   2605 C CA  . ASP B 2 146 ? 72.087  33.236 95.597  1.00 52.90  ? 184  ASP B CA  1 
ATOM   2606 C C   . ASP B 2 146 ? 72.946  34.022 94.618  1.00 51.58  ? 184  ASP B C   1 
ATOM   2607 O O   . ASP B 2 146 ? 74.033  33.589 94.235  1.00 51.93  ? 184  ASP B O   1 
ATOM   2608 C CB  . ASP B 2 146 ? 70.868  32.696 94.876  1.00 56.57  ? 184  ASP B CB  1 
ATOM   2609 C CG  . ASP B 2 146 ? 70.894  31.211 94.753  1.00 79.92  ? 184  ASP B CG  1 
ATOM   2610 O OD1 . ASP B 2 146 ? 71.146  30.716 93.623  1.00 84.33  ? 184  ASP B OD1 1 
ATOM   2611 O OD2 . ASP B 2 146 ? 70.715  30.546 95.800  1.00 84.58  ? 184  ASP B OD2 1 
ATOM   2612 N N   . SER B 2 147 ? 72.447  35.205 94.269  1.00 43.31  ? 185  SER B N   1 
ATOM   2613 C CA  . SER B 2 147 ? 73.100  36.145 93.380  1.00 41.47  ? 185  SER B CA  1 
ATOM   2614 C C   . SER B 2 147 ? 74.469  36.580 93.867  1.00 44.53  ? 185  SER B C   1 
ATOM   2615 O O   . SER B 2 147 ? 75.416  36.644 93.089  1.00 47.85  ? 185  SER B O   1 
ATOM   2616 C CB  . SER B 2 147 ? 72.191  37.343 93.177  1.00 44.32  ? 185  SER B CB  1 
ATOM   2617 O OG  . SER B 2 147 ? 70.976  36.940 92.533  1.00 49.67  ? 185  SER B OG  1 
ATOM   2618 N N   . ALA B 2 148 ? 74.605  36.826 95.160  1.00 37.77  ? 186  ALA B N   1 
ATOM   2619 C CA  . ALA B 2 148 ? 75.890  37.206 95.732  1.00 37.05  ? 186  ALA B CA  1 
ATOM   2620 C C   . ALA B 2 148 ? 76.909  36.066 95.683  1.00 43.94  ? 186  ALA B C   1 
ATOM   2621 O O   . ALA B 2 148 ? 78.104  36.269 95.436  1.00 43.98  ? 186  ALA B O   1 
ATOM   2622 C CB  . ALA B 2 148 ? 75.697  37.696 97.137  1.00 37.86  ? 186  ALA B CB  1 
ATOM   2623 N N   . ALA B 2 149 ? 76.437  34.845 95.897  1.00 41.86  ? 187  ALA B N   1 
ATOM   2624 C CA  . ALA B 2 149 ? 77.297  33.671 95.756  1.00 39.13  ? 187  ALA B CA  1 
ATOM   2625 C C   . ALA B 2 149 ? 77.780  33.582 94.296  1.00 41.23  ? 187  ALA B C   1 
ATOM   2626 O O   . ALA B 2 149 ? 78.975  33.377 94.018  1.00 43.67  ? 187  ALA B O   1 
ATOM   2627 C CB  . ALA B 2 149 ? 76.542  32.436 96.125  1.00 38.55  ? 187  ALA B CB  1 
ATOM   2628 N N   . ARG B 2 150 ? 76.866  33.714 93.354  1.00 33.58  ? 188  ARG B N   1 
ATOM   2629 C CA  . ARG B 2 150 ? 77.274  33.612 91.961  1.00 34.57  ? 188  ARG B CA  1 
ATOM   2630 C C   . ARG B 2 150 ? 78.333  34.623 91.624  1.00 42.44  ? 188  ARG B C   1 
ATOM   2631 O O   . ARG B 2 150 ? 79.362  34.291 90.983  1.00 44.54  ? 188  ARG B O   1 
ATOM   2632 C CB  . ARG B 2 150 ? 76.089  33.794 91.025  1.00 36.80  ? 188  ARG B CB  1 
ATOM   2633 C CG  . ARG B 2 150 ? 75.141  32.600 90.942  1.00 49.30  ? 188  ARG B CG  1 
ATOM   2634 C CD  . ARG B 2 150 ? 74.246  32.733 89.702  1.00 70.85  ? 188  ARG B CD  1 
ATOM   2635 N NE  . ARG B 2 150 ? 72.976  33.421 89.973  1.00 82.88  ? 188  ARG B NE  1 
ATOM   2636 C CZ  . ARG B 2 150 ? 72.014  32.962 90.781  1.00 96.30  ? 188  ARG B CZ  1 
ATOM   2637 N NH1 . ARG B 2 150 ? 72.172  31.823 91.448  1.00 84.87  ? 188  ARG B NH1 1 
ATOM   2638 N NH2 . ARG B 2 150 ? 70.894  33.650 90.942  1.00 80.53  ? 188  ARG B NH2 1 
ATOM   2639 N N   . ALA B 2 151 ? 78.080  35.857 92.077  1.00 36.92  ? 189  ALA B N   1 
ATOM   2640 C CA  . ALA B 2 151 ? 78.977  36.973 91.853  1.00 35.23  ? 189  ALA B CA  1 
ATOM   2641 C C   . ALA B 2 151 ? 80.365  36.763 92.448  1.00 36.27  ? 189  ALA B C   1 
ATOM   2642 O O   . ALA B 2 151 ? 81.357  36.797 91.733  1.00 34.98  ? 189  ALA B O   1 
ATOM   2643 C CB  . ALA B 2 151 ? 78.361  38.192 92.368  1.00 36.25  ? 189  ALA B CB  1 
ATOM   2644 N N   . LYS B 2 152 ? 80.431  36.533 93.758  1.00 33.07  ? 190  LYS B N   1 
ATOM   2645 C CA  . LYS B 2 152 ? 81.722  36.286 94.439  1.00 32.43  ? 190  LYS B CA  1 
ATOM   2646 C C   . LYS B 2 152 ? 82.552  35.291 93.680  1.00 36.76  ? 190  LYS B C   1 
ATOM   2647 O O   . LYS B 2 152 ? 83.754  35.411 93.525  1.00 36.36  ? 190  LYS B O   1 
ATOM   2648 C CB  . LYS B 2 152 ? 81.501  35.709 95.836  1.00 31.76  ? 190  LYS B CB  1 
ATOM   2649 C CG  . LYS B 2 152 ? 82.797  35.292 96.477  1.00 27.71  ? 190  LYS B CG  1 
ATOM   2650 C CD  . LYS B 2 152 ? 82.678  35.225 97.988  1.00 34.76  ? 190  LYS B CD  1 
ATOM   2651 C CE  . LYS B 2 152 ? 84.020  34.880 98.609  1.00 45.79  ? 190  LYS B CE  1 
ATOM   2652 N NZ  . LYS B 2 152 ? 84.125  33.439 98.946  1.00 60.85  ? 190  LYS B NZ  1 
ATOM   2653 N N   . SER B 2 153 ? 81.852  34.290 93.215  1.00 34.20  ? 191  SER B N   1 
ATOM   2654 C CA  . SER B 2 153 ? 82.452  33.181 92.554  1.00 36.14  ? 191  SER B CA  1 
ATOM   2655 C C   . SER B 2 153 ? 82.972  33.512 91.178  1.00 43.18  ? 191  SER B C   1 
ATOM   2656 O O   . SER B 2 153 ? 83.984  32.973 90.730  1.00 45.33  ? 191  SER B O   1 
ATOM   2657 C CB  . SER B 2 153 ? 81.405  32.078 92.435  1.00 40.80  ? 191  SER B CB  1 
ATOM   2658 O OG  . SER B 2 153 ? 81.701  31.293 91.323  1.00 46.25  ? 191  SER B OG  1 
ATOM   2659 N N   . ASP B 2 154 ? 82.237  34.340 90.464  1.00 38.65  ? 192  ASP B N   1 
ATOM   2660 C CA  . ASP B 2 154 ? 82.654  34.676 89.121  1.00 37.76  ? 192  ASP B CA  1 
ATOM   2661 C C   . ASP B 2 154 ? 83.663  35.846 89.099  1.00 41.29  ? 192  ASP B C   1 
ATOM   2662 O O   . ASP B 2 154 ? 84.439  35.989 88.130  1.00 40.86  ? 192  ASP B O   1 
ATOM   2663 C CB  . ASP B 2 154 ? 81.407  35.010 88.295  1.00 38.49  ? 192  ASP B CB  1 
ATOM   2664 C CG  . ASP B 2 154 ? 80.909  33.835 87.476  1.00 41.05  ? 192  ASP B CG  1 
ATOM   2665 O OD1 . ASP B 2 154 ? 80.387  34.067 86.393  1.00 36.75  ? 192  ASP B OD1 1 
ATOM   2666 O OD2 . ASP B 2 154 ? 80.994  32.680 87.923  1.00 59.22  ? 192  ASP B OD2 1 
ATOM   2667 N N   . LEU B 2 155 ? 83.636  36.659 90.171  1.00 35.82  ? 193  LEU B N   1 
ATOM   2668 C CA  . LEU B 2 155 ? 84.470  37.857 90.324  1.00 33.45  ? 193  LEU B CA  1 
ATOM   2669 C C   . LEU B 2 155 ? 85.791  37.701 91.111  1.00 35.35  ? 193  LEU B C   1 
ATOM   2670 O O   . LEU B 2 155 ? 86.722  38.457 90.913  1.00 33.27  ? 193  LEU B O   1 
ATOM   2671 C CB  . LEU B 2 155 ? 83.640  39.011 90.876  1.00 32.58  ? 193  LEU B CB  1 
ATOM   2672 C CG  . LEU B 2 155 ? 82.416  39.516 90.063  1.00 34.51  ? 193  LEU B CG  1 
ATOM   2673 C CD1 . LEU B 2 155 ? 81.642  40.557 90.845  1.00 31.35  ? 193  LEU B CD1 1 
ATOM   2674 C CD2 . LEU B 2 155 ? 82.796  40.095 88.702  1.00 36.38  ? 193  LEU B CD2 1 
ATOM   2675 N N   . LEU B 2 156 ? 85.907  36.675 91.941  1.00 31.51  ? 194  LEU B N   1 
ATOM   2676 C CA  . LEU B 2 156 ? 87.137  36.503 92.665  1.00 31.33  ? 194  LEU B CA  1 
ATOM   2677 C C   . LEU B 2 156 ? 88.211  35.962 91.721  1.00 37.08  ? 194  LEU B C   1 
ATOM   2678 O O   . LEU B 2 156 ? 88.113  34.844 91.251  1.00 38.68  ? 194  LEU B O   1 
ATOM   2679 C CB  . LEU B 2 156 ? 86.909  35.606 93.868  1.00 31.51  ? 194  LEU B CB  1 
ATOM   2680 C CG  . LEU B 2 156 ? 88.050  35.447 94.867  1.00 36.99  ? 194  LEU B CG  1 
ATOM   2681 C CD1 . LEU B 2 156 ? 88.188  36.642 95.779  1.00 39.22  ? 194  LEU B CD1 1 
ATOM   2682 C CD2 . LEU B 2 156 ? 87.667  34.283 95.683  1.00 37.48  ? 194  LEU B CD2 1 
ATOM   2683 N N   . GLY B 2 157 ? 89.216  36.769 91.396  1.00 31.42  ? 195  GLY B N   1 
ATOM   2684 C CA  . GLY B 2 157 ? 90.265  36.332 90.514  1.00 29.41  ? 195  GLY B CA  1 
ATOM   2685 C C   . GLY B 2 157 ? 89.970  36.745 89.086  1.00 34.84  ? 195  GLY B C   1 
ATOM   2686 O O   . GLY B 2 157 ? 90.722  36.435 88.171  1.00 31.96  ? 195  GLY B O   1 
ATOM   2687 N N   . LYS B 2 158 ? 88.890  37.500 88.888  1.00 33.11  ? 196  LYS B N   1 
ATOM   2688 C CA  . LYS B 2 158 ? 88.588  37.997 87.554  1.00 32.04  ? 196  LYS B CA  1 
ATOM   2689 C C   . LYS B 2 158 ? 89.557  39.069 87.119  1.00 35.89  ? 196  LYS B C   1 
ATOM   2690 O O   . LYS B 2 158 ? 89.787  40.021 87.840  1.00 35.61  ? 196  LYS B O   1 
ATOM   2691 C CB  . LYS B 2 158 ? 87.180  38.593 87.483  1.00 32.34  ? 196  LYS B CB  1 
ATOM   2692 C CG  . LYS B 2 158 ? 86.785  39.004 86.061  1.00 27.23  ? 196  LYS B CG  1 
ATOM   2693 C CD  . LYS B 2 158 ? 85.409  39.698 85.923  1.00 25.72  ? 196  LYS B CD  1 
ATOM   2694 C CE  . LYS B 2 158 ? 84.792  39.556 84.484  1.00 29.21  ? 196  LYS B CE  1 
ATOM   2695 N NZ  . LYS B 2 158 ? 85.672  38.956 83.360  1.00 34.46  ? 196  LYS B NZ  1 
ATOM   2696 N N   . PRO B 2 159 ? 90.056  38.977 85.881  1.00 32.79  ? 197  PRO B N   1 
ATOM   2697 C CA  . PRO B 2 159 ? 90.878  40.088 85.406  1.00 32.38  ? 197  PRO B CA  1 
ATOM   2698 C C   . PRO B 2 159 ? 90.000  41.197 84.894  1.00 40.04  ? 197  PRO B C   1 
ATOM   2699 O O   . PRO B 2 159 ? 89.141  40.962 84.063  1.00 42.16  ? 197  PRO B O   1 
ATOM   2700 C CB  . PRO B 2 159 ? 91.599  39.505 84.186  1.00 33.04  ? 197  PRO B CB  1 
ATOM   2701 C CG  . PRO B 2 159 ? 90.996  38.168 83.942  1.00 36.46  ? 197  PRO B CG  1 
ATOM   2702 C CD  . PRO B 2 159 ? 90.445  37.711 85.237  1.00 32.89  ? 197  PRO B CD  1 
ATOM   2703 N N   . LEU B 2 160 ? 90.247  42.410 85.361  1.00 37.44  ? 198  LEU B N   1 
ATOM   2704 C CA  . LEU B 2 160 ? 89.603  43.621 84.865  1.00 36.63  ? 198  LEU B CA  1 
ATOM   2705 C C   . LEU B 2 160 ? 90.800  44.541 84.629  1.00 42.57  ? 198  LEU B C   1 
ATOM   2706 O O   . LEU B 2 160 ? 91.485  44.935 85.588  1.00 44.25  ? 198  LEU B O   1 
ATOM   2707 C CB  . LEU B 2 160 ? 88.716  44.234 85.932  1.00 36.63  ? 198  LEU B CB  1 
ATOM   2708 C CG  . LEU B 2 160 ? 87.311  44.702 85.615  1.00 41.46  ? 198  LEU B CG  1 
ATOM   2709 C CD1 . LEU B 2 160 ? 86.867  45.835 86.522  1.00 42.43  ? 198  LEU B CD1 1 
ATOM   2710 C CD2 . LEU B 2 160 ? 87.063  45.004 84.154  1.00 40.34  ? 198  LEU B CD2 1 
ATOM   2711 N N   . GLY B 2 161 ? 91.121  44.784 83.362  1.00 38.92  ? 199  GLY B N   1 
ATOM   2712 C CA  . GLY B 2 161 ? 92.257  45.586 82.970  1.00 39.20  ? 199  GLY B CA  1 
ATOM   2713 C C   . GLY B 2 161 ? 93.549  45.048 83.543  1.00 46.53  ? 199  GLY B C   1 
ATOM   2714 O O   . GLY B 2 161 ? 93.807  43.831 83.509  1.00 47.68  ? 199  GLY B O   1 
ATOM   2715 N N   . PRO B 2 162 ? 94.380  45.946 84.109  1.00 42.09  ? 200  PRO B N   1 
ATOM   2716 C CA  . PRO B 2 162 ? 95.639  45.418 84.642  1.00 41.35  ? 200  PRO B CA  1 
ATOM   2717 C C   . PRO B 2 162 ? 95.496  44.775 86.003  1.00 45.05  ? 200  PRO B C   1 
ATOM   2718 O O   . PRO B 2 162 ? 96.516  44.455 86.624  1.00 47.95  ? 200  PRO B O   1 
ATOM   2719 C CB  . PRO B 2 162 ? 96.506  46.670 84.736  1.00 42.04  ? 200  PRO B CB  1 
ATOM   2720 C CG  . PRO B 2 162 ? 95.512  47.770 85.008  1.00 44.46  ? 200  PRO B CG  1 
ATOM   2721 C CD  . PRO B 2 162 ? 94.219  47.385 84.383  1.00 40.60  ? 200  PRO B CD  1 
ATOM   2722 N N   . ARG B 2 163 ? 94.252  44.628 86.476  1.00 39.38  ? 201  ARG B N   1 
ATOM   2723 C CA  . ARG B 2 163 ? 93.958  44.097 87.827  1.00 38.24  ? 201  ARG B CA  1 
ATOM   2724 C C   . ARG B 2 163 ? 93.324  42.704 87.932  1.00 41.10  ? 201  ARG B C   1 
ATOM   2725 O O   . ARG B 2 163 ? 92.735  42.224 86.975  1.00 42.37  ? 201  ARG B O   1 
ATOM   2726 C CB  . ARG B 2 163 ? 93.078  45.069 88.572  1.00 34.16  ? 201  ARG B CB  1 
ATOM   2727 C CG  . ARG B 2 163 ? 93.669  46.430 88.612  1.00 41.99  ? 201  ARG B CG  1 
ATOM   2728 C CD  . ARG B 2 163 ? 94.843  46.501 89.590  1.00 42.91  ? 201  ARG B CD  1 
ATOM   2729 N NE  . ARG B 2 163 ? 95.308  47.872 89.673  1.00 41.94  ? 201  ARG B NE  1 
ATOM   2730 C CZ  . ARG B 2 163 ? 95.283  48.603 90.768  1.00 52.18  ? 201  ARG B CZ  1 
ATOM   2731 N NH1 . ARG B 2 163 ? 94.926  48.052 91.905  1.00 37.61  ? 201  ARG B NH1 1 
ATOM   2732 N NH2 . ARG B 2 163 ? 95.699  49.856 90.731  1.00 47.58  ? 201  ARG B NH2 1 
ATOM   2733 N N   . THR B 2 164 ? 93.430  42.077 89.110  1.00 33.59  ? 202  THR B N   1 
ATOM   2734 C CA  . THR B 2 164 ? 92.786  40.801 89.395  1.00 30.15  ? 202  THR B CA  1 
ATOM   2735 C C   . THR B 2 164 ? 91.926  41.117 90.584  1.00 33.67  ? 202  THR B C   1 
ATOM   2736 O O   . THR B 2 164 ? 92.422  41.561 91.596  1.00 35.16  ? 202  THR B O   1 
ATOM   2737 C CB  . THR B 2 164 ? 93.802  39.700 89.633  1.00 31.91  ? 202  THR B CB  1 
ATOM   2738 O OG1 . THR B 2 164 ? 94.588  39.554 88.451  1.00 39.92  ? 202  THR B OG1 1 
ATOM   2739 C CG2 . THR B 2 164 ? 93.141  38.364 89.946  1.00 23.60  ? 202  THR B CG2 1 
ATOM   2740 N N   . LEU B 2 165 ? 90.613  41.045 90.409  1.00 30.41  ? 203  LEU B N   1 
ATOM   2741 C CA  . LEU B 2 165 ? 89.676  41.438 91.463  1.00 29.58  ? 203  LEU B CA  1 
ATOM   2742 C C   . LEU B 2 165 ? 89.640  40.555 92.687  1.00 32.92  ? 203  LEU B C   1 
ATOM   2743 O O   . LEU B 2 165 ? 89.951  39.374 92.631  1.00 31.06  ? 203  LEU B O   1 
ATOM   2744 C CB  . LEU B 2 165 ? 88.268  41.565 90.896  1.00 29.31  ? 203  LEU B CB  1 
ATOM   2745 C CG  . LEU B 2 165 ? 88.165  42.397 89.630  1.00 34.04  ? 203  LEU B CG  1 
ATOM   2746 C CD1 . LEU B 2 165 ? 86.751  42.297 89.059  1.00 33.52  ? 203  LEU B CD1 1 
ATOM   2747 C CD2 . LEU B 2 165 ? 88.644  43.860 89.799  1.00 35.67  ? 203  LEU B CD2 1 
ATOM   2748 N N   . TYR B 2 166 ? 89.211  41.138 93.796  1.00 32.12  ? 204  TYR B N   1 
ATOM   2749 C CA  . TYR B 2 166 ? 89.091  40.402 95.045  1.00 32.40  ? 204  TYR B CA  1 
ATOM   2750 C C   . TYR B 2 166 ? 87.686  40.636 95.516  1.00 40.22  ? 204  TYR B C   1 
ATOM   2751 O O   . TYR B 2 166 ? 87.125  41.726 95.341  1.00 40.95  ? 204  TYR B O   1 
ATOM   2752 C CB  . TYR B 2 166 ? 90.082  40.887 96.109  1.00 32.91  ? 204  TYR B CB  1 
ATOM   2753 C CG  . TYR B 2 166 ? 89.862  40.219 97.470  1.00 37.00  ? 204  TYR B CG  1 
ATOM   2754 C CD1 . TYR B 2 166 ? 90.160  38.861 97.684  1.00 39.27  ? 204  TYR B CD1 1 
ATOM   2755 C CD2 . TYR B 2 166 ? 89.331  40.945 98.542  1.00 37.02  ? 204  TYR B CD2 1 
ATOM   2756 C CE1 . TYR B 2 166 ? 89.909  38.280 98.898  1.00 38.77  ? 204  TYR B CE1 1 
ATOM   2757 C CE2 . TYR B 2 166 ? 89.028  40.353 99.709  1.00 36.39  ? 204  TYR B CE2 1 
ATOM   2758 C CZ  . TYR B 2 166 ? 89.341  39.045 99.895  1.00 43.22  ? 204  TYR B CZ  1 
ATOM   2759 O OH  . TYR B 2 166 ? 89.064  38.530 101.115 1.00 49.65  ? 204  TYR B OH  1 
ATOM   2760 N N   . VAL B 2 167 ? 87.087  39.600 96.072  1.00 37.22  ? 205  VAL B N   1 
ATOM   2761 C CA  . VAL B 2 167 ? 85.740  39.745 96.539  1.00 37.41  ? 205  VAL B CA  1 
ATOM   2762 C C   . VAL B 2 167 ? 85.641  39.361 97.969  1.00 46.97  ? 205  VAL B C   1 
ATOM   2763 O O   . VAL B 2 167 ? 86.245  38.390 98.429  1.00 47.90  ? 205  VAL B O   1 
ATOM   2764 C CB  . VAL B 2 167 ? 84.763  38.953 95.718  1.00 39.42  ? 205  VAL B CB  1 
ATOM   2765 C CG1 . VAL B 2 167 ? 83.354  39.318 96.147  1.00 38.46  ? 205  VAL B CG1 1 
ATOM   2766 C CG2 . VAL B 2 167 ? 84.996  39.223 94.249  1.00 38.87  ? 205  VAL B CG2 1 
ATOM   2767 N N   . HIS B 2 168 ? 84.832  40.091 98.696  1.00 46.65  ? 206  HIS B N   1 
ATOM   2768 C CA  . HIS B 2 168 ? 84.718  39.714 100.063 1.00 47.89  ? 206  HIS B CA  1 
ATOM   2769 C C   . HIS B 2 168 ? 83.356  40.001 100.629 1.00 56.49  ? 206  HIS B C   1 
ATOM   2770 O O   . HIS B 2 168 ? 82.759  41.005 100.288 1.00 57.01  ? 206  HIS B O   1 
ATOM   2771 C CB  . HIS B 2 168 ? 85.883  40.290 100.826 1.00 48.71  ? 206  HIS B CB  1 
ATOM   2772 C CG  . HIS B 2 168 ? 85.498  40.975 102.075 1.00 52.16  ? 206  HIS B CG  1 
ATOM   2773 N ND1 . HIS B 2 168 ? 85.702  40.420 103.316 1.00 53.93  ? 206  HIS B ND1 1 
ATOM   2774 C CD2 . HIS B 2 168 ? 84.898  42.166 102.278 1.00 55.44  ? 206  HIS B CD2 1 
ATOM   2775 C CE1 . HIS B 2 168 ? 85.244  41.249 104.236 1.00 54.60  ? 206  HIS B CE1 1 
ATOM   2776 N NE2 . HIS B 2 168 ? 84.764  42.323 103.634 1.00 55.37  ? 206  HIS B NE2 1 
ATOM   2777 N N   . TRP B 2 169 ? 82.809  39.029 101.358 1.00 57.77  ? 207  TRP B N   1 
ATOM   2778 C CA  . TRP B 2 169 ? 81.466  39.127 101.931 1.00 59.67  ? 207  TRP B CA  1 
ATOM   2779 C C   . TRP B 2 169 ? 81.372  40.077 103.079 1.00 69.10  ? 207  TRP B C   1 
ATOM   2780 O O   . TRP B 2 169 ? 82.176  40.022 103.995 1.00 67.77  ? 207  TRP B O   1 
ATOM   2781 C CB  . TRP B 2 169 ? 81.003  37.800 102.481 1.00 58.45  ? 207  TRP B CB  1 
ATOM   2782 C CG  . TRP B 2 169 ? 80.404  36.892 101.486 1.00 60.40  ? 207  TRP B CG  1 
ATOM   2783 C CD1 . TRP B 2 169 ? 81.025  35.825 100.874 1.00 63.78  ? 207  TRP B CD1 1 
ATOM   2784 C CD2 . TRP B 2 169 ? 79.035  36.857 101.058 1.00 59.62  ? 207  TRP B CD2 1 
ATOM   2785 N NE1 . TRP B 2 169 ? 80.136  35.174 100.034 1.00 63.46  ? 207  TRP B NE1 1 
ATOM   2786 C CE2 . TRP B 2 169 ? 78.905  35.767 100.148 1.00 63.85  ? 207  TRP B CE2 1 
ATOM   2787 C CE3 . TRP B 2 169 ? 77.909  37.611 101.368 1.00 60.54  ? 207  TRP B CE3 1 
ATOM   2788 C CZ2 . TRP B 2 169 ? 77.690  35.396 99.592  1.00 62.33  ? 207  TRP B CZ2 1 
ATOM   2789 C CZ3 . TRP B 2 169 ? 76.709  37.259 100.788 1.00 62.21  ? 207  TRP B CZ3 1 
ATOM   2790 C CH2 . TRP B 2 169 ? 76.602  36.136 99.935  1.00 62.93  ? 207  TRP B CH2 1 
ATOM   2791 N N   . THR B 2 170 ? 80.342  40.914 103.083 1.00 72.39  ? 208  THR B N   1 
ATOM   2792 C CA  . THR B 2 170 ? 79.936  41.569 104.319 1.00 75.25  ? 208  THR B CA  1 
ATOM   2793 C C   . THR B 2 170 ? 78.781  40.815 104.966 1.00 88.41  ? 208  THR B C   1 
ATOM   2794 O O   . THR B 2 170 ? 77.718  40.650 104.368 1.00 88.66  ? 208  THR B O   1 
ATOM   2795 C CB  . THR B 2 170 ? 79.513  43.029 104.073 1.00 77.16  ? 208  THR B CB  1 
ATOM   2796 O OG1 . THR B 2 170 ? 80.408  43.637 103.134 1.00 73.46  ? 208  THR B OG1 1 
ATOM   2797 C CG2 . THR B 2 170 ? 79.537  43.817 105.374 1.00 74.57  ? 208  THR B CG2 1 
ATOM   2798 N N   . ASP B 2 171 ? 79.008  40.343 106.188 1.00 90.60  ? 209  ASP B N   1 
ATOM   2799 C CA  . ASP B 2 171 ? 78.472  39.061 106.628 1.00 92.75  ? 209  ASP B CA  1 
ATOM   2800 C C   . ASP B 2 171 ? 76.949  39.088 106.637 1.00 100.90 ? 209  ASP B C   1 
ATOM   2801 O O   . ASP B 2 171 ? 76.297  38.118 106.250 1.00 100.06 ? 209  ASP B O   1 
ATOM   2802 C CB  . ASP B 2 171 ? 79.000  38.709 108.020 1.00 94.84  ? 209  ASP B CB  1 
ATOM   2803 C CG  . ASP B 2 171 ? 80.060  39.679 108.504 1.00 106.53 ? 209  ASP B CG  1 
ATOM   2804 O OD1 . ASP B 2 171 ? 81.220  39.252 108.684 1.00 107.85 ? 209  ASP B OD1 1 
ATOM   2805 O OD2 . ASP B 2 171 ? 79.733  40.868 108.704 1.00 110.27 ? 209  ASP B OD2 1 
ATOM   2806 N N   . ALA B 2 172 ? 76.391  40.208 107.082 1.00 100.80 ? 210  ALA B N   1 
ATOM   2807 C CA  . ALA B 2 172 ? 77.133  41.461 107.130 1.00 101.54 ? 210  ALA B CA  1 
ATOM   2808 C C   . ALA B 2 172 ? 77.365  41.903 108.571 1.00 108.39 ? 210  ALA B C   1 
ATOM   2809 O O   . ALA B 2 172 ? 76.432  41.945 109.373 1.00 109.13 ? 210  ALA B O   1 
ATOM   2810 C CB  . ALA B 2 172 ? 76.400  42.543 106.353 1.00 101.85 ? 210  ALA B CB  1 
ATOM   2811 N N   . GLY B 2 173 ? 78.606  42.267 108.870 1.00 104.71 ? 211  GLY B N   1 
ATOM   2812 C CA  . GLY B 2 173 ? 78.853  43.395 109.739 1.00 104.29 ? 211  GLY B CA  1 
ATOM   2813 C C   . GLY B 2 173 ? 78.300  44.666 109.129 1.00 107.77 ? 211  GLY B C   1 
ATOM   2814 O O   . GLY B 2 173 ? 78.440  44.923 107.933 1.00 107.33 ? 211  GLY B O   1 
ATOM   2815 N N   . GLN B 2 174 ? 77.665  45.461 109.978 1.00 103.34 ? 212  GLN B N   1 
ATOM   2816 C CA  . GLN B 2 174 ? 76.991  46.694 109.580 1.00 102.58 ? 212  GLN B CA  1 
ATOM   2817 C C   . GLN B 2 174 ? 77.941  47.876 109.424 1.00 103.58 ? 212  GLN B C   1 
ATOM   2818 O O   . GLN B 2 174 ? 78.727  48.188 110.326 1.00 103.77 ? 212  GLN B O   1 
ATOM   2819 C CB  . GLN B 2 174 ? 75.888  47.049 110.574 1.00 104.18 ? 212  GLN B CB  1 
ATOM   2820 C CG  . GLN B 2 174 ? 74.952  45.904 110.879 1.00 129.84 ? 212  GLN B CG  1 
ATOM   2821 C CD  . GLN B 2 174 ? 75.637  44.793 111.647 1.00 162.80 ? 212  GLN B CD  1 
ATOM   2822 O OE1 . GLN B 2 174 ? 76.103  44.995 112.770 1.00 159.84 ? 212  GLN B OE1 1 
ATOM   2823 N NE2 . GLN B 2 174 ? 75.796  43.642 111.002 1.00 160.45 ? 212  GLN B NE2 1 
ATOM   2824 N N   . LEU B 2 175 ? 77.836  48.555 108.286 1.00 96.33  ? 213  LEU B N   1 
ATOM   2825 C CA  . LEU B 2 175 ? 78.703  49.679 108.005 1.00 94.26  ? 213  LEU B CA  1 
ATOM   2826 C C   . LEU B 2 175 ? 77.998  51.025 108.080 1.00 94.79  ? 213  LEU B C   1 
ATOM   2827 O O   . LEU B 2 175 ? 76.771  51.115 107.953 1.00 94.05  ? 213  LEU B O   1 
ATOM   2828 C CB  . LEU B 2 175 ? 79.383  49.506 106.641 1.00 94.09  ? 213  LEU B CB  1 
ATOM   2829 C CG  . LEU B 2 175 ? 78.801  48.477 105.669 1.00 97.94  ? 213  LEU B CG  1 
ATOM   2830 C CD1 . LEU B 2 175 ? 79.463  48.620 104.321 1.00 97.35  ? 213  LEU B CD1 1 
ATOM   2831 C CD2 . LEU B 2 175 ? 78.991  47.065 106.209 1.00 101.11 ? 213  LEU B CD2 1 
ATOM   2832 N N   . THR B 2 176 ? 78.811  52.063 108.268 1.00 88.73  ? 214  THR B N   1 
ATOM   2833 C CA  . THR B 2 176 ? 78.371  53.451 108.326 1.00 86.87  ? 214  THR B CA  1 
ATOM   2834 C C   . THR B 2 176 ? 79.209  54.168 107.269 1.00 87.74  ? 214  THR B C   1 
ATOM   2835 O O   . THR B 2 176 ? 80.150  53.575 106.734 1.00 87.36  ? 214  THR B O   1 
ATOM   2836 C CB  . THR B 2 176 ? 78.645  54.019 109.724 1.00 92.02  ? 214  THR B CB  1 
ATOM   2837 O OG1 . THR B 2 176 ? 80.060  54.121 109.930 1.00 90.52  ? 214  THR B OG1 1 
ATOM   2838 C CG2 . THR B 2 176 ? 78.077  53.092 110.776 1.00 90.26  ? 214  THR B CG2 1 
ATOM   2839 N N   . PRO B 2 177 ? 78.889  55.442 106.952 1.00 81.90  ? 215  PRO B N   1 
ATOM   2840 C CA  . PRO B 2 177 ? 79.763  56.070 105.942 1.00 81.19  ? 215  PRO B CA  1 
ATOM   2841 C C   . PRO B 2 177 ? 81.243  56.035 106.352 1.00 84.76  ? 215  PRO B C   1 
ATOM   2842 O O   . PRO B 2 177 ? 82.147  56.074 105.508 1.00 85.09  ? 215  PRO B O   1 
ATOM   2843 C CB  . PRO B 2 177 ? 79.247  57.513 105.881 1.00 82.56  ? 215  PRO B CB  1 
ATOM   2844 C CG  . PRO B 2 177 ? 77.795  57.391 106.210 1.00 86.81  ? 215  PRO B CG  1 
ATOM   2845 C CD  . PRO B 2 177 ? 77.657  56.227 107.173 1.00 82.32  ? 215  PRO B CD  1 
ATOM   2846 N N   . ALA B 2 178 ? 81.469  55.878 107.652 1.00 79.87  ? 216  ALA B N   1 
ATOM   2847 C CA  . ALA B 2 178 ? 82.812  55.804 108.217 1.00 79.17  ? 216  ALA B CA  1 
ATOM   2848 C C   . ALA B 2 178 ? 83.557  54.491 107.888 1.00 79.47  ? 216  ALA B C   1 
ATOM   2849 O O   . ALA B 2 178 ? 84.753  54.498 107.552 1.00 78.54  ? 216  ALA B O   1 
ATOM   2850 C CB  . ALA B 2 178 ? 82.747  56.024 109.745 1.00 79.93  ? 216  ALA B CB  1 
ATOM   2851 N N   . LEU B 2 179 ? 82.856  53.368 108.017 1.00 72.65  ? 217  LEU B N   1 
ATOM   2852 C CA  . LEU B 2 179 ? 83.464  52.069 107.755 1.00 71.39  ? 217  LEU B CA  1 
ATOM   2853 C C   . LEU B 2 179 ? 83.660  51.787 106.273 1.00 70.34  ? 217  LEU B C   1 
ATOM   2854 O O   . LEU B 2 179 ? 84.478  50.944 105.892 1.00 70.18  ? 217  LEU B O   1 
ATOM   2855 C CB  . LEU B 2 179 ? 82.672  50.958 108.423 1.00 71.73  ? 217  LEU B CB  1 
ATOM   2856 C CG  . LEU B 2 179 ? 82.661  51.166 109.936 1.00 76.25  ? 217  LEU B CG  1 
ATOM   2857 C CD1 . LEU B 2 179 ? 83.812  52.082 110.309 1.00 75.44  ? 217  LEU B CD1 1 
ATOM   2858 C CD2 . LEU B 2 179 ? 81.314  51.724 110.410 1.00 77.69  ? 217  LEU B CD2 1 
ATOM   2859 N N   . LEU B 2 180 ? 82.938  52.537 105.445 1.00 61.34  ? 218  LEU B N   1 
ATOM   2860 C CA  . LEU B 2 180 ? 83.054  52.420 104.000 1.00 57.55  ? 218  LEU B CA  1 
ATOM   2861 C C   . LEU B 2 180 ? 84.496  52.684 103.565 1.00 59.94  ? 218  LEU B C   1 
ATOM   2862 O O   . LEU B 2 180 ? 84.928  52.260 102.492 1.00 59.63  ? 218  LEU B O   1 
ATOM   2863 C CB  . LEU B 2 180 ? 82.099  53.410 103.322 1.00 56.14  ? 218  LEU B CB  1 
ATOM   2864 C CG  . LEU B 2 180 ? 80.623  52.987 103.264 1.00 58.95  ? 218  LEU B CG  1 
ATOM   2865 C CD1 . LEU B 2 180 ? 79.858  53.661 102.164 1.00 58.36  ? 218  LEU B CD1 1 
ATOM   2866 C CD2 . LEU B 2 180 ? 80.429  51.484 103.197 1.00 57.98  ? 218  LEU B CD2 1 
ATOM   2867 N N   . HIS B 2 181 ? 85.243  53.384 104.418 1.00 55.00  ? 219  HIS B N   1 
ATOM   2868 C CA  . HIS B 2 181 ? 86.605  53.796 104.095 1.00 51.62  ? 219  HIS B CA  1 
ATOM   2869 C C   . HIS B 2 181 ? 87.618  52.878 104.704 1.00 55.13  ? 219  HIS B C   1 
ATOM   2870 O O   . HIS B 2 181 ? 87.562  52.571 105.877 1.00 55.30  ? 219  HIS B O   1 
ATOM   2871 C CB  . HIS B 2 181 ? 86.820  55.279 104.405 1.00 49.76  ? 219  HIS B CB  1 
ATOM   2872 C CG  . HIS B 2 181 ? 85.989  56.186 103.549 1.00 51.65  ? 219  HIS B CG  1 
ATOM   2873 N ND1 . HIS B 2 181 ? 86.461  56.747 102.380 1.00 53.52  ? 219  HIS B ND1 1 
ATOM   2874 C CD2 . HIS B 2 181 ? 84.689  56.556 103.641 1.00 53.01  ? 219  HIS B CD2 1 
ATOM   2875 C CE1 . HIS B 2 181 ? 85.501  57.457 101.807 1.00 52.94  ? 219  HIS B CE1 1 
ATOM   2876 N NE2 . HIS B 2 181 ? 84.414  57.363 102.557 1.00 53.11  ? 219  HIS B NE2 1 
ATOM   2877 N N   . SER B 2 182 ? 88.460  52.326 103.855 1.00 52.69  ? 220  SER B N   1 
ATOM   2878 C CA  . SER B 2 182 ? 89.387  51.321 104.301 1.00 53.86  ? 220  SER B CA  1 
ATOM   2879 C C   . SER B 2 182 ? 90.552  51.914 105.048 1.00 63.07  ? 220  SER B C   1 
ATOM   2880 O O   . SER B 2 182 ? 90.965  53.054 104.779 1.00 64.07  ? 220  SER B O   1 
ATOM   2881 C CB  . SER B 2 182 ? 89.856  50.456 103.127 1.00 55.91  ? 220  SER B CB  1 
ATOM   2882 O OG  . SER B 2 182 ? 90.660  49.374 103.561 1.00 59.93  ? 220  SER B OG  1 
ATOM   2883 N N   . ARG B 2 183 ? 91.081  51.092 105.958 1.00 61.93  ? 221  ARG B N   1 
ATOM   2884 C CA  . ARG B 2 183 ? 92.229  51.384 106.815 1.00 62.02  ? 221  ARG B CA  1 
ATOM   2885 C C   . ARG B 2 183 ? 93.402  50.510 106.412 1.00 64.95  ? 221  ARG B C   1 
ATOM   2886 O O   . ARG B 2 183 ? 94.483  50.660 106.945 1.00 65.07  ? 221  ARG B O   1 
ATOM   2887 C CB  . ARG B 2 183 ? 91.892  51.064 108.283 1.00 64.43  ? 221  ARG B CB  1 
ATOM   2888 C CG  . ARG B 2 183 ? 91.086  52.144 109.019 1.00 79.09  ? 221  ARG B CG  1 
ATOM   2889 C CD  . ARG B 2 183 ? 89.724  51.622 109.488 1.00 99.74  ? 221  ARG B CD  1 
ATOM   2890 N NE  . ARG B 2 183 ? 89.368  50.337 108.873 1.00 115.80 ? 221  ARG B NE  1 
ATOM   2891 C CZ  . ARG B 2 183 ? 88.151  50.017 108.427 1.00 127.42 ? 221  ARG B CZ  1 
ATOM   2892 N NH1 . ARG B 2 183 ? 87.147  50.884 108.528 1.00 105.50 ? 221  ARG B NH1 1 
ATOM   2893 N NH2 . ARG B 2 183 ? 87.938  48.823 107.876 1.00 114.71 ? 221  ARG B NH2 1 
ATOM   2894 N N   . CYS B 2 184 ? 93.169  49.563 105.507 1.00 61.07  ? 222  CYS B N   1 
ATOM   2895 C CA  . CYS B 2 184 ? 94.209  48.645 105.035 1.00 59.30  ? 222  CYS B CA  1 
ATOM   2896 C C   . CYS B 2 184 ? 94.606  48.903 103.591 1.00 57.61  ? 222  CYS B C   1 
ATOM   2897 O O   . CYS B 2 184 ? 93.781  49.365 102.794 1.00 55.45  ? 222  CYS B O   1 
ATOM   2898 C CB  . CYS B 2 184 ? 93.714  47.221 105.140 1.00 60.25  ? 222  CYS B CB  1 
ATOM   2899 S SG  . CYS B 2 184 ? 93.985  46.492 106.738 1.00 64.51  ? 222  CYS B SG  1 
ATOM   2900 N N   . LEU B 2 185 ? 95.864  48.581 103.268 1.00 51.18  ? 223  LEU B N   1 
ATOM   2901 C CA  . LEU B 2 185 ? 96.415  48.760 101.928 1.00 49.20  ? 223  LEU B CA  1 
ATOM   2902 C C   . LEU B 2 185 ? 97.228  47.553 101.532 1.00 51.41  ? 223  LEU B C   1 
ATOM   2903 O O   . LEU B 2 185 ? 97.733  46.841 102.376 1.00 48.49  ? 223  LEU B O   1 
ATOM   2904 C CB  . LEU B 2 185 ? 97.298  50.013 101.827 1.00 49.07  ? 223  LEU B CB  1 
ATOM   2905 C CG  . LEU B 2 185 ? 96.707  51.411 102.134 1.00 53.19  ? 223  LEU B CG  1 
ATOM   2906 C CD1 . LEU B 2 185 ? 97.776  52.502 102.031 1.00 52.72  ? 223  LEU B CD1 1 
ATOM   2907 C CD2 . LEU B 2 185 ? 95.505  51.763 101.255 1.00 54.40  ? 223  LEU B CD2 1 
ATOM   2908 N N   . CYS B 2 186 ? 97.362  47.357 100.224 1.00 49.59  ? 224  CYS B N   1 
ATOM   2909 C CA  . CYS B 2 186 ? 98.072  46.236 99.654  1.00 48.83  ? 224  CYS B CA  1 
ATOM   2910 C C   . CYS B 2 186 ? 99.165  46.759 98.761  1.00 53.55  ? 224  CYS B C   1 
ATOM   2911 O O   . CYS B 2 186 ? 98.944  47.673 97.951  1.00 56.26  ? 224  CYS B O   1 
ATOM   2912 C CB  . CYS B 2 186 ? 97.111  45.382 98.839  1.00 49.53  ? 224  CYS B CB  1 
ATOM   2913 S SG  . CYS B 2 186 ? 97.898  43.901 98.172  1.00 54.60  ? 224  CYS B SG  1 
ATOM   2914 N N   . VAL B 2 187 ? 100.352 46.194 98.920  1.00 46.80  ? 225  VAL B N   1 
ATOM   2915 C CA  . VAL B 2 187 ? 101.515 46.636 98.166  1.00 45.72  ? 225  VAL B CA  1 
ATOM   2916 C C   . VAL B 2 187 ? 101.943 45.466 97.337  1.00 53.92  ? 225  VAL B C   1 
ATOM   2917 O O   . VAL B 2 187 ? 102.153 44.370 97.846  1.00 57.36  ? 225  VAL B O   1 
ATOM   2918 C CB  . VAL B 2 187 ? 102.678 47.052 99.110  1.00 47.26  ? 225  VAL B CB  1 
ATOM   2919 C CG1 . VAL B 2 187 ? 103.986 47.116 98.339  1.00 46.65  ? 225  VAL B CG1 1 
ATOM   2920 C CG2 . VAL B 2 187 ? 102.375 48.369 99.794  1.00 46.06  ? 225  VAL B CG2 1 
ATOM   2921 N N   . ASP B 2 188 ? 102.089 45.664 96.051  1.00 49.41  ? 226  ASP B N   1 
ATOM   2922 C CA  . ASP B 2 188 ? 102.488 44.533 95.250  1.00 49.70  ? 226  ASP B CA  1 
ATOM   2923 C C   . ASP B 2 188 ? 103.400 45.107 94.183  1.00 54.24  ? 226  ASP B C   1 
ATOM   2924 O O   . ASP B 2 188 ? 103.701 46.316 94.220  1.00 52.68  ? 226  ASP B O   1 
ATOM   2925 C CB  . ASP B 2 188 ? 101.250 43.857 94.644  1.00 51.97  ? 226  ASP B CB  1 
ATOM   2926 C CG  . ASP B 2 188 ? 100.527 44.747 93.660  1.00 63.59  ? 226  ASP B CG  1 
ATOM   2927 O OD1 . ASP B 2 188 ? 99.948  45.795 94.074  1.00 64.39  ? 226  ASP B OD1 1 
ATOM   2928 O OD2 . ASP B 2 188 ? 100.565 44.394 92.462  1.00 67.79  ? 226  ASP B OD2 1 
ATOM   2929 N N   . ARG B 2 189 ? 103.847 44.251 93.265  1.00 51.42  ? 227  ARG B N   1 
ATOM   2930 C CA  . ARG B 2 189 ? 104.727 44.687 92.203  1.00 52.45  ? 227  ARG B CA  1 
ATOM   2931 C C   . ARG B 2 189 ? 106.106 44.780 92.840  1.00 61.88  ? 227  ARG B C   1 
ATOM   2932 O O   . ARG B 2 189 ? 107.015 45.433 92.320  1.00 63.22  ? 227  ARG B O   1 
ATOM   2933 C CB  . ARG B 2 189 ? 104.268 46.043 91.649  1.00 51.42  ? 227  ARG B CB  1 
ATOM   2934 C CG  . ARG B 2 189 ? 103.888 46.088 90.186  1.00 56.53  ? 227  ARG B CG  1 
ATOM   2935 C CD  . ARG B 2 189 ? 102.758 45.142 89.831  1.00 59.31  ? 227  ARG B CD  1 
ATOM   2936 N NE  . ARG B 2 189 ? 103.231 43.849 89.322  1.00 71.69  ? 227  ARG B NE  1 
ATOM   2937 C CZ  . ARG B 2 189 ? 104.263 43.668 88.496  1.00 83.36  ? 227  ARG B CZ  1 
ATOM   2938 N NH1 . ARG B 2 189 ? 104.975 44.693 88.067  1.00 72.02  ? 227  ARG B NH1 1 
ATOM   2939 N NH2 . ARG B 2 189 ? 104.593 42.448 88.097  1.00 62.74  ? 227  ARG B NH2 1 
ATOM   2940 N N   . LEU B 2 190 ? 106.249 44.092 93.972  1.00 59.14  ? 228  LEU B N   1 
ATOM   2941 C CA  . LEU B 2 190 ? 107.503 44.030 94.722  1.00 57.83  ? 228  LEU B CA  1 
ATOM   2942 C C   . LEU B 2 190 ? 108.579 43.293 93.922  1.00 63.19  ? 228  LEU B C   1 
ATOM   2943 O O   . LEU B 2 190 ? 108.277 42.417 93.094  1.00 62.63  ? 228  LEU B O   1 
ATOM   2944 C CB  . LEU B 2 190 ? 107.281 43.258 96.025  1.00 57.19  ? 228  LEU B CB  1 
ATOM   2945 C CG  . LEU B 2 190 ? 106.200 43.800 96.946  1.00 60.45  ? 228  LEU B CG  1 
ATOM   2946 C CD1 . LEU B 2 190 ? 106.155 42.985 98.234  1.00 59.94  ? 228  LEU B CD1 1 
ATOM   2947 C CD2 . LEU B 2 190 ? 106.464 45.276 97.206  1.00 61.61  ? 228  LEU B CD2 1 
ATOM   2948 N N   . PRO B 2 191 ? 109.860 43.587 94.218  1.00 60.59  ? 229  PRO B N   1 
ATOM   2949 C CA  . PRO B 2 191 ? 110.912 42.891 93.471  1.00 60.03  ? 229  PRO B CA  1 
ATOM   2950 C C   . PRO B 2 191 ? 110.884 41.391 93.728  1.00 66.49  ? 229  PRO B C   1 
ATOM   2951 O O   . PRO B 2 191 ? 110.417 40.931 94.791  1.00 65.96  ? 229  PRO B O   1 
ATOM   2952 C CB  . PRO B 2 191 ? 112.199 43.511 94.023  1.00 60.93  ? 229  PRO B CB  1 
ATOM   2953 C CG  . PRO B 2 191 ? 111.776 44.793 94.660  1.00 64.61  ? 229  PRO B CG  1 
ATOM   2954 C CD  . PRO B 2 191 ? 110.429 44.530 95.201  1.00 60.97  ? 229  PRO B CD  1 
ATOM   2955 N N   . PRO B 2 192 ? 111.391 40.616 92.702  1.00 63.04  ? 230  PRO B N   1 
ATOM   2956 C CA  . PRO B 2 192 ? 111.404 39.159 92.868  1.00 62.72  ? 230  PRO B CA  1 
ATOM   2957 C C   . PRO B 2 192 ? 112.115 38.784 94.150  1.00 70.02  ? 230  PRO B C   1 
ATOM   2958 O O   . PRO B 2 192 ? 113.186 39.312 94.469  1.00 71.04  ? 230  PRO B O   1 
ATOM   2959 C CB  . PRO B 2 192 ? 112.202 38.668 91.654  1.00 63.98  ? 230  PRO B CB  1 
ATOM   2960 C CG  . PRO B 2 192 ? 111.921 39.657 90.593  1.00 67.99  ? 230  PRO B CG  1 
ATOM   2961 C CD  . PRO B 2 192 ? 111.655 41.004 91.301  1.00 64.09  ? 230  PRO B CD  1 
ATOM   2962 N N   . GLY B 2 193 ? 111.491 37.883 94.898  1.00 67.10  ? 231  GLY B N   1 
ATOM   2963 C CA  . GLY B 2 193 ? 112.023 37.382 96.144  1.00 66.26  ? 231  GLY B CA  1 
ATOM   2964 C C   . GLY B 2 193 ? 112.161 38.434 97.212  1.00 69.45  ? 231  GLY B C   1 
ATOM   2965 O O   . GLY B 2 193 ? 112.786 38.165 98.243  1.00 70.64  ? 231  GLY B O   1 
ATOM   2966 N N   . PHE B 2 194 ? 111.623 39.627 96.992  1.00 64.01  ? 232  PHE B N   1 
ATOM   2967 C CA  . PHE B 2 194 ? 112.084 40.773 97.762  1.00 63.10  ? 232  PHE B CA  1 
ATOM   2968 C C   . PHE B 2 194 ? 111.772 40.542 99.236  1.00 70.89  ? 232  PHE B C   1 
ATOM   2969 O O   . PHE B 2 194 ? 110.671 40.119 99.587  1.00 71.93  ? 232  PHE B O   1 
ATOM   2970 C CB  . PHE B 2 194 ? 111.411 42.057 97.274  1.00 63.13  ? 232  PHE B CB  1 
ATOM   2971 C CG  . PHE B 2 194 ? 111.220 43.088 98.349  1.00 62.87  ? 232  PHE B CG  1 
ATOM   2972 C CD1 . PHE B 2 194 ? 112.094 44.155 98.467  1.00 64.37  ? 232  PHE B CD1 1 
ATOM   2973 C CD2 . PHE B 2 194 ? 110.167 42.990 99.243  1.00 63.42  ? 232  PHE B CD2 1 
ATOM   2974 C CE1 . PHE B 2 194 ? 111.921 45.106 99.455  1.00 64.74  ? 232  PHE B CE1 1 
ATOM   2975 C CE2 . PHE B 2 194 ? 109.989 43.937 100.233 1.00 65.80  ? 232  PHE B CE2 1 
ATOM   2976 C CZ  . PHE B 2 194 ? 110.867 44.996 100.339 1.00 63.96  ? 232  PHE B CZ  1 
ATOM   2977 N N   . ASN B 2 195 ? 112.749 40.820 100.093 1.00 68.20  ? 233  ASN B N   1 
ATOM   2978 C CA  . ASN B 2 195 ? 112.551 40.733 101.535 1.00 67.67  ? 233  ASN B CA  1 
ATOM   2979 C C   . ASN B 2 195 ? 113.033 41.986 102.259 1.00 70.36  ? 233  ASN B C   1 
ATOM   2980 O O   . ASN B 2 195 ? 114.070 41.972 102.921 1.00 70.45  ? 233  ASN B O   1 
ATOM   2981 C CB  . ASN B 2 195 ? 113.254 39.497 102.099 1.00 69.09  ? 233  ASN B CB  1 
ATOM   2982 C CG  . ASN B 2 195 ? 112.452 38.817 103.191 1.00 99.86  ? 233  ASN B CG  1 
ATOM   2983 O OD1 . ASN B 2 195 ? 111.725 39.469 103.940 1.00 90.14  ? 233  ASN B OD1 1 
ATOM   2984 N ND2 . ASN B 2 195 ? 112.582 37.499 103.287 1.00 92.04  ? 233  ASN B ND2 1 
ATOM   2985 N N   . ASP B 2 196 ? 112.272 43.068 102.127 1.00 65.11  ? 234  ASP B N   1 
ATOM   2986 C CA  . ASP B 2 196 ? 112.433 44.228 102.996 1.00 65.09  ? 234  ASP B CA  1 
ATOM   2987 C C   . ASP B 2 196 ? 111.093 44.677 103.569 1.00 68.92  ? 234  ASP B C   1 
ATOM   2988 O O   . ASP B 2 196 ? 110.542 45.697 103.158 1.00 68.43  ? 234  ASP B O   1 
ATOM   2989 C CB  . ASP B 2 196 ? 113.093 45.380 102.235 1.00 67.28  ? 234  ASP B CB  1 
ATOM   2990 C CG  . ASP B 2 196 ? 114.379 45.847 102.887 1.00 80.92  ? 234  ASP B CG  1 
ATOM   2991 O OD1 . ASP B 2 196 ? 114.343 46.220 104.078 1.00 81.19  ? 234  ASP B OD1 1 
ATOM   2992 O OD2 . ASP B 2 196 ? 115.427 45.842 102.207 1.00 86.40  ? 234  ASP B OD2 1 
ATOM   2993 N N   . VAL B 2 197 ? 110.576 43.907 104.521 1.00 66.54  ? 235  VAL B N   1 
ATOM   2994 C CA  . VAL B 2 197 ? 109.497 44.376 105.383 1.00 68.29  ? 235  VAL B CA  1 
ATOM   2995 C C   . VAL B 2 197 ? 109.941 45.569 106.222 1.00 74.83  ? 235  VAL B C   1 
ATOM   2996 O O   . VAL B 2 197 ? 109.186 46.523 106.411 1.00 73.85  ? 235  VAL B O   1 
ATOM   2997 C CB  . VAL B 2 197 ? 108.996 43.260 106.318 1.00 73.29  ? 235  VAL B CB  1 
ATOM   2998 C CG1 . VAL B 2 197 ? 107.483 43.133 106.230 1.00 73.29  ? 235  VAL B CG1 1 
ATOM   2999 C CG2 . VAL B 2 197 ? 109.670 41.940 105.977 1.00 73.12  ? 235  VAL B CG2 1 
ATOM   3000 N N   . ASP B 2 198 ? 111.171 45.509 106.722 1.00 72.84  ? 236  ASP B N   1 
ATOM   3001 C CA  . ASP B 2 198 ? 111.755 46.626 107.455 1.00 71.54  ? 236  ASP B CA  1 
ATOM   3002 C C   . ASP B 2 198 ? 111.894 47.857 106.566 1.00 71.61  ? 236  ASP B C   1 
ATOM   3003 O O   . ASP B 2 198 ? 111.640 48.980 107.001 1.00 69.67  ? 236  ASP B O   1 
ATOM   3004 C CB  . ASP B 2 198 ? 113.118 46.235 108.029 1.00 73.99  ? 236  ASP B CB  1 
ATOM   3005 C CG  . ASP B 2 198 ? 113.008 45.553 109.379 1.00 89.69  ? 236  ASP B CG  1 
ATOM   3006 O OD1 . ASP B 2 198 ? 112.876 46.264 110.397 1.00 90.13  ? 236  ASP B OD1 1 
ATOM   3007 O OD2 . ASP B 2 198 ? 113.053 44.305 109.421 1.00 98.17  ? 236  ASP B OD2 1 
ATOM   3008 N N   . ALA B 2 199 ? 112.299 47.638 105.319 1.00 67.50  ? 237  ALA B N   1 
ATOM   3009 C CA  . ALA B 2 199 ? 112.539 48.733 104.390 1.00 67.19  ? 237  ALA B CA  1 
ATOM   3010 C C   . ALA B 2 199 ? 111.184 49.150 103.821 1.00 72.45  ? 237  ALA B C   1 
ATOM   3011 O O   . ALA B 2 199 ? 110.787 50.333 103.834 1.00 71.42  ? 237  ALA B O   1 
ATOM   3012 C CB  . ALA B 2 199 ? 113.469 48.282 103.303 1.00 67.51  ? 237  ALA B CB  1 
ATOM   3013 N N   . LEU B 2 200 ? 110.449 48.140 103.386 1.00 69.52  ? 238  LEU B N   1 
ATOM   3014 C CA  . LEU B 2 200 ? 109.125 48.272 102.858 1.00 69.35  ? 238  LEU B CA  1 
ATOM   3015 C C   . LEU B 2 200 ? 108.222 48.987 103.864 1.00 72.76  ? 238  LEU B C   1 
ATOM   3016 O O   . LEU B 2 200 ? 107.502 49.930 103.532 1.00 73.05  ? 238  LEU B O   1 
ATOM   3017 C CB  . LEU B 2 200 ? 108.608 46.872 102.588 1.00 69.51  ? 238  LEU B CB  1 
ATOM   3018 C CG  . LEU B 2 200 ? 107.324 46.785 101.777 1.00 74.77  ? 238  LEU B CG  1 
ATOM   3019 C CD1 . LEU B 2 200 ? 107.222 45.376 101.230 1.00 74.96  ? 238  LEU B CD1 1 
ATOM   3020 C CD2 . LEU B 2 200 ? 106.098 47.165 102.628 1.00 76.06  ? 238  LEU B CD2 1 
ATOM   3021 N N   . CYS B 2 201 ? 108.269 48.549 105.108 1.00 68.33  ? 239  CYS B N   1 
ATOM   3022 C CA  . CYS B 2 201 ? 107.429 49.156 106.131 1.00 68.33  ? 239  CYS B CA  1 
ATOM   3023 C C   . CYS B 2 201 ? 107.927 50.556 106.507 1.00 72.00  ? 239  CYS B C   1 
ATOM   3024 O O   . CYS B 2 201 ? 107.140 51.433 106.916 1.00 71.46  ? 239  CYS B O   1 
ATOM   3025 C CB  . CYS B 2 201 ? 107.314 48.221 107.340 1.00 69.02  ? 239  CYS B CB  1 
ATOM   3026 S SG  . CYS B 2 201 ? 106.485 46.621 106.974 1.00 73.17  ? 239  CYS B SG  1 
ATOM   3027 N N   . ARG B 2 202 ? 109.234 50.764 106.335 1.00 67.92  ? 240  ARG B N   1 
ATOM   3028 C CA  . ARG B 2 202 ? 109.858 52.056 106.597 1.00 67.37  ? 240  ARG B CA  1 
ATOM   3029 C C   . ARG B 2 202 ? 109.273 52.995 105.561 1.00 70.01  ? 240  ARG B C   1 
ATOM   3030 O O   . ARG B 2 202 ? 108.678 54.023 105.895 1.00 69.19  ? 240  ARG B O   1 
ATOM   3031 C CB  . ARG B 2 202 ? 111.371 51.945 106.370 1.00 69.30  ? 240  ARG B CB  1 
ATOM   3032 C CG  . ARG B 2 202 ? 112.292 52.946 107.122 1.00 83.05  ? 240  ARG B CG  1 
ATOM   3033 C CD  . ARG B 2 202 ? 111.619 54.280 107.516 1.00 96.27  ? 240  ARG B CD  1 
ATOM   3034 N NE  . ARG B 2 202 ? 112.433 55.459 107.187 1.00 106.48 ? 240  ARG B NE  1 
ATOM   3035 C CZ  . ARG B 2 202 ? 112.308 56.652 107.769 1.00 120.97 ? 240  ARG B CZ  1 
ATOM   3036 N NH1 . ARG B 2 202 ? 113.083 57.665 107.392 1.00 102.63 ? 240  ARG B NH1 1 
ATOM   3037 N NH2 . ARG B 2 202 ? 111.403 56.837 108.724 1.00 110.32 ? 240  ARG B NH2 1 
ATOM   3038 N N   . ALA B 2 203 ? 109.415 52.601 104.295 1.00 66.27  ? 241  ALA B N   1 
ATOM   3039 C CA  . ALA B 2 203 ? 108.906 53.384 103.168 1.00 65.26  ? 241  ALA B CA  1 
ATOM   3040 C C   . ALA B 2 203 ? 107.471 53.849 103.401 1.00 71.58  ? 241  ALA B C   1 
ATOM   3041 O O   . ALA B 2 203 ? 107.140 55.024 103.193 1.00 71.00  ? 241  ALA B O   1 
ATOM   3042 C CB  . ALA B 2 203 ? 109.005 52.584 101.883 1.00 64.92  ? 241  ALA B CB  1 
ATOM   3043 N N   . LEU B 2 204 ? 106.639 52.921 103.870 1.00 69.15  ? 242  LEU B N   1 
ATOM   3044 C CA  . LEU B 2 204 ? 105.223 53.169 104.077 1.00 69.74  ? 242  LEU B CA  1 
ATOM   3045 C C   . LEU B 2 204 ? 104.832 54.007 105.278 1.00 75.37  ? 242  LEU B C   1 
ATOM   3046 O O   . LEU B 2 204 ? 103.639 54.230 105.535 1.00 75.34  ? 242  LEU B O   1 
ATOM   3047 C CB  . LEU B 2 204 ? 104.446 51.858 104.008 1.00 70.38  ? 242  LEU B CB  1 
ATOM   3048 C CG  . LEU B 2 204 ? 104.681 51.254 102.604 1.00 76.08  ? 242  LEU B CG  1 
ATOM   3049 C CD1 . LEU B 2 204 ? 104.612 49.739 102.550 1.00 77.39  ? 242  LEU B CD1 1 
ATOM   3050 C CD2 . LEU B 2 204 ? 103.851 51.892 101.491 1.00 74.76  ? 242  LEU B CD2 1 
ATOM   3051 N N   . SER B 2 205 ? 105.835 54.529 105.980 1.00 71.96  ? 243  SER B N   1 
ATOM   3052 C CA  . SER B 2 205 ? 105.590 55.340 107.160 1.00 70.28  ? 243  SER B CA  1 
ATOM   3053 C C   . SER B 2 205 ? 105.820 56.831 106.892 1.00 73.82  ? 243  SER B C   1 
ATOM   3054 O O   . SER B 2 205 ? 105.495 57.699 107.720 1.00 72.31  ? 243  SER B O   1 
ATOM   3055 C CB  . SER B 2 205 ? 106.434 54.796 108.287 1.00 71.21  ? 243  SER B CB  1 
ATOM   3056 O OG  . SER B 2 205 ? 106.386 53.379 108.240 1.00 75.12  ? 243  SER B OG  1 
ATOM   3057 N N   . ALA B 2 206 ? 106.277 57.119 105.675 1.00 70.48  ? 244  ALA B N   1 
ATOM   3058 C CA  . ALA B 2 206 ? 106.582 58.484 105.263 1.00 70.27  ? 244  ALA B CA  1 
ATOM   3059 C C   . ALA B 2 206 ? 105.514 59.529 105.532 1.00 75.38  ? 244  ALA B C   1 
ATOM   3060 O O   . ALA B 2 206 ? 105.717 60.703 105.232 1.00 75.93  ? 244  ALA B O   1 
ATOM   3061 C CB  . ALA B 2 206 ? 106.999 58.520 103.824 1.00 71.00  ? 244  ALA B CB  1 
ATOM   3062 N N   . VAL B 2 207 ? 104.378 59.121 106.090 1.00 71.55  ? 245  VAL B N   1 
ATOM   3063 C CA  . VAL B 2 207 ? 103.291 60.062 106.350 1.00 70.40  ? 245  VAL B CA  1 
ATOM   3064 C C   . VAL B 2 207 ? 102.637 59.723 107.663 1.00 73.95  ? 245  VAL B C   1 
ATOM   3065 O O   . VAL B 2 207 ? 102.386 60.594 108.497 1.00 73.60  ? 245  VAL B O   1 
ATOM   3066 C CB  . VAL B 2 207 ? 102.246 60.033 105.234 1.00 73.69  ? 245  VAL B CB  1 
ATOM   3067 C CG1 . VAL B 2 207 ? 101.352 61.284 105.278 1.00 73.15  ? 245  VAL B CG1 1 
ATOM   3068 C CG2 . VAL B 2 207 ? 102.916 59.886 103.893 1.00 73.56  ? 245  VAL B CG2 1 
ATOM   3069 N N   . HIS B 2 208 ? 102.306 58.454 107.820 1.00 69.94  ? 246  HIS B N   1 
ATOM   3070 C CA  . HIS B 2 208 ? 101.693 58.007 109.038 1.00 70.67  ? 246  HIS B CA  1 
ATOM   3071 C C   . HIS B 2 208 ? 102.284 56.645 109.226 1.00 75.28  ? 246  HIS B C   1 
ATOM   3072 O O   . HIS B 2 208 ? 102.898 56.120 108.309 1.00 74.03  ? 246  HIS B O   1 
ATOM   3073 C CB  . HIS B 2 208 ? 100.174 57.941 108.892 1.00 72.68  ? 246  HIS B CB  1 
ATOM   3074 C CG  . HIS B 2 208 ? 99.536  59.262 108.564 1.00 76.75  ? 246  HIS B CG  1 
ATOM   3075 N ND1 . HIS B 2 208 ? 99.558  59.808 107.298 1.00 78.55  ? 246  HIS B ND1 1 
ATOM   3076 C CD2 . HIS B 2 208 ? 98.847  60.138 109.336 1.00 78.62  ? 246  HIS B CD2 1 
ATOM   3077 C CE1 . HIS B 2 208 ? 98.917  60.965 107.305 1.00 77.82  ? 246  HIS B CE1 1 
ATOM   3078 N NE2 . HIS B 2 208 ? 98.476  61.188 108.530 1.00 78.13  ? 246  HIS B NE2 1 
ATOM   3079 N N   . SER B 2 209 ? 102.170 56.103 110.430 1.00 74.37  ? 247  SER B N   1 
ATOM   3080 C CA  . SER B 2 209 ? 102.752 54.795 110.711 1.00 74.73  ? 247  SER B CA  1 
ATOM   3081 C C   . SER B 2 209 ? 101.761 53.624 110.750 1.00 76.32  ? 247  SER B C   1 
ATOM   3082 O O   . SER B 2 209 ? 100.655 53.709 111.322 1.00 74.38  ? 247  SER B O   1 
ATOM   3083 C CB  . SER B 2 209 ? 103.683 54.830 111.945 1.00 79.26  ? 247  SER B CB  1 
ATOM   3084 O OG  . SER B 2 209 ? 105.047 54.634 111.576 1.00 85.58  ? 247  SER B OG  1 
ATOM   3085 N N   . PRO B 2 210 ? 102.148 52.517 110.104 1.00 72.89  ? 248  PRO B N   1 
ATOM   3086 C CA  . PRO B 2 210 ? 101.334 51.306 110.024 1.00 73.10  ? 248  PRO B CA  1 
ATOM   3087 C C   . PRO B 2 210 ? 101.183 50.613 111.365 1.00 77.86  ? 248  PRO B C   1 
ATOM   3088 O O   . PRO B 2 210 ? 102.168 50.195 111.978 1.00 77.96  ? 248  PRO B O   1 
ATOM   3089 C CB  . PRO B 2 210 ? 102.120 50.403 109.056 1.00 74.52  ? 248  PRO B CB  1 
ATOM   3090 C CG  . PRO B 2 210 ? 103.394 51.155 108.709 1.00 78.50  ? 248  PRO B CG  1 
ATOM   3091 C CD  . PRO B 2 210 ? 103.126 52.592 109.006 1.00 74.02  ? 248  PRO B CD  1 
ATOM   3092 N N   . THR B 2 211 ? 99.939  50.460 111.793 1.00 74.18  ? 249  THR B N   1 
ATOM   3093 C CA  . THR B 2 211 ? 99.657  49.717 113.000 1.00 74.14  ? 249  THR B CA  1 
ATOM   3094 C C   . THR B 2 211 ? 99.916  48.255 112.648 1.00 76.54  ? 249  THR B C   1 
ATOM   3095 O O   . THR B 2 211 ? 100.130 47.431 113.531 1.00 76.51  ? 249  THR B O   1 
ATOM   3096 C CB  . THR B 2 211 ? 98.205  49.959 113.530 1.00 85.47  ? 249  THR B CB  1 
ATOM   3097 O OG1 . THR B 2 211 ? 97.306  48.976 112.992 1.00 85.14  ? 249  THR B OG1 1 
ATOM   3098 C CG2 . THR B 2 211 ? 97.713  51.375 113.171 1.00 83.54  ? 249  THR B CG2 1 
ATOM   3099 N N   . PHE B 2 212 ? 99.933  47.961 111.344 1.00 71.00  ? 250  PHE B N   1 
ATOM   3100 C CA  . PHE B 2 212 ? 100.196 46.608 110.822 1.00 70.07  ? 250  PHE B CA  1 
ATOM   3101 C C   . PHE B 2 212 ? 101.029 46.684 109.522 1.00 71.92  ? 250  PHE B C   1 
ATOM   3102 O O   . PHE B 2 212 ? 100.955 47.666 108.769 1.00 71.74  ? 250  PHE B O   1 
ATOM   3103 C CB  . PHE B 2 212 ? 98.882  45.818 110.594 1.00 71.72  ? 250  PHE B CB  1 
ATOM   3104 C CG  . PHE B 2 212 ? 99.091  44.438 110.018 1.00 73.27  ? 250  PHE B CG  1 
ATOM   3105 C CD1 . PHE B 2 212 ? 99.447  44.269 108.689 1.00 76.66  ? 250  PHE B CD1 1 
ATOM   3106 C CD2 . PHE B 2 212 ? 98.965  43.315 110.802 1.00 74.51  ? 250  PHE B CD2 1 
ATOM   3107 C CE1 . PHE B 2 212 ? 99.677  43.006 108.163 1.00 77.11  ? 250  PHE B CE1 1 
ATOM   3108 C CE2 . PHE B 2 212 ? 99.178  42.056 110.272 1.00 77.31  ? 250  PHE B CE2 1 
ATOM   3109 C CZ  . PHE B 2 212 ? 99.545  41.904 108.957 1.00 75.53  ? 250  PHE B CZ  1 
ATOM   3110 N N   . CYS B 2 213 ? 101.832 45.660 109.271 1.00 66.60  ? 251  CYS B N   1 
ATOM   3111 C CA  . CYS B 2 213 ? 102.682 45.664 108.106 1.00 67.46  ? 251  CYS B CA  1 
ATOM   3112 C C   . CYS B 2 213 ? 103.406 44.344 107.980 1.00 73.02  ? 251  CYS B C   1 
ATOM   3113 O O   . CYS B 2 213 ? 104.241 44.027 108.813 1.00 73.70  ? 251  CYS B O   1 
ATOM   3114 C CB  . CYS B 2 213 ? 103.708 46.787 108.222 1.00 68.62  ? 251  CYS B CB  1 
ATOM   3115 S SG  . CYS B 2 213 ? 104.557 47.175 106.663 1.00 73.33  ? 251  CYS B SG  1 
ATOM   3116 N N   . GLN B 2 214 ? 103.115 43.579 106.933 1.00 70.50  ? 252  GLN B N   1 
ATOM   3117 C CA  . GLN B 2 214 ? 103.744 42.269 106.792 1.00 71.40  ? 252  GLN B CA  1 
ATOM   3118 C C   . GLN B 2 214 ? 103.859 41.809 105.346 1.00 75.33  ? 252  GLN B C   1 
ATOM   3119 O O   . GLN B 2 214 ? 103.115 42.282 104.491 1.00 75.65  ? 252  GLN B O   1 
ATOM   3120 C CB  . GLN B 2 214 ? 102.917 41.237 107.561 1.00 73.02  ? 252  GLN B CB  1 
ATOM   3121 C CG  . GLN B 2 214 ? 103.660 40.514 108.661 1.00 91.28  ? 252  GLN B CG  1 
ATOM   3122 C CD  . GLN B 2 214 ? 102.725 40.104 109.770 1.00 108.03 ? 252  GLN B CD  1 
ATOM   3123 O OE1 . GLN B 2 214 ? 102.515 40.858 110.730 1.00 102.94 ? 252  GLN B OE1 1 
ATOM   3124 N NE2 . GLN B 2 214 ? 102.075 38.953 109.598 1.00 94.51  ? 252  GLN B NE2 1 
ATOM   3125 N N   . LEU B 2 215 ? 104.750 40.852 105.092 1.00 70.76  ? 253  LEU B N   1 
ATOM   3126 C CA  . LEU B 2 215 ? 104.909 40.292 103.754 1.00 70.75  ? 253  LEU B CA  1 
ATOM   3127 C C   . LEU B 2 215 ? 103.963 39.111 103.611 1.00 79.11  ? 253  LEU B C   1 
ATOM   3128 O O   . LEU B 2 215 ? 103.500 38.549 104.608 1.00 79.56  ? 253  LEU B O   1 
ATOM   3129 C CB  . LEU B 2 215 ? 106.334 39.782 103.510 1.00 70.07  ? 253  LEU B CB  1 
ATOM   3130 C CG  . LEU B 2 215 ? 107.323 40.690 102.781 1.00 74.89  ? 253  LEU B CG  1 
ATOM   3131 C CD1 . LEU B 2 215 ? 107.987 41.634 103.766 1.00 75.63  ? 253  LEU B CD1 1 
ATOM   3132 C CD2 . LEU B 2 215 ? 108.381 39.870 102.072 1.00 76.44  ? 253  LEU B CD2 1 
ATOM   3133 N N   . ALA B 2 216 ? 103.716 38.723 102.361 1.00 77.32  ? 254  ALA B N   1 
ATOM   3134 C CA  . ALA B 2 216 ? 102.869 37.591 102.041 1.00 77.13  ? 254  ALA B CA  1 
ATOM   3135 C C   . ALA B 2 216 ? 103.747 36.355 101.950 1.00 83.39  ? 254  ALA B C   1 
ATOM   3136 O O   . ALA B 2 216 ? 104.447 36.122 100.959 1.00 81.28  ? 254  ALA B O   1 
ATOM   3137 C CB  . ALA B 2 216 ? 102.133 37.824 100.736 1.00 77.62  ? 254  ALA B CB  1 
ATOM   3138 N N   . CYS B 2 217 ? 103.742 35.594 103.031 1.00 84.11  ? 255  CYS B N   1 
ATOM   3139 C CA  . CYS B 2 217 ? 104.508 34.374 103.090 1.00 86.15  ? 255  CYS B CA  1 
ATOM   3140 C C   . CYS B 2 217 ? 103.516 33.228 102.940 1.00 91.29  ? 255  CYS B C   1 
ATOM   3141 O O   . CYS B 2 217 ? 102.520 33.162 103.660 1.00 90.72  ? 255  CYS B O   1 
ATOM   3142 C CB  . CYS B 2 217 ? 105.255 34.283 104.432 1.00 87.48  ? 255  CYS B CB  1 
ATOM   3143 S SG  . CYS B 2 217 ? 106.849 33.392 104.382 1.00 91.81  ? 255  CYS B SG  1 
ATOM   3144 N N   . GLY B 2 218 ? 103.772 32.346 101.984 1.00 89.62  ? 256  GLY B N   1 
ATOM   3145 C CA  . GLY B 2 218 ? 102.907 31.207 101.750 1.00 91.23  ? 256  GLY B CA  1 
ATOM   3146 C C   . GLY B 2 218 ? 103.120 30.050 102.717 1.00 99.38  ? 256  GLY B C   1 
ATOM   3147 O O   . GLY B 2 218 ? 104.014 30.074 103.580 1.00 99.26  ? 256  GLY B O   1 
ATOM   3148 N N   . GLN B 2 219 ? 102.275 29.031 102.585 1.00 98.18  ? 257  GLN B N   1 
ATOM   3149 C CA  . GLN B 2 219 ? 102.381 27.846 103.431 1.00 98.50  ? 257  GLN B CA  1 
ATOM   3150 C C   . GLN B 2 219 ? 103.137 26.798 102.634 1.00 102.79 ? 257  GLN B C   1 
ATOM   3151 O O   . GLN B 2 219 ? 102.784 25.621 102.616 1.00 102.28 ? 257  GLN B O   1 
ATOM   3152 C CB  . GLN B 2 219 ? 101.002 27.347 103.885 1.00 99.77  ? 257  GLN B CB  1 
ATOM   3153 C CG  . GLN B 2 219 ? 100.553 27.932 105.235 1.00 113.48 ? 257  GLN B CG  1 
ATOM   3154 C CD  . GLN B 2 219 ? 101.719 28.215 106.200 1.00 134.26 ? 257  GLN B CD  1 
ATOM   3155 O OE1 . GLN B 2 219 ? 102.550 29.106 105.964 1.00 128.27 ? 257  GLN B OE1 1 
ATOM   3156 N NE2 . GLN B 2 219 ? 101.757 27.479 107.312 1.00 124.24 ? 257  GLN B NE2 1 
ATOM   3157 N N   . ASP B 2 220 ? 104.179 27.275 101.959 1.00 99.68  ? 258  ASP B N   1 
ATOM   3158 C CA  . ASP B 2 220 ? 105.040 26.439 101.140 1.00 99.23  ? 258  ASP B CA  1 
ATOM   3159 C C   . ASP B 2 220 ? 106.533 26.409 101.558 1.00 101.77 ? 258  ASP B C   1 
ATOM   3160 O O   . ASP B 2 220 ? 107.249 25.506 101.129 1.00 101.57 ? 258  ASP B O   1 
ATOM   3161 C CB  . ASP B 2 220 ? 104.874 26.741 99.630  1.00 101.10 ? 258  ASP B CB  1 
ATOM   3162 C CG  . ASP B 2 220 ? 103.524 27.392 99.290  1.00 109.70 ? 258  ASP B CG  1 
ATOM   3163 O OD1 . ASP B 2 220 ? 102.945 27.069 98.225  1.00 109.07 ? 258  ASP B OD1 1 
ATOM   3164 O OD2 . ASP B 2 220 ? 103.065 28.265 100.059 1.00 115.61 ? 258  ASP B OD2 1 
ATOM   3165 N N   . GLY B 2 221 ? 107.027 27.300 102.425 1.00 96.63  ? 259  GLY B N   1 
ATOM   3166 C CA  . GLY B 2 221 ? 106.425 28.490 102.992 1.00 95.34  ? 259  GLY B CA  1 
ATOM   3167 C C   . GLY B 2 221 ? 107.002 29.636 102.181 1.00 97.05  ? 259  GLY B C   1 
ATOM   3168 O O   . GLY B 2 221 ? 107.846 30.408 102.649 1.00 96.26  ? 259  GLY B O   1 
ATOM   3169 N N   . GLN B 2 222 ? 106.554 29.680 100.925 1.00 92.01  ? 260  GLN B N   1 
ATOM   3170 C CA  . GLN B 2 222 ? 106.967 30.651 99.908  1.00 90.67  ? 260  GLN B CA  1 
ATOM   3171 C C   . GLN B 2 222 ? 106.690 32.118 100.225 1.00 91.07  ? 260  GLN B C   1 
ATOM   3172 O O   . GLN B 2 222 ? 106.231 32.475 101.317 1.00 90.83  ? 260  GLN B O   1 
ATOM   3173 C CB  . GLN B 2 222 ? 106.306 30.310 98.565  1.00 92.01  ? 260  GLN B CB  1 
ATOM   3174 C CG  . GLN B 2 222 ? 106.535 28.875 98.091  1.00 107.60 ? 260  GLN B CG  1 
ATOM   3175 C CD  . GLN B 2 222 ? 108.011 28.501 98.045  1.00 127.26 ? 260  GLN B CD  1 
ATOM   3176 O OE1 . GLN B 2 222 ? 108.590 28.338 96.967  1.00 119.48 ? 260  GLN B OE1 1 
ATOM   3177 N NE2 . GLN B 2 222 ? 108.628 28.371 99.220  1.00 121.78 ? 260  GLN B NE2 1 
ATOM   3178 N N   . LEU B 2 223 ? 107.002 32.963 99.248  1.00 84.22  ? 261  LEU B N   1 
ATOM   3179 C CA  . LEU B 2 223 ? 106.773 34.401 99.356  1.00 82.37  ? 261  LEU B CA  1 
ATOM   3180 C C   . LEU B 2 223 ? 105.901 34.790 98.163  1.00 84.00  ? 261  LEU B C   1 
ATOM   3181 O O   . LEU B 2 223 ? 106.189 34.433 97.004  1.00 83.56  ? 261  LEU B O   1 
ATOM   3182 C CB  . LEU B 2 223 ? 108.102 35.191 99.362  1.00 81.73  ? 261  LEU B CB  1 
ATOM   3183 C CG  . LEU B 2 223 ? 108.815 35.591 100.677 1.00 84.44  ? 261  LEU B CG  1 
ATOM   3184 C CD1 . LEU B 2 223 ? 110.146 36.272 100.408 1.00 84.06  ? 261  LEU B CD1 1 
ATOM   3185 C CD2 . LEU B 2 223 ? 107.958 36.491 101.540 1.00 84.78  ? 261  LEU B CD2 1 
ATOM   3186 N N   . LYS B 2 224 ? 104.781 35.434 98.468  1.00 77.54  ? 262  LYS B N   1 
ATOM   3187 C CA  . LYS B 2 224 ? 103.841 35.871 97.443  1.00 75.46  ? 262  LYS B CA  1 
ATOM   3188 C C   . LYS B 2 224 ? 104.117 37.345 97.243  1.00 77.04  ? 262  LYS B C   1 
ATOM   3189 O O   . LYS B 2 224 ? 104.101 38.128 98.202  1.00 79.27  ? 262  LYS B O   1 
ATOM   3190 C CB  . LYS B 2 224 ? 102.416 35.661 97.937  1.00 76.94  ? 262  LYS B CB  1 
ATOM   3191 C CG  . LYS B 2 224 ? 102.203 34.297 98.578  1.00 77.06  ? 262  LYS B CG  1 
ATOM   3192 C CD  . LYS B 2 224 ? 102.875 33.186 97.765  1.00 77.87  ? 262  LYS B CD  1 
ATOM   3193 C CE  . LYS B 2 224 ? 102.758 31.820 98.445  1.00 77.00  ? 262  LYS B CE  1 
ATOM   3194 N NZ  . LYS B 2 224 ? 102.910 30.692 97.474  1.00 82.07  ? 262  LYS B NZ  1 
ATOM   3195 N N   . GLY B 2 225 ? 104.471 37.713 96.022  1.00 68.62  ? 263  GLY B N   1 
ATOM   3196 C CA  . GLY B 2 225 ? 104.845 39.084 95.701  1.00 65.99  ? 263  GLY B CA  1 
ATOM   3197 C C   . GLY B 2 225 ? 103.983 40.227 96.200  1.00 63.74  ? 263  GLY B C   1 
ATOM   3198 O O   . GLY B 2 225 ? 103.636 41.114 95.420  1.00 64.26  ? 263  GLY B O   1 
ATOM   3199 N N   . PHE B 2 226 ? 103.671 40.240 97.489  1.00 55.83  ? 264  PHE B N   1 
ATOM   3200 C CA  . PHE B 2 226 ? 102.891 41.325 98.048  1.00 54.67  ? 264  PHE B CA  1 
ATOM   3201 C C   . PHE B 2 226 ? 102.954 41.483 99.560  1.00 58.36  ? 264  PHE B C   1 
ATOM   3202 O O   . PHE B 2 226 ? 103.591 40.697 100.239 1.00 58.33  ? 264  PHE B O   1 
ATOM   3203 C CB  . PHE B 2 226 ? 101.460 41.315 97.528  1.00 55.78  ? 264  PHE B CB  1 
ATOM   3204 C CG  . PHE B 2 226 ? 100.577 40.292 98.172  1.00 56.01  ? 264  PHE B CG  1 
ATOM   3205 C CD1 . PHE B 2 226 ? 99.733  40.647 99.201  1.00 57.89  ? 264  PHE B CD1 1 
ATOM   3206 C CD2 . PHE B 2 226 ? 100.496 39.007 97.660  1.00 57.35  ? 264  PHE B CD2 1 
ATOM   3207 C CE1 . PHE B 2 226 ? 98.879  39.723 99.765  1.00 57.96  ? 264  PHE B CE1 1 
ATOM   3208 C CE2 . PHE B 2 226 ? 99.654  38.073 98.226  1.00 59.10  ? 264  PHE B CE2 1 
ATOM   3209 C CZ  . PHE B 2 226 ? 98.846  38.438 99.282  1.00 57.04  ? 264  PHE B CZ  1 
ATOM   3210 N N   . ALA B 2 227 ? 102.317 42.534 100.065 1.00 55.19  ? 265  ALA B N   1 
ATOM   3211 C CA  . ALA B 2 227 ? 102.307 42.845 101.479 1.00 55.62  ? 265  ALA B CA  1 
ATOM   3212 C C   . ALA B 2 227 ? 101.021 43.547 101.821 1.00 61.13  ? 265  ALA B C   1 
ATOM   3213 O O   . ALA B 2 227 ? 100.468 44.235 100.981 1.00 60.21  ? 265  ALA B O   1 
ATOM   3214 C CB  . ALA B 2 227 ? 103.461 43.763 101.803 1.00 56.43  ? 265  ALA B CB  1 
ATOM   3215 N N   . VAL B 2 228 ? 100.616 43.456 103.087 1.00 60.03  ? 266  VAL B N   1 
ATOM   3216 C CA  . VAL B 2 228 ? 99.410  44.128 103.588 1.00 60.56  ? 266  VAL B CA  1 
ATOM   3217 C C   . VAL B 2 228 ? 99.689  45.094 104.779 1.00 63.72  ? 266  VAL B C   1 
ATOM   3218 O O   . VAL B 2 228 ? 100.459 44.760 105.664 1.00 64.11  ? 266  VAL B O   1 
ATOM   3219 C CB  . VAL B 2 228 ? 98.313  43.084 103.886 1.00 64.31  ? 266  VAL B CB  1 
ATOM   3220 C CG1 . VAL B 2 228 ? 97.075  43.726 104.473 1.00 63.55  ? 266  VAL B CG1 1 
ATOM   3221 C CG2 . VAL B 2 228 ? 97.983  42.304 102.605 1.00 64.31  ? 266  VAL B CG2 1 
ATOM   3222 N N   . LEU B 2 229 ? 99.103  46.297 104.760 1.00 59.19  ? 267  LEU B N   1 
ATOM   3223 C CA  . LEU B 2 229 ? 99.289  47.301 105.810 1.00 59.31  ? 267  LEU B CA  1 
ATOM   3224 C C   . LEU B 2 229 ? 97.987  47.799 106.422 1.00 67.06  ? 267  LEU B C   1 
ATOM   3225 O O   . LEU B 2 229 ? 96.979  47.934 105.728 1.00 67.26  ? 267  LEU B O   1 
ATOM   3226 C CB  . LEU B 2 229 ? 99.949  48.546 105.237 1.00 58.82  ? 267  LEU B CB  1 
ATOM   3227 C CG  . LEU B 2 229 ? 101.347 48.488 104.641 1.00 62.97  ? 267  LEU B CG  1 
ATOM   3228 C CD1 . LEU B 2 229 ? 102.302 49.337 105.457 1.00 63.40  ? 267  LEU B CD1 1 
ATOM   3229 C CD2 . LEU B 2 229 ? 101.837 47.076 104.503 1.00 63.05  ? 267  LEU B CD2 1 
ATOM   3230 N N   . GLU B 2 230 ? 98.059  48.226 107.680 1.00 64.55  ? 268  GLU B N   1 
ATOM   3231 C CA  . GLU B 2 230 ? 96.911  48.821 108.350 1.00 65.49  ? 268  GLU B CA  1 
ATOM   3232 C C   . GLU B 2 230 ? 97.300  50.180 108.955 1.00 74.25  ? 268  GLU B C   1 
ATOM   3233 O O   . GLU B 2 230 ? 98.469  50.455 109.195 1.00 75.33  ? 268  GLU B O   1 
ATOM   3234 C CB  . GLU B 2 230 ? 96.340  47.882 109.425 1.00 66.79  ? 268  GLU B CB  1 
ATOM   3235 C CG  . GLU B 2 230 ? 95.142  48.464 110.167 1.00 76.46  ? 268  GLU B CG  1 
ATOM   3236 C CD  . GLU B 2 230 ? 94.175  47.412 110.676 1.00 86.59  ? 268  GLU B CD  1 
