data_3H3P
# 
_entry.id   3H3P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H3P         
RCSB  RCSB052652   
WWPDB D_1000052652 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H3P 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Holmes, M.A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Interactions between lipids and human anti-HIV antibody 4E10 can be reduced without ablating neutralizing activity' 
_citation.journal_abbrev            J.Virol. 
_citation.journal_volume            84 
_citation.page_first                1076 
_citation.page_last                 1088 
_citation.year                      2010 
_citation.journal_id_ASTM           JOVIAM 
_citation.country                   US 
_citation.journal_id_ISSN           0022-538X 
_citation.journal_id_CSD            0825 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19906921 
_citation.pdbx_database_id_DOI      10.1128/JVI.02113-09 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, H.'         1 
primary 'Song, L.'       2 
primary 'Kim, M.'        3 
primary 'Holmes, M.A.'   4 
primary 'Kraft, Z.'      5 
primary 'Sellhorn, G.'   6 
primary 'Reinherz, E.L.' 7 
primary 'Stamatatos, L.' 8 
primary 'Strong, R.K.'   9 
# 
_cell.entry_id           3H3P 
_cell.length_a           92.400 
_cell.length_b           92.400 
_cell.length_c           272.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H3P 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fv 4E10 heavy chain' 14712.454 2  ? W104A ? ? 
2 polymer     man 'Fv 4E10 light chain' 12304.698 2  ? ?     ? ? 
3 polymer     man 4E10_S0_1TJLC_004_N   10501.508 2  ? ?     ? 
'The author states that THE EPITOPE-SCAFFOLD IS BASED on transcription factor DksA from E. coli (PDB ID 1TJL).' 
4 non-polymer syn 'CALCIUM ION'         40.078    1  ? ?     ? ? 
5 water       nat water                 18.015    55 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSQVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGVIPLLTITNYAPRFQGRITITADRSTST
AYLELNSLRPEDTAVYYCAREGTTGAGWLGKPIGAFAHWGQGTLVTVSSLEHHHHHH
;
;GSQVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGVIPLLTITNYAPRFQGRITITADRSTST
AYLELNSLRPEDTAVYYCAREGTTGAGWLGKPIGAFAHWGQGTLVTVSSLEHHHHHH
;
H,I ? 
2 'polypeptide(L)' no no 
;MAEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISR
LEPEDFAVYYCQQYGQSLSTFGQGTKVEVKLVPR
;
;MAEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISR
LEPEDFAVYYCQQYGQSLSTFGQGTKVEVKLVPR
;
L,M ? 
3 'polypeptide(L)' no no 
;HHHHHHTNEAYLAHERRELEAKRNQLRDEVDRTKTHMQDEAANDPNWFDITAQLWEFSQELRNRDREEKLIKKIEQTLKK
VENED
;
;HHHHHHTNEAYLAHERRELEAKRNQLRDEVDRTKTHMQDEAANDPNWFDITAQLWEFSQELRNRDREEKLIKKIEQTLKK
VENED
;
S,T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   VAL n 
1 5   GLN n 
1 6   LEU n 
1 7   VAL n 
1 8   GLN n 
1 9   SER n 
1 10  GLY n 
1 11  ALA n 
1 12  GLU n 
1 13  VAL n 
1 14  LYS n 
1 15  ARG n 
1 16  PRO n 
1 17  GLY n 
1 18  SER n 
1 19  SER n 
1 20  VAL n 
1 21  THR n 
1 22  VAL n 
1 23  SER n 
1 24  CYS n 
1 25  LYS n 
1 26  ALA n 
1 27  SER n 
1 28  GLY n 
1 29  GLY n 
1 30  SER n 
1 31  PHE n 
1 32  SER n 
1 33  THR n 
1 34  TYR n 
1 35  ALA n 
1 36  LEU n 
1 37  SER n 
1 38  TRP n 
1 39  VAL n 
1 40  ARG n 
1 41  GLN n 
1 42  ALA n 
1 43  PRO n 
1 44  GLY n 
1 45  ARG n 
1 46  GLY n 
1 47  LEU n 
1 48  GLU n 
1 49  TRP n 
1 50  MET n 
1 51  GLY n 
1 52  GLY n 
1 53  VAL n 
1 54  ILE n 
1 55  PRO n 
1 56  LEU n 
1 57  LEU n 
1 58  THR n 
1 59  ILE n 
1 60  THR n 
1 61  ASN n 
1 62  TYR n 
1 63  ALA n 
1 64  PRO n 
1 65  ARG n 
1 66  PHE n 
1 67  GLN n 
1 68  GLY n 
1 69  ARG n 
1 70  ILE n 
1 71  THR n 
1 72  ILE n 
1 73  THR n 
1 74  ALA n 
1 75  ASP n 
1 76  ARG n 
1 77  SER n 
1 78  THR n 
1 79  SER n 
1 80  THR n 
1 81  ALA n 
1 82  TYR n 
1 83  LEU n 
1 84  GLU n 
1 85  LEU n 
1 86  ASN n 
1 87  SER n 
1 88  LEU n 
1 89  ARG n 
1 90  PRO n 
1 91  GLU n 
1 92  ASP n 
1 93  THR n 
1 94  ALA n 
1 95  VAL n 
1 96  TYR n 
1 97  TYR n 
1 98  CYS n 
1 99  ALA n 
1 100 ARG n 
1 101 GLU n 
1 102 GLY n 
1 103 THR n 
1 104 THR n 
1 105 GLY n 
1 106 ALA n 
1 107 GLY n 
1 108 TRP n 
1 109 LEU n 
1 110 GLY n 
1 111 LYS n 
1 112 PRO n 
1 113 ILE n 
1 114 GLY n 
1 115 ALA n 
1 116 PHE n 
1 117 ALA n 
1 118 HIS n 
1 119 TRP n 
1 120 GLY n 
1 121 GLN n 
1 122 GLY n 
1 123 THR n 
1 124 LEU n 
1 125 VAL n 
1 126 THR n 
1 127 VAL n 
1 128 SER n 
1 129 SER n 
1 130 LEU n 
1 131 GLU n 
1 132 HIS n 
1 133 HIS n 
1 134 HIS n 
1 135 HIS n 
1 136 HIS n 
1 137 HIS n 
2 1   MET n 
2 2   ALA n 
2 3   GLU n 
2 4   ILE n 
2 5   VAL n 
2 6   LEU n 
2 7   THR n 
2 8   GLN n 
2 9   SER n 
2 10  PRO n 
2 11  GLY n 
2 12  THR n 
2 13  GLN n 
2 14  SER n 
2 15  LEU n 
2 16  SER n 
2 17  PRO n 
2 18  GLY n 
2 19  GLU n 
2 20  ARG n 
2 21  ALA n 
2 22  THR n 
2 23  LEU n 
2 24  SER n 
2 25  CYS n 
2 26  ARG n 
2 27  ALA n 
2 28  SER n 
2 29  GLN n 
2 30  SER n 
2 31  VAL n 
2 32  GLY n 
2 33  ASN n 
2 34  ASN n 
2 35  LYS n 
2 36  LEU n 
2 37  ALA n 
2 38  TRP n 
2 39  TYR n 
2 40  GLN n 
2 41  GLN n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  GLN n 
2 46  ALA n 
2 47  PRO n 
2 48  ARG n 
2 49  LEU n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLY n 
2 54  ALA n 
2 55  SER n 
2 56  SER n 
2 57  ARG n 
2 58  PRO n 
2 59  SER n 
2 60  GLY n 
2 61  VAL n 
2 62  ALA n 
2 63  ASP n 
2 64  ARG n 
2 65  PHE n 
2 66  SER n 
2 67  GLY n 
2 68  SER n 
2 69  GLY n 
2 70  SER n 
2 71  GLY n 
2 72  THR n 
2 73  ASP n 
2 74  PHE n 
2 75  THR n 
2 76  LEU n 
2 77  THR n 
2 78  ILE n 
2 79  SER n 
2 80  ARG n 
2 81  LEU n 
2 82  GLU n 
2 83  PRO n 
2 84  GLU n 
2 85  ASP n 
2 86  PHE n 
2 87  ALA n 
2 88  VAL n 
2 89  TYR n 
2 90  TYR n 
2 91  CYS n 
2 92  GLN n 
2 93  GLN n 
2 94  TYR n 
2 95  GLY n 
2 96  GLN n 
2 97  SER n 
2 98  LEU n 
2 99  SER n 
2 100 THR n 
2 101 PHE n 
2 102 GLY n 
2 103 GLN n 
2 104 GLY n 
2 105 THR n 
2 106 LYS n 
2 107 VAL n 
2 108 GLU n 
2 109 VAL n 
2 110 LYS n 
2 111 LEU n 
2 112 VAL n 
2 113 PRO n 
2 114 ARG n 
3 1   HIS n 
3 2   HIS n 
3 3   HIS n 
3 4   HIS n 
3 5   HIS n 
3 6   HIS n 
3 7   THR n 
3 8   ASN n 
3 9   GLU n 
3 10  ALA n 
3 11  TYR n 
3 12  LEU n 
3 13  ALA n 
3 14  HIS n 
3 15  GLU n 
3 16  ARG n 
3 17  ARG n 
3 18  GLU n 
3 19  LEU n 
3 20  GLU n 
3 21  ALA n 
3 22  LYS n 
3 23  ARG n 
3 24  ASN n 
3 25  GLN n 
3 26  LEU n 
3 27  ARG n 
3 28  ASP n 
3 29  GLU n 
3 30  VAL n 
3 31  ASP n 
3 32  ARG n 
3 33  THR n 
3 34  LYS n 
3 35  THR n 
3 36  HIS n 
3 37  MET n 
3 38  GLN n 
3 39  ASP n 
3 40  GLU n 
3 41  ALA n 
3 42  ALA n 
3 43  ASN n 
3 44  ASP n 
3 45  PRO n 
3 46  ASN n 
3 47  TRP n 
3 48  PHE n 
3 49  ASP n 
3 50  ILE n 
3 51  THR n 
3 52  ALA n 
3 53  GLN n 
3 54  LEU n 
3 55  TRP n 
3 56  GLU n 
3 57  PHE n 
3 58  SER n 
3 59  GLN n 
3 60  GLU n 
3 61  LEU n 
3 62  ARG n 
3 63  ASN n 
3 64  ARG n 
3 65  ASP n 
3 66  ARG n 
3 67  GLU n 
3 68  GLU n 
3 69  LYS n 
3 70  LEU n 
3 71  ILE n 
3 72  LYS n 
3 73  LYS n 
3 74  ILE n 
3 75  GLU n 
3 76  GLN n 
3 77  THR n 
3 78  LEU n 
3 79  LYS n 
3 80  LYS n 
3 81  VAL n 
3 82  GLU n 
3 83  ASN n 
3 84  GLU n 
3 85  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'Homo sapiens'    9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) RIL'  ? ? 
? ? ? ? ? plasmid ? ? ? pET22b ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'Homo sapiens'    9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) RIL'  ? ? 
? ? ? ? ? plasmid ? ? ? pET22b ? ? 
3 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'artificial gene' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3) star' ? ? 
? ? ? ? ? plasmid ? ? ? pET29  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 PDB 3H3P 3H3P 1 ? 
;GSQVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGVIPLLTITNYAPRFQGRITITADRSTST
AYLELNSLRPEDTAVYYCAREGTTGAGWLGKPIGAFAHWGQGTLVTVSSLEHHHHHH
;
? 
2 PDB 3H3P 3H3P 2 ? 
;2MAEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTIS
RLEPEDFAVYYCQQYGQSLSTFGQGTKVEVKLVPR
;
? 
3 PDB 3H3P 3H3P 3 ? 
;HHHHHHTNEAYLAHERRELEAKRNQLRDEVDRTKTHMQDEAANDPNWFDITAQLWEFSQELRNRDREEKLIKKIEQTLKK
VENED
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H3P H 1 ? 137 ? 3H3P -1 ? 135 ? -1 135 
2 1 3H3P I 1 ? 137 ? 3H3P -1 ? 135 ? -1 135 
3 2 3H3P L 1 ? 114 ? 3H3P -1 ? 112 ? -1 112 
4 2 3H3P M 1 ? 114 ? 3H3P -1 ? 112 ? -1 112 
5 3 3H3P S 1 ? 85  ? 3H3P 1  ? 85  ? 1  85  
6 3 3H3P T 1 ? 85  ? 3H3P 1  ? 85  ? 1  85  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H3P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.24 
_exptl_crystal.density_percent_sol   45.09 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.2 M calcium acetate, 8% PEG 8000, 0.1 M Hepes, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           107 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2008-08-13 
_diffrn_detector.details                'Rigaku VariMax HR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3H3P 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             69.02 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   19557 
_reflns.number_all                   19557 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.104 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.5 
_reflns.B_iso_Wilson_estimate        63.6 
_reflns.pdbx_redundancy              4.56 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.347 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        4.29 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      8305 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3H3P 
_refine.ls_number_reflns_obs                     18347 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             60.08 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    97.30 
_refine.ls_R_factor_obs                          0.23171 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22890 
_refine.ls_R_factor_R_free                       0.28697 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  953 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.929 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.B_iso_mean                               59.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'computationally-derived model of the Fv, based on 1TZG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'isotropic, 1 tls group per chain' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.725 
_refine.pdbx_overall_ESU_R_Free                  0.364 
_refine.overall_SU_ML                            0.260 
_refine.overall_SU_B                             25.371 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3794 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             55 
_refine_hist.number_atoms_total               3850 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        60.08 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.022  ? 3881 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.007  0.020  ? 2583 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.109  1.947  ? 5284 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.722  3.003  ? 6267 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.646  5.000  ? 502  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.999 23.377 ? 151  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.597 15.000 ? 572  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.868 15.000 ? 24   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.061  0.200  ? 592  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 4379 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 805  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.236  0.300  ? 616  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.227  0.300  ? 2506 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.191  0.500  ? 1810 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.088  0.500  ? 2166 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.173  0.500  ? 218  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.122  0.500  ? 3    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.077  0.500  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.200  0.300  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.242  0.300  ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.160  0.500  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.700  2.000  ? 2566 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.094  2.000  ? 1041 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.048  3.000  ? 4012 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.611  4.000  ? 1530 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.421  6.000  ? 1272 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             1351 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               99.44 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H3P 
_struct.title                     'Crystal structure of HIV epitope-scaffold 4E10 Fv complex' 
_struct.pdbx_descriptor           'Fv 4E10 heavy chain, Fv 4E10 light chain, 4E10_S0_1TJLC_004_N' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H3P 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'epitope-scaffold Fv complex, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 64 ? GLN A 67 ? PRO H 62 GLN H 65 5 ? 4  
HELX_P HELX_P2  2  ARG A 89 ? THR A 93 ? ARG H 87 THR H 91 5 ? 5  
HELX_P HELX_P3  3  PRO B 55 ? THR B 58 ? PRO I 53 THR I 56 5 ? 4  
HELX_P HELX_P4  4  ARG B 89 ? THR B 93 ? ARG I 87 THR I 91 5 ? 5  
HELX_P HELX_P5  5  VAL C 31 ? ASN C 34 ? VAL L 29 ASN L 32 5 ? 4  
HELX_P HELX_P6  6  GLU C 82 ? PHE C 86 ? GLU L 80 PHE L 84 5 ? 5  
HELX_P HELX_P7  7  VAL D 31 ? ASN D 34 ? VAL M 29 ASN M 32 5 ? 4  
HELX_P HELX_P8  8  GLU D 82 ? PHE D 86 ? GLU M 80 PHE M 84 5 ? 5  
HELX_P HELX_P9  9  ASN E 46 ? PHE E 48 ? ASN S 46 PHE S 48 5 ? 3  
HELX_P HELX_P10 10 ASP E 49 ? GLN E 59 ? ASP S 49 GLN S 59 1 ? 11 
HELX_P HELX_P11 11 ASN F 46 ? PHE F 48 ? ASN T 46 PHE T 48 5 ? 3  
HELX_P HELX_P12 12 ASP F 49 ? ARG F 64 ? ASP T 49 ARG T 64 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 24 SG  ? ? ? 1_555 A CYS 98 SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf2 disulf ? ? B CYS 24 SG  ? ? ? 1_555 B CYS 98 SG ? ? I CYS 22  I CYS 96  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf3 disulf ? ? C CYS 25 SG  ? ? ? 1_555 C CYS 91 SG ? ? L CYS 23  L CYS 89  1_555 ? ? ? ? ? ? ? 2.099 ? 
disulf4 disulf ? ? D CYS 25 SG  ? ? ? 1_555 D CYS 91 SG ? ? M CYS 23  M CYS 89  1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc1 metalc ? ? A GLU 12 OE1 ? ? ? 1_555 G CA  .  CA ? ? H GLU 10  H CA  136 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc2 metalc ? ? A GLU 12 OE2 ? ? ? 1_555 G CA  .  CA ? ? H GLU 10  H CA  136 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc3 metalc ? ? A THR 21 O   ? ? ? 1_555 G CA  .  CA ? ? H THR 19  H CA  136 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc4 metalc ? ? G CA  .  CA  ? ? ? 1_555 H HOH .  O  ? ? H CA  136 H HOH 149 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc5 metalc ? ? G CA  .  CA  ? ? ? 1_555 I HOH .  O  ? ? H CA  136 I HOH 150 1_555 ? ? ? ? ? ? ? 2.508 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 9 C . ? SER 7 L PRO 10 C ? PRO 8 L 1 -3.10  
2 SER 9 D . ? SER 7 M PRO 10 D ? PRO 8 M 1 -11.32 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 6 ? 
F ? 4 ? 
G ? 4 ? 
H ? 5 ? 
I ? 4 ? 