ATOM   3237 O OE1 . GLU B 2 230 ? 93.063  47.804 111.109 1.00 71.42  ? 268  GLU B OE1 1 
ATOM   3238 O OE2 . GLU B 2 230 ? 94.544  46.212 110.693 1.00 70.14  ? 268  GLU B OE2 1 
ATOM   3239 N N   . TYR B 2 231 ? 96.323  51.049 109.151 1.00 73.42  ? 269  TYR B N   1 
ATOM   3240 C CA  . TYR B 2 231 ? 96.571  52.359 109.711 1.00 75.03  ? 269  TYR B CA  1 
ATOM   3241 C C   . TYR B 2 231 ? 95.408  52.672 110.660 1.00 83.57  ? 269  TYR B C   1 
ATOM   3242 O O   . TYR B 2 231 ? 94.303  52.131 110.514 1.00 83.06  ? 269  TYR B O   1 
ATOM   3243 C CB  . TYR B 2 231 ? 96.700  53.416 108.601 1.00 76.39  ? 269  TYR B CB  1 
ATOM   3244 C CG  . TYR B 2 231 ? 97.914  53.223 107.705 1.00 77.88  ? 269  TYR B CG  1 
ATOM   3245 C CD1 . TYR B 2 231 ? 97.917  52.250 106.720 1.00 80.03  ? 269  TYR B CD1 1 
ATOM   3246 C CD2 . TYR B 2 231 ? 99.040  54.027 107.822 1.00 78.06  ? 269  TYR B CD2 1 
ATOM   3247 C CE1 . TYR B 2 231 ? 99.017  52.043 105.903 1.00 79.55  ? 269  TYR B CE1 1 
ATOM   3248 C CE2 . TYR B 2 231 ? 100.146 53.835 106.995 1.00 78.45  ? 269  TYR B CE2 1 
ATOM   3249 C CZ  . TYR B 2 231 ? 100.124 52.830 106.040 1.00 83.32  ? 269  TYR B CZ  1 
ATOM   3250 O OH  . TYR B 2 231 ? 101.202 52.577 105.218 1.00 80.05  ? 269  TYR B OH  1 
ATOM   3251 N N   . GLU B 2 232 ? 95.681  53.497 111.666 1.00 82.60  ? 270  GLU B N   1 
ATOM   3252 C CA  . GLU B 2 232 ? 94.697  53.820 112.687 1.00 83.17  ? 270  GLU B CA  1 
ATOM   3253 C C   . GLU B 2 232 ? 93.384  54.379 112.161 1.00 85.90  ? 270  GLU B C   1 
ATOM   3254 O O   . GLU B 2 232 ? 92.317  54.091 112.695 1.00 85.31  ? 270  GLU B O   1 
ATOM   3255 C CB  . GLU B 2 232 ? 95.300  54.731 113.757 1.00 85.15  ? 270  GLU B CB  1 
ATOM   3256 C CG  . GLU B 2 232 ? 96.714  54.323 114.193 1.00 102.32 ? 270  GLU B CG  1 
ATOM   3257 C CD  . GLU B 2 232 ? 97.476  55.454 114.882 1.00 126.91 ? 270  GLU B CD  1 
ATOM   3258 O OE1 . GLU B 2 232 ? 96.880  56.109 115.770 1.00 122.28 ? 270  GLU B OE1 1 
ATOM   3259 O OE2 . GLU B 2 232 ? 98.665  55.679 114.535 1.00 115.04 ? 270  GLU B OE2 1 
ATOM   3260 N N   . THR B 2 233 ? 93.455  55.198 111.127 1.00 82.04  ? 271  THR B N   1 
ATOM   3261 C CA  . THR B 2 233 ? 92.241  55.755 110.572 1.00 81.93  ? 271  THR B CA  1 
ATOM   3262 C C   . THR B 2 233 ? 92.212  55.545 109.083 1.00 87.02  ? 271  THR B C   1 
ATOM   3263 O O   . THR B 2 233 ? 93.248  55.286 108.451 1.00 86.39  ? 271  THR B O   1 
ATOM   3264 C CB  . THR B 2 233 ? 92.074  57.244 110.921 1.00 88.59  ? 271  THR B CB  1 
ATOM   3265 O OG1 . THR B 2 233 ? 92.180  58.047 109.733 1.00 84.67  ? 271  THR B OG1 1 
ATOM   3266 C CG2 . THR B 2 233 ? 93.125  57.669 111.915 1.00 86.98  ? 271  THR B CG2 1 
ATOM   3267 N N   . ALA B 2 234 ? 91.015  55.680 108.525 1.00 83.70  ? 272  ALA B N   1 
ATOM   3268 C CA  . ALA B 2 234 ? 90.821  55.541 107.092 1.00 82.78  ? 272  ALA B CA  1 
ATOM   3269 C C   . ALA B 2 234 ? 91.533  56.698 106.396 1.00 86.84  ? 272  ALA B C   1 
ATOM   3270 O O   . ALA B 2 234 ? 91.957  56.576 105.236 1.00 87.97  ? 272  ALA B O   1 
ATOM   3271 C CB  . ALA B 2 234 ? 89.331  55.535 106.765 1.00 83.13  ? 272  ALA B CB  1 
ATOM   3272 N N   . GLU B 2 235 ? 91.682  57.808 107.128 1.00 81.51  ? 273  GLU B N   1 
ATOM   3273 C CA  . GLU B 2 235 ? 92.338  59.018 106.623 1.00 80.08  ? 273  GLU B CA  1 
ATOM   3274 C C   . GLU B 2 235 ? 93.860  58.831 106.541 1.00 78.93  ? 273  GLU B C   1 
ATOM   3275 O O   . GLU B 2 235 ? 94.509  59.253 105.585 1.00 76.59  ? 273  GLU B O   1 
ATOM   3276 C CB  . GLU B 2 235 ? 91.968  60.218 107.500 1.00 81.73  ? 273  GLU B CB  1 
ATOM   3277 C CG  . GLU B 2 235 ? 91.917  61.552 106.758 1.00 97.17  ? 273  GLU B CG  1 
ATOM   3278 C CD  . GLU B 2 235 ? 92.318  62.736 107.643 1.00 133.44 ? 273  GLU B CD  1 
ATOM   3279 O OE1 . GLU B 2 235 ? 91.575  63.029 108.608 1.00 137.04 ? 273  GLU B OE1 1 
ATOM   3280 O OE2 . GLU B 2 235 ? 93.375  63.366 107.381 1.00 130.47 ? 273  GLU B OE2 1 
ATOM   3281 N N   . MET B 2 236 ? 94.411  58.137 107.523 1.00 74.37  ? 274  MET B N   1 
ATOM   3282 C CA  . MET B 2 236 ? 95.834  57.857 107.538 1.00 74.12  ? 274  MET B CA  1 
ATOM   3283 C C   . MET B 2 236 ? 96.222  56.892 106.418 1.00 74.26  ? 274  MET B C   1 
ATOM   3284 O O   . MET B 2 236 ? 97.327  56.988 105.852 1.00 75.50  ? 274  MET B O   1 
ATOM   3285 C CB  . MET B 2 236 ? 96.246  57.286 108.893 1.00 77.09  ? 274  MET B CB  1 
ATOM   3286 C CG  . MET B 2 236 ? 96.064  58.239 110.072 1.00 80.86  ? 274  MET B CG  1 
ATOM   3287 S SD  . MET B 2 236 ? 96.389  57.371 111.613 1.00 85.30  ? 274  MET B SD  1 
ATOM   3288 C CE  . MET B 2 236 ? 98.063  56.547 111.248 1.00 82.13  ? 274  MET B CE  1 
ATOM   3289 N N   . ALA B 2 237 ? 95.328  55.946 106.121 1.00 65.27  ? 275  ALA B N   1 
ATOM   3290 C CA  . ALA B 2 237 ? 95.552  54.992 105.033 1.00 61.72  ? 275  ALA B CA  1 
ATOM   3291 C C   . ALA B 2 237 ? 95.461  55.781 103.728 1.00 59.18  ? 275  ALA B C   1 
ATOM   3292 O O   . ALA B 2 237 ? 96.324  55.683 102.851 1.00 57.23  ? 275  ALA B O   1 
ATOM   3293 C CB  . ALA B 2 237 ? 94.489  53.909 105.058 1.00 62.30  ? 275  ALA B CB  1 
ATOM   3294 N N   . GLU B 2 238 ? 94.423  56.598 103.624 1.00 53.59  ? 276  GLU B N   1 
ATOM   3295 C CA  . GLU B 2 238 ? 94.228  57.387 102.423 1.00 53.99  ? 276  GLU B CA  1 
ATOM   3296 C C   . GLU B 2 238 ? 95.496  58.143 101.999 1.00 61.59  ? 276  GLU B C   1 
ATOM   3297 O O   . GLU B 2 238 ? 96.041  57.914 100.928 1.00 62.10  ? 276  GLU B O   1 
ATOM   3298 C CB  . GLU B 2 238 ? 92.993  58.304 102.551 1.00 54.98  ? 276  GLU B CB  1 
ATOM   3299 C CG  . GLU B 2 238 ? 92.683  59.051 101.241 1.00 64.17  ? 276  GLU B CG  1 
ATOM   3300 C CD  . GLU B 2 238 ? 91.299  59.719 101.165 1.00 79.62  ? 276  GLU B CD  1 
ATOM   3301 O OE1 . GLU B 2 238 ? 90.438  59.535 102.065 1.00 69.09  ? 276  GLU B OE1 1 
ATOM   3302 O OE2 . GLU B 2 238 ? 91.082  60.457 100.173 1.00 71.30  ? 276  GLU B OE2 1 
ATOM   3303 N N   . GLU B 2 239 ? 96.020  58.966 102.901 1.00 61.51  ? 277  GLU B N   1 
ATOM   3304 C CA  . GLU B 2 239 ? 97.229  59.754 102.658 1.00 61.05  ? 277  GLU B CA  1 
ATOM   3305 C C   . GLU B 2 239 ? 98.441  58.868 102.361 1.00 61.74  ? 277  GLU B C   1 
ATOM   3306 O O   . GLU B 2 239 ? 99.212  59.124 101.436 1.00 60.97  ? 277  GLU B O   1 
ATOM   3307 C CB  . GLU B 2 239 ? 97.481  60.705 103.842 1.00 62.83  ? 277  GLU B CB  1 
ATOM   3308 C CG  . GLU B 2 239 ? 96.269  61.633 104.171 1.00 76.68  ? 277  GLU B CG  1 
ATOM   3309 C CD  . GLU B 2 239 ? 96.591  62.815 105.109 1.00 101.33 ? 277  GLU B CD  1 
ATOM   3310 O OE1 . GLU B 2 239 ? 96.464  63.985 104.675 1.00 96.40  ? 277  GLU B OE1 1 
ATOM   3311 O OE2 . GLU B 2 239 ? 96.873  62.578 106.303 1.00 94.78  ? 277  GLU B OE2 1 
ATOM   3312 N N   . ALA B 2 240 ? 98.580  57.798 103.124 1.00 56.75  ? 278  ALA B N   1 
ATOM   3313 C CA  . ALA B 2 240 ? 99.675  56.862 102.904 1.00 56.90  ? 278  ALA B CA  1 
ATOM   3314 C C   . ALA B 2 240 ? 99.694  56.312 101.440 1.00 62.36  ? 278  ALA B C   1 
ATOM   3315 O O   . ALA B 2 240 ? 100.740 56.280 100.765 1.00 61.15  ? 278  ALA B O   1 
ATOM   3316 C CB  . ALA B 2 240 ? 99.556  55.716 103.916 1.00 57.34  ? 278  ALA B CB  1 
ATOM   3317 N N   . GLN B 2 241 ? 98.533  55.858 100.968 1.00 58.62  ? 279  GLN B N   1 
ATOM   3318 C CA  . GLN B 2 241 ? 98.412  55.286 99.636  1.00 57.48  ? 279  GLN B CA  1 
ATOM   3319 C C   . GLN B 2 241 ? 98.761  56.341 98.566  1.00 60.91  ? 279  GLN B C   1 
ATOM   3320 O O   . GLN B 2 241 ? 99.510  56.067 97.588  1.00 58.94  ? 279  GLN B O   1 
ATOM   3321 C CB  . GLN B 2 241 ? 96.984  54.760 99.444  1.00 57.90  ? 279  GLN B CB  1 
ATOM   3322 C CG  . GLN B 2 241 ? 96.787  53.918 98.193  1.00 55.78  ? 279  GLN B CG  1 
ATOM   3323 C CD  . GLN B 2 241 ? 96.548  54.771 96.974  1.00 63.82  ? 279  GLN B CD  1 
ATOM   3324 O OE1 . GLN B 2 241 ? 96.042  55.898 97.076  1.00 64.61  ? 279  GLN B OE1 1 
ATOM   3325 N NE2 . GLN B 2 241 ? 96.986  54.283 95.817  1.00 37.99  ? 279  GLN B NE2 1 
ATOM   3326 N N   . GLN B 2 242 ? 98.218  57.543 98.772  1.00 56.64  ? 280  GLN B N   1 
ATOM   3327 C CA  . GLN B 2 242 ? 98.433  58.673 97.868  1.00 56.87  ? 280  GLN B CA  1 
ATOM   3328 C C   . GLN B 2 242 ? 99.912  58.960 97.608  1.00 59.27  ? 280  GLN B C   1 
ATOM   3329 O O   . GLN B 2 242 ? 100.310 59.236 96.477  1.00 58.82  ? 280  GLN B O   1 
ATOM   3330 C CB  . GLN B 2 242 ? 97.772  59.917 98.459  1.00 58.95  ? 280  GLN B CB  1 
ATOM   3331 C CG  . GLN B 2 242 ? 97.828  61.165 97.578  1.00 90.56  ? 280  GLN B CG  1 
ATOM   3332 C CD  . GLN B 2 242 ? 96.870  62.265 98.063  1.00 120.40 ? 280  GLN B CD  1 
ATOM   3333 O OE1 . GLN B 2 242 ? 96.326  62.193 99.175  1.00 115.22 ? 280  GLN B OE1 1 
ATOM   3334 N NE2 . GLN B 2 242 ? 96.659  63.283 97.226  1.00 113.34 ? 280  GLN B NE2 1 
ATOM   3335 N N   . GLN B 2 243 ? 100.706 58.904 98.677  1.00 54.88  ? 281  GLN B N   1 
ATOM   3336 C CA  . GLN B 2 243 ? 102.140 59.160 98.629  1.00 53.95  ? 281  GLN B CA  1 
ATOM   3337 C C   . GLN B 2 243 ? 102.925 57.920 98.219  1.00 55.80  ? 281  GLN B C   1 
ATOM   3338 O O   . GLN B 2 243 ? 103.882 58.014 97.448  1.00 58.02  ? 281  GLN B O   1 
ATOM   3339 C CB  . GLN B 2 243 ? 102.612 59.649 100.018 1.00 55.65  ? 281  GLN B CB  1 
ATOM   3340 C CG  . GLN B 2 243 ? 104.100 60.038 100.153 1.00 65.94  ? 281  GLN B CG  1 
ATOM   3341 C CD  . GLN B 2 243 ? 105.031 58.841 100.369 1.00 84.28  ? 281  GLN B CD  1 
ATOM   3342 O OE1 . GLN B 2 243 ? 104.665 57.858 101.052 1.00 77.10  ? 281  GLN B OE1 1 
ATOM   3343 N NE2 . GLN B 2 243 ? 106.228 58.895 99.741  1.00 64.24  ? 281  GLN B NE2 1 
ATOM   3344 N N   . ALA B 2 244 ? 102.548 56.763 98.750  1.00 48.03  ? 282  ALA B N   1 
ATOM   3345 C CA  . ALA B 2 244 ? 103.299 55.563 98.473  1.00 47.70  ? 282  ALA B CA  1 
ATOM   3346 C C   . ALA B 2 244 ? 103.240 54.965 97.069  1.00 53.92  ? 282  ALA B C   1 
ATOM   3347 O O   . ALA B 2 244 ? 104.258 54.462 96.570  1.00 53.70  ? 282  ALA B O   1 
ATOM   3348 C CB  . ALA B 2 244 ? 103.016 54.515 99.505  1.00 48.37  ? 282  ALA B CB  1 
ATOM   3349 N N   . ASP B 2 245 ? 102.055 54.977 96.451  1.00 50.78  ? 283  ASP B N   1 
ATOM   3350 C CA  . ASP B 2 245 ? 101.854 54.363 95.128  1.00 49.76  ? 283  ASP B CA  1 
ATOM   3351 C C   . ASP B 2 245 ? 102.823 54.878 94.060  1.00 51.78  ? 283  ASP B C   1 
ATOM   3352 O O   . ASP B 2 245 ? 102.909 56.098 93.855  1.00 52.69  ? 283  ASP B O   1 
ATOM   3353 C CB  . ASP B 2 245 ? 100.379 54.534 94.679  1.00 51.40  ? 283  ASP B CB  1 
ATOM   3354 C CG  . ASP B 2 245 ? 100.092 53.901 93.306  1.00 56.94  ? 283  ASP B CG  1 
ATOM   3355 O OD1 . ASP B 2 245 ? 99.684  54.660 92.415  1.00 59.76  ? 283  ASP B OD1 1 
ATOM   3356 O OD2 . ASP B 2 245 ? 100.321 52.683 93.087  1.00 52.66  ? 283  ASP B OD2 1 
ATOM   3357 N N   . GLY B 2 246 ? 103.523 53.968 93.372  1.00 46.39  ? 284  GLY B N   1 
ATOM   3358 C CA  . GLY B 2 246 ? 104.462 54.321 92.309  1.00 46.94  ? 284  GLY B CA  1 
ATOM   3359 C C   . GLY B 2 246 ? 105.928 54.341 92.725  1.00 56.70  ? 284  GLY B C   1 
ATOM   3360 O O   . GLY B 2 246 ? 106.851 54.131 91.919  1.00 56.19  ? 284  GLY B O   1 
ATOM   3361 N N   . LEU B 2 247 ? 106.135 54.571 94.015  1.00 57.74  ? 285  LEU B N   1 
ATOM   3362 C CA  . LEU B 2 247 ? 107.450 54.644 94.630  1.00 59.80  ? 285  LEU B CA  1 
ATOM   3363 C C   . LEU B 2 247 ? 108.443 53.572 94.220  1.00 65.28  ? 285  LEU B C   1 
ATOM   3364 O O   . LEU B 2 247 ? 108.110 52.358 94.192  1.00 65.27  ? 285  LEU B O   1 
ATOM   3365 C CB  . LEU B 2 247 ? 107.297 54.568 96.143  1.00 61.36  ? 285  LEU B CB  1 
ATOM   3366 C CG  . LEU B 2 247 ? 108.240 55.519 96.895  1.00 68.21  ? 285  LEU B CG  1 
ATOM   3367 C CD1 . LEU B 2 247 ? 107.488 56.707 97.533  1.00 68.51  ? 285  LEU B CD1 1 
ATOM   3368 C CD2 . LEU B 2 247 ? 109.127 54.778 97.914  1.00 70.16  ? 285  LEU B CD2 1 
ATOM   3369 N N   . SER B 2 248 ? 109.694 54.000 93.997  1.00 60.06  ? 286  SER B N   1 
ATOM   3370 C CA  . SER B 2 248 ? 110.735 53.031 93.680  1.00 58.21  ? 286  SER B CA  1 
ATOM   3371 C C   . SER B 2 248 ? 111.239 52.444 94.987  1.00 59.70  ? 286  SER B C   1 
ATOM   3372 O O   . SER B 2 248 ? 111.194 53.084 96.035  1.00 58.11  ? 286  SER B O   1 
ATOM   3373 C CB  . SER B 2 248 ? 111.868 53.597 92.820  1.00 60.72  ? 286  SER B CB  1 
ATOM   3374 O OG  . SER B 2 248 ? 112.598 52.545 92.182  1.00 65.79  ? 286  SER B OG  1 
ATOM   3375 N N   . LEU B 2 249 ? 111.626 51.181 94.915  1.00 55.58  ? 287  LEU B N   1 
ATOM   3376 C CA  . LEU B 2 249 ? 112.067 50.397 96.055  1.00 53.83  ? 287  LEU B CA  1 
ATOM   3377 C C   . LEU B 2 249 ? 112.497 49.065 95.448  1.00 56.45  ? 287  LEU B C   1 
ATOM   3378 O O   . LEU B 2 249 ? 111.734 48.446 94.717  1.00 56.24  ? 287  LEU B O   1 
ATOM   3379 C CB  . LEU B 2 249 ? 110.906 50.187 97.029  1.00 53.21  ? 287  LEU B CB  1 
ATOM   3380 C CG  . LEU B 2 249 ? 111.271 49.267 98.197  1.00 58.47  ? 287  LEU B CG  1 
ATOM   3381 C CD1 . LEU B 2 249 ? 110.900 49.868 99.514  1.00 58.29  ? 287  LEU B CD1 1 
ATOM   3382 C CD2 . LEU B 2 249 ? 110.784 47.807 98.090  1.00 61.21  ? 287  LEU B CD2 1 
ATOM   3383 N N   . GLY B 2 250 ? 113.731 48.657 95.684  1.00 53.46  ? 288  GLY B N   1 
ATOM   3384 C CA  . GLY B 2 250 ? 114.242 47.452 95.056  1.00 54.31  ? 288  GLY B CA  1 
ATOM   3385 C C   . GLY B 2 250 ? 114.474 47.868 93.643  1.00 61.12  ? 288  GLY B C   1 
ATOM   3386 O O   . GLY B 2 250 ? 114.554 49.072 93.355  1.00 63.15  ? 288  GLY B O   1 
ATOM   3387 N N   . GLY B 2 251 ? 114.514 46.934 92.717  1.00 59.64  ? 289  GLY B N   1 
ATOM   3388 C CA  . GLY B 2 251 ? 114.650 47.457 91.362  1.00 61.08  ? 289  GLY B CA  1 
ATOM   3389 C C   . GLY B 2 251 ? 113.335 47.986 90.771  1.00 64.57  ? 289  GLY B C   1 
ATOM   3390 O O   . GLY B 2 251 ? 113.295 48.335 89.593  1.00 64.83  ? 289  GLY B O   1 
ATOM   3391 N N   . SER B 2 252 ? 112.275 48.068 91.588  1.00 59.70  ? 290  SER B N   1 
ATOM   3392 C CA  . SER B 2 252 ? 110.930 48.333 91.096  1.00 58.71  ? 290  SER B CA  1 
ATOM   3393 C C   . SER B 2 252 ? 109.995 49.406 91.654  1.00 58.89  ? 290  SER B C   1 
ATOM   3394 O O   . SER B 2 252 ? 110.107 49.854 92.804  1.00 58.33  ? 290  SER B O   1 
ATOM   3395 C CB  . SER B 2 252 ? 110.157 47.014 91.072  1.00 63.68  ? 290  SER B CB  1 
ATOM   3396 O OG  . SER B 2 252 ? 109.496 46.832 92.305  1.00 73.56  ? 290  SER B OG  1 
ATOM   3397 N N   . HIS B 2 253 ? 108.998 49.735 90.826  1.00 51.10  ? 291  HIS B N   1 
ATOM   3398 C CA  . HIS B 2 253 ? 107.976 50.702 91.185  1.00 49.61  ? 291  HIS B CA  1 
ATOM   3399 C C   . HIS B 2 253 ? 106.831 49.952 91.804  1.00 54.12  ? 291  HIS B C   1 
ATOM   3400 O O   . HIS B 2 253 ? 106.259 49.058 91.200  1.00 55.23  ? 291  HIS B O   1 
ATOM   3401 C CB  . HIS B 2 253 ? 107.480 51.436 89.952  1.00 49.78  ? 291  HIS B CB  1 
ATOM   3402 C CG  . HIS B 2 253 ? 108.530 52.272 89.291  1.00 52.79  ? 291  HIS B CG  1 
ATOM   3403 N ND1 . HIS B 2 253 ? 109.356 51.784 88.295  1.00 54.10  ? 291  HIS B ND1 1 
ATOM   3404 C CD2 . HIS B 2 253 ? 108.926 53.550 89.522  1.00 53.42  ? 291  HIS B CD2 1 
ATOM   3405 C CE1 . HIS B 2 253 ? 110.210 52.728 87.936  1.00 52.76  ? 291  HIS B CE1 1 
ATOM   3406 N NE2 . HIS B 2 253 ? 109.964 53.812 88.660  1.00 52.94  ? 291  HIS B NE2 1 
ATOM   3407 N N   . LEU B 2 254 ? 106.520 50.310 93.031  1.00 49.82  ? 292  LEU B N   1 
ATOM   3408 C CA  . LEU B 2 254 ? 105.485 49.635 93.758  1.00 48.50  ? 292  LEU B CA  1 
ATOM   3409 C C   . LEU B 2 254 ? 104.115 50.133 93.365  1.00 50.77  ? 292  LEU B C   1 
ATOM   3410 O O   . LEU B 2 254 ? 103.946 51.332 93.057  1.00 50.80  ? 292  LEU B O   1 
ATOM   3411 C CB  . LEU B 2 254 ? 105.697 49.868 95.253  1.00 48.21  ? 292  LEU B CB  1 
ATOM   3412 C CG  . LEU B 2 254 ? 106.968 49.139 95.691  1.00 52.44  ? 292  LEU B CG  1 
ATOM   3413 C CD1 . LEU B 2 254 ? 106.970 48.866 97.154  1.00 51.73  ? 292  LEU B CD1 1 
ATOM   3414 C CD2 . LEU B 2 254 ? 107.135 47.847 94.908  1.00 55.43  ? 292  LEU B CD2 1 
ATOM   3415 N N   . ARG B 2 255 ? 103.148 49.201 93.399  1.00 43.73  ? 293  ARG B N   1 
ATOM   3416 C CA  . ARG B 2 255 ? 101.747 49.512 93.227  1.00 41.69  ? 293  ARG B CA  1 
ATOM   3417 C C   . ARG B 2 255 ? 101.146 49.464 94.609  1.00 45.30  ? 293  ARG B C   1 
ATOM   3418 O O   . ARG B 2 255 ? 101.405 48.538 95.372  1.00 46.84  ? 293  ARG B O   1 
ATOM   3419 C CB  . ARG B 2 255 ? 101.046 48.502 92.351  1.00 41.97  ? 293  ARG B CB  1 
ATOM   3420 C CG  . ARG B 2 255 ? 99.612  48.937 92.024  1.00 37.96  ? 293  ARG B CG  1 
ATOM   3421 C CD  . ARG B 2 255 ? 99.047  48.171 90.869  1.00 38.13  ? 293  ARG B CD  1 
ATOM   3422 N NE  . ARG B 2 255 ? 99.414  46.752 90.842  1.00 40.65  ? 293  ARG B NE  1 
ATOM   3423 C CZ  . ARG B 2 255 ? 99.136  45.942 89.825  1.00 60.06  ? 293  ARG B CZ  1 
ATOM   3424 N NH1 . ARG B 2 255 ? 98.439  46.397 88.777  1.00 49.10  ? 293  ARG B NH1 1 
ATOM   3425 N NH2 . ARG B 2 255 ? 99.560  44.687 89.848  1.00 48.86  ? 293  ARG B NH2 1 
ATOM   3426 N N   . VAL B 2 256 ? 100.360 50.469 94.951  1.00 40.60  ? 294  VAL B N   1 
ATOM   3427 C CA  . VAL B 2 256 ? 99.807  50.513 96.279  1.00 40.77  ? 294  VAL B CA  1 
ATOM   3428 C C   . VAL B 2 256 ? 98.301  50.792 96.194  1.00 48.77  ? 294  VAL B C   1 
ATOM   3429 O O   . VAL B 2 256 ? 97.891  51.886 95.789  1.00 48.68  ? 294  VAL B O   1 
ATOM   3430 C CB  . VAL B 2 256 ? 100.568 51.581 97.083  1.00 44.06  ? 294  VAL B CB  1 
ATOM   3431 C CG1 . VAL B 2 256 ? 99.840  51.930 98.419  1.00 43.02  ? 294  VAL B CG1 1 
ATOM   3432 C CG2 . VAL B 2 256 ? 102.065 51.146 97.267  1.00 43.89  ? 294  VAL B CG2 1 
ATOM   3433 N N   . SER B 2 257 ? 97.477  49.797 96.542  1.00 45.79  ? 295  SER B N   1 
ATOM   3434 C CA  . SER B 2 257 ? 96.026  49.963 96.451  1.00 44.40  ? 295  SER B CA  1 
ATOM   3435 C C   . SER B 2 257 ? 95.370  49.676 97.784  1.00 48.79  ? 295  SER B C   1 
ATOM   3436 O O   . SER B 2 257 ? 96.008  49.149 98.666  1.00 50.23  ? 295  SER B O   1 
ATOM   3437 C CB  . SER B 2 257 ? 95.435  49.064 95.351  1.00 46.08  ? 295  SER B CB  1 
ATOM   3438 O OG  . SER B 2 257 ? 96.399  48.591 94.403  1.00 52.28  ? 295  SER B OG  1 
ATOM   3439 N N   . PHE B 2 258 ? 94.113  50.061 97.945  1.00 46.48  ? 296  PHE B N   1 
ATOM   3440 C CA  . PHE B 2 258 ? 93.357  49.771 99.170  1.00 47.86  ? 296  PHE B CA  1 
ATOM   3441 C C   . PHE B 2 258 ? 92.864  48.301 99.202  1.00 54.24  ? 296  PHE B C   1 
ATOM   3442 O O   . PHE B 2 258 ? 92.565  47.695 98.147  1.00 55.52  ? 296  PHE B O   1 
ATOM   3443 C CB  . PHE B 2 258 ? 92.090  50.632 99.240  1.00 49.89  ? 296  PHE B CB  1 
ATOM   3444 C CG  . PHE B 2 258 ? 92.356  52.062 99.497  1.00 52.61  ? 296  PHE B CG  1 
ATOM   3445 C CD1 . PHE B 2 258 ? 92.671  52.918 98.443  1.00 56.66  ? 296  PHE B CD1 1 
ATOM   3446 C CD2 . PHE B 2 258 ? 92.335  52.551 100.807 1.00 55.75  ? 296  PHE B CD2 1 
ATOM   3447 C CE1 . PHE B 2 258 ? 92.952  54.247 98.689  1.00 58.62  ? 296  PHE B CE1 1 
ATOM   3448 C CE2 . PHE B 2 258 ? 92.627  53.868 101.090 1.00 58.68  ? 296  PHE B CE2 1 
ATOM   3449 C CZ  . PHE B 2 258 ? 92.933  54.735 100.039 1.00 57.86  ? 296  PHE B CZ  1 
ATOM   3450 N N   . CYS B 2 259 ? 92.688  47.776 100.410 1.00 48.15  ? 297  CYS B N   1 
ATOM   3451 C CA  . CYS B 2 259 ? 92.124  46.467 100.607 1.00 47.71  ? 297  CYS B CA  1 
ATOM   3452 C C   . CYS B 2 259 ? 90.647  46.728 100.894 1.00 53.76  ? 297  CYS B C   1 
ATOM   3453 O O   . CYS B 2 259 ? 90.264  47.869 101.193 1.00 52.28  ? 297  CYS B O   1 
ATOM   3454 C CB  . CYS B 2 259 ? 92.773  45.823 101.818 1.00 47.84  ? 297  CYS B CB  1 
ATOM   3455 S SG  . CYS B 2 259 ? 94.460  45.400 101.475 1.00 51.98  ? 297  CYS B SG  1 
ATOM   3456 N N   . ALA B 2 260 ? 89.802  45.702 100.814 1.00 50.98  ? 298  ALA B N   1 
ATOM   3457 C CA  . ALA B 2 260 ? 88.399  45.975 101.117 1.00 51.13  ? 298  ALA B CA  1 
ATOM   3458 C C   . ALA B 2 260 ? 88.263  46.355 102.591 1.00 54.37  ? 298  ALA B C   1 
ATOM   3459 O O   . ALA B 2 260 ? 88.888  45.736 103.461 1.00 53.57  ? 298  ALA B O   1 
ATOM   3460 C CB  . ALA B 2 260 ? 87.497  44.786 100.759 1.00 51.85  ? 298  ALA B CB  1 
ATOM   3461 N N   . PRO B 2 261 ? 87.450  47.392 102.892 1.00 50.59  ? 299  PRO B N   1 
ATOM   3462 C CA  . PRO B 2 261 ? 87.333  47.757 104.302 1.00 49.10  ? 299  PRO B CA  1 
ATOM   3463 C C   . PRO B 2 261 ? 86.740  46.618 105.118 1.00 59.84  ? 299  PRO B C   1 
ATOM   3464 O O   . PRO B 2 261 ? 86.039  45.764 104.580 1.00 61.97  ? 299  PRO B O   1 
ATOM   3465 C CB  . PRO B 2 261 ? 86.397  48.941 104.273 1.00 49.17  ? 299  PRO B CB  1 
ATOM   3466 C CG  . PRO B 2 261 ? 85.558  48.738 103.087 1.00 54.60  ? 299  PRO B CG  1 
ATOM   3467 C CD  . PRO B 2 261 ? 86.396  48.028 102.075 1.00 51.73  ? 299  PRO B CD  1 
ATOM   3468 N N   . GLY B 2 262 ? 87.016  46.599 106.420 1.00 58.62  ? 300  GLY B N   1 
ATOM   3469 C CA  . GLY B 2 262 ? 86.465  45.584 107.291 1.00 58.29  ? 300  GLY B CA  1 
ATOM   3470 C C   . GLY B 2 262 ? 87.521  44.888 108.107 1.00 62.44  ? 300  GLY B C   1 
ATOM   3471 O O   . GLY B 2 262 ? 87.923  45.378 109.167 1.00 61.91  ? 300  GLY B O   1 
ATOM   3472 N N   . PRO B 2 263 ? 87.991  43.730 107.616 1.00 58.70  ? 301  PRO B N   1 
ATOM   3473 C CA  . PRO B 2 263 ? 89.027  42.864 108.182 1.00 59.14  ? 301  PRO B CA  1 
ATOM   3474 C C   . PRO B 2 263 ? 90.243  43.663 108.576 1.00 66.03  ? 301  PRO B C   1 
ATOM   3475 O O   . PRO B 2 263 ? 90.538  44.694 107.977 1.00 65.79  ? 301  PRO B O   1 
ATOM   3476 C CB  . PRO B 2 263 ? 89.405  41.963 107.000 1.00 60.52  ? 301  PRO B CB  1 
ATOM   3477 C CG  . PRO B 2 263 ? 88.186  41.918 106.168 1.00 63.61  ? 301  PRO B CG  1 
ATOM   3478 C CD  . PRO B 2 263 ? 87.527  43.255 106.305 1.00 59.33  ? 301  PRO B CD  1 
ATOM   3479 N N   . PRO B 2 264 ? 90.992  43.172 109.568 1.00 65.31  ? 302  PRO B N   1 
ATOM   3480 C CA  . PRO B 2 264 ? 92.196  43.934 109.901 1.00 65.78  ? 302  PRO B CA  1 
ATOM   3481 C C   . PRO B 2 264 ? 93.345  43.256 109.187 1.00 69.55  ? 302  PRO B C   1 
ATOM   3482 O O   . PRO B 2 264 ? 93.133  42.222 108.560 1.00 69.91  ? 302  PRO B O   1 
ATOM   3483 C CB  . PRO B 2 264 ? 92.306  43.786 111.425 1.00 67.48  ? 302  PRO B CB  1 
ATOM   3484 C CG  . PRO B 2 264 ? 90.933  43.414 111.874 1.00 71.43  ? 302  PRO B CG  1 
ATOM   3485 C CD  . PRO B 2 264 ? 90.407  42.545 110.762 1.00 67.29  ? 302  PRO B CD  1 
ATOM   3486 N N   . GLY B 2 265 ? 94.519  43.881 109.210 1.00 65.02  ? 303  GLY B N   1 
ATOM   3487 C CA  . GLY B 2 265 ? 95.705  43.408 108.519 1.00 64.75  ? 303  GLY B CA  1 
ATOM   3488 C C   . GLY B 2 265 ? 95.904  41.915 108.534 1.00 70.54  ? 303  GLY B C   1 
ATOM   3489 O O   . GLY B 2 265 ? 96.119  41.298 107.477 1.00 69.20  ? 303  GLY B O   1 
ATOM   3490 N N   . ARG B 2 266 ? 95.838  41.354 109.745 1.00 69.81  ? 304  ARG B N   1 
ATOM   3491 C CA  . ARG B 2 266 ? 96.001  39.917 110.014 1.00 70.12  ? 304  ARG B CA  1 
ATOM   3492 C C   . ARG B 2 266 ? 95.153  39.065 109.071 1.00 71.90  ? 304  ARG B C   1 
ATOM   3493 O O   . ARG B 2 266 ? 95.661  38.166 108.381 1.00 70.56  ? 304  ARG B O   1 
ATOM   3494 C CB  . ARG B 2 266 ? 95.550  39.634 111.458 1.00 74.24  ? 304  ARG B CB  1 
ATOM   3495 C CG  . ARG B 2 266 ? 96.520  38.808 112.299 1.00 90.99  ? 304  ARG B CG  1 
ATOM   3496 C CD  . ARG B 2 266 ? 97.220  39.669 113.359 1.00 106.63 ? 304  ARG B CD  1 
ATOM   3497 N NE  . ARG B 2 266 ? 97.334  38.995 114.655 1.00 117.85 ? 304  ARG B NE  1 
ATOM   3498 C CZ  . ARG B 2 266 ? 96.598  39.293 115.726 1.00 130.16 ? 304  ARG B CZ  1 
ATOM   3499 N NH1 . ARG B 2 266 ? 96.777  38.624 116.863 1.00 115.70 ? 304  ARG B NH1 1 
ATOM   3500 N NH2 . ARG B 2 266 ? 95.680  40.256 115.660 1.00 114.06 ? 304  ARG B NH2 1 
ATOM   3501 N N   . SER B 2 267 ? 93.848  39.342 109.100 1.00 68.01  ? 305  SER B N   1 
ATOM   3502 C CA  . SER B 2 267 ? 92.830  38.649 108.305 1.00 67.60  ? 305  SER B CA  1 
ATOM   3503 C C   . SER B 2 267 ? 92.958  38.854 106.779 1.00 69.91  ? 305  SER B C   1 
ATOM   3504 O O   . SER B 2 267 ? 93.016  37.876 106.016 1.00 70.14  ? 305  SER B O   1 
ATOM   3505 C CB  . SER B 2 267 ? 91.438  39.054 108.800 1.00 71.92  ? 305  SER B CB  1 
ATOM   3506 O OG  . SER B 2 267 ? 91.529  40.034 109.835 1.00 82.74  ? 305  SER B OG  1 
ATOM   3507 N N   . MET B 2 268 ? 92.984  40.115 106.339 1.00 63.21  ? 306  MET B N   1 
ATOM   3508 C CA  . MET B 2 268 ? 93.167  40.442 104.919 1.00 60.52  ? 306  MET B CA  1 
ATOM   3509 C C   . MET B 2 268 ? 94.352  39.677 104.325 1.00 64.73  ? 306  MET B C   1 
ATOM   3510 O O   . MET B 2 268 ? 94.245  39.060 103.255 1.00 65.27  ? 306  MET B O   1 
ATOM   3511 C CB  . MET B 2 268 ? 93.423  41.935 104.752 1.00 61.38  ? 306  MET B CB  1 
ATOM   3512 C CG  . MET B 2 268 ? 93.095  42.472 103.372 1.00 63.37  ? 306  MET B CG  1 
ATOM   3513 S SD  . MET B 2 268 ? 91.364  42.189 102.895 1.00 66.07  ? 306  MET B SD  1 
ATOM   3514 C CE  . MET B 2 268 ? 91.689  41.017 101.729 1.00 62.77  ? 306  MET B CE  1 
ATOM   3515 N N   . LEU B 2 269 ? 95.489  39.726 105.012 1.00 59.22  ? 307  LEU B N   1 
ATOM   3516 C CA  . LEU B 2 269 ? 96.670  39.026 104.538 1.00 57.99  ? 307  LEU B CA  1 
ATOM   3517 C C   . LEU B 2 269 ? 96.374  37.544 104.247 1.00 62.84  ? 307  LEU B C   1 
ATOM   3518 O O   . LEU B 2 269 ? 96.694  37.035 103.162 1.00 63.38  ? 307  LEU B O   1 
ATOM   3519 C CB  . LEU B 2 269 ? 97.821  39.185 105.541 1.00 57.72  ? 307  LEU B CB  1 
ATOM   3520 C CG  . LEU B 2 269 ? 99.207  39.442 104.939 1.00 61.45  ? 307  LEU B CG  1 
ATOM   3521 C CD1 . LEU B 2 269 ? 100.361 39.230 105.907 1.00 60.77  ? 307  LEU B CD1 1 
ATOM   3522 C CD2 . LEU B 2 269 ? 99.407  38.669 103.664 1.00 62.14  ? 307  LEU B CD2 1 
ATOM   3523 N N   . ALA B 2 270 ? 95.758  36.849 105.205 1.00 58.71  ? 308  ALA B N   1 
ATOM   3524 C CA  . ALA B 2 270 ? 95.471  35.428 105.033 1.00 57.58  ? 308  ALA B CA  1 
ATOM   3525 C C   . ALA B 2 270 ? 94.515  35.310 103.882 1.00 59.20  ? 308  ALA B C   1 
ATOM   3526 O O   . ALA B 2 270 ? 94.784  34.618 102.892 1.00 58.74  ? 308  ALA B O   1 
ATOM   3527 C CB  . ALA B 2 270 ? 94.846  34.885 106.268 1.00 58.73  ? 308  ALA B CB  1 
ATOM   3528 N N   . ALA B 2 271 ? 93.406  36.030 104.024 1.00 55.34  ? 309  ALA B N   1 
ATOM   3529 C CA  . ALA B 2 271 ? 92.353  36.126 103.006 1.00 54.76  ? 309  ALA B CA  1 
ATOM   3530 C C   . ALA B 2 271 ? 92.944  36.244 101.595 1.00 57.66  ? 309  ALA B C   1 
ATOM   3531 O O   . ALA B 2 271 ? 92.694  35.381 100.730 1.00 58.06  ? 309  ALA B O   1 
ATOM   3532 C CB  . ALA B 2 271 ? 91.442  37.311 103.308 1.00 55.15  ? 309  ALA B CB  1 
ATOM   3533 N N   . LEU B 2 272 ? 93.787  37.258 101.391 1.00 50.71  ? 310  LEU B N   1 
ATOM   3534 C CA  . LEU B 2 272 ? 94.427  37.439 100.097 1.00 50.01  ? 310  LEU B CA  1 
ATOM   3535 C C   . LEU B 2 272 ? 95.351  36.267 99.742  1.00 57.50  ? 310  LEU B C   1 
ATOM   3536 O O   . LEU B 2 272 ? 95.319  35.745 98.632  1.00 57.24  ? 310  LEU B O   1 
ATOM   3537 C CB  . LEU B 2 272 ? 95.148  38.794 100.048 1.00 49.55  ? 310  LEU B CB  1 
ATOM   3538 C CG  . LEU B 2 272 ? 94.251  40.042 100.181 1.00 50.36  ? 310  LEU B CG  1 
ATOM   3539 C CD1 . LEU B 2 272 ? 95.020  41.315 100.312 1.00 48.35  ? 310  LEU B CD1 1 
ATOM   3540 C CD2 . LEU B 2 272 ? 93.309  40.108 99.030  1.00 49.52  ? 310  LEU B CD2 1 
ATOM   3541 N N   . ILE B 2 273 ? 96.134  35.808 100.709 1.00 57.88  ? 311  ILE B N   1 
ATOM   3542 C CA  . ILE B 2 273 ? 96.995  34.655 100.480 1.00 58.65  ? 311  ILE B CA  1 
ATOM   3543 C C   . ILE B 2 273 ? 96.196  33.446 99.982  1.00 63.41  ? 311  ILE B C   1 
ATOM   3544 O O   . ILE B 2 273 ? 96.573  32.802 99.004  1.00 63.06  ? 311  ILE B O   1 
ATOM   3545 C CB  . ILE B 2 273 ? 97.780  34.292 101.742 1.00 61.46  ? 311  ILE B CB  1 
ATOM   3546 C CG1 . ILE B 2 273 ? 99.069  35.106 101.815 1.00 61.88  ? 311  ILE B CG1 1 
ATOM   3547 C CG2 . ILE B 2 273 ? 98.164  32.852 101.679 1.00 62.01  ? 311  ILE B CG2 1 
ATOM   3548 C CD1 . ILE B 2 273 ? 99.329  35.726 103.158 1.00 70.37  ? 311  ILE B CD1 1 
ATOM   3549 N N   . ALA B 2 274 ? 95.118  33.127 100.695 1.00 60.98  ? 312  ALA B N   1 
ATOM   3550 C CA  . ALA B 2 274 ? 94.246  32.000 100.364 1.00 62.25  ? 312  ALA B CA  1 
ATOM   3551 C C   . ALA B 2 274 ? 93.500  32.133 99.024  1.00 72.76  ? 312  ALA B C   1 
ATOM   3552 O O   . ALA B 2 274 ? 93.268  31.140 98.316  1.00 72.70  ? 312  ALA B O   1 
ATOM   3553 C CB  . ALA B 2 274 ? 93.257  31.824 101.446 1.00 62.54  ? 312  ALA B CB  1 
ATOM   3554 N N   . ALA B 2 275 ? 93.061  33.357 98.732  1.00 72.44  ? 313  ALA B N   1 
ATOM   3555 C CA  . ALA B 2 275 ? 92.333  33.681 97.515  1.00 72.58  ? 313  ALA B CA  1 
ATOM   3556 C C   . ALA B 2 275 ? 93.228  33.423 96.323  1.00 80.66  ? 313  ALA B C   1 
ATOM   3557 O O   . ALA B 2 275 ? 92.925  32.589 95.471  1.00 79.10  ? 313  ALA B O   1 
ATOM   3558 C CB  . ALA B 2 275 ? 91.915  35.140 97.553  1.00 72.98  ? 313  ALA B CB  1 
ATOM   3559 N N   . GLN B 2 276 ? 94.341  34.149 96.278  1.00 82.88  ? 314  GLN B N   1 
ATOM   3560 C CA  . GLN B 2 276 ? 95.321  34.003 95.198  1.00 84.93  ? 314  GLN B CA  1 
ATOM   3561 C C   . GLN B 2 276 ? 95.828  32.564 95.162  1.00 93.30  ? 314  GLN B C   1 
ATOM   3562 O O   . GLN B 2 276 ? 96.343  32.104 94.131  1.00 92.35  ? 314  GLN B O   1 
ATOM   3563 C CB  . GLN B 2 276 ? 96.508  34.961 95.399  1.00 86.10  ? 314  GLN B CB  1 
ATOM   3564 C CG  . GLN B 2 276 ? 97.830  34.414 94.836  1.00 95.18  ? 314  GLN B CG  1 
ATOM   3565 C CD  . GLN B 2 276 ? 99.052  34.948 95.561  1.00 109.33 ? 314  GLN B CD  1 
ATOM   3566 O OE1 . GLN B 2 276 ? 99.905  35.625 94.969  1.00 103.59 ? 314  GLN B OE1 1 
ATOM   3567 N NE2 . GLN B 2 276 ? 99.145  34.647 96.850  1.00 100.63 ? 314  GLN B NE2 1 
ATOM   3568 N N   . ALA B 2 277 ? 95.689  31.881 96.306  1.00 93.28  ? 315  ALA B N   1 
ATOM   3569 C CA  . ALA B 2 277 ? 96.109  30.483 96.482  1.00 94.47  ? 315  ALA B CA  1 
ATOM   3570 C C   . ALA B 2 277 ? 95.366  29.575 95.503  1.00 102.41 ? 315  ALA B C   1 
ATOM   3571 O O   . ALA B 2 277 ? 95.979  28.894 94.661  1.00 102.06 ? 315  ALA B O   1 
ATOM   3572 C CB  . ALA B 2 277 ? 95.842  30.039 97.910  1.00 95.03  ? 315  ALA B CB  1 
ATOM   3573 N N   . THR B 2 278 ? 94.035  29.618 95.599  1.00 100.86 ? 316  THR B N   1 
ATOM   3574 C CA  . THR B 2 278 ? 93.121  28.870 94.733  1.00 100.50 ? 316  THR B CA  1 
ATOM   3575 C C   . THR B 2 278 ? 93.360  29.131 93.222  1.00 105.32 ? 316  THR B C   1 
ATOM   3576 O O   . THR B 2 278 ? 92.443  29.005 92.410  1.00 104.44 ? 316  THR B O   1 
ATOM   3577 C CB  . THR B 2 278 ? 91.644  29.140 95.171  1.00 103.74 ? 316  THR B CB  1 
ATOM   3578 O OG1 . THR B 2 278 ? 91.258  30.481 94.823  1.00 103.65 ? 316  THR B OG1 1 
ATOM   3579 C CG2 . THR B 2 278 ? 91.510  28.980 96.683  1.00 97.34  ? 316  THR B CG2 1 
ATOM   3580 N N   . ALA B 2 279 ? 94.608  29.451 92.859  1.00 103.04 ? 317  ALA B N   1 
ATOM   3581 C CA  . ALA B 2 279 ? 95.006  29.784 91.477  1.00 108.95 ? 317  ALA B CA  1 
ATOM   3582 C C   . ALA B 2 279 ? 94.630  28.765 90.410  1.00 112.89 ? 317  ALA B C   1 
ATOM   3583 O O   . ALA B 2 279 ? 94.787  29.032 89.216  1.00 104.67 ? 317  ALA B O   1 
ATOM   3584 C CB  . ALA B 2 279 ? 96.511  30.122 91.397  1.00 109.41 ? 317  ALA B CB  1 
ATOM   3585 N N   . GLU C 1 5   ? 34.038  19.354 166.986 1.00 97.46  ? 883  GLU C N   1 
ATOM   3586 C CA  . GLU C 1 5   ? 32.624  19.599 166.709 1.00 98.04  ? 883  GLU C CA  1 
ATOM   3587 C C   . GLU C 1 5   ? 32.042  18.594 165.696 1.00 104.09 ? 883  GLU C C   1 
ATOM   3588 O O   . GLU C 1 5   ? 32.578  17.484 165.538 1.00 104.08 ? 883  GLU C O   1 
ATOM   3589 C CB  . GLU C 1 5   ? 32.436  21.025 166.201 1.00 99.53  ? 883  GLU C CB  1 
ATOM   3590 C CG  . GLU C 1 5   ? 33.695  21.898 166.317 1.00 114.49 ? 883  GLU C CG  1 
ATOM   3591 C CD  . GLU C 1 5   ? 34.060  22.645 165.017 1.00 137.39 ? 883  GLU C CD  1 
ATOM   3592 O OE1 . GLU C 1 5   ? 33.160  23.231 164.365 1.00 119.94 ? 883  GLU C OE1 1 
ATOM   3593 O OE2 . GLU C 1 5   ? 35.265  22.675 164.669 1.00 131.45 ? 883  GLU C OE2 1 
ATOM   3594 N N   . GLU C 1 6   ? 30.949  18.985 165.024 1.00 100.51 ? 884  GLU C N   1 
ATOM   3595 C CA  . GLU C 1 6   ? 30.288  18.147 164.001 1.00 100.11 ? 884  GLU C CA  1 
ATOM   3596 C C   . GLU C 1 6   ? 29.771  18.952 162.784 1.00 101.98 ? 884  GLU C C   1 
ATOM   3597 O O   . GLU C 1 6   ? 29.379  20.121 162.915 1.00 101.77 ? 884  GLU C O   1 
ATOM   3598 C CB  . GLU C 1 6   ? 29.143  17.316 164.608 1.00 101.76 ? 884  GLU C CB  1 
ATOM   3599 C CG  . GLU C 1 6   ? 29.111  15.821 164.189 1.00 114.96 ? 884  GLU C CG  1 
ATOM   3600 C CD  . GLU C 1 6   ? 28.663  15.570 162.737 1.00 132.12 ? 884  GLU C CD  1 
ATOM   3601 O OE1 . GLU C 1 6   ? 29.325  16.067 161.795 1.00 138.25 ? 884  GLU C OE1 1 
ATOM   3602 O OE2 . GLU C 1 6   ? 27.712  14.781 162.539 1.00 113.34 ? 884  GLU C OE2 1 
ATOM   3603 N N   . PHE C 1 7   ? 29.725  18.298 161.618 1.00 95.81  ? 885  PHE C N   1 
ATOM   3604 C CA  . PHE C 1 7   ? 29.314  18.929 160.361 1.00 93.88  ? 885  PHE C CA  1 
ATOM   3605 C C   . PHE C 1 7   ? 27.907  18.581 159.890 1.00 96.75  ? 885  PHE C C   1 
ATOM   3606 O O   . PHE C 1 7   ? 27.670  17.496 159.358 1.00 95.97  ? 885  PHE C O   1 
ATOM   3607 C CB  . PHE C 1 7   ? 30.303  18.550 159.268 1.00 94.88  ? 885  PHE C CB  1 
ATOM   3608 C CG  . PHE C 1 7   ? 30.929  19.727 158.580 1.00 95.26  ? 885  PHE C CG  1 
ATOM   3609 C CD1 . PHE C 1 7   ? 32.189  20.179 158.955 1.00 97.16  ? 885  PHE C CD1 1 
ATOM   3610 C CD2 . PHE C 1 7   ? 30.285  20.354 157.537 1.00 96.31  ? 885  PHE C CD2 1 
ATOM   3611 C CE1 . PHE C 1 7   ? 32.787  21.239 158.317 1.00 97.01  ? 885  PHE C CE1 1 
ATOM   3612 C CE2 . PHE C 1 7   ? 30.884  21.409 156.890 1.00 98.98  ? 885  PHE C CE2 1 
ATOM   3613 C CZ  . PHE C 1 7   ? 32.141  21.851 157.285 1.00 96.60  ? 885  PHE C CZ  1 
ATOM   3614 N N   . PRO C 1 8   ? 26.972  19.533 160.018 1.00 93.70  ? 886  PRO C N   1 
ATOM   3615 C CA  . PRO C 1 8   ? 25.535  19.542 159.697 1.00 94.19  ? 886  PRO C CA  1 
ATOM   3616 C C   . PRO C 1 8   ? 25.197  19.433 158.209 1.00 101.74 ? 886  PRO C C   1 
ATOM   3617 O O   . PRO C 1 8   ? 25.539  20.319 157.418 1.00 101.90 ? 886  PRO C O   1 
ATOM   3618 C CB  . PRO C 1 8   ? 25.078  20.904 160.221 1.00 95.37  ? 886  PRO C CB  1 
ATOM   3619 C CG  . PRO C 1 8   ? 26.290  21.763 160.108 1.00 99.12  ? 886  PRO C CG  1 
ATOM   3620 C CD  . PRO C 1 8   ? 27.460  20.865 160.414 1.00 94.82  ? 886  PRO C CD  1 
ATOM   3621 N N   . GLU C 1 9   ? 24.477  18.378 157.836 1.00 100.33 ? 887  GLU C N   1 
ATOM   3622 C CA  . GLU C 1 9   ? 24.070  18.212 156.443 1.00 101.34 ? 887  GLU C CA  1 
ATOM   3623 C C   . GLU C 1 9   ? 22.998  19.245 156.048 1.00 104.62 ? 887  GLU C C   1 
ATOM   3624 O O   . GLU C 1 9   ? 22.154  19.622 156.862 1.00 104.49 ? 887  GLU C O   1 
ATOM   3625 C CB  . GLU C 1 9   ? 23.623  16.769 156.151 1.00 103.22 ? 887  GLU C CB  1 
ATOM   3626 C CG  . GLU C 1 9   ? 22.903  16.080 157.303 1.00 117.96 ? 887  GLU C CG  1 
ATOM   3627 C CD  . GLU C 1 9   ? 21.390  16.306 157.284 1.00 145.34 ? 887  GLU C CD  1 
ATOM   3628 O OE1 . GLU C 1 9   ? 20.769  16.237 156.197 1.00 140.23 ? 887  GLU C OE1 1 
ATOM   3629 O OE2 . GLU C 1 9   ? 20.817  16.530 158.371 1.00 141.77 ? 887  GLU C OE2 1 
ATOM   3630 N N   . GLN C 1 10  ? 23.073  19.732 154.811 1.00 100.28 ? 888  GLN C N   1 
ATOM   3631 C CA  . GLN C 1 10  ? 22.155  20.761 154.318 1.00 125.18 ? 888  GLN C CA  1 
ATOM   3632 C C   . GLN C 1 10  ? 22.467  22.115 154.939 1.00 160.37 ? 888  GLN C C   1 
ATOM   3633 O O   . GLN C 1 10  ? 21.928  22.452 155.993 1.00 121.89 ? 888  GLN C O   1 
ATOM   3634 C CB  . GLN C 1 10  ? 20.702  20.408 154.619 1.00 126.32 ? 888  GLN C CB  1 
ATOM   3635 C CG  . GLN C 1 10  ? 19.731  21.446 154.103 1.00 130.14 ? 888  GLN C CG  1 
ATOM   3636 C CD  . GLN C 1 10  ? 19.733  21.512 152.597 1.00 144.96 ? 888  GLN C CD  1 
ATOM   3637 O OE1 . GLN C 1 10  ? 19.471  22.559 152.006 1.00 140.25 ? 888  GLN C OE1 1 
ATOM   3638 N NE2 . GLN C 1 10  ? 20.039  20.385 151.960 1.00 134.34 ? 888  GLN C NE2 1 
ATOM   3639 N N   . GLU C 1 14  ? 20.712  27.663 151.339 1.00 103.78 ? 892  GLU C N   1 
ATOM   3640 C CA  . GLU C 1 14  ? 21.836  26.770 151.082 1.00 102.36 ? 892  GLU C CA  1 
ATOM   3641 C C   . GLU C 1 14  ? 22.398  26.938 149.670 1.00 99.13  ? 892  GLU C C   1 
ATOM   3642 O O   . GLU C 1 14  ? 22.251  26.076 148.800 1.00 98.64  ? 892  GLU C O   1 
ATOM   3643 C CB  . GLU C 1 14  ? 21.470  25.312 151.382 1.00 104.03 ? 892  GLU C CB  1 
ATOM   3644 C CG  . GLU C 1 14  ? 22.372  24.618 152.436 1.00 116.23 ? 892  GLU C CG  1 
ATOM   3645 C CD  . GLU C 1 14  ? 22.910  25.566 153.513 1.00 142.86 ? 892  GLU C CD  1 
ATOM   3646 O OE1 . GLU C 1 14  ? 24.114  25.475 153.854 1.00 136.53 ? 892  GLU C OE1 1 
ATOM   3647 O OE2 . GLU C 1 14  ? 22.119  26.372 154.049 1.00 144.53 ? 892  GLU C OE2 1 
ATOM   3648 N N   . VAL C 1 15  ? 23.034  28.075 149.452 1.00 89.78  ? 893  VAL C N   1 
ATOM   3649 C CA  . VAL C 1 15  ? 23.655  28.340 148.176 1.00 87.22  ? 893  VAL C CA  1 
ATOM   3650 C C   . VAL C 1 15  ? 25.136  28.024 148.371 1.00 83.21  ? 893  VAL C C   1 
ATOM   3651 O O   . VAL C 1 15  ? 25.883  28.795 148.979 1.00 80.77  ? 893  VAL C O   1 
ATOM   3652 C CB  . VAL C 1 15  ? 23.369  29.790 147.683 1.00 91.51  ? 893  VAL C CB  1 
ATOM   3653 C CG1 . VAL C 1 15  ? 24.563  30.365 146.944 1.00 91.55  ? 893  VAL C CG1 1 
ATOM   3654 C CG2 . VAL C 1 15  ? 22.125  29.824 146.799 1.00 91.15  ? 893  VAL C CG2 1 
ATOM   3655 N N   . ILE C 1 16  ? 25.527  26.834 147.927 1.00 75.88  ? 894  ILE C N   1 
ATOM   3656 C CA  . ILE C 1 16  ? 26.897  26.379 148.070 1.00 73.47  ? 894  ILE C CA  1 
ATOM   3657 C C   . ILE C 1 16  ? 27.336  25.507 146.916 1.00 77.35  ? 894  ILE C C   1 
ATOM   3658 O O   . ILE C 1 16  ? 26.541  25.116 146.067 1.00 78.21  ? 894  ILE C O   1 
ATOM   3659 C CB  . ILE C 1 16  ? 27.058  25.599 149.365 1.00 74.79  ? 894  ILE C CB  1 
ATOM   3660 C CG1 . ILE C 1 16  ? 26.237  24.322 149.284 1.00 74.06  ? 894  ILE C CG1 1 
ATOM   3661 C CG2 . ILE C 1 16  ? 26.632  26.442 150.537 1.00 74.65  ? 894  ILE C CG2 1 
ATOM   3662 C CD1 . ILE C 1 16  ? 26.614  23.284 150.292 1.00 73.84  ? 894  ILE C CD1 1 
ATOM   3663 N N   . ASN C 1 17  ? 28.612  25.155 146.932 1.00 72.62  ? 895  ASN C N   1 
ATOM   3664 C CA  . ASN C 1 17  ? 29.157  24.223 145.970 1.00 71.68  ? 895  ASN C CA  1 
ATOM   3665 C C   . ASN C 1 17  ? 29.171  22.942 146.776 1.00 74.99  ? 895  ASN C C   1 
ATOM   3666 O O   . ASN C 1 17  ? 29.832  22.879 147.808 1.00 73.78  ? 895  ASN C O   1 
ATOM   3667 C CB  . ASN C 1 17  ? 30.583  24.612 145.599 1.00 68.57  ? 895  ASN C CB  1 
ATOM   3668 C CG  . ASN C 1 17  ? 31.168  23.726 144.528 1.00 80.07  ? 895  ASN C CG  1 
ATOM   3669 O OD1 . ASN C 1 17  ? 31.016  24.011 143.342 1.00 70.78  ? 895  ASN C OD1 1 
ATOM   3670 N ND2 . ASN C 1 17  ? 31.875  22.665 144.938 1.00 65.18  ? 895  ASN C ND2 1 
ATOM   3671 N N   . GLN C 1 18  ? 28.377  21.963 146.351 1.00 71.21  ? 896  GLN C N   1 
ATOM   3672 C CA  . GLN C 1 18  ? 28.249  20.709 147.082 1.00 70.56  ? 896  GLN C CA  1 
ATOM   3673 C C   . GLN C 1 18  ? 29.475  19.844 147.060 1.00 72.32  ? 896  GLN C C   1 
ATOM   3674 O O   . GLN C 1 18  ? 29.797  19.215 148.054 1.00 72.50  ? 896  GLN C O   1 
ATOM   3675 C CB  . GLN C 1 18  ? 27.062  19.891 146.578 1.00 72.15  ? 896  GLN C CB  1 
ATOM   3676 C CG  . GLN C 1 18  ? 25.744  20.228 147.243 1.00 86.76  ? 896  GLN C CG  1 
ATOM   3677 C CD  . GLN C 1 18  ? 24.640  20.538 146.238 1.00 117.30 ? 896  GLN C CD  1 
ATOM   3678 O OE1 . GLN C 1 18  ? 24.311  21.704 145.998 1.00 123.65 ? 896  GLN C OE1 1 
ATOM   3679 N NE2 . GLN C 1 18  ? 24.053  19.492 145.656 1.00 98.21  ? 896  GLN C NE2 1 
ATOM   3680 N N   . PRO C 1 19  ? 30.129  19.730 145.901 1.00 67.78  ? 897  PRO C N   1 
ATOM   3681 C CA  . PRO C 1 19  ? 31.282  18.818 145.882 1.00 67.00  ? 897  PRO C CA  1 
ATOM   3682 C C   . PRO C 1 19  ? 32.370  19.303 146.799 1.00 69.17  ? 897  PRO C C   1 
ATOM   3683 O O   . PRO C 1 19  ? 33.134  18.514 147.342 1.00 69.05  ? 897  PRO C O   1 
ATOM   3684 C CB  . PRO C 1 19  ? 31.764  18.880 144.425 1.00 68.34  ? 897  PRO C CB  1 
ATOM   3685 C CG  . PRO C 1 19  ? 30.568  19.335 143.649 1.00 72.70  ? 897  PRO C CG  1 
ATOM   3686 C CD  . PRO C 1 19  ? 29.822  20.266 144.563 1.00 68.62  ? 897  PRO C CD  1 
ATOM   3687 N N   . MET C 1 20  ? 32.441  20.623 146.927 1.00 64.96  ? 898  MET C N   1 
ATOM   3688 C CA  . MET C 1 20  ? 33.466  21.289 147.725 1.00 63.97  ? 898  MET C CA  1 
ATOM   3689 C C   . MET C 1 20  ? 33.169  21.124 149.204 1.00 65.66  ? 898  MET C C   1 
ATOM   3690 O O   . MET C 1 20  ? 34.046  20.814 150.007 1.00 64.95  ? 898  MET C O   1 
ATOM   3691 C CB  . MET C 1 20  ? 33.512  22.774 147.356 1.00 65.74  ? 898  MET C CB  1 
ATOM   3692 C CG  . MET C 1 20  ? 34.535  23.114 146.296 1.00 68.24  ? 898  MET C CG  1 
ATOM   3693 S SD  . MET C 1 20  ? 34.677  24.899 146.123 1.00 71.04  ? 898  MET C SD  1 
ATOM   3694 C CE  . MET C 1 20  ? 36.417  25.117 146.244 1.00 67.27  ? 898  MET C CE  1 
ATOM   3695 N N   . MET C 1 21  ? 31.913  21.342 149.547 1.00 61.82  ? 899  MET C N   1 
ATOM   3696 C CA  . MET C 1 21  ? 31.443  21.189 150.913 1.00 62.12  ? 899  MET C CA  1 
ATOM   3697 C C   . MET C 1 21  ? 31.539  19.713 151.267 1.00 69.01  ? 899  MET C C   1 
ATOM   3698 O O   . MET C 1 21  ? 31.671  19.347 152.433 1.00 69.45  ? 899  MET C O   1 
ATOM   3699 C CB  . MET C 1 21  ? 29.986  21.691 151.021 1.00 64.11  ? 899  MET C CB  1 
ATOM   3700 C CG  . MET C 1 21  ? 29.409  21.759 152.431 1.00 67.38  ? 899  MET C CG  1 
ATOM   3701 S SD  . MET C 1 21  ? 30.280  22.909 153.541 1.00 71.51  ? 899  MET C SD  1 
ATOM   3702 C CE  . MET C 1 21  ? 29.319  24.442 153.330 1.00 67.48  ? 899  MET C CE  1 
ATOM   3703 N N   . MET C 1 22  ? 31.505  18.869 150.245 1.00 67.98  ? 900  MET C N   1 
ATOM   3704 C CA  . MET C 1 22  ? 31.572  17.432 150.438 1.00 69.34  ? 900  MET C CA  1 
ATOM   3705 C C   . MET C 1 22  ? 33.000  17.050 150.767 1.00 67.78  ? 900  MET C C   1 
ATOM   3706 O O   . MET C 1 22  ? 33.264  16.228 151.640 1.00 65.66  ? 900  MET C O   1 
ATOM   3707 C CB  . MET C 1 22  ? 31.132  16.729 149.154 1.00 73.95  ? 900  MET C CB  1 
ATOM   3708 C CG  . MET C 1 22  ? 30.946  15.231 149.295 1.00 81.21  ? 900  MET C CG  1 
ATOM   3709 S SD  . MET C 1 22  ? 29.515  14.828 150.327 1.00 89.14  ? 900  MET C SD  1 
ATOM   3710 C CE  . MET C 1 22  ? 30.347  13.886 151.755 1.00 86.12  ? 900  MET C CE  1 
ATOM   3711 N N   . ALA C 1 23  ? 33.925  17.650 150.035 1.00 62.85  ? 901  ALA C N   1 
ATOM   3712 C CA  . ALA C 1 23  ? 35.336  17.368 150.218 1.00 62.13  ? 901  ALA C CA  1 
ATOM   3713 C C   . ALA C 1 23  ? 35.741  17.897 151.582 1.00 68.16  ? 901  ALA C C   1 
ATOM   3714 O O   . ALA C 1 23  ? 36.545  17.273 152.281 1.00 69.45  ? 901  ALA C O   1 
ATOM   3715 C CB  . ALA C 1 23  ? 36.141  18.011 149.111 1.00 62.26  ? 901  ALA C CB  1 
ATOM   3716 N N   . ALA C 1 24  ? 35.124  19.017 151.965 1.00 63.51  ? 902  ALA C N   1 
ATOM   3717 C CA  . ALA C 1 24  ? 35.347  19.649 153.257 1.00 62.79  ? 902  ALA C CA  1 
ATOM   3718 C C   . ALA C 1 24  ? 34.854  18.704 154.317 1.00 65.99  ? 902  ALA C C   1 
ATOM   3719 O O   . ALA C 1 24  ? 35.542  18.455 155.305 1.00 65.77  ? 902  ALA C O   1 
ATOM   3720 C CB  . ALA C 1 24  ? 34.588  20.979 153.358 1.00 63.61  ? 902  ALA C CB  1 
ATOM   3721 N N   . ARG C 1 25  ? 33.644  18.187 154.125 1.00 63.62  ? 903  ARG C N   1 
ATOM   3722 C CA  . ARG C 1 25  ? 33.061  17.247 155.095 1.00 63.32  ? 903  ARG C CA  1 
ATOM   3723 C C   . ARG C 1 25  ? 33.989  16.051 155.314 1.00 67.11  ? 903  ARG C C   1 
ATOM   3724 O O   . ARG C 1 25  ? 34.259  15.670 156.433 1.00 67.13  ? 903  ARG C O   1 
ATOM   3725 C CB  . ARG C 1 25  ? 31.652  16.804 154.694 1.00 60.89  ? 903  ARG C CB  1 
ATOM   3726 C CG  . ARG C 1 25  ? 30.998  15.931 155.736 1.00 75.55  ? 903  ARG C CG  1 
ATOM   3727 C CD  . ARG C 1 25  ? 29.530  16.309 155.969 1.00 93.07  ? 903  ARG C CD  1 
ATOM   3728 N NE  . ARG C 1 25  ? 28.921  17.053 154.860 1.00 103.37 ? 903  ARG C NE  1 
ATOM   3729 C CZ  . ARG C 1 25  ? 27.834  17.817 154.981 1.00 110.04 ? 903  ARG C CZ  1 
ATOM   3730 N NH1 . ARG C 1 25  ? 27.236  17.950 156.166 1.00 85.99  ? 903  ARG C NH1 1 
ATOM   3731 N NH2 . ARG C 1 25  ? 27.344  18.454 153.919 1.00 91.79  ? 903  ARG C NH2 1 
ATOM   3732 N N   . GLN C 1 26  ? 34.552  15.526 154.238 1.00 64.78  ? 904  GLN C N   1 
ATOM   3733 C CA  . GLN C 1 26  ? 35.497  14.423 154.335 1.00 65.15  ? 904  GLN C CA  1 
ATOM   3734 C C   . GLN C 1 26  ? 36.654  14.759 155.275 1.00 66.10  ? 904  GLN C C   1 
ATOM   3735 O O   . GLN C 1 26  ? 36.971  13.997 156.199 1.00 64.51  ? 904  GLN C O   1 
ATOM   3736 C CB  . GLN C 1 26  ? 36.041  14.072 152.948 1.00 67.63  ? 904  GLN C CB  1 
ATOM   3737 C CG  . GLN C 1 26  ? 35.388  12.821 152.336 1.00 89.65  ? 904  GLN C CG  1 
ATOM   3738 C CD  . GLN C 1 26  ? 34.112  13.134 151.562 1.00 101.41 ? 904  GLN C CD  1 
ATOM   3739 O OE1 . GLN C 1 26  ? 34.149  13.448 150.368 1.00 90.79  ? 904  GLN C OE1 1 
ATOM   3740 N NE2 . GLN C 1 26  ? 32.976  13.025 152.234 1.00 95.37  ? 904  GLN C NE2 1 
ATOM   3741 N N   . LEU C 1 27  ? 37.305  15.890 155.022 1.00 61.21  ? 905  LEU C N   1 
ATOM   3742 C CA  . LEU C 1 27  ? 38.400  16.302 155.878 1.00 60.06  ? 905  LEU C CA  1 
ATOM   3743 C C   . LEU C 1 27  ? 37.935  16.443 157.338 1.00 66.72  ? 905  LEU C C   1 
ATOM   3744 O O   . LEU C 1 27  ? 38.532  15.870 158.264 1.00 67.02  ? 905  LEU C O   1 
ATOM   3745 C CB  . LEU C 1 27  ? 39.005  17.606 155.385 1.00 59.09  ? 905  LEU C CB  1 
ATOM   3746 C CG  . LEU C 1 27  ? 40.415  17.733 155.982 1.00 62.54  ? 905  LEU C CG  1 
ATOM   3747 C CD1 . LEU C 1 27  ? 41.009  16.355 156.345 1.00 60.96  ? 905  LEU C CD1 1 
ATOM   3748 C CD2 . LEU C 1 27  ? 41.346  18.494 155.068 1.00 63.32  ? 905  LEU C CD2 1 
ATOM   3749 N N   . HIS C 1 28  ? 36.857  17.200 157.533 1.00 64.34  ? 906  HIS C N   1 
ATOM   3750 C CA  . HIS C 1 28  ? 36.312  17.435 158.865 1.00 64.30  ? 906  HIS C CA  1 
ATOM   3751 C C   . HIS C 1 28  ? 36.017  16.163 159.646 1.00 66.41  ? 906  HIS C C   1 
ATOM   3752 O O   . HIS C 1 28  ? 36.301  16.080 160.837 1.00 65.20  ? 906  HIS C O   1 
ATOM   3753 C CB  . HIS C 1 28  ? 35.050  18.294 158.808 1.00 65.55  ? 906  HIS C CB  1 
ATOM   3754 C CG  . HIS C 1 28  ? 34.560  18.709 160.158 1.00 69.39  ? 906  HIS C CG  1 
ATOM   3755 N ND1 . HIS C 1 28  ? 33.359  18.277 160.682 1.00 71.49  ? 906  HIS C ND1 1 
ATOM   3756 C CD2 . HIS C 1 28  ? 35.144  19.465 161.119 1.00 71.41  ? 906  HIS C CD2 1 
ATOM   3757 C CE1 . HIS C 1 28  ? 33.218  18.764 161.903 1.00 71.22  ? 906  HIS C CE1 1 
ATOM   3758 N NE2 . HIS C 1 28  ? 34.288  19.486 162.192 1.00 71.43  ? 906  HIS C NE2 1 
ATOM   3759 N N   . ASP C 1 29  ? 35.387  15.199 158.979 1.00 62.78  ? 907  ASP C N   1 
ATOM   3760 C CA  . ASP C 1 29  ? 35.030  13.933 159.607 1.00 61.30  ? 907  ASP C CA  1 
ATOM   3761 C C   . ASP C 1 29  ? 36.251  13.143 160.056 1.00 64.06  ? 907  ASP C C   1 
ATOM   3762 O O   . ASP C 1 29  ? 36.249  12.592 161.158 1.00 65.89  ? 907  ASP C O   1 
ATOM   3763 C CB  . ASP C 1 29  ? 34.132  13.103 158.706 1.00 61.87  ? 907  ASP C CB  1 
ATOM   3764 C CG  . ASP C 1 29  ? 32.724  13.666 158.611 1.00 66.21  ? 907  ASP C CG  1 
ATOM   3765 O OD1 . ASP C 1 29  ? 32.344  14.495 159.466 1.00 64.93  ? 907  ASP C OD1 1 
ATOM   3766 O OD2 . ASP C 1 29  ? 31.997  13.274 157.675 1.00 73.26  ? 907  ASP C OD2 1 
ATOM   3767 N N   . GLU C 1 30  ? 37.315  13.148 159.258 1.00 56.97  ? 908  GLU C N   1 
ATOM   3768 C CA  . GLU C 1 30  ? 38.516  12.443 159.658 1.00 56.57  ? 908  GLU C CA  1 
ATOM   3769 C C   . GLU C 1 30  ? 39.167  13.077 160.883 1.00 62.09  ? 908  GLU C C   1 
ATOM   3770 O O   . GLU C 1 30  ? 39.456  12.412 161.887 1.00 61.57  ? 908  GLU C O   1 
ATOM   3771 C CB  . GLU C 1 30  ? 39.543  12.404 158.526 1.00 57.90  ? 908  GLU C CB  1 
ATOM   3772 C CG  . GLU C 1 30  ? 40.900  11.795 158.944 1.00 67.54  ? 908  GLU C CG  1 
ATOM   3773 C CD  . GLU C 1 30  ? 40.819  10.276 159.167 1.00 93.78  ? 908  GLU C CD  1 
ATOM   3774 O OE1 . GLU C 1 30  ? 39.900  9.649  158.590 1.00 83.40  ? 908  GLU C OE1 1 
ATOM   3775 O OE2 . GLU C 1 30  ? 41.645  9.712  159.930 1.00 93.99  ? 908  GLU C OE2 1 
ATOM   3776 N N   . ALA C 1 31  ? 39.442  14.368 160.769 1.00 58.86  ? 909  ALA C N   1 
ATOM   3777 C CA  . ALA C 1 31  ? 40.138  15.089 161.811 1.00 58.16  ? 909  ALA C CA  1 
ATOM   3778 C C   . ALA C 1 31  ? 39.349  15.191 163.107 1.00 61.80  ? 909  ALA C C   1 
ATOM   3779 O O   . ALA C 1 31  ? 39.925  15.353 164.191 1.00 62.11  ? 909  ALA C O   1 
ATOM   3780 C CB  . ALA C 1 31  ? 40.477  16.457 161.300 1.00 58.68  ? 909  ALA C CB  1 
ATOM   3781 N N   . ARG C 1 32  ? 38.028  15.127 162.972 1.00 57.42  ? 910  ARG C N   1 
ATOM   3782 C CA  . ARG C 1 32  ? 37.119  15.391 164.067 1.00 57.53  ? 910  ARG C CA  1 
ATOM   3783 C C   . ARG C 1 32  ? 36.983  14.337 165.129 1.00 62.55  ? 910  ARG C C   1 
ATOM   3784 O O   . ARG C 1 32  ? 36.402  14.567 166.196 1.00 62.69  ? 910  ARG C O   1 
ATOM   3785 C CB  . ARG C 1 32  ? 35.779  15.928 163.577 1.00 58.72  ? 910  ARG C CB  1 
ATOM   3786 C CG  . ARG C 1 32  ? 34.671  14.900 163.412 1.00 67.27  ? 910  ARG C CG  1 
ATOM   3787 C CD  . ARG C 1 32  ? 33.340  15.622 163.142 1.00 75.50  ? 910  ARG C CD  1 
ATOM   3788 N NE  . ARG C 1 32  ? 32.422  14.775 162.401 1.00 89.52  ? 910  ARG C NE  1 
ATOM   3789 C CZ  . ARG C 1 32  ? 31.887  13.663 162.896 1.00 110.61 ? 910  ARG C CZ  1 
ATOM   3790 N NH1 . ARG C 1 32  ? 32.176  13.290 164.139 1.00 96.39  ? 910  ARG C NH1 1 
ATOM   3791 N NH2 . ARG C 1 32  ? 31.053  12.934 162.159 1.00 98.85  ? 910  ARG C NH2 1 
ATOM   3792 N N   . LYS C 1 33  ? 37.595  13.196 164.874 1.00 59.15  ? 911  LYS C N   1 
ATOM   3793 C CA  . LYS C 1 33  ? 37.586  12.157 165.868 1.00 58.14  ? 911  LYS C CA  1 
ATOM   3794 C C   . LYS C 1 33  ? 38.742  12.417 166.811 1.00 63.15  ? 911  LYS C C   1 
ATOM   3795 O O   . LYS C 1 33  ? 38.805  11.813 167.880 1.00 62.64  ? 911  LYS C O   1 
ATOM   3796 C CB  . LYS C 1 33  ? 37.723  10.776 165.229 1.00 60.73  ? 911  LYS C CB  1 
ATOM   3797 C CG  . LYS C 1 33  ? 37.794  10.741 163.701 1.00 67.60  ? 911  LYS C CG  1 
ATOM   3798 C CD  . LYS C 1 33  ? 38.663  9.578  163.268 1.00 72.79  ? 911  LYS C CD  1 
ATOM   3799 C CE  . LYS C 1 33  ? 38.243  9.040  161.909 1.00 91.62  ? 911  LYS C CE  1 
ATOM   3800 N NZ  . LYS C 1 33  ? 39.387  8.349  161.203 1.00 103.82 ? 911  LYS C NZ  1 
ATOM   3801 N N   . TRP C 1 34  ? 39.638  13.334 166.428 1.00 61.41  ? 912  TRP C N   1 
ATOM   3802 C CA  . TRP C 1 34  ? 40.817  13.662 167.249 1.00 61.29  ? 912  TRP C CA  1 
ATOM   3803 C C   . TRP C 1 34  ? 40.730  14.939 168.068 1.00 66.42  ? 912  TRP C C   1 
ATOM   3804 O O   . TRP C 1 34  ? 39.932  15.834 167.766 1.00 68.25  ? 912  TRP C O   1 
ATOM   3805 C CB  . TRP C 1 34  ? 42.093  13.700 166.398 1.00 59.56  ? 912  TRP C CB  1 
ATOM   3806 C CG  . TRP C 1 34  ? 42.317  12.420 165.685 1.00 60.45  ? 912  TRP C CG  1 
ATOM   3807 C CD1 . TRP C 1 34  ? 42.297  12.208 164.332 1.00 63.35  ? 912  TRP C CD1 1 
ATOM   3808 C CD2 . TRP C 1 34  ? 42.531  11.148 166.287 1.00 60.28  ? 912  TRP C CD2 1 
ATOM   3809 N NE1 . TRP C 1 34  ? 42.562  10.887 164.053 1.00 62.42  ? 912  TRP C NE1 1 
ATOM   3810 C CE2 . TRP C 1 34  ? 42.667  10.205 165.236 1.00 63.71  ? 912  TRP C CE2 1 
ATOM   3811 C CE3 . TRP C 1 34  ? 42.634  10.705 167.619 1.00 61.68  ? 912  TRP C CE3 1 
ATOM   3812 C CZ2 . TRP C 1 34  ? 42.833  8.835  165.474 1.00 62.40  ? 912  TRP C CZ2 1 
ATOM   3813 C CZ3 . TRP C 1 34  ? 42.802  9.325  167.857 1.00 62.63  ? 912  TRP C CZ3 1 
ATOM   3814 C CH2 . TRP C 1 34  ? 42.896  8.413  166.778 1.00 62.97  ? 912  TRP C CH2 1 
ATOM   3815 N N   . SER C 1 35  ? 41.575  15.003 169.102 1.00 61.45  ? 913  SER C N   1 
ATOM   3816 C CA  . SER C 1 35  ? 41.754  16.192 169.933 1.00 59.99  ? 913  SER C CA  1 
ATOM   3817 C C   . SER C 1 35  ? 42.961  16.899 169.313 1.00 65.05  ? 913  SER C C   1 
ATOM   3818 O O   . SER C 1 35  ? 43.981  16.239 168.975 1.00 64.36  ? 913  SER C O   1 
ATOM   3819 C CB  . SER C 1 35  ? 42.094  15.820 171.383 1.00 59.72  ? 913  SER C CB  1 
ATOM   3820 O OG  . SER C 1 35  ? 41.887  16.924 172.247 1.00 62.57  ? 913  SER C OG  1 
ATOM   3821 N N   . SER C 1 36  ? 42.825  18.213 169.123 1.00 61.47  ? 914  SER C N   1 
ATOM   3822 C CA  . SER C 1 36  ? 43.912  19.010 168.554 1.00 61.40  ? 914  SER C CA  1 
ATOM   3823 C C   . SER C 1 36  ? 45.036  19.171 169.602 1.00 68.01  ? 914  SER C C   1 
ATOM   3824 O O   . SER C 1 36  ? 46.178  19.516 169.259 1.00 69.15  ? 914  SER C O   1 
ATOM   3825 C CB  . SER C 1 36  ? 43.398  20.375 168.047 1.00 61.69  ? 914  SER C CB  1 
ATOM   3826 O OG  . SER C 1 36  ? 42.205  20.260 167.269 1.00 62.99  ? 914  SER C OG  1 
ATOM   3827 N N   . LYS C 1 37  ? 44.710  18.870 170.863 1.00 64.76  ? 915  LYS C N   1 
ATOM   3828 C CA  . LYS C 1 37  ? 45.680  18.962 171.948 1.00 65.00  ? 915  LYS C CA  1 
ATOM   3829 C C   . LYS C 1 37  ? 46.956  18.208 171.593 1.00 69.20  ? 915  LYS C C   1 
ATOM   3830 O O   . LYS C 1 37  ? 46.907  17.035 171.240 1.00 69.80  ? 915  LYS C O   1 
ATOM   3831 C CB  . LYS C 1 37  ? 45.088  18.440 173.271 1.00 67.50  ? 915  LYS C CB  1 
ATOM   3832 C CG  . LYS C 1 37  ? 45.145  19.455 174.443 1.00 83.83  ? 915  LYS C CG  1 
ATOM   3833 C CD  . LYS C 1 37  ? 46.465  19.407 175.257 1.00 87.85  ? 915  LYS C CD  1 
ATOM   3834 C CE  . LYS C 1 37  ? 46.343  18.586 176.555 1.00 96.36  ? 915  LYS C CE  1 
ATOM   3835 N NZ  . LYS C 1 37  ? 45.861  19.376 177.721 1.00 103.65 ? 915  LYS C NZ  1 
ATOM   3836 N N   . GLY C 1 38  ? 48.086  18.907 171.658 1.00 65.57  ? 916  GLY C N   1 
ATOM   3837 C CA  . GLY C 1 38  ? 49.394  18.343 171.376 1.00 65.32  ? 916  GLY C CA  1 
ATOM   3838 C C   . GLY C 1 38  ? 49.499  17.866 169.944 1.00 68.92  ? 916  GLY C C   1 
ATOM   3839 O O   . GLY C 1 38  ? 50.515  17.266 169.546 1.00 70.59  ? 916  GLY C O   1 
ATOM   3840 N N   . ASN C 1 39  ? 48.449  18.141 169.171 1.00 61.91  ? 917  ASN C N   1 
ATOM   3841 C CA  . ASN C 1 39  ? 48.399  17.733 167.783 1.00 60.69  ? 917  ASN C CA  1 
ATOM   3842 C C   . ASN C 1 39  ? 48.024  18.887 166.848 1.00 64.31  ? 917  ASN C C   1 
ATOM   3843 O O   . ASN C 1 39  ? 46.838  19.157 166.608 1.00 62.91  ? 917  ASN C O   1 
ATOM   3844 C CB  . ASN C 1 39  ? 47.468  16.530 167.611 1.00 57.65  ? 917  ASN C CB  1 
ATOM   3845 C CG  . ASN C 1 39  ? 47.632  15.862 166.250 1.00 69.10  ? 917  ASN C CG  1 
ATOM   3846 O OD1 . ASN C 1 39  ? 48.021  16.506 165.261 1.00 59.56  ? 917  ASN C OD1 1 
ATOM   3847 N ND2 . ASN C 1 39  ? 47.303  14.570 166.184 1.00 59.94  ? 917  ASN C ND2 1 
ATOM   3848 N N   . ASP C 1 40  ? 49.065  19.546 166.330 1.00 61.27  ? 918  ASP C N   1 
ATOM   3849 C CA  . ASP C 1 40  ? 48.966  20.700 165.427 1.00 59.90  ? 918  ASP C CA  1 
ATOM   3850 C C   . ASP C 1 40  ? 48.428  20.343 164.035 1.00 61.52  ? 918  ASP C C   1 
ATOM   3851 O O   . ASP C 1 40  ? 47.737  21.162 163.413 1.00 61.20  ? 918  ASP C O   1 
ATOM   3852 C CB  . ASP C 1 40  ? 50.347  21.365 165.283 1.00 62.00  ? 918  ASP C CB  1 
ATOM   3853 C CG  . ASP C 1 40  ? 50.612  22.439 166.361 1.00 71.22  ? 918  ASP C CG  1 
ATOM   3854 O OD1 . ASP C 1 40  ? 49.703  22.678 167.207 1.00 70.49  ? 918  ASP C OD1 1 
ATOM   3855 O OD2 . ASP C 1 40  ? 51.731  23.037 166.347 1.00 74.59  ? 918  ASP C OD2 1 
ATOM   3856 N N   . ILE C 1 41  ? 48.781  19.150 163.544 1.00 56.11  ? 919  ILE C N   1 
ATOM   3857 C CA  . ILE C 1 41  ? 48.333  18.696 162.237 1.00 55.78  ? 919  ILE C CA  1 
ATOM   3858 C C   . ILE C 1 41  ? 46.803  18.490 162.194 1.00 60.90  ? 919  ILE C C   1 
ATOM   3859 O O   . ILE C 1 41  ? 46.164  18.692 161.150 1.00 60.81  ? 919  ILE C O   1 
ATOM   3860 C CB  . ILE C 1 41  ? 49.099  17.455 161.780 1.00 59.41  ? 919  ILE C CB  1 
ATOM   3861 C CG1 . ILE C 1 41  ? 50.466  17.857 161.185 1.00 60.07  ? 919  ILE C CG1 1 
ATOM   3862 C CG2 . ILE C 1 41  ? 48.266  16.648 160.759 1.00 59.31  ? 919  ILE C CG2 1 
ATOM   3863 C CD1 . ILE C 1 41  ? 51.239  16.698 160.528 1.00 62.65  ? 919  ILE C CD1 1 
ATOM   3864 N N   . ILE C 1 42  ? 46.221  18.136 163.339 1.00 57.10  ? 920  ILE C N   1 
ATOM   3865 C CA  . ILE C 1 42  ? 44.772  17.965 163.480 1.00 55.80  ? 920  ILE C CA  1 
ATOM   3866 C C   . ILE C 1 42  ? 44.070  19.334 163.629 1.00 60.41  ? 920  ILE C C   1 
ATOM   3867 O O   . ILE C 1 42  ? 42.954  19.526 163.129 1.00 60.55  ? 920  ILE C O   1 
ATOM   3868 C CB  . ILE C 1 42  ? 44.428  17.043 164.685 1.00 58.19  ? 920  ILE C CB  1 
ATOM   3869 C CG1 . ILE C 1 42  ? 44.447  15.567 164.272 1.00 56.84  ? 920  ILE C CG1 1 