J ? 4 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 5   ? GLN A 8   ? GLN H 3   GLN H 6   
A 2 VAL A 20  ? SER A 27  ? VAL H 18  SER H 25  
A 3 THR A 80  ? LEU A 85  ? THR H 78  LEU H 83  
A 4 ILE A 70  ? ASP A 75  ? ILE H 68  ASP H 73  
B 1 GLU A 12  ? LYS A 14  ? GLU H 10  LYS H 12  
B 2 THR A 123 ? VAL A 127 ? THR H 121 VAL H 125 
B 3 ALA A 94  ? THR A 103 ? ALA H 92  THR H 101 
B 4 LEU A 36  ? GLN A 41  ? LEU H 34  GLN H 39  
B 5 LEU A 47  ? ILE A 54  ? LEU H 45  ILE H 52  
B 6 ILE A 59  ? TYR A 62  ? ILE H 57  TYR H 60  
C 1 GLU A 12  ? LYS A 14  ? GLU H 10  LYS H 12  
C 2 THR A 123 ? VAL A 127 ? THR H 121 VAL H 125 
C 3 ALA A 94  ? THR A 103 ? ALA H 92  THR H 101 
C 4 PRO A 112 ? TRP A 119 ? PRO H 110 TRP H 117 
D 1 GLN B 5   ? GLN B 8   ? GLN I 3   GLN I 6   
D 2 VAL B 20  ? SER B 27  ? VAL I 18  SER I 25  
D 3 THR B 80  ? LEU B 85  ? THR I 78  LEU I 83  
D 4 ILE B 70  ? ASP B 75  ? ILE I 68  ASP I 73  
E 1 GLU B 12  ? LYS B 14  ? GLU I 10  LYS I 12  
E 2 THR B 123 ? VAL B 127 ? THR I 121 VAL I 125 
E 3 ALA B 94  ? THR B 104 ? ALA I 92  THR I 102 
E 4 LEU B 36  ? GLN B 41  ? LEU I 34  GLN I 39  
E 5 LEU B 47  ? ILE B 54  ? LEU I 45  ILE I 52  
E 6 ILE B 59  ? TYR B 62  ? ILE I 57  TYR I 60  
F 1 GLU B 12  ? LYS B 14  ? GLU I 10  LYS I 12  
F 2 THR B 123 ? VAL B 127 ? THR I 121 VAL I 125 
F 3 ALA B 94  ? THR B 104 ? ALA I 92  THR I 102 
F 4 LYS B 111 ? TRP B 119 ? LYS I 109 TRP I 117 
G 1 LEU C 6   ? SER C 9   ? LEU L 4   SER L 7   
G 2 ALA C 21  ? ALA C 27  ? ALA L 19  ALA L 25  
G 3 ASP C 73  ? ILE C 78  ? ASP L 71  ILE L 76  
G 4 PHE C 65  ? SER C 70  ? PHE L 63  SER L 68  
H 1 THR C 12  ? LEU C 15  ? THR L 10  LEU L 13  
H 2 THR C 105 ? VAL C 109 ? THR L 103 VAL L 107 
H 3 VAL C 88  ? GLN C 93  ? VAL L 86  GLN L 91  
H 4 LEU C 36  ? GLN C 41  ? LEU L 34  GLN L 39  
H 5 ARG C 48  ? ILE C 51  ? ARG L 46  ILE L 49  
I 1 THR C 12  ? LEU C 15  ? THR L 10  LEU L 13  
I 2 THR C 105 ? VAL C 109 ? THR L 103 VAL L 107 
I 3 VAL C 88  ? GLN C 93  ? VAL L 86  GLN L 91  
I 4 THR C 100 ? PHE C 101 ? THR L 98  PHE L 99  
J 1 LEU D 6   ? SER D 9   ? LEU M 4   SER M 7   
J 2 ALA D 21  ? ALA D 27  ? ALA M 19  ALA M 25  
J 3 ASP D 73  ? ILE D 78  ? ASP M 71  ILE M 76  
J 4 PHE D 65  ? SER D 70  ? PHE M 63  SER M 68  
K 1 SER D 14  ? LEU D 15  ? SER M 12  LEU M 13  
K 2 GLU D 108 ? VAL D 109 ? GLU M 106 VAL M 107 
L 1 ARG D 48  ? ILE D 51  ? ARG M 46  ILE M 49  
L 2 LEU D 36  ? GLN D 41  ? LEU M 34  GLN M 39  
L 3 VAL D 88  ? GLN D 93  ? VAL M 86  GLN M 91  
L 4 THR D 100 ? PHE D 101 ? THR M 98  PHE M 99  
M 1 ARG D 48  ? ILE D 51  ? ARG M 46  ILE M 49  
M 2 LEU D 36  ? GLN D 41  ? LEU M 34  GLN M 39  
M 3 VAL D 88  ? GLN D 93  ? VAL M 86  GLN M 91  
M 4 THR D 105 ? LYS D 106 ? THR M 103 LYS M 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5   ? N GLN H 3   O SER A 27  ? O SER H 25  
A 2 3 N CYS A 24  ? N CYS H 22  O ALA A 81  ? O ALA H 79  
A 3 4 O TYR A 82  ? O TYR H 80  N THR A 73  ? N THR H 71  
B 1 2 N LYS A 14  ? N LYS H 12  O THR A 126 ? O THR H 124 
B 2 3 O VAL A 125 ? O VAL H 123 N ALA A 94  ? N ALA H 92  
B 3 4 O ALA A 99  ? O ALA H 97  N SER A 37  ? N SER H 35  
B 4 5 N LEU A 36  ? N LEU H 34  O VAL A 53  ? O VAL H 51  
B 5 6 N GLY A 52  ? N GLY H 50  O ASN A 61  ? O ASN H 59  
C 1 2 N LYS A 14  ? N LYS H 12  O THR A 126 ? O THR H 124 
C 2 3 O VAL A 125 ? O VAL H 123 N ALA A 94  ? N ALA H 92  
C 3 4 N ARG A 100 ? N ARG H 98  O HIS A 118 ? O HIS H 116 
D 1 2 N VAL B 7   ? N VAL I 5   O LYS B 25  ? O LYS I 23  
D 2 3 N CYS B 24  ? N CYS I 22  O ALA B 81  ? O ALA I 79  
D 3 4 O GLU B 84  ? O GLU I 82  N THR B 71  ? N THR I 69  
E 1 2 N LYS B 14  ? N LYS I 12  O THR B 126 ? O THR I 124 
E 2 3 O VAL B 125 ? O VAL I 123 N ALA B 94  ? N ALA I 92  
E 3 4 O ALA B 99  ? O ALA I 97  N SER B 37  ? N SER I 35  
E 4 5 N TRP B 38  ? N TRP I 36  O GLY B 51  ? O GLY I 49  
E 5 6 N ILE B 54  ? N ILE I 52  O ILE B 59  ? O ILE I 57  
F 1 2 N LYS B 14  ? N LYS I 12  O THR B 126 ? O THR I 124 
F 2 3 O VAL B 125 ? O VAL I 123 N ALA B 94  ? N ALA I 92  
F 3 4 N THR B 104 ? N THR I 102 O LYS B 111 ? O LYS I 109 
G 1 2 N THR C 7   ? N THR L 5   O ARG C 26  ? O ARG L 24  
G 2 3 N LEU C 23  ? N LEU L 21  O LEU C 76  ? O LEU L 74  
G 3 4 O THR C 77  ? O THR L 75  N SER C 66  ? N SER L 64  
H 1 2 N GLN C 13  ? N GLN L 11  O GLU C 108 ? O GLU L 106 
H 2 3 O THR C 105 ? O THR L 103 N TYR C 89  ? N TYR L 87  
H 3 4 O GLN C 92  ? O GLN L 90  N ALA C 37  ? N ALA L 35  
H 4 5 N GLN C 40  ? N GLN L 38  O ARG C 48  ? O ARG L 46  
I 1 2 N GLN C 13  ? N GLN L 11  O GLU C 108 ? O GLU L 106 
I 2 3 O THR C 105 ? O THR L 103 N TYR C 89  ? N TYR L 87  
I 3 4 N GLN C 93  ? N GLN L 91  O THR C 100 ? O THR L 98  
J 1 2 N THR D 7   ? N THR M 5   O ARG D 26  ? O ARG M 24  
J 2 3 N CYS D 25  ? N CYS M 23  O PHE D 74  ? O PHE M 72  
J 3 4 O THR D 77  ? O THR M 75  N SER D 66  ? N SER M 64  
K 1 2 N LEU D 15  ? N LEU M 13  O GLU D 108 ? O GLU M 106 
L 1 2 O LEU D 50  ? O LEU M 48  N TRP D 38  ? N TRP M 36  
L 2 3 N TYR D 39  ? N TYR M 37  O TYR D 90  ? O TYR M 88  
L 3 4 N GLN D 93  ? N GLN M 91  O THR D 100 ? O THR M 98  
M 1 2 O LEU D 50  ? O LEU M 48  N TRP D 38  ? N TRP M 36  
M 2 3 N TYR D 39  ? N TYR M 37  O TYR D 90  ? O TYR M 88  
M 3 4 N TYR D 89  ? N TYR M 87  O THR D 105 ? O THR M 103 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE CA H 136' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 GLU A 12 ? GLU H 10  . ? 1_555 ? 
2 AC1 5 THR A 21 ? THR H 19  . ? 1_555 ? 
3 AC1 5 HOH H .  ? HOH H 149 . ? 1_555 ? 
4 AC1 5 GLU B 12 ? GLU I 10  . ? 1_555 ? 
5 AC1 5 HOH I .  ? HOH I 150 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H3P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H3P 
_atom_sites.fract_transf_matrix[1][1]   0.010823 
_atom_sites.fract_transf_matrix[1][2]   0.006248 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012497 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 3   ? -4.696  -13.503 -7.970  1.00 43.30 ? 1   GLN H N   1 
ATOM   2    C  CA  . GLN A 1 3   ? -5.393  -13.321 -9.284  1.00 43.11 ? 1   GLN H CA  1 
ATOM   3    C  C   . GLN A 1 3   ? -6.100  -14.616 -9.685  1.00 42.17 ? 1   GLN H C   1 
ATOM   4    O  O   . GLN A 1 3   ? -7.107  -14.596 -10.390 1.00 41.99 ? 1   GLN H O   1 
ATOM   5    C  CB  . GLN A 1 3   ? -4.403  -12.913 -10.390 1.00 43.44 ? 1   GLN H CB  1 
ATOM   6    C  CG  . GLN A 1 3   ? -3.046  -12.384 -9.892  1.00 44.29 ? 1   GLN H CG  1 
ATOM   7    C  CD  . GLN A 1 3   ? -2.739  -10.981 -10.407 1.00 44.39 ? 1   GLN H CD  1 
ATOM   8    O  OE1 . GLN A 1 3   ? -3.547  -10.062 -10.252 1.00 43.80 ? 1   GLN H OE1 1 
ATOM   9    N  NE2 . GLN A 1 3   ? -1.566  -10.811 -11.019 1.00 43.38 ? 1   GLN H NE2 1 
ATOM   10   N  N   . VAL A 1 4   ? -5.556  -15.733 -9.218  1.00 40.75 ? 2   VAL H N   1 
ATOM   11   C  CA  . VAL A 1 4   ? -6.062  -17.051 -9.545  1.00 39.77 ? 2   VAL H CA  1 
ATOM   12   C  C   . VAL A 1 4   ? -6.494  -17.784 -8.280  1.00 39.04 ? 2   VAL H C   1 
ATOM   13   O  O   . VAL A 1 4   ? -5.766  -17.796 -7.283  1.00 39.85 ? 2   VAL H O   1 
ATOM   14   C  CB  . VAL A 1 4   ? -4.952  -17.903 -10.194 1.00 39.79 ? 2   VAL H CB  1 
ATOM   15   C  CG1 . VAL A 1 4   ? -5.492  -19.255 -10.605 1.00 39.26 ? 2   VAL H CG1 1 
ATOM   16   C  CG2 . VAL A 1 4   ? -4.352  -17.179 -11.380 1.00 38.68 ? 2   VAL H CG2 1 
ATOM   17   N  N   . GLN A 1 5   ? -7.661  -18.414 -8.316  1.00 37.40 ? 3   GLN H N   1 
ATOM   18   C  CA  . GLN A 1 5   ? -8.069  -19.272 -7.204  1.00 36.13 ? 3   GLN H CA  1 
ATOM   19   C  C   . GLN A 1 5   ? -8.036  -20.753 -7.620  1.00 34.37 ? 3   GLN H C   1 
ATOM   20   O  O   . GLN A 1 5   ? -8.543  -21.147 -8.670  1.00 34.13 ? 3   GLN H O   1 
ATOM   21   C  CB  . GLN A 1 5   ? -9.435  -18.855 -6.631  1.00 36.00 ? 3   GLN H CB  1 
ATOM   22   C  CG  . GLN A 1 5   ? -9.412  -17.545 -5.801  1.00 37.57 ? 3   GLN H CG  1 
ATOM   23   C  CD  . GLN A 1 5   ? -9.149  -17.750 -4.290  1.00 39.10 ? 3   GLN H CD  1 
ATOM   24   O  OE1 . GLN A 1 5   ? -8.004  -17.760 -3.839  1.00 40.15 ? 3   GLN H OE1 1 
ATOM   25   N  NE2 . GLN A 1 5   ? -10.221 -17.881 -3.509  1.00 40.71 ? 3   GLN H NE2 1 
ATOM   26   N  N   . LEU A 1 6   ? -7.390  -21.555 -6.789  1.00 32.78 ? 4   LEU H N   1 
ATOM   27   C  CA  . LEU A 1 6   ? -7.355  -22.986 -6.956  1.00 31.49 ? 4   LEU H CA  1 
ATOM   28   C  C   . LEU A 1 6   ? -8.191  -23.621 -5.841  1.00 30.95 ? 4   LEU H C   1 
ATOM   29   O  O   . LEU A 1 6   ? -8.032  -23.262 -4.682  1.00 31.35 ? 4   LEU H O   1 
ATOM   30   C  CB  . LEU A 1 6   ? -5.906  -23.465 -6.869  1.00 31.53 ? 4   LEU H CB  1 
ATOM   31   C  CG  . LEU A 1 6   ? -4.895  -22.874 -7.865  1.00 31.18 ? 4   LEU H CG  1 
ATOM   32   C  CD1 . LEU A 1 6   ? -3.479  -23.253 -7.468  1.00 29.82 ? 4   LEU H CD1 1 
ATOM   33   C  CD2 . LEU A 1 6   ? -5.178  -23.335 -9.312  1.00 31.45 ? 4   LEU H CD2 1 
ATOM   34   N  N   . VAL A 1 7   ? -9.096  -24.538 -6.177  1.00 30.09 ? 5   VAL H N   1 
ATOM   35   C  CA  . VAL A 1 7   ? -9.799  -25.321 -5.157  1.00 29.82 ? 5   VAL H CA  1 
ATOM   36   C  C   . VAL A 1 7   ? -9.567  -26.805 -5.370  1.00 28.77 ? 5   VAL H C   1 
ATOM   37   O  O   . VAL A 1 7   ? -9.747  -27.325 -6.458  1.00 28.38 ? 5   VAL H O   1 
ATOM   38   C  CB  . VAL A 1 7   ? -11.319 -25.101 -5.172  1.00 30.08 ? 5   VAL H CB  1 
ATOM   39   C  CG1 . VAL A 1 7   ? -11.645 -23.646 -5.100  1.00 30.89 ? 5   VAL H CG1 1 
ATOM   40   C  CG2 . VAL A 1 7   ? -11.924 -25.705 -6.437  1.00 33.40 ? 5   VAL H CG2 1 
ATOM   41   N  N   . GLN A 1 8   ? -9.200  -27.496 -4.309  1.00 28.75 ? 6   GLN H N   1 
ATOM   42   C  CA  . GLN A 1 8   ? -8.947  -28.922 -4.396  1.00 28.80 ? 6   GLN H CA  1 
ATOM   43   C  C   . GLN A 1 8   ? -10.141 -29.765 -3.930  1.00 29.51 ? 6   GLN H C   1 
ATOM   44   O  O   . GLN A 1 8   ? -11.022 -29.298 -3.203  1.00 28.83 ? 6   GLN H O   1 
ATOM   45   C  CB  . GLN A 1 8   ? -7.707  -29.264 -3.583  1.00 28.74 ? 6   GLN H CB  1 
ATOM   46   C  CG  . GLN A 1 8   ? -6.454  -28.526 -4.064  1.00 28.37 ? 6   GLN H CG  1 
ATOM   47   C  CD  . GLN A 1 8   ? -5.209  -28.978 -3.349  1.00 27.99 ? 6   GLN H CD  1 
ATOM   48   O  OE1 . GLN A 1 8   ? -4.322  -28.185 -3.060  1.00 27.63 ? 6   GLN H OE1 1 
ATOM   49   N  NE2 . GLN A 1 8   ? -5.141  -30.264 -3.046  1.00 30.06 ? 6   GLN H NE2 1 
ATOM   50   N  N   . SER A 1 9   ? -10.174 -31.007 -4.394  1.00 30.51 ? 7   SER H N   1 
ATOM   51   C  CA  . SER A 1 9   ? -11.158 -31.966 -3.936  1.00 30.85 ? 7   SER H CA  1 
ATOM   52   C  C   . SER A 1 9   ? -10.908 -32.189 -2.458  1.00 31.11 ? 7   SER H C   1 
ATOM   53   O  O   . SER A 1 9   ? -9.881  -31.761 -1.912  1.00 31.72 ? 7   SER H O   1 
ATOM   54   C  CB  . SER A 1 9   ? -11.024 -33.276 -4.703  1.00 31.26 ? 7   SER H CB  1 
ATOM   55   O  OG  . SER A 1 9   ? -9.660  -33.552 -4.988  1.00 32.36 ? 7   SER H OG  1 
ATOM   56   N  N   . GLY A 1 10  ? -11.840 -32.867 -1.814  1.00 30.62 ? 8   GLY H N   1 
ATOM   57   C  CA  . GLY A 1 10  ? -11.835 -32.948 -0.372  1.00 30.66 ? 8   GLY H CA  1 
ATOM   58   C  C   . GLY A 1 10  ? -11.098 -34.127 0.203   1.00 30.61 ? 8   GLY H C   1 