ATOM   3870 C CG2 . ILE C 1 42  ? 43.088  17.465 165.356 1.00 59.88  ? 920  ILE C CG2 1 
ATOM   3871 C CD1 . ILE C 1 42  ? 43.273  15.138 163.369 1.00 52.27  ? 920  ILE C CD1 1 
ATOM   3872 N N   . ALA C 1 43  ? 44.704  20.264 164.350 1.00 55.94  ? 921  ALA C N   1 
ATOM   3873 C CA  . ALA C 1 43  ? 44.154  21.615 164.514 1.00 54.41  ? 921  ALA C CA  1 
ATOM   3874 C C   . ALA C 1 43  ? 44.160  22.255 163.122 1.00 60.69  ? 921  ALA C C   1 
ATOM   3875 O O   . ALA C 1 43  ? 43.113  22.714 162.649 1.00 60.71  ? 921  ALA C O   1 
ATOM   3876 C CB  . ALA C 1 43  ? 45.013  22.436 165.470 1.00 54.23  ? 921  ALA C CB  1 
ATOM   3877 N N   . ALA C 1 44  ? 45.333  22.247 162.465 1.00 56.61  ? 922  ALA C N   1 
ATOM   3878 C CA  . ALA C 1 44  ? 45.490  22.817 161.122 1.00 55.54  ? 922  ALA C CA  1 
ATOM   3879 C C   . ALA C 1 44  ? 44.420  22.299 160.166 1.00 58.03  ? 922  ALA C C   1 
ATOM   3880 O O   . ALA C 1 44  ? 43.753  23.081 159.488 1.00 56.88  ? 922  ALA C O   1 
ATOM   3881 C CB  . ALA C 1 44  ? 46.924  22.533 160.547 1.00 55.76  ? 922  ALA C CB  1 
ATOM   3882 N N   . ALA C 1 45  ? 44.293  20.978 160.112 1.00 53.65  ? 923  ALA C N   1 
ATOM   3883 C CA  . ALA C 1 45  ? 43.332  20.315 159.227 1.00 53.70  ? 923  ALA C CA  1 
ATOM   3884 C C   . ALA C 1 45  ? 41.866  20.703 159.450 1.00 57.16  ? 923  ALA C C   1 
ATOM   3885 O O   . ALA C 1 45  ? 41.078  20.774 158.477 1.00 55.32  ? 923  ALA C O   1 
ATOM   3886 C CB  . ALA C 1 45  ? 43.492  18.784 159.278 1.00 54.07  ? 923  ALA C CB  1 
ATOM   3887 N N   . LYS C 1 46  ? 41.503  20.903 160.723 1.00 53.25  ? 924  LYS C N   1 
ATOM   3888 C CA  . LYS C 1 46  ? 40.138  21.305 161.103 1.00 52.71  ? 924  LYS C CA  1 
ATOM   3889 C C   . LYS C 1 46  ? 39.899  22.715 160.567 1.00 57.33  ? 924  LYS C C   1 
ATOM   3890 O O   . LYS C 1 46  ? 38.828  23.045 160.032 1.00 58.20  ? 924  LYS C O   1 
ATOM   3891 C CB  . LYS C 1 46  ? 39.947  21.279 162.636 1.00 53.92  ? 924  LYS C CB  1 
ATOM   3892 C CG  . LYS C 1 46  ? 39.921  19.870 163.243 1.00 47.77  ? 924  LYS C CG  1 
ATOM   3893 C CD  . LYS C 1 46  ? 39.862  19.884 164.784 1.00 49.47  ? 924  LYS C CD  1 
ATOM   3894 C CE  . LYS C 1 46  ? 40.081  18.468 165.399 1.00 51.94  ? 924  LYS C CE  1 
ATOM   3895 N NZ  . LYS C 1 46  ? 39.982  18.403 166.867 1.00 46.15  ? 924  LYS C NZ  1 
ATOM   3896 N N   . ARG C 1 47  ? 40.923  23.543 160.675 1.00 53.63  ? 925  ARG C N   1 
ATOM   3897 C CA  . ARG C 1 47  ? 40.825  24.886 160.161 1.00 53.00  ? 925  ARG C CA  1 
ATOM   3898 C C   . ARG C 1 47  ? 40.567  24.776 158.645 1.00 56.19  ? 925  ARG C C   1 
ATOM   3899 O O   . ARG C 1 47  ? 39.720  25.478 158.102 1.00 55.46  ? 925  ARG C O   1 
ATOM   3900 C CB  . ARG C 1 47  ? 42.148  25.607 160.419 1.00 53.07  ? 925  ARG C CB  1 
ATOM   3901 C CG  . ARG C 1 47  ? 42.285  26.400 161.728 1.00 46.41  ? 925  ARG C CG  1 
ATOM   3902 C CD  . ARG C 1 47  ? 43.604  27.178 161.663 1.00 38.68  ? 925  ARG C CD  1 
ATOM   3903 N NE  . ARG C 1 47  ? 44.608  26.533 162.499 1.00 45.81  ? 925  ARG C NE  1 
ATOM   3904 C CZ  . ARG C 1 47  ? 45.860  26.256 162.163 1.00 56.81  ? 925  ARG C CZ  1 
ATOM   3905 N NH1 . ARG C 1 47  ? 46.338  26.572 160.988 1.00 32.71  ? 925  ARG C NH1 1 
ATOM   3906 N NH2 . ARG C 1 47  ? 46.648  25.659 163.043 1.00 67.47  ? 925  ARG C NH2 1 
ATOM   3907 N N   . MET C 1 48  ? 41.281  23.867 157.977 1.00 52.76  ? 926  MET C N   1 
ATOM   3908 C CA  . MET C 1 48  ? 41.196  23.708 156.517 1.00 51.64  ? 926  MET C CA  1 
ATOM   3909 C C   . MET C 1 48  ? 39.847  23.283 156.010 1.00 55.26  ? 926  MET C C   1 
ATOM   3910 O O   . MET C 1 48  ? 39.371  23.786 154.990 1.00 56.11  ? 926  MET C O   1 
ATOM   3911 C CB  . MET C 1 48  ? 42.282  22.795 155.994 1.00 53.66  ? 926  MET C CB  1 
ATOM   3912 C CG  . MET C 1 48  ? 43.645  23.419 156.145 1.00 58.16  ? 926  MET C CG  1 
ATOM   3913 S SD  . MET C 1 48  ? 44.919  22.479 155.306 1.00 63.55  ? 926  MET C SD  1 
ATOM   3914 C CE  . MET C 1 48  ? 43.923  21.723 153.959 1.00 60.39  ? 926  MET C CE  1 
ATOM   3915 N N   . ALA C 1 49  ? 39.211  22.393 156.760 1.00 50.08  ? 927  ALA C N   1 
ATOM   3916 C CA  . ALA C 1 49  ? 37.867  21.943 156.446 1.00 48.92  ? 927  ALA C CA  1 
ATOM   3917 C C   . ALA C 1 49  ? 36.971  23.132 156.566 1.00 55.38  ? 927  ALA C C   1 
ATOM   3918 O O   . ALA C 1 49  ? 36.102  23.353 155.731 1.00 55.20  ? 927  ALA C O   1 
ATOM   3919 C CB  . ALA C 1 49  ? 37.406  20.872 157.463 1.00 49.18  ? 927  ALA C CB  1 
ATOM   3920 N N   . LEU C 1 50  ? 37.142  23.842 157.684 1.00 54.61  ? 928  LEU C N   1 
ATOM   3921 C CA  . LEU C 1 50  ? 36.317  24.999 158.045 1.00 53.92  ? 928  LEU C CA  1 
ATOM   3922 C C   . LEU C 1 50  ? 36.475  26.146 157.053 1.00 55.77  ? 928  LEU C C   1 
ATOM   3923 O O   . LEU C 1 50  ? 35.530  26.864 156.786 1.00 56.67  ? 928  LEU C O   1 
ATOM   3924 C CB  . LEU C 1 50  ? 36.643  25.438 159.477 1.00 53.83  ? 928  LEU C CB  1 
ATOM   3925 C CG  . LEU C 1 50  ? 35.741  25.101 160.684 1.00 56.43  ? 928  LEU C CG  1 
ATOM   3926 C CD1 . LEU C 1 50  ? 34.613  24.108 160.435 1.00 55.54  ? 928  LEU C CD1 1 
ATOM   3927 C CD2 . LEU C 1 50  ? 36.600  24.675 161.820 1.00 54.69  ? 928  LEU C CD2 1 
ATOM   3928 N N   . LEU C 1 51  ? 37.670  26.270 156.487 1.00 50.48  ? 929  LEU C N   1 
ATOM   3929 C CA  . LEU C 1 51  ? 37.989  27.259 155.457 1.00 49.91  ? 929  LEU C CA  1 
ATOM   3930 C C   . LEU C 1 51  ? 37.443  26.816 154.087 1.00 57.62  ? 929  LEU C C   1 
ATOM   3931 O O   . LEU C 1 51  ? 37.038  27.646 153.262 1.00 58.89  ? 929  LEU C O   1 
ATOM   3932 C CB  . LEU C 1 51  ? 39.526  27.457 155.365 1.00 48.41  ? 929  LEU C CB  1 
ATOM   3933 C CG  . LEU C 1 51  ? 40.156  28.473 156.357 1.00 48.97  ? 929  LEU C CG  1 
ATOM   3934 C CD1 . LEU C 1 51  ? 41.675  28.516 156.263 1.00 46.47  ? 929  LEU C CD1 1 
ATOM   3935 C CD2 . LEU C 1 51  ? 39.538  29.873 156.225 1.00 45.42  ? 929  LEU C CD2 1 
ATOM   3936 N N   . MET C 1 52  ? 37.467  25.506 153.836 1.00 53.09  ? 930  MET C N   1 
ATOM   3937 C CA  . MET C 1 52  ? 36.995  24.969 152.581 1.00 51.48  ? 930  MET C CA  1 
ATOM   3938 C C   . MET C 1 52  ? 35.476  25.011 152.509 1.00 57.52  ? 930  MET C C   1 
ATOM   3939 O O   . MET C 1 52  ? 34.905  25.059 151.407 1.00 59.03  ? 930  MET C O   1 
ATOM   3940 C CB  . MET C 1 52  ? 37.519  23.561 152.368 1.00 53.29  ? 930  MET C CB  1 
ATOM   3941 C CG  . MET C 1 52  ? 37.069  22.947 151.038 1.00 56.63  ? 930  MET C CG  1 
ATOM   3942 S SD  . MET C 1 52  ? 37.609  23.859 149.531 1.00 59.30  ? 930  MET C SD  1 
ATOM   3943 C CE  . MET C 1 52  ? 39.472  23.538 149.525 1.00 54.14  ? 930  MET C CE  1 
ATOM   3944 N N   . ALA C 1 53  ? 34.837  25.021 153.684 1.00 52.29  ? 931  ALA C N   1 
ATOM   3945 C CA  . ALA C 1 53  ? 33.379  25.124 153.804 1.00 51.93  ? 931  ALA C CA  1 
ATOM   3946 C C   . ALA C 1 53  ? 33.048  26.565 153.454 1.00 57.88  ? 931  ALA C C   1 
ATOM   3947 O O   . ALA C 1 53  ? 32.039  26.878 152.788 1.00 59.75  ? 931  ALA C O   1 
ATOM   3948 C CB  . ALA C 1 53  ? 32.927  24.829 155.233 1.00 52.45  ? 931  ALA C CB  1 
ATOM   3949 N N   . GLU C 1 54  ? 33.939  27.452 153.880 1.00 51.96  ? 932  GLU C N   1 
ATOM   3950 C CA  . GLU C 1 54  ? 33.809  28.867 153.565 1.00 49.39  ? 932  GLU C CA  1 
ATOM   3951 C C   . GLU C 1 54  ? 33.935  28.991 152.043 1.00 53.97  ? 932  GLU C C   1 
ATOM   3952 O O   . GLU C 1 54  ? 33.067  29.547 151.396 1.00 53.42  ? 932  GLU C O   1 
ATOM   3953 C CB  . GLU C 1 54  ? 34.902  29.670 154.285 1.00 48.96  ? 932  GLU C CB  1 
ATOM   3954 C CG  . GLU C 1 54  ? 34.575  31.114 154.490 1.00 42.26  ? 932  GLU C CG  1 
ATOM   3955 C CD  . GLU C 1 54  ? 35.809  31.964 154.622 1.00 61.05  ? 932  GLU C CD  1 
ATOM   3956 O OE1 . GLU C 1 54  ? 35.692  33.208 154.421 1.00 47.67  ? 932  GLU C OE1 1 
ATOM   3957 O OE2 . GLU C 1 54  ? 36.889  31.371 154.906 1.00 42.49  ? 932  GLU C OE2 1 
ATOM   3958 N N   . MET C 1 55  ? 34.991  28.416 151.477 1.00 51.78  ? 933  MET C N   1 
ATOM   3959 C CA  . MET C 1 55  ? 35.193  28.480 150.034 1.00 52.92  ? 933  MET C CA  1 
ATOM   3960 C C   . MET C 1 55  ? 33.986  28.003 149.250 1.00 61.50  ? 933  MET C C   1 
ATOM   3961 O O   . MET C 1 55  ? 33.638  28.559 148.197 1.00 61.20  ? 933  MET C O   1 
ATOM   3962 C CB  . MET C 1 55  ? 36.414  27.682 149.616 1.00 54.44  ? 933  MET C CB  1 
ATOM   3963 C CG  . MET C 1 55  ? 37.140  28.303 148.451 1.00 56.64  ? 933  MET C CG  1 
ATOM   3964 S SD  . MET C 1 55  ? 38.549  27.373 147.831 1.00 58.73  ? 933  MET C SD  1 
ATOM   3965 C CE  . MET C 1 55  ? 39.857  28.381 148.282 1.00 56.15  ? 933  MET C CE  1 
ATOM   3966 N N   . SER C 1 56  ? 33.350  26.964 149.780 1.00 59.94  ? 934  SER C N   1 
ATOM   3967 C CA  . SER C 1 56  ? 32.190  26.362 149.150 1.00 59.34  ? 934  SER C CA  1 
ATOM   3968 C C   . SER C 1 56  ? 31.064  27.379 149.054 1.00 65.35  ? 934  SER C C   1 
ATOM   3969 O O   . SER C 1 56  ? 30.136  27.212 148.269 1.00 67.01  ? 934  SER C O   1 
ATOM   3970 C CB  . SER C 1 56  ? 31.774  25.113 149.924 1.00 61.21  ? 934  SER C CB  1 
ATOM   3971 O OG  . SER C 1 56  ? 30.379  25.065 150.122 1.00 69.24  ? 934  SER C OG  1 
ATOM   3972 N N   . ARG C 1 57  ? 31.172  28.460 149.824 1.00 60.58  ? 935  ARG C N   1 
ATOM   3973 C CA  . ARG C 1 57  ? 30.152  29.516 149.828 1.00 58.92  ? 935  ARG C CA  1 
ATOM   3974 C C   . ARG C 1 57  ? 30.564  30.697 148.975 1.00 61.17  ? 935  ARG C C   1 
ATOM   3975 O O   . ARG C 1 57  ? 29.747  31.316 148.298 1.00 61.56  ? 935  ARG C O   1 
ATOM   3976 C CB  . ARG C 1 57  ? 29.974  30.045 151.239 1.00 56.26  ? 935  ARG C CB  1 
ATOM   3977 C CG  . ARG C 1 57  ? 28.824  29.490 152.019 1.00 59.47  ? 935  ARG C CG  1 
ATOM   3978 C CD  . ARG C 1 57  ? 28.975  29.897 153.480 1.00 59.31  ? 935  ARG C CD  1 
ATOM   3979 N NE  . ARG C 1 57  ? 29.273  28.744 154.324 1.00 76.47  ? 935  ARG C NE  1 
ATOM   3980 C CZ  . ARG C 1 57  ? 30.222  28.704 155.253 1.00 86.82  ? 935  ARG C CZ  1 
ATOM   3981 N NH1 . ARG C 1 57  ? 30.994  29.759 155.481 1.00 61.74  ? 935  ARG C NH1 1 
ATOM   3982 N NH2 . ARG C 1 57  ? 30.404  27.588 155.945 1.00 76.21  ? 935  ARG C NH2 1 
ATOM   3983 N N   . LEU C 1 58  ? 31.834  31.051 149.104 1.00 56.29  ? 936  LEU C N   1 
ATOM   3984 C CA  . LEU C 1 58  ? 32.434  32.208 148.445 1.00 54.49  ? 936  LEU C CA  1 
ATOM   3985 C C   . LEU C 1 58  ? 32.369  32.015 146.955 1.00 60.14  ? 936  LEU C C   1 
ATOM   3986 O O   . LEU C 1 58  ? 31.965  32.903 146.203 1.00 58.81  ? 936  LEU C O   1 
ATOM   3987 C CB  . LEU C 1 58  ? 33.883  32.373 148.926 1.00 52.72  ? 936  LEU C CB  1 
ATOM   3988 C CG  . LEU C 1 58  ? 33.921  32.835 150.393 1.00 52.88  ? 936  LEU C CG  1 
ATOM   3989 C CD1 . LEU C 1 58  ? 35.301  32.865 150.992 1.00 51.40  ? 936  LEU C CD1 1 
ATOM   3990 C CD2 . LEU C 1 58  ? 33.299  34.191 150.493 1.00 48.32  ? 936  LEU C CD2 1 
ATOM   3991 N N   . VAL C 1 59  ? 32.684  30.792 146.570 1.00 58.95  ? 937  VAL C N   1 
ATOM   3992 C CA  . VAL C 1 59  ? 32.651  30.360 145.197 1.00 59.74  ? 937  VAL C CA  1 
ATOM   3993 C C   . VAL C 1 59  ? 31.269  30.538 144.534 1.00 70.60  ? 937  VAL C C   1 
ATOM   3994 O O   . VAL C 1 59  ? 31.167  30.606 143.303 1.00 71.48  ? 937  VAL C O   1 
ATOM   3995 C CB  . VAL C 1 59  ? 33.110  28.937 145.146 1.00 61.72  ? 937  VAL C CB  1 
ATOM   3996 C CG1 . VAL C 1 59  ? 31.961  28.025 144.838 1.00 60.91  ? 937  VAL C CG1 1 
ATOM   3997 C CG2 . VAL C 1 59  ? 34.245  28.799 144.228 1.00 61.26  ? 937  VAL C CG2 1 
ATOM   3998 N N   . ARG C 1 60  ? 30.210  30.653 145.334 1.00 70.06  ? 938  ARG C N   1 
ATOM   3999 C CA  . ARG C 1 60  ? 28.881  30.795 144.765 1.00 71.24  ? 938  ARG C CA  1 
ATOM   4000 C C   . ARG C 1 60  ? 28.555  32.219 144.359 1.00 83.60  ? 938  ARG C C   1 
ATOM   4001 O O   . ARG C 1 60  ? 27.416  32.539 143.992 1.00 84.52  ? 938  ARG C O   1 
ATOM   4002 C CB  . ARG C 1 60  ? 27.813  30.168 145.643 1.00 65.94  ? 938  ARG C CB  1 
ATOM   4003 C CG  . ARG C 1 60  ? 27.717  28.634 145.465 1.00 74.27  ? 938  ARG C CG  1 
ATOM   4004 C CD  . ARG C 1 60  ? 27.342  28.213 144.025 1.00 78.13  ? 938  ARG C CD  1 
ATOM   4005 N NE  . ARG C 1 60  ? 25.930  28.453 143.719 1.00 81.85  ? 938  ARG C NE  1 
ATOM   4006 C CZ  . ARG C 1 60  ? 24.920  27.733 144.197 1.00 101.03 ? 938  ARG C CZ  1 
ATOM   4007 N NH1 . ARG C 1 60  ? 25.152  26.697 144.985 1.00 96.21  ? 938  ARG C NH1 1 
ATOM   4008 N NH2 . ARG C 1 60  ? 23.673  28.054 143.896 1.00 87.62  ? 938  ARG C NH2 1 
ATOM   4009 N N   . GLY C 1 61  ? 29.599  33.048 144.346 1.00 83.39  ? 939  GLY C N   1 
ATOM   4010 C CA  . GLY C 1 61  ? 29.520  34.448 143.970 1.00 83.53  ? 939  GLY C CA  1 
ATOM   4011 C C   . GLY C 1 61  ? 28.969  35.191 145.155 1.00 88.62  ? 939  GLY C C   1 
ATOM   4012 O O   . GLY C 1 61  ? 28.672  34.581 146.178 1.00 87.83  ? 939  GLY C O   1 
ATOM   4013 N N   . GLY C 1 62  ? 28.821  36.502 145.038 1.00 87.24  ? 940  GLY C N   1 
ATOM   4014 C CA  . GLY C 1 62  ? 28.229  37.236 146.139 1.00 87.87  ? 940  GLY C CA  1 
ATOM   4015 C C   . GLY C 1 62  ? 28.808  38.608 146.324 1.00 94.32  ? 940  GLY C C   1 
ATOM   4016 O O   . GLY C 1 62  ? 29.574  39.086 145.467 1.00 95.97  ? 940  GLY C O   1 
ATOM   4017 N N   . SER C 1 63  ? 28.420  39.244 147.431 1.00 89.80  ? 941  SER C N   1 
ATOM   4018 C CA  . SER C 1 63  ? 28.939  40.559 147.780 1.00 89.07  ? 941  SER C CA  1 
ATOM   4019 C C   . SER C 1 63  ? 30.167  40.410 148.675 1.00 91.86  ? 941  SER C C   1 
ATOM   4020 O O   . SER C 1 63  ? 30.106  39.770 149.733 1.00 90.91  ? 941  SER C O   1 
ATOM   4021 C CB  . SER C 1 63  ? 27.895  41.437 148.463 1.00 91.98  ? 941  SER C CB  1 
ATOM   4022 O OG  . SER C 1 63  ? 28.446  42.715 148.774 1.00 97.78  ? 941  SER C OG  1 
ATOM   4023 N N   . GLY C 1 64  ? 31.276  40.992 148.215 1.00 86.69  ? 942  GLY C N   1 
ATOM   4024 C CA  . GLY C 1 64  ? 32.559  40.977 148.885 1.00 84.98  ? 942  GLY C CA  1 
ATOM   4025 C C   . GLY C 1 64  ? 33.294  39.665 148.721 1.00 83.99  ? 942  GLY C C   1 
ATOM   4026 O O   . GLY C 1 64  ? 34.349  39.472 149.330 1.00 83.18  ? 942  GLY C O   1 
ATOM   4027 N N   . THR C 1 65  ? 32.740  38.774 147.896 1.00 76.38  ? 943  THR C N   1 
ATOM   4028 C CA  . THR C 1 65  ? 33.288  37.435 147.703 1.00 74.13  ? 943  THR C CA  1 
ATOM   4029 C C   . THR C 1 65  ? 34.668  37.313 147.068 1.00 72.56  ? 943  THR C C   1 
ATOM   4030 O O   . THR C 1 65  ? 35.444  36.412 147.425 1.00 70.45  ? 943  THR C O   1 
ATOM   4031 C CB  . THR C 1 65  ? 32.255  36.494 147.074 1.00 81.88  ? 943  THR C CB  1 
ATOM   4032 O OG1 . THR C 1 65  ? 31.892  36.976 145.777 1.00 86.18  ? 943  THR C OG1 1 
ATOM   4033 C CG2 . THR C 1 65  ? 31.006  36.442 147.944 1.00 78.63  ? 943  THR C CG2 1 
ATOM   4034 N N   . LYS C 1 66  ? 34.958  38.235 146.145 1.00 65.44  ? 944  LYS C N   1 
ATOM   4035 C CA  . LYS C 1 66  ? 36.202  38.255 145.385 1.00 62.98  ? 944  LYS C CA  1 
ATOM   4036 C C   . LYS C 1 66  ? 37.406  38.327 146.289 1.00 62.03  ? 944  LYS C C   1 
ATOM   4037 O O   . LYS C 1 66  ? 38.258  37.440 146.288 1.00 59.59  ? 944  LYS C O   1 
ATOM   4038 C CB  . LYS C 1 66  ? 36.192  39.422 144.381 1.00 65.54  ? 944  LYS C CB  1 
ATOM   4039 C CG  . LYS C 1 66  ? 37.546  40.064 144.083 1.00 71.66  ? 944  LYS C CG  1 
ATOM   4040 C CD  . LYS C 1 66  ? 37.579  40.763 142.746 1.00 72.80  ? 944  LYS C CD  1 
ATOM   4041 C CE  . LYS C 1 66  ? 39.005  40.969 142.279 1.00 83.72  ? 944  LYS C CE  1 
ATOM   4042 N NZ  . LYS C 1 66  ? 39.108  41.303 140.828 1.00 89.94  ? 944  LYS C NZ  1 
ATOM   4043 N N   . ARG C 1 67  ? 37.471  39.411 147.050 1.00 57.07  ? 945  ARG C N   1 
ATOM   4044 C CA  . ARG C 1 67  ? 38.563  39.669 147.967 1.00 55.76  ? 945  ARG C CA  1 
ATOM   4045 C C   . ARG C 1 67  ? 38.687  38.583 149.019 1.00 58.45  ? 945  ARG C C   1 
ATOM   4046 O O   . ARG C 1 67  ? 39.805  38.236 149.424 1.00 57.31  ? 945  ARG C O   1 
ATOM   4047 C CB  . ARG C 1 67  ? 38.312  40.986 148.671 1.00 56.71  ? 945  ARG C CB  1 
ATOM   4048 C CG  . ARG C 1 67  ? 38.849  42.219 148.001 1.00 52.34  ? 945  ARG C CG  1 
ATOM   4049 C CD  . ARG C 1 67  ? 39.591  43.062 149.026 1.00 51.45  ? 945  ARG C CD  1 
ATOM   4050 N NE  . ARG C 1 67  ? 38.839  44.233 149.453 1.00 63.32  ? 945  ARG C NE  1 
ATOM   4051 C CZ  . ARG C 1 67  ? 39.098  44.893 150.574 1.00 87.75  ? 945  ARG C CZ  1 
ATOM   4052 N NH1 . ARG C 1 67  ? 40.076  44.477 151.374 1.00 69.25  ? 945  ARG C NH1 1 
ATOM   4053 N NH2 . ARG C 1 67  ? 38.380  45.958 150.895 1.00 94.50  ? 945  ARG C NH2 1 
ATOM   4054 N N   . ALA C 1 68  ? 37.541  38.086 149.496 1.00 54.77  ? 946  ALA C N   1 
ATOM   4055 C CA  . ALA C 1 68  ? 37.514  37.027 150.526 1.00 54.02  ? 946  ALA C CA  1 
ATOM   4056 C C   . ALA C 1 68  ? 37.941  35.680 149.973 1.00 57.36  ? 946  ALA C C   1 
ATOM   4057 O O   . ALA C 1 68  ? 38.687  34.963 150.618 1.00 57.39  ? 946  ALA C O   1 
ATOM   4058 C CB  . ALA C 1 68  ? 36.149  36.930 151.220 1.00 54.11  ? 946  ALA C CB  1 
ATOM   4059 N N   . LEU C 1 69  ? 37.478  35.348 148.770 1.00 52.72  ? 947  LEU C N   1 
ATOM   4060 C CA  . LEU C 1 69  ? 37.852  34.103 148.123 1.00 52.46  ? 947  LEU C CA  1 
ATOM   4061 C C   . LEU C 1 69  ? 39.356  33.979 147.900 1.00 53.96  ? 947  LEU C C   1 
ATOM   4062 O O   . LEU C 1 69  ? 39.928  32.902 148.075 1.00 53.64  ? 947  LEU C O   1 
ATOM   4063 C CB  . LEU C 1 69  ? 37.111  33.953 146.795 1.00 52.90  ? 947  LEU C CB  1 
ATOM   4064 C CG  . LEU C 1 69  ? 37.435  32.726 145.938 1.00 55.88  ? 947  LEU C CG  1 
ATOM   4065 C CD1 . LEU C 1 69  ? 37.278  31.435 146.728 1.00 55.75  ? 947  LEU C CD1 1 
ATOM   4066 C CD2 . LEU C 1 69  ? 36.523  32.733 144.759 1.00 56.14  ? 947  LEU C CD2 1 
ATOM   4067 N N   . ILE C 1 70  ? 39.988  35.090 147.529 1.00 48.94  ? 948  ILE C N   1 
ATOM   4068 C CA  . ILE C 1 70  ? 41.439  35.146 147.324 1.00 47.63  ? 948  ILE C CA  1 
ATOM   4069 C C   . ILE C 1 70  ? 42.174  34.905 148.636 1.00 52.77  ? 948  ILE C C   1 
ATOM   4070 O O   . ILE C 1 70  ? 43.136  34.166 148.694 1.00 53.39  ? 948  ILE C O   1 
ATOM   4071 C CB  . ILE C 1 70  ? 41.866  36.499 146.684 1.00 48.81  ? 948  ILE C CB  1 
ATOM   4072 C CG1 . ILE C 1 70  ? 41.524  36.513 145.185 1.00 49.34  ? 948  ILE C CG1 1 
ATOM   4073 C CG2 . ILE C 1 70  ? 43.339  36.792 146.930 1.00 42.56  ? 948  ILE C CG2 1 
ATOM   4074 C CD1 . ILE C 1 70  ? 41.162  37.878 144.643 1.00 40.77  ? 948  ILE C CD1 1 
ATOM   4075 N N   . GLN C 1 71  ? 41.713  35.562 149.686 1.00 50.09  ? 949  GLN C N   1 
ATOM   4076 C CA  . GLN C 1 71  ? 42.297  35.440 151.014 1.00 50.13  ? 949  GLN C CA  1 
ATOM   4077 C C   . GLN C 1 71  ? 42.048  34.035 151.560 1.00 55.10  ? 949  GLN C C   1 
ATOM   4078 O O   . GLN C 1 71  ? 42.963  33.379 152.053 1.00 53.72  ? 949  GLN C O   1 
ATOM   4079 C CB  . GLN C 1 71  ? 41.682  36.485 151.948 1.00 50.92  ? 949  GLN C CB  1 
ATOM   4080 C CG  . GLN C 1 71  ? 42.472  36.717 153.206 1.00 48.83  ? 949  GLN C CG  1 
ATOM   4081 C CD  . GLN C 1 71  ? 43.939  36.994 152.938 1.00 57.32  ? 949  GLN C CD  1 
ATOM   4082 O OE1 . GLN C 1 71  ? 44.813  36.373 153.529 1.00 40.10  ? 949  GLN C OE1 1 
ATOM   4083 N NE2 . GLN C 1 71  ? 44.214  37.934 152.040 1.00 59.09  ? 949  GLN C NE2 1 
ATOM   4084 N N   . CYS C 1 72  ? 40.806  33.584 151.459 1.00 52.46  ? 950  CYS C N   1 
ATOM   4085 C CA  . CYS C 1 72  ? 40.459  32.230 151.844 1.00 54.30  ? 950  CYS C CA  1 
ATOM   4086 C C   . CYS C 1 72  ? 41.485  31.227 151.309 1.00 57.58  ? 950  CYS C C   1 
ATOM   4087 O O   . CYS C 1 72  ? 42.054  30.459 152.065 1.00 56.08  ? 950  CYS C O   1 
ATOM   4088 C CB  . CYS C 1 72  ? 39.064  31.872 151.326 1.00 55.54  ? 950  CYS C CB  1 
ATOM   4089 S SG  . CYS C 1 72  ? 38.415  30.346 151.987 1.00 59.62  ? 950  CYS C SG  1 
ATOM   4090 N N   . ALA C 1 73  ? 41.782  31.283 150.017 1.00 54.88  ? 951  ALA C N   1 
ATOM   4091 C CA  . ALA C 1 73  ? 42.782  30.368 149.469 1.00 54.81  ? 951  ALA C CA  1 
ATOM   4092 C C   . ALA C 1 73  ? 44.212  30.612 149.928 1.00 57.64  ? 951  ALA C C   1 
ATOM   4093 O O   . ALA C 1 73  ? 45.022  29.692 149.947 1.00 58.46  ? 951  ALA C O   1 
ATOM   4094 C CB  . ALA C 1 73  ? 42.694  30.284 147.985 1.00 55.72  ? 951  ALA C CB  1 
ATOM   4095 N N   . LYS C 1 74  ? 44.508  31.838 150.341 1.00 52.66  ? 952  LYS C N   1 
ATOM   4096 C CA  . LYS C 1 74  ? 45.829  32.169 150.887 1.00 51.50  ? 952  LYS C CA  1 
ATOM   4097 C C   . LYS C 1 74  ? 45.948  31.575 152.299 1.00 56.15  ? 952  LYS C C   1 
ATOM   4098 O O   . LYS C 1 74  ? 46.982  31.033 152.696 1.00 54.69  ? 952  LYS C O   1 
ATOM   4099 C CB  . LYS C 1 74  ? 46.007  33.681 150.947 1.00 52.21  ? 952  LYS C CB  1 
ATOM   4100 C CG  . LYS C 1 74  ? 46.234  34.357 149.594 1.00 49.29  ? 952  LYS C CG  1 
ATOM   4101 C CD  . LYS C 1 74  ? 46.957  35.695 149.712 1.00 44.74  ? 952  LYS C CD  1 
ATOM   4102 C CE  . LYS C 1 74  ? 46.773  36.589 148.483 1.00 51.51  ? 952  LYS C CE  1 
ATOM   4103 N NZ  . LYS C 1 74  ? 45.996  37.825 148.781 1.00 76.44  ? 952  LYS C NZ  1 
ATOM   4104 N N   . ASP C 1 75  ? 44.857  31.668 153.047 1.00 53.67  ? 953  ASP C N   1 
ATOM   4105 C CA  . ASP C 1 75  ? 44.806  31.099 154.378 1.00 52.28  ? 953  ASP C CA  1 
ATOM   4106 C C   . ASP C 1 75  ? 45.001  29.597 154.195 1.00 57.70  ? 953  ASP C C   1 
ATOM   4107 O O   . ASP C 1 75  ? 46.009  29.056 154.660 1.00 59.88  ? 953  ASP C O   1 
ATOM   4108 C CB  . ASP C 1 75  ? 43.456  31.385 155.076 1.00 52.71  ? 953  ASP C CB  1 
ATOM   4109 C CG  . ASP C 1 75  ? 43.239  32.850 155.369 1.00 51.49  ? 953  ASP C CG  1 
ATOM   4110 O OD1 . ASP C 1 75  ? 44.247  33.595 155.430 1.00 51.05  ? 953  ASP C OD1 1 
ATOM   4111 O OD2 . ASP C 1 75  ? 42.060  33.247 155.487 1.00 50.41  ? 953  ASP C OD2 1 
ATOM   4112 N N   . ILE C 1 76  ? 44.064  28.946 153.489 1.00 51.22  ? 954  ILE C N   1 
ATOM   4113 C CA  . ILE C 1 76  ? 44.094  27.490 153.258 1.00 49.24  ? 954  ILE C CA  1 
ATOM   4114 C C   . ILE C 1 76  ? 45.469  27.052 152.851 1.00 50.88  ? 954  ILE C C   1 
ATOM   4115 O O   . ILE C 1 76  ? 45.908  25.991 153.224 1.00 50.74  ? 954  ILE C O   1 
ATOM   4116 C CB  . ILE C 1 76  ? 43.113  27.017 152.158 1.00 51.66  ? 954  ILE C CB  1 
ATOM   4117 C CG1 . ILE C 1 76  ? 41.662  27.074 152.592 1.00 50.83  ? 954  ILE C CG1 1 
ATOM   4118 C CG2 . ILE C 1 76  ? 43.370  25.583 151.855 1.00 53.53  ? 954  ILE C CG2 1 
ATOM   4119 C CD1 . ILE C 1 76  ? 40.716  26.823 151.462 1.00 49.49  ? 954  ILE C CD1 1 
ATOM   4120 N N   . ALA C 1 77  ? 46.121  27.867 152.036 1.00 47.59  ? 955  ALA C N   1 
ATOM   4121 C CA  . ALA C 1 77  ? 47.474  27.589 151.566 1.00 46.88  ? 955  ALA C CA  1 
ATOM   4122 C C   . ALA C 1 77  ? 48.463  27.666 152.721 1.00 52.50  ? 955  ALA C C   1 
ATOM   4123 O O   . ALA C 1 77  ? 49.314  26.822 152.857 1.00 53.29  ? 955  ALA C O   1 
ATOM   4124 C CB  . ALA C 1 77  ? 47.850  28.551 150.467 1.00 46.90  ? 955  ALA C CB  1 
ATOM   4125 N N   . LYS C 1 78  ? 48.277  28.625 153.617 1.00 50.83  ? 956  LYS C N   1 
ATOM   4126 C CA  . LYS C 1 78  ? 49.137  28.748 154.790 1.00 50.41  ? 956  LYS C CA  1 
ATOM   4127 C C   . LYS C 1 78  ? 49.042  27.524 155.720 1.00 55.01  ? 956  LYS C C   1 
ATOM   4128 O O   . LYS C 1 78  ? 50.037  27.056 156.272 1.00 52.98  ? 956  LYS C O   1 
ATOM   4129 C CB  . LYS C 1 78  ? 48.761  30.005 155.562 1.00 51.05  ? 956  LYS C CB  1 
ATOM   4130 C CG  . LYS C 1 78  ? 49.842  30.477 156.549 1.00 63.39  ? 956  LYS C CG  1 
ATOM   4131 C CD  . LYS C 1 78  ? 49.288  31.514 157.556 1.00 67.55  ? 956  LYS C CD  1 
ATOM   4132 C CE  . LYS C 1 78  ? 50.333  32.006 158.573 1.00 77.67  ? 956  LYS C CE  1 
ATOM   4133 N NZ  . LYS C 1 78  ? 49.796  33.087 159.481 1.00 94.39  ? 956  LYS C NZ  1 
ATOM   4134 N N   . ALA C 1 79  ? 47.826  27.017 155.881 1.00 54.09  ? 957  ALA C N   1 
ATOM   4135 C CA  . ALA C 1 79  ? 47.547  25.889 156.762 1.00 54.53  ? 957  ALA C CA  1 
ATOM   4136 C C   . ALA C 1 79  ? 48.107  24.596 156.221 1.00 60.60  ? 957  ALA C C   1 
ATOM   4137 O O   . ALA C 1 79  ? 48.648  23.789 156.957 1.00 60.96  ? 957  ALA C O   1 
ATOM   4138 C CB  . ALA C 1 79  ? 46.049  25.746 156.986 1.00 55.22  ? 957  ALA C CB  1 
ATOM   4139 N N   . SER C 1 80  ? 47.926  24.368 154.933 1.00 58.80  ? 958  SER C N   1 
ATOM   4140 C CA  . SER C 1 80  ? 48.444  23.154 154.319 1.00 58.73  ? 958  SER C CA  1 
ATOM   4141 C C   . SER C 1 80  ? 49.972  23.162 154.492 1.00 63.66  ? 958  SER C C   1 
ATOM   4142 O O   . SER C 1 80  ? 50.585  22.114 154.575 1.00 63.43  ? 958  SER C O   1 
ATOM   4143 C CB  . SER C 1 80  ? 48.115  23.173 152.835 1.00 60.15  ? 958  SER C CB  1 
ATOM   4144 O OG  . SER C 1 80  ? 48.894  24.193 152.228 1.00 68.12  ? 958  SER C OG  1 
ATOM   4145 N N   . ASP C 1 81  ? 50.578  24.349 154.501 1.00 60.67  ? 959  ASP C N   1 
ATOM   4146 C CA  . ASP C 1 81  ? 52.022  24.482 154.691 1.00 60.85  ? 959  ASP C CA  1 
ATOM   4147 C C   . ASP C 1 81  ? 52.444  23.928 156.047 1.00 65.48  ? 959  ASP C C   1 
ATOM   4148 O O   . ASP C 1 81  ? 53.378  23.132 156.143 1.00 68.07  ? 959  ASP C O   1 
ATOM   4149 C CB  . ASP C 1 81  ? 52.421  25.949 154.594 1.00 63.08  ? 959  ASP C CB  1 
ATOM   4150 C CG  . ASP C 1 81  ? 52.522  26.426 153.152 1.00 77.34  ? 959  ASP C CG  1 
ATOM   4151 O OD1 . ASP C 1 81  ? 52.667  25.552 152.269 1.00 76.85  ? 959  ASP C OD1 1 
ATOM   4152 O OD2 . ASP C 1 81  ? 52.433  27.654 152.901 1.00 86.33  ? 959  ASP C OD2 1 
ATOM   4153 N N   . GLU C 1 82  ? 51.747  24.343 157.097 1.00 59.64  ? 960  GLU C N   1 
ATOM   4154 C CA  . GLU C 1 82  ? 52.025  23.843 158.447 1.00 59.16  ? 960  GLU C CA  1 
ATOM   4155 C C   . GLU C 1 82  ? 51.917  22.318 158.411 1.00 65.68  ? 960  GLU C C   1 
ATOM   4156 O O   . GLU C 1 82  ? 52.723  21.611 159.020 1.00 68.93  ? 960  GLU C O   1 
ATOM   4157 C CB  . GLU C 1 82  ? 50.976  24.377 159.443 1.00 59.84  ? 960  GLU C CB  1 
ATOM   4158 C CG  . GLU C 1 82  ? 51.456  24.668 160.879 1.00 66.29  ? 960  GLU C CG  1 
ATOM   4159 C CD  . GLU C 1 82  ? 50.288  24.921 161.849 1.00 86.76  ? 960  GLU C CD  1 
ATOM   4160 O OE1 . GLU C 1 82  ? 50.279  24.294 162.944 1.00 78.66  ? 960  GLU C OE1 1 
ATOM   4161 O OE2 . GLU C 1 82  ? 49.381  25.738 161.511 1.00 70.60  ? 960  GLU C OE2 1 
ATOM   4162 N N   . VAL C 1 83  ? 50.884  21.822 157.733 1.00 58.64  ? 961  VAL C N   1 
ATOM   4163 C CA  . VAL C 1 83  ? 50.609  20.398 157.641 1.00 56.11  ? 961  VAL C CA  1 
ATOM   4164 C C   . VAL C 1 83  ? 51.757  19.677 156.911 1.00 61.74  ? 961  VAL C C   1 
ATOM   4165 O O   . VAL C 1 83  ? 52.193  18.606 157.311 1.00 61.71  ? 961  VAL C O   1 
ATOM   4166 C CB  . VAL C 1 83  ? 49.192  20.166 157.011 1.00 57.42  ? 961  VAL C CB  1 
ATOM   4167 C CG1 . VAL C 1 83  ? 49.005  18.705 156.507 1.00 56.04  ? 961  VAL C CG1 1 
ATOM   4168 C CG2 . VAL C 1 83  ? 48.073  20.600 158.013 1.00 56.75  ? 961  VAL C CG2 1 
ATOM   4169 N N   . THR C 1 84  ? 52.301  20.301 155.883 1.00 59.86  ? 962  THR C N   1 
ATOM   4170 C CA  . THR C 1 84  ? 53.406  19.691 155.154 1.00 60.64  ? 962  THR C CA  1 
ATOM   4171 C C   . THR C 1 84  ? 54.625  19.659 156.074 1.00 64.70  ? 962  THR C C   1 
ATOM   4172 O O   . THR C 1 84  ? 55.206  18.601 156.363 1.00 62.93  ? 962  THR C O   1 
ATOM   4173 C CB  . THR C 1 84  ? 53.715  20.476 153.850 1.00 69.83  ? 962  THR C CB  1 
ATOM   4174 O OG1 . THR C 1 84  ? 52.577  20.430 152.976 1.00 70.54  ? 962  THR C OG1 1 
ATOM   4175 C CG2 . THR C 1 84  ? 54.922  19.889 153.136 1.00 66.52  ? 962  THR C CG2 1 
ATOM   4176 N N   . ARG C 1 85  ? 54.977  20.842 156.556 1.00 62.39  ? 963  ARG C N   1 
ATOM   4177 C CA  . ARG C 1 85  ? 56.100  21.013 157.466 1.00 62.84  ? 963  ARG C CA  1 
ATOM   4178 C C   . ARG C 1 85  ? 56.099  20.036 158.683 1.00 67.03  ? 963  ARG C C   1 
ATOM   4179 O O   . ARG C 1 85  ? 57.119  19.380 158.947 1.00 67.09  ? 963  ARG C O   1 
ATOM   4180 C CB  . ARG C 1 85  ? 56.193  22.497 157.869 1.00 61.32  ? 963  ARG C CB  1 
ATOM   4181 C CG  . ARG C 1 85  ? 56.437  22.759 159.330 1.00 68.27  ? 963  ARG C CG  1 
ATOM   4182 C CD  . ARG C 1 85  ? 56.372  24.256 159.631 1.00 77.65  ? 963  ARG C CD  1 
ATOM   4183 N NE  . ARG C 1 85  ? 55.448  24.578 160.725 1.00 95.67  ? 963  ARG C NE  1 
ATOM   4184 C CZ  . ARG C 1 85  ? 55.611  24.209 161.999 1.00 105.65 ? 963  ARG C CZ  1 
ATOM   4185 N NH1 . ARG C 1 85  ? 56.670  23.479 162.369 1.00 92.54  ? 963  ARG C NH1 1 
ATOM   4186 N NH2 . ARG C 1 85  ? 54.702  24.567 162.908 1.00 78.44  ? 963  ARG C NH2 1 
ATOM   4187 N N   . LEU C 1 86  ? 54.955  19.942 159.380 1.00 63.26  ? 964  LEU C N   1 
ATOM   4188 C CA  . LEU C 1 86  ? 54.730  19.055 160.542 1.00 62.65  ? 964  LEU C CA  1 
ATOM   4189 C C   . LEU C 1 86  ? 54.701  17.591 160.109 1.00 66.98  ? 964  LEU C C   1 
ATOM   4190 O O   . LEU C 1 86  ? 55.040  16.710 160.875 1.00 66.78  ? 964  LEU C O   1 
ATOM   4191 C CB  . LEU C 1 86  ? 53.365  19.336 161.206 1.00 62.25  ? 964  LEU C CB  1 
ATOM   4192 C CG  . LEU C 1 86  ? 52.963  20.601 161.980 1.00 65.82  ? 964  LEU C CG  1 
ATOM   4193 C CD1 . LEU C 1 86  ? 51.567  20.441 162.569 1.00 64.67  ? 964  LEU C CD1 1 
ATOM   4194 C CD2 . LEU C 1 86  ? 53.932  20.923 163.090 1.00 69.19  ? 964  LEU C CD2 1 
ATOM   4195 N N   . ALA C 1 87  ? 54.228  17.338 158.897 1.00 64.47  ? 965  ALA C N   1 
ATOM   4196 C CA  . ALA C 1 87  ? 54.148  15.982 158.360 1.00 64.38  ? 965  ALA C CA  1 
ATOM   4197 C C   . ALA C 1 87  ? 55.543  15.426 158.064 1.00 70.16  ? 965  ALA C C   1 
ATOM   4198 O O   . ALA C 1 87  ? 55.791  14.226 158.252 1.00 71.36  ? 965  ALA C O   1 
ATOM   4199 C CB  . ALA C 1 87  ? 53.294  15.965 157.089 1.00 64.73  ? 965  ALA C CB  1 
ATOM   4200 N N   . LYS C 1 88  ? 56.437  16.300 157.590 1.00 66.44  ? 966  LYS C N   1 
ATOM   4201 C CA  . LYS C 1 88  ? 57.837  15.946 157.287 1.00 65.82  ? 966  LYS C CA  1 
ATOM   4202 C C   . LYS C 1 88  ? 58.683  15.669 158.556 1.00 72.54  ? 966  LYS C C   1 
ATOM   4203 O O   . LYS C 1 88  ? 59.639  14.873 158.522 1.00 72.73  ? 966  LYS C O   1 
ATOM   4204 C CB  . LYS C 1 88  ? 58.478  17.018 156.415 1.00 65.88  ? 966  LYS C CB  1 
ATOM   4205 C CG  . LYS C 1 88  ? 57.920  16.973 155.003 1.00 78.74  ? 966  LYS C CG  1 
ATOM   4206 C CD  . LYS C 1 88  ? 58.392  18.140 154.155 1.00 85.55  ? 966  LYS C CD  1 
ATOM   4207 C CE  . LYS C 1 88  ? 58.099  17.925 152.659 1.00 94.48  ? 966  LYS C CE  1 
ATOM   4208 N NZ  . LYS C 1 88  ? 58.722  18.976 151.787 1.00 99.12  ? 966  LYS C NZ  1 
ATOM   4209 N N   . GLU C 1 89  ? 58.299  16.285 159.682 1.00 68.33  ? 967  GLU C N   1 
ATOM   4210 C CA  . GLU C 1 89  ? 58.961  16.013 160.948 1.00 67.67  ? 967  GLU C CA  1 
ATOM   4211 C C   . GLU C 1 89  ? 58.603  14.600 161.408 1.00 72.51  ? 967  GLU C C   1 
ATOM   4212 O O   . GLU C 1 89  ? 59.491  13.799 161.710 1.00 74.26  ? 967  GLU C O   1 
ATOM   4213 C CB  . GLU C 1 89  ? 58.538  17.022 162.005 1.00 68.94  ? 967  GLU C CB  1 
ATOM   4214 C CG  . GLU C 1 89  ? 59.129  18.404 161.796 1.00 82.39  ? 967  GLU C CG  1 
ATOM   4215 C CD  . GLU C 1 89  ? 60.619  18.367 161.503 1.00 108.59 ? 967  GLU C CD  1 
ATOM   4216 O OE1 . GLU C 1 89  ? 61.265  17.324 161.778 1.00 103.31 ? 967  GLU C OE1 1 
ATOM   4217 O OE2 . GLU C 1 89  ? 61.139  19.390 161.004 1.00 104.24 ? 967  GLU C OE2 1 
ATOM   4218 N N   . VAL C 1 90  ? 57.301  14.300 161.424 1.00 67.21  ? 968  VAL C N   1 
ATOM   4219 C CA  . VAL C 1 90  ? 56.759  12.990 161.829 1.00 66.04  ? 968  VAL C CA  1 
ATOM   4220 C C   . VAL C 1 90  ? 57.395  11.851 161.050 1.00 70.77  ? 968  VAL C C   1 
ATOM   4221 O O   . VAL C 1 90  ? 57.687  10.787 161.625 1.00 71.21  ? 968  VAL C O   1 
ATOM   4222 C CB  . VAL C 1 90  ? 55.203  12.928 161.644 1.00 68.38  ? 968  VAL C CB  1 
ATOM   4223 C CG1 . VAL C 1 90  ? 54.727  11.468 161.504 1.00 67.22  ? 968  VAL C CG1 1 
ATOM   4224 C CG2 . VAL C 1 90  ? 54.455  13.682 162.793 1.00 67.61  ? 968  VAL C CG2 1 
ATOM   4225 N N   . ALA C 1 91  ? 57.544  12.072 159.739 1.00 67.02  ? 969  ALA C N   1 
ATOM   4226 C CA  . ALA C 1 91  ? 58.158  11.110 158.824 1.00 66.60  ? 969  ALA C CA  1 
ATOM   4227 C C   . ALA C 1 91  ? 59.633  10.941 159.235 1.00 72.47  ? 969  ALA C C   1 
ATOM   4228 O O   . ALA C 1 91  ? 60.134  9.813  159.367 1.00 71.69  ? 969  ALA C O   1 
ATOM   4229 C CB  . ALA C 1 91  ? 58.057  11.632 157.355 1.00 66.70  ? 969  ALA C CB  1 
ATOM   4230 N N   . LYS C 1 92  ? 60.298  12.079 159.457 1.00 71.08  ? 970  LYS C N   1 
ATOM   4231 C CA  . LYS C 1 92  ? 61.725  12.155 159.817 1.00 72.45  ? 970  LYS C CA  1 
ATOM   4232 C C   . LYS C 1 92  ? 62.109  11.493 161.159 1.00 78.79  ? 970  LYS C C   1 
ATOM   4233 O O   . LYS C 1 92  ? 63.314  11.303 161.457 1.00 78.93  ? 970  LYS C O   1 
ATOM   4234 C CB  . LYS C 1 92  ? 62.194  13.615 159.798 1.00 75.21  ? 970  LYS C CB  1 
ATOM   4235 C CG  . LYS C 1 92  ? 63.667  13.783 159.564 1.00 95.06  ? 970  LYS C CG  1 
ATOM   4236 C CD  . LYS C 1 92  ? 64.094  15.125 160.078 1.00 114.23 ? 970  LYS C CD  1 
ATOM   4237 C CE  . LYS C 1 92  ? 64.467  16.060 158.959 1.00 136.20 ? 970  LYS C CE  1 
ATOM   4238 N NZ  . LYS C 1 92  ? 65.770  15.688 158.339 1.00 147.41 ? 970  LYS C NZ  1 
ATOM   4239 N N   . GLN C 1 93  ? 61.076  11.140 161.942 1.00 74.46  ? 971  GLN C N   1 
ATOM   4240 C CA  . GLN C 1 93  ? 61.209  10.466 163.247 1.00 72.43  ? 971  GLN C CA  1 
ATOM   4241 C C   . GLN C 1 93  ? 60.575  9.074  163.229 1.00 73.53  ? 971  GLN C C   1 
ATOM   4242 O O   . GLN C 1 93  ? 60.441  8.449  164.277 1.00 72.31  ? 971  GLN C O   1 
ATOM   4243 C CB  . GLN C 1 93  ? 60.492  11.282 164.323 1.00 73.25  ? 971  GLN C CB  1 
ATOM   4244 C CG  . GLN C 1 93  ? 60.979  12.720 164.432 1.00 83.10  ? 971  GLN C CG  1 
ATOM   4245 C CD  . GLN C 1 93  ? 62.142  12.856 165.409 1.00 101.53 ? 971  GLN C CD  1 
ATOM   4246 O OE1 . GLN C 1 93  ? 62.244  12.091 166.383 1.00 90.73  ? 971  GLN C OE1 1 
ATOM   4247 N NE2 . GLN C 1 93  ? 63.047  13.805 165.136 1.00 98.05  ? 971  GLN C NE2 1 
ATOM   4248 N N   . CYS C 1 94  ? 60.135  8.624  162.054 1.00 69.61  ? 972  CYS C N   1 
ATOM   4249 C CA  . CYS C 1 94  ? 59.464  7.328  161.916 1.00 69.39  ? 972  CYS C CA  1 
ATOM   4250 C C   . CYS C 1 94  ? 60.454  6.257  161.450 1.00 74.49  ? 972  CYS C C   1 
ATOM   4251 O O   . CYS C 1 94  ? 61.306  6.523  160.588 1.00 74.03  ? 972  CYS C O   1 
ATOM   4252 C CB  . CYS C 1 94  ? 58.285  7.466  160.935 1.00 69.49  ? 972  CYS C CB  1 
ATOM   4253 S SG  . CYS C 1 94  ? 57.214  6.025  160.775 1.00 73.66  ? 972  CYS C SG  1 
ATOM   4254 N N   . THR C 1 95  ? 60.451  5.113  162.145 1.00 73.33  ? 973  THR C N   1 
ATOM   4255 C CA  . THR C 1 95  ? 61.166  3.881  161.742 1.00 73.86  ? 973  THR C CA  1 
ATOM   4256 C C   . THR C 1 95  ? 60.715  3.051  160.516 1.00 80.96  ? 973  THR C C   1 
ATOM   4257 O O   . THR C 1 95  ? 61.547  2.643  159.706 1.00 83.02  ? 973  THR C O   1 
ATOM   4258 C CB  . THR C 1 95  ? 61.298  2.912  162.941 1.00 77.56  ? 973  THR C CB  1 
ATOM   4259 O OG1 . THR C 1 95  ? 59.998  2.460  163.339 1.00 80.23  ? 973  THR C OG1 1 
ATOM   4260 C CG2 . THR C 1 95  ? 61.971  3.605  164.115 1.00 71.64  ? 973  THR C CG2 1 
ATOM   4261 N N   . ASP C 1 96  ? 59.411  2.807  160.384 1.00 76.40  ? 974  ASP C N   1 
ATOM   4262 C CA  . ASP C 1 96  ? 58.867  1.951  159.323 1.00 75.62  ? 974  ASP C CA  1 
ATOM   4263 C C   . ASP C 1 96  ? 59.077  2.631  157.963 1.00 81.58  ? 974  ASP C C   1 
ATOM   4264 O O   . ASP C 1 96  ? 58.694  3.789  157.776 1.00 81.69  ? 974  ASP C O   1 
ATOM   4265 C CB  . ASP C 1 96  ? 57.376  1.660  159.571 1.00 76.92  ? 974  ASP C CB  1 
ATOM   4266 C CG  . ASP C 1 96  ? 56.851  0.462  158.759 1.00 85.61  ? 974  ASP C CG  1 
ATOM   4267 O OD1 . ASP C 1 96  ? 56.412  0.639  157.592 1.00 85.29  ? 974  ASP C OD1 1 
ATOM   4268 O OD2 . ASP C 1 96  ? 56.806  -0.650 159.321 1.00 88.94  ? 974  ASP C OD2 1 
ATOM   4269 N N   . LYS C 1 97  ? 59.683  1.906  157.028 1.00 79.69  ? 975  LYS C N   1 
ATOM   4270 C CA  . LYS C 1 97  ? 59.940  2.437  155.695 1.00 80.07  ? 975  LYS C CA  1 
ATOM   4271 C C   . LYS C 1 97  ? 58.696  2.345  154.817 1.00 82.00  ? 975  LYS C C   1 
ATOM   4272 O O   . LYS C 1 97  ? 58.566  3.069  153.830 1.00 81.64  ? 975  LYS C O   1 
ATOM   4273 C CB  . LYS C 1 97  ? 61.104  1.693  155.037 1.00 84.21  ? 975  LYS C CB  1 
ATOM   4274 C CG  . LYS C 1 97  ? 62.317  2.564  154.757 1.00 107.52 ? 975  LYS C CG  1 
ATOM   4275 C CD  . LYS C 1 97  ? 62.040  4.021  155.089 1.00 116.66 ? 975  LYS C CD  1 
ATOM   4276 C CE  . LYS C 1 97  ? 62.356  4.926  153.909 1.00 123.50 ? 975  LYS C CE  1 
ATOM   4277 N NZ  . LYS C 1 97  ? 63.596  5.719  154.134 1.00 122.27 ? 975  LYS C NZ  1 
ATOM   4278 N N   . ARG C 1 98  ? 57.785  1.450  155.183 1.00 77.05  ? 976  ARG C N   1 
ATOM   4279 C CA  . ARG C 1 98  ? 56.550  1.262  154.432 1.00 76.37  ? 976  ARG C CA  1 
ATOM   4280 C C   . ARG C 1 98  ? 55.535  2.353  154.758 1.00 80.06  ? 976  ARG C C   1 
ATOM   4281 O O   . ARG C 1 98  ? 54.668  2.671  153.945 1.00 81.08  ? 976  ARG C O   1 
ATOM   4282 C CB  . ARG C 1 98  ? 55.951  -0.116 154.720 1.00 73.55  ? 976  ARG C CB  1 
ATOM   4283 C CG  . ARG C 1 98  ? 54.835  -0.519 153.770 1.00 80.25  ? 976  ARG C CG  1 
ATOM   4284 C CD  . ARG C 1 98  ? 53.669  -1.140 154.521 1.00 90.85  ? 976  ARG C CD  1 
ATOM   4285 N NE  . ARG C 1 98  ? 52.585  -0.185 154.735 1.00 102.71 ? 976  ARG C NE  1 
ATOM   4286 C CZ  . ARG C 1 98  ? 51.884  -0.091 155.860 1.00 116.93 ? 976  ARG C CZ  1 
ATOM   4287 N NH1 . ARG C 1 98  ? 52.150  -0.896 156.879 1.00 94.40  ? 976  ARG C NH1 1 
ATOM   4288 N NH2 . ARG C 1 98  ? 50.915  0.809  155.966 1.00 109.36 ? 976  ARG C NH2 1 
ATOM   4289 N N   . ILE C 1 99  ? 55.650  2.921  155.954 1.00 73.81  ? 977  ILE C N   1 
ATOM   4290 C CA  . ILE C 1 99  ? 54.744  3.977  156.391 1.00 71.89  ? 977  ILE C CA  1 
ATOM   4291 C C   . ILE C 1 99  ? 55.335  5.356  156.120 1.00 75.04  ? 977  ILE C C   1 
ATOM   4292 O O   . ILE C 1 99  ? 54.684  6.215  155.525 1.00 74.48  ? 977  ILE C O   1 
ATOM   4293 C CB  . ILE C 1 99  ? 54.416  3.855  157.890 1.00 73.41  ? 977  ILE C CB  1 
ATOM   4294 C CG1 . ILE C 1 99  ? 53.678  2.544  158.170 1.00 72.65  ? 977  ILE C CG1 1 
ATOM   4295 C CG2 . ILE C 1 99  ? 53.591  5.046  158.353 1.00 72.62  ? 977  ILE C CG2 1 
ATOM   4296 C CD1 . ILE C 1 99  ? 53.241  2.385  159.609 1.00 71.44  ? 977  ILE C CD1 1 
ATOM   4297 N N   . ARG C 1 100 ? 56.601  5.536  156.466 1.00 71.07  ? 978  ARG C N   1 
ATOM   4298 C CA  . ARG C 1 100 ? 57.210  6.845  156.349 1.00 70.44  ? 978  ARG C CA  1 
ATOM   4299 C C   . ARG C 1 100 ? 57.109  7.214  154.881 1.00 77.18  ? 978  ARG C C   1 
ATOM   4300 O O   . ARG C 1 100 ? 56.880  8.373  154.532 1.00 77.85  ? 978  ARG C O   1 
ATOM   4301 C CB  . ARG C 1 100 ? 58.673  6.803  156.789 1.00 66.43  ? 978  ARG C CB  1 
ATOM   4302 C CG  . ARG C 1 100 ? 59.508  7.969  156.284 1.00 71.11  ? 978  ARG C CG  1 
ATOM   4303 C CD  . ARG C 1 100 ? 60.994  7.688  156.432 1.00 78.69  ? 978  ARG C CD  1 
ATOM   4304 N NE  . ARG C 1 100 ? 61.431  7.774  157.823 1.00 86.91  ? 978  ARG C NE  1 
ATOM   4305 C CZ  . ARG C 1 100 ? 62.703  7.813  158.204 1.00 101.39 ? 978  ARG C CZ  1 
ATOM   4306 N NH1 . ARG C 1 100 ? 63.671  7.774  157.299 1.00 91.68  ? 978  ARG C NH1 1 
ATOM   4307 N NH2 . ARG C 1 100 ? 63.009  7.890  159.493 1.00 82.09  ? 978  ARG C NH2 1 
ATOM   4308 N N   . THR C 1 101 ? 57.283  6.217  154.021 1.00 74.04  ? 979  THR C N   1 
ATOM   4309 C CA  . THR C 1 101 ? 57.312  6.450  152.575 1.00 74.12  ? 979  THR C CA  1 
ATOM   4310 C C   . THR C 1 101 ? 55.922  6.923  152.153 1.00 76.27  ? 979  THR C C   1 
ATOM   4311 O O   . THR C 1 101 ? 55.783  7.944  151.473 1.00 76.88  ? 979  THR C O   1 
ATOM   4312 C CB  . THR C 1 101 ? 57.798  5.179  151.796 1.00 82.05  ? 979  THR C CB  1 
ATOM   4313 O OG1 . THR C 1 101 ? 59.220  5.039  151.959 1.00 82.32  ? 979  THR C OG1 1 
ATOM   4314 C CG2 . THR C 1 101 ? 57.447  5.269  150.295 1.00 75.94  ? 979  THR C CG2 1 
ATOM   4315 N N   . ASN C 1 102 ? 54.902  6.204  152.611 1.00 70.83  ? 980  ASN C N   1 
ATOM   4316 C CA  . ASN C 1 102 ? 53.521  6.577  152.356 1.00 70.89  ? 980  ASN C CA  1 
ATOM   4317 C C   . ASN C 1 102 ? 53.334  8.008  152.813 1.00 75.27  ? 980  ASN C C   1 
ATOM   4318 O O   . ASN C 1 102 ? 52.903  8.867  152.043 1.00 76.33  ? 980  ASN C O   1 
ATOM   4319 C CB  . ASN C 1 102 ? 52.584  5.701  153.180 1.00 71.31  ? 980  ASN C CB  1 
ATOM   4320 C CG  . ASN C 1 102 ? 52.556  4.281  152.694 1.00 103.02 ? 980  ASN C CG  1 
ATOM   4321 O OD1 . ASN C 1 102 ? 52.106  3.377  153.406 1.00 104.86 ? 980  ASN C OD1 1 
ATOM   4322 N ND2 . ASN C 1 102 ? 53.062  4.064  151.478 1.00 93.66  ? 980  ASN C ND2 1 
ATOM   4323 N N   . LEU C 1 103 ? 53.656  8.254  154.077 1.00 70.71  ? 981  LEU C N   1 
ATOM   4324 C CA  . LEU C 1 103 ? 53.523  9.587  154.645 1.00 70.52  ? 981  LEU C CA  1 
ATOM   4325 C C   . LEU C 1 103 ? 54.258  10.681 153.850 1.00 79.14  ? 981  LEU C C   1 
ATOM   4326 O O   . LEU C 1 103 ? 53.671  11.741 153.605 1.00 81.81  ? 981  LEU C O   1 
ATOM   4327 C CB  . LEU C 1 103 ? 53.885  9.603  156.135 1.00 69.76  ? 981  LEU C CB  1 
ATOM   4328 C CG  . LEU C 1 103 ? 53.480  10.839 156.951 1.00 73.00  ? 981  LEU C CG  1 
ATOM   4329 C CD1 . LEU C 1 103 ? 51.979  10.805 157.289 1.00 71.97  ? 981  LEU C CD1 1 
ATOM   4330 C CD2 . LEU C 1 103 ? 54.332  10.926 158.215 1.00 74.33  ? 981  LEU C CD2 1 
ATOM   4331 N N   . LEU C 1 104 ? 55.497  10.434 153.406 1.00 75.08  ? 982  LEU C N   1 
ATOM   4332 C CA  . LEU C 1 104 ? 56.220  11.446 152.621 1.00 74.72  ? 982  LEU C CA  1 
ATOM   4333 C C   . LEU C 1 104 ? 55.557  11.696 151.261 1.00 81.75  ? 982  LEU C C   1 
ATOM   4334 O O   . LEU C 1 104 ? 55.328  12.839 150.879 1.00 81.97  ? 982  LEU C O   1 
ATOM   4335 C CB  . LEU C 1 104 ? 57.714  11.119 152.471 1.00 74.03  ? 982  LEU C CB  1 
ATOM   4336 C CG  . LEU C 1 104 ? 58.581  11.429 153.703 1.00 77.20  ? 982  LEU C CG  1 
ATOM   4337 C CD1 . LEU C 1 104 ? 59.982  10.854 153.578 1.00 76.87  ? 982  LEU C CD1 1 
ATOM   4338 C CD2 . LEU C 1 104 ? 58.660  12.912 153.968 1.00 78.71  ? 982  LEU C CD2 1 
ATOM   4339 N N   . GLN C 1 105 ? 55.208  10.628 150.555 1.00 80.92  ? 983  GLN C N   1 
ATOM   4340 C CA  . GLN C 1 105 ? 54.559  10.752 149.249 1.00 82.69  ? 983  GLN C CA  1 
ATOM   4341 C C   . GLN C 1 105 ? 53.314  11.631 149.331 1.00 89.03  ? 983  GLN C C   1 
ATOM   4342 O O   . GLN C 1 105 ? 53.264  12.721 148.739 1.00 88.94  ? 983  GLN C O   1 
ATOM   4343 C CB  . GLN C 1 105 ? 54.125  9.371  148.741 1.00 84.45  ? 983  GLN C CB  1 
ATOM   4344 C CG  . GLN C 1 105 ? 55.253  8.488  148.235 1.00 109.32 ? 983  GLN C CG  1 
ATOM   4345 C CD  . GLN C 1 105 ? 54.802  7.055  148.004 1.00 133.34 ? 983  GLN C CD  1 
ATOM   4346 O OE1 . GLN C 1 105 ? 55.616  6.170  147.727 1.00 126.07 ? 983  GLN C OE1 1 
ATOM   4347 N NE2 . GLN C 1 105 ? 53.498  6.819  148.129 1.00 128.25 ? 983  GLN C NE2 1 
ATOM   4348 N N   . VAL C 1 106 ? 52.306  11.110 150.037 1.00 86.62  ? 984  VAL C N   1 
ATOM   4349 C CA  . VAL C 1 106 ? 51.003  11.762 150.225 1.00 87.03  ? 984  VAL C CA  1 
ATOM   4350 C C   . VAL C 1 106 ? 51.059  13.220 150.677 1.00 90.22  ? 984  VAL C C   1 
ATOM   4351 O O   . VAL C 1 106 ? 50.014  13.822 150.939 1.00 90.33  ? 984  VAL C O   1 
ATOM   4352 C CB  . VAL C 1 106 ? 50.078  10.953 151.189 1.00 91.28  ? 984  VAL C CB  1 
ATOM   4353 C CG1 . VAL C 1 106 ? 50.170  9.468  150.909 1.00 91.39  ? 984  VAL C CG1 1 
ATOM   4354 C CG2 . VAL C 1 106 ? 50.389  11.266 152.664 1.00 90.97  ? 984  VAL C CG2 1 
ATOM   4355 N N   . CYS C 1 107 ? 52.260  13.776 150.800 1.00 85.04  ? 985  CYS C N   1 
ATOM   4356 C CA  . CYS C 1 107 ? 52.389  15.133 151.299 1.00 84.42  ? 985  CYS C CA  1 
ATOM   4357 C C   . CYS C 1 107 ? 53.458  16.010 150.645 1.00 89.49  ? 985  CYS C C   1 
ATOM   4358 O O   . CYS C 1 107 ? 53.609  17.182 151.006 1.00 88.77  ? 985  CYS C O   1 
ATOM   4359 C CB  . CYS C 1 107 ? 52.393  15.169 152.855 1.00 84.24  ? 985  CYS C CB  1 
ATOM   4360 S SG  . CYS C 1 107 ? 54.004  15.194 153.744 1.00 87.73  ? 985  CYS C SG  1 
ATOM   4361 N N   . GLU C 1 108 ? 54.143  15.474 149.635 1.00 87.27  ? 986  GLU C N   1 
ATOM   4362 C CA  . GLU C 1 108 ? 55.155  16.264 148.928 1.00 87.85  ? 986  GLU C CA  1 
ATOM   4363 C C   . GLU C 1 108 ? 54.497  16.935 147.710 1.00 88.91  ? 986  GLU C C   1 
ATOM   4364 O O   . GLU C 1 108 ? 55.101  17.778 147.010 1.00 88.50  ? 986  GLU C O   1 
ATOM   4365 C CB  . GLU C 1 108 ? 56.376  15.412 148.550 1.00 89.94  ? 986  GLU C CB  1 
ATOM   4366 C CG  . GLU C 1 108 ? 57.698  15.888 149.185 1.00 105.74 ? 986  GLU C CG  1 
ATOM   4367 C CD  . GLU C 1 108 ? 58.367  14.827 150.060 1.00 124.69 ? 986  GLU C CD  1 
ATOM   4368 O OE1 . GLU C 1 108 ? 58.083  13.620 149.882 1.00 129.39 ? 986  GLU C OE1 1 
ATOM   4369 O OE2 . GLU C 1 108 ? 59.187  15.201 150.927 1.00 106.39 ? 986  GLU C OE2 1 
ATOM   4370 N N   . ARG C 1 109 ? 53.225  16.585 147.510 1.00 82.22  ? 987  ARG C N   1 
ATOM   4371 C CA  . ARG C 1 109 ? 52.402  17.184 146.460 1.00 80.19  ? 987  ARG C CA  1 
ATOM   4372 C C   . ARG C 1 109 ? 51.514  18.302 147.035 1.00 79.18  ? 987  ARG C C   1 
ATOM   4373 O O   . ARG C 1 109 ? 51.043  19.178 146.296 1.00 78.72  ? 987  ARG C O   1 
ATOM   4374 C CB  . ARG C 1 109 ? 51.520  16.130 145.783 1.00 78.76  ? 987  ARG C CB  1 
ATOM   4375 C CG  . ARG C 1 109 ? 51.154  14.932 146.644 1.00 89.14  ? 987  ARG C CG  1 
ATOM   4376 C CD  . ARG C 1 109 ? 50.957  13.709 145.751 1.00 96.31  ? 987  ARG C CD  1 
ATOM   4377 N NE  . ARG C 1 109 ? 51.239  12.439 146.418 1.00 109.46 ? 987  ARG C NE  1 
ATOM   4378 C CZ  . ARG C 1 109 ? 50.359  11.771 147.160 1.00 128.87 ? 987  ARG C CZ  1 
ATOM   4379 N NH1 . ARG C 1 109 ? 49.147  12.272 147.365 1.00 123.99 ? 987  ARG C NH1 1 
ATOM   4380 N NH2 . ARG C 1 109 ? 50.689  10.607 147.708 1.00 109.76 ? 987  ARG C NH2 1 
ATOM   4381 N N   . ILE C 1 110 ? 51.286  18.255 148.350 1.00 70.80  ? 988  ILE C N   1 
ATOM   4382 C CA  . ILE C 1 110 ? 50.429  19.214 149.018 1.00 68.80  ? 988  ILE C CA  1 
ATOM   4383 C C   . ILE C 1 110 ? 50.675  20.672 148.630 1.00 72.34  ? 988  ILE C C   1 
ATOM   4384 O O   . ILE C 1 110 ? 49.723  21.371 148.238 1.00 70.90  ? 988  ILE C O   1 
ATOM   4385 C CB  . ILE C 1 110 ? 50.316  18.971 150.558 1.00 70.95  ? 988  ILE C CB  1 
ATOM   4386 C CG1 . ILE C 1 110 ? 49.516  17.691 150.851 1.00 69.81  ? 988  ILE C CG1 1 
ATOM   4387 C CG2 . ILE C 1 110 ? 49.639  20.180 151.267 1.00 70.71  ? 988  ILE C CG2 1 
ATOM   4388 C CD1 . ILE C 1 110 ? 49.069  17.569 152.305 1.00 67.62  ? 988  ILE C CD1 1 
ATOM   4389 N N   . PRO C 1 111 ? 51.950  21.145 148.724 1.00 68.86  ? 989  PRO C N   1 
ATOM   4390 C CA  . PRO C 1 111 ? 52.374  22.518 148.394 1.00 67.28  ? 989  PRO C CA  1 
ATOM   4391 C C   . PRO C 1 111 ? 51.913  22.904 147.002 1.00 69.02  ? 989  PRO C C   1 
ATOM   4392 O O   . PRO C 1 111 ? 51.427  24.010 146.752 1.00 70.18  ? 989  PRO C O   1 
ATOM   4393 C CB  . PRO C 1 111 ? 53.918  22.445 148.417 1.00 68.46  ? 989  PRO C CB  1 
ATOM   4394 C CG  . PRO C 1 111 ? 54.282  21.036 148.648 1.00 73.11  ? 989  PRO C CG  1 
ATOM   4395 C CD  . PRO C 1 111 ? 53.080  20.340 149.227 1.00 69.90  ? 989  PRO C CD  1 
ATOM   4396 N N   . THR C 1 112 ? 52.069  21.968 146.091 1.00 62.76  ? 990  THR C N   1 
ATOM   4397 C CA  . THR C 1 112 ? 51.715  22.201 144.717 1.00 61.24  ? 990  THR C CA  1 
ATOM   4398 C C   . THR C 1 112 ? 50.214  22.399 144.482 1.00 61.51  ? 990  THR C C   1 
ATOM   4399 O O   . THR C 1 112 ? 49.814  23.395 143.893 1.00 60.26  ? 990  THR C O   1 
ATOM   4400 C CB  . THR C 1 112 ? 52.384  21.159 143.854 1.00 70.92  ? 990  THR C CB  1 
ATOM   4401 O OG1 . THR C 1 112 ? 53.795  21.210 144.108 1.00 71.90  ? 990  THR C OG1 1 
ATOM   4402 C CG2 . THR C 1 112 ? 52.128  21.431 142.383 1.00 67.11  ? 990  THR C CG2 1 
ATOM   4403 N N   . ILE C 1 113 ? 49.389  21.487 144.996 1.00 56.69  ? 991  ILE C N   1 
ATOM   4404 C CA  . ILE C 1 113 ? 47.930  21.619 144.906 1.00 55.85  ? 991  ILE C CA  1 
ATOM   4405 C C   . ILE C 1 113 ? 47.527  22.991 145.418 1.00 61.08  ? 991  ILE C C   1 
ATOM   4406 O O   . ILE C 1 113 ? 46.583  23.595 144.909 1.00 61.55  ? 991  ILE C O   1 
ATOM   4407 C CB  . ILE C 1 113 ? 47.186  20.571 145.775 1.00 58.61  ? 991  ILE C CB  1 
ATOM   4408 C CG1 . ILE C 1 113 ? 47.681  19.135 145.521 1.00 59.20  ? 991  ILE C CG1 1 
ATOM   4409 C CG2 . ILE C 1 113 ? 45.648  20.727 145.658 1.00 55.97  ? 991  ILE C CG2 1 
ATOM   4410 C CD1 . ILE C 1 113 ? 47.040  18.093 146.496 1.00 59.59  ? 991  ILE C CD1 1 
ATOM   4411 N N   . SER C 1 114 ? 48.218  23.436 146.469 1.00 58.63  ? 992  SER C N   1 
ATOM   4412 C CA  . SER C 1 114 ? 47.967  24.715 147.159 1.00 58.60  ? 992  SER C CA  1 
ATOM   4413 C C   . SER C 1 114 ? 48.289  25.932 146.310 1.00 61.51  ? 992  SER C C   1 
ATOM   4414 O O   . SER C 1 114 ? 47.520  26.901 146.260 1.00 61.32  ? 992  SER C O   1 
ATOM   4415 C CB  . SER C 1 114 ? 48.807  24.798 148.442 1.00 62.88  ? 992  SER C CB  1 
ATOM   4416 O OG  . SER C 1 114 ? 48.219  24.041 149.479 1.00 71.89  ? 992  SER C OG  1 
ATOM   4417 N N   . THR C 1 115 ? 49.467  25.917 145.710 1.00 56.84  ? 993  THR C N   1 
ATOM   4418 C CA  . THR C 1 115 ? 49.839  27.027 144.857 1.00 57.55  ? 993  THR C CA  1 
ATOM   4419 C C   . THR C 1 115 ? 48.756  27.198 143.796 1.00 60.26  ? 993  THR C C   1 
ATOM   4420 O O   . THR C 1 115 ? 48.322  28.312 143.483 1.00 59.53  ? 993  THR C O   1 
ATOM   4421 C CB  . THR C 1 115 ? 51.178  26.782 144.180 1.00 65.57  ? 993  THR C CB  1 
ATOM   4422 O OG1 . THR C 1 115 ? 52.195  26.577 145.168 1.00 64.30  ? 993  THR C OG1 1 
ATOM   4423 C CG2 . THR C 1 115 ? 51.527  27.962 143.318 1.00 61.54  ? 993  THR C CG2 1 
ATOM   4424 N N   . GLN C 1 116 ? 48.327  26.058 143.273 1.00 55.23  ? 994  GLN C N   1 
ATOM   4425 C CA  . GLN C 1 116 ? 47.322  25.996 142.248 1.00 55.03  ? 994  GLN C CA  1 
ATOM   4426 C C   . GLN C 1 116 ? 45.967  26.471 142.758 1.00 62.49  ? 994  GLN C C   1 
ATOM   4427 O O   . GLN C 1 116 ? 45.175  27.036 141.990 1.00 63.65  ? 994  GLN C O   1 
ATOM   4428 C CB  . GLN C 1 116 ? 47.238  24.573 141.701 1.00 55.55  ? 994  GLN C CB  1 
ATOM   4429 C CG  . GLN C 1 116 ? 48.539  24.113 141.057 1.00 60.57  ? 994  GLN C CG  1 
ATOM   4430 C CD  . GLN C 1 116 ? 48.384  22.909 140.125 1.00 72.14  ? 994  GLN C CD  1 
ATOM   4431 O OE1 . GLN C 1 116 ? 47.366  22.206 140.133 1.00 62.61  ? 994  GLN C OE1 1 
ATOM   4432 N NE2 . GLN C 1 116 ? 49.425  22.646 139.345 1.00 58.82  ? 994  GLN C NE2 1 
ATOM   4433 N N   . LEU C 1 117 ? 45.702  26.250 144.048 1.00 58.05  ? 995  LEU C N   1 
ATOM   4434 C CA  . LEU C 1 117 ? 44.445  26.683 144.660 1.00 55.94  ? 995  LEU C CA  1 
ATOM   4435 C C   . LEU C 1 117 ? 44.486  28.187 144.617 1.00 58.98  ? 995  LEU C C   1 
ATOM   4436 O O   . LEU C 1 117 ? 43.540  28.838 144.189 1.00 59.47  ? 995  LEU C O   1 
ATOM   4437 C CB  . LEU C 1 117 ? 44.341  26.216 146.108 1.00 55.51  ? 995  LEU C CB  1 
ATOM   4438 C CG  . LEU C 1 117 ? 43.001  26.454 146.809 1.00 60.16  ? 995  LEU C CG  1 
ATOM   4439 C CD1 . LEU C 1 117 ? 41.840  25.754 146.111 1.00 60.17  ? 995  LEU C CD1 1 
ATOM   4440 C CD2 . LEU C 1 117 ? 43.072  26.039 148.269 1.00 61.57  ? 995  LEU C CD2 1 
ATOM   4441 N N   . LYS C 1 118 ? 45.618  28.743 145.014 1.00 54.43  ? 996  LYS C N   1 
ATOM   4442 C CA  . LYS C 1 118 ? 45.773  30.179 144.993 1.00 53.58  ? 996  LYS C CA  1 
ATOM   4443 C C   . LYS C 1 118 ? 45.463  30.689 143.605 1.00 60.82  ? 996  LYS C C   1 
ATOM   4444 O O   . LYS C 1 118 ? 44.519  31.466 143.423 1.00 62.40  ? 996  LYS C O   1 
ATOM   4445 C CB  . LYS C 1 118 ? 47.172  30.569 145.408 1.00 53.81  ? 996  LYS C CB  1 
ATOM   4446 C CG  . LYS C 1 118 ? 47.366  30.572 146.902 1.00 52.86  ? 996  LYS C CG  1 
ATOM   4447 C CD  . LYS C 1 118 ? 48.633  31.333 147.278 1.00 57.57  ? 996  LYS C CD  1 
ATOM   4448 C CE  . LYS C 1 118 ? 49.862  30.444 147.297 1.00 61.71  ? 996  LYS C CE  1 
ATOM   4449 N NZ  . LYS C 1 118 ? 50.992  31.059 146.570 1.00 73.59  ? 996  LYS C NZ  1 
ATOM   4450 N N   . ILE C 1 119 ? 46.196  30.172 142.618 1.00 56.79  ? 997  ILE C N   1 
ATOM   4451 C CA  . ILE C 1 119 ? 46.003  30.534 141.206 1.00 54.89  ? 997  ILE C CA  1 
ATOM   4452 C C   . ILE C 1 119 ? 44.548  30.442 140.701 1.00 54.90  ? 997  ILE C C   1 
ATOM   4453 O O   . ILE C 1 119 ? 43.986  31.405 140.184 1.00 51.86  ? 997  ILE C O   1 
ATOM   4454 C CB  . ILE C 1 119 ? 46.990  29.780 140.306 1.00 57.54  ? 997  ILE C CB  1 
ATOM   4455 C CG1 . ILE C 1 119 ? 48.401  30.358 140.447 1.00 55.68  ? 997  ILE C CG1 1 
ATOM   4456 C CG2 . ILE C 1 119 ? 46.521  29.825 138.849 1.00 60.01  ? 997  ILE C CG2 1 
ATOM   4457 C CD1 . ILE C 1 119 ? 49.508  29.337 140.310 1.00 58.55  ? 997  ILE C CD1 1 
ATOM   4458 N N   . LEU C 1 120 ? 43.930  29.296 140.912 1.00 53.27  ? 998  LEU C N   1 
ATOM   4459 C CA  . LEU C 1 120 ? 42.542  29.082 140.502 1.00 54.76  ? 998  LEU C CA  1 
ATOM   4460 C C   . LEU C 1 120 ? 41.508  29.921 141.262 1.00 60.70  ? 998  LEU C C   1 
ATOM   4461 O O   . LEU C 1 120 ? 40.500  30.355 140.699 1.00 60.16  ? 998  LEU C O   1 
ATOM   4462 C CB  . LEU C 1 120 ? 42.197  27.585 140.555 1.00 55.06  ? 998  LEU C CB  1 
ATOM   4463 C CG  . LEU C 1 120 ? 43.172  26.691 139.753 1.00 59.98  ? 998  LEU C CG  1 
ATOM   4464 C CD1 . LEU C 1 120 ? 43.045  25.201 140.058 1.00 59.26  ? 998  LEU C CD1 1 
ATOM   4465 C CD2 . LEU C 1 120 ? 43.065  26.946 138.258 1.00 61.69  ? 998  LEU C CD2 1 
ATOM   4466 N N   . SER C 1 121 ? 41.753  30.134 142.550 1.00 59.70  ? 999  SER C N   1 
ATOM   4467 C CA  . SER C 1 121 ? 40.844  30.939 143.384 1.00 59.62  ? 999  SER C CA  1 
ATOM   4468 C C   . SER C 1 121 ? 40.786  32.352 142.838 1.00 61.84  ? 999  SER C C   1 
ATOM   4469 O O   . SER C 1 121 ? 39.715  32.937 142.715 1.00 61.02  ? 999  SER C O   1 
ATOM   4470 C CB  . SER C 1 121 ? 41.345  31.000 144.824 1.00 62.61  ? 999  SER C CB  1 
ATOM   4471 O OG  . SER C 1 121 ? 41.351  29.713 145.387 1.00 76.44  ? 999  SER C OG  1 
ATOM   4472 N N   . THR C 1 122 ? 41.963  32.886 142.531 1.00 57.25  ? 1000 THR C N   1 
ATOM   4473 C CA  . THR C 1 122 ? 42.100  34.217 141.994 1.00 57.02  ? 1000 THR C CA  1 
ATOM   4474 C C   . THR C 1 122 ? 41.424  34.309 140.650 1.00 62.46  ? 1000 THR C C   1 
ATOM   4475 O O   . THR C 1 122 ? 40.890  35.337 140.304 1.00 62.70  ? 1000 THR C O   1 
ATOM   4476 C CB  . THR C 1 122 ? 43.560  34.572 141.857 1.00 63.47  ? 1000 THR C CB  1 
ATOM   4477 O OG1 . THR C 1 122 ? 44.224  34.379 143.108 1.00 62.44  ? 1000 THR C OG1 1 
ATOM   4478 C CG2 . THR C 1 122 ? 43.704  35.992 141.428 1.00 59.20  ? 1000 THR C CG2 1 
ATOM   4479 N N   . VAL C 1 123 ? 41.478  33.229 139.884 1.00 59.41  ? 1001 VAL C N   1 
ATOM   4480 C CA  . VAL C 1 123 ? 40.831  33.168 138.585 1.00 58.71  ? 1001 VAL C CA  1 
ATOM   4481 C C   . VAL C 1 123 ? 39.326  33.262 138.830 1.00 64.68  ? 1001 VAL C C   1 
ATOM   4482 O O   . VAL C 1 123 ? 38.642  34.124 138.289 1.00 64.50  ? 1001 VAL C O   1 
ATOM   4483 C CB  . VAL C 1 123 ? 41.162  31.818 137.873 1.00 61.13  ? 1001 VAL C CB  1 
ATOM   4484 C CG1 . VAL C 1 123 ? 40.006  31.381 136.970 1.00 60.58  ? 1001 VAL C CG1 1 
ATOM   4485 C CG2 . VAL C 1 123 ? 42.479  31.887 137.115 1.00 60.02  ? 1001 VAL C CG2 1 
ATOM   4486 N N   . LYS C 1 124 ? 38.816  32.352 139.652 1.00 62.05  ? 1002 LYS C N   1 
ATOM   4487 C CA  . LYS C 1 124 ? 37.395  32.321 139.931 1.00 62.33  ? 1002 LYS C CA  1 
ATOM   4488 C C   . LYS C 1 124 ? 36.925  33.620 140.571 1.00 69.43  ? 1002 LYS C C   1 
ATOM   4489 O O   . LYS C 1 124 ? 35.834  34.094 140.264 1.00 70.75  ? 1002 LYS C O   1 
ATOM   4490 C CB  . LYS C 1 124 ? 37.020  31.094 140.763 1.00 64.04  ? 1002 LYS C CB  1 
ATOM   4491 C CG  . LYS C 1 124 ? 35.523  30.916 140.970 1.00 69.85  ? 1002 LYS C CG  1 
ATOM   4492 C CD  . LYS C 1 124 ? 34.784  30.758 139.652 1.00 80.91  ? 1002 LYS C CD  1 
ATOM   4493 C CE  . LYS C 1 124 ? 33.318  31.167 139.765 1.00 89.34  ? 1002 LYS C CE  1 
ATOM   4494 N NZ  . LYS C 1 124 ? 32.405  30.155 139.175 1.00 91.37  ? 1002 LYS C NZ  1 
ATOM   4495 N N   . ALA C 1 125 ? 37.761  34.220 141.416 1.00 65.97  ? 1003 ALA C N   1 
ATOM   4496 C CA  . ALA C 1 125 ? 37.430  35.491 142.061 1.00 65.99  ? 1003 ALA C CA  1 
ATOM   4497 C C   . ALA C 1 125 ? 37.263  36.629 141.053 1.00 73.88  ? 1003 ALA C C   1 
ATOM   4498 O O   . ALA C 1 125 ? 36.344  37.447 141.177 1.00 73.42  ? 1003 ALA C O   1 
ATOM   4499 C CB  . ALA C 1 125 ? 38.469  35.853 143.089 1.00 66.34  ? 1003 ALA C CB  1 
ATOM   4500 N N   . THR C 1 126 ? 38.141  36.697 140.054 1.00 72.97  ? 1004 THR C N   1 
ATOM   4501 C CA  . THR C 1 126 ? 38.014  37.756 139.057 1.00 74.45  ? 1004 THR C CA  1 