ATOM   59   O  O   . GLY A 1 10  ? -10.696 -35.039 -0.501  1.00 29.85 ? 8   GLY H O   1 
ATOM   60   N  N   . ALA A 1 11  ? -10.948 -34.075 1.518   1.00 31.58 ? 9   ALA H N   1 
ATOM   61   C  CA  . ALA A 1 11  ? -10.322 -35.122 2.308   1.00 31.96 ? 9   ALA H CA  1 
ATOM   62   C  C   . ALA A 1 11  ? -10.766 -36.527 1.886   1.00 32.52 ? 9   ALA H C   1 
ATOM   63   O  O   . ALA A 1 11  ? -11.951 -36.776 1.643   1.00 33.04 ? 9   ALA H O   1 
ATOM   64   C  CB  . ALA A 1 11  ? -10.642 -34.890 3.783   1.00 31.67 ? 9   ALA H CB  1 
ATOM   65   N  N   . GLU A 1 12  ? -9.810  -37.448 1.849   1.00 32.58 ? 10  GLU H N   1 
ATOM   66   C  CA  . GLU A 1 12  ? -10.057 -38.789 1.359   1.00 32.86 ? 10  GLU H CA  1 
ATOM   67   C  C   . GLU A 1 12  ? -9.361  -39.820 2.259   1.00 32.75 ? 10  GLU H C   1 
ATOM   68   O  O   . GLU A 1 12  ? -8.271  -39.564 2.769   1.00 33.01 ? 10  GLU H O   1 
ATOM   69   C  CB  . GLU A 1 12  ? -9.530  -38.884 -0.072  1.00 33.57 ? 10  GLU H CB  1 
ATOM   70   C  CG  . GLU A 1 12  ? -10.568 -39.300 -1.098  1.00 34.59 ? 10  GLU H CG  1 
ATOM   71   C  CD  . GLU A 1 12  ? -10.025 -39.254 -2.510  1.00 35.32 ? 10  GLU H CD  1 
ATOM   72   O  OE1 . GLU A 1 12  ? -9.567  -38.169 -2.939  1.00 35.84 ? 10  GLU H OE1 1 
ATOM   73   O  OE2 . GLU A 1 12  ? -10.057 -40.305 -3.188  1.00 34.94 ? 10  GLU H OE2 1 
ATOM   74   N  N   . VAL A 1 13  ? -9.990  -40.980 2.450   1.00 32.28 ? 11  VAL H N   1 
ATOM   75   C  CA  . VAL A 1 13  ? -9.451  -42.039 3.318   1.00 31.96 ? 11  VAL H CA  1 
ATOM   76   C  C   . VAL A 1 13  ? -9.187  -43.318 2.520   1.00 31.78 ? 11  VAL H C   1 
ATOM   77   O  O   . VAL A 1 13  ? -10.119 -43.887 1.965   1.00 31.96 ? 11  VAL H O   1 
ATOM   78   C  CB  . VAL A 1 13  ? -10.434 -42.371 4.472   1.00 32.16 ? 11  VAL H CB  1 
ATOM   79   C  CG1 . VAL A 1 13  ? -9.936  -43.564 5.291   1.00 31.83 ? 11  VAL H CG1 1 
ATOM   80   C  CG2 . VAL A 1 13  ? -10.639 -41.156 5.368   1.00 31.60 ? 11  VAL H CG2 1 
ATOM   81   N  N   . LYS A 1 14  ? -7.932  -43.776 2.480   1.00 31.60 ? 12  LYS H N   1 
ATOM   82   C  CA  . LYS A 1 14  ? -7.540  -44.938 1.644   1.00 31.80 ? 12  LYS H CA  1 
ATOM   83   C  C   . LYS A 1 14  ? -6.905  -46.088 2.423   1.00 31.66 ? 12  LYS H C   1 
ATOM   84   O  O   . LYS A 1 14  ? -6.321  -45.884 3.482   1.00 32.11 ? 12  LYS H O   1 
ATOM   85   C  CB  . LYS A 1 14  ? -6.537  -44.529 0.554   1.00 32.08 ? 12  LYS H CB  1 
ATOM   86   C  CG  . LYS A 1 14  ? -6.965  -43.377 -0.348  1.00 33.14 ? 12  LYS H CG  1 
ATOM   87   C  CD  . LYS A 1 14  ? -8.290  -43.633 -1.052  1.00 33.78 ? 12  LYS H CD  1 
ATOM   88   C  CE  . LYS A 1 14  ? -8.175  -44.711 -2.104  1.00 34.05 ? 12  LYS H CE  1 
ATOM   89   N  NZ  . LYS A 1 14  ? -9.255  -44.572 -3.116  1.00 34.24 ? 12  LYS H NZ  1 
ATOM   90   N  N   . ARG A 1 15  ? -6.999  -47.298 1.878   1.00 31.31 ? 13  ARG H N   1 
ATOM   91   C  CA  . ARG A 1 15  ? -6.317  -48.446 2.471   1.00 31.32 ? 13  ARG H CA  1 
ATOM   92   C  C   . ARG A 1 15  ? -5.003  -48.715 1.735   1.00 31.22 ? 13  ARG H C   1 
ATOM   93   O  O   . ARG A 1 15  ? -4.849  -48.349 0.568   1.00 31.41 ? 13  ARG H O   1 
ATOM   94   C  CB  . ARG A 1 15  ? -7.209  -49.695 2.474   1.00 31.22 ? 13  ARG H CB  1 
ATOM   95   C  CG  . ARG A 1 15  ? -8.339  -49.653 3.511   1.00 31.47 ? 13  ARG H CG  1 
ATOM   96   C  CD  . ARG A 1 15  ? -8.568  -51.015 4.184   1.00 31.53 ? 13  ARG H CD  1 
ATOM   97   N  N   . PRO A 1 16  ? -4.025  -49.307 2.429   1.00 30.78 ? 14  PRO H N   1 
ATOM   98   C  CA  . PRO A 1 16  ? -2.783  -49.636 1.739   1.00 30.96 ? 14  PRO H CA  1 
ATOM   99   C  C   . PRO A 1 16  ? -3.017  -50.453 0.483   1.00 30.31 ? 14  PRO H C   1 
ATOM   100  O  O   . PRO A 1 16  ? -3.894  -51.310 0.449   1.00 29.40 ? 14  PRO H O   1 
ATOM   101  C  CB  . PRO A 1 16  ? -1.997  -50.435 2.782   1.00 30.88 ? 14  PRO H CB  1 
ATOM   102  C  CG  . PRO A 1 16  ? -2.494  -49.916 4.074   1.00 31.22 ? 14  PRO H CG  1 
ATOM   103  C  CD  . PRO A 1 16  ? -3.957  -49.626 3.860   1.00 30.69 ? 14  PRO H CD  1 
ATOM   104  N  N   . GLY A 1 17  ? -2.235  -50.155 -0.547  1.00 30.29 ? 15  GLY H N   1 
ATOM   105  C  CA  . GLY A 1 17  ? -2.294  -50.900 -1.804  1.00 30.18 ? 15  GLY H CA  1 
ATOM   106  C  C   . GLY A 1 17  ? -3.277  -50.319 -2.798  1.00 29.40 ? 15  GLY H C   1 
ATOM   107  O  O   . GLY A 1 17  ? -3.440  -50.838 -3.902  1.00 29.07 ? 15  GLY H O   1 
ATOM   108  N  N   . SER A 1 18  ? -3.928  -49.232 -2.414  1.00 28.67 ? 16  SER H N   1 
ATOM   109  C  CA  . SER A 1 18  ? -4.921  -48.623 -3.282  1.00 28.51 ? 16  SER H CA  1 
ATOM   110  C  C   . SER A 1 18  ? -4.369  -47.384 -3.989  1.00 27.65 ? 16  SER H C   1 
ATOM   111  O  O   . SER A 1 18  ? -3.196  -47.074 -3.899  1.00 27.38 ? 16  SER H O   1 
ATOM   112  C  CB  . SER A 1 18  ? -6.220  -48.320 -2.505  1.00 28.37 ? 16  SER H CB  1 
ATOM   113  O  OG  . SER A 1 18  ? -6.054  -47.272 -1.566  1.00 29.44 ? 16  SER H OG  1 
ATOM   114  N  N   . SER A 1 19  ? -5.244  -46.701 -4.706  1.00 27.60 ? 17  SER H N   1 
ATOM   115  C  CA  . SER A 1 19  ? -4.884  -45.565 -5.523  1.00 27.58 ? 17  SER H CA  1 
ATOM   116  C  C   . SER A 1 19  ? -5.687  -44.344 -5.061  1.00 26.89 ? 17  SER H C   1 
ATOM   117  O  O   . SER A 1 19  ? -6.804  -44.482 -4.555  1.00 26.34 ? 17  SER H O   1 
ATOM   118  C  CB  . SER A 1 19  ? -5.213  -45.898 -6.982  1.00 27.78 ? 17  SER H CB  1 
ATOM   119  O  OG  . SER A 1 19  ? -4.315  -45.283 -7.887  1.00 30.60 ? 17  SER H OG  1 
ATOM   120  N  N   . VAL A 1 20  ? -5.122  -43.150 -5.222  1.00 26.09 ? 18  VAL H N   1 
ATOM   121  C  CA  . VAL A 1 20  ? -5.870  -41.909 -4.944  1.00 24.97 ? 18  VAL H CA  1 