ATOM   4502 C C   . THR C 1 126 ? 36.780  37.550 138.195 1.00 83.00  ? 1004 THR C C   1 
ATOM   4503 O O   . THR C 1 126 ? 36.267  38.488 137.599 1.00 83.87  ? 1004 THR C O   1 
ATOM   4504 C CB  . THR C 1 126 ? 39.270  37.967 138.207 1.00 79.23  ? 1004 THR C CB  1 
ATOM   4505 O OG1 . THR C 1 126 ? 39.358  36.940 137.217 1.00 84.19  ? 1004 THR C OG1 1 
ATOM   4506 C CG2 . THR C 1 126 ? 40.516  37.970 139.063 1.00 76.89  ? 1004 THR C CG2 1 
ATOM   4507 N N   . MET C 1 127 ? 36.286  36.323 138.143 1.00 80.81  ? 1005 MET C N   1 
ATOM   4508 C CA  . MET C 1 127 ? 35.116  36.066 137.344 1.00 81.63  ? 1005 MET C CA  1 
ATOM   4509 C C   . MET C 1 127 ? 33.863  36.380 138.098 1.00 91.61  ? 1005 MET C C   1 
ATOM   4510 O O   . MET C 1 127 ? 32.830  36.620 137.483 1.00 92.67  ? 1005 MET C O   1 
ATOM   4511 C CB  . MET C 1 127 ? 35.063  34.622 136.883 1.00 83.47  ? 1005 MET C CB  1 
ATOM   4512 C CG  . MET C 1 127 ? 36.113  34.298 135.888 1.00 86.37  ? 1005 MET C CG  1 
ATOM   4513 S SD  . MET C 1 127 ? 35.989  32.637 135.346 1.00 89.42  ? 1005 MET C SD  1 
ATOM   4514 C CE  . MET C 1 127 ? 37.251  32.651 134.086 1.00 85.86  ? 1005 MET C CE  1 
ATOM   4515 N N   . LEU C 1 128 ? 33.917  36.310 139.424 1.00 91.18  ? 1006 LEU C N   1 
ATOM   4516 C CA  . LEU C 1 128 ? 32.714  36.564 140.218 1.00 92.29  ? 1006 LEU C CA  1 
ATOM   4517 C C   . LEU C 1 128 ? 32.131  37.930 139.853 1.00 105.15 ? 1006 LEU C C   1 
ATOM   4518 O O   . LEU C 1 128 ? 32.844  38.941 139.879 1.00 104.75 ? 1006 LEU C O   1 
ATOM   4519 C CB  . LEU C 1 128 ? 32.990  36.472 141.721 1.00 90.90  ? 1006 LEU C CB  1 
ATOM   4520 C CG  . LEU C 1 128 ? 33.171  35.069 142.287 1.00 92.89  ? 1006 LEU C CG  1 
ATOM   4521 C CD1 . LEU C 1 128 ? 33.519  35.105 143.762 1.00 91.58  ? 1006 LEU C CD1 1 
ATOM   4522 C CD2 . LEU C 1 128 ? 31.943  34.239 142.028 1.00 93.55  ? 1006 LEU C CD2 1 
ATOM   4523 N N   . GLY C 1 129 ? 30.853  37.935 139.460 1.00 107.84 ? 1007 GLY C N   1 
ATOM   4524 C CA  . GLY C 1 129 ? 30.123  39.131 139.063 1.00 110.02 ? 1007 GLY C CA  1 
ATOM   4525 C C   . GLY C 1 129 ? 30.025  39.371 137.564 1.00 119.45 ? 1007 GLY C C   1 
ATOM   4526 O O   . GLY C 1 129 ? 28.937  39.306 136.982 1.00 118.95 ? 1007 GLY C O   1 
ATOM   4527 N N   . ARG C 1 130 ? 31.170  39.678 136.954 1.00 120.17 ? 1008 ARG C N   1 
ATOM   4528 C CA  . ARG C 1 130 ? 31.265  39.963 135.523 1.00 121.53 ? 1008 ARG C CA  1 
ATOM   4529 C C   . ARG C 1 130 ? 30.445  38.997 134.676 1.00 129.56 ? 1008 ARG C C   1 
ATOM   4530 O O   . ARG C 1 130 ? 30.695  37.789 134.672 1.00 129.50 ? 1008 ARG C O   1 
ATOM   4531 C CB  . ARG C 1 130 ? 32.729  39.960 135.057 1.00 120.75 ? 1008 ARG C CB  1 
ATOM   4532 C CG  . ARG C 1 130 ? 33.763  40.011 136.173 1.00 127.82 ? 1008 ARG C CG  1 
ATOM   4533 C CD  . ARG C 1 130 ? 34.966  40.846 135.771 1.00 137.34 ? 1008 ARG C CD  1 
ATOM   4534 N NE  . ARG C 1 130 ? 35.043  42.077 136.555 1.00 149.95 ? 1008 ARG C NE  1 
ATOM   4535 C CZ  . ARG C 1 130 ? 35.040  43.305 136.040 1.00 161.44 ? 1008 ARG C CZ  1 
ATOM   4536 N NH1 . ARG C 1 130 ? 34.975  43.485 134.726 1.00 148.73 ? 1008 ARG C NH1 1 
ATOM   4537 N NH2 . ARG C 1 130 ? 35.103  44.357 136.845 1.00 141.08 ? 1008 ARG C NH2 1 
ATOM   4538 N N   . THR C 1 131 ? 29.460  39.532 133.962 1.00 128.41 ? 1009 THR C N   1 
ATOM   4539 C CA  . THR C 1 131 ? 28.630  38.702 133.103 1.00 128.96 ? 1009 THR C CA  1 
ATOM   4540 C C   . THR C 1 131 ? 29.143  38.766 131.664 1.00 132.20 ? 1009 THR C C   1 
ATOM   4541 O O   . THR C 1 131 ? 28.527  38.233 130.733 1.00 132.46 ? 1009 THR C O   1 
ATOM   4542 C CB  . THR C 1 131 ? 27.141  39.043 133.244 1.00 141.36 ? 1009 THR C CB  1 
ATOM   4543 O OG1 . THR C 1 131 ? 26.969  39.965 134.329 1.00 142.82 ? 1009 THR C OG1 1 
ATOM   4544 C CG2 . THR C 1 131 ? 26.341  37.774 133.528 1.00 140.55 ? 1009 THR C CG2 1 
ATOM   4545 N N   . ASN C 1 132 ? 30.311  39.388 131.518 1.00 126.74 ? 1010 ASN C N   1 
ATOM   4546 C CA  . ASN C 1 132 ? 31.009  39.510 130.241 1.00 125.35 ? 1010 ASN C CA  1 
ATOM   4547 C C   . ASN C 1 132 ? 32.039  38.380 130.150 1.00 124.64 ? 1010 ASN C C   1 
ATOM   4548 O O   . ASN C 1 132 ? 33.092  38.531 129.521 1.00 123.80 ? 1010 ASN C O   1 
ATOM   4549 C CB  . ASN C 1 132 ? 31.747  40.838 130.214 1.00 127.75 ? 1010 ASN C CB  1 
ATOM   4550 C CG  . ASN C 1 132 ? 32.224  41.248 131.586 1.00 153.97 ? 1010 ASN C CG  1 
ATOM   4551 O OD1 . ASN C 1 132 ? 31.433  41.695 132.424 1.00 145.62 ? 1010 ASN C OD1 1 
ATOM   4552 N ND2 . ASN C 1 132 ? 33.498  40.995 131.864 1.00 147.13 ? 1010 ASN C ND2 1 
ATOM   4553 N N   . ILE C 1 133 ? 31.733  37.270 130.823 1.00 117.14 ? 1011 ILE C N   1 
ATOM   4554 C CA  . ILE C 1 133 ? 32.580  36.078 130.874 1.00 114.30 ? 1011 ILE C CA  1 
ATOM   4555 C C   . ILE C 1 133 ? 31.714  34.849 130.525 1.00 114.57 ? 1011 ILE C C   1 
ATOM   4556 O O   . ILE C 1 133 ? 30.720  34.564 131.207 1.00 114.02 ? 1011 ILE C O   1 
ATOM   4557 C CB  . ILE C 1 133 ? 33.269  35.953 132.265 1.00 116.29 ? 1011 ILE C CB  1 
ATOM   4558 C CG1 . ILE C 1 133 ? 34.465  35.006 132.204 1.00 115.86 ? 1011 ILE C CG1 1 
ATOM   4559 C CG2 . ILE C 1 133 ? 32.288  35.487 133.315 1.00 116.15 ? 1011 ILE C CG2 1 
ATOM   4560 C CD1 . ILE C 1 133 ? 34.100  33.568 132.465 1.00 117.14 ? 1011 ILE C CD1 1 
ATOM   4561 N N   . SER C 1 134 ? 32.057  34.171 129.425 1.00 107.93 ? 1012 SER C N   1 
ATOM   4562 C CA  . SER C 1 134 ? 31.286  33.019 128.949 1.00 105.71 ? 1012 SER C CA  1 
ATOM   4563 C C   . SER C 1 134 ? 30.881  32.098 130.081 1.00 106.12 ? 1012 SER C C   1 
ATOM   4564 O O   . SER C 1 134 ? 31.511  32.062 131.126 1.00 105.69 ? 1012 SER C O   1 
ATOM   4565 C CB  . SER C 1 134 ? 32.009  32.247 127.832 1.00 107.39 ? 1012 SER C CB  1 
ATOM   4566 O OG  . SER C 1 134 ? 33.376  32.033 128.128 1.00 112.04 ? 1012 SER C OG  1 
ATOM   4567 N N   . ASP C 1 135 ? 29.775  31.408 129.900 1.00 100.08 ? 1013 ASP C N   1 
ATOM   4568 C CA  . ASP C 1 135 ? 29.314  30.514 130.934 1.00 98.71  ? 1013 ASP C CA  1 
ATOM   4569 C C   . ASP C 1 135 ? 30.302  29.377 131.052 1.00 96.94  ? 1013 ASP C C   1 
ATOM   4570 O O   . ASP C 1 135 ? 30.621  28.935 132.149 1.00 96.34  ? 1013 ASP C O   1 
ATOM   4571 C CB  . ASP C 1 135 ? 27.936  29.961 130.581 1.00 101.40 ? 1013 ASP C CB  1 
ATOM   4572 C CG  . ASP C 1 135 ? 26.804  30.777 131.181 1.00 113.82 ? 1013 ASP C CG  1 
ATOM   4573 O OD1 . ASP C 1 135 ? 25.726  30.195 131.412 1.00 114.93 ? 1013 ASP C OD1 1 
ATOM   4574 O OD2 . ASP C 1 135 ? 26.987  31.992 131.417 1.00 118.61 ? 1013 ASP C OD2 1 
ATOM   4575 N N   . GLU C 1 136 ? 30.786  28.907 129.910 1.00 89.72  ? 1014 GLU C N   1 
ATOM   4576 C CA  . GLU C 1 136 ? 31.720  27.795 129.891 1.00 87.46  ? 1014 GLU C CA  1 
ATOM   4577 C C   . GLU C 1 136 ? 33.022  28.143 130.583 1.00 85.87  ? 1014 GLU C C   1 
ATOM   4578 O O   . GLU C 1 136 ? 33.585  27.333 131.300 1.00 83.20  ? 1014 GLU C O   1 
ATOM   4579 C CB  . GLU C 1 136 ? 31.982  27.329 128.464 1.00 88.91  ? 1014 GLU C CB  1 
ATOM   4580 C CG  . GLU C 1 136 ? 30.921  27.715 127.464 1.00 102.31 ? 1014 GLU C CG  1 
ATOM   4581 C CD  . GLU C 1 136 ? 31.469  27.805 126.050 1.00 136.27 ? 1014 GLU C CD  1 
ATOM   4582 O OE1 . GLU C 1 136 ? 31.248  28.853 125.401 1.00 145.66 ? 1014 GLU C OE1 1 
ATOM   4583 O OE2 . GLU C 1 136 ? 32.146  26.848 125.600 1.00 127.60 ? 1014 GLU C OE2 1 
ATOM   4584 N N   . GLU C 1 137 ? 33.491  29.364 130.373 1.00 81.08  ? 1015 GLU C N   1 
ATOM   4585 C CA  . GLU C 1 137 ? 34.737  29.793 130.972 1.00 80.07  ? 1015 GLU C CA  1 
ATOM   4586 C C   . GLU C 1 137 ? 34.660  29.704 132.487 1.00 83.03  ? 1015 GLU C C   1 
ATOM   4587 O O   . GLU C 1 137 ? 35.484  29.035 133.115 1.00 82.24  ? 1015 GLU C O   1 
ATOM   4588 C CB  . GLU C 1 137 ? 35.159  31.190 130.481 1.00 81.08  ? 1015 GLU C CB  1 
ATOM   4589 C CG  . GLU C 1 137 ? 36.154  31.155 129.319 1.00 87.47  ? 1015 GLU C CG  1 
ATOM   4590 C CD  . GLU C 1 137 ? 36.531  32.528 128.795 1.00 98.68  ? 1015 GLU C CD  1 
ATOM   4591 O OE1 . GLU C 1 137 ? 36.836  33.419 129.611 1.00 95.92  ? 1015 GLU C OE1 1 
ATOM   4592 O OE2 . GLU C 1 137 ? 36.588  32.697 127.560 1.00 82.58  ? 1015 GLU C OE2 1 
ATOM   4593 N N   . SER C 1 138 ? 33.639  30.337 133.062 1.00 79.50  ? 1016 SER C N   1 
ATOM   4594 C CA  . SER C 1 138 ? 33.425  30.346 134.518 1.00 79.43  ? 1016 SER C CA  1 
ATOM   4595 C C   . SER C 1 138 ? 33.134  28.958 135.088 1.00 81.53  ? 1016 SER C C   1 
ATOM   4596 O O   . SER C 1 138 ? 33.686  28.559 136.115 1.00 80.55  ? 1016 SER C O   1 
ATOM   4597 C CB  . SER C 1 138 ? 32.276  31.278 134.876 1.00 83.82  ? 1016 SER C CB  1 
ATOM   4598 O OG  . SER C 1 138 ? 31.049  30.699 134.478 1.00 95.17  ? 1016 SER C OG  1 
ATOM   4599 N N   . GLU C 1 139 ? 32.252  28.235 134.416 1.00 76.61  ? 1017 GLU C N   1 
ATOM   4600 C CA  . GLU C 1 139 ? 31.915  26.895 134.821 1.00 76.04  ? 1017 GLU C CA  1 
ATOM   4601 C C   . GLU C 1 139 ? 33.167  26.025 134.846 1.00 76.94  ? 1017 GLU C C   1 
ATOM   4602 O O   . GLU C 1 139 ? 33.385  25.271 135.791 1.00 77.73  ? 1017 GLU C O   1 
ATOM   4603 C CB  . GLU C 1 139 ? 30.853  26.331 133.887 1.00 78.27  ? 1017 GLU C CB  1 
ATOM   4604 C CG  . GLU C 1 139 ? 31.036  24.870 133.534 1.00 99.58  ? 1017 GLU C CG  1 
ATOM   4605 C CD  . GLU C 1 139 ? 30.096  23.957 134.299 1.00 130.41 ? 1017 GLU C CD  1 
ATOM   4606 O OE1 . GLU C 1 139 ? 29.494  24.427 135.290 1.00 136.39 ? 1017 GLU C OE1 1 
ATOM   4607 O OE2 . GLU C 1 139 ? 29.985  22.765 133.926 1.00 116.62 ? 1017 GLU C OE2 1 
ATOM   4608 N N   . GLN C 1 140 ? 34.006  26.162 133.820 1.00 69.38  ? 1018 GLN C N   1 
ATOM   4609 C CA  . GLN C 1 140 ? 35.257  25.424 133.736 1.00 66.93  ? 1018 GLN C CA  1 
ATOM   4610 C C   . GLN C 1 140 ? 36.186  25.885 134.867 1.00 65.57  ? 1018 GLN C C   1 
ATOM   4611 O O   . GLN C 1 140 ? 36.795  25.069 135.546 1.00 64.01  ? 1018 GLN C O   1 
ATOM   4612 C CB  . GLN C 1 140 ? 35.890  25.646 132.354 1.00 68.65  ? 1018 GLN C CB  1 
ATOM   4613 C CG  . GLN C 1 140 ? 36.850  24.578 131.880 1.00 75.30  ? 1018 GLN C CG  1 
ATOM   4614 C CD  . GLN C 1 140 ? 36.374  23.195 132.218 1.00 85.22  ? 1018 GLN C CD  1 
ATOM   4615 O OE1 . GLN C 1 140 ? 37.094  22.407 132.827 1.00 77.80  ? 1018 GLN C OE1 1 
ATOM   4616 N NE2 . GLN C 1 140 ? 35.137  22.900 131.863 1.00 74.27  ? 1018 GLN C NE2 1 
ATOM   4617 N N   . ALA C 1 141 ? 36.275  27.193 135.082 1.00 60.15  ? 1019 ALA C N   1 
ATOM   4618 C CA  . ALA C 1 141 ? 37.099  27.731 136.162 1.00 60.05  ? 1019 ALA C CA  1 
ATOM   4619 C C   . ALA C 1 141 ? 36.699  27.125 137.506 1.00 65.77  ? 1019 ALA C C   1 
ATOM   4620 O O   . ALA C 1 141 ? 37.561  26.837 138.355 1.00 65.16  ? 1019 ALA C O   1 
ATOM   4621 C CB  . ALA C 1 141 ? 36.975  29.224 136.220 1.00 60.52  ? 1019 ALA C CB  1 
ATOM   4622 N N   . THR C 1 142 ? 35.383  26.955 137.674 1.00 61.17  ? 1020 THR C N   1 
ATOM   4623 C CA  . THR C 1 142 ? 34.764  26.392 138.864 1.00 60.44  ? 1020 THR C CA  1 
ATOM   4624 C C   . THR C 1 142 ? 35.182  24.933 139.023 1.00 64.57  ? 1020 THR C C   1 
ATOM   4625 O O   . THR C 1 142 ? 35.549  24.478 140.107 1.00 63.99  ? 1020 THR C O   1 
ATOM   4626 C CB  . THR C 1 142 ? 33.208  26.497 138.771 1.00 66.22  ? 1020 THR C CB  1 
ATOM   4627 O OG1 . THR C 1 142 ? 32.767  27.809 139.121 1.00 69.02  ? 1020 THR C OG1 1 
ATOM   4628 C CG2 . THR C 1 142 ? 32.551  25.546 139.697 1.00 63.18  ? 1020 THR C CG2 1 
ATOM   4629 N N   . GLU C 1 143 ? 35.074  24.198 137.929 1.00 60.89  ? 1021 GLU C N   1 
ATOM   4630 C CA  . GLU C 1 143 ? 35.404  22.785 137.904 1.00 60.64  ? 1021 GLU C CA  1 
ATOM   4631 C C   . GLU C 1 143 ? 36.853  22.536 138.270 1.00 62.29  ? 1021 GLU C C   1 
ATOM   4632 O O   . GLU C 1 143 ? 37.183  21.558 138.942 1.00 61.10  ? 1021 GLU C O   1 
ATOM   4633 C CB  . GLU C 1 143 ? 35.172  22.253 136.498 1.00 62.42  ? 1021 GLU C CB  1 
ATOM   4634 C CG  . GLU C 1 143 ? 33.722  22.090 136.155 1.00 81.35  ? 1021 GLU C CG  1 
ATOM   4635 C CD  . GLU C 1 143 ? 33.177  20.793 136.681 1.00 114.64 ? 1021 GLU C CD  1 
ATOM   4636 O OE1 . GLU C 1 143 ? 32.578  20.812 137.782 1.00 105.06 ? 1021 GLU C OE1 1 
ATOM   4637 O OE2 . GLU C 1 143 ? 33.431  19.751 136.035 1.00 110.12 ? 1021 GLU C OE2 1 
ATOM   4638 N N   . MET C 1 144 ? 37.721  23.400 137.767 1.00 57.59  ? 1022 MET C N   1 
ATOM   4639 C CA  . MET C 1 144 ? 39.147  23.268 137.990 1.00 57.06  ? 1022 MET C CA  1 
ATOM   4640 C C   . MET C 1 144 ? 39.458  23.480 139.456 1.00 61.38  ? 1022 MET C C   1 
ATOM   4641 O O   . MET C 1 144 ? 40.390  22.886 140.008 1.00 61.26  ? 1022 MET C O   1 
ATOM   4642 C CB  . MET C 1 144 ? 39.878  24.344 137.186 1.00 58.98  ? 1022 MET C CB  1 
ATOM   4643 C CG  . MET C 1 144 ? 39.653  24.317 135.680 1.00 60.45  ? 1022 MET C CG  1 
ATOM   4644 S SD  . MET C 1 144 ? 40.954  25.234 134.919 1.00 62.01  ? 1022 MET C SD  1 
ATOM   4645 C CE  . MET C 1 144 ? 40.053  26.497 134.375 1.00 59.30  ? 1022 MET C CE  1 
ATOM   4646 N N   . LEU C 1 145 ? 38.692  24.384 140.057 1.00 57.67  ? 1023 LEU C N   1 
ATOM   4647 C CA  . LEU C 1 145 ? 38.847  24.739 141.453 1.00 56.93  ? 1023 LEU C CA  1 
ATOM   4648 C C   . LEU C 1 145 ? 38.369  23.584 142.301 1.00 59.85  ? 1023 LEU C C   1 
ATOM   4649 O O   . LEU C 1 145 ? 39.082  23.086 143.158 1.00 58.75  ? 1023 LEU C O   1 
ATOM   4650 C CB  . LEU C 1 145 ? 38.026  26.000 141.751 1.00 55.89  ? 1023 LEU C CB  1 
ATOM   4651 C CG  . LEU C 1 145 ? 38.222  26.659 143.108 1.00 58.32  ? 1023 LEU C CG  1 
ATOM   4652 C CD1 . LEU C 1 145 ? 39.674  26.566 143.574 1.00 58.98  ? 1023 LEU C CD1 1 
ATOM   4653 C CD2 . LEU C 1 145 ? 37.780  28.086 143.045 1.00 56.39  ? 1023 LEU C CD2 1 
ATOM   4654 N N   . VAL C 1 146 ? 37.138  23.184 142.036 1.00 57.00  ? 1024 VAL C N   1 
ATOM   4655 C CA  . VAL C 1 146 ? 36.481  22.069 142.713 1.00 57.07  ? 1024 VAL C CA  1 
ATOM   4656 C C   . VAL C 1 146 ? 37.373  20.833 142.712 1.00 64.92  ? 1024 VAL C C   1 
ATOM   4657 O O   . VAL C 1 146 ? 37.471  20.139 143.708 1.00 64.03  ? 1024 VAL C O   1 
ATOM   4658 C CB  . VAL C 1 146 ? 35.101  21.769 142.045 1.00 58.77  ? 1024 VAL C CB  1 
ATOM   4659 C CG1 . VAL C 1 146 ? 34.495  20.490 142.570 1.00 57.75  ? 1024 VAL C CG1 1 
ATOM   4660 C CG2 . VAL C 1 146 ? 34.153  22.923 142.240 1.00 58.08  ? 1024 VAL C CG2 1 
ATOM   4661 N N   . HIS C 1 147 ? 38.013  20.560 141.581 1.00 66.43  ? 1025 HIS C N   1 
ATOM   4662 C CA  . HIS C 1 147 ? 38.892  19.403 141.445 1.00 68.73  ? 1025 HIS C CA  1 
ATOM   4663 C C   . HIS C 1 147 ? 40.141  19.583 142.297 1.00 67.75  ? 1025 HIS C C   1 
ATOM   4664 O O   . HIS C 1 147 ? 40.512  18.688 143.038 1.00 67.83  ? 1025 HIS C O   1 
ATOM   4665 C CB  . HIS C 1 147 ? 39.216  19.147 139.964 1.00 72.53  ? 1025 HIS C CB  1 
ATOM   4666 C CG  . HIS C 1 147 ? 40.434  18.296 139.731 1.00 78.60  ? 1025 HIS C CG  1 
ATOM   4667 N ND1 . HIS C 1 147 ? 40.387  16.914 139.689 1.00 81.63  ? 1025 HIS C ND1 1 
ATOM   4668 C CD2 . HIS C 1 147 ? 41.718  18.636 139.450 1.00 81.99  ? 1025 HIS C CD2 1 
ATOM   4669 C CE1 . HIS C 1 147 ? 41.596  16.443 139.431 1.00 81.72  ? 1025 HIS C CE1 1 
ATOM   4670 N NE2 . HIS C 1 147 ? 42.421  17.467 139.275 1.00 82.11  ? 1025 HIS C NE2 1 
ATOM   4671 N N   . ASN C 1 148 ? 40.719  20.774 142.260 1.00 61.88  ? 1026 ASN C N   1 
ATOM   4672 C CA  . ASN C 1 148 ? 41.865  21.113 143.102 1.00 61.41  ? 1026 ASN C CA  1 
ATOM   4673 C C   . ASN C 1 148 ? 41.568  20.910 144.590 1.00 62.73  ? 1026 ASN C C   1 
ATOM   4674 O O   . ASN C 1 148 ? 42.367  20.344 145.333 1.00 59.84  ? 1026 ASN C O   1 
ATOM   4675 C CB  . ASN C 1 148 ? 42.260  22.570 142.883 1.00 62.97  ? 1026 ASN C CB  1 
ATOM   4676 C CG  . ASN C 1 148 ? 43.739  22.794 143.078 1.00 92.85  ? 1026 ASN C CG  1 
ATOM   4677 O OD1 . ASN C 1 148 ? 44.170  23.330 144.097 1.00 83.45  ? 1026 ASN C OD1 1 
ATOM   4678 N ND2 . ASN C 1 148 ? 44.533  22.339 142.118 1.00 86.72  ? 1026 ASN C ND2 1 
ATOM   4679 N N   . ALA C 1 149 ? 40.412  21.418 145.005 1.00 60.43  ? 1027 ALA C N   1 
ATOM   4680 C CA  . ALA C 1 149 ? 39.919  21.331 146.384 1.00 59.31  ? 1027 ALA C CA  1 
ATOM   4681 C C   . ALA C 1 149 ? 39.682  19.869 146.775 1.00 64.07  ? 1027 ALA C C   1 
ATOM   4682 O O   . ALA C 1 149 ? 39.786  19.484 147.940 1.00 63.54  ? 1027 ALA C O   1 
ATOM   4683 C CB  . ALA C 1 149 ? 38.628  22.128 146.516 1.00 59.24  ? 1027 ALA C CB  1 
ATOM   4684 N N   . GLN C 1 150 ? 39.384  19.042 145.783 1.00 59.88  ? 1028 GLN C N   1 
ATOM   4685 C CA  . GLN C 1 150 ? 39.155  17.636 146.043 1.00 57.68  ? 1028 GLN C CA  1 
ATOM   4686 C C   . GLN C 1 150 ? 40.449  16.932 146.320 1.00 59.44  ? 1028 GLN C C   1 
ATOM   4687 O O   . GLN C 1 150 ? 40.546  16.147 147.249 1.00 59.33  ? 1028 GLN C O   1 
ATOM   4688 C CB  . GLN C 1 150 ? 38.405  16.997 144.892 1.00 58.12  ? 1028 GLN C CB  1 
ATOM   4689 C CG  . GLN C 1 150 ? 36.916  17.274 144.992 1.00 62.77  ? 1028 GLN C CG  1 
ATOM   4690 C CD  . GLN C 1 150 ? 36.186  16.985 143.710 1.00 73.99  ? 1028 GLN C CD  1 
ATOM   4691 O OE1 . GLN C 1 150 ? 36.802  16.616 142.699 1.00 71.79  ? 1028 GLN C OE1 1 
ATOM   4692 N NE2 . GLN C 1 150 ? 34.863  17.140 143.736 1.00 58.08  ? 1028 GLN C NE2 1 
ATOM   4693 N N   . ASN C 1 151 ? 41.466  17.252 145.549 1.00 55.66  ? 1029 ASN C N   1 
ATOM   4694 C CA  . ASN C 1 151 ? 42.757  16.643 145.796 1.00 56.25  ? 1029 ASN C CA  1 
ATOM   4695 C C   . ASN C 1 151 ? 43.313  17.152 147.115 1.00 59.23  ? 1029 ASN C C   1 
ATOM   4696 O O   . ASN C 1 151 ? 43.834  16.375 147.915 1.00 60.23  ? 1029 ASN C O   1 
ATOM   4697 C CB  . ASN C 1 151 ? 43.744  16.948 144.675 1.00 60.79  ? 1029 ASN C CB  1 
ATOM   4698 C CG  . ASN C 1 151 ? 43.186  16.625 143.300 1.00 97.71  ? 1029 ASN C CG  1 
ATOM   4699 O OD1 . ASN C 1 151 ? 43.654  17.169 142.301 1.00 102.73 ? 1029 ASN C OD1 1 
ATOM   4700 N ND2 . ASN C 1 151 ? 42.209  15.710 143.235 1.00 83.67  ? 1029 ASN C ND2 1 
ATOM   4701 N N   . LEU C 1 152 ? 43.204  18.454 147.342 1.00 52.44  ? 1030 LEU C N   1 
ATOM   4702 C CA  . LEU C 1 152 ? 43.705  19.017 148.563 1.00 51.35  ? 1030 LEU C CA  1 
ATOM   4703 C C   . LEU C 1 152 ? 43.100  18.323 149.776 1.00 57.21  ? 1030 LEU C C   1 
ATOM   4704 O O   . LEU C 1 152 ? 43.821  17.801 150.628 1.00 57.26  ? 1030 LEU C O   1 
ATOM   4705 C CB  . LEU C 1 152 ? 43.430  20.528 148.615 1.00 50.48  ? 1030 LEU C CB  1 
ATOM   4706 C CG  . LEU C 1 152 ? 44.266  21.291 149.650 1.00 53.11  ? 1030 LEU C CG  1 
ATOM   4707 C CD1 . LEU C 1 152 ? 45.778  21.203 149.387 1.00 52.18  ? 1030 LEU C CD1 1 
ATOM   4708 C CD2 . LEU C 1 152 ? 43.819  22.705 149.770 1.00 53.53  ? 1030 LEU C CD2 1 
ATOM   4709 N N   . MET C 1 153 ? 41.774  18.377 149.874 1.00 54.52  ? 1031 MET C N   1 
ATOM   4710 C CA  . MET C 1 153 ? 41.062  17.819 151.019 1.00 54.77  ? 1031 MET C CA  1 
ATOM   4711 C C   . MET C 1 153 ? 41.460  16.367 151.236 1.00 60.67  ? 1031 MET C C   1 
ATOM   4712 O O   . MET C 1 153 ? 41.552  15.928 152.384 1.00 60.89  ? 1031 MET C O   1 
ATOM   4713 C CB  . MET C 1 153 ? 39.516  17.917 150.877 1.00 56.77  ? 1031 MET C CB  1 
ATOM   4714 C CG  . MET C 1 153 ? 38.903  19.305 150.999 1.00 59.99  ? 1031 MET C CG  1 
ATOM   4715 S SD  . MET C 1 153 ? 39.297  20.227 152.513 1.00 64.58  ? 1031 MET C SD  1 
ATOM   4716 C CE  . MET C 1 153 ? 41.020  20.786 152.134 1.00 60.15  ? 1031 MET C CE  1 
ATOM   4717 N N   . GLN C 1 154 ? 41.615  15.622 150.128 1.00 58.67  ? 1032 GLN C N   1 
ATOM   4718 C CA  . GLN C 1 154 ? 41.958  14.186 150.139 1.00 58.31  ? 1032 GLN C CA  1 
ATOM   4719 C C   . GLN C 1 154 ? 43.414  13.991 150.507 1.00 61.36  ? 1032 GLN C C   1 
ATOM   4720 O O   . GLN C 1 154 ? 43.695  13.279 151.466 1.00 61.88  ? 1032 GLN C O   1 
ATOM   4721 C CB  . GLN C 1 154 ? 41.656  13.508 148.800 1.00 59.86  ? 1032 GLN C CB  1 
ATOM   4722 C CG  . GLN C 1 154 ? 41.926  11.986 148.801 1.00 81.22  ? 1032 GLN C CG  1 
ATOM   4723 C CD  . GLN C 1 154 ? 40.905  11.174 149.614 1.00 103.20 ? 1032 GLN C CD  1 
ATOM   4724 O OE1 . GLN C 1 154 ? 39.738  11.564 149.751 1.00 96.03  ? 1032 GLN C OE1 1 
ATOM   4725 N NE2 . GLN C 1 154 ? 41.343  10.022 150.133 1.00 98.78  ? 1032 GLN C NE2 1 
ATOM   4726 N N   . SER C 1 155 ? 44.319  14.634 149.758 1.00 56.00  ? 1033 SER C N   1 
ATOM   4727 C CA  . SER C 1 155 ? 45.745  14.661 150.076 1.00 55.40  ? 1033 SER C CA  1 
ATOM   4728 C C   . SER C 1 155 ? 45.945  14.927 151.582 1.00 60.76  ? 1033 SER C C   1 
ATOM   4729 O O   . SER C 1 155 ? 46.895  14.406 152.180 1.00 62.38  ? 1033 SER C O   1 
ATOM   4730 C CB  . SER C 1 155 ? 46.401  15.827 149.343 1.00 59.01  ? 1033 SER C CB  1 
ATOM   4731 O OG  . SER C 1 155 ? 47.048  15.428 148.153 1.00 67.63  ? 1033 SER C OG  1 
ATOM   4732 N N   . VAL C 1 156 ? 45.090  15.766 152.186 1.00 54.93  ? 1034 VAL C N   1 
ATOM   4733 C CA  . VAL C 1 156 ? 45.245  16.110 153.611 1.00 54.26  ? 1034 VAL C CA  1 
ATOM   4734 C C   . VAL C 1 156 ? 44.739  15.061 154.581 1.00 62.46  ? 1034 VAL C C   1 
ATOM   4735 O O   . VAL C 1 156 ? 45.321  14.861 155.648 1.00 63.06  ? 1034 VAL C O   1 
ATOM   4736 C CB  . VAL C 1 156 ? 44.674  17.502 153.981 1.00 55.37  ? 1034 VAL C CB  1 
ATOM   4737 C CG1 . VAL C 1 156 ? 44.485  17.608 155.512 1.00 53.81  ? 1034 VAL C CG1 1 
ATOM   4738 C CG2 . VAL C 1 156 ? 45.581  18.619 153.450 1.00 54.41  ? 1034 VAL C CG2 1 
ATOM   4739 N N   . LYS C 1 157 ? 43.619  14.442 154.218 1.00 61.32  ? 1035 LYS C N   1 
ATOM   4740 C CA  . LYS C 1 157 ? 42.962  13.402 155.006 1.00 61.74  ? 1035 LYS C CA  1 
ATOM   4741 C C   . LYS C 1 157 ? 43.926  12.247 155.137 1.00 67.47  ? 1035 LYS C C   1 
ATOM   4742 O O   . LYS C 1 157 ? 44.055  11.626 156.202 1.00 68.22  ? 1035 LYS C O   1 
ATOM   4743 C CB  . LYS C 1 157 ? 41.732  12.899 154.247 1.00 63.77  ? 1035 LYS C CB  1 
ATOM   4744 C CG  . LYS C 1 157 ? 40.674  12.261 155.116 1.00 76.24  ? 1035 LYS C CG  1 
ATOM   4745 C CD  . LYS C 1 157 ? 39.415  12.017 154.315 1.00 92.17  ? 1035 LYS C CD  1 
ATOM   4746 C CE  . LYS C 1 157 ? 39.411  10.619 153.713 1.00 106.50 ? 1035 LYS C CE  1 
ATOM   4747 N NZ  . LYS C 1 157 ? 38.879  9.631  154.692 1.00 113.84 ? 1035 LYS C NZ  1 
ATOM   4748 N N   . GLU C 1 158 ? 44.600  11.967 154.034 1.00 63.24  ? 1036 GLU C N   1 
ATOM   4749 C CA  . GLU C 1 158 ? 45.540  10.878 153.984 1.00 63.15  ? 1036 GLU C CA  1 
ATOM   4750 C C   . GLU C 1 158 ? 46.758  11.151 154.846 1.00 65.76  ? 1036 GLU C C   1 
ATOM   4751 O O   . GLU C 1 158 ? 47.167  10.275 155.627 1.00 66.91  ? 1036 GLU C O   1 
ATOM   4752 C CB  . GLU C 1 158 ? 45.896  10.552 152.540 1.00 64.95  ? 1036 GLU C CB  1 
ATOM   4753 C CG  . GLU C 1 158 ? 44.723  9.903  151.776 1.00 77.37  ? 1036 GLU C CG  1 
ATOM   4754 C CD  . GLU C 1 158 ? 44.916  9.912  150.269 1.00 106.03 ? 1036 GLU C CD  1 
ATOM   4755 O OE1 . GLU C 1 158 ? 46.016  10.299 149.790 1.00 101.65 ? 1036 GLU C OE1 1 
ATOM   4756 O OE2 . GLU C 1 158 ? 43.953  9.541  149.565 1.00 101.34 ? 1036 GLU C OE2 1 
ATOM   4757 N N   . THR C 1 159 ? 47.276  12.376 154.773 1.00 59.12  ? 1037 THR C N   1 
ATOM   4758 C CA  . THR C 1 159 ? 48.411  12.781 155.603 1.00 58.18  ? 1037 THR C CA  1 
ATOM   4759 C C   . THR C 1 159 ? 48.114  12.670 157.111 1.00 63.20  ? 1037 THR C C   1 
ATOM   4760 O O   . THR C 1 159 ? 49.042  12.578 157.923 1.00 62.54  ? 1037 THR C O   1 
ATOM   4761 C CB  . THR C 1 159 ? 48.855  14.205 155.298 1.00 62.65  ? 1037 THR C CB  1 
ATOM   4762 O OG1 . THR C 1 159 ? 48.696  14.492 153.904 1.00 63.42  ? 1037 THR C OG1 1 
ATOM   4763 C CG2 . THR C 1 159 ? 50.305  14.383 155.699 1.00 60.47  ? 1037 THR C CG2 1 
ATOM   4764 N N   . VAL C 1 160 ? 46.823  12.733 157.472 1.00 59.91  ? 1038 VAL C N   1 
ATOM   4765 C CA  . VAL C 1 160 ? 46.350  12.632 158.858 1.00 58.98  ? 1038 VAL C CA  1 
ATOM   4766 C C   . VAL C 1 160 ? 46.282  11.149 159.256 1.00 65.64  ? 1038 VAL C C   1 
ATOM   4767 O O   . VAL C 1 160 ? 46.642  10.774 160.383 1.00 66.71  ? 1038 VAL C O   1 
ATOM   4768 C CB  . VAL C 1 160 ? 44.955  13.321 159.023 1.00 61.82  ? 1038 VAL C CB  1 
ATOM   4769 C CG1 . VAL C 1 160 ? 44.206  12.871 160.342 1.00 61.34  ? 1038 VAL C CG1 1 
ATOM   4770 C CG2 . VAL C 1 160 ? 45.119  14.819 158.990 1.00 61.43  ? 1038 VAL C CG2 1 
ATOM   4771 N N   . ARG C 1 161 ? 45.824  10.307 158.328 1.00 61.78  ? 1039 ARG C N   1 
ATOM   4772 C CA  . ARG C 1 161 ? 45.721  8.873  158.581 1.00 61.54  ? 1039 ARG C CA  1 
ATOM   4773 C C   . ARG C 1 161 ? 47.112  8.184  158.610 1.00 65.35  ? 1039 ARG C C   1 
ATOM   4774 O O   . ARG C 1 161 ? 47.359  7.255  159.410 1.00 65.47  ? 1039 ARG C O   1 
ATOM   4775 C CB  . ARG C 1 161 ? 44.763  8.238  157.570 1.00 61.90  ? 1039 ARG C CB  1 
ATOM   4776 C CG  . ARG C 1 161 ? 43.345  8.835  157.647 1.00 70.20  ? 1039 ARG C CG  1 
ATOM   4777 C CD  . ARG C 1 161 ? 42.365  8.044  156.794 1.00 87.78  ? 1039 ARG C CD  1 
ATOM   4778 N NE  . ARG C 1 161 ? 42.989  7.544  155.569 1.00 111.43 ? 1039 ARG C NE  1 
ATOM   4779 C CZ  . ARG C 1 161 ? 42.506  7.748  154.347 1.00 130.80 ? 1039 ARG C CZ  1 
ATOM   4780 N NH1 . ARG C 1 161 ? 41.388  8.449  154.179 1.00 122.77 ? 1039 ARG C NH1 1 
ATOM   4781 N NH2 . ARG C 1 161 ? 43.149  7.257  153.291 1.00 110.87 ? 1039 ARG C NH2 1 
ATOM   4782 N N   . GLU C 1 162 ? 48.036  8.690  157.798 1.00 59.70  ? 1040 GLU C N   1 
ATOM   4783 C CA  . GLU C 1 162 ? 49.390  8.167  157.818 1.00 59.40  ? 1040 GLU C CA  1 
ATOM   4784 C C   . GLU C 1 162 ? 50.169  8.643  159.049 1.00 64.94  ? 1040 GLU C C   1 
ATOM   4785 O O   . GLU C 1 162 ? 50.844  7.841  159.719 1.00 65.11  ? 1040 GLU C O   1 
ATOM   4786 C CB  . GLU C 1 162 ? 50.127  8.552  156.544 1.00 60.40  ? 1040 GLU C CB  1 
ATOM   4787 C CG  . GLU C 1 162 ? 49.546  7.855  155.318 1.00 68.43  ? 1040 GLU C CG  1 
ATOM   4788 C CD  . GLU C 1 162 ? 49.955  6.391  155.215 1.00 82.95  ? 1040 GLU C CD  1 
ATOM   4789 O OE1 . GLU C 1 162 ? 49.529  5.733  154.243 1.00 88.27  ? 1040 GLU C OE1 1 
ATOM   4790 O OE2 . GLU C 1 162 ? 50.713  5.897  156.086 1.00 77.83  ? 1040 GLU C OE2 1 
ATOM   4791 N N   . ALA C 1 163 ? 50.083  9.947  159.328 1.00 61.17  ? 1041 ALA C N   1 
ATOM   4792 C CA  . ALA C 1 163 ? 50.772  10.587 160.473 1.00 59.53  ? 1041 ALA C CA  1 
ATOM   4793 C C   . ALA C 1 163 ? 50.524  9.857  161.794 1.00 63.80  ? 1041 ALA C C   1 
ATOM   4794 O O   . ALA C 1 163 ? 51.428  9.709  162.632 1.00 63.05  ? 1041 ALA C O   1 
ATOM   4795 C CB  . ALA C 1 163 ? 50.332  12.040 160.611 1.00 59.36  ? 1041 ALA C CB  1 
ATOM   4796 N N   . GLU C 1 164 ? 49.272  9.442  161.975 1.00 60.62  ? 1042 GLU C N   1 
ATOM   4797 C CA  . GLU C 1 164 ? 48.850  8.704  163.171 1.00 59.71  ? 1042 GLU C CA  1 
ATOM   4798 C C   . GLU C 1 164 ? 49.487  7.285  163.107 1.00 61.73  ? 1042 GLU C C   1 
ATOM   4799 O O   . GLU C 1 164 ? 50.165  6.845  164.060 1.00 59.52  ? 1042 GLU C O   1 
ATOM   4800 C CB  . GLU C 1 164 ? 47.308  8.689  163.278 1.00 60.28  ? 1042 GLU C CB  1 
ATOM   4801 C CG  . GLU C 1 164 ? 46.761  7.933  164.469 1.00 67.69  ? 1042 GLU C CG  1 
ATOM   4802 C CD  . GLU C 1 164 ? 46.217  6.579  164.051 1.00 86.56  ? 1042 GLU C CD  1 
ATOM   4803 O OE1 . GLU C 1 164 ? 46.045  6.407  162.815 1.00 80.86  ? 1042 GLU C OE1 1 
ATOM   4804 O OE2 . GLU C 1 164 ? 45.997  5.693  164.924 1.00 68.66  ? 1042 GLU C OE2 1 
ATOM   4805 N N   . ALA C 1 165 ? 49.382  6.635  161.944 1.00 57.52  ? 1043 ALA C N   1 
ATOM   4806 C CA  . ALA C 1 165 ? 50.038  5.329  161.758 1.00 57.09  ? 1043 ALA C CA  1 
ATOM   4807 C C   . ALA C 1 165 ? 51.537  5.459  162.151 1.00 64.26  ? 1043 ALA C C   1 
ATOM   4808 O O   . ALA C 1 165 ? 52.035  4.691  163.010 1.00 66.86  ? 1043 ALA C O   1 
ATOM   4809 C CB  . ALA C 1 165 ? 49.882  4.826  160.309 1.00 56.97  ? 1043 ALA C CB  1 
ATOM   4810 N N   . ALA C 1 166 ? 52.215  6.482  161.608 1.00 58.75  ? 1044 ALA C N   1 
ATOM   4811 C CA  . ALA C 1 166 ? 53.619  6.763  161.955 1.00 57.91  ? 1044 ALA C CA  1 
ATOM   4812 C C   . ALA C 1 166 ? 53.849  7.182  163.419 1.00 63.99  ? 1044 ALA C C   1 
ATOM   4813 O O   . ALA C 1 166 ? 54.955  7.583  163.752 1.00 63.62  ? 1044 ALA C O   1 
ATOM   4814 C CB  . ALA C 1 166 ? 54.210  7.840  161.032 1.00 58.10  ? 1044 ALA C CB  1 
ATOM   4815 N N   . SER C 1 167 ? 52.826  7.150  164.279 1.00 61.20  ? 1045 SER C N   1 
ATOM   4816 C CA  . SER C 1 167 ? 53.024  7.582  165.684 1.00 61.54  ? 1045 SER C CA  1 
ATOM   4817 C C   . SER C 1 167 ? 53.345  6.374  166.580 1.00 68.72  ? 1045 SER C C   1 
ATOM   4818 O O   . SER C 1 167 ? 53.775  6.514  167.750 1.00 67.53  ? 1045 SER C O   1 
ATOM   4819 C CB  . SER C 1 167 ? 51.768  8.303  166.232 1.00 63.18  ? 1045 SER C CB  1 
ATOM   4820 O OG  . SER C 1 167 ? 50.941  7.410  166.987 1.00 68.39  ? 1045 SER C OG  1 
ATOM   4821 N N   . ILE C 1 168 ? 53.091  5.194  166.013 1.00 67.05  ? 1046 ILE C N   1 
ATOM   4822 C CA  . ILE C 1 168 ? 53.261  3.943  166.724 1.00 67.60  ? 1046 ILE C CA  1 
ATOM   4823 C C   . ILE C 1 168 ? 54.597  3.248  166.410 1.00 73.91  ? 1046 ILE C C   1 
ATOM   4824 O O   . ILE C 1 168 ? 55.023  2.363  167.174 1.00 73.93  ? 1046 ILE C O   1 
ATOM   4825 C CB  . ILE C 1 168 ? 51.976  3.034  166.538 1.00 70.68  ? 1046 ILE C CB  1 
ATOM   4826 C CG1 . ILE C 1 168 ? 51.419  2.573  167.898 1.00 72.21  ? 1046 ILE C CG1 1 
ATOM   4827 C CG2 . ILE C 1 168 ? 52.145  1.928  165.453 1.00 68.64  ? 1046 ILE C CG2 1 
ATOM   4828 C CD1 . ILE C 1 168 ? 51.084  3.741  168.872 1.00 87.40  ? 1046 ILE C CD1 1 
ATOM   4829 N N   . LYS C 1 169 ? 55.253  3.662  165.310 1.00 70.67  ? 1047 LYS C N   1 
ATOM   4830 C CA  . LYS C 1 169 ? 56.536  3.056  164.841 1.00 69.42  ? 1047 LYS C CA  1 
ATOM   4831 C C   . LYS C 1 169 ? 57.730  3.994  165.029 1.00 70.28  ? 1047 LYS C C   1 
ATOM   4832 O O   . LYS C 1 169 ? 58.740  3.874  164.336 1.00 68.75  ? 1047 LYS C O   1 
ATOM   4833 C CB  . LYS C 1 169 ? 56.441  2.720  163.324 1.00 71.27  ? 1047 LYS C CB  1 
ATOM   4834 C CG  . LYS C 1 169 ? 55.272  1.821  162.926 1.00 80.38  ? 1047 LYS C CG  1 
ATOM   4835 C CD  . LYS C 1 169 ? 55.774  0.504  162.323 1.00 91.13  ? 1047 LYS C CD  1 
ATOM   4836 C CE  . LYS C 1 169 ? 55.939  -0.600 163.391 1.00 106.31 ? 1047 LYS C CE  1 
ATOM   4837 N NZ  . LYS C 1 169 ? 57.239  -1.349 163.271 1.00 114.04 ? 1047 LYS C NZ  1 
ATOM   4838 N N   . ILE C 1 170 ? 57.581  4.990  165.891 1.00 66.55  ? 1048 ILE C N   1 
ATOM   4839 C CA  . ILE C 1 170 ? 58.616  6.026  166.000 1.00 66.19  ? 1048 ILE C CA  1 
ATOM   4840 C C   . ILE C 1 170 ? 59.886  5.662  166.783 1.00 73.58  ? 1048 ILE C C   1 
ATOM   4841 O O   . ILE C 1 170 ? 59.808  5.227  167.942 1.00 72.98  ? 1048 ILE C O   1 
ATOM   4842 C CB  . ILE C 1 170 ? 58.040  7.387  166.469 1.00 67.87  ? 1048 ILE C CB  1 
ATOM   4843 C CG1 . ILE C 1 170 ? 56.902  7.882  165.548 1.00 66.55  ? 1048 ILE C CG1 1 
ATOM   4844 C CG2 . ILE C 1 170 ? 59.166  8.394  166.681 1.00 68.46  ? 1048 ILE C CG2 1 
ATOM   4845 C CD1 . ILE C 1 170 ? 57.324  8.789  164.331 1.00 60.56  ? 1048 ILE C CD1 1 
ATOM   4846 N N   . ARG C 1 171 ? 61.043  5.890  166.147 1.00 71.28  ? 1049 ARG C N   1 
ATOM   4847 C CA  . ARG C 1 171 ? 62.365  5.643  166.728 1.00 71.78  ? 1049 ARG C CA  1 
ATOM   4848 C C   . ARG C 1 171 ? 62.471  5.958  168.232 1.00 84.21  ? 1049 ARG C C   1 
ATOM   4849 O O   . ARG C 1 171 ? 62.247  7.094  168.671 1.00 79.38  ? 1049 ARG C O   1 
ATOM   4850 C CB  . ARG C 1 171 ? 63.433  6.434  165.946 1.00 69.99  ? 1049 ARG C CB  1 
ATOM   4851 C CG  . ARG C 1 171 ? 63.563  7.915  166.357 1.00 73.78  ? 1049 ARG C CG  1 
ATOM   4852 C CD  . ARG C 1 171 ? 65.009  8.375  166.351 1.00 86.88  ? 1049 ARG C CD  1 
ATOM   4853 N NE  . ARG C 1 171 ? 65.150  9.685  165.724 1.00 104.11 ? 1049 ARG C NE  1 
ATOM   4854 C CZ  . ARG C 1 171 ? 65.500  9.880  164.456 1.00 124.45 ? 1049 ARG C CZ  1 
ATOM   4855 N NH1 . ARG C 1 171 ? 65.745  8.842  163.663 1.00 108.68 ? 1049 ARG C NH1 1 
ATOM   4856 N NH2 . ARG C 1 171 ? 65.598  11.116 163.978 1.00 115.57 ? 1049 ARG C NH2 1 
ATOM   4857 N N   . PHE C 1 176 ? 60.356  15.421 168.628 1.00 84.17  ? 1054 PHE C N   1 
ATOM   4858 C CA  . PHE C 1 176 ? 59.037  15.888 168.176 1.00 84.47  ? 1054 PHE C CA  1 
ATOM   4859 C C   . PHE C 1 176 ? 57.994  14.761 168.186 1.00 87.61  ? 1054 PHE C C   1 
ATOM   4860 O O   . PHE C 1 176 ? 58.325  13.604 167.925 1.00 88.10  ? 1054 PHE C O   1 
ATOM   4861 C CB  . PHE C 1 176 ? 59.136  16.500 166.772 1.00 86.80  ? 1054 PHE C CB  1 
ATOM   4862 C CG  . PHE C 1 176 ? 57.797  16.855 166.161 1.00 88.65  ? 1054 PHE C CG  1 
ATOM   4863 C CD1 . PHE C 1 176 ? 57.283  18.140 166.270 1.00 91.41  ? 1054 PHE C CD1 1 
ATOM   4864 C CD2 . PHE C 1 176 ? 57.058  15.906 165.466 1.00 90.52  ? 1054 PHE C CD2 1 
ATOM   4865 C CE1 . PHE C 1 176 ? 56.050  18.460 165.727 1.00 91.82  ? 1054 PHE C CE1 1 
ATOM   4866 C CE2 . PHE C 1 176 ? 55.832  16.231 164.906 1.00 92.70  ? 1054 PHE C CE2 1 
ATOM   4867 C CZ  . PHE C 1 176 ? 55.327  17.504 165.044 1.00 90.45  ? 1054 PHE C CZ  1 
ATOM   4868 N N   . THR C 1 177 ? 56.738  15.099 168.488 1.00 82.12  ? 1055 THR C N   1 
ATOM   4869 C CA  . THR C 1 177 ? 55.655  14.105 168.578 1.00 80.59  ? 1055 THR C CA  1 
ATOM   4870 C C   . THR C 1 177 ? 54.296  14.775 168.445 1.00 80.79  ? 1055 THR C C   1 
ATOM   4871 O O   . THR C 1 177 ? 54.186  15.997 168.603 1.00 81.38  ? 1055 THR C O   1 
ATOM   4872 C CB  . THR C 1 177 ? 55.676  13.358 169.943 1.00 91.02  ? 1055 THR C CB  1 
ATOM   4873 O OG1 . THR C 1 177 ? 55.126  14.209 170.965 1.00 91.71  ? 1055 THR C OG1 1 
ATOM   4874 C CG2 . THR C 1 177 ? 57.101  12.906 170.335 1.00 88.69  ? 1055 THR C CG2 1 
ATOM   4875 N N   . LEU C 1 178 ? 53.258  13.966 168.233 1.00 74.13  ? 1056 LEU C N   1 
ATOM   4876 C CA  . LEU C 1 178 ? 51.885  14.476 168.144 1.00 73.17  ? 1056 LEU C CA  1 
ATOM   4877 C C   . LEU C 1 178 ? 50.960  13.621 169.020 1.00 77.24  ? 1056 LEU C C   1 
ATOM   4878 O O   . LEU C 1 178 ? 51.131  12.398 169.083 1.00 75.17  ? 1056 LEU C O   1 
ATOM   4879 C CB  . LEU C 1 178 ? 51.383  14.560 166.674 1.00 72.71  ? 1056 LEU C CB  1 
ATOM   4880 C CG  . LEU C 1 178 ? 52.011  15.541 165.642 1.00 75.34  ? 1056 LEU C CG  1 
ATOM   4881 C CD1 . LEU C 1 178 ? 51.805  15.097 164.215 1.00 73.71  ? 1056 LEU C CD1 1 
ATOM   4882 C CD2 . LEU C 1 178 ? 51.565  16.994 165.803 1.00 76.72  ? 1056 LEU C CD2 1 
ATOM   4883 N N   . ARG C 1 179 ? 50.030  14.285 169.731 1.00 76.64  ? 1057 ARG C N   1 
ATOM   4884 C CA  . ARG C 1 179 ? 49.052  13.636 170.643 1.00 77.15  ? 1057 ARG C CA  1 
ATOM   4885 C C   . ARG C 1 179 ? 47.802  13.039 169.932 1.00 81.99  ? 1057 ARG C C   1 
ATOM   4886 O O   . ARG C 1 179 ? 46.942  13.760 169.380 1.00 81.95  ? 1057 ARG C O   1 
ATOM   4887 C CB  . ARG C 1 179 ? 48.663  14.572 171.812 1.00 76.67  ? 1057 ARG C CB  1 
ATOM   4888 C CG  . ARG C 1 179 ? 47.922  13.890 173.004 1.00 85.40  ? 1057 ARG C CG  1 
ATOM   4889 C CD  . ARG C 1 179 ? 47.261  14.921 173.944 1.00 97.04  ? 1057 ARG C CD  1 
ATOM   4890 N NE  . ARG C 1 179 ? 45.939  14.543 174.485 1.00 108.13 ? 1057 ARG C NE  1 
ATOM   4891 C CZ  . ARG C 1 179 ? 44.756  14.956 174.006 1.00 109.92 ? 1057 ARG C CZ  1 
ATOM   4892 N NH1 . ARG C 1 179 ? 44.696  15.715 172.909 1.00 98.91  ? 1057 ARG C NH1 1 
ATOM   4893 N NH2 . ARG C 1 179 ? 43.622  14.581 174.608 1.00 69.79  ? 1057 ARG C NH2 1 
ATOM   4894 N N   . TRP C 1 180 ? 47.725  11.711 169.946 1.00 78.14  ? 1058 TRP C N   1 
ATOM   4895 C CA  . TRP C 1 180 ? 46.659  10.996 169.268 1.00 78.87  ? 1058 TRP C CA  1 
ATOM   4896 C C   . TRP C 1 180 ? 45.608  10.424 170.227 1.00 80.55  ? 1058 TRP C C   1 
ATOM   4897 O O   . TRP C 1 180 ? 45.574  9.240  170.515 1.00 78.23  ? 1058 TRP C O   1 
ATOM   4898 C CB  . TRP C 1 180 ? 47.262  9.915  168.360 1.00 78.74  ? 1058 TRP C CB  1 
ATOM   4899 C CG  . TRP C 1 180 ? 48.053  10.469 167.170 1.00 81.01  ? 1058 TRP C CG  1 
ATOM   4900 C CD1 . TRP C 1 180 ? 49.423  10.566 167.049 1.00 83.53  ? 1058 TRP C CD1 1 
ATOM   4901 C CD2 . TRP C 1 180 ? 47.509  10.976 165.936 1.00 81.03  ? 1058 TRP C CD2 1 
ATOM   4902 N NE1 . TRP C 1 180 ? 49.752  11.101 165.823 1.00 83.34  ? 1058 TRP C NE1 1 
ATOM   4903 C CE2 . TRP C 1 180 ? 48.599  11.361 165.123 1.00 84.87  ? 1058 TRP C CE2 1 
ATOM   4904 C CE3 . TRP C 1 180 ? 46.202  11.148 165.444 1.00 82.76  ? 1058 TRP C CE3 1 
ATOM   4905 C CZ2 . TRP C 1 180 ? 48.421  11.900 163.850 1.00 84.13  ? 1058 TRP C CZ2 1 
ATOM   4906 C CZ3 . TRP C 1 180 ? 46.032  11.680 164.176 1.00 83.86  ? 1058 TRP C CZ3 1 
ATOM   4907 C CH2 . TRP C 1 180 ? 47.133  12.051 163.398 1.00 84.34  ? 1058 TRP C CH2 1 
ATOM   4908 N N   . VAL C 1 181 ? 44.717  11.292 170.674 1.00 78.51  ? 1059 VAL C N   1 
ATOM   4909 C CA  . VAL C 1 181 ? 43.689  10.942 171.636 1.00 78.84  ? 1059 VAL C CA  1 
ATOM   4910 C C   . VAL C 1 181 ? 42.312  11.086 171.026 1.00 83.40  ? 1059 VAL C C   1 
ATOM   4911 O O   . VAL C 1 181 ? 41.763  12.186 170.981 1.00 82.25  ? 1059 VAL C O   1 
ATOM   4912 C CB  . VAL C 1 181 ? 43.779  11.891 172.831 1.00 83.44  ? 1059 VAL C CB  1 
ATOM   4913 C CG1 . VAL C 1 181 ? 42.542  11.768 173.714 1.00 83.94  ? 1059 VAL C CG1 1 
ATOM   4914 C CG2 . VAL C 1 181 ? 45.075  11.670 173.604 1.00 83.04  ? 1059 VAL C CG2 1 
ATOM   4915 N N   . ARG C 1 182 ? 41.730  9.980  170.593 1.00 81.30  ? 1060 ARG C N   1 
ATOM   4916 C CA  . ARG C 1 182 ? 40.405  10.048 170.010 1.00 81.68  ? 1060 ARG C CA  1 
ATOM   4917 C C   . ARG C 1 182 ? 39.420  10.793 170.910 1.00 88.96  ? 1060 ARG C C   1 
ATOM   4918 O O   . ARG C 1 182 ? 39.443  10.644 172.135 1.00 89.80  ? 1060 ARG C O   1 
ATOM   4919 C CB  . ARG C 1 182 ? 39.884  8.661  169.642 1.00 80.78  ? 1060 ARG C CB  1 
ATOM   4920 C CG  . ARG C 1 182 ? 39.391  8.553  168.191 1.00 86.89  ? 1060 ARG C CG  1 
ATOM   4921 C CD  . ARG C 1 182 ? 37.993  9.158  168.058 1.00 95.54  ? 1060 ARG C CD  1 
ATOM   4922 N NE  . ARG C 1 182 ? 37.152  8.573  167.014 1.00 101.31 ? 1060 ARG C NE  1 
ATOM   4923 C CZ  . ARG C 1 182 ? 37.199  7.309  166.596 1.00 114.71 ? 1060 ARG C CZ  1 
ATOM   4924 N NH1 . ARG C 1 182 ? 38.083  6.450  167.097 1.00 91.30  ? 1060 ARG C NH1 1 
ATOM   4925 N NH2 . ARG C 1 182 ? 36.352  6.903  165.656 1.00 108.62 ? 1060 ARG C NH2 1 
ATOM   4926 N N   . LYS C 1 183 ? 38.585  11.629 170.287 1.00 86.29  ? 1061 LYS C N   1 
ATOM   4927 C CA  . LYS C 1 183 ? 37.577  12.416 171.000 1.00 85.26  ? 1061 LYS C CA  1 
ATOM   4928 C C   . LYS C 1 183 ? 36.701  11.528 171.894 1.00 89.13  ? 1061 LYS C C   1 
ATOM   4929 O O   . LYS C 1 183 ? 36.513  10.343 171.630 1.00 88.48  ? 1061 LYS C O   1 
ATOM   4930 C CB  . LYS C 1 183 ? 36.725  13.249 170.025 1.00 85.79  ? 1061 LYS C CB  1 
ATOM   4931 C CG  . LYS C 1 183 ? 36.440  14.683 170.482 1.00 92.02  ? 1061 LYS C CG  1 
ATOM   4932 C CD  . LYS C 1 183 ? 37.608  15.657 170.183 1.00 102.10 ? 1061 LYS C CD  1 
ATOM   4933 C CE  . LYS C 1 183 ? 37.476  17.015 170.940 1.00 98.98  ? 1061 LYS C CE  1 
ATOM   4934 N NZ  . LYS C 1 183 ? 38.616  17.385 171.875 1.00 84.85  ? 1061 LYS C NZ  1 
ATOM   4935 N N   . THR C 1 184 ? 36.205  12.115 172.975 1.00 86.12  ? 1062 THR C N   1 
ATOM   4936 C CA  . THR C 1 184 ? 35.356  11.428 173.930 1.00 85.84  ? 1062 THR C CA  1 
ATOM   4937 C C   . THR C 1 184 ? 34.435  12.478 174.525 1.00 89.51  ? 1062 THR C C   1 
ATOM   4938 O O   . THR C 1 184 ? 34.666  13.685 174.389 1.00 89.02  ? 1062 THR C O   1 
ATOM   4939 C CB  . THR C 1 184 ? 36.194  10.756 175.070 1.00 96.90  ? 1062 THR C CB  1 
ATOM   4940 O OG1 . THR C 1 184 ? 36.384  11.682 176.156 1.00 94.80  ? 1062 THR C OG1 1 
ATOM   4941 C CG2 . THR C 1 184 ? 37.563  10.275 174.548 1.00 96.10  ? 1062 THR C CG2 1 
ATOM   4942 N N   . PRO C 1 185 ? 33.394  12.029 175.231 1.00 85.55  ? 1063 PRO C N   1 
ATOM   4943 C CA  . PRO C 1 185 ? 32.513  12.976 175.914 1.00 85.59  ? 1063 PRO C CA  1 
ATOM   4944 C C   . PRO C 1 185 ? 33.334  13.803 176.910 1.00 100.02 ? 1063 PRO C C   1 
ATOM   4945 O O   . PRO C 1 185 ? 32.832  14.744 177.524 1.00 59.89  ? 1063 PRO C O   1 
ATOM   4946 C CB  . PRO C 1 185 ? 31.536  12.056 176.665 1.00 87.02  ? 1063 PRO C CB  1 
ATOM   4947 C CG  . PRO C 1 185 ? 32.014  10.626 176.409 1.00 91.02  ? 1063 PRO C CG  1 
ATOM   4948 C CD  . PRO C 1 185 ? 32.804  10.681 175.161 1.00 86.67  ? 1063 PRO C CD  1 
ATOM   4949 N N   . LEU D 2 1   ? -4.272  59.703 187.236 1.00 93.80  ? 39   LEU D N   1 
ATOM   4950 C CA  . LEU D 2 1   ? -2.849  59.397 187.029 1.00 93.99  ? 39   LEU D CA  1 
ATOM   4951 C C   . LEU D 2 1   ? -1.956  60.641 186.855 1.00 97.11  ? 39   LEU D C   1 
ATOM   4952 O O   . LEU D 2 1   ? -2.217  61.487 185.990 1.00 96.20  ? 39   LEU D O   1 
ATOM   4953 C CB  . LEU D 2 1   ? -2.669  58.456 185.827 1.00 94.05  ? 39   LEU D CB  1 
ATOM   4954 C CG  . LEU D 2 1   ? -1.771  57.204 185.916 1.00 98.35  ? 39   LEU D CG  1 
ATOM   4955 C CD1 . LEU D 2 1   ? -0.633  57.259 184.924 1.00 98.70  ? 39   LEU D CD1 1 
ATOM   4956 C CD2 . LEU D 2 1   ? -1.254  56.853 187.304 1.00 98.74  ? 39   LEU D CD2 1 
ATOM   4957 N N   . ASP D 2 2   ? -0.895  60.729 187.661 1.00 93.47  ? 40   ASP D N   1 
ATOM   4958 C CA  . ASP D 2 2   ? 0.060   61.842 187.596 1.00 93.79  ? 40   ASP D CA  1 
ATOM   4959 C C   . ASP D 2 2   ? 0.705   61.933 186.205 1.00 98.02  ? 40   ASP D C   1 
ATOM   4960 O O   . ASP D 2 2   ? 0.572   61.009 185.406 1.00 98.62  ? 40   ASP D O   1 
ATOM   4961 C CB  . ASP D 2 2   ? 1.151   61.654 188.651 1.00 95.79  ? 40   ASP D CB  1 
ATOM   4962 C CG  . ASP D 2 2   ? 1.852   62.944 188.985 1.00 109.05 ? 40   ASP D CG  1 
ATOM   4963 O OD1 . ASP D 2 2   ? 2.938   63.182 188.420 1.00 110.75 ? 40   ASP D OD1 1 
ATOM   4964 O OD2 . ASP D 2 2   ? 1.273   63.757 189.740 1.00 113.77 ? 40   ASP D OD2 1 
ATOM   4965 N N   . PRO D 2 3   ? 1.411   63.042 185.895 1.00 93.14  ? 41   PRO D N   1 
ATOM   4966 C CA  . PRO D 2 3   ? 1.989   63.025 184.542 1.00 92.15  ? 41   PRO D CA  1 
ATOM   4967 C C   . PRO D 2 3   ? 3.490   62.747 184.591 1.00 93.42  ? 41   PRO D C   1 
ATOM   4968 O O   . PRO D 2 3   ? 4.156   62.621 183.555 1.00 92.66  ? 41   PRO D O   1 
ATOM   4969 C CB  . PRO D 2 3   ? 1.724   64.442 184.040 1.00 93.82  ? 41   PRO D CB  1 
ATOM   4970 C CG  . PRO D 2 3   ? 1.841   65.269 185.262 1.00 98.60  ? 41   PRO D CG  1 
ATOM   4971 C CD  . PRO D 2 3   ? 1.399   64.410 186.442 1.00 94.44  ? 41   PRO D CD  1 
ATOM   4972 N N   . GLU D 2 4   ? 4.012   62.634 185.805 1.00 87.96  ? 42   GLU D N   1 
ATOM   4973 C CA  . GLU D 2 4   ? 5.416   62.320 185.974 1.00 87.20  ? 42   GLU D CA  1 
ATOM   4974 C C   . GLU D 2 4   ? 5.526   60.818 186.161 1.00 89.68  ? 42   GLU D C   1 
ATOM   4975 O O   . GLU D 2 4   ? 6.597   60.222 186.005 1.00 89.86  ? 42   GLU D O   1 
ATOM   4976 C CB  . GLU D 2 4   ? 6.020   63.069 187.162 1.00 88.76  ? 42   GLU D CB  1 
ATOM   4977 C CG  . GLU D 2 4   ? 7.505   63.468 186.971 1.00 103.58 ? 42   GLU D CG  1 
ATOM   4978 C CD  . GLU D 2 4   ? 7.799   64.148 185.623 1.00 140.42 ? 42   GLU D CD  1 
ATOM   4979 O OE1 . GLU D 2 4   ? 8.995   64.365 185.314 1.00 140.21 ? 42   GLU D OE1 1 
ATOM   4980 O OE2 . GLU D 2 4   ? 6.845   64.460 184.871 1.00 138.88 ? 42   GLU D OE2 1 
ATOM   4981 N N   . GLU D 2 5   ? 4.405   60.198 186.497 1.00 83.69  ? 43   GLU D N   1 
ATOM   4982 C CA  . GLU D 2 5   ? 4.398   58.755 186.623 1.00 81.55  ? 43   GLU D CA  1 
ATOM   4983 C C   . GLU D 2 5   ? 4.234   58.258 185.191 1.00 82.44  ? 43   GLU D C   1 
ATOM   4984 O O   . GLU D 2 5   ? 4.958   57.378 184.732 1.00 82.68  ? 43   GLU D O   1 
ATOM   4985 C CB  . GLU D 2 5   ? 3.241   58.277 187.499 1.00 82.24  ? 43   GLU D CB  1 
ATOM   4986 C CG  . GLU D 2 5   ? 3.115   56.756 187.588 1.00 88.48  ? 43   GLU D CG  1 
ATOM   4987 C CD  . GLU D 2 5   ? 4.312   56.089 188.253 1.00 100.63 ? 43   GLU D CD  1 
ATOM   4988 O OE1 . GLU D 2 5   ? 5.121   56.816 188.851 1.00 88.68  ? 43   GLU D OE1 1 
ATOM   4989 O OE2 . GLU D 2 5   ? 4.432   54.840 188.210 1.00 86.48  ? 43   GLU D OE2 1 
ATOM   4990 N N   . ILE D 2 6   ? 3.321   58.883 184.464 1.00 75.22  ? 44   ILE D N   1 
ATOM   4991 C CA  . ILE D 2 6   ? 3.062   58.495 183.096 1.00 73.67  ? 44   ILE D CA  1 
ATOM   4992 C C   . ILE D 2 6   ? 4.335   58.481 182.283 1.00 80.61  ? 44   ILE D C   1 
ATOM   4993 O O   . ILE D 2 6   ? 4.647   57.511 181.599 1.00 81.70  ? 44   ILE D O   1 
ATOM   4994 C CB  . ILE D 2 6   ? 2.037   59.405 182.436 1.00 75.43  ? 44   ILE D CB  1 
ATOM   4995 C CG1 . ILE D 2 6   ? 0.667   59.250 183.106 1.00 75.39  ? 44   ILE D CG1 1 
ATOM   4996 C CG2 . ILE D 2 6   ? 1.997   59.139 180.924 1.00 74.86  ? 44   ILE D CG2 1 
ATOM   4997 C CD1 . ILE D 2 6   ? -0.501  59.760 182.264 1.00 77.30  ? 44   ILE D CD1 1 
ATOM   4998 N N   . ARG D 2 7   ? 5.068   59.577 182.324 1.00 77.82  ? 45   ARG D N   1 
ATOM   4999 C CA  . ARG D 2 7   ? 6.277   59.645 181.523 1.00 77.23  ? 45   ARG D CA  1 
ATOM   5000 C C   . ARG D 2 7   ? 7.389   58.737 182.061 1.00 79.75  ? 45   ARG D C   1 
ATOM   5001 O O   . ARG D 2 7   ? 8.203   58.215 181.287 1.00 79.88  ? 45   ARG D O   1 
ATOM   5002 C CB  . ARG D 2 7   ? 6.737   61.091 181.315 1.00 77.16  ? 45   ARG D CB  1 
ATOM   5003 C CG  . ARG D 2 7   ? 7.385   61.731 182.538 1.00 90.63  ? 45   ARG D CG  1 
ATOM   5004 C CD  . ARG D 2 7   ? 8.569   62.620 182.139 1.00 101.82 ? 45   ARG D CD  1 
ATOM   5005 N NE  . ARG D 2 7   ? 9.861   61.984 182.404 1.00 114.79 ? 45   ARG D NE  1 
ATOM   5006 C CZ  . ARG D 2 7   ? 10.263  61.574 183.606 1.00 131.89 ? 45   ARG D CZ  1 
ATOM   5007 N NH1 . ARG D 2 7   ? 11.448  61.000 183.758 1.00 111.68 ? 45   ARG D NH1 1 
ATOM   5008 N NH2 . ARG D 2 7   ? 9.475   61.728 184.661 1.00 123.85 ? 45   ARG D NH2 1 
ATOM   5009 N N   . LYS D 2 8   ? 7.405   58.506 183.373 1.00 73.21  ? 46   LYS D N   1 
ATOM   5010 C CA  . LYS D 2 8   ? 8.408   57.615 183.937 1.00 71.63  ? 46   LYS D CA  1 
ATOM   5011 C C   . LYS D 2 8   ? 8.106   56.148 183.560 1.00 75.68  ? 46   LYS D C   1 
ATOM   5012 O O   . LYS D 2 8   ? 9.026   55.330 183.389 1.00 76.25  ? 46   LYS D O   1 
ATOM   5013 C CB  . LYS D 2 8   ? 8.488   57.776 185.443 1.00 72.64  ? 46   LYS D CB  1 
ATOM   5014 C CG  . LYS D 2 8   ? 7.917   56.607 186.205 1.00 84.13  ? 46   LYS D CG  1 
ATOM   5015 C CD  . LYS D 2 8   ? 8.999   55.864 186.953 1.00 94.25  ? 46   LYS D CD  1 
ATOM   5016 C CE  . LYS D 2 8   ? 8.907   56.107 188.442 1.00 103.44 ? 46   LYS D CE  1 
ATOM   5017 N NZ  . LYS D 2 8   ? 9.219   57.525 188.750 1.00 115.08 ? 46   LYS D NZ  1 
ATOM   5018 N N   . ARG D 2 9   ? 6.822   55.830 183.394 1.00 69.73  ? 47   ARG D N   1 
ATOM   5019 C CA  . ARG D 2 9   ? 6.408   54.484 183.016 1.00 68.45  ? 47   ARG D CA  1 
ATOM   5020 C C   . ARG D 2 9   ? 6.761   54.245 181.552 1.00 73.54  ? 47   ARG D C   1 
ATOM   5021 O O   . ARG D 2 9   ? 7.501   53.308 181.220 1.00 73.88  ? 47   ARG D O   1 
ATOM   5022 C CB  . ARG D 2 9   ? 4.903   54.313 183.215 1.00 64.47  ? 47   ARG D CB  1 
ATOM   5023 C CG  . ARG D 2 9   ? 4.470   54.026 184.649 1.00 64.08  ? 47   ARG D CG  1 
ATOM   5024 C CD  . ARG D 2 9   ? 2.941   54.070 184.739 1.00 66.90  ? 47   ARG D CD  1 
ATOM   5025 N NE  . ARG D 2 9   ? 2.451   53.631 186.043 1.00 62.93  ? 47   ARG D NE  1 
ATOM   5026 C CZ  . ARG D 2 9   ? 1.314   52.971 186.228 1.00 69.48  ? 47   ARG D CZ  1 
ATOM   5027 N NH1 . ARG D 2 9   ? 0.968   52.626 187.457 1.00 58.45  ? 47   ARG D NH1 1 
ATOM   5028 N NH2 . ARG D 2 9   ? 0.535   52.653 185.183 1.00 57.36  ? 47   ARG D NH2 1 
ATOM   5029 N N   . LEU D 2 10  ? 6.238   55.115 180.686 1.00 69.60  ? 48   LEU D N   1 
ATOM   5030 C CA  . LEU D 2 10  ? 6.493   55.058 179.241 1.00 68.24  ? 48   LEU D CA  1 
ATOM   5031 C C   . LEU D 2 10  ? 7.987   55.042 178.996 1.00 72.75  ? 48   LEU D C   1 
ATOM   5032 O O   . LEU D 2 10  ? 8.480   54.454 178.038 1.00 72.15  ? 48   LEU D O   1 
ATOM   5033 C CB  . LEU D 2 10  ? 5.869   56.267 178.558 1.00 67.47  ? 48   LEU D CB  1 
ATOM   5034 C CG  . LEU D 2 10  ? 4.347   56.197 178.542 1.00 71.76  ? 48   LEU D CG  1 
ATOM   5035 C CD1 . LEU D 2 10  ? 3.771   57.187 177.537 1.00 72.83  ? 48   LEU D CD1 1 
ATOM   5036 C CD2 . LEU D 2 10  ? 3.907   54.785 178.209 1.00 71.84  ? 48   LEU D CD2 1 
ATOM   5037 N N   . GLU D 2 11  ? 8.700   55.668 179.919 1.00 71.70  ? 49   GLU D N   1 
ATOM   5038 C CA  . GLU D 2 11  ? 10.157  55.765 179.882 1.00 72.16  ? 49   GLU D CA  1 
ATOM   5039 C C   . GLU D 2 11  ? 10.842  54.430 180.098 1.00 71.62  ? 49   GLU D C   1 
ATOM   5040 O O   . GLU D 2 11  ? 11.677  54.025 179.297 1.00 70.55  ? 49   GLU D O   1 
ATOM   5041 C CB  . GLU D 2 11  ? 10.648  56.759 180.952 1.00 74.27  ? 49   GLU D CB  1 
ATOM   5042 C CG  . GLU D 2 11  ? 11.987  57.436 180.606 1.00 89.76  ? 49   GLU D CG  1 
ATOM   5043 C CD  . GLU D 2 11  ? 12.286  58.642 181.485 1.00 116.94 ? 49   GLU D CD  1 
ATOM   5044 O OE1 . GLU D 2 11  ? 13.117  58.510 182.414 1.00 108.37 ? 49   GLU D OE1 1 
ATOM   5045 O OE2 . GLU D 2 11  ? 11.690  59.718 181.245 1.00 113.31 ? 49   GLU D OE2 1 
ATOM   5046 N N   . HIS D 2 12  ? 10.533  53.797 181.229 1.00 65.67  ? 50   HIS D N   1 
ATOM   5047 C CA  . HIS D 2 12  ? 11.097  52.499 181.592 1.00 63.27  ? 50   HIS D CA  1 
ATOM   5048 C C   . HIS D 2 12  ? 10.816  51.474 180.504 1.00 67.19  ? 50   HIS D C   1 
ATOM   5049 O O   . HIS D 2 12  ? 11.673  50.641 180.189 1.00 64.54  ? 50   HIS D O   1 
ATOM   5050 C CB  . HIS D 2 12  ? 10.482  51.999 182.896 1.00 63.13  ? 50   HIS D CB  1 
ATOM   5051 C CG  . HIS D 2 12  ? 11.179  50.801 183.470 1.00 66.13  ? 50   HIS D CG  1 
ATOM   5052 N ND1 . HIS D 2 12  ? 11.008  49.526 182.969 1.00 68.21  ? 50   HIS D ND1 1 
ATOM   5053 C CD2 . HIS D 2 12  ? 12.060  50.685 184.493 1.00 66.66  ? 50   HIS D CD2 1 
ATOM   5054 C CE1 . HIS D 2 12  ? 11.777  48.684 183.639 1.00 66.91  ? 50   HIS D CE1 1 
ATOM   5055 N NE2 . HIS D 2 12  ? 12.420  49.361 184.573 1.00 66.66  ? 50   HIS D NE2 1 
ATOM   5056 N N   . THR D 2 13  ? 9.598   51.522 179.958 1.00 65.12  ? 51   THR D N   1 
ATOM   5057 C CA  . THR D 2 13  ? 9.183   50.584 178.928 1.00 64.90  ? 51   THR D CA  1 
ATOM   5058 C C   . THR D 2 13  ? 10.028  50.733 177.670 1.00 71.64  ? 51   THR D C   1 
ATOM   5059 O O   . THR D 2 13  ? 10.509  49.745 177.124 1.00 72.08  ? 51   THR D O   1 
ATOM   5060 C CB  . THR D 2 13  ? 7.666   50.628 178.690 1.00 65.86  ? 51   THR D CB  1 
ATOM   5061 O OG1 . THR D 2 13  ? 7.001   49.835 179.697 1.00 65.34  ? 51   THR D OG1 1 
ATOM   5062 C CG2 . THR D 2 13  ? 7.325   50.127 177.296 1.00 58.82  ? 51   THR D CG2 1 
ATOM   5063 N N   . GLU D 2 14  ? 10.293  51.976 177.277 1.00 69.92  ? 52   GLU D N   1 
ATOM   5064 C CA  . GLU D 2 14  ? 11.133  52.272 176.108 1.00 69.34  ? 52   GLU D CA  1 
ATOM   5065 C C   . GLU D 2 14  ? 12.559  51.714 176.261 1.00 70.26  ? 52   GLU D C   1 
ATOM   5066 O O   . GLU D 2 14  ? 13.077  51.012 175.394 1.00 67.55  ? 52   GLU D O   1 
ATOM   5067 C CB  . GLU D 2 14  ? 11.151  53.779 175.853 1.00 70.82  ? 52   GLU D CB  1 
ATOM   5068 C CG  . GLU D 2 14  ? 10.065  54.232 174.916 1.00 87.65  ? 52   GLU D CG  1 
ATOM   5069 C CD  . GLU D 2 14  ? 10.278  53.732 173.496 1.00 126.99 ? 52   GLU D CD  1 
ATOM   5070 O OE1 . GLU D 2 14  ? 9.495   52.866 173.045 1.00 131.97 ? 52   GLU D OE1 1 
ATOM   5071 O OE2 . GLU D 2 14  ? 11.226  54.208 172.830 1.00 125.48 ? 52   GLU D OE2 1 
ATOM   5072 N N   . ARG D 2 15  ? 13.180  52.012 177.392 1.00 67.89  ? 53   ARG D N   1 
ATOM   5073 C CA  . ARG D 2 15  ? 14.506  51.486 177.699 1.00 68.20  ? 53   ARG D CA  1 
ATOM   5074 C C   . ARG D 2 15  ? 14.523  49.974 177.549 1.00 73.95  ? 53   ARG D C   1 
ATOM   5075 O O   . ARG D 2 15  ? 15.514  49.406 177.109 1.00 75.24  ? 53   ARG D O   1 
ATOM   5076 C CB  . ARG D 2 15  ? 14.873  51.800 179.151 1.00 69.02  ? 53   ARG D CB  1 
ATOM   5077 C CG  . ARG D 2 15  ? 15.388  53.212 179.393 1.00 80.23  ? 53   ARG D CG  1 
ATOM   5078 C CD  . ARG D 2 15  ? 16.300  53.225 180.595 1.00 89.19  ? 53   ARG D CD  1 
ATOM   5079 N NE  . ARG D 2 15  ? 15.556  53.032 181.842 1.00 105.52 ? 53   ARG D NE  1 
ATOM   5080 C CZ  . ARG D 2 15  ? 14.712  53.926 182.353 1.00 117.03 ? 53   ARG D CZ  1 
ATOM   5081 N NH1 . ARG D 2 15  ? 14.494  55.074 181.720 1.00 103.98 ? 53   ARG D NH1 1 
ATOM   5082 N NH2 . ARG D 2 15  ? 14.091  53.673 183.499 1.00 98.45  ? 53   ARG D NH2 1 
ATOM   5083 N N   . GLN D 2 16  ? 13.452  49.322 177.999 1.00 69.82  ? 54   GLN D N   1 
ATOM   5084 C CA  . GLN D 2 16  ? 13.340  47.865 177.952 1.00 68.28  ? 54   GLN D CA  1 
ATOM   5085 C C   . GLN D 2 16  ? 13.198  47.408 176.508 1.00 71.03  ? 54   GLN D C   1 
ATOM   5086 O O   . GLN D 2 16  ? 13.949  46.559 176.012 1.00 69.91  ? 54   GLN D O   1 
ATOM   5087 C CB  . GLN D 2 16  ? 12.106  47.414 178.726 1.00 68.62  ? 54   GLN D CB  1 
ATOM   5088 C CG  . GLN D 2 16  ? 12.300  47.280 180.204 1.00 55.58  ? 54   GLN D CG  1 
ATOM   5089 C CD  . GLN D 2 16  ? 13.459  46.413 180.550 1.00 62.63  ? 54   GLN D CD  1 
ATOM   5090 O OE1 . GLN D 2 16  ? 14.396  46.847 181.195 1.00 55.57  ? 54   GLN D OE1 1 
ATOM   5091 N NE2 . GLN D 2 16  ? 13.404  45.172 180.136 1.00 60.65  ? 54   GLN D NE2 1 
ATOM   5092 N N   . PHE D 2 17  ? 12.204  47.965 175.842 1.00 66.66  ? 55   PHE D N   1 
ATOM   5093 C CA  . PHE D 2 17  ? 11.968  47.615 174.468 1.00 66.74  ? 55   PHE D CA  1 
ATOM   5094 C C   . PHE D 2 17  ? 13.242  47.742 173.620 1.00 73.57  ? 55   PHE D C   1 
ATOM   5095 O O   . PHE D 2 17  ? 13.547  46.853 172.821 1.00 74.09  ? 55   PHE D O   1 
ATOM   5096 C CB  . PHE D 2 17  ? 10.853  48.474 173.894 1.00 67.94  ? 55   PHE D CB  1 
ATOM   5097 C CG  . PHE D 2 17  ? 10.618  48.239 172.449 1.00 69.71  ? 55   PHE D CG  1 
ATOM   5098 C CD1 . PHE D 2 17  ? 10.863  49.248 171.527 1.00 73.28  ? 55   PHE D CD1 1 
ATOM   5099 C CD2 . PHE D 2 17  ? 10.239  46.983 171.996 1.00 71.58  ? 55   PHE D CD2 1 
ATOM   5100 C CE1 . PHE D 2 17  ? 10.683  49.026 170.188 1.00 74.16  ? 55   PHE D CE1 1 
ATOM   5101 C CE2 . PHE D 2 17  ? 10.052  46.755 170.659 1.00 74.67  ? 55   PHE D CE2 1 
ATOM   5102 C CZ  . PHE D 2 17  ? 10.272  47.779 169.750 1.00 73.08  ? 55   PHE D CZ  1 
ATOM   5103 N N   . ARG D 2 18  ? 13.993  48.828 173.817 1.00 70.04  ? 56   ARG D N   1 
ATOM   5104 C CA  . ARG D 2 18  ? 15.197  49.087 173.027 1.00 69.59  ? 56   ARG D CA  1 
ATOM   5105 C C   . ARG D 2 18  ? 16.461  48.393 173.506 1.00 74.34  ? 56   ARG D C   1 
ATOM   5106 O O   . ARG D 2 18  ? 17.472  48.410 172.819 1.00 73.66  ? 56   ARG D O   1 
ATOM   5107 C CB  . ARG D 2 18  ? 15.444  50.589 172.819 1.00 69.81  ? 56   ARG D CB  1 
ATOM   5108 C CG  . ARG D 2 18  ? 14.177  51.425 172.714 1.00 86.20  ? 56   ARG D CG  1 
ATOM   5109 C CD  . ARG D 2 18  ? 14.256  52.487 171.623 1.00 96.53  ? 56   ARG D CD  1 
ATOM   5110 N NE  . ARG D 2 18  ? 13.711  52.017 170.349 1.00 109.80 ? 56   ARG D NE  1 
ATOM   5111 C CZ  . ARG D 2 18  ? 12.791  52.666 169.638 1.00 128.09 ? 56   ARG D CZ  1 
ATOM   5112 N NH1 . ARG D 2 18  ? 12.295  53.819 170.079 1.00 118.93 ? 56   ARG D NH1 1 
ATOM   5113 N NH2 . ARG D 2 18  ? 12.367  52.163 168.481 1.00 112.35 ? 56   ARG D NH2 1 
ATOM   5114 N N   . ASN D 2 19  ? 16.427  47.769 174.677 1.00 73.01  ? 57   ASN D N   1 
ATOM   5115 C CA  . ASN D 2 19  ? 17.639  47.092 175.146 1.00 73.12  ? 57   ASN D CA  1 
ATOM   5116 C C   . ASN D 2 19  ? 17.898  45.783 174.448 1.00 75.88  ? 57   ASN D C   1 
ATOM   5117 O O   . ASN D 2 19  ? 17.992  44.721 175.084 1.00 73.89  ? 57   ASN D O   1 
ATOM   5118 C CB  . ASN D 2 19  ? 17.749  46.950 176.666 1.00 73.68  ? 57   ASN D CB  1 
ATOM   5119 C CG  . ASN D 2 19  ? 19.192  46.721 177.125 1.00 88.59  ? 57   ASN D CG  1 
ATOM   5120 O OD1 . ASN D 2 19  ? 20.075  47.565 176.918 1.00 80.72  ? 57   ASN D OD1 1 
ATOM   5121 N ND2 . ASN D 2 19  ? 19.436  45.573 177.738 1.00 78.96  ? 57   ASN D ND2 1 
ATOM   5122 N N   . ARG D 2 20  ? 18.027  45.904 173.128 1.00 73.58  ? 58   ARG D N   1 
ATOM   5123 C CA  . ARG D 2 20  ? 18.372  44.803 172.230 1.00 73.89  ? 58   ARG D CA  1 
ATOM   5124 C C   . ARG D 2 20  ? 19.905  44.794 172.165 1.00 76.09  ? 58   ARG D C   1 
ATOM   5125 O O   . ARG D 2 20  ? 20.532  45.629 171.487 1.00 75.42  ? 58   ARG D O   1 
ATOM   5126 C CB  . ARG D 2 20  ? 17.778  45.051 170.835 1.00 74.91  ? 58   ARG D CB  1 
ATOM   5127 C CG  . ARG D 2 20  ? 16.260  45.119 170.809 1.00 85.33  ? 58   ARG D CG  1 
ATOM   5128 C CD  . ARG D 2 20  ? 15.657  43.738 170.577 1.00 91.59  ? 58   ARG D CD  1 
ATOM   5129 N NE  . ARG D 2 20  ? 15.553  43.415 169.158 1.00 96.52  ? 58   ARG D NE  1 
ATOM   5130 C CZ  . ARG D 2 20  ? 15.940  42.260 168.625 1.00 113.85 ? 58   ARG D CZ  1 
ATOM   5131 N NH1 . ARG D 2 20  ? 16.437  41.302 169.396 1.00 103.52 ? 58   ARG D NH1 1 
ATOM   5132 N NH2 . ARG D 2 20  ? 15.829  42.061 167.319 1.00 96.61  ? 58   ARG D NH2 1 
ATOM   5133 N N   . ARG D 2 21  ? 20.497  43.895 172.940 1.00 71.51  ? 59   ARG D N   1 