ATOM   122  C  C   . VAL A 1 20  ? -5.721  -40.943 -6.102  1.00 25.11 ? 18  VAL H C   1 
ATOM   123  O  O   . VAL A 1 20  ? -4.656  -40.827 -6.691  1.00 24.54 ? 18  VAL H O   1 
ATOM   124  C  CB  . VAL A 1 20  ? -5.413  -41.193 -3.624  1.00 24.50 ? 18  VAL H CB  1 
ATOM   125  C  CG1 . VAL A 1 20  ? -4.112  -40.439 -3.813  1.00 20.97 ? 18  VAL H CG1 1 
ATOM   126  C  CG2 . VAL A 1 20  ? -6.485  -40.237 -3.145  1.00 22.87 ? 18  VAL H CG2 1 
ATOM   127  N  N   . THR A 1 21  ? -6.799  -40.248 -6.430  1.00 25.93 ? 19  THR H N   1 
ATOM   128  C  CA  . THR A 1 21  ? -6.732  -39.167 -7.409  1.00 26.55 ? 19  THR H CA  1 
ATOM   129  C  C   . THR A 1 21  ? -7.295  -37.890 -6.783  1.00 26.42 ? 19  THR H C   1 
ATOM   130  O  O   . THR A 1 21  ? -8.429  -37.868 -6.293  1.00 26.50 ? 19  THR H O   1 
ATOM   131  C  CB  . THR A 1 21  ? -7.498  -39.492 -8.703  1.00 26.67 ? 19  THR H CB  1 
ATOM   132  O  OG1 . THR A 1 21  ? -8.884  -39.177 -8.526  1.00 28.94 ? 19  THR H OG1 1 
ATOM   133  C  CG2 . THR A 1 21  ? -7.321  -40.956 -9.100  1.00 26.01 ? 19  THR H CG2 1 
ATOM   134  N  N   . VAL A 1 22  ? -6.480  -36.841 -6.770  1.00 26.26 ? 20  VAL H N   1 
ATOM   135  C  CA  . VAL A 1 22  ? -6.879  -35.574 -6.176  1.00 26.06 ? 20  VAL H CA  1 
ATOM   136  C  C   . VAL A 1 22  ? -7.027  -34.565 -7.298  1.00 26.01 ? 20  VAL H C   1 
ATOM   137  O  O   . VAL A 1 22  ? -6.187  -34.500 -8.187  1.00 25.58 ? 20  VAL H O   1 
ATOM   138  C  CB  . VAL A 1 22  ? -5.852  -35.074 -5.132  1.00 26.11 ? 20  VAL H CB  1 
ATOM   139  C  CG1 . VAL A 1 22  ? -6.271  -33.742 -4.581  1.00 25.23 ? 20  VAL H CG1 1 
ATOM   140  C  CG2 . VAL A 1 22  ? -5.716  -36.077 -4.005  1.00 26.74 ? 20  VAL H CG2 1 
ATOM   141  N  N   . SER A 1 23  ? -8.109  -33.791 -7.255  1.00 26.53 ? 21  SER H N   1 
ATOM   142  C  CA  . SER A 1 23  ? -8.391  -32.807 -8.286  1.00 26.54 ? 21  SER H CA  1 
ATOM   143  C  C   . SER A 1 23  ? -8.043  -31.420 -7.767  1.00 26.93 ? 21  SER H C   1 
ATOM   144  O  O   . SER A 1 23  ? -8.140  -31.156 -6.564  1.00 26.30 ? 21  SER H O   1 
ATOM   145  C  CB  . SER A 1 23  ? -9.853  -32.867 -8.691  1.00 26.09 ? 21  SER H CB  1 
ATOM   146  O  OG  . SER A 1 23  ? -10.667 -32.420 -7.627  1.00 28.07 ? 21  SER H OG  1 
ATOM   147  N  N   . CYS A 1 24  ? -7.585  -30.569 -8.687  1.00 27.38 ? 22  CYS H N   1 
ATOM   148  C  CA  . CYS A 1 24  ? -7.339  -29.145 -8.440  1.00 27.65 ? 22  CYS H CA  1 
ATOM   149  C  C   . CYS A 1 24  ? -7.990  -28.350 -9.579  1.00 27.28 ? 22  CYS H C   1 
ATOM   150  O  O   . CYS A 1 24  ? -7.554  -28.449 -10.723 1.00 27.81 ? 22  CYS H O   1 
ATOM   151  C  CB  . CYS A 1 24  ? -5.838  -28.847 -8.392  1.00 28.18 ? 22  CYS H CB  1 
ATOM   152  S  SG  . CYS A 1 24  ? -5.390  -27.059 -8.258  1.00 32.16 ? 22  CYS H SG  1 
ATOM   153  N  N   . LYS A 1 25  ? -9.034  -27.583 -9.268  1.00 26.48 ? 23  LYS H N   1 
ATOM   154  C  CA  . LYS A 1 25  ? -9.746  -26.804 -10.261 1.00 26.46 ? 23  LYS H CA  1 
ATOM   155  C  C   . LYS A 1 25  ? -9.285  -25.352 -10.211 1.00 26.32 ? 23  LYS H C   1 
ATOM   156  O  O   . LYS A 1 25  ? -9.225  -24.763 -9.143  1.00 25.67 ? 23  LYS H O   1 
ATOM   157  C  CB  . LYS A 1 25  ? -11.254 -26.884 -10.012 1.00 26.98 ? 23  LYS H CB  1 
ATOM   158  C  CG  . LYS A 1 25  ? -12.110 -26.235 -11.098 1.00 26.88 ? 23  LYS H CG  1 
ATOM   159  C  CD  . LYS A 1 25  ? -13.588 -26.440 -10.807 1.00 29.54 ? 23  LYS H CD  1 
ATOM   160  C  CE  . LYS A 1 25  ? -14.460 -26.359 -12.070 1.00 30.32 ? 23  LYS H CE  1 
ATOM   161  N  NZ  . LYS A 1 25  ? -14.015 -25.274 -12.975 1.00 32.51 ? 23  LYS H NZ  1 
ATOM   162  N  N   . ALA A 1 26  ? -8.967  -24.786 -11.372 1.00 26.66 ? 24  ALA H N   1 
ATOM   163  C  CA  . ALA A 1 26  ? -8.448  -23.407 -11.463 1.00 27.91 ? 24  ALA H CA  1 
ATOM   164  C  C   . ALA A 1 26  ? -9.449  -22.387 -12.044 1.00 28.40 ? 24  ALA H C   1 
ATOM   165  O  O   . ALA A 1 26  ? -10.100 -22.620 -13.056 1.00 28.27 ? 24  ALA H O   1 
ATOM   166  C  CB  . ALA A 1 26  ? -7.155  -23.380 -12.269 1.00 27.96 ? 24  ALA H CB  1 
ATOM   167  N  N   . SER A 1 27  ? -9.552  -21.245 -11.391 1.00 29.44 ? 25  SER H N   1 
ATOM   168  C  CA  . SER A 1 27  ? -10.449 -20.189 -11.834 1.00 30.30 ? 25  SER H CA  1 
ATOM   169  C  C   . SER A 1 27  ? -9.732  -18.837 -11.803 1.00 30.83 ? 25  SER H C   1 
ATOM   170  O  O   . SER A 1 27  ? -8.958  -18.547 -10.886 1.00 30.67 ? 25  SER H O   1 
ATOM   171  C  CB  . SER A 1 27  ? -11.682 -20.154 -10.941 1.00 30.23 ? 25  SER H CB  1 
ATOM   172  O  OG  . SER A 1 27  ? -12.071 -18.819 -10.720 1.00 31.56 ? 25  SER H OG  1 
ATOM   173  N  N   . GLY A 1 28  ? -10.000 -18.010 -12.807 1.00 31.72 ? 26  GLY H N   1 
ATOM   174  C  CA  . GLY A 1 28  ? -9.258  -16.759 -12.993 1.00 32.33 ? 26  GLY H CA  1 
ATOM   175  C  C   . GLY A 1 28  ? -8.104  -16.955 -13.968 1.00 32.91 ? 26  GLY H C   1 
ATOM   176  O  O   . GLY A 1 28  ? -7.650  -18.081 -14.196 1.00 34.03 ? 26  GLY H O   1 
ATOM   177  N  N   . GLY A 1 29  ? -7.631  -15.858 -14.548 1.00 32.97 ? 27  GLY H N   1 
ATOM   178  C  CA  . GLY A 1 29  ? -6.556  -15.899 -15.536 1.00 32.83 ? 27  GLY H CA  1 
ATOM   179  C  C   . GLY A 1 29  ? -6.787  -16.945 -16.616 1.00 32.80 ? 27  GLY H C   1 
ATOM   180  O  O   . GLY A 1 29  ? -7.935  -17.227 -16.993 1.00 33.16 ? 27  GLY H O   1 
ATOM   181  N  N   . SER A 1 30  ? -5.685  -17.519 -17.102 1.00 31.82 ? 28  SER H N   1 
ATOM   182  C  CA  . SER A 1 30  ? -5.700  -18.531 -18.149 1.00 30.97 ? 28  SER H CA  1 
ATOM   183  C  C   . SER A 1 30  ? -4.971  -19.778 -17.656 1.00 30.36 ? 28  SER H C   1 
ATOM   184  O  O   . SER A 1 30  ? -4.007  -19.691 -16.904 1.00 30.65 ? 28  SER H O   1 
ATOM   185  C  CB  . SER A 1 30  ? -5.041  -17.999 -19.430 1.00 30.43 ? 28  SER H CB  1 
ATOM   186  N  N   . PHE A 1 31  ? -5.418  -20.933 -18.126 1.00 29.42 ? 29  PHE H N   1 
ATOM   187  C  CA  . PHE A 1 31  ? -5.011  -22.216 -17.576 1.00 28.66 ? 29  PHE H CA  1 
ATOM   188  C  C   . PHE A 1 31  ? -3.877  -22.937 -18.339 1.00 28.33 ? 29  PHE H C   1 
ATOM   189  O  O   . PHE A 1 31  ? -2.963  -23.504 -17.738 1.00 28.81 ? 29  PHE H O   1 
ATOM   190  C  CB  . PHE A 1 31  ? -6.254  -23.112 -17.523 1.00 28.41 ? 29  PHE H CB  1 
ATOM   191  C  CG  . PHE A 1 31  ? -5.972  -24.522 -17.093 1.00 26.97 ? 29  PHE H CG  1 
ATOM   192  C  CD1 . PHE A 1 31  ? -5.652  -24.804 -15.776 1.00 25.61 ? 29  PHE H CD1 1 
ATOM   193  C  CD2 . PHE A 1 31  ? -6.052  -25.563 -18.004 1.00 25.84 ? 29  PHE H CD2 1 
ATOM   194  C  CE1 . PHE A 1 31  ? -5.409  -26.095 -15.371 1.00 27.35 ? 29  PHE H CE1 1 
ATOM   195  C  CE2 . PHE A 1 31  ? -5.811  -26.860 -17.612 1.00 27.15 ? 29  PHE H CE2 1 
ATOM   196  C  CZ  . PHE A 1 31  ? -5.484  -27.127 -16.285 1.00 29.06 ? 29  PHE H CZ  1 
ATOM   197  N  N   . SER A 1 32  ? -3.930  -22.910 -19.658 1.00 27.75 ? 30  SER H N   1 
ATOM   198  C  CA  . SER A 1 32  ? -3.105  -23.814 -20.461 1.00 27.84 ? 30  SER H CA  1 
ATOM   199  C  C   . SER A 1 32  ? -1.583  -23.632 -20.410 1.00 27.71 ? 30  SER H C   1 
ATOM   200  O  O   . SER A 1 32  ? -0.855  -24.617 -20.505 1.00 27.59 ? 30  SER H O   1 
ATOM   201  C  CB  . SER A 1 32  ? -3.556  -23.765 -21.914 1.00 27.96 ? 30  SER H CB  1 
ATOM   202  O  OG  . SER A 1 32  ? -4.728  -24.539 -22.084 1.00 28.63 ? 30  SER H OG  1 
ATOM   203  N  N   . THR A 1 33  ? -1.094  -22.402 -20.283 1.00 27.06 ? 31  THR H N   1 
ATOM   204  C  CA  . THR A 1 33  ? 0.339   -22.177 -20.428 1.00 26.80 ? 31  THR H CA  1 
ATOM   205  C  C   . THR A 1 33  ? 1.051   -21.754 -19.142 1.00 27.07 ? 31  THR H C   1 
ATOM   206  O  O   . THR A 1 33  ? 2.098   -21.104 -19.186 1.00 27.31 ? 31  THR H O   1 
ATOM   207  C  CB  . THR A 1 33  ? 0.638   -21.162 -21.522 1.00 26.47 ? 31  THR H CB  1 
ATOM   208  O  OG1 . THR A 1 33  ? 0.059   -19.909 -21.173 1.00 26.25 ? 31  THR H OG1 1 
ATOM   209  C  CG2 . THR A 1 33  ? 0.070   -21.627 -22.843 1.00 26.71 ? 31  THR H CG2 1 
ATOM   210  N  N   . TYR A 1 34  ? 0.516   -22.163 -18.003 1.00 26.98 ? 32  TYR H N   1 
ATOM   211  C  CA  . TYR A 1 34  ? 1.206   -21.941 -16.741 1.00 27.08 ? 32  TYR H CA  1 
ATOM   212  C  C   . TYR A 1 34  ? 1.407   -23.251 -16.015 1.00 26.28 ? 32  TYR H C   1 
ATOM   213  O  O   . TYR A 1 34  ? 0.523   -24.081 -15.984 1.00 26.64 ? 32  TYR H O   1 
ATOM   214  C  CB  . TYR A 1 34  ? 0.443   -20.921 -15.899 1.00 27.52 ? 32  TYR H CB  1 
ATOM   215  C  CG  . TYR A 1 34  ? 0.463   -19.561 -16.566 1.00 29.43 ? 32  TYR H CG  1 
ATOM   216  C  CD1 . TYR A 1 34  ? -0.613  -19.117 -17.331 1.00 30.97 ? 32  TYR H CD1 1 
ATOM   217  C  CD2 . TYR A 1 34  ? 1.580   -18.746 -16.481 1.00 29.83 ? 32  TYR H CD2 1 
ATOM   218  C  CE1 . TYR A 1 34  ? -0.587  -17.872 -17.969 1.00 29.79 ? 32  TYR H CE1 1 
ATOM   219  C  CE2 . TYR A 1 34  ? 1.611   -17.504 -17.108 1.00 31.55 ? 32  TYR H CE2 1 
ATOM   220  C  CZ  . TYR A 1 34  ? 0.528   -17.080 -17.852 1.00 30.68 ? 32  TYR H CZ  1 
ATOM   221  O  OH  . TYR A 1 34  ? 0.582   -15.855 -18.473 1.00 32.42 ? 32  TYR H OH  1 
ATOM   222  N  N   . ALA A 1 35  ? 2.588   -23.436 -15.442 1.00 26.18 ? 33  ALA H N   1 
ATOM   223  C  CA  . ALA A 1 35  ? 2.981   -24.732 -14.893 1.00 25.82 ? 33  ALA H CA  1 
ATOM   224  C  C   . ALA A 1 35  ? 2.312   -24.984 -13.555 1.00 25.89 ? 33  ALA H C   1 
ATOM   225  O  O   . ALA A 1 35  ? 2.298   -24.111 -12.681 1.00 25.42 ? 33  ALA H O   1 
ATOM   226  C  CB  . ALA A 1 35  ? 4.501   -24.801 -14.741 1.00 25.57 ? 33  ALA H CB  1 
ATOM   227  N  N   . LEU A 1 36  ? 1.773   -26.185 -13.384 1.00 25.73 ? 34  LEU H N   1 
ATOM   228  C  CA  . LEU A 1 36  ? 1.140   -26.545 -12.117 1.00 25.75 ? 34  LEU H CA  1 
ATOM   229  C  C   . LEU A 1 36  ? 1.801   -27.751 -11.435 1.00 25.33 ? 34  LEU H C   1 
ATOM   230  O  O   . LEU A 1 36  ? 1.909   -28.801 -12.019 1.00 25.79 ? 34  LEU H O   1 
ATOM   231  C  CB  . LEU A 1 36  ? -0.336  -26.828 -12.336 1.00 25.73 ? 34  LEU H CB  1 
ATOM   232  C  CG  . LEU A 1 36  ? -0.998  -27.254 -11.029 1.00 26.58 ? 34  LEU H CG  1 
ATOM   233  C  CD1 . LEU A 1 36  ? -2.280  -26.467 -10.808 1.00 26.21 ? 34  LEU H CD1 1 
ATOM   234  C  CD2 . LEU A 1 36  ? -1.208  -28.783 -10.977 1.00 25.58 ? 34  LEU H CD2 1 
ATOM   235  N  N   . SER A 1 37  ? 2.223   -27.598 -10.188 1.00 24.98 ? 35  SER H N   1 
ATOM   236  C  CA  . SER A 1 37  ? 2.915   -28.669 -9.483  1.00 24.40 ? 35  SER H CA  1 
ATOM   237  C  C   . SER A 1 37  ? 2.120   -29.239 -8.298  1.00 24.97 ? 35  SER H C   1 
ATOM   238  O  O   . SER A 1 37  ? 1.256   -28.577 -7.739  1.00 24.18 ? 35  SER H O   1 
ATOM   239  C  CB  . SER A 1 37  ? 4.273   -28.165 -8.995  1.00 23.87 ? 35  SER H CB  1 
ATOM   240  O  OG  . SER A 1 37  ? 5.154   -27.945 -10.082 1.00 22.55 ? 35  SER H OG  1 
ATOM   241  N  N   . TRP A 1 38  ? 2.426   -30.474 -7.917  1.00 25.73 ? 36  TRP H N   1 
ATOM   242  C  CA  . TRP A 1 38  ? 1.866   -31.043 -6.699  1.00 26.59 ? 36  TRP H CA  1 
ATOM   243  C  C   . TRP A 1 38  ? 2.918   -31.136 -5.625  1.00 26.57 ? 36  TRP H C   1 
ATOM   244  O  O   . TRP A 1 38  ? 3.986   -31.695 -5.848  1.00 28.04 ? 36  TRP H O   1 
ATOM   245  C  CB  . TRP A 1 38  ? 1.276   -32.414 -6.957  1.00 26.87 ? 36  TRP H CB  1 
ATOM   246  C  CG  . TRP A 1 38  ? 0.035   -32.338 -7.788  1.00 28.05 ? 36  TRP H CG  1 
ATOM   247  C  CD1 . TRP A 1 38  ? -0.053  -32.468 -9.132  1.00 28.51 ? 36  TRP H CD1 1 
ATOM   248  C  CD2 . TRP A 1 38  ? -1.296  -32.110 -7.317  1.00 29.23 ? 36  TRP H CD2 1 