ATOM   5134 C CA  . ARG D 2 21  ? 21.950  43.824 173.083 1.00 71.17  ? 59   ARG D CA  1 
ATOM   5135 C C   . ARG D 2 21  ? 22.545  42.551 172.475 1.00 72.01  ? 59   ARG D C   1 
ATOM   5136 O O   . ARG D 2 21  ? 23.724  42.225 172.648 1.00 70.84  ? 59   ARG D O   1 
ATOM   5137 C CB  . ARG D 2 21  ? 22.352  44.018 174.569 1.00 71.01  ? 59   ARG D CB  1 
ATOM   5138 C CG  . ARG D 2 21  ? 22.475  42.732 175.370 1.00 70.26  ? 59   ARG D CG  1 
ATOM   5139 C CD  . ARG D 2 21  ? 22.228  42.934 176.860 1.00 65.83  ? 59   ARG D CD  1 
ATOM   5140 N NE  . ARG D 2 21  ? 22.306  41.635 177.537 1.00 67.59  ? 59   ARG D NE  1 
ATOM   5141 C CZ  . ARG D 2 21  ? 22.842  41.417 178.739 1.00 82.49  ? 59   ARG D CZ  1 
ATOM   5142 N NH1 . ARG D 2 21  ? 23.329  42.417 179.461 1.00 71.89  ? 59   ARG D NH1 1 
ATOM   5143 N NH2 . ARG D 2 21  ? 22.886  40.188 179.234 1.00 63.57  ? 59   ARG D NH2 1 
ATOM   5144 N N   . LYS D 2 22  ? 21.720  41.854 171.713 1.00 67.53  ? 60   LYS D N   1 
ATOM   5145 C CA  . LYS D 2 22  ? 22.175  40.636 171.062 1.00 66.75  ? 60   LYS D CA  1 
ATOM   5146 C C   . LYS D 2 22  ? 22.483  40.797 169.556 1.00 67.00  ? 60   LYS D C   1 
ATOM   5147 O O   . LYS D 2 22  ? 21.621  41.208 168.743 1.00 65.29  ? 60   LYS D O   1 
ATOM   5148 C CB  . LYS D 2 22  ? 21.264  39.458 171.394 1.00 69.10  ? 60   LYS D CB  1 
ATOM   5149 C CG  . LYS D 2 22  ? 21.496  38.890 172.833 1.00 75.92  ? 60   LYS D CG  1 
ATOM   5150 C CD  . LYS D 2 22  ? 21.624  37.343 172.835 1.00 79.43  ? 60   LYS D CD  1 
ATOM   5151 C CE  . LYS D 2 22  ? 20.978  36.689 174.066 1.00 78.77  ? 60   LYS D CE  1 
ATOM   5152 N NZ  . LYS D 2 22  ? 21.459  35.294 174.378 1.00 73.45  ? 60   LYS D NZ  1 
ATOM   5153 N N   . ILE D 2 23  ? 23.757  40.573 169.221 1.00 59.95  ? 61   ILE D N   1 
ATOM   5154 C CA  . ILE D 2 23  ? 24.223  40.766 167.857 1.00 57.49  ? 61   ILE D CA  1 
ATOM   5155 C C   . ILE D 2 23  ? 24.623  39.501 167.114 1.00 58.10  ? 61   ILE D C   1 
ATOM   5156 O O   . ILE D 2 23  ? 25.056  38.491 167.708 1.00 54.08  ? 61   ILE D O   1 
ATOM   5157 C CB  . ILE D 2 23  ? 25.283  41.870 167.758 1.00 59.16  ? 61   ILE D CB  1 
ATOM   5158 C CG1 . ILE D 2 23  ? 26.675  41.293 167.928 1.00 57.19  ? 61   ILE D CG1 1 
ATOM   5159 C CG2 . ILE D 2 23  ? 25.056  42.922 168.823 1.00 61.59  ? 61   ILE D CG2 1 
ATOM   5160 C CD1 . ILE D 2 23  ? 27.706  42.220 167.472 1.00 52.15  ? 61   ILE D CD1 1 
ATOM   5161 N N   . LEU D 2 24  ? 24.441  39.566 165.798 1.00 55.68  ? 62   LEU D N   1 
ATOM   5162 C CA  . LEU D 2 24  ? 24.801  38.447 164.932 1.00 56.28  ? 62   LEU D CA  1 
ATOM   5163 C C   . LEU D 2 24  ? 25.789  38.880 163.848 1.00 59.87  ? 62   LEU D C   1 
ATOM   5164 O O   . LEU D 2 24  ? 25.521  39.809 163.065 1.00 59.27  ? 62   LEU D O   1 
ATOM   5165 C CB  . LEU D 2 24  ? 23.552  37.810 164.337 1.00 56.39  ? 62   LEU D CB  1 
ATOM   5166 C CG  . LEU D 2 24  ? 23.669  36.727 163.265 1.00 60.59  ? 62   LEU D CG  1 
ATOM   5167 C CD1 . LEU D 2 24  ? 24.209  35.392 163.768 1.00 59.46  ? 62   LEU D CD1 1 
ATOM   5168 C CD2 . LEU D 2 24  ? 22.321  36.579 162.562 1.00 61.74  ? 62   LEU D CD2 1 
ATOM   5169 N N   . ILE D 2 25  ? 26.952  38.232 163.866 1.00 54.94  ? 63   ILE D N   1 
ATOM   5170 C CA  . ILE D 2 25  ? 28.027  38.525 162.937 1.00 54.29  ? 63   ILE D CA  1 
ATOM   5171 C C   . ILE D 2 25  ? 28.114  37.391 161.945 1.00 59.71  ? 63   ILE D C   1 
ATOM   5172 O O   . ILE D 2 25  ? 28.490  36.277 162.324 1.00 60.74  ? 63   ILE D O   1 
ATOM   5173 C CB  . ILE D 2 25  ? 29.383  38.571 163.680 1.00 56.54  ? 63   ILE D CB  1 
ATOM   5174 C CG1 . ILE D 2 25  ? 29.395  39.637 164.776 1.00 55.52  ? 63   ILE D CG1 1 
ATOM   5175 C CG2 . ILE D 2 25  ? 30.569  38.647 162.699 1.00 55.85  ? 63   ILE D CG2 1 
ATOM   5176 C CD1 . ILE D 2 25  ? 30.718  39.697 165.530 1.00 51.59  ? 63   ILE D CD1 1 
ATOM   5177 N N   . ARG D 2 26  ? 27.840  37.661 160.674 1.00 56.16  ? 64   ARG D N   1 
ATOM   5178 C CA  . ARG D 2 26  ? 28.012  36.620 159.659 1.00 56.25  ? 64   ARG D CA  1 
ATOM   5179 C C   . ARG D 2 26  ? 29.083  37.023 158.652 1.00 58.26  ? 64   ARG D C   1 
ATOM   5180 O O   . ARG D 2 26  ? 29.315  38.216 158.414 1.00 58.63  ? 64   ARG D O   1 
ATOM   5181 C CB  . ARG D 2 26  ? 26.704  36.270 158.943 1.00 57.71  ? 64   ARG D CB  1 
ATOM   5182 C CG  . ARG D 2 26  ? 25.624  37.330 159.007 1.00 74.82  ? 64   ARG D CG  1 
ATOM   5183 C CD  . ARG D 2 26  ? 24.343  36.854 158.310 1.00 86.58  ? 64   ARG D CD  1 
ATOM   5184 N NE  . ARG D 2 26  ? 23.821  35.619 158.892 1.00 100.85 ? 64   ARG D NE  1 
ATOM   5185 C CZ  . ARG D 2 26  ? 22.594  35.487 159.389 1.00 110.87 ? 64   ARG D CZ  1 
ATOM   5186 N NH1 . ARG D 2 26  ? 21.766  36.528 159.390 1.00 90.21  ? 64   ARG D NH1 1 
ATOM   5187 N NH2 . ARG D 2 26  ? 22.195  34.313 159.884 1.00 93.95  ? 64   ARG D NH2 1 
ATOM   5188 N N   . GLY D 2 27  ? 29.762  36.024 158.101 1.00 51.17  ? 65   GLY D N   1 
ATOM   5189 C CA  . GLY D 2 27  ? 30.776  36.244 157.100 1.00 49.38  ? 65   GLY D CA  1 
ATOM   5190 C C   . GLY D 2 27  ? 32.188  36.059 157.582 1.00 53.44  ? 65   GLY D C   1 
ATOM   5191 O O   . GLY D 2 27  ? 33.130  36.353 156.862 1.00 54.36  ? 65   GLY D O   1 
ATOM   5192 N N   . LEU D 2 28  ? 32.359  35.560 158.792 1.00 49.16  ? 66   LEU D N   1 
ATOM   5193 C CA  . LEU D 2 28  ? 33.704  35.414 159.302 1.00 49.14  ? 66   LEU D CA  1 
ATOM   5194 C C   . LEU D 2 28  ? 34.534  34.363 158.578 1.00 54.26  ? 66   LEU D C   1 
ATOM   5195 O O   . LEU D 2 28  ? 33.992  33.549 157.852 1.00 56.92  ? 66   LEU D O   1 
ATOM   5196 C CB  . LEU D 2 28  ? 33.655  35.116 160.789 1.00 49.41  ? 66   LEU D CB  1 
ATOM   5197 C CG  . LEU D 2 28  ? 32.968  36.217 161.603 1.00 53.66  ? 66   LEU D CG  1 
ATOM   5198 C CD1 . LEU D 2 28  ? 32.357  35.605 162.863 1.00 52.54  ? 66   LEU D CD1 1 
ATOM   5199 C CD2 . LEU D 2 28  ? 33.959  37.324 161.947 1.00 54.11  ? 66   LEU D CD2 1 
ATOM   5200 N N   . PRO D 2 29  ? 35.871  34.363 158.774 1.00 48.37  ? 67   PRO D N   1 
ATOM   5201 C CA  . PRO D 2 29  ? 36.629  33.289 158.146 1.00 47.24  ? 67   PRO D CA  1 
ATOM   5202 C C   . PRO D 2 29  ? 36.176  31.963 158.699 1.00 53.19  ? 67   PRO D C   1 
ATOM   5203 O O   . PRO D 2 29  ? 35.751  31.872 159.835 1.00 55.13  ? 67   PRO D O   1 
ATOM   5204 C CB  . PRO D 2 29  ? 38.042  33.535 158.646 1.00 48.23  ? 67   PRO D CB  1 
ATOM   5205 C CG  . PRO D 2 29  ? 38.109  34.985 158.815 1.00 51.77  ? 67   PRO D CG  1 
ATOM   5206 C CD  . PRO D 2 29  ? 36.767  35.424 159.274 1.00 48.19  ? 67   PRO D CD  1 
ATOM   5207 N N   . GLY D 2 30  ? 36.286  30.919 157.903 1.00 49.94  ? 68   GLY D N   1 
ATOM   5208 C CA  . GLY D 2 30  ? 35.902  29.614 158.378 1.00 49.91  ? 68   GLY D CA  1 
ATOM   5209 C C   . GLY D 2 30  ? 36.769  29.210 159.555 1.00 52.50  ? 68   GLY D C   1 
ATOM   5210 O O   . GLY D 2 30  ? 36.343  28.458 160.420 1.00 51.64  ? 68   GLY D O   1 
ATOM   5211 N N   . ASP D 2 31  ? 38.004  29.690 159.575 1.00 48.68  ? 69   ASP D N   1 
ATOM   5212 C CA  . ASP D 2 31  ? 38.910  29.329 160.653 1.00 48.25  ? 69   ASP D CA  1 
ATOM   5213 C C   . ASP D 2 31  ? 39.017  30.472 161.716 1.00 56.03  ? 69   ASP D C   1 
ATOM   5214 O O   . ASP D 2 31  ? 40.034  30.590 162.450 1.00 55.72  ? 69   ASP D O   1 
ATOM   5215 C CB  . ASP D 2 31  ? 40.281  29.005 160.093 1.00 47.44  ? 69   ASP D CB  1 
ATOM   5216 C CG  . ASP D 2 31  ? 41.006  30.243 159.671 1.00 56.07  ? 69   ASP D CG  1 
ATOM   5217 O OD1 . ASP D 2 31  ? 40.276  31.216 159.368 1.00 58.60  ? 69   ASP D OD1 1 
ATOM   5218 O OD2 . ASP D 2 31  ? 42.266  30.281 159.663 1.00 58.36  ? 69   ASP D OD2 1 
ATOM   5219 N N   . VAL D 2 32  ? 37.990  31.318 161.793 1.00 50.63  ? 70   VAL D N   1 
ATOM   5220 C CA  . VAL D 2 32  ? 38.003  32.362 162.798 1.00 50.94  ? 70   VAL D CA  1 
ATOM   5221 C C   . VAL D 2 32  ? 38.017  31.640 164.144 1.00 62.75  ? 70   VAL D C   1 
ATOM   5222 O O   . VAL D 2 32  ? 37.561  30.498 164.225 1.00 65.80  ? 70   VAL D O   1 
ATOM   5223 C CB  . VAL D 2 32  ? 36.762  33.282 162.693 1.00 53.46  ? 70   VAL D CB  1 
ATOM   5224 C CG1 . VAL D 2 32  ? 35.489  32.501 162.832 1.00 52.92  ? 70   VAL D CG1 1 
ATOM   5225 C CG2 . VAL D 2 32  ? 36.804  34.356 163.744 1.00 53.05  ? 70   VAL D CG2 1 
ATOM   5226 N N   . THR D 2 33  ? 38.534  32.291 165.192 1.00 60.94  ? 71   THR D N   1 
ATOM   5227 C CA  . THR D 2 33  ? 38.552  31.730 166.564 1.00 60.32  ? 71   THR D CA  1 
ATOM   5228 C C   . THR D 2 33  ? 37.798  32.659 167.522 1.00 65.01  ? 71   THR D C   1 
ATOM   5229 O O   . THR D 2 33  ? 37.483  33.804 167.168 1.00 64.87  ? 71   THR D O   1 
ATOM   5230 C CB  . THR D 2 33  ? 39.965  31.529 167.082 1.00 60.78  ? 71   THR D CB  1 
ATOM   5231 O OG1 . THR D 2 33  ? 40.497  32.803 167.452 1.00 56.51  ? 71   THR D OG1 1 
ATOM   5232 C CG2 . THR D 2 33  ? 40.833  30.907 166.016 1.00 59.64  ? 71   THR D CG2 1 
ATOM   5233 N N   . ASN D 2 34  ? 37.482  32.164 168.723 1.00 61.91  ? 72   ASN D N   1 
ATOM   5234 C CA  . ASN D 2 34  ? 36.753  32.985 169.704 1.00 60.59  ? 72   ASN D CA  1 
ATOM   5235 C C   . ASN D 2 34  ? 37.650  34.156 170.101 1.00 59.38  ? 72   ASN D C   1 
ATOM   5236 O O   . ASN D 2 34  ? 37.215  35.316 170.115 1.00 57.75  ? 72   ASN D O   1 
ATOM   5237 C CB  . ASN D 2 34  ? 36.294  32.156 170.915 1.00 62.96  ? 72   ASN D CB  1 
ATOM   5238 C CG  . ASN D 2 34  ? 35.072  31.323 170.610 1.00 88.40  ? 72   ASN D CG  1 
ATOM   5239 O OD1 . ASN D 2 34  ? 33.944  31.818 170.599 1.00 91.30  ? 72   ASN D OD1 1 
ATOM   5240 N ND2 . ASN D 2 34  ? 35.298  30.062 170.298 1.00 78.12  ? 72   ASN D ND2 1 
ATOM   5241 N N   . GLN D 2 35  ? 38.927  33.855 170.327 1.00 53.55  ? 73   GLN D N   1 
ATOM   5242 C CA  . GLN D 2 35  ? 39.929  34.898 170.592 1.00 53.26  ? 73   GLN D CA  1 
ATOM   5243 C C   . GLN D 2 35  ? 39.774  36.075 169.611 1.00 59.66  ? 73   GLN D C   1 
ATOM   5244 O O   . GLN D 2 35  ? 39.661  37.227 170.020 1.00 59.57  ? 73   GLN D O   1 
ATOM   5245 C CB  . GLN D 2 35  ? 41.339  34.319 170.451 1.00 54.27  ? 73   GLN D CB  1 
ATOM   5246 C CG  . GLN D 2 35  ? 42.399  35.055 171.232 1.00 76.08  ? 73   GLN D CG  1 
ATOM   5247 C CD  . GLN D 2 35  ? 41.864  35.636 172.546 1.00 98.56  ? 73   GLN D CD  1 
ATOM   5248 O OE1 . GLN D 2 35  ? 41.777  36.857 172.702 1.00 93.64  ? 73   GLN D OE1 1 
ATOM   5249 N NE2 . GLN D 2 35  ? 41.477  34.760 173.485 1.00 81.21  ? 73   GLN D NE2 1 
ATOM   5250 N N   . GLU D 2 36  ? 39.723  35.767 168.315 1.00 57.38  ? 74   GLU D N   1 
ATOM   5251 C CA  . GLU D 2 36  ? 39.567  36.785 167.274 1.00 56.89  ? 74   GLU D CA  1 
ATOM   5252 C C   . GLU D 2 36  ? 38.306  37.614 167.393 1.00 61.12  ? 74   GLU D C   1 
ATOM   5253 O O   . GLU D 2 36  ? 38.307  38.806 167.095 1.00 62.26  ? 74   GLU D O   1 
ATOM   5254 C CB  . GLU D 2 36  ? 39.570  36.140 165.906 1.00 58.32  ? 74   GLU D CB  1 
ATOM   5255 C CG  . GLU D 2 36  ? 40.905  35.600 165.501 1.00 66.70  ? 74   GLU D CG  1 
ATOM   5256 C CD  . GLU D 2 36  ? 40.883  35.132 164.095 1.00 75.79  ? 74   GLU D CD  1 
ATOM   5257 O OE1 . GLU D 2 36  ? 41.492  35.833 163.272 1.00 62.93  ? 74   GLU D OE1 1 
ATOM   5258 O OE2 . GLU D 2 36  ? 40.136  34.166 163.810 1.00 65.36  ? 74   GLU D OE2 1 
ATOM   5259 N N   . VAL D 2 37  ? 37.199  36.981 167.742 1.00 55.65  ? 75   VAL D N   1 
ATOM   5260 C CA  . VAL D 2 37  ? 35.972  37.740 167.867 1.00 54.17  ? 75   VAL D CA  1 
ATOM   5261 C C   . VAL D 2 37  ? 36.069  38.658 169.073 1.00 60.44  ? 75   VAL D C   1 
ATOM   5262 O O   . VAL D 2 37  ? 35.638  39.803 169.043 1.00 58.37  ? 75   VAL D O   1 
ATOM   5263 C CB  . VAL D 2 37  ? 34.802  36.829 167.997 1.00 55.38  ? 75   VAL D CB  1 
ATOM   5264 C CG1 . VAL D 2 37  ? 33.536  37.614 167.803 1.00 54.57  ? 75   VAL D CG1 1 
ATOM   5265 C CG2 . VAL D 2 37  ? 34.944  35.713 167.019 1.00 54.96  ? 75   VAL D CG2 1 
ATOM   5266 N N   . HIS D 2 38  ? 36.601  38.131 170.166 1.00 61.71  ? 76   HIS D N   1 
ATOM   5267 C CA  . HIS D 2 38  ? 36.740  38.937 171.377 1.00 62.60  ? 76   HIS D CA  1 
ATOM   5268 C C   . HIS D 2 38  ? 37.682  40.095 171.054 1.00 63.33  ? 76   HIS D C   1 
ATOM   5269 O O   . HIS D 2 38  ? 37.299  41.239 171.259 1.00 62.78  ? 76   HIS D O   1 
ATOM   5270 C CB  . HIS D 2 38  ? 37.224  38.102 172.577 1.00 64.93  ? 76   HIS D CB  1 
ATOM   5271 C CG  . HIS D 2 38  ? 36.304  36.969 172.940 1.00 70.51  ? 76   HIS D CG  1 
ATOM   5272 N ND1 . HIS D 2 38  ? 36.250  36.426 174.208 1.00 73.01  ? 76   HIS D ND1 1 
ATOM   5273 C CD2 . HIS D 2 38  ? 35.403  36.272 172.198 1.00 73.82  ? 76   HIS D CD2 1 
ATOM   5274 C CE1 . HIS D 2 38  ? 35.353  35.453 174.233 1.00 73.03  ? 76   HIS D CE1 1 
ATOM   5275 N NE2 . HIS D 2 38  ? 34.829  35.333 173.024 1.00 73.63  ? 76   HIS D NE2 1 
ATOM   5276 N N   . ASP D 2 39  ? 38.853  39.806 170.455 1.00 56.79  ? 77   ASP D N   1 
ATOM   5277 C CA  . ASP D 2 39  ? 39.817  40.856 170.075 1.00 55.34  ? 77   ASP D CA  1 
ATOM   5278 C C   . ASP D 2 39  ? 39.184  41.896 169.156 1.00 56.51  ? 77   ASP D C   1 
ATOM   5279 O O   . ASP D 2 39  ? 39.493  43.060 169.238 1.00 56.85  ? 77   ASP D O   1 
ATOM   5280 C CB  . ASP D 2 39  ? 41.071  40.296 169.371 1.00 57.60  ? 77   ASP D CB  1 
ATOM   5281 C CG  . ASP D 2 39  ? 41.937  39.408 170.277 1.00 73.35  ? 77   ASP D CG  1 
ATOM   5282 O OD1 . ASP D 2 39  ? 41.866  39.538 171.517 1.00 72.23  ? 77   ASP D OD1 1 
ATOM   5283 O OD2 . ASP D 2 39  ? 42.719  38.588 169.734 1.00 84.73  ? 77   ASP D OD2 1 
ATOM   5284 N N   . LEU D 2 40  ? 38.354  41.455 168.224 1.00 51.68  ? 78   LEU D N   1 
ATOM   5285 C CA  . LEU D 2 40  ? 37.692  42.357 167.293 1.00 50.04  ? 78   LEU D CA  1 
ATOM   5286 C C   . LEU D 2 40  ? 36.742  43.316 168.027 1.00 55.32  ? 78   LEU D C   1 
ATOM   5287 O O   . LEU D 2 40  ? 36.554  44.463 167.621 1.00 53.47  ? 78   LEU D O   1 
ATOM   5288 C CB  . LEU D 2 40  ? 36.908  41.545 166.245 1.00 49.32  ? 78   LEU D CB  1 
ATOM   5289 C CG  . LEU D 2 40  ? 35.787  42.286 165.468 1.00 52.31  ? 78   LEU D CG  1 
ATOM   5290 C CD1 . LEU D 2 40  ? 36.279  43.176 164.359 1.00 50.23  ? 78   LEU D CD1 1 
ATOM   5291 C CD2 . LEU D 2 40  ? 34.647  41.381 164.977 1.00 52.60  ? 78   LEU D CD2 1 
ATOM   5292 N N   . LEU D 2 41  ? 36.116  42.820 169.088 1.00 54.62  ? 79   LEU D N   1 
ATOM   5293 C CA  . LEU D 2 41  ? 35.147  43.601 169.831 1.00 55.56  ? 79   LEU D CA  1 
ATOM   5294 C C   . LEU D 2 41  ? 35.653  43.976 171.207 1.00 59.79  ? 79   LEU D C   1 
ATOM   5295 O O   . LEU D 2 41  ? 34.860  44.048 172.137 1.00 58.84  ? 79   LEU D O   1 
ATOM   5296 C CB  . LEU D 2 41  ? 33.862  42.801 169.988 1.00 55.84  ? 79   LEU D CB  1 
ATOM   5297 C CG  . LEU D 2 41  ? 33.148  42.333 168.714 1.00 59.70  ? 79   LEU D CG  1 
ATOM   5298 C CD1 . LEU D 2 41  ? 32.241  41.140 169.086 1.00 59.87  ? 79   LEU D CD1 1 
ATOM   5299 C CD2 . LEU D 2 41  ? 32.328  43.483 168.093 1.00 57.54  ? 79   LEU D CD2 1 
ATOM   5300 N N   . SER D 2 42  ? 36.969  44.185 171.317 1.00 56.46  ? 80   SER D N   1 
ATOM   5301 C CA  . SER D 2 42  ? 37.676  44.531 172.567 1.00 55.54  ? 80   SER D CA  1 
ATOM   5302 C C   . SER D 2 42  ? 37.187  45.812 173.247 1.00 60.13  ? 80   SER D C   1 
ATOM   5303 O O   . SER D 2 42  ? 37.352  45.990 174.458 1.00 60.25  ? 80   SER D O   1 
ATOM   5304 C CB  . SER D 2 42  ? 39.193  44.623 172.321 1.00 56.87  ? 80   SER D CB  1 
ATOM   5305 O OG  . SER D 2 42  ? 39.528  45.548 171.292 1.00 58.48  ? 80   SER D OG  1 
ATOM   5306 N N   . ASP D 2 43  ? 36.577  46.694 172.461 1.00 55.05  ? 81   ASP D N   1 
ATOM   5307 C CA  . ASP D 2 43  ? 36.068  47.945 172.982 1.00 53.98  ? 81   ASP D CA  1 
ATOM   5308 C C   . ASP D 2 43  ? 34.757  47.775 173.711 1.00 59.22  ? 81   ASP D C   1 
ATOM   5309 O O   . ASP D 2 43  ? 34.229  48.718 174.329 1.00 58.72  ? 81   ASP D O   1 
ATOM   5310 C CB  . ASP D 2 43  ? 35.902  48.975 171.871 1.00 54.67  ? 81   ASP D CB  1 
ATOM   5311 C CG  . ASP D 2 43  ? 37.229  49.519 171.386 1.00 68.84  ? 81   ASP D CG  1 
ATOM   5312 O OD1 . ASP D 2 43  ? 37.167  50.372 170.483 1.00 67.58  ? 81   ASP D OD1 1 
ATOM   5313 O OD2 . ASP D 2 43  ? 38.317  49.064 171.868 1.00 74.07  ? 81   ASP D OD2 1 
ATOM   5314 N N   . TYR D 2 44  ? 34.220  46.565 173.629 1.00 55.37  ? 82   TYR D N   1 
ATOM   5315 C CA  . TYR D 2 44  ? 32.931  46.276 174.223 1.00 54.01  ? 82   TYR D CA  1 
ATOM   5316 C C   . TYR D 2 44  ? 33.041  45.228 175.304 1.00 56.93  ? 82   TYR D C   1 
ATOM   5317 O O   . TYR D 2 44  ? 34.069  44.580 175.471 1.00 54.74  ? 82   TYR D O   1 
ATOM   5318 C CB  . TYR D 2 44  ? 31.891  45.888 173.155 1.00 54.60  ? 82   TYR D CB  1 
ATOM   5319 C CG  . TYR D 2 44  ? 31.842  46.835 171.974 1.00 56.33  ? 82   TYR D CG  1 
ATOM   5320 C CD1 . TYR D 2 44  ? 31.115  48.012 172.032 1.00 58.01  ? 82   TYR D CD1 1 
ATOM   5321 C CD2 . TYR D 2 44  ? 32.578  46.585 170.813 1.00 57.27  ? 82   TYR D CD2 1 
ATOM   5322 C CE1 . TYR D 2 44  ? 31.101  48.900 170.975 1.00 56.76  ? 82   TYR D CE1 1 
ATOM   5323 C CE2 . TYR D 2 44  ? 32.567  47.484 169.756 1.00 57.34  ? 82   TYR D CE2 1 
ATOM   5324 C CZ  . TYR D 2 44  ? 31.834  48.639 169.860 1.00 62.78  ? 82   TYR D CZ  1 
ATOM   5325 O OH  . TYR D 2 44  ? 31.846  49.558 168.849 1.00 68.05  ? 82   TYR D OH  1 
ATOM   5326 N N   . GLU D 2 45  ? 31.981  45.124 176.088 1.00 55.58  ? 83   GLU D N   1 
ATOM   5327 C CA  . GLU D 2 45  ? 31.938  44.145 177.146 1.00 56.09  ? 83   GLU D CA  1 
ATOM   5328 C C   . GLU D 2 45  ? 31.118  42.976 176.643 1.00 60.24  ? 83   GLU D C   1 
ATOM   5329 O O   . GLU D 2 45  ? 29.928  43.104 176.402 1.00 58.70  ? 83   GLU D O   1 
ATOM   5330 C CB  . GLU D 2 45  ? 31.331  44.759 178.402 1.00 57.43  ? 83   GLU D CB  1 
ATOM   5331 C CG  . GLU D 2 45  ? 32.229  44.646 179.618 1.00 62.60  ? 83   GLU D CG  1 
ATOM   5332 C CD  . GLU D 2 45  ? 31.998  45.757 180.577 1.00 86.58  ? 83   GLU D CD  1 
ATOM   5333 O OE1 . GLU D 2 45  ? 32.393  45.592 181.738 1.00 87.68  ? 83   GLU D OE1 1 
ATOM   5334 O OE2 . GLU D 2 45  ? 31.404  46.784 180.176 1.00 83.69  ? 83   GLU D OE2 1 
ATOM   5335 N N   . LEU D 2 46  ? 31.794  41.861 176.407 1.00 58.81  ? 84   LEU D N   1 
ATOM   5336 C CA  . LEU D 2 46  ? 31.155  40.673 175.856 1.00 59.26  ? 84   LEU D CA  1 
ATOM   5337 C C   . LEU D 2 46  ? 30.642  39.836 176.978 1.00 64.17  ? 84   LEU D C   1 
ATOM   5338 O O   . LEU D 2 46  ? 31.426  39.175 177.653 1.00 63.23  ? 84   LEU D O   1 
ATOM   5339 C CB  . LEU D 2 46  ? 32.174  39.797 175.119 1.00 59.16  ? 84   LEU D CB  1 
ATOM   5340 C CG  . LEU D 2 46  ? 32.903  40.264 173.876 1.00 63.83  ? 84   LEU D CG  1 
ATOM   5341 C CD1 . LEU D 2 46  ? 33.069  39.074 173.001 1.00 64.31  ? 84   LEU D CD1 1 
ATOM   5342 C CD2 . LEU D 2 46  ? 32.153  41.357 173.166 1.00 68.55  ? 84   LEU D CD2 1 
ATOM   5343 N N   . LYS D 2 47  ? 29.330  39.785 177.137 1.00 61.93  ? 85   LYS D N   1 
ATOM   5344 C CA  . LYS D 2 47  ? 28.785  38.955 178.193 1.00 62.01  ? 85   LYS D CA  1 
ATOM   5345 C C   . LYS D 2 47  ? 28.655  37.554 177.655 1.00 68.43  ? 85   LYS D C   1 
ATOM   5346 O O   . LYS D 2 47  ? 28.816  36.587 178.383 1.00 68.27  ? 85   LYS D O   1 
ATOM   5347 C CB  . LYS D 2 47  ? 27.468  39.514 178.712 1.00 64.82  ? 85   LYS D CB  1 
ATOM   5348 C CG  . LYS D 2 47  ? 27.658  40.718 179.683 1.00 74.74  ? 85   LYS D CG  1 
ATOM   5349 C CD  . LYS D 2 47  ? 27.965  40.261 181.129 1.00 71.70  ? 85   LYS D CD  1 
ATOM   5350 C CE  . LYS D 2 47  ? 29.211  40.895 181.671 1.00 81.09  ? 85   LYS D CE  1 
ATOM   5351 N NZ  . LYS D 2 47  ? 29.096  41.151 183.138 1.00 96.63  ? 85   LYS D NZ  1 
ATOM   5352 N N   . TYR D 2 48  ? 28.486  37.441 176.340 1.00 67.20  ? 86   TYR D N   1 
ATOM   5353 C CA  . TYR D 2 48  ? 28.371  36.115 175.738 1.00 67.20  ? 86   TYR D CA  1 
ATOM   5354 C C   . TYR D 2 48  ? 28.881  36.086 174.317 1.00 67.96  ? 86   TYR D C   1 
ATOM   5355 O O   . TYR D 2 48  ? 28.548  36.961 173.504 1.00 67.53  ? 86   TYR D O   1 
ATOM   5356 C CB  . TYR D 2 48  ? 26.910  35.645 175.745 1.00 68.69  ? 86   TYR D CB  1 
ATOM   5357 C CG  . TYR D 2 48  ? 26.687  34.288 175.105 1.00 69.69  ? 86   TYR D CG  1 
ATOM   5358 C CD1 . TYR D 2 48  ? 27.151  33.124 175.719 1.00 71.10  ? 86   TYR D CD1 1 
ATOM   5359 C CD2 . TYR D 2 48  ? 26.013  34.168 173.882 1.00 70.26  ? 86   TYR D CD2 1 
ATOM   5360 C CE1 . TYR D 2 48  ? 26.913  31.863 175.162 1.00 70.97  ? 86   TYR D CE1 1 
ATOM   5361 C CE2 . TYR D 2 48  ? 25.790  32.908 173.298 1.00 70.97  ? 86   TYR D CE2 1 
ATOM   5362 C CZ  . TYR D 2 48  ? 26.236  31.753 173.957 1.00 76.64  ? 86   TYR D CZ  1 
ATOM   5363 O OH  . TYR D 2 48  ? 26.013  30.489 173.426 1.00 75.76  ? 86   TYR D OH  1 
ATOM   5364 N N   . CYS D 2 49  ? 29.608  35.025 173.999 1.00 62.09  ? 87   CYS D N   1 
ATOM   5365 C CA  . CYS D 2 49  ? 30.105  34.860 172.654 1.00 62.34  ? 87   CYS D CA  1 
ATOM   5366 C C   . CYS D 2 49  ? 30.129  33.415 172.163 1.00 65.81  ? 87   CYS D C   1 
ATOM   5367 O O   . CYS D 2 49  ? 30.885  32.574 172.671 1.00 64.78  ? 87   CYS D O   1 
ATOM   5368 C CB  . CYS D 2 49  ? 31.492  35.481 172.524 1.00 62.79  ? 87   CYS D CB  1 
ATOM   5369 S SG  . CYS D 2 49  ? 32.382  35.063 171.013 1.00 66.36  ? 87   CYS D SG  1 
ATOM   5370 N N   . PHE D 2 50  ? 29.335  33.146 171.133 1.00 62.78  ? 88   PHE D N   1 
ATOM   5371 C CA  . PHE D 2 50  ? 29.346  31.823 170.534 1.00 63.60  ? 88   PHE D CA  1 
ATOM   5372 C C   . PHE D 2 50  ? 29.581  31.907 169.039 1.00 64.64  ? 88   PHE D C   1 
ATOM   5373 O O   . PHE D 2 50  ? 28.906  32.668 168.322 1.00 61.45  ? 88   PHE D O   1 
ATOM   5374 C CB  . PHE D 2 50  ? 28.085  30.992 170.833 1.00 66.10  ? 88   PHE D CB  1 
ATOM   5375 C CG  . PHE D 2 50  ? 28.074  29.667 170.130 1.00 68.02  ? 88   PHE D CG  1 
ATOM   5376 C CD1 . PHE D 2 50  ? 27.285  29.472 169.008 1.00 71.73  ? 88   PHE D CD1 1 
ATOM   5377 C CD2 . PHE D 2 50  ? 28.987  28.677 170.487 1.00 70.43  ? 88   PHE D CD2 1 
ATOM   5378 C CE1 . PHE D 2 50  ? 27.334  28.270 168.320 1.00 72.70  ? 88   PHE D CE1 1 
ATOM   5379 C CE2 . PHE D 2 50  ? 29.052  27.483 169.791 1.00 73.27  ? 88   PHE D CE2 1 
ATOM   5380 C CZ  . PHE D 2 50  ? 28.230  27.277 168.710 1.00 71.05  ? 88   PHE D CZ  1 
ATOM   5381 N N   . VAL D 2 51  ? 30.536  31.090 168.593 1.00 60.51  ? 89   VAL D N   1 
ATOM   5382 C CA  . VAL D 2 51  ? 30.905  31.016 167.184 1.00 59.28  ? 89   VAL D CA  1 
ATOM   5383 C C   . VAL D 2 51  ? 30.507  29.735 166.435 1.00 62.22  ? 89   VAL D C   1 
ATOM   5384 O O   . VAL D 2 51  ? 31.108  28.676 166.617 1.00 62.27  ? 89   VAL D O   1 
ATOM   5385 C CB  . VAL D 2 51  ? 32.400  31.332 166.981 1.00 61.53  ? 89   VAL D CB  1 
ATOM   5386 C CG1 . VAL D 2 51  ? 32.744  31.220 165.533 1.00 60.63  ? 89   VAL D CG1 1 
ATOM   5387 C CG2 . VAL D 2 51  ? 32.712  32.744 167.475 1.00 61.09  ? 89   VAL D CG2 1 
ATOM   5388 N N   . ASP D 2 52  ? 29.526  29.855 165.547 1.00 58.27  ? 90   ASP D N   1 
ATOM   5389 C CA  . ASP D 2 52  ? 29.128  28.741 164.680 1.00 57.53  ? 90   ASP D CA  1 
ATOM   5390 C C   . ASP D 2 52  ? 30.133  28.746 163.539 1.00 61.66  ? 90   ASP D C   1 
ATOM   5391 O O   . ASP D 2 52  ? 29.996  29.544 162.590 1.00 60.10  ? 90   ASP D O   1 
ATOM   5392 C CB  . ASP D 2 52  ? 27.729  28.966 164.098 1.00 58.80  ? 90   ASP D CB  1 
ATOM   5393 C CG  . ASP D 2 52  ? 27.053  27.676 163.713 1.00 67.81  ? 90   ASP D CG  1 
ATOM   5394 O OD1 . ASP D 2 52  ? 25.856  27.550 164.030 1.00 70.07  ? 90   ASP D OD1 1 
ATOM   5395 O OD2 . ASP D 2 52  ? 27.723  26.782 163.142 1.00 69.40  ? 90   ASP D OD2 1 
ATOM   5396 N N   . LYS D 2 53  ? 31.186  27.937 163.676 1.00 58.34  ? 91   LYS D N   1 
ATOM   5397 C CA  . LYS D 2 53  ? 32.234  27.890 162.661 1.00 58.12  ? 91   LYS D CA  1 
ATOM   5398 C C   . LYS D 2 53  ? 31.810  27.326 161.291 1.00 64.86  ? 91   LYS D C   1 
ATOM   5399 O O   . LYS D 2 53  ? 32.388  27.690 160.278 1.00 64.20  ? 91   LYS D O   1 
ATOM   5400 C CB  . LYS D 2 53  ? 33.456  27.171 163.193 1.00 60.02  ? 91   LYS D CB  1 
ATOM   5401 C CG  . LYS D 2 53  ? 34.435  28.074 163.899 1.00 67.17  ? 91   LYS D CG  1 
ATOM   5402 C CD  . LYS D 2 53  ? 35.680  27.312 164.327 1.00 73.94  ? 91   LYS D CD  1 
ATOM   5403 C CE  . LYS D 2 53  ? 35.879  27.385 165.841 1.00 76.69  ? 91   LYS D CE  1 
ATOM   5404 N NZ  . LYS D 2 53  ? 37.312  27.580 166.269 1.00 74.20  ? 91   LYS D NZ  1 
ATOM   5405 N N   . TYR D 2 54  ? 30.786  26.475 161.252 1.00 64.58  ? 92   TYR D N   1 
ATOM   5406 C CA  . TYR D 2 54  ? 30.307  25.939 159.975 1.00 65.58  ? 92   TYR D CA  1 
ATOM   5407 C C   . TYR D 2 54  ? 29.608  27.064 159.226 1.00 66.99  ? 92   TYR D C   1 
ATOM   5408 O O   . TYR D 2 54  ? 29.592  27.080 158.006 1.00 67.34  ? 92   TYR D O   1 
ATOM   5409 C CB  . TYR D 2 54  ? 29.341  24.726 160.161 1.00 68.51  ? 92   TYR D CB  1 
ATOM   5410 C CG  . TYR D 2 54  ? 28.492  24.338 158.931 1.00 72.55  ? 92   TYR D CG  1 
ATOM   5411 C CD1 . TYR D 2 54  ? 28.997  23.502 157.933 1.00 74.14  ? 92   TYR D CD1 1 
ATOM   5412 C CD2 . TYR D 2 54  ? 27.176  24.798 158.783 1.00 74.87  ? 92   TYR D CD2 1 
ATOM   5413 C CE1 . TYR D 2 54  ? 28.228  23.146 156.801 1.00 74.79  ? 92   TYR D CE1 1 
ATOM   5414 C CE2 . TYR D 2 54  ? 26.394  24.448 157.650 1.00 76.31  ? 92   TYR D CE2 1 
ATOM   5415 C CZ  . TYR D 2 54  ? 26.932  23.615 156.663 1.00 83.79  ? 92   TYR D CZ  1 
ATOM   5416 O OH  . TYR D 2 54  ? 26.192  23.254 155.541 1.00 84.37  ? 92   TYR D OH  1 
ATOM   5417 N N   . LYS D 2 55  ? 29.020  28.006 159.942 1.00 61.08  ? 93   LYS D N   1 
ATOM   5418 C CA  . LYS D 2 55  ? 28.308  29.073 159.259 1.00 60.43  ? 93   LYS D CA  1 
ATOM   5419 C C   . LYS D 2 55  ? 29.084  30.393 159.085 1.00 64.66  ? 93   LYS D C   1 
ATOM   5420 O O   . LYS D 2 55  ? 28.679  31.245 158.282 1.00 65.58  ? 93   LYS D O   1 
ATOM   5421 C CB  . LYS D 2 55  ? 26.926  29.311 159.895 1.00 62.50  ? 93   LYS D CB  1 
ATOM   5422 C CG  . LYS D 2 55  ? 26.007  28.108 159.984 1.00 66.33  ? 93   LYS D CG  1 
ATOM   5423 C CD  . LYS D 2 55  ? 24.564  28.528 159.756 1.00 83.51  ? 93   LYS D CD  1 
ATOM   5424 C CE  . LYS D 2 55  ? 24.434  29.471 158.544 1.00 101.20 ? 93   LYS D CE  1 
ATOM   5425 N NZ  . LYS D 2 55  ? 23.379  30.527 158.704 1.00 103.22 ? 93   LYS D NZ  1 
ATOM   5426 N N   . GLY D 2 56  ? 30.195  30.569 159.808 1.00 60.25  ? 94   GLY D N   1 
ATOM   5427 C CA  . GLY D 2 56  ? 30.976  31.802 159.770 1.00 59.04  ? 94   GLY D CA  1 
ATOM   5428 C C   . GLY D 2 56  ? 30.167  32.907 160.439 1.00 63.58  ? 94   GLY D C   1 
ATOM   5429 O O   . GLY D 2 56  ? 30.131  34.089 160.021 1.00 61.96  ? 94   GLY D O   1 
ATOM   5430 N N   . THR D 2 57  ? 29.436  32.490 161.464 1.00 61.11  ? 95   THR D N   1 
ATOM   5431 C CA  . THR D 2 57  ? 28.609  33.421 162.218 1.00 60.60  ? 95   THR D CA  1 
ATOM   5432 C C   . THR D 2 57  ? 29.067  33.383 163.692 1.00 61.51  ? 95   THR D C   1 
ATOM   5433 O O   . THR D 2 57  ? 29.720  32.439 164.149 1.00 60.13  ? 95   THR D O   1 
ATOM   5434 C CB  . THR D 2 57  ? 27.068  33.090 162.053 1.00 65.87  ? 95   THR D CB  1 
ATOM   5435 O OG1 . THR D 2 57  ? 26.816  31.753 162.486 1.00 68.63  ? 95   THR D OG1 1 
ATOM   5436 C CG2 . THR D 2 57  ? 26.616  33.196 160.586 1.00 62.50  ? 95   THR D CG2 1 
ATOM   5437 N N   . ALA D 2 58  ? 28.759  34.431 164.429 1.00 56.71  ? 96   ALA D N   1 
ATOM   5438 C CA  . ALA D 2 58  ? 29.023  34.430 165.854 1.00 55.60  ? 96   ALA D CA  1 
ATOM   5439 C C   . ALA D 2 58  ? 27.844  35.121 166.504 1.00 61.79  ? 96   ALA D C   1 
ATOM   5440 O O   . ALA D 2 58  ? 27.312  36.146 166.015 1.00 59.52  ? 96   ALA D O   1 
ATOM   5441 C CB  . ALA D 2 58  ? 30.303  35.108 166.191 1.00 55.93  ? 96   ALA D CB  1 
ATOM   5442 N N   . PHE D 2 59  ? 27.376  34.477 167.563 1.00 63.03  ? 97   PHE D N   1 
ATOM   5443 C CA  . PHE D 2 59  ? 26.263  34.979 168.365 1.00 63.64  ? 97   PHE D CA  1 
ATOM   5444 C C   . PHE D 2 59  ? 26.896  35.651 169.581 1.00 61.87  ? 97   PHE D C   1 
ATOM   5445 O O   . PHE D 2 59  ? 27.658  35.024 170.331 1.00 59.55  ? 97   PHE D O   1 
ATOM   5446 C CB  . PHE D 2 59  ? 25.321  33.817 168.738 1.00 66.38  ? 97   PHE D CB  1 
ATOM   5447 C CG  . PHE D 2 59  ? 24.780  33.072 167.532 1.00 69.10  ? 97   PHE D CG  1 
ATOM   5448 C CD1 . PHE D 2 59  ? 25.626  32.279 166.753 1.00 72.71  ? 97   PHE D CD1 1 
ATOM   5449 C CD2 . PHE D 2 59  ? 23.443  33.207 167.140 1.00 71.76  ? 97   PHE D CD2 1 
ATOM   5450 C CE1 . PHE D 2 59  ? 25.142  31.605 165.630 1.00 73.65  ? 97   PHE D CE1 1 
ATOM   5451 C CE2 . PHE D 2 59  ? 22.950  32.537 166.011 1.00 74.57  ? 97   PHE D CE2 1 
ATOM   5452 C CZ  . PHE D 2 59  ? 23.798  31.734 165.258 1.00 72.61  ? 97   PHE D CZ  1 
ATOM   5453 N N   . VAL D 2 60  ? 26.691  36.954 169.688 1.00 56.42  ? 98   VAL D N   1 
ATOM   5454 C CA  . VAL D 2 60  ? 27.341  37.701 170.748 1.00 56.69  ? 98   VAL D CA  1 
ATOM   5455 C C   . VAL D 2 60  ? 26.412  38.508 171.638 1.00 59.89  ? 98   VAL D C   1 
ATOM   5456 O O   . VAL D 2 60  ? 25.486  39.177 171.178 1.00 57.26  ? 98   VAL D O   1 
ATOM   5457 C CB  . VAL D 2 60  ? 28.509  38.580 170.179 1.00 61.21  ? 98   VAL D CB  1 
ATOM   5458 C CG1 . VAL D 2 60  ? 29.263  39.309 171.312 1.00 61.09  ? 98   VAL D CG1 1 
ATOM   5459 C CG2 . VAL D 2 60  ? 29.483  37.718 169.350 1.00 60.74  ? 98   VAL D CG2 1 
ATOM   5460 N N   . THR D 2 61  ? 26.700  38.458 172.930 1.00 59.75  ? 99   THR D N   1 
ATOM   5461 C CA  . THR D 2 61  ? 25.952  39.251 173.893 1.00 60.57  ? 99   THR D CA  1 
ATOM   5462 C C   . THR D 2 61  ? 26.851  40.311 174.513 1.00 62.21  ? 99   THR D C   1 
ATOM   5463 O O   . THR D 2 61  ? 27.844  39.995 175.186 1.00 60.34  ? 99   THR D O   1 
ATOM   5464 C CB  . THR D 2 61  ? 25.268  38.392 174.946 1.00 70.01  ? 99   THR D CB  1 
ATOM   5465 O OG1 . THR D 2 61  ? 24.733  37.227 174.308 1.00 73.72  ? 99   THR D OG1 1 
ATOM   5466 C CG2 . THR D 2 61  ? 24.146  39.186 175.586 1.00 65.60  ? 99   THR D CG2 1 
ATOM   5467 N N   . LEU D 2 62  ? 26.522  41.564 174.215 1.00 57.55  ? 100  LEU D N   1 
ATOM   5468 C CA  . LEU D 2 62  ? 27.261  42.699 174.727 1.00 58.57  ? 100  LEU D CA  1 
ATOM   5469 C C   . LEU D 2 62  ? 26.596  43.235 176.008 1.00 67.63  ? 100  LEU D C   1 
ATOM   5470 O O   . LEU D 2 62  ? 25.713  42.599 176.575 1.00 69.71  ? 100  LEU D O   1 
ATOM   5471 C CB  . LEU D 2 62  ? 27.406  43.780 173.644 1.00 58.48  ? 100  LEU D CB  1 
ATOM   5472 C CG  . LEU D 2 62  ? 28.276  43.418 172.419 1.00 61.62  ? 100  LEU D CG  1 
ATOM   5473 C CD1 . LEU D 2 62  ? 28.313  44.558 171.405 1.00 61.45  ? 100  LEU D CD1 1 
ATOM   5474 C CD2 . LEU D 2 62  ? 29.688  43.019 172.835 1.00 60.82  ? 100  LEU D CD2 1 
ATOM   5475 N N   . LEU D 2 63  ? 27.056  44.364 176.515 1.00 64.60  ? 101  LEU D N   1 
ATOM   5476 C CA  . LEU D 2 63  ? 26.515  44.871 177.765 1.00 64.21  ? 101  LEU D CA  1 
ATOM   5477 C C   . LEU D 2 63  ? 25.080  45.371 177.612 1.00 68.88  ? 101  LEU D C   1 
ATOM   5478 O O   . LEU D 2 63  ? 24.218  45.095 178.446 1.00 68.01  ? 101  LEU D O   1 
ATOM   5479 C CB  . LEU D 2 63  ? 27.417  45.992 178.303 1.00 63.95  ? 101  LEU D CB  1 
ATOM   5480 C CG  . LEU D 2 63  ? 27.332  46.365 179.785 1.00 67.15  ? 101  LEU D CG  1 
ATOM   5481 C CD1 . LEU D 2 63  ? 27.806  45.210 180.656 1.00 66.46  ? 101  LEU D CD1 1 
ATOM   5482 C CD2 . LEU D 2 63  ? 28.118  47.636 180.059 1.00 67.24  ? 101  LEU D CD2 1 
ATOM   5483 N N   . ASN D 2 64  ? 24.833  46.131 176.549 1.00 65.04  ? 102  ASN D N   1 
ATOM   5484 C CA  . ASN D 2 64  ? 23.520  46.717 176.333 1.00 63.61  ? 102  ASN D CA  1 
ATOM   5485 C C   . ASN D 2 64  ? 23.255  47.077 174.865 1.00 67.77  ? 102  ASN D C   1 
ATOM   5486 O O   . ASN D 2 64  ? 24.087  46.861 173.980 1.00 67.80  ? 102  ASN D O   1 
ATOM   5487 C CB  . ASN D 2 64  ? 23.439  47.978 177.157 1.00 57.53  ? 102  ASN D CB  1 
ATOM   5488 C CG  . ASN D 2 64  ? 24.597  48.918 176.872 1.00 72.29  ? 102  ASN D CG  1 
ATOM   5489 O OD1 . ASN D 2 64  ? 24.723  49.433 175.755 1.00 67.52  ? 102  ASN D OD1 1 
ATOM   5490 N ND2 . ASN D 2 64  ? 25.483  49.110 177.861 1.00 57.12  ? 102  ASN D ND2 1 
ATOM   5491 N N   . GLY D 2 65  ? 22.095  47.666 174.617 1.00 63.16  ? 103  GLY D N   1 
ATOM   5492 C CA  . GLY D 2 65  ? 21.745  48.051 173.272 1.00 62.90  ? 103  GLY D CA  1 
ATOM   5493 C C   . GLY D 2 65  ? 22.606  49.186 172.751 1.00 67.39  ? 103  GLY D C   1 
ATOM   5494 O O   . GLY D 2 65  ? 22.671  49.417 171.542 1.00 67.86  ? 103  GLY D O   1 
ATOM   5495 N N   . GLU D 2 66  ? 23.238  49.931 173.651 1.00 63.06  ? 104  GLU D N   1 
ATOM   5496 C CA  . GLU D 2 66  ? 24.065  51.042 173.214 1.00 63.09  ? 104  GLU D CA  1 
ATOM   5497 C C   . GLU D 2 66  ? 25.351  50.464 172.606 1.00 66.88  ? 104  GLU D C   1 
ATOM   5498 O O   . GLU D 2 66  ? 25.865  50.980 171.600 1.00 66.58  ? 104  GLU D O   1 
ATOM   5499 C CB  . GLU D 2 66  ? 24.374  51.985 174.385 1.00 64.60  ? 104  GLU D CB  1 
ATOM   5500 C CG  . GLU D 2 66  ? 23.289  53.019 174.695 1.00 79.87  ? 104  GLU D CG  1 
ATOM   5501 C CD  . GLU D 2 66  ? 22.722  52.855 176.105 1.00 115.01 ? 104  GLU D CD  1 
ATOM   5502 O OE1 . GLU D 2 66  ? 22.690  53.849 176.867 1.00 112.15 ? 104  GLU D OE1 1 
ATOM   5503 O OE2 . GLU D 2 66  ? 22.328  51.719 176.457 1.00 105.95 ? 104  GLU D OE2 1 
ATOM   5504 N N   . GLN D 2 67  ? 25.837  49.380 173.216 1.00 62.02  ? 105  GLN D N   1 
ATOM   5505 C CA  . GLN D 2 67  ? 27.049  48.715 172.765 1.00 61.54  ? 105  GLN D CA  1 
ATOM   5506 C C   . GLN D 2 67  ? 26.744  47.970 171.478 1.00 67.55  ? 105  GLN D C   1 
ATOM   5507 O O   . GLN D 2 67  ? 27.490  48.070 170.498 1.00 66.96  ? 105  GLN D O   1 
ATOM   5508 C CB  . GLN D 2 67  ? 27.630  47.789 173.851 1.00 61.82  ? 105  GLN D CB  1 
ATOM   5509 C CG  . GLN D 2 67  ? 28.497  48.554 174.873 1.00 65.76  ? 105  GLN D CG  1 
ATOM   5510 C CD  . GLN D 2 67  ? 29.259  47.659 175.859 1.00 82.83  ? 105  GLN D CD  1 
ATOM   5511 O OE1 . GLN D 2 67  ? 29.480  46.469 175.614 1.00 78.67  ? 105  GLN D OE1 1 
ATOM   5512 N NE2 . GLN D 2 67  ? 29.688  48.250 176.973 1.00 70.19  ? 105  GLN D NE2 1 
ATOM   5513 N N   . ALA D 2 68  ? 25.599  47.292 171.457 1.00 65.38  ? 106  ALA D N   1 
ATOM   5514 C CA  . ALA D 2 68  ? 25.160  46.543 170.274 1.00 65.18  ? 106  ALA D CA  1 
ATOM   5515 C C   . ALA D 2 68  ? 25.054  47.442 169.051 1.00 69.04  ? 106  ALA D C   1 
ATOM   5516 O O   . ALA D 2 68  ? 25.525  47.106 167.983 1.00 69.83  ? 106  ALA D O   1 
ATOM   5517 C CB  . ALA D 2 68  ? 23.857  45.889 170.546 1.00 66.03  ? 106  ALA D CB  1 
ATOM   5518 N N   . GLU D 2 69  ? 24.423  48.590 169.214 1.00 65.80  ? 107  GLU D N   1 
ATOM   5519 C CA  . GLU D 2 69  ? 24.347  49.580 168.154 1.00 65.88  ? 107  GLU D CA  1 
ATOM   5520 C C   . GLU D 2 69  ? 25.773  49.932 167.704 1.00 67.40  ? 107  GLU D C   1 
ATOM   5521 O O   . GLU D 2 69  ? 26.123  49.740 166.552 1.00 65.87  ? 107  GLU D O   1 
ATOM   5522 C CB  . GLU D 2 69  ? 23.657  50.843 168.701 1.00 67.77  ? 107  GLU D CB  1 
ATOM   5523 C CG  . GLU D 2 69  ? 22.634  51.463 167.769 1.00 83.21  ? 107  GLU D CG  1 
ATOM   5524 C CD  . GLU D 2 69  ? 22.186  50.493 166.696 1.00 115.19 ? 107  GLU D CD  1 
ATOM   5525 O OE1 . GLU D 2 69  ? 22.588  50.678 165.519 1.00 109.16 ? 107  GLU D OE1 1 
ATOM   5526 O OE2 . GLU D 2 69  ? 21.449  49.537 167.041 1.00 105.71 ? 107  GLU D OE2 1 
ATOM   5527 N N   . ALA D 2 70  ? 26.576  50.449 168.636 1.00 64.32  ? 108  ALA D N   1 
ATOM   5528 C CA  . ALA D 2 70  ? 27.961  50.832 168.382 1.00 64.29  ? 108  ALA D CA  1 
ATOM   5529 C C   . ALA D 2 70  ? 28.723  49.771 167.584 1.00 68.23  ? 108  ALA D C   1 
ATOM   5530 O O   . ALA D 2 70  ? 29.366  50.097 166.589 1.00 69.62  ? 108  ALA D O   1 
ATOM   5531 C CB  . ALA D 2 70  ? 28.681  51.155 169.696 1.00 64.74  ? 108  ALA D CB  1 
ATOM   5532 N N   . ALA D 2 71  ? 28.650  48.516 168.022 1.00 61.94  ? 109  ALA D N   1 
ATOM   5533 C CA  . ALA D 2 71  ? 29.334  47.419 167.341 1.00 61.11  ? 109  ALA D CA  1 
ATOM   5534 C C   . ALA D 2 71  ? 28.845  47.289 165.893 1.00 66.03  ? 109  ALA D C   1 
ATOM   5535 O O   . ALA D 2 71  ? 29.649  47.245 164.961 1.00 67.66  ? 109  ALA D O   1 
ATOM   5536 C CB  . ALA D 2 71  ? 29.153  46.111 168.098 1.00 61.29  ? 109  ALA D CB  1 
ATOM   5537 N N   . ILE D 2 72  ? 27.530  47.260 165.703 1.00 60.38  ? 110  ILE D N   1 
ATOM   5538 C CA  . ILE D 2 72  ? 26.952  47.194 164.366 1.00 59.49  ? 110  ILE D CA  1 
ATOM   5539 C C   . ILE D 2 72  ? 27.487  48.330 163.486 1.00 63.22  ? 110  ILE D C   1 
ATOM   5540 O O   . ILE D 2 72  ? 27.980  48.092 162.401 1.00 62.03  ? 110  ILE D O   1 
ATOM   5541 C CB  . ILE D 2 72  ? 25.416  47.268 164.418 1.00 62.33  ? 110  ILE D CB  1 
ATOM   5542 C CG1 . ILE D 2 72  ? 24.826  46.113 165.209 1.00 62.79  ? 110  ILE D CG1 1 
ATOM   5543 C CG2 . ILE D 2 72  ? 24.825  47.296 163.025 1.00 61.58  ? 110  ILE D CG2 1 
ATOM   5544 C CD1 . ILE D 2 72  ? 23.328  46.248 165.389 1.00 64.80  ? 110  ILE D CD1 1 
ATOM   5545 N N   . ASN D 2 73  ? 27.358  49.570 163.940 1.00 60.69  ? 111  ASN D N   1 
ATOM   5546 C CA  . ASN D 2 73  ? 27.841  50.697 163.160 1.00 60.97  ? 111  ASN D CA  1 
ATOM   5547 C C   . ASN D 2 73  ? 29.289  50.512 162.774 1.00 64.37  ? 111  ASN D C   1 
ATOM   5548 O O   . ASN D 2 73  ? 29.639  50.695 161.616 1.00 66.23  ? 111  ASN D O   1 
ATOM   5549 C CB  . ASN D 2 73  ? 27.708  51.995 163.940 1.00 66.10  ? 111  ASN D CB  1 
ATOM   5550 C CG  . ASN D 2 73  ? 26.297  52.242 164.402 1.00 104.23 ? 111  ASN D CG  1 
ATOM   5551 O OD1 . ASN D 2 73  ? 25.361  51.586 163.944 1.00 96.98  ? 111  ASN D OD1 1 
ATOM   5552 N ND2 . ASN D 2 73  ? 26.136  53.161 165.346 1.00 101.59 ? 111  ASN D ND2 1 
ATOM   5553 N N   . ALA D 2 74  ? 30.115  50.149 163.754 1.00 56.92  ? 112  ALA D N   1 
ATOM   5554 C CA  . ALA D 2 74  ? 31.550  50.007 163.591 1.00 54.69  ? 112  ALA D CA  1 
ATOM   5555 C C   . ALA D 2 74  ? 32.002  48.875 162.683 1.00 58.89  ? 112  ALA D C   1 
ATOM   5556 O O   . ALA D 2 74  ? 33.015  48.988 161.971 1.00 59.07  ? 112  ALA D O   1 
ATOM   5557 C CB  . ALA D 2 74  ? 32.178  49.830 164.946 1.00 54.88  ? 112  ALA D CB  1 
ATOM   5558 N N   . PHE D 2 75  ? 31.312  47.748 162.785 1.00 53.78  ? 113  PHE D N   1 
ATOM   5559 C CA  . PHE D 2 75  ? 31.762  46.529 162.147 1.00 52.90  ? 113  PHE D CA  1 
ATOM   5560 C C   . PHE D 2 75  ? 30.940  45.922 161.020 1.00 58.83  ? 113  PHE D C   1 
ATOM   5561 O O   . PHE D 2 75  ? 31.407  45.068 160.266 1.00 58.04  ? 113  PHE D O   1 
ATOM   5562 C CB  . PHE D 2 75  ? 32.053  45.499 163.215 1.00 53.44  ? 113  PHE D CB  1 
ATOM   5563 C CG  . PHE D 2 75  ? 33.128  45.916 164.156 1.00 54.47  ? 113  PHE D CG  1 
ATOM   5564 C CD1 . PHE D 2 75  ? 32.828  46.194 165.480 1.00 57.68  ? 113  PHE D CD1 1 
ATOM   5565 C CD2 . PHE D 2 75  ? 34.437  46.077 163.711 1.00 54.41  ? 113  PHE D CD2 1 
ATOM   5566 C CE1 . PHE D 2 75  ? 33.826  46.574 166.346 1.00 58.01  ? 113  PHE D CE1 1 
ATOM   5567 C CE2 . PHE D 2 75  ? 35.420  46.478 164.560 1.00 56.98  ? 113  PHE D CE2 1 
ATOM   5568 C CZ  . PHE D 2 75  ? 35.131  46.711 165.878 1.00 55.72  ? 113  PHE D CZ  1 
ATOM   5569 N N   . HIS D 2 76  ? 29.700  46.338 160.912 1.00 55.83  ? 114  HIS D N   1 
ATOM   5570 C CA  . HIS D 2 76  ? 28.899  45.830 159.833 1.00 55.85  ? 114  HIS D CA  1 
ATOM   5571 C C   . HIS D 2 76  ? 29.522  46.311 158.517 1.00 59.11  ? 114  HIS D C   1 
ATOM   5572 O O   . HIS D 2 76  ? 29.759  47.513 158.324 1.00 58.20  ? 114  HIS D O   1 
ATOM   5573 C CB  . HIS D 2 76  ? 27.478  46.328 159.963 1.00 56.58  ? 114  HIS D CB  1 
ATOM   5574 C CG  . HIS D 2 76  ? 26.587  45.861 158.873 1.00 60.07  ? 114  HIS D CG  1 
ATOM   5575 N ND1 . HIS D 2 76  ? 26.309  44.523 158.662 1.00 61.67  ? 114  HIS D ND1 1 
ATOM   5576 C CD2 . HIS D 2 76  ? 25.933  46.546 157.906 1.00 61.90  ? 114  HIS D CD2 1 
ATOM   5577 C CE1 . HIS D 2 76  ? 25.495  44.409 157.628 1.00 61.20  ? 114  HIS D CE1 1 
ATOM   5578 N NE2 . HIS D 2 76  ? 25.251  45.622 157.152 1.00 61.76  ? 114  HIS D NE2 1 
ATOM   5579 N N   . GLN D 2 77  ? 29.758  45.354 157.620 1.00 54.75  ? 115  GLN D N   1 
ATOM   5580 C CA  . GLN D 2 77  ? 30.420  45.588 156.349 1.00 53.77  ? 115  GLN D CA  1 
ATOM   5581 C C   . GLN D 2 77  ? 31.914  45.877 156.465 1.00 56.26  ? 115  GLN D C   1 
ATOM   5582 O O   . GLN D 2 77  ? 32.543  46.282 155.499 1.00 57.06  ? 115  GLN D O   1 
ATOM   5583 C CB  . GLN D 2 77  ? 29.720  46.648 155.550 1.00 54.81  ? 115  GLN D CB  1 
ATOM   5584 C CG  . GLN D 2 77  ? 28.304  46.275 155.246 1.00 66.50  ? 115  GLN D CG  1 
ATOM   5585 C CD  . GLN D 2 77  ? 27.572  47.390 154.528 1.00 80.51  ? 115  GLN D CD  1 
ATOM   5586 O OE1 . GLN D 2 77  ? 28.090  48.505 154.379 1.00 69.34  ? 115  GLN D OE1 1 
ATOM   5587 N NE2 . GLN D 2 77  ? 26.363  47.098 154.076 1.00 65.68  ? 115  GLN D NE2 1 
ATOM   5588 N N   . SER D 2 78  ? 32.449  45.696 157.669 1.00 49.48  ? 116  SER D N   1 
ATOM   5589 C CA  . SER D 2 78  ? 33.855  45.866 157.955 1.00 47.39  ? 116  SER D CA  1 
ATOM   5590 C C   . SER D 2 78  ? 34.512  44.644 157.296 1.00 53.22  ? 116  SER D C   1 
ATOM   5591 O O   . SER D 2 78  ? 33.801  43.788 156.792 1.00 52.00  ? 116  SER D O   1 
ATOM   5592 C CB  . SER D 2 78  ? 34.052  45.900 159.484 1.00 46.63  ? 116  SER D CB  1 
ATOM   5593 O OG  . SER D 2 78  ? 34.707  44.741 160.016 1.00 52.93  ? 116  SER D OG  1 
ATOM   5594 N N   . ARG D 2 79  ? 35.848  44.600 157.243 1.00 50.47  ? 117  ARG D N   1 
ATOM   5595 C CA  . ARG D 2 79  ? 36.565  43.485 156.657 1.00 49.33  ? 117  ARG D CA  1 
ATOM   5596 C C   . ARG D 2 79  ? 37.449  42.921 157.716 1.00 52.51  ? 117  ARG D C   1 
ATOM   5597 O O   . ARG D 2 79  ? 38.217  43.643 158.322 1.00 53.27  ? 117  ARG D O   1 
ATOM   5598 C CB  . ARG D 2 79  ? 37.470  43.934 155.516 1.00 48.96  ? 117  ARG D CB  1 
ATOM   5599 C CG  . ARG D 2 79  ? 36.751  44.370 154.301 1.00 52.58  ? 117  ARG D CG  1 
ATOM   5600 C CD  . ARG D 2 79  ? 37.047  43.441 153.144 1.00 59.45  ? 117  ARG D CD  1 
ATOM   5601 N NE  . ARG D 2 79  ? 36.150  43.745 152.034 1.00 60.69  ? 117  ARG D NE  1 
ATOM   5602 C CZ  . ARG D 2 79  ? 35.781  42.877 151.104 1.00 74.45  ? 117  ARG D CZ  1 
ATOM   5603 N NH1 . ARG D 2 79  ? 36.240  41.631 151.116 1.00 59.18  ? 117  ARG D NH1 1 
ATOM   5604 N NH2 . ARG D 2 79  ? 34.951  43.265 150.158 1.00 60.18  ? 117  ARG D NH2 1 
ATOM   5605 N N   . LEU D 2 80  ? 37.380  41.619 157.893 1.00 47.45  ? 118  LEU D N   1 
ATOM   5606 C CA  . LEU D 2 80  ? 38.214  40.978 158.845 1.00 47.64  ? 118  LEU D CA  1 
ATOM   5607 C C   . LEU D 2 80  ? 38.946  39.901 158.059 1.00 51.66  ? 118  LEU D C   1 
ATOM   5608 O O   . LEU D 2 80  ? 38.329  38.955 157.572 1.00 52.35  ? 118  LEU D O   1 
ATOM   5609 C CB  . LEU D 2 80  ? 37.366  40.385 159.985 1.00 47.85  ? 118  LEU D CB  1 
ATOM   5610 C CG  . LEU D 2 80  ? 38.248  39.598 160.968 1.00 51.86  ? 118  LEU D CG  1 
ATOM   5611 C CD1 . LEU D 2 80  ? 39.127  40.581 161.700 1.00 50.28  ? 118  LEU D CD1 1 
ATOM   5612 C CD2 . LEU D 2 80  ? 37.480  38.665 161.925 1.00 53.48  ? 118  LEU D CD2 1 
ATOM   5613 N N   . ARG D 2 81  ? 40.251  40.077 157.897 1.00 46.55  ? 119  ARG D N   1 
ATOM   5614 C CA  . ARG D 2 81  ? 41.051  39.086 157.204 1.00 45.40  ? 119  ARG D CA  1 
ATOM   5615 C C   . ARG D 2 81  ? 40.475  38.890 155.788 1.00 48.41  ? 119  ARG D C   1 
ATOM   5616 O O   . ARG D 2 81  ? 40.215  37.761 155.290 1.00 48.79  ? 119  ARG D O   1 
ATOM   5617 C CB  . ARG D 2 81  ? 41.117  37.811 158.054 1.00 41.92  ? 119  ARG D CB  1 
ATOM   5618 C CG  . ARG D 2 81  ? 42.227  37.827 159.110 1.00 38.84  ? 119  ARG D CG  1 
ATOM   5619 C CD  . ARG D 2 81  ? 42.344  36.475 159.835 1.00 48.48  ? 119  ARG D CD  1 
ATOM   5620 N NE  . ARG D 2 81  ? 41.907  35.325 159.050 1.00 63.89  ? 119  ARG D NE  1 
ATOM   5621 C CZ  . ARG D 2 81  ? 41.153  34.346 159.538 1.00 70.51  ? 119  ARG D CZ  1 
ATOM   5622 N NH1 . ARG D 2 81  ? 40.760  34.407 160.800 1.00 41.92  ? 119  ARG D NH1 1 
ATOM   5623 N NH2 . ARG D 2 81  ? 40.790  33.315 158.765 1.00 61.37  ? 119  ARG D NH2 1 
ATOM   5624 N N   . GLU D 2 82  ? 40.244  40.048 155.177 1.00 42.92  ? 120  GLU D N   1 
ATOM   5625 C CA  . GLU D 2 82  ? 39.756  40.171 153.808 1.00 41.85  ? 120  GLU D CA  1 
ATOM   5626 C C   . GLU D 2 82  ? 38.329  39.788 153.586 1.00 44.11  ? 120  GLU D C   1 
ATOM   5627 O O   . GLU D 2 82  ? 37.805  39.987 152.510 1.00 40.05  ? 120  GLU D O   1 
ATOM   5628 C CB  . GLU D 2 82  ? 40.650  39.429 152.846 1.00 42.77  ? 120  GLU D CB  1 
ATOM   5629 C CG  . GLU D 2 82  ? 41.940  40.157 152.588 1.00 50.57  ? 120  GLU D CG  1 
ATOM   5630 C CD  . GLU D 2 82  ? 41.723  41.587 152.138 1.00 71.38  ? 120  GLU D CD  1 
ATOM   5631 O OE1 . GLU D 2 82  ? 41.555  41.824 150.925 1.00 45.22  ? 120  GLU D OE1 1 
ATOM   5632 O OE2 . GLU D 2 82  ? 41.711  42.479 153.006 1.00 66.59  ? 120  GLU D OE2 1 
ATOM   5633 N N   . ARG D 2 83  ? 37.695  39.296 154.639 1.00 44.49  ? 121  ARG D N   1 
ATOM   5634 C CA  . ARG D 2 83  ? 36.308  38.856 154.595 1.00 44.80  ? 121  ARG D CA  1 
ATOM   5635 C C   . ARG D 2 83  ? 35.427  39.987 154.949 1.00 49.83  ? 121  ARG D C   1 
ATOM   5636 O O   . ARG D 2 83  ? 35.687  40.650 155.916 1.00 51.36  ? 121  ARG D O   1 
ATOM   5637 C CB  . ARG D 2 83  ? 36.072  37.777 155.640 1.00 43.20  ? 121  ARG D CB  1 
ATOM   5638 C CG  . ARG D 2 83  ? 36.297  36.396 155.114 1.00 47.09  ? 121  ARG D CG  1 
ATOM   5639 C CD  . ARG D 2 83  ? 37.776  36.144 154.993 1.00 41.73  ? 121  ARG D CD  1 
ATOM   5640 N NE  . ARG D 2 83  ? 38.014  34.721 154.972 1.00 40.36  ? 121  ARG D NE  1 
ATOM   5641 C CZ  . ARG D 2 83  ? 39.193  34.167 155.186 1.00 51.07  ? 121  ARG D CZ  1 
ATOM   5642 N NH1 . ARG D 2 83  ? 40.253  34.925 155.390 1.00 28.10  ? 121  ARG D NH1 1 
ATOM   5643 N NH2 . ARG D 2 83  ? 39.292  32.851 155.197 1.00 44.76  ? 121  ARG D NH2 1 
ATOM   5644 N N   . GLU D 2 84  ? 34.347  40.174 154.208 1.00 46.33  ? 122  GLU D N   1 
ATOM   5645 C CA  . GLU D 2 84  ? 33.400  41.225 154.536 1.00 46.78  ? 122  GLU D CA  1 
ATOM   5646 C C   . GLU D 2 84  ? 32.328  40.748 155.515 1.00 53.36  ? 122  GLU D C   1 
ATOM   5647 O O   . GLU D 2 84  ? 31.442  39.973 155.152 1.00 53.35  ? 122  GLU D O   1 
ATOM   5648 C CB  . GLU D 2 84  ? 32.706  41.779 153.293 1.00 47.86  ? 122  GLU D CB  1 
ATOM   5649 C CG  . GLU D 2 84  ? 31.539  42.684 153.652 1.00 50.83  ? 122  GLU D CG  1 
ATOM   5650 C CD  . GLU D 2 84  ? 30.818  43.217 152.452 1.00 68.99  ? 122  GLU D CD  1 
ATOM   5651 O OE1 . GLU D 2 84  ? 31.033  44.388 152.075 1.00 74.26  ? 122  GLU D OE1 1 
ATOM   5652 O OE2 . GLU D 2 84  ? 29.987  42.484 151.914 1.00 68.66  ? 122  GLU D OE2 1 
ATOM   5653 N N   . LEU D 2 85  ? 32.358  41.287 156.727 1.00 51.15  ? 123  LEU D N   1 
ATOM   5654 C CA  . LEU D 2 85  ? 31.392  40.928 157.760 1.00 50.12  ? 123  LEU D CA  1 
ATOM   5655 C C   . LEU D 2 85  ? 30.027  41.603 157.675 1.00 55.47  ? 123  LEU D C   1 
ATOM   5656 O O   . LEU D 2 85  ? 29.890  42.760 157.267 1.00 54.24  ? 123  LEU D O   1 
ATOM   5657 C CB  . LEU D 2 85  ? 31.988  41.207 159.142 1.00 49.15  ? 123  LEU D CB  1 
ATOM   5658 C CG  . LEU D 2 85  ? 33.407  40.727 159.383 1.00 53.16  ? 123  LEU D CG  1 
ATOM   5659 C CD1 . LEU D 2 85  ? 33.840  41.185 160.769 1.00 53.70  ? 123  LEU D CD1 1 
ATOM   5660 C CD2 . LEU D 2 85  ? 33.468  39.209 159.252 1.00 53.97  ? 123  LEU D CD2 1 
ATOM   5661 N N   . SER D 2 86  ? 29.024  40.878 158.154 1.00 54.77  ? 124  SER D N   1 
ATOM   5662 C CA  . SER D 2 86  ? 27.681  41.424 158.365 1.00 55.17  ? 124  SER D CA  1 
ATOM   5663 C C   . SER D 2 86  ? 27.520  41.381 159.879 1.00 58.48  ? 124  SER D C   1 
ATOM   5664 O O   . SER D 2 86  ? 27.847  40.391 160.513 1.00 56.99  ? 124  SER D O   1 
ATOM   5665 C CB  . SER D 2 86  ? 26.585  40.549 157.737 1.00 58.95  ? 124  SER D CB  1 
ATOM   5666 O OG  . SER D 2 86  ? 25.411  40.554 158.550 1.00 65.56  ? 124  SER D OG  1 
ATOM   5667 N N   . VAL D 2 87  ? 27.108  42.490 160.460 1.00 57.22  ? 125  VAL D N   1 
ATOM   5668 C CA  . VAL D 2 87  ? 26.924  42.582 161.901 1.00 56.47  ? 125  VAL D CA  1 
ATOM   5669 C C   . VAL D 2 87  ? 25.582  43.263 162.084 1.00 63.91  ? 125  VAL D C   1 
ATOM   5670 O O   . VAL D 2 87  ? 25.367  44.403 161.658 1.00 63.98  ? 125  VAL D O   1 
ATOM   5671 C CB  . VAL D 2 87  ? 28.067  43.383 162.576 1.00 58.33  ? 125  VAL D CB  1 
ATOM   5672 C CG1 . VAL D 2 87  ? 27.822  43.516 164.056 1.00 57.70  ? 125  VAL D CG1 1 
ATOM   5673 C CG2 . VAL D 2 87  ? 29.413  42.730 162.320 1.00 57.42  ? 125  VAL D CG2 1 
ATOM   5674 N N   . GLN D 2 88  ? 24.634  42.517 162.619 1.00 63.20  ? 126  GLN D N   1 
ATOM   5675 C CA  . GLN D 2 88  ? 23.301  43.065 162.862 1.00 63.79  ? 126  GLN D CA  1 
ATOM   5676 C C   . GLN D 2 88  ? 22.643  42.445 164.089 1.00 68.06  ? 126  GLN D C   1 
ATOM   5677 O O   . GLN D 2 88  ? 23.177  41.478 164.677 1.00 66.97  ? 126  GLN D O   1 
ATOM   5678 C CB  . GLN D 2 88  ? 22.427  42.939 161.623 1.00 65.16  ? 126  GLN D CB  1 
ATOM   5679 C CG  . GLN D 2 88  ? 22.648  44.061 160.628 1.00 80.91  ? 126  GLN D CG  1 
ATOM   5680 C CD  . GLN D 2 88  ? 22.320  43.604 159.246 1.00 116.96 ? 126  GLN D CD  1 
ATOM   5681 O OE1 . GLN D 2 88  ? 22.509  42.428 158.922 1.00 117.73 ? 126  GLN D OE1 1 
ATOM   5682 N NE2 . GLN D 2 88  ? 21.734  44.490 158.445 1.00 112.66 ? 126  GLN D NE2 1 
ATOM   5683 N N   . LEU D 2 89  ? 21.513  43.009 164.507 1.00 65.39  ? 127  LEU D N   1 
ATOM   5684 C CA  . LEU D 2 89  ? 20.876  42.488 165.719 1.00 66.74  ? 127  LEU D CA  1 
ATOM   5685 C C   . LEU D 2 89  ? 20.408  41.070 165.549 1.00 72.26  ? 127  LEU D C   1 
ATOM   5686 O O   . LEU D 2 89  ? 19.736  40.738 164.577 1.00 71.64  ? 127  LEU D O   1 
ATOM   5687 C CB  . LEU D 2 89  ? 19.743  43.375 166.243 1.00 66.94  ? 127  LEU D CB  1 
ATOM   5688 C CG  . LEU D 2 89  ? 20.154  44.720 166.842 1.00 71.87  ? 127  LEU D CG  1 
ATOM   5689 C CD1 . LEU D 2 89  ? 18.933  45.559 167.241 1.00 72.00  ? 127  LEU D CD1 1 
ATOM   5690 C CD2 . LEU D 2 89  ? 21.107  44.499 168.017 1.00 72.97  ? 127  LEU D CD2 1 
ATOM   5691 N N   . GLN D 2 90  ? 20.781  40.228 166.494 1.00 71.88  ? 128  GLN D N   1 
ATOM   5692 C CA  . GLN D 2 90  ? 20.357  38.841 166.465 1.00 74.26  ? 128  GLN D CA  1 
ATOM   5693 C C   . GLN D 2 90  ? 18.826  38.805 166.423 1.00 87.72  ? 128  GLN D C   1 
ATOM   5694 O O   . GLN D 2 90  ? 18.157  39.750 166.856 1.00 89.03  ? 128  GLN D O   1 
ATOM   5695 C CB  . GLN D 2 90  ? 20.838  38.152 167.728 1.00 74.89  ? 128  GLN D CB  1 
ATOM   5696 C CG  . GLN D 2 90  ? 21.279  36.722 167.564 1.00 71.20  ? 128  GLN D CG  1 
ATOM   5697 C CD  . GLN D 2 90  ? 22.114  36.265 168.759 1.00 89.43  ? 128  GLN D CD  1 
ATOM   5698 O OE1 . GLN D 2 90  ? 22.748  37.082 169.442 1.00 79.63  ? 128  GLN D OE1 1 
ATOM   5699 N NE2 . GLN D 2 90  ? 22.096  34.966 169.034 1.00 85.08  ? 128  GLN D NE2 1 
ATOM   5700 N N   . PRO D 2 91  ? 18.248  37.699 165.932 1.00 89.45  ? 129  PRO D N   1 
ATOM   5701 C CA  . PRO D 2 91  ? 16.784  37.576 165.819 1.00 90.90  ? 129  PRO D CA  1 
ATOM   5702 C C   . PRO D 2 91  ? 16.019  37.212 167.118 1.00 96.99  ? 129  PRO D C   1 
ATOM   5703 O O   . PRO D 2 91  ? 16.534  36.488 167.994 1.00 95.63  ? 129  PRO D O   1 
ATOM   5704 C CB  . PRO D 2 91  ? 16.621  36.460 164.786 1.00 92.63  ? 129  PRO D CB  1 
ATOM   5705 C CG  . PRO D 2 91  ? 17.804  35.571 165.036 1.00 96.66  ? 129  PRO D CG  1 
ATOM   5706 C CD  . PRO D 2 91  ? 18.939  36.474 165.489 1.00 91.80  ? 129  PRO D CD  1 
ATOM   5707 N N   . THR D 2 92  ? 14.770  37.694 167.199 1.00 95.53  ? 130  THR D N   1 
ATOM   5708 C CA  . THR D 2 92  ? 13.878  37.447 168.346 1.00 95.59  ? 130  THR D CA  1 
ATOM   5709 C C   . THR D 2 92  ? 13.746  35.935 168.577 1.00 98.64  ? 130  THR D C   1 
ATOM   5710 O O   . THR D 2 92  ? 13.206  35.192 167.750 1.00 97.76  ? 130  THR D O   1 
ATOM   5711 C CB  . THR D 2 92  ? 12.483  38.177 168.209 1.00 103.47 ? 130  THR D CB  1 
ATOM   5712 O OG1 . THR D 2 92  ? 12.593  39.557 168.599 1.00 101.54 ? 130  THR D OG1 1 
ATOM   5713 C CG2 . THR D 2 92  ? 11.446  37.512 169.091 1.00 101.30 ? 130  THR D CG2 1 
ATOM   5714 N N   . ASP D 2 93  ? 14.295  35.486 169.695 1.00 94.56  ? 131  ASP D N   1 
ATOM   5715 C CA  . ASP D 2 93  ? 14.315  34.070 170.034 1.00 93.86  ? 131  ASP D CA  1 
ATOM   5716 C C   . ASP D 2 93  ? 13.158  33.687 170.992 1.00 89.86  ? 131  ASP D C   1 
ATOM   5717 O O   . ASP D 2 93  ? 12.120  33.158 170.568 1.00 89.33  ? 131  ASP D O   1 
ATOM   5718 C CB  . ASP D 2 93  ? 15.686  33.766 170.685 1.00 97.42  ? 131  ASP D CB  1 
ATOM   5719 C CG  . ASP D 2 93  ? 16.279  32.421 170.257 1.00 115.17 ? 131  ASP D CG  1 
ATOM   5720 O OD1 . ASP D 2 93  ? 17.269  31.977 170.893 1.00 115.98 ? 131  ASP D OD1 1 
ATOM   5721 O OD2 . ASP D 2 93  ? 15.750  31.802 169.308 1.00 124.48 ? 131  ASP D OD2 1 
ATOM   5722 N N   . ALA D 2 94  ? 13.370  33.970 172.277 1.00 79.66  ? 132  ALA D N   1 
ATOM   5723 C CA  . ALA D 2 94  ? 12.444  33.656 173.359 1.00 76.70  ? 132  ALA D CA  1 
ATOM   5724 C C   . ALA D 2 94  ? 11.605  34.843 173.806 1.00 73.08  ? 132  ALA D C   1 
ATOM   5725 O O   . ALA D 2 94  ? 11.669  35.227 174.971 1.00 72.25  ? 132  ALA D O   1 
ATOM   5726 C CB  . ALA D 2 94  ? 13.217  33.122 174.551 1.00 77.54  ? 132  ALA D CB  1 
ATOM   5727 N N   . LEU D 2 95  ? 10.820  35.405 172.888 1.00 64.58  ? 133  LEU D N   1 
ATOM   5728 C CA  . LEU D 2 95  ? 9.969   36.556 173.175 1.00 61.77  ? 133  LEU D CA  1 
ATOM   5729 C C   . LEU D 2 95  ? 8.501   36.151 173.358 1.00 62.08  ? 133  LEU D C   1 
ATOM   5730 O O   . LEU D 2 95  ? 7.821   35.752 172.410 1.00 61.14  ? 133  LEU D O   1 
ATOM   5731 C CB  . LEU D 2 95  ? 10.093  37.613 172.071 1.00 61.31  ? 133  LEU D CB  1 
ATOM   5732 C CG  . LEU D 2 95  ? 10.006  39.088 172.452 1.00 65.08  ? 133  LEU D CG  1 
ATOM   5733 C CD1 . LEU D 2 95  ? 8.863   39.775 171.747 1.00 65.01  ? 133  LEU D CD1 1 
ATOM   5734 C CD2 . LEU D 2 95  ? 9.871   39.257 173.934 1.00 67.59  ? 133  LEU D CD2 1 
ATOM   5735 N N   . LEU D 2 96  ? 8.017   36.278 174.590 1.00 55.79  ? 134  LEU D N   1 
ATOM   5736 C CA  . LEU D 2 96  ? 6.642   35.946 174.920 1.00 53.45  ? 134  LEU D CA  1 
ATOM   5737 C C   . LEU D 2 96  ? 5.830   37.212 175.137 1.00 55.89  ? 134  LEU D C   1 
ATOM   5738 O O   . LEU D 2 96  ? 6.366   38.248 175.513 1.00 55.06  ? 134  LEU D O   1 
ATOM   5739 C CB  . LEU D 2 96  ? 6.621   35.153 176.223 1.00 52.45  ? 134  LEU D CB  1 
ATOM   5740 C CG  . LEU D 2 96  ? 7.312   33.810 176.117 1.00 56.15  ? 134  LEU D CG  1 
ATOM   5741 C CD1 . LEU D 2 96  ? 7.051   32.903 177.309 1.00 55.70  ? 134  LEU D CD1 1 
ATOM   5742 C CD2 . LEU D 2 96  ? 6.766   33.184 174.861 1.00 60.69  ? 134  LEU D CD2 1 
ATOM   5743 N N   . CYS D 2 97  ? 4.526   37.117 174.942 1.00 51.54  ? 135  CYS D N   1 
ATOM   5744 C CA  . CYS D 2 97  ? 3.658   38.209 175.314 1.00 51.48  ? 135  CYS D CA  1 
ATOM   5745 C C   . CYS D 2 97  ? 2.637   37.596 176.267 1.00 53.02  ? 135  CYS D C   1 
ATOM   5746 O O   . CYS D 2 97  ? 1.958   36.618 175.930 1.00 51.86  ? 135  CYS D O   1 
ATOM   5747 C CB  . CYS D 2 97  ? 2.965   38.843 174.137 1.00 52.54  ? 135  CYS D CB  1 
ATOM   5748 S SG  . CYS D 2 97  ? 1.794   40.097 174.719 1.00 57.08  ? 135  CYS D SG  1 
ATOM   5749 N N   . VAL D 2 98  ? 2.629   38.090 177.498 1.00 47.47  ? 136  VAL D N   1 
ATOM   5750 C CA  . VAL D 2 98  ? 1.717   37.593 178.512 1.00 45.73  ? 136  VAL D CA  1 
ATOM   5751 C C   . VAL D 2 98  ? 0.527   38.535 178.589 1.00 47.18  ? 136  VAL D C   1 
ATOM   5752 O O   . VAL D 2 98  ? 0.668   39.666 179.039 1.00 46.45  ? 136  VAL D O   1 
ATOM   5753 C CB  . VAL D 2 98  ? 2.415   37.546 179.830 1.00 49.18  ? 136  VAL D CB  1 
ATOM   5754 C CG1 . VAL D 2 98  ? 1.446   37.152 180.923 1.00 48.94  ? 136  VAL D CG1 1 
ATOM   5755 C CG2 . VAL D 2 98  ? 3.556   36.591 179.743 1.00 49.14  ? 136  VAL D CG2 1 
ATOM   5756 N N   . ALA D 2 99  ? -0.627  38.104 178.088 1.00 42.08  ? 137  ALA D N   1 
ATOM   5757 C CA  . ALA D 2 99  ? -1.800  38.971 178.110 1.00 41.63  ? 137  ALA D CA  1 
ATOM   5758 C C   . ALA D 2 99  ? -2.904  38.625 179.114 1.00 49.08  ? 137  ALA D C   1 
ATOM   5759 O O   . ALA D 2 99  ? -2.857  37.619 179.841 1.00 49.29  ? 137  ALA D O   1 
ATOM   5760 C CB  . ALA D 2 99  ? -2.355  39.199 176.732 1.00 41.43  ? 137  ALA D CB  1 
ATOM   5761 N N   . ASN D 2 100 ? -3.878  39.516 179.179 1.00 47.19  ? 138  ASN D N   1 
ATOM   5762 C CA  . ASN D 2 100 ? -5.008  39.347 180.068 1.00 46.60  ? 138  ASN D CA  1 
ATOM   5763 C C   . ASN D 2 100 ? -4.604  39.453 181.545 1.00 51.83  ? 138  ASN D C   1 
ATOM   5764 O O   . ASN D 2 100 ? -5.337  39.016 182.443 1.00 52.57  ? 138  ASN D O   1 
ATOM   5765 C CB  . ASN D 2 100 ? -5.783  38.079 179.719 1.00 39.67  ? 138  ASN D CB  1 
ATOM   5766 C CG  . ASN D 2 100 ? -7.090  37.985 180.450 1.00 62.84  ? 138  ASN D CG  1 
ATOM   5767 O OD1 . ASN D 2 100 ? -7.850  38.952 180.505 1.00 51.29  ? 138  ASN D OD1 1 
ATOM   5768 N ND2 . ASN D 2 100 ? -7.373  36.805 181.018 1.00 58.11  ? 138  ASN D ND2 1 
ATOM   5769 N N   . LEU D 2 101 ? -3.465  40.109 181.778 1.00 48.42  ? 139  LEU D N   1 
ATOM   5770 C CA  . LEU D 2 101 ? -2.964  40.414 183.130 1.00 48.50  ? 139  LEU D CA  1 
ATOM   5771 C C   . LEU D 2 101 ? -3.925  41.337 183.848 1.00 52.44  ? 139  LEU D C   1 
ATOM   5772 O O   . LEU D 2 101 ? -4.598  42.158 183.225 1.00 51.60  ? 139  LEU D O   1 
ATOM   5773 C CB  . LEU D 2 101 ? -1.661  41.228 183.043 1.00 48.13  ? 139  LEU D CB  1 
ATOM   5774 C CG  . LEU D 2 101 ? -0.417  40.676 182.369 1.00 51.74  ? 139  LEU D CG  1 
ATOM   5775 C CD1 . LEU D 2 101 ? 0.629   41.781 182.178 1.00 51.36  ? 139  LEU D CD1 1 
ATOM   5776 C CD2 . LEU D 2 101 ? 0.125   39.520 183.186 1.00 51.93  ? 139  LEU D CD2 1 
ATOM   5777 N N   . PRO D 2 102 ? -3.908  41.301 185.180 1.00 50.83  ? 140  PRO D N   1 
ATOM   5778 C CA  . PRO D 2 102 ? -4.715  42.252 185.949 1.00 51.28  ? 140  PRO D CA  1 
ATOM   5779 C C   . PRO D 2 102 ? -4.354  43.682 185.509 1.00 56.56  ? 140  PRO D C   1 
ATOM   5780 O O   . PRO D 2 102 ? -3.187  44.049 185.421 1.00 55.23  ? 140  PRO D O   1 
ATOM   5781 C CB  . PRO D 2 102 ? -4.232  42.018 187.376 1.00 52.36  ? 140  PRO D CB  1 
ATOM   5782 C CG  . PRO D 2 102 ? -3.897  40.585 187.405 1.00 56.18  ? 140  PRO D CG  1 
ATOM   5783 C CD  . PRO D 2 102 ? -3.326  40.261 186.041 1.00 52.15  ? 140  PRO D CD  1 
ATOM   5784 N N   . PRO D 2 103 ? -5.366  44.487 185.168 1.00 55.98  ? 141  PRO D N   1 
ATOM   5785 C CA  . PRO D 2 103 ? -5.067  45.836 184.666 1.00 55.19  ? 141  PRO D CA  1 
ATOM   5786 C C   . PRO D 2 103 ? -4.253  46.653 185.647 1.00 57.55  ? 141  PRO D C   1 
ATOM   5787 O O   . PRO D 2 103 ? -3.577  47.599 185.242 1.00 57.40  ? 141  PRO D O   1 
ATOM   5788 C CB  . PRO D 2 103 ? -6.449  46.465 184.469 1.00 56.86  ? 141  PRO D CB  1 
ATOM   5789 C CG  . PRO D 2 103 ? -7.455  45.326 184.570 1.00 61.87  ? 141  PRO D CG  1 
ATOM   5790 C CD  . PRO D 2 103 ? -6.802  44.317 185.478 1.00 58.37  ? 141  PRO D CD  1 
ATOM   5791 N N   . SER D 2 104 ? -4.311  46.273 186.926 1.00 51.96  ? 142  SER D N   1 
ATOM   5792 C CA  . SER D 2 104 ? -3.568  46.954 187.999 1.00 50.67  ? 142  SER D CA  1 
ATOM   5793 C C   . SER D 2 104 ? -2.158  46.378 188.273 1.00 54.76  ? 142  SER D C   1 
ATOM   5794 O O   . SER D 2 104 ? -1.401  46.938 189.066 1.00 54.48  ? 142  SER D O   1 
ATOM   5795 C CB  . SER D 2 104 ? -4.395  46.930 189.305 1.00 51.58  ? 142  SER D CB  1 
ATOM   5796 O OG  . SER D 2 104 ? -4.223  45.720 190.035 1.00 56.74  ? 142  SER D OG  1 
ATOM   5797 N N   . LEU D 2 105 ? -1.843  45.224 187.686 1.00 50.72  ? 143  LEU D N   1 
ATOM   5798 C CA  . LEU D 2 105 ? -0.547  44.582 187.912 1.00 49.25  ? 143  LEU D CA  1 
ATOM   5799 C C   . LEU D 2 105 ? 0.563   45.561 187.622 1.00 55.60  ? 143  LEU D C   1 
ATOM   5800 O O   . LEU D 2 105 ? 0.529   46.237 186.602 1.00 56.51  ? 143  LEU D O   1 
ATOM   5801 C CB  . LEU D 2 105 ? -0.386  43.339 187.036 1.00 47.84  ? 143  LEU D CB  1 
ATOM   5802 C CG  . LEU D 2 105 ? 0.766   42.445 187.500 1.00 51.14  ? 143  LEU D CG  1 
ATOM   5803 C CD1 . LEU D 2 105 ? 0.435   41.782 188.817 1.00 50.34  ? 143  LEU D CD1 1 
ATOM   5804 C CD2 . LEU D 2 105 ? 1.194   41.395 186.455 1.00 50.54  ? 143  LEU D CD2 1 
ATOM   5805 N N   . THR D 2 106 ? 1.541   45.674 188.515 1.00 53.01  ? 144  THR D N   1 
ATOM   5806 C CA  . THR D 2 106 ? 2.644   46.617 188.256 1.00 52.62  ? 144  THR D CA  1 
ATOM   5807 C C   . THR D 2 106 ? 3.773   45.969 187.520 1.00 58.87  ? 144  THR D C   1 
ATOM   5808 O O   . THR D 2 106 ? 3.952   44.743 187.574 1.00 59.94  ? 144  THR D O   1 
ATOM   5809 C CB  . THR D 2 106 ? 3.225   47.257 189.503 1.00 49.47  ? 144  THR D CB  1 
ATOM   5810 O OG1 . THR D 2 106 ? 3.985   46.289 190.241 1.00 50.32  ? 144  THR D OG1 1 
ATOM   5811 C CG2 . THR D 2 106 ? 2.153   47.872 190.337 1.00 44.28  ? 144  THR D CG2 1 
ATOM   5812 N N   . GLN D 2 107 ? 4.605   46.830 186.948 1.00 55.09  ? 145  GLN D N   1 
ATOM   5813 C CA  . GLN D 2 107 ? 5.768   46.412 186.174 1.00 54.10  ? 145  GLN D CA  1 
ATOM   5814 C C   . GLN D 2 107 ? 6.676   45.548 186.992 1.00 56.00  ? 145  GLN D C   1 
ATOM   5815 O O   . GLN D 2 107 ? 7.175   44.532 186.515 1.00 55.64  ? 145  GLN D O   1 
ATOM   5816 C CB  . GLN D 2 107 ? 6.507   47.627 185.589 1.00 55.31  ? 145  GLN D CB  1 
ATOM   5817 C CG  . GLN D 2 107 ? 7.979   47.421 185.273 1.00 57.04  ? 145  GLN D CG  1 
ATOM   5818 C CD  . GLN D 2 107 ? 8.233   46.471 184.113 1.00 59.44  ? 145  GLN D CD  1 
ATOM   5819 O OE1 . GLN D 2 107 ? 9.092   45.606 184.208 1.00 52.98  ? 145  GLN D OE1 1 
ATOM   5820 N NE2 . GLN D 2 107 ? 7.510   46.646 183.013 1.00 44.19  ? 145  GLN D NE2 1 
ATOM   5821 N N   . GLN D 2 108 ? 6.844   45.913 188.251 1.00 52.72  ? 146  GLN D N   1 
ATOM   5822 C CA  . GLN D 2 108 ? 7.700   45.119 189.122 1.00 52.54  ? 146  GLN D CA  1 
ATOM   5823 C C   . GLN D 2 108 ? 7.041   43.805 189.472 1.00 57.63  ? 146  GLN D C   1 
ATOM   5824 O O   . GLN D 2 108 ? 7.727   42.835 189.827 1.00 58.47  ? 146  GLN D O   1 
ATOM   5825 C CB  . GLN D 2 108 ? 8.067   45.898 190.387 1.00 54.34  ? 146  GLN D CB  1 
ATOM   5826 C CG  . GLN D 2 108 ? 8.926   45.103 191.384 1.00 80.36  ? 146  GLN D CG  1 
ATOM   5827 C CD  . GLN D 2 108 ? 8.671   45.506 192.835 1.00 106.42 ? 146  GLN D CD  1 
ATOM   5828 O OE1 . GLN D 2 108 ? 8.212   44.700 193.651 1.00 101.44 ? 146  GLN D OE1 1 
ATOM   5829 N NE2 . GLN D 2 108 ? 8.958   46.763 193.156 1.00 99.82  ? 146  GLN D NE2 1 
ATOM   5830 N N   . GLN D 2 109 ? 5.707   43.764 189.380 1.00 53.66  ? 147  GLN D N   1 
ATOM   5831 C CA  . GLN D 2 109 ? 4.968   42.535 189.706 1.00 51.68  ? 147  GLN D CA  1 
ATOM   5832 C C   . GLN D 2 109 ? 5.041   41.661 188.517 1.00 49.71  ? 147  GLN D C   1 
ATOM   5833 O O   . GLN D 2 109 ? 5.318   40.495 188.614 1.00 49.46  ? 147  GLN D O   1 
ATOM   5834 C CB  . GLN D 2 109 ? 3.533   42.842 190.064 1.00 53.02  ? 147  GLN D CB  1 
ATOM   5835 C CG  . GLN D 2 109 ? 3.459   43.576 191.371 1.00 52.17  ? 147  GLN D CG  1 
ATOM   5836 C CD  . GLN D 2 109 ? 2.091   44.012 191.693 1.00 65.33  ? 147  GLN D CD  1 
ATOM   5837 O OE1 . GLN D 2 109 ? 1.396   44.607 190.860 1.00 64.47  ? 147  GLN D OE1 1 
ATOM   5838 N NE2 . GLN D 2 109 ? 1.676   43.734 192.917 1.00 59.94  ? 147  GLN D NE2 1 
ATOM   5839 N N   . PHE D 2 110 ? 4.909   42.280 187.369 1.00 44.88  ? 148  PHE D N   1 
ATOM   5840 C CA  . PHE D 2 110 ? 5.084   41.571 186.122 1.00 44.85  ? 148  PHE D CA  1 
ATOM   5841 C C   . PHE D 2 110 ? 6.437   40.867 186.121 1.00 50.56  ? 148  PHE D C   1 
ATOM   5842 O O   . PHE D 2 110 ? 6.518   39.672 185.928 1.00 51.53  ? 148  PHE D O   1 
ATOM   5843 C CB  . PHE D 2 110 ? 5.021   42.560 184.969 1.00 46.10  ? 148  PHE D CB  1 
ATOM   5844 C CG  . PHE D 2 110 ? 5.003   41.904 183.636 1.00 47.06  ? 148  PHE D CG  1 
ATOM   5845 C CD1 . PHE D 2 110 ? 4.080   40.895 183.364 1.00 47.76  ? 148  PHE D CD1 1 
ATOM   5846 C CD2 . PHE D 2 110 ? 5.916   42.267 182.662 1.00 49.64  ? 148  PHE D CD2 1 
ATOM   5847 C CE1 . PHE D 2 110 ? 4.040   40.274 182.149 1.00 48.10  ? 148  PHE D CE1 1 
ATOM   5848 C CE2 . PHE D 2 110 ? 5.890   41.642 181.423 1.00 52.51  ? 148  PHE D CE2 1 
ATOM   5849 C CZ  . PHE D 2 110 ? 4.950   40.623 181.172 1.00 49.45  ? 148  PHE D CZ  1 
ATOM   5850 N N   . GLU D 2 111 ? 7.499   41.624 186.364 1.00 48.46  ? 149  GLU D N   1 
ATOM   5851 C CA  . GLU D 2 111 ? 8.854   41.087 186.433 1.00 48.42  ? 149  GLU D CA  1 
ATOM   5852 C C   . GLU D 2 111 ? 8.991   39.901 187.401 1.00 51.50  ? 149  GLU D C   1 
ATOM   5853 O O   . GLU D 2 111 ? 9.683   38.936 187.118 1.00 50.15  ? 149  GLU D O   1 
ATOM   5854 C CB  . GLU D 2 111 ? 9.810   42.197 186.850 1.00 50.04  ? 149  GLU D CB  1 
ATOM   5855 C CG  . GLU D 2 111 ? 11.170  42.131 186.149 1.00 65.77  ? 149  GLU D CG  1 
ATOM   5856 C CD  . GLU D 2 111 ? 12.350  41.966 187.118 1.00 92.15  ? 149  GLU D CD  1 
ATOM   5857 O OE1 . GLU D 2 111 ? 12.272  41.104 188.028 1.00 102.44 ? 149  GLU D OE1 1 
ATOM   5858 O OE2 . GLU D 2 111 ? 13.374  42.670 186.933 1.00 81.74  ? 149  GLU D OE2 1 
ATOM   5859 N N   . GLU D 2 112 ? 8.346   40.001 188.559 1.00 49.01  ? 150  GLU D N   1 
ATOM   5860 C CA  . GLU D 2 112 ? 8.386   38.935 189.574 1.00 48.09  ? 150  GLU D CA  1 
ATOM   5861 C C   . GLU D 2 112 ? 7.684   37.688 189.120 1.00 53.08  ? 150  GLU D C   1 
ATOM   5862 O O   . GLU D 2 112 ? 7.982   36.592 189.588 1.00 55.49  ? 150  GLU D O   1 
ATOM   5863 C CB  . GLU D 2 112 ? 7.663   39.383 190.823 1.00 48.28  ? 150  GLU D CB  1 
ATOM   5864 C CG  . GLU D 2 112 ? 8.561   39.869 191.919 1.00 51.41  ? 150  GLU D CG  1 
ATOM   5865 C CD  . GLU D 2 112 ? 7.862   40.905 192.748 1.00 68.22  ? 150  GLU D CD  1 
ATOM   5866 O OE1 . GLU D 2 112 ? 6.638   41.115 192.528 1.00 73.04  ? 150  GLU D OE1 1 
ATOM   5867 O OE2 . GLU D 2 112 ? 8.527   41.525 193.608 1.00 62.04  ? 150  GLU D OE2 1 
ATOM   5868 N N   . LEU D 2 113 ? 6.705   37.893 188.247 1.00 47.32  ? 151  LEU D N   1 
ATOM   5869 C CA  . LEU D 2 113 ? 5.838   36.849 187.729 1.00 45.72  ? 151  LEU D CA  1 
ATOM   5870 C C   . LEU D 2 113 ? 6.563   36.024 186.698 1.00 51.49  ? 151  LEU D C   1 
ATOM   5871 O O   . LEU D 2 113 ? 6.568   34.818 186.721 1.00 52.00  ? 151  LEU D O   1 
ATOM   5872 C CB  . LEU D 2 113 ? 4.582   37.512 187.091 1.00 44.74  ? 151  LEU D CB  1 
ATOM   5873 C CG  . LEU D 2 113 ? 3.675   36.598 186.257 1.00 48.12  ? 151  LEU D CG  1 
ATOM   5874 C CD1 . LEU D 2 113 ? 2.988   35.587 187.150 1.00 47.33  ? 151  LEU D CD1 1 
ATOM   5875 C CD2 . LEU D 2 113 ? 2.683   37.328 185.362 1.00 46.88  ? 151  LEU D CD2 1 
ATOM   5876 N N   . VAL D 2 114 ? 7.172   36.728 185.776 1.00 51.18  ? 152  VAL D N   1 
ATOM   5877 C CA  . VAL D 2 114 ? 7.805   36.161 184.614 1.00 51.61  ? 152  VAL D CA  1 
ATOM   5878 C C   . VAL D 2 114 ? 9.293   35.765 184.793 1.00 56.39  ? 152  VAL D C   1 
ATOM   5879 O O   . VAL D 2 114 ? 9.833   34.924 184.070 1.00 55.56  ? 152  VAL D O   1 
ATOM   5880 C CB  . VAL D 2 114 ? 7.568   37.180 183.508 1.00 54.57  ? 152  VAL D CB  1 
ATOM   5881 C CG1 . VAL D 2 114 ? 8.843   37.773 182.989 1.00 53.96  ? 152  VAL D CG1 1 
ATOM   5882 C CG2 . VAL D 2 114 ? 6.619   36.644 182.468 1.00 54.43  ? 152  VAL D CG2 1 
ATOM   5883 N N   . ARG D 2 115 ? 9.920   36.347 185.816 1.00 53.24  ? 153  ARG D N   1 
ATOM   5884 C CA  . ARG D 2 115 ? 11.345  36.141 186.105 1.00 52.85  ? 153  ARG D CA  1 
ATOM   5885 C C   . ARG D 2 115 ? 11.805  34.721 186.496 1.00 58.34  ? 153  ARG D C   1 
ATOM   5886 O O   . ARG D 2 115 ? 12.839  34.262 186.013 1.00 60.50  ? 153  ARG D O   1 
ATOM   5887 C CB  . ARG D 2 115 ? 11.812  37.140 187.169 1.00 51.56  ? 153  ARG D CB  1 
ATOM   5888 C CG  . ARG D 2 115 ? 12.334  36.492 188.442 1.00 57.00  ? 153  ARG D CG  1 
ATOM   5889 C CD  . ARG D 2 115 ? 12.767  37.538 189.456 1.00 61.30  ? 153  ARG D CD  1 
ATOM   5890 N NE  . ARG D 2 115 ? 12.210  37.278 190.781 1.00 66.26  ? 153  ARG D NE  1 
ATOM   5891 C CZ  . ARG D 2 115 ? 12.067  38.203 191.725 1.00 79.73  ? 153  ARG D CZ  1 
ATOM   5892 N NH1 . ARG D 2 115 ? 12.441  39.454 191.493 1.00 63.06  ? 153  ARG D NH1 1 
ATOM   5893 N NH2 . ARG D 2 115 ? 11.551  37.877 192.902 1.00 67.80  ? 153  ARG D NH2 1 
ATOM   5894 N N   . PRO D 2 116 ? 11.058  34.027 187.356 1.00 54.94  ? 154  PRO D N   1 
ATOM   5895 C CA  . PRO D 2 116 ? 11.505  32.700 187.832 1.00 54.04  ? 154  PRO D CA  1 
ATOM   5896 C C   . PRO D 2 116 ? 11.806  31.599 186.792 1.00 59.00  ? 154  PRO D C   1 
ATOM   5897 O O   . PRO D 2 116 ? 12.419  30.581 187.145 1.00 57.97  ? 154  PRO D O   1 
ATOM   5898 C CB  . PRO D 2 116 ? 10.365  32.251 188.784 1.00 54.69  ? 154  PRO D CB  1 
ATOM   5899 C CG  . PRO D 2 116 ? 9.235   33.171 188.525 1.00 58.88  ? 154  PRO D CG  1 
ATOM   5900 C CD  . PRO D 2 116 ? 9.867   34.479 188.103 1.00 55.95  ? 154  PRO D CD  1 
ATOM   5901 N N   . PHE D 2 117 ? 11.341  31.766 185.546 1.00 55.70  ? 155  PHE D N   1 
ATOM   5902 C CA  . PHE D 2 117 ? 11.596  30.769 184.494 1.00 55.08  ? 155  PHE D CA  1 
ATOM   5903 C C   . PHE D 2 117 ? 13.003  30.866 183.886 1.00 61.37  ? 155  PHE D C   1 
ATOM   5904 O O   . PHE D 2 117 ? 13.456  29.949 183.195 1.00 61.45  ? 155  PHE D O   1 
ATOM   5905 C CB  . PHE D 2 117 ? 10.508  30.849 183.426 1.00 56.27  ? 155  PHE D CB  1 
ATOM   5906 C CG  . PHE D 2 117 ? 9.124   30.825 184.004 1.00 56.74  ? 155  PHE D CG  1 
ATOM   5907 C CD1 . PHE D 2 117 ? 8.401   32.001 184.168 1.00 58.86  ? 155  PHE D CD1 1 
ATOM   5908 C CD2 . PHE D 2 117 ? 8.592   29.636 184.516 1.00 57.30  ? 155  PHE D CD2 1 
ATOM   5909 C CE1 . PHE D 2 117 ? 7.114   31.988 184.764 1.00 58.75  ? 155  PHE D CE1 1 
ATOM   5910 C CE2 . PHE D 2 117 ? 7.326   29.615 185.130 1.00 58.77  ? 155  PHE D CE2 1 
ATOM   5911 C CZ  . PHE D 2 117 ? 6.582   30.797 185.249 1.00 56.23  ? 155  PHE D CZ  1 
ATOM   5912 N N   . GLY D 2 118 ? 13.695  31.963 184.188 1.00 59.75  ? 156  GLY D N   1 
ATOM   5913 C CA  . GLY D 2 118 ? 15.047  32.185 183.721 1.00 60.77  ? 156  GLY D CA  1 
ATOM   5914 C C   . GLY D 2 118 ? 15.425  33.640 183.545 1.00 65.48  ? 156  GLY D C   1 
ATOM   5915 O O   . GLY D 2 118 ? 14.560  34.527 183.547 1.00 65.78  ? 156  GLY D O   1 
ATOM   5916 N N   . SER D 2 119 ? 16.725  33.868 183.367 1.00 60.12  ? 157  SER D N   1 
ATOM   5917 C CA  . SER D 2 119 ? 17.244  35.209 183.223 1.00 58.56  ? 157  SER D CA  1 
ATOM   5918 C C   . SER D 2 119 ? 16.555  35.896 182.057 1.00 59.12  ? 157  SER D C   1 
ATOM   5919 O O   . SER D 2 119 ? 16.318  35.297 181.009 1.00 58.58  ? 157  SER D O   1 
ATOM   5920 C CB  . SER D 2 119 ? 18.763  35.182 183.055 1.00 62.72  ? 157  SER D CB  1 
ATOM   5921 O OG  . SER D 2 119 ? 19.396  34.651 184.205 1.00 68.07  ? 157  SER D OG  1 
ATOM   5922 N N   . LEU D 2 120 ? 16.221  37.158 182.274 1.00 53.45  ? 158  LEU D N   1 
ATOM   5923 C CA  . LEU D 2 120 ? 15.513  37.945 181.300 1.00 52.50  ? 158  LEU D CA  1 
ATOM   5924 C C   . LEU D 2 120 ? 16.452  38.892 180.585 1.00 59.10  ? 158  LEU D C   1 
ATOM   5925 O O   . LEU D 2 120 ? 17.476  39.282 181.125 1.00 61.01  ? 158  LEU D O   1 
ATOM   5926 C CB  . LEU D 2 120 ? 14.405  38.728 182.000 1.00 51.91  ? 158  LEU D CB  1 
ATOM   5927 C CG  . LEU D 2 120 ? 13.179  37.973 182.561 1.00 54.22  ? 158  LEU D CG  1 
ATOM   5928 C CD1 . LEU D 2 120 ? 12.627  38.687 183.806 1.00 52.78  ? 158  LEU D CD1 1 
ATOM   5929 C CD2 . LEU D 2 120 ? 12.096  37.875 181.472 1.00 52.60  ? 158  LEU D CD2 1 
ATOM   5930 N N   . GLU D 2 121 ? 16.090  39.239 179.355 1.00 54.71  ? 159  GLU D N   1 
ATOM   5931 C CA  . GLU D 2 121 ? 16.847  40.135 178.506 1.00 52.91  ? 159  GLU D CA  1 
ATOM   5932 C C   . GLU D 2 121 ? 16.104  41.453 178.498 1.00 58.91  ? 159  GLU D C   1 
ATOM   5933 O O   . GLU D 2 121 ? 16.710  42.507 178.515 1.00 60.96  ? 159  GLU D O   1 
ATOM   5934 C CB  . GLU D 2 121 ? 16.866  39.571 177.085 1.00 53.98  ? 159  GLU D CB  1 
ATOM   5935 C CG  . GLU D 2 121 ? 18.054  38.693 176.773 1.00 65.97  ? 159  GLU D CG  1 
ATOM   5936 C CD  . GLU D 2 121 ? 19.352  39.461 176.836 1.00 90.90  ? 159  GLU D CD  1 
ATOM   5937 O OE1 . GLU D 2 121 ? 20.313  38.968 177.469 1.00 68.10  ? 159  GLU D OE1 1 
ATOM   5938 O OE2 . GLU D 2 121 ? 19.387  40.586 176.285 1.00 83.63  ? 159  GLU D OE2 1 
ATOM   5939 N N   . ARG D 2 122 ? 14.780  41.378 178.403 1.00 55.15  ? 160  ARG D N   1 
ATOM   5940 C CA  . ARG D 2 122 ? 13.896  42.544 178.383 1.00 54.23  ? 160  ARG D CA  1 
ATOM   5941 C C   . ARG D 2 122 ? 12.625  42.085 179.084 1.00 58.18  ? 160  ARG D C   1 
ATOM   5942 O O   . ARG D 2 122 ? 12.291  40.898 179.060 1.00 56.79  ? 160  ARG D O   1 
ATOM   5943 C CB  . ARG D 2 122 ? 13.540  42.940 176.944 1.00 53.57  ? 160  ARG D CB  1 
ATOM   5944 C CG  . ARG D 2 122 ? 14.716  43.213 176.023 1.00 52.43  ? 160  ARG D CG  1 
ATOM   5945 C CD  . ARG D 2 122 ? 14.234  43.820 174.722 1.00 51.51  ? 160  ARG D CD  1 
ATOM   5946 N NE  . ARG D 2 122 ? 13.849  42.783 173.762 1.00 59.32  ? 160  ARG D NE  1 
ATOM   5947 C CZ  . ARG D 2 122 ? 13.100  42.992 172.680 1.00 70.73  ? 160  ARG D CZ  1 
ATOM   5948 N NH1 . ARG D 2 122 ? 12.646  44.211 172.407 1.00 50.67  ? 160  ARG D NH1 1 
ATOM   5949 N NH2 . ARG D 2 122 ? 12.805  41.977 171.873 1.00 60.65  ? 160  ARG D NH2 1 
ATOM   5950 N N   . CYS D 2 123 ? 11.922  43.022 179.709 1.00 55.62  ? 161  CYS D N   1 
ATOM   5951 C CA  . CYS D 2 123 ? 10.677  42.726 180.424 1.00 55.26  ? 161  CYS D CA  1 
ATOM   5952 C C   . CYS D 2 123 ? 9.890   44.005 180.645 1.00 58.67  ? 161  CYS D C   1 
ATOM   5953 O O   . CYS D 2 123 ? 10.264  44.840 181.462 1.00 59.74  ? 161  CYS D O   1 
ATOM   5954 C CB  . CYS D 2 123 ? 10.978  42.111 181.775 1.00 55.80  ? 161  CYS D CB  1 
ATOM   5955 S SG  . CYS D 2 123 ? 9.503   41.914 182.772 1.00 59.74  ? 161  CYS D SG  1 
ATOM   5956 N N   . PHE D 2 124 ? 8.795   44.163 179.923 1.00 52.60  ? 162  PHE D N   1 
ATOM   5957 C CA  . PHE D 2 124 ? 8.065   45.399 180.021 1.00 50.43  ? 162  PHE D CA  1 
ATOM   5958 C C   . PHE D 2 124 ? 6.575   45.252 179.786 1.00 52.05  ? 162  PHE D C   1 
ATOM   5959 O O   . PHE D 2 124 ? 6.152   44.575 178.862 1.00 51.11  ? 162  PHE D O   1 
ATOM   5960 C CB  . PHE D 2 124 ? 8.672   46.412 179.023 1.00 51.78  ? 162  PHE D CB  1 
ATOM   5961 C CG  . PHE D 2 124 ? 8.663   45.943 177.565 1.00 52.20  ? 162  PHE D CG  1 
ATOM   5962 C CD1 . PHE D 2 124 ? 7.647   46.353 176.690 1.00 52.78  ? 162  PHE D CD1 1 
ATOM   5963 C CD2 . PHE D 2 124 ? 9.674   45.116 177.067 1.00 51.88  ? 162  PHE D CD2 1 
ATOM   5964 C CE1 . PHE D 2 124 ? 7.614   45.915 175.383 1.00 52.12  ? 162  PHE D CE1 1 
ATOM   5965 C CE2 . PHE D 2 124 ? 9.651   44.692 175.757 1.00 53.03  ? 162  PHE D CE2 1 
ATOM   5966 C CZ  . PHE D 2 124 ? 8.625   45.095 174.914 1.00 51.09  ? 162  PHE D CZ  1 
ATOM   5967 N N   . LEU D 2 125 ? 5.799   45.936 180.618 1.00 49.58  ? 163  LEU D N   1 
ATOM   5968 C CA  . LEU D 2 125 ? 4.354   46.042 180.460 1.00 50.34  ? 163  LEU D CA  1 
ATOM   5969 C C   . LEU D 2 125 ? 4.182   47.101 179.342 1.00 57.69  ? 163  LEU D C   1 
ATOM   5970 O O   . LEU D 2 125 ? 5.119   47.841 179.032 1.00 57.45  ? 163  LEU D O   1 
ATOM   5971 C CB  . LEU D 2 125 ? 3.727   46.614 181.745 1.00 49.84  ? 163  LEU D CB  1 
ATOM   5972 C CG  . LEU D 2 125 ? 3.015   45.753 182.792 1.00 53.25  ? 163  LEU D CG  1 
ATOM   5973 C CD1 . LEU D 2 125 ? 2.760   44.311 182.377 1.00 52.74  ? 163  LEU D CD1 1 
ATOM   5974 C CD2 . LEU D 2 125 ? 3.712   45.834 184.136 1.00 53.80  ? 163  LEU D CD2 1 
ATOM   5975 N N   . VAL D 2 126 ? 2.992   47.183 178.752 1.00 54.60  ? 164  VAL D N   1 
ATOM   5976 C CA  . VAL D 2 126 ? 2.724   48.156 177.704 1.00 53.19  ? 164  VAL D CA  1 
ATOM   5977 C C   . VAL D 2 126 ? 1.601   49.022 178.247 1.00 59.50  ? 164  VAL D C   1 
ATOM   5978 O O   . VAL D 2 126 ? 0.524   48.521 178.586 1.00 57.95  ? 164  VAL D O   1 
ATOM   5979 C CB  . VAL D 2 126 ? 2.362   47.483 176.365 1.00 55.23  ? 164  VAL D CB  1 
ATOM   5980 C CG1 . VAL D 2 126 ? 1.733   48.496 175.403 1.00 54.45  ? 164  VAL D CG1 1 
ATOM   5981 C CG2 . VAL D 2 126 ? 3.600   46.788 175.756 1.00 54.39  ? 164  VAL D CG2 1 
ATOM   5982 N N   . TYR D 2 127 ? 1.885   50.311 178.415 1.00 58.55  ? 165  TYR D N   1 
ATOM   5983 C CA  . TYR D 2 127 ? 0.893   51.226 178.954 1.00 59.17  ? 165  TYR D CA  1 
ATOM   5984 C C   . TYR D 2 127 ? 0.312   52.123 177.880 1.00 69.13  ? 165  TYR D C   1 
ATOM   5985 O O   . TYR D 2 127 ? 0.905   52.253 176.807 1.00 70.01  ? 165  TYR D O   1 
ATOM   5986 C CB  . TYR D 2 127 ? 1.489   52.117 180.024 1.00 57.74  ? 165  TYR D CB  1 
ATOM   5987 C CG  . TYR D 2 127 ? 2.381   51.447 181.013 1.00 55.29  ? 165  TYR D CG  1 
ATOM   5988 C CD1 . TYR D 2 127 ? 3.727   51.323 180.759 1.00 56.32  ? 165  TYR D CD1 1 
ATOM   5989 C CD2 . TYR D 2 127 ? 1.937   51.182 182.293 1.00 55.23  ? 165  TYR D CD2 1 
ATOM   5990 C CE1 . TYR D 2 127 ? 4.592   50.845 181.711 1.00 55.14  ? 165  TYR D CE1 1 
ATOM   5991 C CE2 . TYR D 2 127 ? 2.793   50.683 183.245 1.00 55.33  ? 165  TYR D CE2 1 
ATOM   5992 C CZ  . TYR D 2 127 ? 4.131   50.527 182.947 1.00 57.79  ? 165  TYR D CZ  1 
ATOM   5993 O OH  . TYR D 2 127 ? 5.018   50.024 183.877 1.00 58.96  ? 165  TYR D OH  1 
ATOM   5994 N N   . SER D 2 128 ? -0.822  52.761 178.187 1.00 68.91  ? 166  SER D N   1 
ATOM   5995 C CA  . SER D 2 128 ? -1.446  53.710 177.258 1.00 70.50  ? 166  SER D CA  1 
ATOM   5996 C C   . SER D 2 128 ? -0.592  54.982 177.189 1.00 77.92  ? 166  SER D C   1 
ATOM   5997 O O   . SER D 2 128 ? -0.022  55.433 178.203 1.00 76.24  ? 166  SER D O   1 
ATOM   5998 C CB  . SER D 2 128 ? -2.871  54.064 177.695 1.00 73.31  ? 166  SER D CB  1 
ATOM   5999 O OG  . SER D 2 128 ? -3.122  55.449 177.528 1.00 76.28  ? 166  SER D OG  1 
ATOM   6000 N N   . GLU D 2 129 ? -0.474  55.548 175.993 1.00 77.95  ? 167  GLU D N   1 
ATOM   6001 C CA  . GLU D 2 129 ? 0.346   56.747 175.840 1.00 79.45  ? 167  GLU D CA  1 
ATOM   6002 C C   . GLU D 2 129 ? -0.212  57.929 176.649 1.00 85.23  ? 167  GLU D C   1 
ATOM   6003 O O   . GLU D 2 129 ? 0.512   58.556 177.429 1.00 84.39  ? 167  GLU D O   1 
ATOM   6004 C CB  . GLU D 2 129 ? 0.503   57.097 174.370 1.00 81.18  ? 167  GLU D CB  1 
ATOM   6005 C CG  . GLU D 2 129 ? 1.239   56.032 173.571 1.00 93.95  ? 167  GLU D CG  1 
ATOM   6006 C CD  . GLU D 2 129 ? 2.746   56.180 173.683 1.00 112.29 ? 167  GLU D CD  1 
ATOM   6007 O OE1 . GLU D 2 129 ? 3.194   56.991 174.523 1.00 99.16  ? 167  GLU D OE1 1 
ATOM   6008 O OE2 . GLU D 2 129 ? 3.479   55.494 172.934 1.00 105.21 ? 167  GLU D OE2 1 
ATOM   6009 N N   . ARG D 2 130 ? -1.516  58.179 176.503 1.00 82.41  ? 168  ARG D N   1 
ATOM   6010 C CA  . ARG D 2 130 ? -2.208  59.237 177.253 1.00 81.68  ? 168  ARG D CA  1 
ATOM   6011 C C   . ARG D 2 130 ? -2.312  58.904 178.753 1.00 81.86  ? 168  ARG D C   1 
ATOM   6012 O O   . ARG D 2 130 ? -1.590  59.460 179.571 1.00 81.08  ? 168  ARG D O   1 
ATOM   6013 C CB  . ARG D 2 130 ? -3.610  59.505 176.663 1.00 84.32  ? 168  ARG D CB  1 
ATOM   6014 C CG  . ARG D 2 130 ? -4.135  58.454 175.673 1.00 100.37 ? 168  ARG D CG  1 
ATOM   6015 C CD  . ARG D 2 130 ? -5.653  58.238 175.833 1.00 120.87 ? 168  ARG D CD  1 
ATOM   6016 N NE  . ARG D 2 130 ? -6.436  59.436 175.524 1.00 140.65 ? 168  ARG D NE  1 
ATOM   6017 C CZ  . ARG D 2 130 ? -7.634  59.429 174.935 1.00 162.05 ? 168  ARG D CZ  1 
ATOM   6018 N NH1 . ARG D 2 130 ? -8.207  58.283 174.589 1.00 151.95 ? 168  ARG D NH1 1 
ATOM   6019 N NH2 . ARG D 2 130 ? -8.267  60.572 174.691 1.00 148.68 ? 168  ARG D NH2 1 
ATOM   6020 N N   . THR D 2 131 ? -3.178  57.946 179.083 1.00 75.73  ? 169  THR D N   1 
ATOM   6021 C CA  . THR D 2 131 ? -3.425  57.501 180.454 1.00 73.43  ? 169  THR D CA  1 
ATOM   6022 C C   . THR D 2 131 ? -2.226  57.096 181.323 1.00 72.79  ? 169  THR D C   1 
ATOM   6023 O O   . THR D 2 131 ? -2.145  57.484 182.484 1.00 71.38  ? 169  THR D O   1 
ATOM   6024 C CB  . THR D 2 131 ? -4.540  56.438 180.492 1.00 83.16  ? 169  THR D CB  1 
ATOM   6025 O OG1 . THR D 2 131 ? -3.998  55.156 180.139 1.00 84.97  ? 169  THR D OG1 1 
ATOM   6026 C CG2 . THR D 2 131 ? -5.665  56.810 179.513 1.00 81.44  ? 169  THR D CG2 1 
ATOM   6027 N N   . GLY D 2 132 ? -1.325  56.277 180.795 1.00 68.00  ? 170  GLY D N   1 
ATOM   6028 C CA  . GLY D 2 132 ? -0.211  55.785 181.591 1.00 66.87  ? 170  GLY D CA  1 
ATOM   6029 C C   . GLY D 2 132 ? -0.555  54.477 182.315 1.00 69.83  ? 170  GLY D C   1 
ATOM   6030 O O   . GLY D 2 132 ? 0.229   53.969 183.126 1.00 69.79  ? 170  GLY D O   1 
ATOM   6031 N N   . GLN D 2 133 ? -1.732  53.923 182.009 1.00 64.57  ? 171  GLN D N   1 
ATOM   6032 C CA  . GLN D 2 133 ? -2.203  52.665 182.607 1.00 63.10  ? 171  GLN D CA  1 
ATOM   6033 C C   . GLN D 2 133 ? -1.876  51.417 181.768 1.00 64.78  ? 171  GLN D C   1 
ATOM   6034 O O   . GLN D 2 133 ? -2.108  51.386 180.549 1.00 64.28  ? 171  GLN D O   1 
ATOM   6035 C CB  . GLN D 2 133 ? -3.724  52.699 182.815 1.00 63.99  ? 171  GLN D CB  1 
ATOM   6036 C CG  . GLN D 2 133 ? -4.214  53.860 183.631 1.00 64.73  ? 171  GLN D CG  1 
ATOM   6037 C CD  . GLN D 2 133 ? -4.092  53.608 185.105 1.00 80.10  ? 171  GLN D CD  1 
ATOM   6038 O OE1 . GLN D 2 133 ? -3.821  54.521 185.867 1.00 76.91  ? 171  GLN D OE1 1 
ATOM   6039 N NE2 . GLN D 2 133 ? -4.273  52.357 185.517 1.00 75.26  ? 171  GLN D NE2 1 
ATOM   6040 N N   . SER D 2 134 ? -1.414  50.378 182.463 1.00 57.89  ? 172  SER D N   1 
ATOM   6041 C CA  . SER D 2 134 ? -1.106  49.086 181.890 1.00 54.73  ? 172  SER D CA  1 
ATOM   6042 C C   . SER D 2 134 ? -2.263  48.626 181.005 1.00 56.62  ? 172  SER D C   1 
ATOM   6043 O O   . SER D 2 134 ? -3.422  48.708 181.395 1.00 56.50  ? 172  SER D O   1 
ATOM   6044 C CB  . SER D 2 134 ? -0.848  48.100 183.041 1.00 55.44  ? 172  SER D CB  1 
ATOM   6045 O OG  . SER D 2 134 ? -0.923  46.740 182.653 1.00 59.72  ? 172  SER D OG  1 
ATOM   6046 N N   . LYS D 2 135 ? -1.929  48.197 179.790 1.00 52.62  ? 173  LYS D N   1 
ATOM   6047 C CA  . LYS D 2 135 ? -2.896  47.688 178.811 1.00 52.21  ? 173  LYS D CA  1 
ATOM   6048 C C   . LYS D 2 135 ? -3.294  46.227 179.118 1.00 56.45  ? 173  LYS D C   1 
ATOM   6049 O O   . LYS D 2 135 ? -4.055  45.603 178.352 1.00 57.64  ? 173  LYS D O   1 
ATOM   6050 C CB  . LYS D 2 135 ? -2.305  47.767 177.386 1.00 53.58  ? 173  LYS D CB  1 
ATOM   6051 C CG  . LYS D 2 135 ? -2.220  49.192 176.805 1.00 59.83  ? 173  LYS D CG  1 
ATOM   6052 C CD  . LYS D 2 135 ? -2.764  49.278 175.361 1.00 57.49  ? 173  LYS D CD  1 
ATOM   6053 C CE  . LYS D 2 135 ? -2.449  50.638 174.701 1.00 56.33  ? 173  LYS D CE  1 
ATOM   6054 N NZ  . LYS D 2 135 ? -2.729  50.648 173.224 1.00 64.34  ? 173  LYS D NZ  1 
ATOM   6055 N N   . GLY D 2 136 ? -2.752  45.684 180.210 1.00 49.87  ? 174  GLY D N   1 
ATOM   6056 C CA  . GLY D 2 136 ? -3.035  44.337 180.629 1.00 49.48  ? 174  GLY D CA  1 
ATOM   6057 C C   . GLY D 2 136 ? -2.213  43.279 179.935 1.00 54.42  ? 174  GLY D C   1 
ATOM   6058 O O   . GLY D 2 136 ? -2.557  42.091 179.904 1.00 55.26  ? 174  GLY D O   1 
ATOM   6059 N N   . TYR D 2 137 ? -1.108  43.697 179.364 1.00 50.63  ? 175  TYR D N   1 
ATOM   6060 C CA  . TYR D 2 137 ? -0.226  42.727 178.743 1.00 50.59  ? 175  TYR D CA  1 
ATOM   6061 C C   . TYR D 2 137 ? 1.165   43.302 178.733 1.00 53.40  ? 175  TYR D C   1 
ATOM   6062 O O   . TYR D 2 137 ? 1.358   44.497 178.967 1.00 51.98  ? 175  TYR D O   1 
ATOM   6063 C CB  . TYR D 2 137 ? -0.707  42.303 177.350 1.00 51.66  ? 175  TYR D CB  1 
ATOM   6064 C CG  . TYR D 2 137 ? -0.745  43.440 176.354 1.00 54.12  ? 175  TYR D CG  1 
ATOM   6065 C CD1 . TYR D 2 137 ? -1.946  44.052 175.996 1.00 54.63  ? 175  TYR D CD1 1 
ATOM   6066 C CD2 . TYR D 2 137 ? 0.435   43.931 175.793 1.00 55.90  ? 175  TYR D CD2 1 
ATOM   6067 C CE1 . TYR D 2 137 ? -1.966  45.099 175.101 1.00 54.42  ? 175  TYR D CE1 1 
ATOM   6068 C CE2 . TYR D 2 137 ? 0.414   44.984 174.876 1.00 56.80  ? 175  TYR D CE2 1 
ATOM   6069 C CZ  . TYR D 2 137 ? -0.779  45.560 174.534 1.00 63.45  ? 175  TYR D CZ  1 
ATOM   6070 O OH  . TYR D 2 137 ? -0.766  46.591 173.613 1.00 67.17  ? 175  TYR D OH  1 
ATOM   6071 N N   . GLY D 2 138 ? 2.132   42.415 178.572 1.00 49.55  ? 176  GLY D N   1 
ATOM   6072 C CA  . GLY D 2 138 ? 3.536   42.746 178.607 1.00 48.07  ? 176  GLY D CA  1 
ATOM   6073 C C   . GLY D 2 138 ? 4.307   41.679 177.878 1.00 51.84  ? 176  GLY D C   1 
ATOM   6074 O O   . GLY D 2 138 ? 3.754   40.666 177.414 1.00 51.64  ? 176  GLY D O   1 
ATOM   6075 N N   . PHE D 2 139 ? 5.597   41.931 177.745 1.00 48.54  ? 177  PHE D N   1 
ATOM   6076 C CA  . PHE D 2 139 ? 6.480   41.064 176.998 1.00 47.02  ? 177  PHE D CA  1 
ATOM   6077 C C   . PHE D 2 139 ? 7.614   40.626 177.864 1.00 52.02  ? 177  PHE D C   1 
ATOM   6078 O O   . PHE D 2 139 ? 8.099   41.377 178.703 1.00 53.61  ? 177  PHE D O   1 
ATOM   6079 C CB  . PHE D 2 139 ? 7.055   41.851 175.835 1.00 47.95  ? 177  PHE D CB  1 
ATOM   6080 C CG  . PHE D 2 139 ? 6.042   42.231 174.822 1.00 48.82  ? 177  PHE D CG  1 
ATOM   6081 C CD1 . PHE D 2 139 ? 5.875   41.464 173.699 1.00 52.40  ? 177  PHE D CD1 1 
ATOM   6082 C CD2 . PHE D 2 139 ? 5.206   43.303 175.030 1.00 52.12  ? 177  PHE D CD2 1 
ATOM   6083 C CE1 . PHE D 2 139 ? 4.911   41.774 172.757 1.00 54.12  ? 177  PHE D CE1 1 
ATOM   6084 C CE2 . PHE D 2 139 ? 4.234   43.641 174.091 1.00 56.04  ? 177  PHE D CE2 1 
ATOM   6085 C CZ  . PHE D 2 139 ? 4.086   42.868 172.945 1.00 53.98  ? 177  PHE D CZ  1 
ATOM   6086 N N   . ALA D 2 140 ? 8.089   39.422 177.621 1.00 47.95  ? 178  ALA D N   1 
ATOM   6087 C CA  . ALA D 2 140 ? 9.220   38.907 178.359 1.00 46.78  ? 178  ALA D CA  1 
ATOM   6088 C C   . ALA D 2 140 ? 10.104  38.157 177.391 1.00 51.72  ? 178  ALA D C   1 
ATOM   6089 O O   . ALA D 2 140 ? 9.636   37.283 176.681 1.00 49.98  ? 178  ALA D O   1 
ATOM   6090 C CB  . ALA D 2 140 ? 8.752   37.987 179.447 1.00 46.93  ? 178  ALA D CB  1 
ATOM   6091 N N   . GLU D 2 141 ? 11.377  38.539 177.344 1.00 51.24  ? 179  GLU D N   1 
ATOM   6092 C CA  . GLU D 2 141 ? 12.376  37.870 176.508 1.00 50.47  ? 179  GLU D CA  1 
ATOM   6093 C C   . GLU D 2 141 ? 13.448  37.346 177.425 1.00 54.83  ? 179  GLU D C   1 
ATOM   6094 O O   . GLU D 2 141 ? 14.008  38.099 178.214 1.00 53.59  ? 179  GLU D O   1 
ATOM   6095 C CB  . GLU D 2 141 ? 13.016  38.816 175.516 1.00 51.09  ? 179  GLU D CB  1 
ATOM   6096 C CG  . GLU D 2 141 ? 13.986  38.133 174.585 1.00 53.79  ? 179  GLU D CG  1 
ATOM   6097 C CD  . GLU D 2 141 ? 14.222  38.931 173.324 1.00 74.02  ? 179  GLU D CD  1 
ATOM   6098 O OE1 . GLU D 2 141 ? 14.451  38.314 172.265 1.00 95.22  ? 179  GLU D OE1 1 
ATOM   6099 O OE2 . GLU D 2 141 ? 14.141  40.175 173.379 1.00 56.67  ? 179  GLU D OE2 1 
ATOM   6100 N N   . TYR D 2 142 ? 13.688  36.038 177.345 1.00 52.03  ? 180  TYR D N   1 
ATOM   6101 C CA  . TYR D 2 142 ? 14.679  35.375 178.178 1.00 50.97  ? 180  TYR D CA  1 
ATOM   6102 C C   . TYR D 2 142 ? 16.021  35.321 177.459 1.00 60.67  ? 180  TYR D C   1 
ATOM   6103 O O   . TYR D 2 142 ? 16.115  35.737 176.284 1.00 59.71  ? 180  TYR D O   1 
ATOM   6104 C CB  . TYR D 2 142 ? 14.193  33.965 178.459 1.00 49.52  ? 180  TYR D CB  1 
ATOM   6105 C CG  . TYR D 2 142 ? 12.935  33.980 179.274 1.00 48.70  ? 180  TYR D CG  1 
ATOM   6106 C CD1 . TYR D 2 142 ? 11.696  34.214 178.675 1.00 49.61  ? 180  TYR D CD1 1 
ATOM   6107 C CD2 . TYR D 2 142 ? 12.991  33.908 180.663 1.00 48.82  ? 180  TYR D CD2 1 
ATOM   6108 C CE1 . TYR D 2 142 ? 10.534  34.292 179.440 1.00 45.52  ? 180  TYR D CE1 1 
ATOM   6109 C CE2 . TYR D 2 142 ? 11.856  33.991 181.424 1.00 49.22  ? 180  TYR D CE2 1 
ATOM   6110 C CZ  . TYR D 2 142 ? 10.629  34.170 180.811 1.00 52.56  ? 180  TYR D CZ  1 
ATOM   6111 O OH  . TYR D 2 142 ? 9.501   34.238 181.587 1.00 57.56  ? 180  TYR D OH  1 
ATOM   6112 N N   . MET D 2 143 ? 17.050  34.804 178.140 1.00 61.41  ? 181  MET D N   1 
ATOM   6113 C CA  . MET D 2 143 ? 18.350  34.646 177.500 1.00 63.69  ? 181  MET D CA  1 
ATOM   6114 C C   . MET D 2 143 ? 18.345  33.305 176.735 1.00 71.28  ? 181  MET D C   1 
ATOM   6115 O O   . MET D 2 143 ? 19.027  33.154 175.695 1.00 73.08  ? 181  MET D O   1 
ATOM   6116 C CB  . MET D 2 143 ? 19.505  34.739 178.501 1.00 66.70  ? 181  MET D CB  1 
ATOM   6117 C CG  . MET D 2 143 ? 19.248  35.722 179.665 1.00 72.05  ? 181  MET D CG  1 
ATOM   6118 S SD  . MET D 2 143 ? 20.348  37.208 179.894 1.00 77.22  ? 181  MET D SD  1 
ATOM   6119 C CE  . MET D 2 143 ? 20.849  36.998 181.604 1.00 73.55  ? 181  MET D CE  1 
ATOM   6120 N N   . LYS D 2 144 ? 17.487  32.387 177.194 1.00 67.19  ? 182  LYS D N   1 
ATOM   6121 C CA  . LYS D 2 144 ? 17.357  31.039 176.622 1.00 66.85  ? 182  LYS D CA  1 
ATOM   6122 C C   . LYS D 2 144 ? 15.924  30.753 176.166 1.00 71.97  ? 182  LYS D C   1 
ATOM   6123 O O   . LYS D 2 144 ? 14.988  31.086 176.882 1.00 71.66  ? 182  LYS D O   1 
ATOM   6124 C CB  . LYS D 2 144 ? 17.767  29.986 177.667 1.00 67.92  ? 182  LYS D CB  1 
ATOM   6125 C CG  . LYS D 2 144 ? 19.268  29.850 177.861 1.00 79.74  ? 182  LYS D CG  1 
ATOM   6126 C CD  . LYS D 2 144 ? 20.055  30.468 176.675 1.00 99.33  ? 182  LYS D CD  1 
ATOM   6127 C CE  . LYS D 2 144 ? 20.823  29.409 175.857 1.00 115.22 ? 182  LYS D CE  1 
ATOM   6128 N NZ  . LYS D 2 144 ? 22.131  29.887 175.292 1.00 119.17 ? 182  LYS D NZ  1 
ATOM   6129 N N   . LYS D 2 145 ? 15.770  30.108 175.000 1.00 68.93  ? 183  LYS D N   1 
ATOM   6130 C CA  . LYS D 2 145 ? 14.453  29.761 174.432 1.00 68.65  ? 183  LYS D CA  1 
ATOM   6131 C C   . LYS D 2 145 ? 13.811  28.734 175.348 1.00 73.54  ? 183  LYS D C   1 
ATOM   6132 O O   . LYS D 2 145 ? 12.576  28.627 175.447 1.00 73.26  ? 183  LYS D O   1 
ATOM   6133 C CB  . LYS D 2 145 ? 14.608  29.147 173.026 1.00 70.81  ? 183  LYS D CB  1 
ATOM   6134 C CG  . LYS D 2 145 ? 13.743  29.814 171.928 1.00 91.59  ? 183  LYS D CG  1 
ATOM   6135 C CD  . LYS D 2 145 ? 13.088  28.782 170.992 1.00 102.31 ? 183  LYS D CD  1 
ATOM   6136 C CE  . LYS D 2 145 ? 12.755  29.374 169.616 1.00 109.61 ? 183  LYS D CE  1 
ATOM   6137 N NZ  . LYS D 2 145 ? 11.542  30.249 169.615 1.00 116.38 ? 183  LYS D NZ  1 
ATOM   6138 N N   . ASP D 2 146 ? 14.693  27.993 176.014 1.00 69.19  ? 184  ASP D N   1 
ATOM   6139 C CA  . ASP D 2 146 ? 14.349  26.954 176.973 1.00 68.67  ? 184  ASP D CA  1 
ATOM   6140 C C   . ASP D 2 146 ? 13.415  27.502 178.027 1.00 68.85  ? 184  ASP D C   1 
ATOM   6141 O O   . ASP D 2 146 ? 12.497  26.818 178.463 1.00 70.06  ? 184  ASP D O   1 
ATOM   6142 C CB  . ASP D 2 146 ? 15.627  26.536 177.712 1.00 72.16  ? 184  ASP D CB  1 
ATOM   6143 C CG  . ASP D 2 146 ? 15.822  25.042 177.750 1.00 94.15  ? 184  ASP D CG  1 
ATOM   6144 O OD1 . ASP D 2 146 ? 15.829  24.470 178.871 1.00 97.00  ? 184  ASP D OD1 1 
ATOM   6145 O OD2 . ASP D 2 146 ? 16.020  24.454 176.660 1.00 100.77 ? 184  ASP D OD2 1 
ATOM   6146 N N   . SER D 2 147 ? 13.748  28.690 178.523 1.00 60.77  ? 185  SER D N   1 
ATOM   6147 C CA  . SER D 2 147 ? 13.014  29.333 179.596 1.00 58.31  ? 185  SER D CA  1 
ATOM   6148 C C   . SER D 2 147 ? 11.696  29.903 179.105 1.00 61.16  ? 185  SER D C   1 
ATOM   6149 O O   . SER D 2 147 ? 10.682  29.793 179.797 1.00 62.52  ? 185  SER D O   1 
ATOM   6150 C CB  . SER D 2 147 ? 13.878  30.425 180.228 1.00 60.91  ? 185  SER D CB  1 
ATOM   6151 O OG  . SER D 2 147 ? 14.999  29.850 180.896 1.00 65.99  ? 185  SER D OG  1 
ATOM   6152 N N   . ALA D 2 148 ? 11.712  30.519 177.924 1.00 54.73  ? 186  ALA D N   1 
ATOM   6153 C CA  . ALA D 2 148 ? 10.503  31.075 177.326 1.00 54.11  ? 186  ALA D CA  1 
ATOM   6154 C C   . ALA D 2 148 ? 9.484   29.953 177.227 1.00 61.12  ? 186  ALA D C   1 
ATOM   6155 O O   . ALA D 2 148 ? 8.271   30.171 177.327 1.00 61.11  ? 186  ALA D O   1 
ATOM   6156 C CB  . ALA D 2 148 ? 10.810  31.597 175.935 1.00 54.50  ? 186  ALA D CB  1 
ATOM   6157 N N   . ALA D 2 149 ? 10.011  28.752 176.976 1.00 58.69  ? 187  ALA D N   1 
ATOM   6158 C CA  . ALA D 2 149 ? 9.223   27.531 176.842 1.00 56.61  ? 187  ALA D CA  1 
ATOM   6159 C C   . ALA D 2 149 ? 8.589   27.191 178.189 1.00 58.40  ? 187  ALA D C   1 
ATOM   6160 O O   . ALA D 2 149 ? 7.367   27.049 178.290 1.00 60.55  ? 187  ALA D O   1 
ATOM   6161 C CB  . ALA D 2 149 ? 10.129  26.384 176.363 1.00 56.74  ? 187  ALA D CB  1 
ATOM   6162 N N   . ARG D 2 150 ? 9.422   27.067 179.219 1.00 51.76  ? 188  ARG D N   1 
ATOM   6163 C CA  . ARG D 2 150 ? 8.945   26.771 180.564 1.00 52.03  ? 188  ARG D CA  1 
ATOM   6164 C C   . ARG D 2 150 ? 7.807   27.733 180.959 1.00 58.83  ? 188  ARG D C   1 
ATOM   6165 O O   . ARG D 2 150 ? 6.712   27.291 181.355 1.00 59.81  ? 188  ARG D O   1 
ATOM   6166 C CB  . ARG D 2 150 ? 10.087  26.800 181.594 1.00 52.47  ? 188  ARG D CB  1 
ATOM   6167 C CG  . ARG D 2 150 ? 10.997  25.552 181.564 1.00 66.43  ? 188  ARG D CG  1 
ATOM   6168 C CD  . ARG D 2 150 ? 12.090  25.545 182.657 1.00 84.57  ? 188  ARG D CD  1 
ATOM   6169 N NE  . ARG D 2 150 ? 13.222  26.454 182.407 1.00 96.59  ? 188  ARG D NE  1 
ATOM   6170 C CZ  . ARG D 2 150 ? 14.237  26.202 181.580 1.00 110.58 ? 188  ARG D CZ  1 
ATOM   6171 N NH1 . ARG D 2 150 ? 14.268  25.073 180.879 1.00 98.15  ? 188  ARG D NH1 1 
ATOM   6172 N NH2 . ARG D 2 150 ? 15.220  27.088 181.446 1.00 96.48  ? 188  ARG D NH2 1 
ATOM   6173 N N   . ALA D 2 151 ? 8.052   29.033 180.796 1.00 54.19  ? 189  ALA D N   1 
ATOM   6174 C CA  . ALA D 2 151 ? 7.054   30.077 181.088 1.00 53.72  ? 189  ALA D CA  1 
ATOM   6175 C C   . ALA D 2 151 ? 5.696   29.960 180.335 1.00 52.53  ? 189  ALA D C   1 
ATOM   6176 O O   . ALA D 2 151 ? 4.624   29.996 180.955 1.00 49.58  ? 189  ALA D O   1 
ATOM   6177 C CB  . ALA D 2 151 ? 7.666   31.503 180.853 1.00 54.89  ? 189  ALA D CB  1 
ATOM   6178 N N   . LYS D 2 152 ? 5.738   29.903 179.006 1.00 47.89  ? 190  LYS D N   1 
ATOM   6179 C CA  . LYS D 2 152 ? 4.501   29.843 178.227 1.00 47.63  ? 190  LYS D CA  1 
ATOM   6180 C C   . LYS D 2 152 ? 3.660   28.664 178.676 1.00 55.65  ? 190  LYS D C   1 
ATOM   6181 O O   . LYS D 2 152 ? 2.421   28.677 178.620 1.00 55.89  ? 190  LYS D O   1 
ATOM   6182 C CB  . LYS D 2 152 ? 4.788   29.652 176.755 1.00 48.46  ? 190  LYS D CB  1 
ATOM   6183 C CG  . LYS D 2 152 ? 3.601   29.039 176.041 1.00 47.21  ? 190  LYS D CG  1 
ATOM   6184 C CD  . LYS D 2 152 ? 3.801   29.003 174.522 1.00 51.44  ? 190  LYS D CD  1 
ATOM   6185 C CE  . LYS D 2 152 ? 2.474   28.714 173.802 1.00 62.69  ? 190  LYS D CE  1 
ATOM   6186 N NZ  . LYS D 2 152 ? 2.376   27.298 173.321 1.00 75.88  ? 190  LYS D NZ  1 
ATOM   6187 N N   . SER D 2 153 ? 4.350   27.615 179.084 1.00 53.71  ? 191  SER D N   1 
ATOM   6188 C CA  . SER D 2 153 ? 3.670   26.430 179.532 1.00 54.08  ? 191  SER D CA  1 
ATOM   6189 C C   . SER D 2 153 ? 3.027   26.647 180.938 1.00 58.93  ? 191  SER D C   1 
ATOM   6190 O O   . SER D 2 153 ? 1.854   26.304 181.153 1.00 58.81  ? 191  SER D O   1 
ATOM   6191 C CB  . SER D 2 153 ? 4.668   25.257 179.522 1.00 57.46  ? 191  SER D CB  1 
ATOM   6192 O OG  . SER D 2 153 ? 4.675   24.550 180.767 1.00 67.59  ? 191  SER D OG  1 
ATOM   6193 N N   . ASP D 2 154 ? 3.811   27.169 181.890 1.00 54.06  ? 192  ASP D N   1 
ATOM   6194 C CA  . ASP D 2 154 ? 3.358   27.350 183.277 1.00 52.34  ? 192  ASP D CA  1 
ATOM   6195 C C   . ASP D 2 154 ? 2.387   28.504 183.393 1.00 54.95  ? 192  ASP D C   1 
ATOM   6196 O O   . ASP D 2 154 ? 1.620   28.579 184.359 1.00 54.66  ? 192  ASP D O   1 
ATOM   6197 C CB  . ASP D 2 154 ? 4.548   27.630 184.221 1.00 53.21  ? 192  ASP D CB  1 
ATOM   6198 C CG  . ASP D 2 154 ? 5.300   26.364 184.631 1.00 64.96  ? 192  ASP D CG  1 
ATOM   6199 O OD1 . ASP D 2 154 ? 5.682   26.263 185.843 1.00 64.17  ? 192  ASP D OD1 1 
ATOM   6200 O OD2 . ASP D 2 154 ? 5.521   25.476 183.750 1.00 75.72  ? 192  ASP D OD2 1 
ATOM   6201 N N   . LEU D 2 155 ? 2.483   29.441 182.448 1.00 49.85  ? 193  LEU D N   1 
ATOM   6202 C CA  . LEU D 2 155 ? 1.686   30.680 182.505 1.00 48.76  ? 193  LEU D CA  1 
ATOM   6203 C C   . LEU D 2 155 ? 0.390   30.702 181.685 1.00 51.12  ? 193  LEU D C   1 
ATOM   6204 O O   . LEU D 2 155 ? -0.570  31.370 182.064 1.00 49.14  ? 193  LEU D O   1 
ATOM   6205 C CB  . LEU D 2 155 ? 2.538   31.940 182.198 1.00 47.71  ? 193  LEU D CB  1 
ATOM   6206 C CG  . LEU D 2 155 ? 3.662   32.365 183.141 1.00 50.42  ? 193  LEU D CG  1 
ATOM   6207 C CD1 . LEU D 2 155 ? 4.470   33.568 182.602 1.00 49.89  ? 193  LEU D CD1 1 
ATOM   6208 C CD2 . LEU D 2 155 ? 3.120   32.673 184.497 1.00 51.66  ? 193  LEU D CD2 1 
ATOM   6209 N N   . LEU D 2 156 ? 0.387   30.040 180.531 1.00 49.07  ? 194  LEU D N   1 
ATOM   6210 C CA  . LEU D 2 156 ? -0.814  29.984 179.706 1.00 49.22  ? 194  LEU D CA  1 
ATOM   6211 C C   . LEU D 2 156 ? -1.889  29.302 180.586 1.00 55.37  ? 194  LEU D C   1 
ATOM   6212 O O   . LEU D 2 156 ? -1.647  28.206 181.142 1.00 56.32  ? 194  LEU D O   1 
ATOM   6213 C CB  . LEU D 2 156 ? -0.540  29.146 178.466 1.00 49.01  ? 194  LEU D CB  1 
ATOM   6214 C CG  . LEU D 2 156 ? -1.766  29.055 177.549 1.00 54.53  ? 194  LEU D CG  1 
ATOM   6215 C CD1 . LEU D 2 156 ? -2.043  30.347 176.738 1.00 54.39  ? 194  LEU D CD1 1 
ATOM   6216 C CD2 . LEU D 2 156 ? -1.682  27.864 176.630 1.00 55.96  ? 194  LEU D CD2 1 
ATOM   6217 N N   . GLY D 2 157 ? -3.027  29.975 180.782 1.00 49.42  ? 195  GLY D N   1 
ATOM   6218 C CA  . GLY D 2 157 ? -4.068  29.483 181.665 1.00 48.11  ? 195  GLY D CA  1 
ATOM   6219 C C   . GLY D 2 157 ? -3.902  29.845 183.150 1.00 53.25  ? 195  GLY D C   1 
ATOM   6220 O O   . GLY D 2 157 ? -4.886  29.838 183.901 1.00 55.20  ? 195  GLY D O   1 
ATOM   6221 N N   . LYS D 2 158 ? -2.690  30.134 183.617 1.00 48.42  ? 196  LYS D N   1 
ATOM   6222 C CA  . LYS D 2 158 ? -2.535  30.433 185.044 1.00 47.61  ? 196  LYS D CA  1 
ATOM   6223 C C   . LYS D 2 158 ? -3.567  31.458 185.547 1.00 55.17  ? 196  LYS D C   1 
ATOM   6224 O O   . LYS D 2 158 ? -3.927  32.422 184.865 1.00 55.58  ? 196  LYS D O   1 
ATOM   6225 C CB  . LYS D 2 158 ? -1.104  30.881 185.413 1.00 48.24  ? 196  LYS D CB  1 
ATOM   6226 C CG  . LYS D 2 158 ? -0.841  31.050 186.963 1.00 42.87  ? 196  LYS D CG  1 
ATOM   6227 C CD  . LYS D 2 158 ? 0.584   31.604 187.266 1.00 47.54  ? 196  LYS D CD  1 
ATOM   6228 C CE  . LYS D 2 158 ? 0.676   32.306 188.621 1.00 44.01  ? 196  LYS D CE  1 
ATOM   6229 N NZ  . LYS D 2 158 ? 0.161   31.355 189.660 1.00 52.06  ? 196  LYS D NZ  1 
ATOM   6230 N N   . PRO D 2 159 ? -4.090  31.233 186.748 1.00 52.84  ? 197  PRO D N   1 
ATOM   6231 C CA  . PRO D 2 159 ? -4.981  32.325 187.149 1.00 51.46  ? 197  PRO D CA  1 
ATOM   6232 C C   . PRO D 2 159 ? -4.119  33.321 187.889 1.00 58.03  ? 197  PRO D C   1 
ATOM   6233 O O   . PRO D 2 159 ? -3.253  32.932 188.685 1.00 60.51  ? 197  PRO D O   1 
ATOM   6234 C CB  . PRO D 2 159 ? -5.914  31.656 188.178 1.00 52.71  ? 197  PRO D CB  1 
ATOM   6235 C CG  . PRO D 2 159 ? -5.261  30.274 188.506 1.00 56.96  ? 197  PRO D CG  1 
ATOM   6236 C CD  . PRO D 2 159 ? -4.581  29.914 187.207 1.00 53.38  ? 197  PRO D CD  1 
ATOM   6237 N N   . LEU D 2 160 ? -4.340  34.598 187.620 1.00 54.87  ? 198  LEU D N   1 
ATOM   6238 C CA  . LEU D 2 160 ? -3.697  35.683 188.355 1.00 55.09  ? 198  LEU D CA  1 
ATOM   6239 C C   . LEU D 2 160 ? -4.967  36.444 188.653 1.00 59.79  ? 198  LEU D C   1 
ATOM   6240 O O   . LEU D 2 160 ? -5.723  36.751 187.725 1.00 60.29  ? 198  LEU D O   1 
ATOM   6241 C CB  . LEU D 2 160 ? -2.781  36.520 187.446 1.00 55.30  ? 198  LEU D CB  1 
ATOM   6242 C CG  . LEU D 2 160 ? -1.368  36.839 187.958 1.00 60.31  ? 198  LEU D CG  1 
ATOM   6243 C CD1 . LEU D 2 160 ? -0.859  38.168 187.373 1.00 60.24  ? 198  LEU D CD1 1 
ATOM   6244 C CD2 . LEU D 2 160 ? -1.273  36.803 189.517 1.00 60.46  ? 198  LEU D CD2 1 
ATOM   6245 N N   . GLY D 2 161 ? -5.291  36.610 189.929 1.00 56.10  ? 199  GLY D N   1 
ATOM   6246 C CA  . GLY D 2 161 ? -6.549  37.234 190.309 1.00 55.61  ? 199  GLY D CA  1 
ATOM   6247 C C   . GLY D 2 161 ? -7.777  36.597 189.644 1.00 61.67  ? 199  GLY D C   1 
ATOM   6248 O O   . GLY D 2 161 ? -7.900  35.358 189.489 1.00 60.86  ? 199  GLY D O   1 
ATOM   6249 N N   . PRO D 2 162 ? -8.721  37.452 189.201 1.00 59.06  ? 200  PRO D N   1 
ATOM   6250 C CA  . PRO D 2 162 ? -9.971  37.036 188.527 1.00 57.18  ? 200  PRO D CA  1 
ATOM   6251 C C   . PRO D 2 162 ? -9.734  36.793 187.038 1.00 61.16  ? 200  PRO D C   1 
ATOM   6252 O O   . PRO D 2 162 ? -10.675 36.613 186.243 1.00 60.21  ? 200  PRO D O   1 
ATOM   6253 C CB  . PRO D 2 162 ? -10.898 38.241 188.722 1.00 58.04  ? 200  PRO D CB  1 
ATOM   6254 C CG  . PRO D 2 162 ? -9.968  39.434 189.039 1.00 63.98  ? 200  PRO D CG  1 
ATOM   6255 C CD  . PRO D 2 162 ? -8.555  38.925 189.234 1.00 60.58  ? 200  PRO D CD  1 
ATOM   6256 N N   . ARG D 2 163 ? -8.457  36.792 186.661 1.00 56.90  ? 201  ARG D N   1 
ATOM   6257 C CA  . ARG D 2 163 ? -8.066  36.611 185.264 1.00 54.93  ? 201  ARG D CA  1 
ATOM   6258 C C   . ARG D 2 163 ? -7.401  35.269 185.017 1.00 55.12  ? 201  ARG D C   1 
ATOM   6259 O O   . ARG D 2 163 ? -6.742  34.708 185.903 1.00 56.71  ? 201  ARG D O   1 
ATOM   6260 C CB  . ARG D 2 163 ? -7.043  37.695 184.889 1.00 51.84  ? 201  ARG D CB  1 
ATOM   6261 C CG  . ARG D 2 163 ? -7.499  39.073 185.192 1.00 55.41  ? 201  ARG D CG  1 
ATOM   6262 C CD  . ARG D 2 163 ? -8.378  39.481 184.083 1.00 57.06  ? 201  ARG D CD  1 
ATOM   6263 N NE  . ARG D 2 163 ? -8.851  40.865 184.185 1.00 61.63  ? 201  ARG D NE  1 
ATOM   6264 C CZ  . ARG D 2 163 ? -9.045  41.671 183.130 1.00 70.49  ? 201  ARG D CZ  1 
ATOM   6265 N NH1 . ARG D 2 163 ? -8.745  41.268 181.898 1.00 50.85  ? 201  ARG D NH1 1 
ATOM   6266 N NH2 . ARG D 2 163 ? -9.541  42.891 183.293 1.00 62.67  ? 201  ARG D NH2 1 
ATOM   6267 N N   . THR D 2 164 ? -7.495  34.806 183.780 1.00 47.18  ? 202  THR D N   1 
ATOM   6268 C CA  . THR D 2 164 ? -6.714  33.657 183.351 1.00 46.62  ? 202  THR D CA  1 
ATOM   6269 C C   . THR D 2 164 ? -5.708  34.091 182.255 1.00 50.92  ? 202  THR D C   1 
ATOM   6270 O O   . THR D 2 164 ? -6.079  34.659 181.192 1.00 48.99  ? 202  THR D O   1 
ATOM   6271 C CB  . THR D 2 164 ? -7.535  32.399 182.994 1.00 52.63  ? 202  THR D CB  1 
ATOM   6272 O OG1 . THR D 2 164 ? -7.931  31.735 184.211 1.00 60.96  ? 202  THR D OG1 1 
ATOM   6273 C CG2 . THR D 2 164 ? -6.645  31.427 182.219 1.00 46.52  ? 202  THR D CG2 1 
ATOM   6274 N N   . LEU D 2 165 ? -4.425  33.888 182.554 1.00 47.30  ? 203  LEU D N   1 
ATOM   6275 C CA  . LEU D 2 165 ? -3.378  34.316 181.642 1.00 46.51  ? 203  LEU D CA  1 
ATOM   6276 C C   . LEU D 2 165 ? -3.380  33.715 180.229 1.00 50.25  ? 203  LEU D C   1 
ATOM   6277 O O   . LEU D 2 165 ? -3.759  32.570 180.010 1.00 49.82  ? 203  LEU D O   1 
ATOM   6278 C CB  . LEU D 2 165 ? -2.016  34.257 182.317 1.00 45.67  ? 203  LEU D CB  1 
ATOM   6279 C CG  . LEU D 2 165 ? -2.084  35.057 183.607 1.00 49.91  ? 203  LEU D CG  1 
ATOM   6280 C CD1 . LEU D 2 165 ? -0.676  35.223 184.203 1.00 50.16  ? 203  LEU D CD1 1 
ATOM   6281 C CD2 . LEU D 2 165 ? -2.754  36.426 183.313 1.00 51.47  ? 203  LEU D CD2 1 
ATOM   6282 N N   . TYR D 2 166 ? -3.006  34.539 179.263 1.00 47.84  ? 204  TYR D N   1 
ATOM   6283 C CA  . TYR D 2 166 ? -2.864  34.078 177.897 1.00 48.93  ? 204  TYR D CA  1 
ATOM   6284 C C   . TYR D 2 166 ? -1.437  34.350 177.401 1.00 56.64  ? 204  TYR D C   1 
ATOM   6285 O O   . TYR D 2 166 ? -1.065  35.499 177.186 1.00 57.54  ? 204  TYR D O   1 
ATOM   6286 C CB  . TYR D 2 166 ? -3.821  34.765 176.935 1.00 50.29  ? 204  TYR D CB  1 
ATOM   6287 C CG  . TYR D 2 166 ? -3.503  34.309 175.535 1.00 54.18  ? 204  TYR D CG  1 
ATOM   6288 C CD1 . TYR D 2 166 ? -3.565  32.946 175.214 1.00 57.29  ? 204  TYR D CD1 1 
ATOM   6289 C CD2 . TYR D 2 166 ? -2.914  35.161 174.610 1.00 54.50  ? 204  TYR D CD2 1 
ATOM   6290 C CE1 . TYR D 2 166 ? -3.208  32.472 173.949 1.00 57.46  ? 204  TYR D CE1 1 
ATOM   6291 C CE2 . TYR D 2 166 ? -2.506  34.674 173.345 1.00 55.03  ? 204  TYR D CE2 1 
ATOM   6292 C CZ  . TYR D 2 166 ? -2.667  33.330 173.035 1.00 60.45  ? 204  TYR D CZ  1 
ATOM   6293 O OH  . TYR D 2 166 ? -2.276  32.827 171.828 1.00 62.68  ? 204  TYR D OH  1 
ATOM   6294 N N   . VAL D 2 167 ? -0.654  33.302 177.171 1.00 54.01  ? 205  VAL D N   1 
ATOM   6295 C CA  . VAL D 2 167 ? 0.701   33.481 176.685 1.00 53.30  ? 205  VAL D CA  1 
ATOM   6296 C C   . VAL D 2 167 ? 0.790   33.218 175.224 1.00 62.52  ? 205  VAL D C   1 
ATOM   6297 O O   . VAL D 2 167 ? 0.190   32.279 174.725 1.00 63.44  ? 205  VAL D O   1 
ATOM   6298 C CB  . VAL D 2 167 ? 1.663   32.570 177.362 1.00 55.16  ? 205  VAL D CB  1 
ATOM   6299 C CG1 . VAL D 2 167 ? 3.081   33.073 177.093 1.00 54.39  ? 205  VAL D CG1 1 
ATOM   6300 C CG2 . VAL D 2 167 ? 1.321   32.438 178.857 1.00 54.35  ? 205  VAL D CG2 1 
ATOM   6301 N N   . HIS D 2 168 ? 1.628   33.982 174.545 1.00 62.38  ? 206  HIS D N   1 
ATOM   6302 C CA  . HIS D 2 168 ? 1.831   33.744 173.126 1.00 63.04  ? 206  HIS D CA  1 
ATOM   6303 C C   . HIS D 2 168 ? 3.195   34.154 172.573 1.00 72.73  ? 206  HIS D C   1 
ATOM   6304 O O   . HIS D 2 168 ? 3.803   35.126 173.015 1.00 72.28  ? 206  HIS D O   1 
ATOM   6305 C CB  . HIS D 2 168 ? 0.634   34.215 172.311 1.00 63.29  ? 206  HIS D CB  1 
ATOM   6306 C CG  . HIS D 2 168 ? 0.916   35.365 171.409 1.00 66.52  ? 206  HIS D CG  1 
ATOM   6307 N ND1 . HIS D 2 168 ? 0.635   35.322 170.068 1.00 69.04  ? 206  HIS D ND1 1 
ATOM   6308 C CD2 . HIS D 2 168 ? 1.354   36.619 171.660 1.00 68.64  ? 206  HIS D CD2 1 
ATOM   6309 C CE1 . HIS D 2 168 ? 0.954   36.479 169.516 1.00 68.90  ? 206  HIS D CE1 1 
ATOM   6310 N NE2 . HIS D 2 168 ? 1.383   37.290 170.464 1.00 68.72  ? 206  HIS D NE2 1 
ATOM   6311 N N   . TRP D 2 169 ? 3.725   33.322 171.683 1.00 74.59  ? 207  TRP D N   1 
ATOM   6312 C CA  . TRP D 2 169 ? 5.022   33.565 171.065 1.00 75.34  ? 207  TRP D CA  1 
ATOM   6313 C C   . TRP D 2 169 ? 4.973   34.697 170.067 1.00 83.42  ? 207  TRP D C   1 
ATOM   6314 O O   . TRP D 2 169 ? 4.058   34.787 169.237 1.00 80.46  ? 207  TRP D O   1 
ATOM   6315 C CB  . TRP D 2 169 ? 5.483   32.340 170.281 1.00 73.65  ? 207  TRP D CB  1 
ATOM   6316 C CG  . TRP D 2 169 ? 6.057   31.258 171.080 1.00 75.02  ? 207  TRP D CG  1 
ATOM   6317 C CD1 . TRP D 2 169 ? 5.480   30.051 171.354 1.00 77.83  ? 207  TRP D CD1 1 
ATOM   6318 C CD2 . TRP D 2 169 ? 7.387   31.200 171.608 1.00 74.60  ? 207  TRP D CD2 1 
ATOM   6319 N NE1 . TRP D 2 169 ? 6.348   29.268 172.095 1.00 77.76  ? 207  TRP D NE1 1 
ATOM   6320 C CE2 . TRP D 2 169 ? 7.525   29.952 172.264 1.00 79.02  ? 207  TRP D CE2 1 
ATOM   6321 C CE3 . TRP D 2 169 ? 8.462   32.093 171.629 1.00 75.74  ? 207  TRP D CE3 1 
ATOM   6322 C CZ2 . TRP D 2 169 ? 8.698   29.581 172.925 1.00 77.94  ? 207  TRP D CZ2 1 
ATOM   6323 C CZ3 . TRP D 2 169 ? 9.612   31.724 172.282 1.00 76.98  ? 207  TRP D CZ3 1 
ATOM   6324 C CH2 . TRP D 2 169 ? 9.730   30.475 172.910 1.00 77.71  ? 207  TRP D CH2 1 
ATOM   6325 N N   . THR D 2 170 ? 5.967   35.577 170.140 1.00 87.24  ? 208  THR D N   1 
ATOM   6326 C CA  . THR D 2 170 ? 6.100   36.663 169.176 1.00 89.69  ? 208  THR D CA  1 
ATOM   6327 C C   . THR D 2 170 ? 7.399   36.541 168.385 1.00 102.50 ? 208  THR D C   1 
ATOM   6328 O O   . THR D 2 170 ? 8.473   36.368 168.960 1.00 102.65 ? 208  THR D O   1 
ATOM   6329 C CB  . THR D 2 170 ? 6.057   38.038 169.867 1.00 90.80  ? 208  THR D CB  1 
ATOM   6330 O OG1 . THR D 2 170 ? 5.054   38.032 170.890 1.00 88.24  ? 208  THR D OG1 1 
ATOM   6331 C CG2 . THR D 2 170 ? 5.739   39.131 168.857 1.00 88.27  ? 208  THR D CG2 1 
ATOM   6332 N N   . ASP D 2 171 ? 7.291   36.634 167.064 1.00 105.06 ? 209  ASP D N   1 
ATOM   6333 C CA  . ASP D 2 171 ? 8.105   35.818 166.170 1.00 107.01 ? 209  ASP D CA  1 
ATOM   6334 C C   . ASP D 2 171 ? 9.588   36.132 166.334 1.00 115.28 ? 209  ASP D C   1 
ATOM   6335 O O   . ASP D 2 171 ? 10.428  35.232 166.326 1.00 115.58 ? 209  ASP D O   1 
ATOM   6336 C CB  . ASP D 2 171 ? 7.680   36.031 164.716 1.00 108.62 ? 209  ASP D CB  1 
ATOM   6337 C CG  . ASP D 2 171 ? 6.987   34.817 164.128 1.00 113.19 ? 209  ASP D CG  1 
ATOM   6338 O OD1 . ASP D 2 171 ? 6.149   34.992 163.219 1.00 111.31 ? 209  ASP D OD1 1 
ATOM   6339 O OD2 . ASP D 2 171 ? 7.280   33.688 164.576 1.00 118.92 ? 209  ASP D OD2 1 
ATOM   6340 N N   . ALA D 2 172 ? 9.904   37.414 166.483 1.00 113.57 ? 210  ALA D N   1 
ATOM   6341 C CA  . ALA D 2 172 ? 10.591  38.161 165.436 1.00 113.89 ? 210  ALA D CA  1 
ATOM   6342 C C   . ALA D 2 172 ? 9.798   38.142 164.133 1.00 119.46 ? 210  ALA D C   1 
ATOM   6343 O O   . ALA D 2 172 ? 10.371  38.054 163.047 1.00 119.09 ? 210  ALA D O   1 
ATOM   6344 C CB  . ALA D 2 172 ? 11.989  37.601 165.217 1.00 114.43 ? 210  ALA D CB  1 
ATOM   6345 N N   . GLY D 2 173 ? 8.477   38.226 164.249 1.00 116.82 ? 211  GLY D N   1 
ATOM   6346 C CA  . GLY D 2 173 ? 7.837   38.459 165.531 1.00 116.61 ? 211  GLY D CA  1 
ATOM   6347 C C   . GLY D 2 173 ? 8.306   39.743 166.188 1.00 119.47 ? 211  GLY D C   1 
ATOM   6348 O O   . GLY D 2 173 ? 8.475   39.802 167.406 1.00 118.67 ? 211  GLY D O   1 
ATOM   6349 N N   . GLN D 2 174 ? 8.517   40.774 165.377 1.00 114.74 ? 212  GLN D N   1 
ATOM   6350 C CA  . GLN D 2 174 ? 9.309   41.926 165.792 1.00 113.70 ? 212  GLN D CA  1 
ATOM   6351 C C   . GLN D 2 174 ? 8.469   43.198 165.804 1.00 114.60 ? 212  GLN D C   1 
ATOM   6352 O O   . GLN D 2 174 ? 7.776   43.505 164.835 1.00 115.06 ? 212  GLN D O   1 
ATOM   6353 C CB  . GLN D 2 174 ? 10.519  42.103 164.872 1.00 115.21 ? 212  GLN D CB  1 
ATOM   6354 C CG  . GLN D 2 174 ? 10.380  41.415 163.524 1.00 141.00 ? 212  GLN D CG  1 
ATOM   6355 C CD  . GLN D 2 174 ? 9.635   42.262 162.512 1.00 174.28 ? 212  GLN D CD  1 
ATOM   6356 O OE1 . GLN D 2 174 ? 8.771   41.768 161.786 1.00 170.98 ? 212  GLN D OE1 1 
ATOM   6357 N NE2 . GLN D 2 174 ? 9.966   43.547 162.457 1.00 172.41 ? 212  GLN D NE2 1 
ATOM   6358 N N   . LEU D 2 175 ? 8.535   43.935 166.909 1.00 107.10 ? 213  LEU D N   1 
ATOM   6359 C CA  . LEU D 2 175 ? 7.579   45.001 167.178 1.00 105.01 ? 213  LEU D CA  1 
ATOM   6360 C C   . LEU D 2 175 ? 8.273   46.357 167.258 1.00 105.32 ? 213  LEU D C   1 
ATOM   6361 O O   . LEU D 2 175 ? 9.272   46.512 167.960 1.00 105.05 ? 213  LEU D O   1 
ATOM   6362 C CB  . LEU D 2 175 ? 6.816   44.723 168.475 1.00 104.75 ? 213  LEU D CB  1 
ATOM   6363 C CG  . LEU D 2 175 ? 7.269   43.502 169.278 1.00 108.31 ? 213  LEU D CG  1 
ATOM   6364 C CD1 . LEU D 2 175 ? 6.432   43.347 170.538 1.00 107.95 ? 213  LEU D CD1 1 
ATOM   6365 C CD2 . LEU D 2 175 ? 7.202   42.243 168.427 1.00 110.28 ? 213  LEU D CD2 1 
ATOM   6366 N N   . THR D 2 176 ? 7.736   47.335 166.536 1.00 99.30  ? 214  THR D N   1 
ATOM   6367 C CA  . THR D 2 176 ? 8.228   48.705 166.617 1.00 97.87  ? 214  THR D CA  1 
ATOM   6368 C C   . THR D 2 176 ? 7.434   49.308 167.774 1.00 99.22  ? 214  THR D C   1 
ATOM   6369 O O   . THR D 2 176 ? 6.578   48.631 168.336 1.00 99.38  ? 214  THR D O   1 
ATOM   6370 C CB  . THR D 2 176 ? 7.988   49.445 165.290 1.00 102.76 ? 214  THR D CB  1 
ATOM   6371 O OG1 . THR D 2 176 ? 6.592   49.727 165.140 1.00 100.47 ? 214  THR D OG1 1 
ATOM   6372 C CG2 . THR D 2 176 ? 8.437   48.567 164.135 1.00 101.46 ? 214  THR D CG2 1 
ATOM   6373 N N   . PRO D 2 177 ? 7.727   50.556 168.178 1.00 92.81  ? 215  PRO D N   1 
ATOM   6374 C CA  . PRO D 2 177 ? 6.867   50.950 169.300 1.00 91.99  ? 215  PRO D CA  1 
ATOM   6375 C C   . PRO D 2 177 ? 5.393   51.005 168.891 1.00 95.39  ? 215  PRO D C   1 
ATOM   6376 O O   . PRO D 2 177 ? 4.494   50.848 169.720 1.00 94.69  ? 215  PRO D O   1 
ATOM   6377 C CB  . PRO D 2 177 ? 7.400   52.329 169.665 1.00 93.43  ? 215  PRO D CB  1 
ATOM   6378 C CG  . PRO D 2 177 ? 8.851   52.219 169.373 1.00 97.69  ? 215  PRO D CG  1 
ATOM   6379 C CD  . PRO D 2 177 ? 8.977   51.332 168.160 1.00 93.39  ? 215  PRO D CD  1 
ATOM   6380 N N   . ALA D 2 178 ? 5.169   51.122 167.585 1.00 91.55  ? 216  ALA D N   1 
ATOM   6381 C CA  . ALA D 2 178 ? 3.822   51.165 167.007 1.00 91.07  ? 216  ALA D CA  1 
ATOM   6382 C C   . ALA D 2 178 ? 3.072   49.834 167.162 1.00 91.39  ? 216  ALA D C   1 
ATOM   6383 O O   . ALA D 2 178 ? 1.858   49.819 167.423 1.00 90.48  ? 216  ALA D O   1 
ATOM   6384 C CB  . ALA D 2 178 ? 3.898   51.557 165.516 1.00 91.88  ? 216  ALA D CB  1 
ATOM   6385 N N   . LEU D 2 179 ? 3.801   48.733 166.961 1.00 84.18  ? 217  LEU D N   1 
ATOM   6386 C CA  . LEU D 2 179 ? 3.237   47.389 167.052 1.00 82.62  ? 217  LEU D CA  1 
ATOM   6387 C C   . LEU D 2 179 ? 3.067   46.874 168.482 1.00 81.60  ? 217  LEU D C   1 
ATOM   6388 O O   . LEU D 2 179 ? 2.379   45.880 168.711 1.00 81.45  ? 217  LEU D O   1 
ATOM   6389 C CB  . LEU D 2 179 ? 4.058   46.397 166.228 1.00 82.95  ? 217  LEU D CB  1 
ATOM   6390 C CG  . LEU D 2 179 ? 4.042   46.631 164.715 1.00 87.84  ? 217  LEU D CG  1 
ATOM   6391 C CD1 . LEU D 2 179 ? 2.933   47.609 164.356 1.00 87.33  ? 217  LEU D CD1 1 
ATOM   6392 C CD2 . LEU D 2 179 ? 5.413   47.145 164.228 1.00 90.76  ? 217  LEU D CD2 1 
ATOM   6393 N N   . LEU D 2 180 ? 3.686   47.551 169.442 1.00 73.05  ? 218  LEU D N   1 
ATOM   6394 C CA  . LEU D 2 180 ? 3.557   47.161 170.840 1.00 69.52  ? 218  LEU D CA  1 
ATOM   6395 C C   . LEU D 2 180 ? 2.113   47.410 171.282 1.00 72.03  ? 218  LEU D C   1 
ATOM   6396 O O   . LEU D 2 180 ? 1.573   46.725 172.144 1.00 72.58  ? 218  LEU D O   1 
ATOM   6397 C CB  . LEU D 2 180 ? 4.513   47.978 171.697 1.00 68.37  ? 218  LEU D CB  1 
ATOM   6398 C CG  . LEU D 2 180 ? 5.993   47.587 171.629 1.00 71.44  ? 218  LEU D CG  1 
ATOM   6399 C CD1 . LEU D 2 180 ? 6.740   47.996 172.876 1.00 70.70  ? 218  LEU D CD1 1 
ATOM   6400 C CD2 . LEU D 2 180 ? 6.172   46.111 171.366 1.00 71.29  ? 218  LEU D CD2 1 
ATOM   6401 N N   . HIS D 2 181 ? 1.469   48.375 170.643 1.00 66.55  ? 219  HIS D N   1 
ATOM   6402 C CA  . HIS D 2 181 ? 0.091   48.708 170.963 1.00 63.63  ? 219  HIS D CA  1 
ATOM   6403 C C   . HIS D 2 181 ? -0.883  47.897 170.161 1.00 67.73  ? 219  HIS D C   1 
ATOM   6404 O O   . HIS D 2 181 ? -0.931  47.998 168.933 1.00 67.83  ? 219  HIS D O   1 
ATOM   6405 C CB  . HIS D 2 181 ? -0.149  50.198 170.815 1.00 62.44  ? 219  HIS D CB  1 
ATOM   6406 C CG  . HIS D 2 181 ? 0.671   51.009 171.763 1.00 64.98  ? 219  HIS D CG  1 
ATOM   6407 N ND1 . HIS D 2 181 ? 0.164   51.512 172.943 1.00 66.83  ? 219  HIS D ND1 1 
ATOM   6408 C CD2 . HIS D 2 181 ? 1.989   51.325 171.754 1.00 66.60  ? 219  HIS D CD2 1 
ATOM   6409 C CE1 . HIS D 2 181 ? 1.125   52.149 173.598 1.00 66.20  ? 219  HIS D CE1 1 
ATOM   6410 N NE2 . HIS D 2 181 ? 2.246   52.036 172.905 1.00 66.43  ? 219  HIS D NE2 1 
ATOM   6411 N N   . SER D 2 182 ? -1.614  47.048 170.878 1.00 65.22  ? 220  SER D N   1 
ATOM   6412 C CA  . SER D 2 182 ? -2.598  46.161 170.278 1.00 65.89  ? 220  SER D CA  1 
ATOM   6413 C C   . SER D 2 182 ? -3.751  46.894 169.627 1.00 74.11  ? 220  SER D C   1 
ATOM   6414 O O   . SER D 2 182 ? -4.061  48.054 169.980 1.00 74.31  ? 220  SER D O   1 
ATOM   6415 C CB  . SER D 2 182 ? -3.132  45.151 171.291 1.00 67.77  ? 220  SER D CB  1 
ATOM   6416 O OG  . SER D 2 182 ? -3.850  44.117 170.627 1.00 72.41  ? 220  SER D OG  1 
ATOM   6417 N N   . ARG D 2 183 ? -4.374  46.190 168.677 1.00 73.22  ? 221  ARG D N   1 
ATOM   6418 C CA  . ARG D 2 183 ? -5.513  46.688 167.891 1.00 74.24  ? 221  ARG D CA  1 
ATOM   6419 C C   . ARG D 2 183 ? -6.744  45.826 168.200 1.00 76.37  ? 221  ARG D C   1 
ATOM   6420 O O   . ARG D 2 183 ? -7.867  46.196 167.868 1.00 75.83  ? 221  ARG D O   1 
ATOM   6421 C CB  . ARG D 2 183 ? -5.197  46.624 166.366 1.00 77.67  ? 221  ARG D CB  1 
ATOM   6422 C CG  . ARG D 2 183 ? -4.313  47.769 165.794 1.00 91.34  ? 221  ARG D CG  1 
ATOM   6423 C CD  . ARG D 2 183 ? -3.001  47.234 165.204 1.00 110.66 ? 221  ARG D CD  1 
ATOM   6424 N NE  . ARG D 2 183 ? -2.683  45.891 165.698 1.00 126.88 ? 221  ARG D NE  1 
ATOM   6425 C CZ  . ARG D 2 183 ? -1.464  45.468 166.035 1.00 138.65 ? 221  ARG D CZ  1 
ATOM   6426 N NH1 . ARG D 2 183 ? -0.411  46.274 165.930 1.00 117.08 ? 221  ARG D NH1 1 
ATOM   6427 N NH2 . ARG D 2 183 ? -1.300  44.230 166.484 1.00 125.81 ? 221  ARG D NH2 1 
ATOM   6428 N N   . CYS D 2 184 ? -6.512  44.679 168.842 1.00 72.36  ? 222  CYS D N   1 
ATOM   6429 C CA  . CYS D 2 184 ? -7.579  43.721 169.187 1.00 71.42  ? 222  CYS D CA  1 
ATOM   6430 C C   . CYS D 2 184 ? -8.017  43.767 170.644 1.00 70.91  ? 222  CYS D C   1 
ATOM   6431 O O   . CYS D 2 184 ? -7.191  43.937 171.563 1.00 70.30  ? 222  CYS D O   1 
ATOM   6432 C CB  . CYS D 2 184 ? -7.166  42.288 168.850 1.00 72.04  ? 222  CYS D CB  1 
ATOM   6433 S SG  . CYS D 2 184 ? -7.106  41.927 167.074 1.00 76.09  ? 222  CYS D SG  1 
ATOM   6434 N N   . LEU D 2 185 ? -9.318  43.562 170.841 1.00 63.11  ? 223  LEU D N   1 
ATOM   6435 C CA  . LEU D 2 185 ? -9.912  43.618 172.163 1.00 60.65  ? 223  LEU D CA  1 
ATOM   6436 C C   . LEU D 2 185 ? -10.619 42.337 172.527 1.00 62.92  ? 223  LEU D C   1 
ATOM   6437 O O   . LEU D 2 185 ? -10.962 41.527 171.668 1.00 60.34  ? 223  LEU D O   1 
ATOM   6438 C CB  . LEU D 2 185 ? -10.885 44.800 172.266 1.00 59.73  ? 223  LEU D CB  1 
ATOM   6439 C CG  . LEU D 2 185 ? -10.274 46.204 172.356 1.00 62.96  ? 223  LEU D CG  1 
ATOM   6440 C CD1 . LEU D 2 185 ? -11.306 47.267 172.700 1.00 62.50  ? 223  LEU D CD1 1 
ATOM   6441 C CD2 . LEU D 2 185 ? -9.130  46.228 173.334 1.00 65.06  ? 223  LEU D CD2 1 
ATOM   6442 N N   . CYS D 2 186 ? -10.822 42.153 173.824 1.00 60.52  ? 224  CYS D N   1 
ATOM   6443 C CA  . CYS D 2 186 ? -11.536 40.993 174.300 1.00 60.63  ? 224  CYS D CA  1 
ATOM   6444 C C   . CYS D 2 186 ? -12.669 41.421 175.227 1.00 66.55  ? 224  CYS D C   1 
ATOM   6445 O O   . CYS D 2 186 ? -12.440 42.049 176.282 1.00 68.04  ? 224  CYS D O   1 
ATOM   6446 C CB  . CYS D 2 186 ? -10.610 40.017 175.019 1.00 60.80  ? 224  CYS D CB  1 
ATOM   6447 S SG  . CYS D 2 186 ? -11.401 38.441 175.525 1.00 64.92  ? 224  CYS D SG  1 
ATOM   6448 N N   . VAL D 2 187 ? -13.889 41.055 174.835 1.00 60.10  ? 225  VAL D N   1 
ATOM   6449 C CA  . VAL D 2 187 ? -15.047 41.323 175.651 1.00 58.60  ? 225  VAL D CA  1 
ATOM   6450 C C   . VAL D 2 187 ? -15.437 40.032 176.322 1.00 65.40  ? 225  VAL D C   1 
ATOM   6451 O O   . VAL D 2 187 ? -15.823 39.077 175.660 1.00 66.94  ? 225  VAL D O   1 
ATOM   6452 C CB  . VAL D 2 187 ? -16.230 41.746 174.814 1.00 60.86  ? 225  VAL D CB  1 
ATOM   6453 C CG1 . VAL D 2 187 ? -17.471 41.605 175.639 1.00 60.89  ? 225  VAL D CG1 1 
ATOM   6454 C CG2 . VAL D 2 187 ? -16.081 43.143 174.330 1.00 59.99  ? 225  VAL D CG2 1 
ATOM   6455 N N   . ASP D 2 188 ? -15.408 40.003 177.638 1.00 61.93  ? 226  ASP D N   1 
ATOM   6456 C CA  . ASP D 2 188 ? -15.859 38.810 178.323 1.00 61.01  ? 226  ASP D CA  1 
ATOM   6457 C C   . ASP D 2 188 ? -16.816 39.279 179.394 1.00 64.39  ? 226  ASP D C   1 
ATOM   6458 O O   . ASP D 2 188 ? -17.234 40.425 179.375 1.00 62.24  ? 226  ASP D O   1 
ATOM   6459 C CB  . ASP D 2 188 ? -14.689 38.009 178.891 1.00 62.95  ? 226  ASP D CB  1 
ATOM   6460 C CG  . ASP D 2 188 ? -13.859 38.796 179.914 1.00 77.28  ? 226  ASP D CG  1 
ATOM   6461 O OD1 . ASP D 2 188 ? -13.308 39.887 179.568 1.00 79.36  ? 226  ASP D OD1 1 
ATOM   6462 O OD2 . ASP D 2 188 ? -13.694 38.262 181.041 1.00 80.02  ? 226  ASP D OD2 1 
ATOM   6463 N N   . ARG D 2 189 ? -17.163 38.393 180.319 1.00 63.42  ? 227  ARG D N   1 
ATOM   6464 C CA  . ARG D 2 189 ? -18.095 38.734 181.375 1.00 64.00  ? 227  ARG D CA  1 
ATOM   6465 C C   . ARG D 2 189 ? -19.471 38.851 180.697 1.00 71.60  ? 227  ARG D C   1 
ATOM   6466 O O   . ARG D 2 189 ? -20.396 39.456 181.247 1.00 73.17  ? 227  ARG D O   1 
ATOM   6467 C CB  . ARG D 2 189 ? -17.667 40.053 182.050 1.00 62.81  ? 227  ARG D CB  1 
ATOM   6468 C CG  . ARG D 2 189 ? -17.254 39.944 183.520 1.00 68.85  ? 227  ARG D CG  1 
ATOM   6469 C CD  . ARG D 2 189 ? -16.113 38.951 183.744 1.00 71.65  ? 227  ARG D CD  1 
ATOM   6470 N NE  . ARG D 2 189 ? -16.578 37.656 184.252 1.00 87.52  ? 227  ARG D NE  1 
ATOM   6471 C CZ  . ARG D 2 189 ? -17.485 37.495 185.224 1.00 99.58  ? 227  ARG D CZ  1 
ATOM   6472 N NH1 . ARG D 2 189 ? -18.019 38.567 185.826 1.00 83.54  ? 227  ARG D NH1 1 
ATOM   6473 N NH2 . ARG D 2 189 ? -17.857 36.258 185.601 1.00 79.92  ? 227  ARG D NH2 1 
ATOM   6474 N N   . LEU D 2 190 ? -19.595 38.247 179.510 1.00 68.08  ? 228  LEU D N   1 
ATOM   6475 C CA  . LEU D 2 190 ? -20.842 38.253 178.734 1.00 67.82  ? 228  LEU D CA  1 
ATOM   6476 C C   . LEU D 2 190 ? -21.942 37.469 179.433 1.00 73.21  ? 228  LEU D C   1 
ATOM   6477 O O   . LEU D 2 190 ? -21.678 36.453 180.076 1.00 73.21  ? 228  LEU D O   1 
ATOM   6478 C CB  . LEU D 2 190 ? -20.617 37.653 177.350 1.00 67.59  ? 228  LEU D CB  1 
ATOM   6479 C CG  . LEU D 2 190 ? -19.781 38.419 176.314 1.00 71.54  ? 228  LEU D CG  1 
ATOM   6480 C CD1 . LEU D 2 190 ? -19.752 37.668 174.996 1.00 71.96  ? 228  LEU D CD1 1 
ATOM   6481 C CD2 . LEU D 2 190 ? -20.231 39.836 176.075 1.00 70.08  ? 228  LEU D CD2 1 
ATOM   6482 N N   . PRO D 2 191 ? -23.197 37.933 179.316 1.00 70.96  ? 229  PRO D N   1 
ATOM   6483 C CA  . PRO D 2 191 ? -24.250 37.183 180.017 1.00 71.28  ? 229  PRO D CA  1 
ATOM   6484 C C   . PRO D 2 191 ? -24.375 35.717 179.560 1.00 77.79  ? 229  PRO D C   1 
ATOM   6485 O O   . PRO D 2 191 ? -23.950 35.344 178.451 1.00 77.72  ? 229  PRO D O   1 
ATOM   6486 C CB  . PRO D 2 191 ? -25.535 37.979 179.711 1.00 72.26  ? 229  PRO D CB  1 
ATOM   6487 C CG  . PRO D 2 191 ? -25.120 39.176 178.917 1.00 76.26  ? 229  PRO D CG  1 
ATOM   6488 C CD  . PRO D 2 191 ? -23.758 38.899 178.356 1.00 72.14  ? 229  PRO D CD  1 
ATOM   6489 N N   . PRO D 2 192 ? -24.936 34.859 180.464 1.00 74.38  ? 230  PRO D N   1 
ATOM   6490 C CA  . PRO D 2 192 ? -25.049 33.458 180.029 1.00 74.89  ? 230  PRO D CA  1 
ATOM   6491 C C   . PRO D 2 192 ? -25.835 33.273 178.718 1.00 81.06  ? 230  PRO D C   1 
ATOM   6492 O O   . PRO D 2 192 ? -26.882 33.899 178.490 1.00 80.73  ? 230  PRO D O   1 
ATOM   6493 C CB  . PRO D 2 192 ? -25.752 32.765 181.204 1.00 75.99  ? 230  PRO D CB  1 
ATOM   6494 C CG  . PRO D 2 192 ? -25.401 33.598 182.396 1.00 79.78  ? 230  PRO D CG  1 
ATOM   6495 C CD  . PRO D 2 192 ? -25.184 35.013 181.910 1.00 75.24  ? 230  PRO D CD  1 
ATOM   6496 N N   . GLY D 2 193 ? -25.300 32.401 177.865 1.00 77.31  ? 231  GLY D N   1 
ATOM   6497 C CA  . GLY D 2 193 ? -25.884 32.042 176.597 1.00 76.09  ? 231  GLY D CA  1 
ATOM   6498 C C   . GLY D 2 193 ? -25.914 33.202 175.649 1.00 79.48  ? 231  GLY D C   1 
ATOM   6499 O O   . GLY D 2 193 ? -26.409 33.060 174.535 1.00 79.20  ? 231  GLY D O   1 
ATOM   6500 N N   . PHE D 2 194 ? -25.400 34.350 176.076 1.00 76.34  ? 232  PHE D N   1 
ATOM   6501 C CA  . PHE D 2 194 ? -25.840 35.626 175.524 1.00 75.74  ? 232  PHE D CA  1 
ATOM   6502 C C   . PHE D 2 194 ? -25.482 35.727 174.046 1.00 82.13  ? 232  PHE D C   1 
ATOM   6503 O O   . PHE D 2 194 ? -24.407 35.296 173.627 1.00 81.80  ? 232  PHE D O   1 
ATOM   6504 C CB  . PHE D 2 194 ? -25.215 36.789 176.298 1.00 75.90  ? 232  PHE D CB  1 
ATOM   6505 C CG  . PHE D 2 194 ? -24.796 37.939 175.428 1.00 75.20  ? 232  PHE D CG  1 
ATOM   6506 C CD1 . PHE D 2 194 ? -25.540 39.107 175.395 1.00 76.69  ? 232  PHE D CD1 1 
ATOM   6507 C CD2 . PHE D 2 194 ? -23.658 37.854 174.644 1.00 74.95  ? 232  PHE D CD2 1 
ATOM   6508 C CE1 . PHE D 2 194 ? -25.157 40.167 174.596 1.00 76.29  ? 232  PHE D CE1 1 
ATOM   6509 C CE2 . PHE D 2 194 ? -23.269 38.911 173.843 1.00 77.13  ? 232  PHE D CE2 1 
ATOM   6510 C CZ  . PHE D 2 194 ? -24.020 40.069 173.819 1.00 74.72  ? 232  PHE D CZ  1 
ATOM   6511 N N   . ASN D 2 195 ? -26.392 36.285 173.252 1.00 79.88  ? 233  ASN D N   1 
ATOM   6512 C CA  . ASN D 2 195 ? -26.381 36.077 171.805 1.00 79.75  ? 233  ASN D CA  1 
ATOM   6513 C C   . ASN D 2 195 ? -26.516 37.365 170.990 1.00 81.78  ? 233  ASN D C   1 
ATOM   6514 O O   . ASN D 2 195 ? -27.575 37.634 170.423 1.00 80.79  ? 233  ASN D O   1 
ATOM   6515 C CB  . ASN D 2 195 ? -27.475 35.086 171.401 1.00 81.02  ? 233  ASN D CB  1 
ATOM   6516 C CG  . ASN D 2 195 ? -26.995 34.072 170.381 1.00 111.45 ? 233  ASN D CG  1 
ATOM   6517 O OD1 . ASN D 2 195 ? -26.428 34.433 169.350 1.00 105.14 ? 233  ASN D OD1 1 
ATOM   6518 N ND2 . ASN D 2 195 ? -27.222 32.795 170.664 1.00 102.84 ? 233  ASN D ND2 1 
ATOM   6519 N N   . ASP D 2 196 ? -25.449 38.157 170.931 1.00 78.05  ? 234  ASP D N   1 
ATOM   6520 C CA  . ASP D 2 196 ? -25.198 39.008 169.767 1.00 78.73  ? 234  ASP D CA  1 
ATOM   6521 C C   . ASP D 2 196 ? -23.860 38.694 169.100 1.00 83.50  ? 234  ASP D C   1 
ATOM   6522 O O   . ASP D 2 196 ? -22.826 38.636 169.766 1.00 83.60  ? 234  ASP D O   1 
ATOM   6523 C CB  . ASP D 2 196 ? -25.253 40.485 170.163 1.00 80.78  ? 234  ASP D CB  1 
ATOM   6524 C CG  . ASP D 2 196 ? -26.536 41.160 169.719 1.00 92.98  ? 234  ASP D CG  1 
ATOM   6525 O OD1 . ASP D 2 196 ? -26.611 41.585 168.547 1.00 92.59  ? 234  ASP D OD1 1 
ATOM   6526 O OD2 . ASP D 2 196 ? -27.469 41.265 170.542 1.00 99.47  ? 234  ASP D OD2 1 
ATOM   6527 N N   . VAL D 2 197 ? -23.884 38.492 167.785 1.00 80.85  ? 235  VAL D N   1 
ATOM   6528 C CA  . VAL D 2 197 ? -22.951 39.158 166.877 1.00 81.47  ? 235  VAL D CA  1 
ATOM   6529 C C   . VAL D 2 197 ? -23.122 40.677 166.856 1.00 87.31  ? 235  VAL D C   1 
ATOM   6530 O O   . VAL D 2 197 ? -22.142 41.422 166.832 1.00 87.95  ? 235  VAL D O   1 
ATOM   6531 C CB  . VAL D 2 197 ? -23.087 38.620 165.439 1.00 85.09  ? 235  VAL D CB  1 
ATOM   6532 C CG1 . VAL D 2 197 ? -21.770 38.767 164.691 1.00 84.63  ? 235  VAL D CG1 1 
ATOM   6533 C CG2 . VAL D 2 197 ? -23.539 37.168 165.456 1.00 84.98  ? 235  VAL D CG2 1 
ATOM   6534 N N   . ASP D 2 198 ? -24.373 41.124 166.866 1.00 83.01  ? 236  ASP D N   1 
ATOM   6535 C CA  . ASP D 2 198 ? -24.731 42.471 166.407 1.00 82.39  ? 236  ASP D CA  1 
ATOM   6536 C C   . ASP D 2 198 ? -24.969 43.565 167.461 1.00 83.88  ? 236  ASP D C   1 
ATOM   6537 O O   . ASP D 2 198 ? -24.506 44.705 167.312 1.00 81.74  ? 236  ASP D O   1 
ATOM   6538 C CB  . ASP D 2 198 ? -25.921 42.402 165.473 1.00 85.14  ? 236  ASP D CB  1 
ATOM   6539 C CG  . ASP D 2 198 ? -25.619 41.636 164.220 1.00 102.09 ? 236  ASP D CG  1 
ATOM   6540 O OD1 . ASP D 2 198 ? -25.802 42.204 163.125 1.00 103.04 ? 236  ASP D OD1 1 
ATOM   6541 O OD2 . ASP D 2 198 ? -25.191 40.468 164.331 1.00 111.46 ? 236  ASP D OD2 1 
ATOM   6542 N N   . ALA D 2 199 ? -25.759 43.257 168.482 1.00 80.09  ? 237  ALA D N   1 
ATOM   6543 C CA  . ALA D 2 199 ? -25.995 44.243 169.532 1.00 79.97  ? 237  ALA D CA  1 
ATOM   6544 C C   . ALA D 2 199 ? -24.607 44.614 170.100 1.00 83.44  ? 237  ALA D C   1 
ATOM   6545 O O   . ALA D 2 199 ? -24.192 45.786 170.120 1.00 80.67  ? 237  ALA D O   1 
ATOM   6546 C CB  . ALA D 2 199 ? -26.877 43.626 170.630 1.00 80.58  ? 237  ALA D CB  1 
ATOM   6547 N N   . LEU D 2 200 ? -23.854 43.563 170.559 1.00 81.02  ? 238  LEU D N   1 
ATOM   6548 C CA  . LEU D 2 200 ? -22.512 43.666 171.100 1.00 81.25  ? 238  LEU D CA  1 
ATOM   6549 C C   . LEU D 2 200 ? -21.587 44.462 170.178 1.00 84.24  ? 238  LEU D C   1 
ATOM   6550 O O   . LEU D 2 200 ? -20.955 45.430 170.609 1.00 84.28  ? 238  LEU D O   1 
ATOM   6551 C CB  . LEU D 2 200 ? -21.962 42.252 171.305 1.00 81.69  ? 238  LEU D CB  1 
ATOM   6552 C CG  . LEU D 2 200 ? -20.776 42.003 172.246 1.00 86.63  ? 238  LEU D CG  1 
ATOM   6553 C CD1 . LEU D 2 200 ? -20.703 40.531 172.694 1.00 86.48  ? 238  LEU D CD1 1 
ATOM   6554 C CD2 . LEU D 2 200 ? -19.485 42.407 171.553 1.00 89.41  ? 238  LEU D CD2 1 
ATOM   6555 N N   . CYS D 2 201 ? -21.495 44.041 168.919 1.00 79.48  ? 239  CYS D N   1 
ATOM   6556 C CA  . CYS D 2 201 ? -20.621 44.698 167.958 1.00 79.27  ? 239  CYS D CA  1 
ATOM   6557 C C   . CYS D 2 201 ? -21.091 46.110 167.703 1.00 83.38  ? 239  CYS D C   1 
ATOM   6558 O O   . CYS D 2 201 ? -20.307 46.983 167.340 1.00 82.77  ? 239  CYS D O   1 
ATOM   6559 C CB  . CYS D 2 201 ? -20.570 43.913 166.657 1.00 80.09  ? 239  CYS D CB  1 
ATOM   6560 S SG  . CYS D 2 201 ? -19.759 42.276 166.798 1.00 84.67  ? 239  CYS D SG  1 
ATOM   6561 N N   . ARG D 2 202 ? -22.382 46.330 167.918 1.00 80.66  ? 240  ARG D N   1 
ATOM   6562 C CA  . ARG D 2 202 ? -22.990 47.649 167.741 1.00 80.23  ? 240  ARG D CA  1 
ATOM   6563 C C   . ARG D 2 202 ? -22.585 48.504 168.952 1.00 82.26  ? 240  ARG D C   1 
ATOM   6564 O O   . ARG D 2 202 ? -22.239 49.683 168.805 1.00 80.49  ? 240  ARG D O   1 
ATOM   6565 C CB  . ARG D 2 202 ? -24.524 47.497 167.598 1.00 80.97  ? 240  ARG D CB  1 
ATOM   6566 C CG  . ARG D 2 202 ? -25.386 48.736 167.888 1.00 93.77  ? 240  ARG D CG  1 
ATOM   6567 C CD  . ARG D 2 202 ? -25.238 49.847 166.860 1.00 105.76 ? 240  ARG D CD  1 
ATOM   6568 N NE  . ARG D 2 202 ? -26.063 50.999 167.220 1.00 117.39 ? 240  ARG D NE  1 
ATOM   6569 C CZ  . ARG D 2 202 ? -25.806 52.258 166.873 1.00 132.52 ? 240  ARG D CZ  1 
ATOM   6570 N NH1 . ARG D 2 202 ? -26.623 53.234 167.265 1.00 113.05 ? 240  ARG D NH1 1 
ATOM   6571 N NH2 . ARG D 2 202 ? -24.738 52.544 166.132 1.00 122.08 ? 240  ARG D NH2 1 
ATOM   6572 N N   . ALA D 2 203 ? -22.581 47.877 170.134 1.00 77.92  ? 241  ALA D N   1 
ATOM   6573 C CA  . ALA D 2 203 ? -22.169 48.544 171.367 1.00 77.17  ? 241  ALA D CA  1 
ATOM   6574 C C   . ALA D 2 203 ? -20.736 49.027 171.185 1.00 83.37  ? 241  ALA D C   1 
ATOM   6575 O O   . ALA D 2 203 ? -20.407 50.175 171.486 1.00 82.30  ? 241  ALA D O   1 
ATOM   6576 C CB  . ALA D 2 203 ? -22.236 47.572 172.552 1.00 77.20  ? 241  ALA D CB  1 
ATOM   6577 N N   . LEU D 2 204 ? -19.902 48.137 170.651 1.00 81.44  ? 242  LEU D N   1 
ATOM   6578 C CA  . LEU D 2 204 ? -18.483 48.399 170.460 1.00 81.88  ? 242  LEU D CA  1 
ATOM   6579 C C   . LEU D 2 204 ? -18.056 49.382 169.371 1.00 86.68  ? 242  LEU D C   1 
ATOM   6580 O O   . LEU D 2 204 ? -16.860 49.694 169.224 1.00 86.64  ? 242  LEU D O   1 
ATOM   6581 C CB  . LEU D 2 204 ? -17.707 47.088 170.402 1.00 82.15  ? 242  LEU D CB  1 
ATOM   6582 C CG  . LEU D 2 204 ? -17.992 46.348 171.713 1.00 87.28  ? 242  LEU D CG  1 
ATOM   6583 C CD1 . LEU D 2 204 ? -17.746 44.850 171.579 1.00 88.34  ? 242  LEU D CD1 1 
ATOM   6584 C CD2 . LEU D 2 204 ? -17.197 46.941 172.865 1.00 86.45  ? 242  LEU D CD2 1 
ATOM   6585 N N   . SER D 2 205 ? -19.038 49.929 168.665 1.00 82.85  ? 243  SER D N   1 
ATOM   6586 C CA  . SER D 2 205 ? -18.771 50.891 167.603 1.00 81.70  ? 243  SER D CA  1 
ATOM   6587 C C   . SER D 2 205 ? -19.080 52.311 168.055 1.00 85.01  ? 243  SER D C   1 
ATOM   6588 O O   . SER D 2 205 ? -18.923 53.265 167.291 1.00 84.29  ? 243  SER D O   1 
ATOM   6589 C CB  . SER D 2 205 ? -19.574 50.533 166.355 1.00 83.45  ? 243  SER D CB  1 
ATOM   6590 O OG  . SER D 2 205 ? -19.158 49.278 165.846 1.00 88.32  ? 243  SER D OG  1 
ATOM   6591 N N   . ALA D 2 206 ? -19.492 52.446 169.312 1.00 81.90  ? 244  ALA D N   1 
ATOM   6592 C CA  . ALA D 2 206 ? -19.843 53.752 169.855 1.00 82.03  ? 244  ALA D CA  1 
ATOM   6593 C C   . ALA D 2 206 ? -18.746 54.817 169.764 1.00 86.92  ? 244  ALA D C   1 
ATOM   6594 O O   . ALA D 2 206 ? -18.950 55.948 170.206 1.00 87.28  ? 244  ALA D O   1 
ATOM   6595 C CB  . ALA D 2 206 ? -20.376 53.631 171.269 1.00 82.66  ? 244  ALA D CB  1 
ATOM   6596 N N   . VAL D 2 207 ? -17.604 54.478 169.164 1.00 82.82  ? 245  VAL D N   1 
ATOM   6597 C CA  . VAL D 2 207 ? -16.512 55.446 169.019 1.00 81.88  ? 245  VAL D CA  1 
ATOM   6598 C C   . VAL D 2 207 ? -15.796 55.306 167.698 1.00 84.09  ? 245  VAL D C   1 
ATOM   6599 O O   . VAL D 2 207 ? -15.416 56.291 167.081 1.00 82.47  ? 245  VAL D O   1 
ATOM   6600 C CB  . VAL D 2 207 ? -15.500 55.352 170.172 1.00 85.37  ? 245  VAL D CB  1 
ATOM   6601 C CG1 . VAL D 2 207 ? -14.546 56.560 170.152 1.00 84.72  ? 245  VAL D CG1 1 
ATOM   6602 C CG2 . VAL D 2 207 ? -16.223 55.218 171.504 1.00 85.11  ? 245  VAL D CG2 1 
ATOM   6603 N N   . HIS D 2 208 ? -15.559 54.063 167.314 1.00 81.61  ? 246  HIS D N   1 
ATOM   6604 C CA  . HIS D 2 208 ? -14.870 53.734 166.078 1.00 82.56  ? 246  HIS D CA  1 
ATOM   6605 C C   . HIS D 2 208 ? -15.454 52.391 165.681 1.00 88.20  ? 246  HIS D C   1 
ATOM   6606 O O   . HIS D 2 208 ? -16.042 51.709 166.520 1.00 87.96  ? 246  HIS D O   1 
ATOM   6607 C CB  . HIS D 2 208 ? -13.360 53.610 166.317 1.00 83.88  ? 246  HIS D CB  1 
ATOM   6608 C CG  . HIS D 2 208 ? -12.703 54.885 166.769 1.00 87.88  ? 246  HIS D CG  1 
ATOM   6609 N ND1 . HIS D 2 208 ? -12.745 55.324 168.079 1.00 89.88  ? 246  HIS D ND1 1 
ATOM   6610 C CD2 . HIS D 2 208 ? -11.963 55.799 166.092 1.00 89.57  ? 246  HIS D CD2 1 
ATOM   6611 C CE1 . HIS D 2 208 ? -12.064 56.452 168.187 1.00 89.04  ? 246  HIS D CE1 1 
ATOM   6612 N NE2 . HIS D 2 208 ? -11.578 56.761 166.997 1.00 89.27  ? 246  HIS D NE2 1 
ATOM   6613 N N   . SER D 2 209 ? -15.330 52.008 164.415 1.00 86.10  ? 247  SER D N   1 
ATOM   6614 C CA  . SER D 2 209 ? -15.931 50.748 163.976 1.00 86.48  ? 247  SER D CA  1 
ATOM   6615 C C   . SER D 2 209 ? -14.991 49.530 163.921 1.00 88.61  ? 247  SER D C   1 
ATOM   6616 O O   . SER D 2 209 ? -13.849 49.625 163.453 1.00 87.49  ? 247  SER D O   1 
ATOM   6617 C CB  . SER D 2 209 ? -16.728 50.936 162.665 1.00 91.11  ? 247  SER D CB  1 
ATOM   6618 O OG  . SER D 2 209 ? -18.130 51.087 162.898 1.00 98.36  ? 247  SER D OG  1 
ATOM   6619 N N   . PRO D 2 210 ? -15.467 48.372 164.416 1.00 84.61  ? 248  PRO D N   1 
ATOM   6620 C CA  . PRO D 2 210 ? -14.610 47.186 164.388 1.00 84.62  ? 248  PRO D CA  1 
ATOM   6621 C C   . PRO D 2 210 ? -14.456 46.619 162.975 1.00 90.35  ? 248  PRO D C   1 
ATOM   6622 O O   . PRO D 2 210 ? -15.436 46.459 162.244 1.00 89.93  ? 248  PRO D O   1 
ATOM   6623 C CB  . PRO D 2 210 ? -15.344 46.179 165.304 1.00 85.92  ? 248  PRO D CB  1 
ATOM   6624 C CG  . PRO D 2 210 ? -16.641 46.807 165.673 1.00 90.11  ? 248  PRO D CG  1 
ATOM   6625 C CD  . PRO D 2 210 ? -16.462 48.291 165.497 1.00 85.90  ? 248  PRO D CD  1 
ATOM   6626 N N   . THR D 2 211 ? -13.209 46.318 162.606 1.00 87.57  ? 249  THR D N   1 
ATOM   6627 C CA  . THR D 2 211 ? -12.877 45.704 161.317 1.00 86.53  ? 249  THR D CA  1 
ATOM   6628 C C   . THR D 2 211 ? -13.086 44.183 161.438 1.00 88.66  ? 249  THR D C   1 
ATOM   6629 O O   . THR D 2 211 ? -13.061 43.458 160.439 1.00 88.29  ? 249  THR D O   1 
ATOM   6630 C CB  . THR D 2 211 ? -11.424 46.074 160.857 1.00 95.56  ? 249  THR D CB  1 
ATOM   6631 O OG1 . THR D 2 211 ? -10.496 45.062 161.272 1.00 95.47  ? 249  THR D OG1 1 
ATOM   6632 C CG2 . THR D 2 211 ? -10.985 47.438 161.434 1.00 92.86  ? 249  THR D CG2 1 
ATOM   6633 N N   . PHE D 2 212 ? -13.290 43.722 162.677 1.00 83.46  ? 250  PHE D N   1 
ATOM   6634 C CA  . PHE D 2 212 ? -13.551 42.308 163.007 1.00 82.13  ? 250  PHE D CA  1 
ATOM   6635 C C   . PHE D 2 212 ? -14.358 42.301 164.296 1.00 83.95  ? 250  PHE D C   1 
ATOM   6636 O O   . PHE D 2 212 ? -14.233 43.221 165.107 1.00 83.64  ? 250  PHE D O   1 
ATOM   6637 C CB  . PHE D 2 212 ? -12.245 41.535 163.233 1.00 83.73  ? 250  PHE D CB  1 
ATOM   6638 C CG  . PHE D 2 212 ? -12.448 40.106 163.673 1.00 84.72  ? 250  PHE D CG  1 
ATOM   6639 C CD1 . PHE D 2 212 ? -12.617 39.791 165.013 1.00 87.12  ? 250  PHE D CD1 1 
ATOM   6640 C CD2 . PHE D 2 212 ? -12.440 39.072 162.750 1.00 85.87  ? 250  PHE D CD2 1 
ATOM   6641 C CE1 . PHE D 2 212 ? -12.792 38.477 165.420 1.00 87.46  ? 250  PHE D CE1 1 
ATOM   6642 C CE2 . PHE D 2 212 ? -12.601 37.754 163.158 1.00 88.24  ? 250  PHE D CE2 1 
ATOM   6643 C CZ  . PHE D 2 212 ? -12.786 37.462 164.494 1.00 86.30  ? 250  PHE D CZ  1 
ATOM   6644 N N   . CYS D 2 213 ? -15.185 41.278 164.489 1.00 79.48  ? 251  CYS D N   1 
ATOM   6645 C CA  . CYS D 2 213 ? -16.030 41.222 165.680 1.00 79.69  ? 251  CYS D CA  1 
ATOM   6646 C C   . CYS D 2 213 ? -16.874 39.950 165.683 1.00 83.46  ? 251  CYS D C   1 
ATOM   6647 O O   . CYS D 2 213 ? -17.799 39.806 164.891 1.00 83.24  ? 251  CYS D O   1 
ATOM   6648 C CB  . CYS D 2 213 ? -16.926 42.469 165.721 1.00 80.70  ? 251  CYS D CB  1 
ATOM   6649 S SG  . CYS D 2 213 ? -17.841 42.757 167.263 1.00 84.75  ? 251  CYS D SG  1 
ATOM   6650 N N   . GLN D 2 214 ? -16.547 39.021 166.568 1.00 80.42  ? 252  GLN D N   1 
ATOM   6651 C CA  . GLN D 2 214 ? -17.232 37.746 166.579 1.00 81.21  ? 252  GLN D CA  1 
ATOM   6652 C C   . GLN D 2 214 ? -17.277 37.182 167.964 1.00 86.49  ? 252  GLN D C   1 
ATOM   6653 O O   . GLN D 2 214 ? -16.432 37.504 168.788 1.00 87.16  ? 252  GLN D O   1 
ATOM   6654 C CB  . GLN D 2 214 ? -16.442 36.755 165.734 1.00 83.25  ? 252  GLN D CB  1 
ATOM   6655 C CG  . GLN D 2 214 ? -17.116 36.328 164.438 1.00 102.95 ? 252  GLN D CG  1 
ATOM   6656 C CD  . GLN D 2 214 ? -16.102 35.985 163.360 1.00 119.00 ? 252  GLN D CD  1 
ATOM   6657 O OE1 . GLN D 2 214 ? -15.865 36.776 162.438 1.00 112.59 ? 252  GLN D OE1 1 
ATOM   6658 N NE2 . GLN D 2 214 ? -15.454 34.828 163.502 1.00 105.32 ? 252  GLN D NE2 1 
ATOM   6659 N N   . LEU D 2 215 ? -18.223 36.277 168.192 1.00 82.95  ? 253  LEU D N   1 
ATOM   6660 C CA  . LEU D 2 215 ? -18.359 35.623 169.480 1.00 82.85  ? 253  LEU D CA  1 
ATOM   6661 C C   . LEU D 2 215 ? -17.439 34.421 169.512 1.00 90.07  ? 253  LEU D C   1 
ATOM   6662 O O   . LEU D 2 215 ? -16.849 34.057 168.491 1.00 89.72  ? 253  LEU D O   1 
ATOM   6663 C CB  . LEU D 2 215 ? -19.795 35.162 169.704 1.00 82.57  ? 253  LEU D CB  1 
ATOM   6664 C CG  . LEU D 2 215 ? -20.670 36.046 170.589 1.00 87.05  ? 253  LEU D CG  1 
ATOM   6665 C CD1 . LEU D 2 215 ? -21.442 37.038 169.718 1.00 87.32  ? 253  LEU D CD1 1 
ATOM   6666 C CD2 . LEU D 2 215 ? -21.626 35.177 171.410 1.00 89.01  ? 253  LEU D CD2 1 
ATOM   6667 N N   . ALA D 2 216 ? -17.349 33.795 170.685 1.00 88.59  ? 254  ALA D N   1 
ATOM   6668 C CA  . ALA D 2 216 ? -16.500 32.631 170.888 1.00 88.90  ? 254  ALA D CA  1 
ATOM   6669 C C   . ALA D 2 216 ? -17.329 31.368 170.826 1.00 95.68  ? 254  ALA D C   1 
ATOM   6670 O O   . ALA D 2 216 ? -17.979 30.990 171.809 1.00 94.29  ? 254  ALA D O   1 
ATOM   6671 C CB  . ALA D 2 216 ? -15.790 32.722 172.224 1.00 89.50  ? 254  ALA D CB  1 
ATOM   6672 N N   . CYS D 2 217 ? -17.292 30.715 169.667 1.00 96.21  ? 255  CYS D N   1 
ATOM   6673 C CA  . CYS D 2 217 ? -18.039 29.474 169.448 1.00 97.47  ? 255  CYS D CA  1 
ATOM   6674 C C   . CYS D 2 217 ? -17.166 28.224 169.450 1.00 102.64 ? 255  CYS D C   1 
ATOM   6675 O O   . CYS D 2 217 ? -16.351 28.018 168.546 1.00 101.25 ? 255  CYS D O   1 
ATOM   6676 C CB  . CYS D 2 217 ? -18.887 29.546 168.179 1.00 97.83  ? 255  CYS D CB  1 
ATOM   6677 S SG  . CYS D 2 217 ? -20.598 29.112 168.497 1.00 101.78 ? 255  CYS D SG  1 
ATOM   6678 N N   . GLY D 2 218 ? -17.349 27.400 170.481 1.00 101.27 ? 256  GLY D N   1 
ATOM   6679 C CA  . GLY D 2 218 ? -16.602 26.174 170.676 1.00 102.29 ? 256  GLY D CA  1 
ATOM   6680 C C   . GLY D 2 218 ? -16.734 25.189 169.534 1.00 110.50 ? 256  GLY D C   1 
ATOM   6681 O O   . GLY D 2 218 ? -17.543 25.378 168.614 1.00 110.96 ? 256  GLY D O   1 
ATOM   6682 N N   . GLN D 2 219 ? -15.916 24.142 169.583 1.00 108.80 ? 257  GLN D N   1 
ATOM   6683 C CA  . GLN D 2 219 ? -15.969 23.096 168.573 1.00 109.16 ? 257  GLN D CA  1 
ATOM   6684 C C   . GLN D 2 219 ? -16.773 21.932 169.138 1.00 114.08 ? 257  GLN D C   1 
ATOM   6685 O O   . GLN D 2 219 ? -16.619 20.777 168.731 1.00 113.49 ? 257  GLN D O   1 
ATOM   6686 C CB  . GLN D 2 219 ? -14.571 22.673 168.124 1.00 110.46 ? 257  GLN D CB  1 
ATOM   6687 C CG  . GLN D 2 219 ? -14.166 23.300 166.800 1.00 124.93 ? 257  GLN D CG  1 
ATOM   6688 C CD  . GLN D 2 219 ? -15.367 23.728 165.954 1.00 144.96 ? 257  GLN D CD  1 
ATOM   6689 O OE1 . GLN D 2 219 ? -16.094 24.668 166.297 1.00 138.24 ? 257  GLN D OE1 1 
ATOM   6690 N NE2 . GLN D 2 219 ? -15.562 23.050 164.829 1.00 136.09 ? 257  GLN D NE2 1 
ATOM   6691 N N   . ASP D 2 220 ? -17.632 22.276 170.094 1.00 111.09 ? 258  ASP D N   1 
ATOM   6692 C CA  . ASP D 2 220 ? -18.555 21.344 170.733 1.00 110.65 ? 258  ASP D CA  1 
ATOM   6693 C C   . ASP D 2 220 ? -19.919 21.811 170.231 1.00 113.62 ? 258  ASP D C   1 
ATOM   6694 O O   . ASP D 2 220 ? -20.952 21.165 170.447 1.00 113.67 ? 258  ASP D O   1 
ATOM   6695 C CB  . ASP D 2 220 ? -18.485 21.507 172.259 1.00 112.35 ? 258  ASP D CB  1 
ATOM   6696 C CG  . ASP D 2 220 ? -17.289 22.345 172.714 1.00 119.86 ? 258  ASP D CG  1 
ATOM   6697 O OD1 . ASP D 2 220 ? -16.694 22.009 173.762 1.00 119.15 ? 258  ASP D OD1 1 
ATOM   6698 O OD2 . ASP D 2 220 ? -16.959 23.352 172.050 1.00 125.13 ? 258  ASP D OD2 1 
ATOM   6699 N N   . GLY D 2 221 ? -19.859 22.943 169.529 1.00 108.61 ? 259  GLY D N   1 
ATOM   6700 C CA  . GLY D 2 221 ? -20.955 23.717 168.984 1.00 107.60 ? 259  GLY D CA  1 
ATOM   6701 C C   . GLY D 2 221 ? -21.166 24.872 169.949 1.00 108.64 ? 259  GLY D C   1 
ATOM   6702 O O   . GLY D 2 221 ? -21.758 25.906 169.615 1.00 107.84 ? 259  GLY D O   1 
ATOM   6703 N N   . GLN D 2 222 ? -20.645 24.669 171.157 1.00 102.87 ? 260  GLN D N   1 
ATOM   6704 C CA  . GLN D 2 222 ? -20.765 25.594 172.277 1.00 101.33 ? 260  GLN D CA  1 
ATOM   6705 C C   . GLN D 2 222 ? -20.488 27.073 172.038 1.00 101.85 ? 260  GLN D C   1 
ATOM   6706 O O   . GLN D 2 222 ? -20.169 27.512 170.931 1.00 101.81 ? 260  GLN D O   1 
ATOM   6707 C CB  . GLN D 2 222 ? -19.947 25.096 173.469 1.00 102.52 ? 260  GLN D CB  1 
ATOM   6708 C CG  . GLN D 2 222 ? -20.196 23.636 173.821 1.00 117.92 ? 260  GLN D CG  1 
ATOM   6709 C CD  . GLN D 2 222 ? -21.673 23.279 173.839 1.00 138.24 ? 260  GLN D CD  1 
ATOM   6710 O OE1 . GLN D 2 222 ? -22.241 22.989 174.895 1.00 131.15 ? 260  GLN D OE1 1 
ATOM   6711 N NE2 . GLN D 2 222 ? -22.304 23.295 172.666 1.00 132.72 ? 260  GLN D NE2 1 
ATOM   6712 N N   . LEU D 2 223 ? -20.662 27.838 173.108 1.00 94.89  ? 261  LEU D N   1 
ATOM   6713 C CA  . LEU D 2 223 ? -20.425 29.271 173.104 1.00 92.97  ? 261  LEU D CA  1 
ATOM   6714 C C   . LEU D 2 223 ? -19.549 29.521 174.318 1.00 94.99  ? 261  LEU D C   1 
ATOM   6715 O O   . LEU D 2 223 ? -19.891 29.112 175.429 1.00 95.88  ? 261  LEU D O   1 
ATOM   6716 C CB  . LEU D 2 223 ? -21.743 30.040 173.270 1.00 92.16  ? 261  LEU D CB  1 
ATOM   6717 C CG  . LEU D 2 223 ? -22.524 30.504 172.038 1.00 95.44  ? 261  LEU D CG  1 
ATOM   6718 C CD1 . LEU D 2 223 ? -23.714 31.325 172.460 1.00 95.08  ? 261  LEU D CD1 1 
ATOM   6719 C CD2 . LEU D 2 223 ? -21.668 31.303 171.095 1.00 97.06  ? 261  LEU D CD2 1 
ATOM   6720 N N   . LYS D 2 224 ? -18.387 30.119 174.106 1.00 87.94  ? 262  LYS D N   1 
ATOM   6721 C CA  . LYS D 2 224 ? -17.520 30.434 175.225 1.00 86.41  ? 262  LYS D CA  1 
ATOM   6722 C C   . LYS D 2 224 ? -17.887 31.873 175.562 1.00 88.22  ? 262  LYS D C   1 
ATOM   6723 O O   . LYS D 2 224 ? -18.254 32.651 174.673 1.00 89.81  ? 262  LYS D O   1 
ATOM   6724 C CB  . LYS D 2 224 ? -16.065 30.283 174.825 1.00 88.24  ? 262  LYS D CB  1 
ATOM   6725 C CG  . LYS D 2 224 ? -15.793 28.956 174.137 1.00 89.37  ? 262  LYS D CG  1 
ATOM   6726 C CD  . LYS D 2 224 ? -16.384 27.786 174.910 1.00 88.37  ? 262  LYS D CD  1 
ATOM   6727 C CE  . LYS D 2 224 ? -16.308 26.491 174.090 1.00 89.39  ? 262  LYS D CE  1 
ATOM   6728 N NZ  . LYS D 2 224 ? -16.284 25.237 174.925 1.00 91.40  ? 262  LYS D NZ  1 
ATOM   6729 N N   . GLY D 2 225 ? -17.909 32.202 176.844 1.00 79.93  ? 263  GLY D N   1 
ATOM   6730 C CA  . GLY D 2 225 ? -18.392 33.502 177.273 1.00 78.04  ? 263  GLY D CA  1 
ATOM   6731 C C   . GLY D 2 225 ? -17.585 34.732 176.946 1.00 77.31  ? 263  GLY D C   1 
ATOM   6732 O O   . GLY D 2 225 ? -17.300 35.523 177.848 1.00 77.23  ? 263  GLY D O   1 
ATOM   6733 N N   . PHE D 2 226 ? -17.267 34.917 175.662 1.00 70.47  ? 264  PHE D N   1 
ATOM   6734 C CA  . PHE D 2 226 ? -16.464 36.059 175.206 1.00 67.96  ? 264  PHE D CA  1 
ATOM   6735 C C   . PHE D 2 226 ? -16.502 36.404 173.713 1.00 69.74  ? 264  PHE D C   1 
ATOM   6736 O O   . PHE D 2 226 ? -17.158 35.746 172.925 1.00 69.44  ? 264  PHE D O   1 
ATOM   6737 C CB  . PHE D 2 226 ? -15.023 35.959 175.722 1.00 68.54  ? 264  PHE D CB  1 
ATOM   6738 C CG  . PHE D 2 226 ? -14.153 34.991 174.966 1.00 68.91  ? 264  PHE D CG  1 
ATOM   6739 C CD1 . PHE D 2 226 ? -13.414 35.414 173.855 1.00 71.04  ? 264  PHE D CD1 1 
ATOM   6740 C CD2 . PHE D 2 226 ? -13.934 33.711 175.452 1.00 70.22  ? 264  PHE D CD2 1 
ATOM   6741 C CE1 . PHE D 2 226 ? -12.542 34.548 173.192 1.00 70.50  ? 264  PHE D CE1 1 
ATOM   6742 C CE2 . PHE D 2 226 ? -13.067 32.834 174.789 1.00 72.16  ? 264  PHE D CE2 1 
ATOM   6743 C CZ  . PHE D 2 226 ? -12.367 33.265 173.660 1.00 69.57  ? 264  PHE D CZ  1 
ATOM   6744 N N   . ALA D 2 227 ? -15.820 37.481 173.358 1.00 66.98  ? 265  ALA D N   1 
ATOM   6745 C CA  . ALA D 2 227 ? -15.753 37.985 171.978 1.00 67.92  ? 265  ALA D CA  1 
ATOM   6746 C C   . ALA D 2 227 ? -14.422 38.711 171.733 1.00 73.48  ? 265  ALA D C   1 
ATOM   6747 O O   . ALA D 2 227 ? -13.801 39.253 172.673 1.00 71.78  ? 265  ALA D O   1 
ATOM   6748 C CB  . ALA D 2 227 ? -16.931 38.939 171.659 1.00 68.45  ? 265  ALA D CB  1 
ATOM   6749 N N   . VAL D 2 228 ? -14.002 38.712 170.463 1.00 71.82  ? 266  VAL D N   1 
ATOM   6750 C CA  . VAL D 2 228 ? -12.746 39.334 170.035 1.00 71.94  ? 266  VAL D CA  1 
ATOM   6751 C C   . VAL D 2 228 ? -13.008 40.353 168.914 1.00 74.17  ? 266  VAL D C   1 
ATOM   6752 O O   . VAL D 2 228 ? -13.734 40.067 167.985 1.00 73.47  ? 266  VAL D O   1 
ATOM   6753 C CB  . VAL D 2 228 ? -11.685 38.262 169.593 1.00 76.04  ? 266  VAL D CB  1 
ATOM   6754 C CG1 . VAL D 2 228 ? -10.466 38.950 168.996 1.00 75.69  ? 266  VAL D CG1 1 
ATOM   6755 C CG2 . VAL D 2 228 ? -11.273 37.294 170.762 1.00 75.48  ? 266  VAL D CG2 1 
ATOM   6756 N N   . LEU D 2 229 ? -12.430 41.544 169.029 1.00 70.80  ? 267  LEU D N   1 
ATOM   6757 C CA  . LEU D 2 229 ? -12.586 42.602 168.032 1.00 70.99  ? 267  LEU D CA  1 
ATOM   6758 C C   . LEU D 2 229 ? -11.238 43.079 167.493 1.00 77.97  ? 267  LEU D C   1 
ATOM   6759 O O   . LEU D 2 229 ? -10.200 42.972 168.148 1.00 77.22  ? 267  LEU D O   1 
ATOM   6760 C CB  . LEU D 2 229 ? -13.254 43.858 168.623 1.00 70.47  ? 267  LEU D CB  1 
ATOM   6761 C CG  . LEU D 2 229 ? -14.509 43.842 169.475 1.00 74.13  ? 267  LEU D CG  1 
ATOM   6762 C CD1 . LEU D 2 229 ? -15.496 44.891 168.932 1.00 73.89  ? 267  LEU D CD1 1 
ATOM   6763 C CD2 . LEU D 2 229 ? -15.094 42.436 169.583 1.00 74.99  ? 267  LEU D CD2 1 
ATOM   6764 N N   . GLU D 2 230 ? -11.302 43.753 166.356 1.00 76.60  ? 268  GLU D N   1 
ATOM   6765 C CA  . GLU D 2 230 ? -10.134 44.361 165.765 1.00 77.36  ? 268  GLU D CA  1 
ATOM   6766 C C   . GLU D 2 230 ? -10.554 45.764 165.357 1.00 85.40  ? 268  GLU D C   1 
ATOM   6767 O O   . GLU D 2 230 ? -11.742 46.041 165.155 1.00 85.08  ? 268  GLU D O   1 
ATOM   6768 C CB  . GLU D 2 230 ? -9.677  43.565 164.547 1.00 78.76  ? 268  GLU D CB  1 
ATOM   6769 C CG  . GLU D 2 230 ? -8.463  44.164 163.830 1.00 90.21  ? 268  GLU D CG  1 
ATOM   6770 C CD  . GLU D 2 230 ? -7.437  43.113 163.372 1.00 98.36  ? 268  GLU D CD  1 
ATOM   6771 O OE1 . GLU D 2 230 ? -6.249  43.482 163.240 1.00 82.32  ? 268  GLU D OE1 1 
ATOM   6772 O OE2 . GLU D 2 230 ? -7.811  41.935 163.143 1.00 80.69  ? 268  GLU D OE2 1 
ATOM   6773 N N   . TYR D 2 231 ? -9.585  46.665 165.319 1.00 85.15  ? 269  TYR D N   1 
ATOM   6774 C CA  . TYR D 2 231 ? -9.830  48.050 164.930 1.00 86.53  ? 269  TYR D CA  1 
ATOM   6775 C C   . TYR D 2 231 ? -8.669  48.428 164.030 1.00 95.03  ? 269  TYR D C   1 
ATOM   6776 O O   . TYR D 2 231 ? -7.574  47.854 164.124 1.00 94.66  ? 269  TYR D O   1 
ATOM   6777 C CB  . TYR D 2 231 ? -9.913  48.991 166.141 1.00 87.52  ? 269  TYR D CB  1 
ATOM   6778 C CG  . TYR D 2 231 ? -11.152 48.790 167.001 1.00 89.23  ? 269  TYR D CG  1 
ATOM   6779 C CD1 . TYR D 2 231 ? -11.199 47.783 167.966 1.00 91.52  ? 269  TYR D CD1 1 
ATOM   6780 C CD2 . TYR D 2 231 ? -12.266 49.608 166.859 1.00 89.36  ? 269  TYR D CD2 1 
ATOM   6781 C CE1 . TYR D 2 231 ? -12.337 47.573 168.734 1.00 91.63  ? 269  TYR D CE1 1 
ATOM   6782 C CE2 . TYR D 2 231 ? -13.395 49.414 167.625 1.00 89.95  ? 269  TYR D CE2 1 
ATOM   6783 C CZ  . TYR D 2 231 ? -13.427 48.401 168.566 1.00 95.51  ? 269  TYR D CZ  1 
ATOM   6784 O OH  . TYR D 2 231 ? -14.556 48.213 169.331 1.00 92.61  ? 269  TYR D OH  1 
ATOM   6785 N N   . GLU D 2 232 ? -8.939  49.334 163.102 1.00 94.23  ? 270  GLU D N   1 
ATOM   6786 C CA  . GLU D 2 232 ? -7.938  49.730 162.134 1.00 95.09  ? 270  GLU D CA  1 
ATOM   6787 C C   . GLU D 2 232 ? -6.600  50.101 162.784 1.00 98.03  ? 270  GLU D C   1 
ATOM   6788 O O   . GLU D 2 232 ? -5.538  49.593 162.399 1.00 97.35  ? 270  GLU D O   1 
ATOM   6789 C CB  . GLU D 2 232 ? -8.487  50.846 161.235 1.00 97.15  ? 270  GLU D CB  1 
ATOM   6790 C CG  . GLU D 2 232 ? -9.869  50.523 160.628 1.00 113.11 ? 270  GLU D CG  1 
ATOM   6791 C CD  . GLU D 2 232 ? -10.582 51.747 160.050 1.00 138.10 ? 270  GLU D CD  1 
ATOM   6792 O OE1 . GLU D 2 232 ? -9.914  52.594 159.407 1.00 132.71 ? 270  GLU D OE1 1 
ATOM   6793 O OE2 . GLU D 2 232 ? -11.819 51.849 160.227 1.00 127.80 ? 270  GLU D OE2 1 
ATOM   6794 N N   . THR D 2 233 ? -6.660  50.947 163.803 1.00 93.92  ? 271  THR D N   1 
ATOM   6795 C CA  . THR D 2 233 ? -5.446  51.372 164.478 1.00 93.82  ? 271  THR D CA  1 
ATOM   6796 C C   . THR D 2 233 ? -5.445  51.003 165.962 1.00 99.42  ? 271  THR D C   1 
ATOM   6797 O O   . THR D 2 233 ? -6.484  50.647 166.539 1.00 99.53  ? 271  THR D O   1 
ATOM   6798 C CB  . THR D 2 233 ? -5.197  52.879 164.258 1.00 98.49  ? 271  THR D CB  1 
ATOM   6799 O OG1 . THR D 2 233 ? -5.364  53.585 165.491 1.00 94.90  ? 271  THR D OG1 1 
ATOM   6800 C CG2 . THR D 2 233 ? -6.178  53.435 163.239 1.00 97.13  ? 271  THR D CG2 1 
ATOM   6801 N N   . ALA D 2 234 ? -4.270  51.096 166.577 1.00 95.47  ? 272  ALA D N   1 
ATOM   6802 C CA  . ALA D 2 234 ? -4.117  50.833 168.002 1.00 94.70  ? 272  ALA D CA  1 
ATOM   6803 C C   . ALA D 2 234 ? -4.787  51.950 168.832 1.00 97.82  ? 272  ALA D C   1 
ATOM   6804 O O   . ALA D 2 234 ? -5.068  51.788 170.027 1.00 98.43  ? 272  ALA D O   1 
ATOM   6805 C CB  . ALA D 2 234 ? -2.633  50.722 168.346 1.00 95.33  ? 272  ALA D CB  1 
ATOM   6806 N N   . GLU D 2 235 ? -5.046  53.077 168.177 1.00 92.76  ? 273  GLU D N   1 
ATOM   6807 C CA  . GLU D 2 235 ? -5.655  54.248 168.807 1.00 91.78  ? 273  GLU D CA  1 
ATOM   6808 C C   . GLU D 2 235 ? -7.165  54.093 168.888 1.00 90.43  ? 273  GLU D C   1 
ATOM   6809 O O   . GLU D 2 235 ? -7.795  54.469 169.872 1.00 87.58  ? 273  GLU D O   1 
ATOM   6810 C CB  . GLU D 2 235 ? -5.316  55.509 167.993 1.00 93.72  ? 273  GLU D CB  1 
ATOM   6811 C CG  . GLU D 2 235 ? -5.194  56.795 168.824 1.00 109.52 ? 273  GLU D CG  1 
ATOM   6812 C CD  . GLU D 2 235 ? -5.522  58.051 168.027 1.00 144.12 ? 273  GLU D CD  1 
ATOM   6813 O OE1 . GLU D 2 235 ? -4.777  58.357 167.071 1.00 148.11 ? 273  GLU D OE1 1 
ATOM   6814 O OE2 . GLU D 2 235 ? -6.511  58.740 168.366 1.00 141.42 ? 273  GLU D OE2 1 
ATOM   6815 N N   . MET D 2 236 ? -7.739  53.553 167.823 1.00 86.20  ? 274  MET D N   1 
ATOM   6816 C CA  . MET D 2 236 ? -9.173  53.336 167.763 1.00 85.42  ? 274  MET D CA  1 
ATOM   6817 C C   . MET D 2 236 ? -9.532  52.229 168.740 1.00 84.10  ? 274  MET D C   1 
ATOM   6818 O O   . MET D 2 236 ? -10.607 52.240 169.340 1.00 84.59  ? 274  MET D O   1 
ATOM   6819 C CB  . MET D 2 236 ? -9.584  52.929 166.349 1.00 88.41  ? 274  MET D CB  1 
ATOM   6820 C CG  . MET D 2 236 ? -9.316  53.976 165.276 1.00 92.85  ? 274  MET D CG  1 
ATOM   6821 S SD  . MET D 2 236 ? -9.629  53.303 163.617 1.00 98.33  ? 274  MET D SD  1 
ATOM   6822 C CE  . MET D 2 236 ? -11.318 52.482 163.810 1.00 94.66  ? 274  MET D CE  1 
ATOM   6823 N N   . ALA D 2 237 ? -8.621  51.271 168.881 1.00 75.18  ? 275  ALA D N   1 
ATOM   6824 C CA  . ALA D 2 237 ? -8.793  50.162 169.813 1.00 72.63  ? 275  ALA D CA  1 
ATOM   6825 C C   . ALA D 2 237 ? -8.761  50.720 171.239 1.00 72.52  ? 275  ALA D C   1 
ATOM   6826 O O   . ALA D 2 237 ? -9.727  50.592 171.997 1.00 71.77  ? 275  ALA D O   1 
ATOM   6827 C CB  . ALA D 2 237 ? -7.679  49.135 169.609 1.00 73.26  ? 275  ALA D CB  1 
ATOM   6828 N N   . GLU D 2 238 ? -7.654  51.373 171.583 1.00 67.22  ? 276  GLU D N   1 
ATOM   6829 C CA  . GLU D 2 238 ? -7.495  52.008 172.880 1.00 66.52  ? 276  GLU D CA  1 
ATOM   6830 C C   . GLU D 2 238 ? -8.746  52.825 173.283 1.00 71.68  ? 276  GLU D C   1 
ATOM   6831 O O   . GLU D 2 238 ? -9.330  52.588 174.334 1.00 70.59  ? 276  GLU D O   1 
ATOM   6832 C CB  . GLU D 2 238 ? -6.230  52.875 172.857 1.00 67.77  ? 276  GLU D CB  1 
ATOM   6833 C CG  . GLU D 2 238 ? -5.905  53.578 174.179 1.00 76.16  ? 276  GLU D CG  1 
ATOM   6834 C CD  . GLU D 2 238 ? -4.496  54.187 174.233 1.00 91.01  ? 276  GLU D CD  1 
ATOM   6835 O OE1 . GLU D 2 238 ? -3.681  53.983 173.296 1.00 78.62  ? 276  GLU D OE1 1 
ATOM   6836 O OE2 . GLU D 2 238 ? -4.207  54.877 175.235 1.00 84.37  ? 276  GLU D OE2 1 
ATOM   6837 N N   . GLU D 2 239 ? -9.181  53.738 172.414 1.00 71.21  ? 277  GLU D N   1 
ATOM   6838 C CA  . GLU D 2 239 ? -10.349 54.594 172.665 1.00 71.69  ? 277  GLU D CA  1 
ATOM   6839 C C   . GLU D 2 239 ? -11.664 53.834 172.856 1.00 73.67  ? 277  GLU D C   1 
ATOM   6840 O O   . GLU D 2 239 ? -12.493 54.197 173.710 1.00 72.30  ? 277  GLU D O   1 
ATOM   6841 C CB  . GLU D 2 239 ? -10.488 55.660 171.574 1.00 73.53  ? 277  GLU D CB  1 
ATOM   6842 C CG  . GLU D 2 239 ? -9.423  56.775 171.661 1.00 87.54  ? 277  GLU D CG  1 
ATOM   6843 C CD  . GLU D 2 239 ? -9.737  57.992 170.779 1.00 113.02 ? 277  GLU D CD  1 
ATOM   6844 O OE1 . GLU D 2 239 ? -9.642  59.145 171.272 1.00 107.62 ? 277  GLU D OE1 1 
ATOM   6845 O OE2 . GLU D 2 239 ? -10.066 57.794 169.586 1.00 107.93 ? 277  GLU D OE2 1 
ATOM   6846 N N   . ALA D 2 240 ? -11.831 52.763 172.085 1.00 69.45  ? 278  ALA D N   1 
ATOM   6847 C CA  . ALA D 2 240 ? -13.015 51.906 172.187 1.00 69.25  ? 278  ALA D CA  1 
ATOM   6848 C C   . ALA D 2 240 ? -13.080 51.167 173.548 1.00 73.85  ? 278  ALA D C   1 
ATOM   6849 O O   . ALA D 2 240 ? -14.132 51.138 174.207 1.00 72.78  ? 278  ALA D O   1 
ATOM   6850 C CB  . ALA D 2 240 ? -13.047 50.917 171.026 1.00 69.75  ? 278  ALA D CB  1 
ATOM   6851 N N   . GLN D 2 241 ? -11.945 50.600 173.968 1.00 70.12  ? 279  GLN D N   1 
ATOM   6852 C CA  . GLN D 2 241 ? -11.833 49.897 175.253 1.00 68.74  ? 279  GLN D CA  1 
ATOM   6853 C C   . GLN D 2 241 ? -12.207 50.822 176.406 1.00 71.57  ? 279  GLN D C   1 
ATOM   6854 O O   . GLN D 2 241 ? -12.923 50.430 177.330 1.00 70.31  ? 279  GLN D O   1 
ATOM   6855 C CB  . GLN D 2 241 ? -10.397 49.389 175.464 1.00 69.27  ? 279  GLN D CB  1 
ATOM   6856 C CG  . GLN D 2 241 ? -10.244 48.432 176.641 1.00 68.77  ? 279  GLN D CG  1 
ATOM   6857 C CD  . GLN D 2 241 ? -10.053 49.139 177.989 1.00 75.05  ? 279  GLN D CD  1 
ATOM   6858 O OE1 . GLN D 2 241 ? -9.561  50.264 178.057 1.00 74.26  ? 279  GLN D OE1 1 
ATOM   6859 N NE2 . GLN D 2 241 ? -10.422 48.461 179.067 1.00 48.87  ? 279  GLN D NE2 1 
ATOM   6860 N N   . GLN D 2 242 ? -11.690 52.047 176.340 1.00 69.05  ? 280  GLN D N   1 
ATOM   6861 C CA  . GLN D 2 242 ? -11.908 53.077 177.361 1.00 68.92  ? 280  GLN D CA  1 
ATOM   6862 C C   . GLN D 2 242 ? -13.401 53.289 177.608 1.00 70.83  ? 280  GLN D C   1 
ATOM   6863 O O   . GLN D 2 242 ? -13.894 53.231 178.735 1.00 70.10  ? 280  GLN D O   1 
ATOM   6864 C CB  . GLN D 2 242 ? -11.257 54.383 176.890 1.00 70.83  ? 280  GLN D CB  1 
ATOM   6865 C CG  . GLN D 2 242 ? -10.993 55.429 177.981 1.00 100.71 ? 280  GLN D CG  1 
ATOM   6866 C CD  . GLN D 2 242 ? -10.086 56.568 177.497 1.00 131.23 ? 280  GLN D CD  1 
ATOM   6867 O OE1 . GLN D 2 242 ? -9.723  56.636 176.314 1.00 125.62 ? 280  GLN D OE1 1 
ATOM   6868 N NE2 . GLN D 2 242 ? -9.713  57.463 178.415 1.00 125.35 ? 280  GLN D NE2 1 
ATOM   6869 N N   . GLN D 2 243 ? -14.124 53.487 176.521 1.00 66.83  ? 281  GLN D N   1 
ATOM   6870 C CA  . GLN D 2 243 ? -15.553 53.717 176.581 1.00 65.71  ? 281  GLN D CA  1 
ATOM   6871 C C   . GLN D 2 243 ? -16.412 52.490 176.907 1.00 66.38  ? 281  GLN D C   1 
ATOM   6872 O O   . GLN D 2 243 ? -17.416 52.609 177.618 1.00 65.49  ? 281  GLN D O   1 
ATOM   6873 C CB  . GLN D 2 243 ? -16.025 54.353 175.263 1.00 66.82  ? 281  GLN D CB  1 
ATOM   6874 C CG  . GLN D 2 243 ? -17.512 54.718 175.258 1.00 76.77  ? 281  GLN D CG  1 
ATOM   6875 C CD  . GLN D 2 243 ? -18.393 53.549 174.815 1.00 95.99  ? 281  GLN D CD  1 
ATOM   6876 O OE1 . GLN D 2 243 ? -18.004 52.750 173.942 1.00 91.22  ? 281  GLN D OE1 1 
ATOM   6877 N NE2 . GLN D 2 243 ? -19.578 53.433 175.423 1.00 74.97  ? 281  GLN D NE2 1 
ATOM   6878 N N   . ALA D 2 244 ? -16.048 51.338 176.334 1.00 60.69  ? 282  ALA D N   1 
ATOM   6879 C CA  . ALA D 2 244 ? -16.828 50.095 176.457 1.00 59.25  ? 282  ALA D CA  1 
ATOM   6880 C C   . ALA D 2 244 ? -16.726 49.320 177.761 1.00 63.18  ? 282  ALA D C   1 
ATOM   6881 O O   . ALA D 2 244 ? -17.697 48.685 178.167 1.00 62.14  ? 282  ALA D O   1 
ATOM   6882 C CB  . ALA D 2 244 ? -16.563 49.170 175.277 1.00 59.18  ? 282  ALA D CB  1 
ATOM   6883 N N   . ASP D 2 245 ? -15.548 49.337 178.385 1.00 59.34  ? 283  ASP D N   1 
ATOM   6884 C CA  . ASP D 2 245 ? -15.331 48.598 179.620 1.00 59.07  ? 283  ASP D CA  1 
ATOM   6885 C C   . ASP D 2 245 ? -16.279 49.005 180.748 1.00 62.44  ? 283  ASP D C   1 
ATOM   6886 O O   . ASP D 2 245 ? -16.445 50.194 181.043 1.00 63.19  ? 283  ASP D O   1 
ATOM   6887 C CB  . ASP D 2 245 ? -13.866 48.687 180.067 1.00 60.86  ? 283  ASP D CB  1 
ATOM   6888 C CG  . ASP D 2 245 ? -13.606 47.945 181.376 1.00 67.82  ? 283  ASP D CG  1 
ATOM   6889 O OD1 . ASP D 2 245 ? -13.108 48.597 182.315 1.00 71.12  ? 283  ASP D OD1 1 
ATOM   6890 O OD2 . ASP D 2 245 ? -13.931 46.737 181.488 1.00 62.76  ? 283  ASP D OD2 1 
ATOM   6891 N N   . GLY D 2 246 ? -16.918 48.013 181.360 1.00 57.86  ? 284  GLY D N   1 
ATOM   6892 C CA  . GLY D 2 246 ? -17.839 48.230 182.462 1.00 57.85  ? 284  GLY D CA  1 
ATOM   6893 C C   . GLY D 2 246 ? -19.285 48.298 182.041 1.00 66.01  ? 284  GLY D C   1 
ATOM   6894 O O   . GLY D 2 246 ? -20.191 48.124 182.859 1.00 64.92  ? 284  GLY D O   1 
ATOM   6895 N N   . LEU D 2 247 ? -19.491 48.539 180.750 1.00 67.25  ? 285  LEU D N   1 
ATOM   6896 C CA  . LEU D 2 247 ? -20.813 48.711 180.188 1.00 69.51  ? 285  LEU D CA  1 
ATOM   6897 C C   . LEU D 2 247 ? -21.804 47.639 180.585 1.00 74.42  ? 285  LEU D C   1 
ATOM   6898 O O   . LEU D 2 247 ? -21.467 46.454 180.629 1.00 75.06  ? 285  LEU D O   1 
ATOM   6899 C CB  . LEU D 2 247 ? -20.758 48.862 178.664 1.00 70.83  ? 285  LEU D CB  1 
ATOM   6900 C CG  . LEU D 2 247 ? -21.760 49.860 178.043 1.00 77.21  ? 285  LEU D CG  1 
ATOM   6901 C CD1 . LEU D 2 247 ? -21.181 51.271 177.847 1.00 77.54  ? 285  LEU D CD1 1 
ATOM   6902 C CD2 . LEU D 2 247 ? -22.234 49.308 176.726 1.00 80.05  ? 285  LEU D CD2 1 
ATOM   6903 N N   . SER D 2 248 ? -23.036 48.060 180.866 1.00 69.15  ? 286  SER D N   1 
ATOM   6904 C CA  . SER D 2 248 ? -24.082 47.115 181.164 1.00 67.94  ? 286  SER D CA  1 
ATOM   6905 C C   . SER D 2 248 ? -24.624 46.621 179.827 1.00 70.80  ? 286  SER D C   1 
ATOM   6906 O O   . SER D 2 248 ? -24.830 47.411 178.890 1.00 70.28  ? 286  SER D O   1 
ATOM   6907 C CB  . SER D 2 248 ? -25.199 47.737 182.003 1.00 69.79  ? 286  SER D CB  1 
ATOM   6908 O OG  . SER D 2 248 ? -25.871 46.733 182.754 1.00 74.02  ? 286  SER D OG  1 
ATOM   6909 N N   . LEU D 2 249 ? -24.791 45.303 179.737 1.00 65.52  ? 287  LEU D N   1 
ATOM   6910 C CA  . LEU D 2 249 ? -25.339 44.643 178.563 1.00 64.82  ? 287  LEU D CA  1 
ATOM   6911 C C   . LEU D 2 249 ? -25.863 43.356 179.100 1.00 67.85  ? 287  LEU D C   1 
ATOM   6912 O O   . LEU D 2 249 ? -25.239 42.766 179.974 1.00 65.95  ? 287  LEU D O   1 
ATOM   6913 C CB  . LEU D 2 249 ? -24.293 44.357 177.493 1.00 64.78  ? 287  LEU D CB  1 
ATOM   6914 C CG  . LEU D 2 249 ? -24.951 43.724 176.265 1.00 69.30  ? 287  LEU D CG  1 
ATOM   6915 C CD1 . LEU D 2 249 ? -24.662 44.492 174.975 1.00 68.99  ? 287  LEU D CD1 1 
ATOM   6916 C CD2 . LEU D 2 249 ? -24.531 42.284 176.152 1.00 72.87  ? 287  LEU D CD2 1 
ATOM   6917 N N   . GLY D 2 250 ? -27.052 42.958 178.656 1.00 66.52  ? 288  GLY D N   1 
ATOM   6918 C CA  . GLY D 2 250 ? -27.702 41.771 179.191 1.00 66.59  ? 288  GLY D CA  1 
ATOM   6919 C C   . GLY D 2 250 ? -27.839 42.070 180.657 1.00 71.90  ? 288  GLY D C   1 
ATOM   6920 O O   . GLY D 2 250 ? -27.747 43.233 181.047 1.00 74.56  ? 288  GLY D O   1 
ATOM   6921 N N   . GLY D 2 251 ? -28.000 41.071 181.502 1.00 67.88  ? 289  GLY D N   1 
ATOM   6922 C CA  . GLY D 2 251 ? -28.087 41.430 182.905 1.00 68.78  ? 289  GLY D CA  1 
ATOM   6923 C C   . GLY D 2 251 ? -26.726 41.666 183.553 1.00 73.71  ? 289  GLY D C   1 
ATOM   6924 O O   . GLY D 2 251 ? -26.587 41.530 184.762 1.00 73.12  ? 289  GLY D O   1 
ATOM   6925 N N   . SER D 2 252 ? -25.705 41.991 182.764 1.00 69.73  ? 290  SER D N   1 
ATOM   6926 C CA  . SER D 2 252 ? -24.357 42.110 183.323 1.00 68.85  ? 290  SER D CA  1 
ATOM   6927 C C   . SER D 2 252 ? -23.411 43.218 182.829 1.00 68.21  ? 290  SER D C   1 
ATOM   6928 O O   . SER D 2 252 ? -23.717 43.991 181.913 1.00 69.32  ? 290  SER D O   1 
ATOM   6929 C CB  . SER D 2 252 ? -23.649 40.752 183.260 1.00 74.04  ? 290  SER D CB  1 
ATOM   6930 O OG  . SER D 2 252 ? -22.643 40.732 182.259 1.00 83.68  ? 290  SER D OG  1 
ATOM   6931 N N   . HIS D 2 253 ? -22.246 43.276 183.452 1.00 58.88  ? 291  HIS D N   1 
ATOM   6932 C CA  . HIS D 2 253 ? -21.282 44.305 183.137 1.00 57.90  ? 291  HIS D CA  1 
ATOM   6933 C C   . HIS D 2 253 ? -20.132 43.760 182.317 1.00 63.58  ? 291  HIS D C   1 
ATOM   6934 O O   . HIS D 2 253 ? -19.458 42.833 182.719 1.00 66.21  ? 291  HIS D O   1 
ATOM   6935 C CB  . HIS D 2 253 ? -20.787 44.979 184.417 1.00 57.20  ? 291  HIS D CB  1 
ATOM   6936 C CG  . HIS D 2 253 ? -21.839 45.785 185.116 1.00 59.56  ? 291  HIS D CG  1 
ATOM   6937 N ND1 . HIS D 2 253 ? -22.552 45.307 186.194 1.00 60.44  ? 291  HIS D ND1 1 
ATOM   6938 C CD2 . HIS D 2 253 ? -22.318 47.027 184.870 1.00 60.31  ? 291  HIS D CD2 1 
ATOM   6939 C CE1 . HIS D 2 253 ? -23.421 46.218 186.582 1.00 59.30  ? 291  HIS D CE1 1 
ATOM   6940 N NE2 . HIS D 2 253 ? -23.302 47.270 185.793 1.00 59.66  ? 291  HIS D NE2 1 
ATOM   6941 N N   . LEU D 2 254 ? -19.913 44.317 181.144 1.00 58.15  ? 292  LEU D N   1 
ATOM   6942 C CA  . LEU D 2 254 ? -18.860 43.801 180.306 1.00 57.81  ? 292  LEU D CA  1 
ATOM   6943 C C   . LEU D 2 254 ? -17.440 44.114 180.756 1.00 59.89  ? 292  LEU D C   1 
ATOM   6944 O O   . LEU D 2 254 ? -17.148 45.224 181.214 1.00 60.03  ? 292  LEU D O   1 
ATOM   6945 C CB  . LEU D 2 254 ? -19.064 44.271 178.865 1.00 58.37  ? 292  LEU D CB  1 
ATOM   6946 C CG  . LEU D 2 254 ? -20.363 43.753 178.218 1.00 63.73  ? 292  LEU D CG  1 
ATOM   6947 C CD1 . LEU D 2 254 ? -20.490 44.123 176.734 1.00 62.71  ? 292  LEU D CD1 1 
ATOM   6948 C CD2 . LEU D 2 254 ? -20.566 42.246 178.457 1.00 66.20  ? 292  LEU D CD2 1 
ATOM   6949 N N   . ARG D 2 255 ? -16.554 43.130 180.599 1.00 53.35  ? 293  ARG D N   1 
ATOM   6950 C CA  . ARG D 2 255 ? -15.131 43.340 180.819 1.00 52.25  ? 293  ARG D CA  1 
ATOM   6951 C C   . ARG D 2 255 ? -14.476 43.487 179.466 1.00 54.32  ? 293  ARG D C   1 
ATOM   6952 O O   . ARG D 2 255 ? -14.537 42.594 178.639 1.00 54.93  ? 293  ARG D O   1 
ATOM   6953 C CB  . ARG D 2 255 ? -14.469 42.187 181.558 1.00 52.45  ? 293  ARG D CB  1 
ATOM   6954 C CG  . ARG D 2 255 ? -13.605 42.667 182.663 1.00 47.88  ? 293  ARG D CG  1 
ATOM   6955 C CD  . ARG D 2 255 ? -12.441 41.833 182.889 1.00 48.73  ? 293  ARG D CD  1 
ATOM   6956 N NE  . ARG D 2 255 ? -12.733 40.416 182.868 1.00 50.47  ? 293  ARG D NE  1 
ATOM   6957 C CZ  . ARG D 2 255 ? -12.484 39.594 183.881 1.00 70.21  ? 293  ARG D CZ  1 
ATOM   6958 N NH1 . ARG D 2 255 ? -12.047 40.068 185.042 1.00 59.38  ? 293  ARG D NH1 1 
ATOM   6959 N NH2 . ARG D 2 255 ? -12.698 38.296 183.745 1.00 61.94  ? 293  ARG D NH2 1 
ATOM   6960 N N   . VAL D 2 256 ? -13.848 44.618 179.229 1.00 49.82  ? 294  VAL D N   1 
ATOM   6961 C CA  . VAL D 2 256 ? -13.240 44.821 177.940 1.00 50.41  ? 294  VAL D CA  1 
ATOM   6962 C C   . VAL D 2 256 ? -11.715 44.971 178.072 1.00 57.69  ? 294  VAL D C   1 
ATOM   6963 O O   . VAL D 2 256 ? -11.217 46.007 178.522 1.00 57.39  ? 294  VAL D O   1 
ATOM   6964 C CB  . VAL D 2 256 ? -13.929 46.009 177.198 1.00 52.93  ? 294  VAL D CB  1 
ATOM   6965 C CG1 . VAL D 2 256 ? -13.262 46.281 175.865 1.00 51.49  ? 294  VAL D CG1 1 
ATOM   6966 C CG2 . VAL D 2 256 ? -15.409 45.730 177.032 1.00 52.79  ? 294  VAL D CG2 1 
ATOM   6967 N N   . SER D 2 257 ? -10.976 43.936 177.676 1.00 55.31  ? 295  SER D N   1 
ATOM   6968 C CA  . SER D 2 257 ? -9.511  43.974 177.752 1.00 55.06  ? 295  SER D CA  1 
ATOM   6969 C C   . SER D 2 257 ? -8.790  43.926 176.404 1.00 59.55  ? 295  SER D C   1 
ATOM   6970 O O   . SER D 2 257 ? -9.339  43.499 175.391 1.00 58.76  ? 295  SER D O   1 
ATOM   6971 C CB  . SER D 2 257 ? -8.980  42.870 178.681 1.00 56.42  ? 295  SER D CB  1 
ATOM   6972 O OG  . SER D 2 257 ? -10.051 42.136 179.263 1.00 64.63  ? 295  SER D OG  1 
ATOM   6973 N N   . PHE D 2 258 ? -7.531  44.329 176.415 1.00 58.56  ? 296  PHE D N   1 
ATOM   6974 C CA  . PHE D 2 258 ? -6.700  44.246 175.220 1.00 59.43  ? 296  PHE D CA  1 
ATOM   6975 C C   . PHE D 2 258 ? -6.235  42.815 174.982 1.00 63.95  ? 296  PHE D C   1 
ATOM   6976 O O   . PHE D 2 258 ? -5.900  42.068 175.936 1.00 63.58  ? 296  PHE D O   1 
ATOM   6977 C CB  . PHE D 2 258 ? -5.459  45.113 175.376 1.00 61.51  ? 296  PHE D CB  1 
ATOM   6978 C CG  . PHE D 2 258 ? -5.736  46.570 175.215 1.00 64.68  ? 296  PHE D CG  1 
ATOM   6979 C CD1 . PHE D 2 258 ? -6.010  47.361 176.327 1.00 68.18  ? 296  PHE D CD1 1 
ATOM   6980 C CD2 . PHE D 2 258 ? -5.769  47.148 173.941 1.00 67.53  ? 296  PHE D CD2 1 
ATOM   6981 C CE1 . PHE D 2 258 ? -6.296  48.696 176.176 1.00 69.70  ? 296  PHE D CE1 1 
ATOM   6982 C CE2 . PHE D 2 258 ? -6.057  48.488 173.781 1.00 70.53  ? 296  PHE D CE2 1 
ATOM   6983 C CZ  . PHE D 2 258 ? -6.326  49.266 174.896 1.00 69.28  ? 296  PHE D CZ  1 
ATOM   6984 N N   . CYS D 2 259 ? -6.137  42.470 173.702 1.00 59.33  ? 297  CYS D N   1 
ATOM   6985 C CA  . CYS D 2 259 ? -5.604  41.173 173.298 1.00 59.43  ? 297  CYS D CA  1 
ATOM   6986 C C   . CYS D 2 259 ? -4.118  41.384 173.065 1.00 63.50  ? 297  CYS D C   1 
ATOM   6987 O O   . CYS D 2 259 ? -3.705  42.486 172.746 1.00 63.90  ? 297  CYS D O   1 
ATOM   6988 C CB  . CYS D 2 259 ? -6.247  40.727 171.983 1.00 59.51  ? 297  CYS D CB  1 
ATOM   6989 S SG  . CYS D 2 259 ? -7.904  40.181 172.181 1.00 63.10  ? 297  CYS D SG  1 
ATOM   6990 N N   . ALA D 2 260 ? -3.307  40.349 173.188 1.00 60.53  ? 298  ALA D N   1 
ATOM   6991 C CA  . ALA D 2 260 ? -1.893  40.559 172.917 1.00 61.67  ? 298  ALA D CA  1 
ATOM   6992 C C   . ALA D 2 260 ? -1.722  41.154 171.500 1.00 67.34  ? 298  ALA D C   1 
ATOM   6993 O O   . ALA D 2 260 ? -2.440  40.777 170.562 1.00 67.66  ? 298  ALA D O   1 
ATOM   6994 C CB  . ALA D 2 260 ? -1.123  39.252 173.064 1.00 62.40  ? 298  ALA D CB  1 
ATOM   6995 N N   . PRO D 2 261 ? -0.839  42.158 171.349 1.00 62.81  ? 299  PRO D N   1 
ATOM   6996 C CA  . PRO D 2 261 ? -0.771  42.654 169.980 1.00 62.03  ? 299  PRO D CA  1 
ATOM   6997 C C   . PRO D 2 261 ? -0.115  41.595 169.096 1.00 70.35  ? 299  PRO D C   1 
ATOM   6998 O O   . PRO D 2 261 ? 0.552   40.669 169.588 1.00 70.41  ? 299  PRO D O   1 
ATOM   6999 C CB  . PRO D 2 261 ? 0.132   43.871 170.106 1.00 63.00  ? 299  PRO D CB  1 
ATOM   7000 C CG  . PRO D 2 261 ? 0.911   43.676 171.405 1.00 67.32  ? 299  PRO D CG  1 
ATOM   7001 C CD  . PRO D 2 261 ? 0.419   42.415 172.062 1.00 63.69  ? 299  PRO D CD  1 
ATOM   7002 N N   . GLY D 2 262 ? -0.333  41.728 167.790 1.00 68.61  ? 300  GLY D N   1 
ATOM   7003 C CA  . GLY D 2 262 ? 0.195   40.821 166.793 1.00 68.27  ? 300  GLY D CA  1 
ATOM   7004 C C   . GLY D 2 262 ? -0.910  40.291 165.904 1.00 72.91  ? 300  GLY D C   1 
ATOM   7005 O O   . GLY D 2 262 ? -1.374  40.953 164.974 1.00 72.18  ? 300  GLY D O   1 
ATOM   7006 N N   . PRO D 2 263 ? -1.366  39.075 166.195 1.00 70.85  ? 301  PRO D N   1 
ATOM   7007 C CA  . PRO D 2 263 ? -2.423  38.418 165.428 1.00 71.52  ? 301  PRO D CA  1 
ATOM   7008 C C   . PRO D 2 263 ? -3.612  39.343 165.135 1.00 78.35  ? 301  PRO D C   1 
ATOM   7009 O O   . PRO D 2 263 ? -3.777  40.392 165.759 1.00 78.50  ? 301  PRO D O   1 
ATOM   7010 C CB  . PRO D 2 263 ? -2.853  37.262 166.349 1.00 73.07  ? 301  PRO D CB  1 
ATOM   7011 C CG  . PRO D 2 263 ? -1.667  36.984 167.220 1.00 76.72  ? 301  PRO D CG  1 
ATOM   7012 C CD  . PRO D 2 263 ? -0.962  38.307 167.388 1.00 72.50  ? 301  PRO D CD  1 
ATOM   7013 N N   . PRO D 2 264 ? -4.443  38.968 164.153 1.00 76.98  ? 302  PRO D N   1 
ATOM   7014 C CA  . PRO D 2 264 ? -5.645  39.772 163.912 1.00 77.04  ? 302  PRO D CA  1 
ATOM   7015 C C   . PRO D 2 264 ? -6.817  38.980 164.516 1.00 81.24  ? 302  PRO D C   1 
ATOM   7016 O O   . PRO D 2 264 ? -6.644  37.817 164.937 1.00 80.69  ? 302  PRO D O   1 
ATOM   7017 C CB  . PRO D 2 264 ? -5.735  39.821 162.377 1.00 78.79  ? 302  PRO D CB  1 
ATOM   7018 C CG  . PRO D 2 264 ? -4.345  39.479 161.893 1.00 82.95  ? 302  PRO D CG  1 
ATOM   7019 C CD  . PRO D 2 264 ? -3.852  38.480 162.891 1.00 78.64  ? 302  PRO D CD  1 
ATOM   7020 N N   . GLY D 2 265 ? -7.988  39.612 164.586 1.00 77.13  ? 303  GLY D N   1 
ATOM   7021 C CA  . GLY D 2 265 ? -9.181  39.018 165.171 1.00 76.68  ? 303  GLY D CA  1 
ATOM   7022 C C   . GLY D 2 265 ? -9.367  37.535 164.940 1.00 81.50  ? 303  GLY D C   1 
ATOM   7023 O O   . GLY D 2 265 ? -9.644  36.764 165.861 1.00 80.55  ? 303  GLY D O   1 
ATOM   7024 N N   . ARG D 2 266 ? -9.208  37.147 163.684 1.00 80.55  ? 304  ARG D N   1 
ATOM   7025 C CA  . ARG D 2 266 ? -9.387  35.776 163.245 1.00 80.97  ? 304  ARG D CA  1 
ATOM   7026 C C   . ARG D 2 266 ? -8.623  34.814 164.108 1.00 82.79  ? 304  ARG D C   1 
ATOM   7027 O O   . ARG D 2 266 ? -9.200  33.912 164.716 1.00 81.62  ? 304  ARG D O   1 
ATOM   7028 C CB  . ARG D 2 266 ? -8.880  35.641 161.810 1.00 84.85  ? 304  ARG D CB  1 
ATOM   7029 C CG  . ARG D 2 266 ? -9.822  34.901 160.888 1.00 101.75 ? 304  ARG D CG  1 
ATOM   7030 C CD  . ARG D 2 266 ? -10.512 35.852 159.930 1.00 116.76 ? 304  ARG D CD  1 
ATOM   7031 N NE  . ARG D 2 266 ? -10.575 35.306 158.578 1.00 128.02 ? 304  ARG D NE  1 
ATOM   7032 C CZ  . ARG D 2 266 ? -9.762  35.662 157.592 1.00 139.93 ? 304  ARG D CZ  1 
ATOM   7033 N NH1 . ARG D 2 266 ? -9.900  35.112 156.395 1.00 126.27 ? 304  ARG D NH1 1 
ATOM   7034 N NH2 . ARG D 2 266 ? -8.816  36.569 157.803 1.00 123.45 ? 304  ARG D NH2 1 
ATOM   7035 N N   . SER D 2 267 ? -7.307  35.004 164.109 1.00 79.01  ? 305  SER D N   1 
ATOM   7036 C CA  . SER D 2 267 ? -6.366  34.149 164.828 1.00 78.46  ? 305  SER D CA  1 
ATOM   7037 C C   . SER D 2 267 ? -6.522  34.186 166.349 1.00 80.38  ? 305  SER D C   1 
ATOM   7038 O O   . SER D 2 267 ? -6.589  33.130 167.008 1.00 80.35  ? 305  SER D O   1 
ATOM   7039 C CB  . SER D 2 267 ? -4.942  34.535 164.435 1.00 82.56  ? 305  SER D CB  1 
ATOM   7040 O OG  . SER D 2 267 ? -4.970  35.732 163.678 1.00 93.96  ? 305  SER D OG  1 
ATOM   7041 N N   . MET D 2 268 ? -6.543  35.401 166.901 1.00 73.75  ? 306  MET D N   1 
ATOM   7042 C CA  . MET D 2 268 ? -6.695  35.597 168.342 1.00 71.78  ? 306  MET D CA  1 
ATOM   7043 C C   . MET D 2 268 ? -7.906  34.810 168.879 1.00 75.06  ? 306  MET D C   1 
ATOM   7044 O O   . MET D 2 268 ? -7.841  34.141 169.928 1.00 74.50  ? 306  MET D O   1 
ATOM   7045 C CB  . MET D 2 268 ? -6.843  37.088 168.649 1.00 73.07  ? 306  MET D CB  1 
ATOM   7046 C CG  . MET D 2 268 ? -6.362  37.493 170.032 1.00 75.23  ? 306  MET D CG  1 
ATOM   7047 S SD  . MET D 2 268 ? -4.654  37.013 170.360 1.00 77.66  ? 306  MET D SD  1 
ATOM   7048 C CE  . MET D 2 268 ? -4.930  35.944 171.695 1.00 74.33  ? 306  MET D CE  1 
ATOM   7049 N N   . LEU D 2 269 ? -9.003  34.870 168.136 1.00 69.68  ? 307  LEU D N   1 
ATOM   7050 C CA  . LEU D 2 269 ? -10.197 34.142 168.524 1.00 69.59  ? 307  LEU D CA  1 
ATOM   7051 C C   . LEU D 2 269 ? -9.922  32.654 168.819 1.00 73.42  ? 307  LEU D C   1 
ATOM   7052 O O   . LEU D 2 269 ? -10.206 32.151 169.914 1.00 72.82  ? 307  LEU D O   1 
ATOM   7053 C CB  . LEU D 2 269 ? -11.273 34.302 167.446 1.00 69.43  ? 307  LEU D CB  1 
ATOM   7054 C CG  . LEU D 2 269 ? -12.616 34.714 168.034 1.00 73.22  ? 307  LEU D CG  1 
ATOM   7055 C CD1 . LEU D 2 269 ? -13.709 34.630 167.000 1.00 72.87  ? 307  LEU D CD1 1 
ATOM   7056 C CD2 . LEU D 2 269 ? -12.912 33.862 169.278 1.00 73.73  ? 307  LEU D CD2 1 
ATOM   7057 N N   . ALA D 2 270 ? -9.370  31.960 167.828 1.00 69.57  ? 308  ALA D N   1 
ATOM   7058 C CA  . ALA D 2 270 ? -9.053  30.544 167.954 1.00 68.70  ? 308  ALA D CA  1 
ATOM   7059 C C   . ALA D 2 270 ? -8.039  30.304 169.053 1.00 71.12  ? 308  ALA D C   1 
ATOM   7060 O O   . ALA D 2 270 ? -8.139  29.326 169.818 1.00 69.21  ? 308  ALA D O   1 
ATOM   7061 C CB  . ALA D 2 270 ? -8.507  30.031 166.666 1.00 69.44  ? 308  ALA D CB  1 
ATOM   7062 N N   . ALA D 2 271 ? -7.019  31.161 169.087 1.00 67.13  ? 309  ALA D N   1 
ATOM   7063 C CA  . ALA D 2 271 ? -5.981  31.015 170.099 1.00 66.11  ? 309  ALA D CA  1 
ATOM   7064 C C   . ALA D 2 271 ? -6.621  31.023 171.481 1.00 68.79  ? 309  ALA D C   1 
ATOM   7065 O O   . ALA D 2 271 ? -6.374  30.130 172.294 1.00 68.86  ? 309  ALA D O   1 
ATOM   7066 C CB  . ALA D 2 271 ? -4.960  32.098 169.972 1.00 66.53  ? 309  ALA D CB  1 
ATOM   7067 N N   . LEU D 2 272 ? -7.495  32.000 171.718 1.00 63.56  ? 310  LEU D N   1 
ATOM   7068 C CA  . LEU D 2 272 ? -8.174  32.138 173.013 1.00 61.87  ? 310  LEU D CA  1 
ATOM   7069 C C   . LEU D 2 272 ? -9.099  30.963 173.262 1.00 67.94  ? 310  LEU D C   1 
ATOM   7070 O O   . LEU D 2 272 ? -9.084  30.346 174.328 1.00 65.89  ? 310  LEU D O   1 
ATOM   7071 C CB  . LEU D 2 272 ? -8.927  33.481 173.093 1.00 60.51  ? 310  LEU D CB  1 
ATOM   7072 C CG  . LEU D 2 272 ? -7.991  34.707 173.071 1.00 62.40  ? 310  LEU D CG  1 
ATOM   7073 C CD1 . LEU D 2 272 ? -8.733  36.012 173.003 1.00 61.60  ? 310  LEU D CD1 1 
ATOM   7074 C CD2 . LEU D 2 272 ? -7.019  34.689 174.229 1.00 60.58  ? 310  LEU D CD2 1 
ATOM   7075 N N   . ILE D 2 273 ? -9.899  30.645 172.255 1.00 68.24  ? 311  ILE D N   1 
ATOM   7076 C CA  . ILE D 2 273 ? -10.806 29.520 172.347 1.00 69.01  ? 311  ILE D CA  1 
ATOM   7077 C C   . ILE D 2 273 ? -10.038 28.273 172.787 1.00 74.72  ? 311  ILE D C   1 
ATOM   7078 O O   . ILE D 2 273 ? -10.376 27.626 173.783 1.00 73.41  ? 311  ILE D O   1 
ATOM   7079 C CB  . ILE D 2 273 ? -11.452 29.286 171.012 1.00 71.99  ? 311  ILE D CB  1 
ATOM   7080 C CG1 . ILE D 2 273 ? -12.726 30.109 170.895 1.00 72.22  ? 311  ILE D CG1 1 
ATOM   7081 C CG2 . ILE D 2 273 ? -11.732 27.842 170.848 1.00 72.86  ? 311  ILE D CG2 1 
ATOM   7082 C CD1 . ILE D 2 273 ? -12.778 30.903 169.649 1.00 81.13  ? 311  ILE D CD1 1 
ATOM   7083 N N   . ALA D 2 274 ? -8.974  27.978 172.048 1.00 73.68  ? 312  ALA D N   1 
ATOM   7084 C CA  . ALA D 2 274 ? -8.104  26.841 172.327 1.00 74.40  ? 312  ALA D CA  1 
ATOM   7085 C C   . ALA D 2 274 ? -7.304  26.944 173.637 1.00 82.59  ? 312  ALA D C   1 
ATOM   7086 O O   . ALA D 2 274 ? -7.078  25.931 174.303 1.00 82.91  ? 312  ALA D O   1 
ATOM   7087 C CB  . ALA D 2 274 ? -7.174  26.604 171.145 1.00 74.90  ? 312  ALA D CB  1 
ATOM   7088 N N   . ALA D 2 275 ? -6.846  28.144 173.996 1.00 81.91  ? 313  ALA D N   1 
ATOM   7089 C CA  . ALA D 2 275 ? -6.088  28.319 175.243 1.00 83.35  ? 313  ALA D CA  1 
ATOM   7090 C C   . ALA D 2 275 ? -6.985  27.949 176.422 1.00 92.14  ? 313  ALA D C   1 
ATOM   7091 O O   . ALA D 2 275 ? -6.682  27.042 177.189 1.00 91.35  ? 313  ALA D O   1 
ATOM   7092 C CB  . ALA D 2 275 ? -5.585  29.756 175.382 1.00 83.75  ? 313  ALA D CB  1 
ATOM   7093 N N   . GLN D 2 276 ? -8.117  28.639 176.521 1.00 93.58  ? 314  GLN D N   1 
ATOM   7094 C CA  . GLN D 2 276 ? -9.130  28.371 177.540 1.00 95.24  ? 314  GLN D CA  1 
ATOM   7095 C C   . GLN D 2 276 ? -9.581  26.925 177.404 1.00 104.00 ? 314  GLN D C   1 
ATOM   7096 O O   . GLN D 2 276 ? -10.002 26.289 178.378 1.00 103.40 ? 314  GLN D O   1 
ATOM   7097 C CB  . GLN D 2 276 ? -10.337 29.290 177.322 1.00 96.27  ? 314  GLN D CB  1 
ATOM   7098 C CG  . GLN D 2 276 ? -11.668 28.729 177.805 1.00 104.07 ? 314  GLN D CG  1 
ATOM   7099 C CD  . GLN D 2 276 ? -12.844 29.286 177.021 1.00 119.27 ? 314  GLN D CD  1 
ATOM   7100 O OE1 . GLN D 2 276 ? -13.786 29.846 177.590 1.00 112.90 ? 314  GLN D OE1 1 
ATOM   7101 N NE2 . GLN D 2 276 ? -12.784 29.151 175.703 1.00 110.30 ? 314  GLN D NE2 1 
ATOM   7102 N N   . ALA D 2 277 ? -9.519  26.427 176.172 1.00 104.14 ? 315  ALA D N   1 
ATOM   7103 C CA  . ALA D 2 277 ? -9.889  25.057 175.881 1.00 105.60 ? 315  ALA D CA  1 
ATOM   7104 C C   . ALA D 2 277 ? -9.064  24.157 176.793 1.00 112.37 ? 315  ALA D C   1 
ATOM   7105 O O   . ALA D 2 277 ? -9.620  23.383 177.570 1.00 112.30 ? 315  ALA D O   1 
ATOM   7106 C CB  . ALA D 2 277 ? -9.621  24.736 174.411 1.00 106.53 ? 315  ALA D CB  1 
ATOM   7107 N N   . THR D 2 278 ? -7.741  24.307 176.739 1.00 110.54 ? 316  THR D N   1 
ATOM   7108 C CA  . THR D 2 278 ? -6.841  23.526 177.588 1.00 110.96 ? 316  THR D CA  1 
ATOM   7109 C C   . THR D 2 278 ? -7.111  23.782 179.082 1.00 116.34 ? 316  THR D C   1 
ATOM   7110 O O   . THR D 2 278 ? -6.191  24.000 179.873 1.00 115.00 ? 316  THR D O   1 
ATOM   7111 C CB  . THR D 2 278 ? -5.350  23.701 177.174 1.00 114.79 ? 316  THR D CB  1 
ATOM   7112 O OG1 . THR D 2 278 ? -4.853  24.961 177.643 1.00 112.43 ? 316  THR D OG1 1 
ATOM   7113 C CG2 . THR D 2 278 ? -5.201  23.632 175.653 1.00 109.55 ? 316  THR D CG2 1 
ATOM   7114 N N   . ALA D 2 279 ? -8.396  23.734 179.439 1.00 115.17 ? 317  ALA D N   1 
ATOM   7115 C CA  . ALA D 2 279 ? -8.900  23.945 180.798 1.00 116.16 ? 317  ALA D CA  1 
ATOM   7116 C C   . ALA D 2 279 ? -8.482  22.872 181.814 1.00 119.74 ? 317  ALA D C   1 
ATOM   7117 O O   . ALA D 2 279 ? -8.016  23.203 182.903 1.00 118.65 ? 317  ALA D O   1 
ATOM   7118 C CB  . ALA D 2 279 ? -10.425 24.095 180.779 1.00 117.03 ? 317  ALA D CB  1 
ATOM   7119 N N   . LEU D 2 280 ? -8.690  21.600 181.474 1.00 114.17 ? 318  LEU D N   1 
ATOM   7120 C CA  . LEU D 2 280 ? -8.309  20.484 182.342 1.00 98.47  ? 318  LEU D CA  1 
ATOM   7121 C C   . LEU D 2 280 ? -8.729  20.600 183.818 1.00 144.93 ? 318  LEU D C   1 
ATOM   7122 O O   . LEU D 2 280 ? -8.802  21.691 184.397 1.00 109.86 ? 318  LEU D O   1 
ATOM   7123 C CB  . LEU D 2 280 ? -6.817  20.139 182.178 1.00 97.77  ? 318  LEU D CB  1 
ATOM   7124 C CG  . LEU D 2 280 ? -5.679  20.634 183.102 1.00 101.83 ? 318  LEU D CG  1 
ATOM   7125 C CD1 . LEU D 2 280 ? -5.135  22.011 182.756 1.00 101.89 ? 318  LEU D CD1 1 
ATOM   7126 C CD2 . LEU D 2 280 ? -5.887  20.475 184.612 1.00 102.51 ? 318  LEU D CD2 1 
HETATM 7127 O O   . HOH E 3 .   ? 39.516  26.709 107.331 1.00 43.90  ? 1    HOH A O   1 
HETATM 7128 O O   . HOH E 3 .   ? 34.052  29.628 117.820 1.00 48.89  ? 2    HOH A O   1 
HETATM 7129 O O   . HOH E 3 .   ? 35.699  26.444 123.505 1.00 60.93  ? 9    HOH A O   1 
HETATM 7130 O O   . HOH E 3 .   ? 47.147  21.426 98.427  1.00 40.06  ? 16   HOH A O   1 
HETATM 7131 O O   . HOH E 3 .   ? 45.764  26.920 107.354 1.00 37.75  ? 18   HOH A O   1 
HETATM 7132 O O   . HOH E 3 .   ? 45.704  7.577  110.845 1.00 52.99  ? 19   HOH A O   1 
HETATM 7133 O O   . HOH E 3 .   ? 56.996  15.244 115.360 1.00 44.37  ? 20   HOH A O   1 
HETATM 7134 O O   . HOH E 3 .   ? 33.264  11.562 106.730 1.00 34.10  ? 22   HOH A O   1 
HETATM 7135 O O   . HOH E 3 .   ? 47.265  22.534 101.236 1.00 38.88  ? 23   HOH A O   1 
HETATM 7136 O O   . HOH E 3 .   ? 58.047  14.353 110.870 1.00 53.37  ? 24   HOH A O   1 
HETATM 7137 O O   . HOH E 3 .   ? 36.983  11.696 101.549 1.00 28.11  ? 30   HOH A O   1 
HETATM 7138 O O   . HOH E 3 .   ? 44.165  19.570 130.195 1.00 41.64  ? 33   HOH A O   1 
HETATM 7139 O O   . HOH E 3 .   ? 49.849  44.043 126.490 1.00 46.95  ? 36   HOH A O   1 
HETATM 7140 O O   . HOH E 3 .   ? 48.396  27.703 107.883 1.00 42.05  ? 39   HOH A O   1 
HETATM 7141 O O   . HOH F 3 .   ? 45.984  50.919 105.110 1.00 49.76  ? 4    HOH B O   1 
HETATM 7142 O O   . HOH F 3 .   ? 82.661  57.206 88.695  1.00 36.25  ? 6    HOH B O   1 
HETATM 7143 O O   . HOH F 3 .   ? 81.836  60.639 105.676 1.00 69.40  ? 8    HOH B O   1 
HETATM 7144 O O   . HOH F 3 .   ? 44.047  45.128 118.354 1.00 43.96  ? 11   HOH B O   1 
HETATM 7145 O O   . HOH F 3 .   ? 43.730  44.379 114.253 1.00 56.18  ? 12   HOH B O   1 
HETATM 7146 O O   . HOH F 3 .   ? 87.934  58.202 89.825  1.00 58.77  ? 15   HOH B O   1 
HETATM 7147 O O   . HOH F 3 .   ? 81.104  40.601 84.953  1.00 16.12  ? 21   HOH B O   1 
HETATM 7148 O O   . HOH F 3 .   ? 107.016 40.699 90.571  1.00 55.65  ? 25   HOH B O   1 
HETATM 7149 O O   . HOH F 3 .   ? 99.337  44.838 85.651  1.00 50.52  ? 26   HOH B O   1 
HETATM 7150 O O   . HOH F 3 .   ? 43.396  37.344 105.689 1.00 48.12  ? 28   HOH B O   1 
HETATM 7151 O O   . HOH F 3 .   ? 55.666  39.228 97.102  1.00 61.08  ? 31   HOH B O   1 
HETATM 7152 O O   . HOH F 3 .   ? 47.951  30.475 108.250 1.00 41.95  ? 32   HOH B O   1 
HETATM 7153 O O   . HOH F 3 .   ? 62.192  50.402 119.246 1.00 51.28  ? 37   HOH B O   1 
HETATM 7154 O O   . HOH F 3 .   ? 81.953  55.143 82.002  1.00 50.57  ? 38   HOH B O   1 
HETATM 7155 O O   . HOH F 3 .   ? 79.832  61.441 101.659 1.00 57.22  ? 322  HOH B O   1 
HETATM 7156 O O   . HOH G 3 .   ? 54.052  22.734 165.859 1.00 54.78  ? 10   HOH C O   1 
HETATM 7157 O O   . HOH G 3 .   ? 41.630  23.720 164.735 1.00 47.23  ? 17   HOH C O   1 
HETATM 7158 O O   . HOH G 3 .   ? 26.669  23.185 143.705 1.00 50.55  ? 35   HOH C O   1 
HETATM 7159 O O   . HOH H 3 .   ? -0.924  26.954 183.504 1.00 58.24  ? 3    HOH D O   1 
HETATM 7160 O O   . HOH H 3 .   ? -19.092 52.404 179.968 1.00 46.47  ? 5    HOH D O   1 
HETATM 7161 O O   . HOH H 3 .   ? -9.917  60.848 168.463 1.00 58.68  ? 7    HOH D O   1 
HETATM 7162 O O   . HOH H 3 .   ? 23.945  39.779 160.546 1.00 49.67  ? 13   HOH D O   1 
HETATM 7163 O O   . HOH H 3 .   ? 41.129  43.150 155.770 1.00 51.26  ? 14   HOH D O   1 
HETATM 7164 O O   . HOH H 3 .   ? -19.496 34.962 181.542 1.00 65.67  ? 27   HOH D O   1 
HETATM 7165 O O   . HOH H 3 .   ? -27.270 45.098 184.681 1.00 62.57  ? 29   HOH D O   1 
HETATM 7166 O O   . HOH H 3 .   ? 19.947  45.193 163.090 1.00 54.07  ? 34   HOH D O   1 
HETATM 7167 O O   . HOH H 3 .   ? 12.115  45.439 183.353 1.00 47.97  ? 322  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   879  ?    ?   ?   A . n 
A 1 2   GLU 2   880  ?    ?   ?   A . n 
A 1 3   LYS 3   881  ?    ?   ?   A . n 
A 1 4   ASP 4   882  882  ASP ASP A . n 
A 1 5   GLU 5   883  883  GLU GLU A . n 
A 1 6   GLU 6   884  884  GLU GLU A . n 
A 1 7   PHE 7   885  885  PHE PHE A . n 
A 1 8   PRO 8   886  886  PRO PRO A . n 
A 1 9   GLU 9   887  887  GLU GLU A . n 
A 1 10  GLN 10  888  888  GLN GLN A . n 
A 1 11  LYS 11  889  889  LYS LYS A . n 
A 1 12  ALA 12  890  890  ALA ALA A . n 
A 1 13  GLY 13  891  891  GLY GLY A . n 
A 1 14  GLU 14  892  892  GLU GLU A . n 
A 1 15  VAL 15  893  893  VAL VAL A . n 
A 1 16  ILE 16  894  894  ILE ILE A . n 
A 1 17  ASN 17  895  895  ASN ASN A . n 
A 1 18  GLN 18  896  896  GLN GLN A . n 
A 1 19  PRO 19  897  897  PRO PRO A . n 
A 1 20  MET 20  898  898  MET MET A . n 
A 1 21  MET 21  899  899  MET MET A . n 
A 1 22  MET 22  900  900  MET MET A . n 
A 1 23  ALA 23  901  901  ALA ALA A . n 
A 1 24  ALA 24  902  902  ALA ALA A . n 
A 1 25  ARG 25  903  903  ARG ARG A . n 
A 1 26  GLN 26  904  904  GLN GLN A . n 
A 1 27  LEU 27  905  905  LEU LEU A . n 
A 1 28  HIS 28  906  906  HIS HIS A . n 
A 1 29  ASP 29  907  907  ASP ASP A . n 
A 1 30  GLU 30  908  908  GLU GLU A . n 
A 1 31  ALA 31  909  909  ALA ALA A . n 
A 1 32  ARG 32  910  910  ARG ARG A . n 
A 1 33  LYS 33  911  911  LYS LYS A . n 
A 1 34  TRP 34  912  912  TRP TRP A . n 
A 1 35  SER 35  913  913  SER SER A . n 
A 1 36  SER 36  914  914  SER SER A . n 
A 1 37  LYS 37  915  915  LYS LYS A . n 
A 1 38  GLY 38  916  916  GLY GLY A . n 
A 1 39  ASN 39  917  917  ASN ASN A . n 
A 1 40  ASP 40  918  918  ASP ASP A . n 
A 1 41  ILE 41  919  919  ILE ILE A . n 
A 1 42  ILE 42  920  920  ILE ILE A . n 
A 1 43  ALA 43  921  921  ALA ALA A . n 
A 1 44  ALA 44  922  922  ALA ALA A . n 
A 1 45  ALA 45  923  923  ALA ALA A . n 
A 1 46  LYS 46  924  924  LYS LYS A . n 
A 1 47  ARG 47  925  925  ARG ARG A . n 
A 1 48  MET 48  926  926  MET MET A . n 
A 1 49  ALA 49  927  927  ALA ALA A . n 
A 1 50  LEU 50  928  928  LEU LEU A . n 
A 1 51  LEU 51  929  929  LEU LEU A . n 
A 1 52  MET 52  930  930  MET MET A . n 
A 1 53  ALA 53  931  931  ALA ALA A . n 
A 1 54  GLU 54  932  932  GLU GLU A . n 
A 1 55  MET 55  933  933  MET MET A . n 
A 1 56  SER 56  934  934  SER SER A . n 
A 1 57  ARG 57  935  935  ARG ARG A . n 
A 1 58  LEU 58  936  936  LEU LEU A . n 
A 1 59  VAL 59  937  937  VAL VAL A . n 
A 1 60  ARG 60  938  938  ARG ARG A . n 
A 1 61  GLY 61  939  939  GLY GLY A . n 
A 1 62  GLY 62  940  940  GLY GLY A . n 
A 1 63  SER 63  941  941  SER SER A . n 
A 1 64  GLY 64  942  942  GLY GLY A . n 
A 1 65  THR 65  943  943  THR THR A . n 
A 1 66  LYS 66  944  944  LYS LYS A . n 
A 1 67  ARG 67  945  945  ARG ARG A . n 
A 1 68  ALA 68  946  946  ALA ALA A . n 
A 1 69  LEU 69  947  947  LEU LEU A . n 
A 1 70  ILE 70  948  948  ILE ILE A . n 
A 1 71  GLN 71  949  949  GLN GLN A . n 
A 1 72  CYS 72  950  950  CYS CYS A . n 
A 1 73  ALA 73  951  951  ALA ALA A . n 
A 1 74  LYS 74  952  952  LYS LYS A . n 
A 1 75  ASP 75  953  953  ASP ASP A . n 
A 1 76  ILE 76  954  954  ILE ILE A . n 
A 1 77  ALA 77  955  955  ALA ALA A . n 
A 1 78  LYS 78  956  956  LYS LYS A . n 
A 1 79  ALA 79  957  957  ALA ALA A . n 
A 1 80  SER 80  958  958  SER SER A . n 
A 1 81  ASP 81  959  959  ASP ASP A . n 
A 1 82  GLU 82  960  960  GLU GLU A . n 
A 1 83  VAL 83  961  961  VAL VAL A . n 
A 1 84  THR 84  962  962  THR THR A . n 
A 1 85  ARG 85  963  963  ARG ARG A . n 
A 1 86  LEU 86  964  964  LEU LEU A . n 
A 1 87  ALA 87  965  965  ALA ALA A . n 
A 1 88  LYS 88  966  966  LYS LYS A . n 
A 1 89  GLU 89  967  967  GLU GLU A . n 
A 1 90  VAL 90  968  968  VAL VAL A . n 
A 1 91  ALA 91  969  969  ALA ALA A . n 
A 1 92  LYS 92  970  970  LYS LYS A . n 
A 1 93  GLN 93  971  971  GLN GLN A . n 
A 1 94  CYS 94  972  972  CYS CYS A . n 
A 1 95  THR 95  973  973  THR THR A . n 
A 1 96  ASP 96  974  974  ASP ASP A . n 
A 1 97  LYS 97  975  975  LYS LYS A . n 
A 1 98  ARG 98  976  976  ARG ARG A . n 
A 1 99  ILE 99  977  977  ILE ILE A . n 
A 1 100 ARG 100 978  978  ARG ARG A . n 
A 1 101 THR 101 979  979  THR THR A . n 
A 1 102 ASN 102 980  980  ASN ASN A . n 
A 1 103 LEU 103 981  981  LEU LEU A . n 
A 1 104 LEU 104 982  982  LEU LEU A . n 
A 1 105 GLN 105 983  983  GLN GLN A . n 
A 1 106 VAL 106 984  984  VAL VAL A . n 
A 1 107 CYS 107 985  985  CYS CYS A . n 
A 1 108 GLU 108 986  986  GLU GLU A . n 
A 1 109 ARG 109 987  987  ARG ARG A . n 
A 1 110 ILE 110 988  988  ILE ILE A . n 
A 1 111 PRO 111 989  989  PRO PRO A . n 
A 1 112 THR 112 990  990  THR THR A . n 
A 1 113 ILE 113 991  991  ILE ILE A . n 
A 1 114 SER 114 992  992  SER SER A . n 
A 1 115 THR 115 993  993  THR THR A . n 
A 1 116 GLN 116 994  994  GLN GLN A . n 
A 1 117 LEU 117 995  995  LEU LEU A . n 
A 1 118 LYS 118 996  996  LYS LYS A . n 
A 1 119 ILE 119 997  997  ILE ILE A . n 
A 1 120 LEU 120 998  998  LEU LEU A . n 
A 1 121 SER 121 999  999  SER SER A . n 
A 1 122 THR 122 1000 1000 THR THR A . n 
A 1 123 VAL 123 1001 1001 VAL VAL A . n 
A 1 124 LYS 124 1002 1002 LYS LYS A . n 
A 1 125 ALA 125 1003 1003 ALA ALA A . n 
A 1 126 THR 126 1004 1004 THR THR A . n 
A 1 127 MET 127 1005 1005 MET MET A . n 
A 1 128 LEU 128 1006 1006 LEU LEU A . n 
A 1 129 GLY 129 1007 1007 GLY GLY A . n 
A 1 130 ARG 130 1008 1008 ARG ARG A . n 
A 1 131 THR 131 1009 1009 THR THR A . n 
A 1 132 ASN 132 1010 1010 ASN ASN A . n 
A 1 133 ILE 133 1011 1011 ILE ILE A . n 
A 1 134 SER 134 1012 1012 SER SER A . n 
A 1 135 ASP 135 1013 1013 ASP ASP A . n 
A 1 136 GLU 136 1014 1014 GLU GLU A . n 
A 1 137 GLU 137 1015 1015 GLU GLU A . n 
A 1 138 SER 138 1016 1016 SER SER A . n 
A 1 139 GLU 139 1017 1017 GLU GLU A . n 
A 1 140 GLN 140 1018 1018 GLN GLN A . n 
A 1 141 ALA 141 1019 1019 ALA ALA A . n 
A 1 142 THR 142 1020 1020 THR THR A . n 
A 1 143 GLU 143 1021 1021 GLU GLU A . n 
A 1 144 MET 144 1022 1022 MET MET A . n 
A 1 145 LEU 145 1023 1023 LEU LEU A . n 
A 1 146 VAL 146 1024 1024 VAL VAL A . n 
A 1 147 HIS 147 1025 1025 HIS HIS A . n 
A 1 148 ASN 148 1026 1026 ASN ASN A . n 
A 1 149 ALA 149 1027 1027 ALA ALA A . n 
A 1 150 GLN 150 1028 1028 GLN GLN A . n 
A 1 151 ASN 151 1029 1029 ASN ASN A . n 
A 1 152 LEU 152 1030 1030 LEU LEU A . n 
A 1 153 MET 153 1031 1031 MET MET A . n 
A 1 154 GLN 154 1032 1032 GLN GLN A . n 
A 1 155 SER 155 1033 1033 SER SER A . n 
A 1 156 VAL 156 1034 1034 VAL VAL A . n 
A 1 157 LYS 157 1035 1035 LYS LYS A . n 
A 1 158 GLU 158 1036 1036 GLU GLU A . n 
A 1 159 THR 159 1037 1037 THR THR A . n 
A 1 160 VAL 160 1038 1038 VAL VAL A . n 
A 1 161 ARG 161 1039 1039 ARG ARG A . n 
A 1 162 GLU 162 1040 1040 GLU GLU A . n 
A 1 163 ALA 163 1041 1041 ALA ALA A . n 
A 1 164 GLU 164 1042 1042 GLU GLU A . n 
A 1 165 ALA 165 1043 1043 ALA ALA A . n 
A 1 166 ALA 166 1044 1044 ALA ALA A . n 
A 1 167 SER 167 1045 1045 SER SER A . n 
A 1 168 ILE 168 1046 1046 ILE ILE A . n 
A 1 169 LYS 169 1047 1047 LYS LYS A . n 
A 1 170 ILE 170 1048 1048 ILE ILE A . n 
A 1 171 ARG 171 1049 1049 ARG ARG A . n 
A 1 172 THR 172 1050 1050 THR THR A . n 
A 1 173 ASP 173 1051 1051 ASP ASP A . n 
A 1 174 ALA 174 1052 1052 ALA ALA A . n 
A 1 175 GLY 175 1053 1053 GLY GLY A . n 
A 1 176 PHE 176 1054 1054 PHE PHE A . n 
A 1 177 THR 177 1055 1055 THR THR A . n 
A 1 178 LEU 178 1056 1056 LEU LEU A . n 
A 1 179 ARG 179 1057 1057 ARG ARG A . n 
A 1 180 TRP 180 1058 1058 TRP TRP A . n 
A 1 181 VAL 181 1059 1059 VAL VAL A . n 
A 1 182 ARG 182 1060 1060 ARG ARG A . n 
A 1 183 LYS 183 1061 1061 LYS LYS A . n 
A 1 184 THR 184 1062 1062 THR THR A . n 
A 1 185 PRO 185 1063 1063 PRO PRO A . n 
A 1 186 TRP 186 1064 ?    ?   ?   A . n 
A 1 187 TYR 187 1065 ?    ?   ?   A . n 
A 1 188 GLN 188 1066 ?    ?   ?   A . n 
B 2 1   LEU 1   39   39   LEU LEU B . n 
B 2 2   ASP 2   40   40   ASP ASP B . n 
B 2 3   PRO 3   41   41   PRO PRO B . n 
B 2 4   GLU 4   42   42   GLU GLU B . n 
B 2 5   GLU 5   43   43   GLU GLU B . n 
B 2 6   ILE 6   44   44   ILE ILE B . n 
B 2 7   ARG 7   45   45   ARG ARG B . n 
B 2 8   LYS 8   46   46   LYS LYS B . n 
B 2 9   ARG 9   47   47   ARG ARG B . n 
B 2 10  LEU 10  48   48   LEU LEU B . n 
B 2 11  GLU 11  49   49   GLU GLU B . n 
B 2 12  HIS 12  50   50   HIS HIS B . n 
B 2 13  THR 13  51   51   THR THR B . n 
B 2 14  GLU 14  52   52   GLU GLU B . n 
B 2 15  ARG 15  53   53   ARG ARG B . n 
B 2 16  GLN 16  54   54   GLN GLN B . n 
B 2 17  PHE 17  55   55   PHE PHE B . n 
B 2 18  ARG 18  56   56   ARG ARG B . n 
B 2 19  ASN 19  57   57   ASN ASN B . n 
B 2 20  ARG 20  58   58   ARG ARG B . n 
B 2 21  ARG 21  59   59   ARG ARG B . n 
B 2 22  LYS 22  60   60   LYS LYS B . n 
B 2 23  ILE 23  61   61   ILE ILE B . n 
B 2 24  LEU 24  62   62   LEU LEU B . n 
B 2 25  ILE 25  63   63   ILE ILE B . n 
B 2 26  ARG 26  64   64   ARG ARG B . n 
B 2 27  GLY 27  65   65   GLY GLY B . n 
B 2 28  LEU 28  66   66   LEU LEU B . n 
B 2 29  PRO 29  67   67   PRO PRO B . n 
B 2 30  GLY 30  68   68   GLY GLY B . n 
B 2 31  ASP 31  69   69   ASP ASP B . n 
B 2 32  VAL 32  70   70   VAL VAL B . n 
B 2 33  THR 33  71   71   THR THR B . n 
B 2 34  ASN 34  72   72   ASN ASN B . n 
B 2 35  GLN 35  73   73   GLN GLN B . n 
B 2 36  GLU 36  74   74   GLU GLU B . n 
B 2 37  VAL 37  75   75   VAL VAL B . n 
B 2 38  HIS 38  76   76   HIS HIS B . n 
B 2 39  ASP 39  77   77   ASP ASP B . n 
B 2 40  LEU 40  78   78   LEU LEU B . n 
B 2 41  LEU 41  79   79   LEU LEU B . n 
B 2 42  SER 42  80   80   SER SER B . n 
B 2 43  ASP 43  81   81   ASP ASP B . n 
B 2 44  TYR 44  82   82   TYR TYR B . n 
B 2 45  GLU 45  83   83   GLU GLU B . n 
B 2 46  LEU 46  84   84   LEU LEU B . n 
B 2 47  LYS 47  85   85   LYS LYS B . n 
B 2 48  TYR 48  86   86   TYR TYR B . n 
B 2 49  CYS 49  87   87   CYS CYS B . n 
B 2 50  PHE 50  88   88   PHE PHE B . n 
B 2 51  VAL 51  89   89   VAL VAL B . n 
B 2 52  ASP 52  90   90   ASP ASP B . n 
B 2 53  LYS 53  91   91   LYS LYS B . n 
B 2 54  TYR 54  92   92   TYR TYR B . n 
B 2 55  LYS 55  93   93   LYS LYS B . n 
B 2 56  GLY 56  94   94   GLY GLY B . n 
B 2 57  THR 57  95   95   THR THR B . n 
B 2 58  ALA 58  96   96   ALA ALA B . n 
B 2 59  PHE 59  97   97   PHE PHE B . n 
B 2 60  VAL 60  98   98   VAL VAL B . n 
B 2 61  THR 61  99   99   THR THR B . n 
B 2 62  LEU 62  100  100  LEU LEU B . n 
B 2 63  LEU 63  101  101  LEU LEU B . n 
B 2 64  ASN 64  102  102  ASN ASN B . n 
B 2 65  GLY 65  103  103  GLY GLY B . n 
B 2 66  GLU 66  104  104  GLU GLU B . n 
B 2 67  GLN 67  105  105  GLN GLN B . n 
B 2 68  ALA 68  106  106  ALA ALA B . n 
B 2 69  GLU 69  107  107  GLU GLU B . n 
B 2 70  ALA 70  108  108  ALA ALA B . n 
B 2 71  ALA 71  109  109  ALA ALA B . n 
B 2 72  ILE 72  110  110  ILE ILE B . n 
B 2 73  ASN 73  111  111  ASN ASN B . n 
B 2 74  ALA 74  112  112  ALA ALA B . n 
B 2 75  PHE 75  113  113  PHE PHE B . n 
B 2 76  HIS 76  114  114  HIS HIS B . n 
B 2 77  GLN 77  115  115  GLN GLN B . n 
B 2 78  SER 78  116  116  SER SER B . n 
B 2 79  ARG 79  117  117  ARG ARG B . n 
B 2 80  LEU 80  118  118  LEU LEU B . n 
B 2 81  ARG 81  119  119  ARG ARG B . n 
B 2 82  GLU 82  120  120  GLU GLU B . n 
B 2 83  ARG 83  121  121  ARG ARG B . n 
B 2 84  GLU 84  122  122  GLU GLU B . n 
B 2 85  LEU 85  123  123  LEU LEU B . n 
B 2 86  SER 86  124  124  SER SER B . n 
B 2 87  VAL 87  125  125  VAL VAL B . n 
B 2 88  GLN 88  126  126  GLN GLN B . n 
B 2 89  LEU 89  127  127  LEU LEU B . n 
B 2 90  GLN 90  128  128  GLN GLN B . n 
B 2 91  PRO 91  129  129  PRO PRO B . n 
B 2 92  THR 92  130  130  THR THR B . n 
B 2 93  ASP 93  131  131  ASP ASP B . n 
B 2 94  ALA 94  132  132  ALA ALA B . n 
B 2 95  LEU 95  133  133  LEU LEU B . n 
B 2 96  LEU 96  134  134  LEU LEU B . n 
B 2 97  CYS 97  135  135  CYS CYS B . n 
B 2 98  VAL 98  136  136  VAL VAL B . n 
B 2 99  ALA 99  137  137  ALA ALA B . n 
B 2 100 ASN 100 138  138  ASN ASN B . n 
B 2 101 LEU 101 139  139  LEU LEU B . n 
B 2 102 PRO 102 140  140  PRO PRO B . n 
B 2 103 PRO 103 141  141  PRO PRO B . n 
B 2 104 SER 104 142  142  SER SER B . n 
B 2 105 LEU 105 143  143  LEU LEU B . n 
B 2 106 THR 106 144  144  THR THR B . n 
B 2 107 GLN 107 145  145  GLN GLN B . n 
B 2 108 GLN 108 146  146  GLN GLN B . n 
B 2 109 GLN 109 147  147  GLN GLN B . n 
B 2 110 PHE 110 148  148  PHE PHE B . n 
B 2 111 GLU 111 149  149  GLU GLU B . n 
B 2 112 GLU 112 150  150  GLU GLU B . n 
B 2 113 LEU 113 151  151  LEU LEU B . n 
B 2 114 VAL 114 152  152  VAL VAL B . n 
B 2 115 ARG 115 153  153  ARG ARG B . n 
B 2 116 PRO 116 154  154  PRO PRO B . n 
B 2 117 PHE 117 155  155  PHE PHE B . n 
B 2 118 GLY 118 156  156  GLY GLY B . n 
B 2 119 SER 119 157  157  SER SER B . n 
B 2 120 LEU 120 158  158  LEU LEU B . n 
B 2 121 GLU 121 159  159  GLU GLU B . n 
B 2 122 ARG 122 160  160  ARG ARG B . n 
B 2 123 CYS 123 161  161  CYS CYS B . n 
B 2 124 PHE 124 162  162  PHE PHE B . n 
B 2 125 LEU 125 163  163  LEU LEU B . n 
B 2 126 VAL 126 164  164  VAL VAL B . n 
B 2 127 TYR 127 165  165  TYR TYR B . n 
B 2 128 SER 128 166  166  SER SER B . n 
B 2 129 GLU 129 167  167  GLU GLU B . n 
B 2 130 ARG 130 168  168  ARG ARG B . n 
B 2 131 THR 131 169  169  THR THR B . n 
B 2 132 GLY 132 170  170  GLY GLY B . n 
B 2 133 GLN 133 171  171  GLN GLN B . n 
B 2 134 SER 134 172  172  SER SER B . n 
B 2 135 LYS 135 173  173  LYS LYS B . n 
B 2 136 GLY 136 174  174  GLY GLY B . n 
B 2 137 TYR 137 175  175  TYR TYR B . n 
B 2 138 GLY 138 176  176  GLY GLY B . n 
B 2 139 PHE 139 177  177  PHE PHE B . n 
B 2 140 ALA 140 178  178  ALA ALA B . n 
B 2 141 GLU 141 179  179  GLU GLU B . n 
B 2 142 TYR 142 180  180  TYR TYR B . n 
B 2 143 MET 143 181  181  MET MET B . n 
B 2 144 LYS 144 182  182  LYS LYS B . n 
B 2 145 LYS 145 183  183  LYS LYS B . n 
B 2 146 ASP 146 184  184  ASP ASP B . n 
B 2 147 SER 147 185  185  SER SER B . n 
B 2 148 ALA 148 186  186  ALA ALA B . n 
B 2 149 ALA 149 187  187  ALA ALA B . n 
B 2 150 ARG 150 188  188  ARG ARG B . n 
B 2 151 ALA 151 189  189  ALA ALA B . n 
B 2 152 LYS 152 190  190  LYS LYS B . n 
B 2 153 SER 153 191  191  SER SER B . n 
B 2 154 ASP 154 192  192  ASP ASP B . n 
B 2 155 LEU 155 193  193  LEU LEU B . n 
B 2 156 LEU 156 194  194  LEU LEU B . n 
B 2 157 GLY 157 195  195  GLY GLY B . n 
B 2 158 LYS 158 196  196  LYS LYS B . n 
B 2 159 PRO 159 197  197  PRO PRO B . n 
B 2 160 LEU 160 198  198  LEU LEU B . n 
B 2 161 GLY 161 199  199  GLY GLY B . n 
B 2 162 PRO 162 200  200  PRO PRO B . n 
B 2 163 ARG 163 201  201  ARG ARG B . n 
B 2 164 THR 164 202  202  THR THR B . n 
B 2 165 LEU 165 203  203  LEU LEU B . n 
B 2 166 TYR 166 204  204  TYR TYR B . n 
B 2 167 VAL 167 205  205  VAL VAL B . n 
B 2 168 HIS 168 206  206  HIS HIS B . n 
B 2 169 TRP 169 207  207  TRP TRP B . n 
B 2 170 THR 170 208  208  THR THR B . n 
B 2 171 ASP 171 209  209  ASP ASP B . n 
B 2 172 ALA 172 210  210  ALA ALA B . n 
B 2 173 GLY 173 211  211  GLY GLY B . n 
B 2 174 GLN 174 212  212  GLN GLN B . n 
B 2 175 LEU 175 213  213  LEU LEU B . n 
B 2 176 THR 176 214  214  THR THR B . n 
B 2 177 PRO 177 215  215  PRO PRO B . n 
B 2 178 ALA 178 216  216  ALA ALA B . n 
B 2 179 LEU 179 217  217  LEU LEU B . n 
B 2 180 LEU 180 218  218  LEU LEU B . n 
B 2 181 HIS 181 219  219  HIS HIS B . n 
B 2 182 SER 182 220  220  SER SER B . n 
B 2 183 ARG 183 221  221  ARG ARG B . n 
B 2 184 CYS 184 222  222  CYS CYS B . n 
B 2 185 LEU 185 223  223  LEU LEU B . n 
B 2 186 CYS 186 224  224  CYS CYS B . n 
B 2 187 VAL 187 225  225  VAL VAL B . n 
B 2 188 ASP 188 226  226  ASP ASP B . n 
B 2 189 ARG 189 227  227  ARG ARG B . n 
B 2 190 LEU 190 228  228  LEU LEU B . n 
B 2 191 PRO 191 229  229  PRO PRO B . n 
B 2 192 PRO 192 230  230  PRO PRO B . n 
B 2 193 GLY 193 231  231  GLY GLY B . n 
B 2 194 PHE 194 232  232  PHE PHE B . n 
B 2 195 ASN 195 233  233  ASN ASN B . n 
B 2 196 ASP 196 234  234  ASP ASP B . n 
B 2 197 VAL 197 235  235  VAL VAL B . n 
B 2 198 ASP 198 236  236  ASP ASP B . n 
B 2 199 ALA 199 237  237  ALA ALA B . n 
B 2 200 LEU 200 238  238  LEU LEU B . n 
B 2 201 CYS 201 239  239  CYS CYS B . n 
B 2 202 ARG 202 240  240  ARG ARG B . n 
B 2 203 ALA 203 241  241  ALA ALA B . n 
B 2 204 LEU 204 242  242  LEU LEU B . n 
B 2 205 SER 205 243  243  SER SER B . n 
B 2 206 ALA 206 244  244  ALA ALA B . n 
B 2 207 VAL 207 245  245  VAL VAL B . n 
B 2 208 HIS 208 246  246  HIS HIS B . n 
B 2 209 SER 209 247  247  SER SER B . n 
B 2 210 PRO 210 248  248  PRO PRO B . n 
B 2 211 THR 211 249  249  THR THR B . n 
B 2 212 PHE 212 250  250  PHE PHE B . n 
B 2 213 CYS 213 251  251  CYS CYS B . n 
B 2 214 GLN 214 252  252  GLN GLN B . n 
B 2 215 LEU 215 253  253  LEU LEU B . n 
B 2 216 ALA 216 254  254  ALA ALA B . n 
B 2 217 CYS 217 255  255  CYS CYS B . n 
B 2 218 GLY 218 256  256  GLY GLY B . n 
B 2 219 GLN 219 257  257  GLN GLN B . n 
B 2 220 ASP 220 258  258  ASP ASP B . n 
B 2 221 GLY 221 259  259  GLY GLY B . n 
B 2 222 GLN 222 260  260  GLN GLN B . n 
B 2 223 LEU 223 261  261  LEU LEU B . n 
B 2 224 LYS 224 262  262  LYS LYS B . n 
B 2 225 GLY 225 263  263  GLY GLY B . n 
B 2 226 PHE 226 264  264  PHE PHE B . n 
B 2 227 ALA 227 265  265  ALA ALA B . n 
B 2 228 VAL 228 266  266  VAL VAL B . n 
B 2 229 LEU 229 267  267  LEU LEU B . n 
B 2 230 GLU 230 268  268  GLU GLU B . n 
B 2 231 TYR 231 269  269  TYR TYR B . n 
B 2 232 GLU 232 270  270  GLU GLU B . n 
B 2 233 THR 233 271  271  THR THR B . n 
B 2 234 ALA 234 272  272  ALA ALA B . n 
B 2 235 GLU 235 273  273  GLU GLU B . n 
B 2 236 MET 236 274  274  MET MET B . n 
B 2 237 ALA 237 275  275  ALA ALA B . n 
B 2 238 GLU 238 276  276  GLU GLU B . n 
B 2 239 GLU 239 277  277  GLU GLU B . n 
B 2 240 ALA 240 278  278  ALA ALA B . n 
B 2 241 GLN 241 279  279  GLN GLN B . n 
B 2 242 GLN 242 280  280  GLN GLN B . n 
B 2 243 GLN 243 281  281  GLN GLN B . n 
B 2 244 ALA 244 282  282  ALA ALA B . n 
B 2 245 ASP 245 283  283  ASP ASP B . n 
B 2 246 GLY 246 284  284  GLY GLY B . n 
B 2 247 LEU 247 285  285  LEU LEU B . n 
B 2 248 SER 248 286  286  SER SER B . n 
B 2 249 LEU 249 287  287  LEU LEU B . n 
B 2 250 GLY 250 288  288  GLY GLY B . n 
B 2 251 GLY 251 289  289  GLY GLY B . n 
B 2 252 SER 252 290  290  SER SER B . n 
B 2 253 HIS 253 291  291  HIS HIS B . n 
B 2 254 LEU 254 292  292  LEU LEU B . n 
B 2 255 ARG 255 293  293  ARG ARG B . n 
B 2 256 VAL 256 294  294  VAL VAL B . n 
B 2 257 SER 257 295  295  SER SER B . n 
B 2 258 PHE 258 296  296  PHE PHE B . n 
B 2 259 CYS 259 297  297  CYS CYS B . n 
B 2 260 ALA 260 298  298  ALA ALA B . n 
B 2 261 PRO 261 299  299  PRO PRO B . n 
B 2 262 GLY 262 300  300  GLY GLY B . n 
B 2 263 PRO 263 301  301  PRO PRO B . n 
B 2 264 PRO 264 302  302  PRO PRO B . n 
B 2 265 GLY 265 303  303  GLY GLY B . n 
B 2 266 ARG 266 304  304  ARG ARG B . n 
B 2 267 SER 267 305  305  SER SER B . n 
B 2 268 MET 268 306  306  MET MET B . n 
B 2 269 LEU 269 307  307  LEU LEU B . n 
B 2 270 ALA 270 308  308  ALA ALA B . n 
B 2 271 ALA 271 309  309  ALA ALA B . n 
B 2 272 LEU 272 310  310  LEU LEU B . n 
B 2 273 ILE 273 311  311  ILE ILE B . n 
B 2 274 ALA 274 312  312  ALA ALA B . n 
B 2 275 ALA 275 313  313  ALA ALA B . n 
B 2 276 GLN 276 314  314  GLN GLN B . n 
B 2 277 ALA 277 315  315  ALA ALA B . n 
B 2 278 THR 278 316  316  THR THR B . n 
B 2 279 ALA 279 317  317  ALA ALA B . n 
B 2 280 LEU 280 318  ?    ?   ?   B . n 
B 2 281 ASN 281 319  ?    ?   ?   B . n 
B 2 282 ARG 282 320  ?    ?   ?   B . n 
B 2 283 GLY 283 321  ?    ?   ?   B . n 
C 1 1   GLU 1   879  ?    ?   ?   C . n 
C 1 2   GLU 2   880  ?    ?   ?   C . n 
C 1 3   LYS 3   881  ?    ?   ?   C . n 
C 1 4   ASP 4   882  ?    ?   ?   C . n 
C 1 5   GLU 5   883  883  GLU GLU C . n 
C 1 6   GLU 6   884  884  GLU GLU C . n 
C 1 7   PHE 7   885  885  PHE PHE C . n 
C 1 8   PRO 8   886  886  PRO PRO C . n 
C 1 9   GLU 9   887  887  GLU GLU C . n 
C 1 10  GLN 10  888  888  GLN GLN C . n 
C 1 11  LYS 11  889  ?    ?   ?   C . n 
C 1 12  ALA 12  890  ?    ?   ?   C . n 
C 1 13  GLY 13  891  ?    ?   ?   C . n 
C 1 14  GLU 14  892  892  GLU GLU C . n 
C 1 15  VAL 15  893  893  VAL VAL C . n 
C 1 16  ILE 16  894  894  ILE ILE C . n 
C 1 17  ASN 17  895  895  ASN ASN C . n 
C 1 18  GLN 18  896  896  GLN GLN C . n 
C 1 19  PRO 19  897  897  PRO PRO C . n 
C 1 20  MET 20  898  898  MET MET C . n 
C 1 21  MET 21  899  899  MET MET C . n 
C 1 22  MET 22  900  900  MET MET C . n 
C 1 23  ALA 23  901  901  ALA ALA C . n 
C 1 24  ALA 24  902  902  ALA ALA C . n 
C 1 25  ARG 25  903  903  ARG ARG C . n 
C 1 26  GLN 26  904  904  GLN GLN C . n 
C 1 27  LEU 27  905  905  LEU LEU C . n 
C 1 28  HIS 28  906  906  HIS HIS C . n 
C 1 29  ASP 29  907  907  ASP ASP C . n 
C 1 30  GLU 30  908  908  GLU GLU C . n 
C 1 31  ALA 31  909  909  ALA ALA C . n 
C 1 32  ARG 32  910  910  ARG ARG C . n 
C 1 33  LYS 33  911  911  LYS LYS C . n 
C 1 34  TRP 34  912  912  TRP TRP C . n 
C 1 35  SER 35  913  913  SER SER C . n 
C 1 36  SER 36  914  914  SER SER C . n 
C 1 37  LYS 37  915  915  LYS LYS C . n 
C 1 38  GLY 38  916  916  GLY GLY C . n 
C 1 39  ASN 39  917  917  ASN ASN C . n 
C 1 40  ASP 40  918  918  ASP ASP C . n 
C 1 41  ILE 41  919  919  ILE ILE C . n 
C 1 42  ILE 42  920  920  ILE ILE C . n 
C 1 43  ALA 43  921  921  ALA ALA C . n 
C 1 44  ALA 44  922  922  ALA ALA C . n 
C 1 45  ALA 45  923  923  ALA ALA C . n 
C 1 46  LYS 46  924  924  LYS LYS C . n 
C 1 47  ARG 47  925  925  ARG ARG C . n 
C 1 48  MET 48  926  926  MET MET C . n 
C 1 49  ALA 49  927  927  ALA ALA C . n 
C 1 50  LEU 50  928  928  LEU LEU C . n 
C 1 51  LEU 51  929  929  LEU LEU C . n 
C 1 52  MET 52  930  930  MET MET C . n 
C 1 53  ALA 53  931  931  ALA ALA C . n 
C 1 54  GLU 54  932  932  GLU GLU C . n 
C 1 55  MET 55  933  933  MET MET C . n 
C 1 56  SER 56  934  934  SER SER C . n 
C 1 57  ARG 57  935  935  ARG ARG C . n 
C 1 58  LEU 58  936  936  LEU LEU C . n 
C 1 59  VAL 59  937  937  VAL VAL C . n 
C 1 60  ARG 60  938  938  ARG ARG C . n 
C 1 61  GLY 61  939  939  GLY GLY C . n 
C 1 62  GLY 62  940  940  GLY GLY C . n 
C 1 63  SER 63  941  941  SER SER C . n 
C 1 64  GLY 64  942  942  GLY GLY C . n 
C 1 65  THR 65  943  943  THR THR C . n 
C 1 66  LYS 66  944  944  LYS LYS C . n 
C 1 67  ARG 67  945  945  ARG ARG C . n 
C 1 68  ALA 68  946  946  ALA ALA C . n 
C 1 69  LEU 69  947  947  LEU LEU C . n 
C 1 70  ILE 70  948  948  ILE ILE C . n 
C 1 71  GLN 71  949  949  GLN GLN C . n 
C 1 72  CYS 72  950  950  CYS CYS C . n 
C 1 73  ALA 73  951  951  ALA ALA C . n 
C 1 74  LYS 74  952  952  LYS LYS C . n 
C 1 75  ASP 75  953  953  ASP ASP C . n 
C 1 76  ILE 76  954  954  ILE ILE C . n 
C 1 77  ALA 77  955  955  ALA ALA C . n 
C 1 78  LYS 78  956  956  LYS LYS C . n 
C 1 79  ALA 79  957  957  ALA ALA C . n 
C 1 80  SER 80  958  958  SER SER C . n 
C 1 81  ASP 81  959  959  ASP ASP C . n 
C 1 82  GLU 82  960  960  GLU GLU C . n 
C 1 83  VAL 83  961  961  VAL VAL C . n 
C 1 84  THR 84  962  962  THR THR C . n 
C 1 85  ARG 85  963  963  ARG ARG C . n 
C 1 86  LEU 86  964  964  LEU LEU C . n 
C 1 87  ALA 87  965  965  ALA ALA C . n 
C 1 88  LYS 88  966  966  LYS LYS C . n 
C 1 89  GLU 89  967  967  GLU GLU C . n 
C 1 90  VAL 90  968  968  VAL VAL C . n 
C 1 91  ALA 91  969  969  ALA ALA C . n 
C 1 92  LYS 92  970  970  LYS LYS C . n 
C 1 93  GLN 93  971  971  GLN GLN C . n 
C 1 94  CYS 94  972  972  CYS CYS C . n 
C 1 95  THR 95  973  973  THR THR C . n 
C 1 96  ASP 96  974  974  ASP ASP C . n 
C 1 97  LYS 97  975  975  LYS LYS C . n 
C 1 98  ARG 98  976  976  ARG ARG C . n 
C 1 99  ILE 99  977  977  ILE ILE C . n 
C 1 100 ARG 100 978  978  ARG ARG C . n 
C 1 101 THR 101 979  979  THR THR C . n 
C 1 102 ASN 102 980  980  ASN ASN C . n 
C 1 103 LEU 103 981  981  LEU LEU C . n 
C 1 104 LEU 104 982  982  LEU LEU C . n 
C 1 105 GLN 105 983  983  GLN GLN C . n 
C 1 106 VAL 106 984  984  VAL VAL C . n 
C 1 107 CYS 107 985  985  CYS CYS C . n 
C 1 108 GLU 108 986  986  GLU GLU C . n 
C 1 109 ARG 109 987  987  ARG ARG C . n 
C 1 110 ILE 110 988  988  ILE ILE C . n 
C 1 111 PRO 111 989  989  PRO PRO C . n 
C 1 112 THR 112 990  990  THR THR C . n 
C 1 113 ILE 113 991  991  ILE ILE C . n 
C 1 114 SER 114 992  992  SER SER C . n 
C 1 115 THR 115 993  993  THR THR C . n 
C 1 116 GLN 116 994  994  GLN GLN C . n 
C 1 117 LEU 117 995  995  LEU LEU C . n 
C 1 118 LYS 118 996  996  LYS LYS C . n 
C 1 119 ILE 119 997  997  ILE ILE C . n 
C 1 120 LEU 120 998  998  LEU LEU C . n 
C 1 121 SER 121 999  999  SER SER C . n 
C 1 122 THR 122 1000 1000 THR THR C . n 
C 1 123 VAL 123 1001 1001 VAL VAL C . n 
C 1 124 LYS 124 1002 1002 LYS LYS C . n 
C 1 125 ALA 125 1003 1003 ALA ALA C . n 
C 1 126 THR 126 1004 1004 THR THR C . n 
C 1 127 MET 127 1005 1005 MET MET C . n 
C 1 128 LEU 128 1006 1006 LEU LEU C . n 
C 1 129 GLY 129 1007 1007 GLY GLY C . n 
C 1 130 ARG 130 1008 1008 ARG ARG C . n 
C 1 131 THR 131 1009 1009 THR THR C . n 
C 1 132 ASN 132 1010 1010 ASN ASN C . n 
C 1 133 ILE 133 1011 1011 ILE ILE C . n 
C 1 134 SER 134 1012 1012 SER SER C . n 
C 1 135 ASP 135 1013 1013 ASP ASP C . n 
C 1 136 GLU 136 1014 1014 GLU GLU C . n 
C 1 137 GLU 137 1015 1015 GLU GLU C . n 
C 1 138 SER 138 1016 1016 SER SER C . n 
C 1 139 GLU 139 1017 1017 GLU GLU C . n 
C 1 140 GLN 140 1018 1018 GLN GLN C . n 
C 1 141 ALA 141 1019 1019 ALA ALA C . n 
C 1 142 THR 142 1020 1020 THR THR C . n 
C 1 143 GLU 143 1021 1021 GLU GLU C . n 
C 1 144 MET 144 1022 1022 MET MET C . n 
C 1 145 LEU 145 1023 1023 LEU LEU C . n 
C 1 146 VAL 146 1024 1024 VAL VAL C . n 
C 1 147 HIS 147 1025 1025 HIS HIS C . n 
C 1 148 ASN 148 1026 1026 ASN ASN C . n 
C 1 149 ALA 149 1027 1027 ALA ALA C . n 
C 1 150 GLN 150 1028 1028 GLN GLN C . n 
C 1 151 ASN 151 1029 1029 ASN ASN C . n 
C 1 152 LEU 152 1030 1030 LEU LEU C . n 
C 1 153 MET 153 1031 1031 MET MET C . n 
C 1 154 GLN 154 1032 1032 GLN GLN C . n 
C 1 155 SER 155 1033 1033 SER SER C . n 
C 1 156 VAL 156 1034 1034 VAL VAL C . n 
C 1 157 LYS 157 1035 1035 LYS LYS C . n 
C 1 158 GLU 158 1036 1036 GLU GLU C . n 
C 1 159 THR 159 1037 1037 THR THR C . n 
C 1 160 VAL 160 1038 1038 VAL VAL C . n 
C 1 161 ARG 161 1039 1039 ARG ARG C . n 
C 1 162 GLU 162 1040 1040 GLU GLU C . n 
C 1 163 ALA 163 1041 1041 ALA ALA C . n 
C 1 164 GLU 164 1042 1042 GLU GLU C . n 
C 1 165 ALA 165 1043 1043 ALA ALA C . n 
C 1 166 ALA 166 1044 1044 ALA ALA C . n 
C 1 167 SER 167 1045 1045 SER SER C . n 
C 1 168 ILE 168 1046 1046 ILE ILE C . n 
C 1 169 LYS 169 1047 1047 LYS LYS C . n 
C 1 170 ILE 170 1048 1048 ILE ILE C . n 
C 1 171 ARG 171 1049 1049 ARG ARG C . n 
C 1 172 THR 172 1050 ?    ?   ?   C . n 
C 1 173 ASP 173 1051 ?    ?   ?   C . n 
C 1 174 ALA 174 1052 ?    ?   ?   C . n 
C 1 175 GLY 175 1053 ?    ?   ?   C . n 
C 1 176 PHE 176 1054 1054 PHE PHE C . n 
C 1 177 THR 177 1055 1055 THR THR C . n 
C 1 178 LEU 178 1056 1056 LEU LEU C . n 
C 1 179 ARG 179 1057 1057 ARG ARG C . n 
C 1 180 TRP 180 1058 1058 TRP TRP C . n 
C 1 181 VAL 181 1059 1059 VAL VAL C . n 
C 1 182 ARG 182 1060 1060 ARG ARG C . n 
C 1 183 LYS 183 1061 1061 LYS LYS C . n 
C 1 184 THR 184 1062 1062 THR THR C . n 
C 1 185 PRO 185 1063 1063 PRO PRO C . n 
C 1 186 TRP 186 1064 ?    ?   ?   C . n 
C 1 187 TYR 187 1065 ?    ?   ?   C . n 
C 1 188 GLN 188 1066 ?    ?   ?   C . n 
D 2 1   LEU 1   39   39   LEU LEU D . n 
D 2 2   ASP 2   40   40   ASP ASP D . n 
D 2 3   PRO 3   41   41   PRO PRO D . n 
D 2 4   GLU 4   42   42   GLU GLU D . n 
D 2 5   GLU 5   43   43   GLU GLU D . n 
D 2 6   ILE 6   44   44   ILE ILE D . n 
D 2 7   ARG 7   45   45   ARG ARG D . n 
D 2 8   LYS 8   46   46   LYS LYS D . n 
D 2 9   ARG 9   47   47   ARG ARG D . n 
D 2 10  LEU 10  48   48   LEU LEU D . n 
D 2 11  GLU 11  49   49   GLU GLU D . n 
D 2 12  HIS 12  50   50   HIS HIS D . n 
D 2 13  THR 13  51   51   THR THR D . n 
D 2 14  GLU 14  52   52   GLU GLU D . n 
D 2 15  ARG 15  53   53   ARG ARG D . n 
D 2 16  GLN 16  54   54   GLN GLN D . n 
D 2 17  PHE 17  55   55   PHE PHE D . n 
D 2 18  ARG 18  56   56   ARG ARG D . n 
D 2 19  ASN 19  57   57   ASN ASN D . n 
D 2 20  ARG 20  58   58   ARG ARG D . n 
D 2 21  ARG 21  59   59   ARG ARG D . n 
D 2 22  LYS 22  60   60   LYS LYS D . n 
D 2 23  ILE 23  61   61   ILE ILE D . n 
D 2 24  LEU 24  62   62   LEU LEU D . n 
D 2 25  ILE 25  63   63   ILE ILE D . n 
D 2 26  ARG 26  64   64   ARG ARG D . n 
D 2 27  GLY 27  65   65   GLY GLY D . n 
D 2 28  LEU 28  66   66   LEU LEU D . n 
D 2 29  PRO 29  67   67   PRO PRO D . n 
D 2 30  GLY 30  68   68   GLY GLY D . n 
D 2 31  ASP 31  69   69   ASP ASP D . n 
D 2 32  VAL 32  70   70   VAL VAL D . n 
D 2 33  THR 33  71   71   THR THR D . n 
D 2 34  ASN 34  72   72   ASN ASN D . n 
D 2 35  GLN 35  73   73   GLN GLN D . n 
D 2 36  GLU 36  74   74   GLU GLU D . n 
D 2 37  VAL 37  75   75   VAL VAL D . n 
D 2 38  HIS 38  76   76   HIS HIS D . n 
D 2 39  ASP 39  77   77   ASP ASP D . n 
D 2 40  LEU 40  78   78   LEU LEU D . n 
D 2 41  LEU 41  79   79   LEU LEU D . n 
D 2 42  SER 42  80   80   SER SER D . n 
D 2 43  ASP 43  81   81   ASP ASP D . n 
D 2 44  TYR 44  82   82   TYR TYR D . n 
D 2 45  GLU 45  83   83   GLU GLU D . n 
D 2 46  LEU 46  84   84   LEU LEU D . n 
D 2 47  LYS 47  85   85   LYS LYS D . n 
D 2 48  TYR 48  86   86   TYR TYR D . n 
D 2 49  CYS 49  87   87   CYS CYS D . n 
D 2 50  PHE 50  88   88   PHE PHE D . n 
D 2 51  VAL 51  89   89   VAL VAL D . n 
D 2 52  ASP 52  90   90   ASP ASP D . n 
D 2 53  LYS 53  91   91   LYS LYS D . n 
D 2 54  TYR 54  92   92   TYR TYR D . n 
D 2 55  LYS 55  93   93   LYS LYS D . n 
D 2 56  GLY 56  94   94   GLY GLY D . n 
D 2 57  THR 57  95   95   THR THR D . n 
D 2 58  ALA 58  96   96   ALA ALA D . n 
D 2 59  PHE 59  97   97   PHE PHE D . n 
D 2 60  VAL 60  98   98   VAL VAL D . n 
D 2 61  THR 61  99   99   THR THR D . n 
D 2 62  LEU 62  100  100  LEU LEU D . n 
D 2 63  LEU 63  101  101  LEU LEU D . n 
D 2 64  ASN 64  102  102  ASN ASN D . n 
D 2 65  GLY 65  103  103  GLY GLY D . n 
D 2 66  GLU 66  104  104  GLU GLU D . n 
D 2 67  GLN 67  105  105  GLN GLN D . n 
D 2 68  ALA 68  106  106  ALA ALA D . n 
D 2 69  GLU 69  107  107  GLU GLU D . n 
D 2 70  ALA 70  108  108  ALA ALA D . n 
D 2 71  ALA 71  109  109  ALA ALA D . n 
D 2 72  ILE 72  110  110  ILE ILE D . n 
D 2 73  ASN 73  111  111  ASN ASN D . n 
D 2 74  ALA 74  112  112  ALA ALA D . n 
D 2 75  PHE 75  113  113  PHE PHE D . n 
D 2 76  HIS 76  114  114  HIS HIS D . n 
D 2 77  GLN 77  115  115  GLN GLN D . n 
D 2 78  SER 78  116  116  SER SER D . n 
D 2 79  ARG 79  117  117  ARG ARG D . n 
D 2 80  LEU 80  118  118  LEU LEU D . n 
D 2 81  ARG 81  119  119  ARG ARG D . n 
D 2 82  GLU 82  120  120  GLU GLU D . n 
D 2 83  ARG 83  121  121  ARG ARG D . n 
D 2 84  GLU 84  122  122  GLU GLU D . n 
D 2 85  LEU 85  123  123  LEU LEU D . n 
D 2 86  SER 86  124  124  SER SER D . n 
D 2 87  VAL 87  125  125  VAL VAL D . n 
D 2 88  GLN 88  126  126  GLN GLN D . n 
D 2 89  LEU 89  127  127  LEU LEU D . n 
D 2 90  GLN 90  128  128  GLN GLN D . n 
D 2 91  PRO 91  129  129  PRO PRO D . n 
D 2 92  THR 92  130  130  THR THR D . n 
D 2 93  ASP 93  131  131  ASP ASP D . n 
D 2 94  ALA 94  132  132  ALA ALA D . n 
D 2 95  LEU 95  133  133  LEU LEU D . n 
D 2 96  LEU 96  134  134  LEU LEU D . n 
D 2 97  CYS 97  135  135  CYS CYS D . n 
D 2 98  VAL 98  136  136  VAL VAL D . n 
D 2 99  ALA 99  137  137  ALA ALA D . n 
D 2 100 ASN 100 138  138  ASN ASN D . n 
D 2 101 LEU 101 139  139  LEU LEU D . n 
D 2 102 PRO 102 140  140  PRO PRO D . n 
D 2 103 PRO 103 141  141  PRO PRO D . n 
D 2 104 SER 104 142  142  SER SER D . n 
D 2 105 LEU 105 143  143  LEU LEU D . n 
D 2 106 THR 106 144  144  THR THR D . n 
D 2 107 GLN 107 145  145  GLN GLN D . n 
D 2 108 GLN 108 146  146  GLN GLN D . n 
D 2 109 GLN 109 147  147  GLN GLN D . n 
D 2 110 PHE 110 148  148  PHE PHE D . n 
D 2 111 GLU 111 149  149  GLU GLU D . n 
D 2 112 GLU 112 150  150  GLU GLU D . n 
D 2 113 LEU 113 151  151  LEU LEU D . n 
D 2 114 VAL 114 152  152  VAL VAL D . n 
D 2 115 ARG 115 153  153  ARG ARG D . n 
D 2 116 PRO 116 154  154  PRO PRO D . n 
D 2 117 PHE 117 155  155  PHE PHE D . n 
D 2 118 GLY 118 156  156  GLY GLY D . n 
D 2 119 SER 119 157  157  SER SER D . n 
D 2 120 LEU 120 158  158  LEU LEU D . n 
D 2 121 GLU 121 159  159  GLU GLU D . n 
D 2 122 ARG 122 160  160  ARG ARG D . n 
D 2 123 CYS 123 161  161  CYS CYS D . n 
D 2 124 PHE 124 162  162  PHE PHE D . n 
D 2 125 LEU 125 163  163  LEU LEU D . n 
D 2 126 VAL 126 164  164  VAL VAL D . n 
D 2 127 TYR 127 165  165  TYR TYR D . n 
D 2 128 SER 128 166  166  SER SER D . n 
D 2 129 GLU 129 167  167  GLU GLU D . n 
D 2 130 ARG 130 168  168  ARG ARG D . n 
D 2 131 THR 131 169  169  THR THR D . n 
D 2 132 GLY 132 170  170  GLY GLY D . n 
D 2 133 GLN 133 171  171  GLN GLN D . n 
D 2 134 SER 134 172  172  SER SER D . n 
D 2 135 LYS 135 173  173  LYS LYS D . n 
D 2 136 GLY 136 174  174  GLY GLY D . n 
D 2 137 TYR 137 175  175  TYR TYR D . n 
D 2 138 GLY 138 176  176  GLY GLY D . n 
D 2 139 PHE 139 177  177  PHE PHE D . n 
D 2 140 ALA 140 178  178  ALA ALA D . n 
D 2 141 GLU 141 179  179  GLU GLU D . n 
D 2 142 TYR 142 180  180  TYR TYR D . n 
D 2 143 MET 143 181  181  MET MET D . n 
D 2 144 LYS 144 182  182  LYS LYS D . n 
D 2 145 LYS 145 183  183  LYS LYS D . n 
D 2 146 ASP 146 184  184  ASP ASP D . n 
D 2 147 SER 147 185  185  SER SER D . n 
D 2 148 ALA 148 186  186  ALA ALA D . n 
D 2 149 ALA 149 187  187  ALA ALA D . n 
D 2 150 ARG 150 188  188  ARG ARG D . n 
D 2 151 ALA 151 189  189  ALA ALA D . n 
D 2 152 LYS 152 190  190  LYS LYS D . n 
D 2 153 SER 153 191  191  SER SER D . n 
D 2 154 ASP 154 192  192  ASP ASP D . n 
D 2 155 LEU 155 193  193  LEU LEU D . n 
D 2 156 LEU 156 194  194  LEU LEU D . n 
D 2 157 GLY 157 195  195  GLY GLY D . n 
D 2 158 LYS 158 196  196  LYS LYS D . n 
D 2 159 PRO 159 197  197  PRO PRO D . n 
D 2 160 LEU 160 198  198  LEU LEU D . n 
D 2 161 GLY 161 199  199  GLY GLY D . n 
D 2 162 PRO 162 200  200  PRO PRO D . n 
D 2 163 ARG 163 201  201  ARG ARG D . n 
D 2 164 THR 164 202  202  THR THR D . n 
D 2 165 LEU 165 203  203  LEU LEU D . n 
D 2 166 TYR 166 204  204  TYR TYR D . n 
D 2 167 VAL 167 205  205  VAL VAL D . n 
D 2 168 HIS 168 206  206  HIS HIS D . n 
D 2 169 TRP 169 207  207  TRP TRP D . n 
D 2 170 THR 170 208  208  THR THR D . n 
D 2 171 ASP 171 209  209  ASP ASP D . n 
D 2 172 ALA 172 210  210  ALA ALA D . n 
D 2 173 GLY 173 211  211  GLY GLY D . n 
D 2 174 GLN 174 212  212  GLN GLN D . n 
D 2 175 LEU 175 213  213  LEU LEU D . n 
D 2 176 THR 176 214  214  THR THR D . n 
D 2 177 PRO 177 215  215  PRO PRO D . n 
D 2 178 ALA 178 216  216  ALA ALA D . n 
D 2 179 LEU 179 217  217  LEU LEU D . n 
D 2 180 LEU 180 218  218  LEU LEU D . n 
D 2 181 HIS 181 219  219  HIS HIS D . n 
D 2 182 SER 182 220  220  SER SER D . n 
D 2 183 ARG 183 221  221  ARG ARG D . n 
D 2 184 CYS 184 222  222  CYS CYS D . n 
D 2 185 LEU 185 223  223  LEU LEU D . n 
D 2 186 CYS 186 224  224  CYS CYS D . n 
D 2 187 VAL 187 225  225  VAL VAL D . n 
D 2 188 ASP 188 226  226  ASP ASP D . n 
D 2 189 ARG 189 227  227  ARG ARG D . n 
D 2 190 LEU 190 228  228  LEU LEU D . n 
D 2 191 PRO 191 229  229  PRO PRO D . n 
D 2 192 PRO 192 230  230  PRO PRO D . n 
D 2 193 GLY 193 231  231  GLY GLY D . n 
D 2 194 PHE 194 232  232  PHE PHE D . n 
D 2 195 ASN 195 233  233  ASN ASN D . n 
D 2 196 ASP 196 234  234  ASP ASP D . n 
D 2 197 VAL 197 235  235  VAL VAL D . n 
D 2 198 ASP 198 236  236  ASP ASP D . n 
D 2 199 ALA 199 237  237  ALA ALA D . n 
D 2 200 LEU 200 238  238  LEU LEU D . n 
D 2 201 CYS 201 239  239  CYS CYS D . n 
D 2 202 ARG 202 240  240  ARG ARG D . n 
D 2 203 ALA 203 241  241  ALA ALA D . n 
D 2 204 LEU 204 242  242  LEU LEU D . n 
D 2 205 SER 205 243  243  SER SER D . n 
D 2 206 ALA 206 244  244  ALA ALA D . n 
D 2 207 VAL 207 245  245  VAL VAL D . n 
D 2 208 HIS 208 246  246  HIS HIS D . n 
D 2 209 SER 209 247  247  SER SER D . n 
D 2 210 PRO 210 248  248  PRO PRO D . n 
D 2 211 THR 211 249  249  THR THR D . n 
D 2 212 PHE 212 250  250  PHE PHE D . n 
D 2 213 CYS 213 251  251  CYS CYS D . n 
D 2 214 GLN 214 252  252  GLN GLN D . n 
D 2 215 LEU 215 253  253  LEU LEU D . n 
D 2 216 ALA 216 254  254  ALA ALA D . n 
D 2 217 CYS 217 255  255  CYS CYS D . n 
D 2 218 GLY 218 256  256  GLY GLY D . n 
D 2 219 GLN 219 257  257  GLN GLN D . n 
D 2 220 ASP 220 258  258  ASP ASP D . n 
D 2 221 GLY 221 259  259  GLY GLY D . n 
D 2 222 GLN 222 260  260  GLN GLN D . n 
D 2 223 LEU 223 261  261  LEU LEU D . n 
D 2 224 LYS 224 262  262  LYS LYS D . n 
D 2 225 GLY 225 263  263  GLY GLY D . n 
D 2 226 PHE 226 264  264  PHE PHE D . n 
D 2 227 ALA 227 265  265  ALA ALA D . n 
D 2 228 VAL 228 266  266  VAL VAL D . n 
D 2 229 LEU 229 267  267  LEU LEU D . n 
D 2 230 GLU 230 268  268  GLU GLU D . n 
D 2 231 TYR 231 269  269  TYR TYR D . n 
D 2 232 GLU 232 270  270  GLU GLU D . n 
D 2 233 THR 233 271  271  THR THR D . n 
D 2 234 ALA 234 272  272  ALA ALA D . n 
D 2 235 GLU 235 273  273  GLU GLU D . n 
D 2 236 MET 236 274  274  MET MET D . n 
D 2 237 ALA 237 275  275  ALA ALA D . n 
D 2 238 GLU 238 276  276  GLU GLU D . n 
D 2 239 GLU 239 277  277  GLU GLU D . n 
D 2 240 ALA 240 278  278  ALA ALA D . n 
D 2 241 GLN 241 279  279  GLN GLN D . n 
D 2 242 GLN 242 280  280  GLN GLN D . n 
D 2 243 GLN 243 281  281  GLN GLN D . n 
D 2 244 ALA 244 282  282  ALA ALA D . n 
D 2 245 ASP 245 283  283  ASP ASP D . n 
D 2 246 GLY 246 284  284  GLY GLY D . n 
D 2 247 LEU 247 285  285  LEU LEU D . n 
D 2 248 SER 248 286  286  SER SER D . n 
D 2 249 LEU 249 287  287  LEU LEU D . n 
D 2 250 GLY 250 288  288  GLY GLY D . n 
D 2 251 GLY 251 289  289  GLY GLY D . n 
D 2 252 SER 252 290  290  SER SER D . n 
D 2 253 HIS 253 291  291  HIS HIS D . n 
D 2 254 LEU 254 292  292  LEU LEU D . n 
D 2 255 ARG 255 293  293  ARG ARG D . n 
D 2 256 VAL 256 294  294  VAL VAL D . n 
D 2 257 SER 257 295  295  SER SER D . n 
D 2 258 PHE 258 296  296  PHE PHE D . n 
D 2 259 CYS 259 297  297  CYS CYS D . n 
D 2 260 ALA 260 298  298  ALA ALA D . n 
D 2 261 PRO 261 299  299  PRO PRO D . n 
D 2 262 GLY 262 300  300  GLY GLY D . n 
D 2 263 PRO 263 301  301  PRO PRO D . n 
D 2 264 PRO 264 302  302  PRO PRO D . n 
D 2 265 GLY 265 303  303  GLY GLY D . n 
D 2 266 ARG 266 304  304  ARG ARG D . n 
D 2 267 SER 267 305  305  SER SER D . n 
D 2 268 MET 268 306  306  MET MET D . n 
D 2 269 LEU 269 307  307  LEU LEU D . n 
D 2 270 ALA 270 308  308  ALA ALA D . n 
D 2 271 ALA 271 309  309  ALA ALA D . n 
D 2 272 LEU 272 310  310  LEU LEU D . n 
D 2 273 ILE 273 311  311  ILE ILE D . n 
D 2 274 ALA 274 312  312  ALA ALA D . n 
D 2 275 ALA 275 313  313  ALA ALA D . n 
D 2 276 GLN 276 314  314  GLN GLN D . n 
D 2 277 ALA 277 315  315  ALA ALA D . n 
D 2 278 THR 278 316  316  THR THR D . n 
D 2 279 ALA 279 317  317  ALA ALA D . n 
D 2 280 LEU 280 318  318  LEU LEU D . n 
D 2 281 ASN 281 319  ?    ?   ?   D . n 
D 2 282 ARG 282 320  ?    ?   ?   D . n 
D 2 283 GLY 283 321  ?    ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  1   1  HOH HOH A . 
E 3 HOH 2  2   2  HOH HOH A . 
E 3 HOH 3  9   9  HOH HOH A . 
E 3 HOH 4  16  16 HOH HOH A . 
E 3 HOH 5  18  18 HOH HOH A . 
E 3 HOH 6  19  19 HOH HOH A . 
E 3 HOH 7  20  20 HOH HOH A . 
E 3 HOH 8  22  22 HOH HOH A . 
E 3 HOH 9  23  23 HOH HOH A . 
E 3 HOH 10 24  24 HOH HOH A . 
E 3 HOH 11 30  30 HOH HOH A . 
E 3 HOH 12 33  33 HOH HOH A . 
E 3 HOH 13 36  36 HOH HOH A . 
E 3 HOH 14 39  39 HOH HOH A . 
F 3 HOH 1  4   4  HOH HOH B . 
F 3 HOH 2  6   6  HOH HOH B . 
F 3 HOH 3  8   8  HOH HOH B . 
F 3 HOH 4  11  11 HOH HOH B . 
F 3 HOH 5  12  12 HOH HOH B . 
F 3 HOH 6  15  15 HOH HOH B . 
F 3 HOH 7  21  21 HOH HOH B . 
F 3 HOH 8  25  25 HOH HOH B . 
F 3 HOH 9  26  26 HOH HOH B . 
F 3 HOH 10 28  28 HOH HOH B . 
F 3 HOH 11 31  31 HOH HOH B . 
F 3 HOH 12 32  32 HOH HOH B . 
F 3 HOH 13 37  37 HOH HOH B . 
F 3 HOH 14 38  38 HOH HOH B . 
F 3 HOH 15 322 40 HOH HOH B . 
G 3 HOH 1  10  10 HOH HOH C . 
G 3 HOH 2  17  17 HOH HOH C . 
G 3 HOH 3  35  35 HOH HOH C . 
H 3 HOH 1  3   3  HOH HOH D . 
H 3 HOH 2  5   5  HOH HOH D . 
H 3 HOH 3  7   7  HOH HOH D . 
H 3 HOH 4  13  13 HOH HOH D . 
H 3 HOH 5  14  14 HOH HOH D . 
H 3 HOH 6  27  27 HOH HOH D . 
H 3 HOH 7  29  29 HOH HOH D . 
H 3 HOH 8  34  34 HOH HOH D . 
H 3 HOH 9  322 41 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_software.name             BUSTER-TNT 
_software.classification   refinement 
_software.version          1.3.2 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 B ASP 209 ? ? N   B GLY 211  ? ? 1.80 
2 1 OD1 D ASP 234 ? ? N   D ALA 237  ? ? 1.88 
3 1 O   D ASP 234 ? ? CD1 D LEU 253  ? ? 2.11 
4 1 OG1 C THR 973 ? ? O   C LYS 1047 ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CB A LYS 889 ? ? CG  A LYS 889 ? ? 1.303 1.521 -0.218 0.027 N 
2  1 CG A GLU 892 ? ? CD  A GLU 892 ? ? 1.334 1.515 -0.181 0.015 N 
3  1 CD A GLU 892 ? ? OE1 A GLU 892 ? ? 1.143 1.252 -0.109 0.011 N 
4  1 CD A GLU 892 ? ? OE2 A GLU 892 ? ? 1.083 1.252 -0.169 0.011 N 
5  1 CA A VAL 893 ? ? CB  A VAL 893 ? ? 1.339 1.543 -0.204 0.021 N 
6  1 CB A VAL 893 ? ? CG1 A VAL 893 ? ? 1.252 1.524 -0.272 0.021 N 
7  1 CB A VAL 893 ? ? CG2 A VAL 893 ? ? 1.221 1.524 -0.303 0.021 N 
8  1 C  A VAL 893 ? ? O   A VAL 893 ? ? 1.064 1.229 -0.165 0.019 N 
9  1 CA A ILE 894 ? ? CB  A ILE 894 ? ? 1.298 1.544 -0.246 0.023 N 
10 1 CB A ILE 894 ? ? CG2 A ILE 894 ? ? 1.207 1.524 -0.317 0.031 N 
11 1 C  A ILE 894 ? ? O   A ILE 894 ? ? 1.064 1.229 -0.165 0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C   A PHE 885  ? ? N  A PRO 886  ? ? CD  A PRO 886  ? ? 115.58 128.40 -12.82 2.10 Y 
2 1 CG1 A VAL 893  ? ? CB A VAL 893  ? ? CG2 A VAL 893  ? ? 94.46  110.90 -16.44 1.60 N 
3 1 CG1 A ILE 894  ? ? CB A ILE 894  ? ? CG2 A ILE 894  ? ? 92.61  111.40 -18.79 2.20 N 
4 1 C   A THR 1062 ? ? N  A PRO 1063 ? ? CD  A PRO 1063 ? ? 99.93  128.40 -28.47 2.10 Y 
5 1 C   C PHE 885  ? ? N  C PRO 886  ? ? CA  C PRO 886  ? ? 131.62 119.30 12.32  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 883  ? ? -35.60  137.65  
2  1 LYS A 889  ? ? -169.72 -141.60 
3  1 GLU A 892  ? ? 100.68  61.91   
4  1 GLN A 983  ? ? -52.76  -71.83  
5  1 VAL A 984  ? ? -48.50  3.54    
6  1 CYS A 985  ? ? -140.51 -4.29   
7  1 LYS A 1061 ? ? -118.46 64.86   
8  1 GLU B 120  ? ? 82.03   -3.21   
9  1 ASP B 131  ? ? -94.99  -94.03  
10 1 ARG B 168  ? ? -78.80  -71.97  
11 1 ALA B 244  ? ? -49.40  -1.50   
12 1 VAL B 245  ? ? -141.70 -49.41  
13 1 CYS B 251  ? ? -175.11 114.51  
14 1 GLN B 257  ? ? -97.95  42.07   
15 1 GLN B 260  ? ? -60.55  -176.08 
16 1 LEU B 287  ? ? -175.92 123.74  
17 1 PRO B 301  ? ? -48.07  152.52  
18 1 THR B 316  ? ? -54.61  28.84   
19 1 VAL C 984  ? ? -49.44  2.87    
20 1 SER C 1012 ? ? -42.95  151.81  
21 1 ALA C 1044 ? ? -65.09  5.77    
22 1 TRP C 1058 ? ? -105.60 79.19   
23 1 GLU D 120  ? ? 71.55   -4.33   
24 1 ASP D 131  ? ? -97.11  -80.50  
25 1 ALA D 132  ? ? -100.22 60.00   
26 1 CYS D 161  ? ? -162.07 108.01  
27 1 ARG D 168  ? ? -68.86  -72.57  
28 1 ALA D 244  ? ? -56.25  2.32    
29 1 VAL D 245  ? ? -142.40 -42.24  
30 1 CYS D 251  ? ? -179.31 108.85  
31 1 GLN D 260  ? ? -46.97  178.10  
32 1 PRO D 301  ? ? -45.82  162.28  
33 1 THR D 316  ? ? -60.62  47.23   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 892 ? ? VAL A 893 ? ? 146.40  
2 1 THR B 208 ? ? ASP B 209 ? ? -143.20 
3 1 ALA B 210 ? ? GLY B 211 ? ? 140.62  
4 1 THR D 208 ? ? ASP D 209 ? ? -142.51 
5 1 ASP D 209 ? ? ALA D 210 ? ? -109.45 
6 1 ASP D 234 ? ? VAL D 235 ? ? 131.15  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 879  ? A GLU 1   
2  1 Y 1 A GLU 880  ? A GLU 2   
3  1 Y 1 A LYS 881  ? A LYS 3   
4  1 Y 1 A TRP 1064 ? A TRP 186 
5  1 Y 1 A TYR 1065 ? A TYR 187 
6  1 Y 1 A GLN 1066 ? A GLN 188 
7  1 Y 1 B LEU 318  ? B LEU 280 
8  1 Y 1 B ASN 319  ? B ASN 281 
9  1 Y 1 B ARG 320  ? B ARG 282 
10 1 Y 1 B GLY 321  ? B GLY 283 
11 1 Y 1 C GLU 879  ? C GLU 1   
12 1 Y 1 C GLU 880  ? C GLU 2   
13 1 Y 1 C LYS 881  ? C LYS 3   
14 1 Y 1 C ASP 882  ? C ASP 4   
15 1 Y 1 C LYS 889  ? C LYS 11  
16 1 Y 1 C ALA 890  ? C ALA 12  
17 1 Y 1 C GLY 891  ? C GLY 13  
18 1 Y 1 C THR 1050 ? C THR 172 
19 1 Y 1 C ASP 1051 ? C ASP 173 
20 1 Y 1 C ALA 1052 ? C ALA 174 
21 1 Y 1 C GLY 1053 ? C GLY 175 
22 1 Y 1 C TRP 1064 ? C TRP 186 
23 1 Y 1 C TYR 1065 ? C TYR 187 
24 1 Y 1 C GLN 1066 ? C GLN 188 
25 1 Y 1 D ASN 319  ? D ASN 281 
26 1 Y 1 D ARG 320  ? D ARG 282 
27 1 Y 1 D GLY 321  ? D GLY 283 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#