ATOM   249  N  NE1 . TRP A 1 38  ? -1.355  -32.328 -9.537  1.00 29.87 ? 36  TRP H NE1 1 
ATOM   250  C  CE2 . TRP A 1 38  ? -2.140  -32.112 -8.440  1.00 28.15 ? 36  TRP H CE2 1 
ATOM   251  C  CE3 . TRP A 1 38  ? -1.854  -31.898 -6.052  1.00 29.51 ? 36  TRP H CE3 1 
ATOM   252  C  CZ2 . TRP A 1 38  ? -3.508  -31.921 -8.343  1.00 28.34 ? 36  TRP H CZ2 1 
ATOM   253  C  CZ3 . TRP A 1 38  ? -3.214  -31.707 -5.957  1.00 28.83 ? 36  TRP H CZ3 1 
ATOM   254  C  CH2 . TRP A 1 38  ? -4.028  -31.723 -7.095  1.00 29.06 ? 36  TRP H CH2 1 
ATOM   255  N  N   . VAL A 1 39  ? 2.607   -30.582 -4.462  1.00 25.75 ? 37  VAL H N   1 
ATOM   256  C  CA  . VAL A 1 39  ? 3.545   -30.526 -3.365  1.00 25.49 ? 37  VAL H CA  1 
ATOM   257  C  C   . VAL A 1 39  ? 2.871   -31.061 -2.126  1.00 26.46 ? 37  VAL H C   1 
ATOM   258  O  O   . VAL A 1 39  ? 1.834   -30.538 -1.725  1.00 28.30 ? 37  VAL H O   1 
ATOM   259  C  CB  . VAL A 1 39  ? 3.958   -29.081 -3.084  1.00 25.51 ? 37  VAL H CB  1 
ATOM   260  C  CG1 . VAL A 1 39  ? 4.817   -29.012 -1.816  1.00 23.94 ? 37  VAL H CG1 1 
ATOM   261  C  CG2 . VAL A 1 39  ? 4.660   -28.484 -4.305  1.00 22.34 ? 37  VAL H CG2 1 
ATOM   262  N  N   . ARG A 1 40  ? 3.432   -32.092 -1.506  1.00 26.21 ? 38  ARG H N   1 
ATOM   263  C  CA  . ARG A 1 40  ? 2.758   -32.689 -0.370  1.00 26.00 ? 38  ARG H CA  1 
ATOM   264  C  C   . ARG A 1 40  ? 3.498   -32.408 0.905   1.00 26.48 ? 38  ARG H C   1 
ATOM   265  O  O   . ARG A 1 40  ? 4.653   -31.953 0.898   1.00 26.73 ? 38  ARG H O   1 
ATOM   266  C  CB  . ARG A 1 40  ? 2.572   -34.195 -0.552  1.00 26.37 ? 38  ARG H CB  1 
ATOM   267  C  CG  . ARG A 1 40  ? 3.802   -35.034 -0.296  1.00 25.61 ? 38  ARG H CG  1 
ATOM   268  C  CD  . ARG A 1 40  ? 3.501   -36.506 -0.457  1.00 24.43 ? 38  ARG H CD  1 
ATOM   269  N  NE  . ARG A 1 40  ? 4.680   -37.346 -0.240  1.00 24.45 ? 38  ARG H NE  1 
ATOM   270  C  CZ  . ARG A 1 40  ? 4.636   -38.675 -0.182  1.00 24.73 ? 38  ARG H CZ  1 
ATOM   271  N  NH1 . ARG A 1 40  ? 5.742   -39.391 0.022   1.00 19.61 ? 38  ARG H NH1 1 
ATOM   272  N  NH2 . ARG A 1 40  ? 3.463   -39.291 -0.323  1.00 26.67 ? 38  ARG H NH2 1 
ATOM   273  N  N   . GLN A 1 41  ? 2.817   -32.675 2.009   1.00 26.59 ? 39  GLN H N   1 
ATOM   274  C  CA  . GLN A 1 41  ? 3.351   -32.372 3.322   1.00 27.39 ? 39  GLN H CA  1 
ATOM   275  C  C   . GLN A 1 41  ? 2.847   -33.393 4.330   1.00 27.86 ? 39  GLN H C   1 
ATOM   276  O  O   . GLN A 1 41  ? 1.670   -33.362 4.699   1.00 28.54 ? 39  GLN H O   1 
ATOM   277  C  CB  . GLN A 1 41  ? 2.934   -30.962 3.745   1.00 27.00 ? 39  GLN H CB  1 
ATOM   278  C  CG  . GLN A 1 41  ? 3.370   -30.586 5.153   1.00 27.97 ? 39  GLN H CG  1 
ATOM   279  C  CD  . GLN A 1 41  ? 3.226   -29.104 5.418   1.00 29.30 ? 39  GLN H CD  1 
ATOM   280  O  OE1 . GLN A 1 41  ? 2.208   -28.493 5.077   1.00 30.74 ? 39  GLN H OE1 1 
ATOM   281  N  NE2 . GLN A 1 41  ? 4.248   -28.513 6.020   1.00 28.71 ? 39  GLN H NE2 1 
ATOM   282  N  N   . ALA A 1 42  ? 3.725   -34.294 4.771   1.00 27.74 ? 40  ALA H N   1 
ATOM   283  C  CA  . ALA A 1 42  ? 3.376   -35.218 5.855   1.00 28.18 ? 40  ALA H CA  1 
ATOM   284  C  C   . ALA A 1 42  ? 3.158   -34.455 7.182   1.00 28.55 ? 40  ALA H C   1 
ATOM   285  O  O   . ALA A 1 42  ? 3.699   -33.376 7.382   1.00 28.05 ? 40  ALA H O   1 
ATOM   286  C  CB  . ALA A 1 42  ? 4.441   -36.274 6.016   1.00 27.32 ? 40  ALA H CB  1 
ATOM   287  N  N   . PRO A 1 43  ? 2.380   -35.028 8.105   1.00 29.50 ? 41  PRO H N   1 
ATOM   288  C  CA  . PRO A 1 43  ? 2.068   -34.235 9.286   1.00 30.01 ? 41  PRO H CA  1 
ATOM   289  C  C   . PRO A 1 43  ? 3.308   -33.956 10.116  1.00 30.14 ? 41  PRO H C   1 
ATOM   290  O  O   . PRO A 1 43  ? 4.153   -34.836 10.281  1.00 30.85 ? 41  PRO H O   1 
ATOM   291  C  CB  . PRO A 1 43  ? 1.070   -35.111 10.069  1.00 29.84 ? 41  PRO H CB  1 
ATOM   292  C  CG  . PRO A 1 43  ? 0.671   -36.212 9.164   1.00 29.97 ? 41  PRO H CG  1 
ATOM   293  C  CD  . PRO A 1 43  ? 1.794   -36.377 8.173   1.00 30.19 ? 41  PRO H CD  1 
ATOM   294  N  N   . GLY A 1 44  ? 3.422   -32.724 10.604  1.00 30.40 ? 42  GLY H N   1 
ATOM   295  C  CA  . GLY A 1 44  ? 4.551   -32.308 11.445  1.00 30.40 ? 42  GLY H CA  1 
ATOM   296  C  C   . GLY A 1 44  ? 5.855   -32.112 10.692  1.00 30.45 ? 42  GLY H C   1 
ATOM   297  O  O   . GLY A 1 44  ? 6.823   -31.590 11.237  1.00 30.75 ? 42  GLY H O   1 
ATOM   298  N  N   . ARG A 1 45  ? 5.884   -32.531 9.436   1.00 30.67 ? 43  ARG H N   1 
ATOM   299  C  CA  . ARG A 1 45  ? 7.110   -32.488 8.651   1.00 30.71 ? 43  ARG H CA  1 
ATOM   300  C  C   . ARG A 1 45  ? 6.972   -31.449 7.549   1.00 29.30 ? 43  ARG H C   1 
ATOM   301  O  O   . ARG A 1 45  ? 5.992   -30.706 7.527   1.00 28.15 ? 43  ARG H O   1 
ATOM   302  C  CB  . ARG A 1 45  ? 7.435   -33.880 8.098   1.00 31.46 ? 43  ARG H CB  1 
ATOM   303  C  CG  . ARG A 1 45  ? 7.540   -34.933 9.197   1.00 34.20 ? 43  ARG H CG  1 
ATOM   304  C  CD  . ARG A 1 45  ? 7.996   -36.280 8.665   1.00 38.81 ? 43  ARG H CD  1 
ATOM   305  N  NE  . ARG A 1 45  ? 9.399   -36.265 8.238   1.00 42.20 ? 43  ARG H NE  1 
ATOM   306  C  CZ  . ARG A 1 45  ? 9.820   -36.227 6.968   1.00 44.07 ? 43  ARG H CZ  1 
ATOM   307  N  NH1 . ARG A 1 45  ? 8.959   -36.203 5.945   1.00 42.37 ? 43  ARG H NH1 1 
ATOM   308  N  NH2 . ARG A 1 45  ? 11.124  -36.218 6.717   1.00 45.14 ? 43  ARG H NH2 1 
ATOM   309  N  N   . GLY A 1 46  ? 7.956   -31.400 6.649   1.00 28.37 ? 44  GLY H N   1 
ATOM   310  C  CA  . GLY A 1 46  ? 8.087   -30.292 5.696   1.00 27.76 ? 44  GLY H CA  1 
ATOM   311  C  C   . GLY A 1 46  ? 7.591   -30.587 4.292   1.00 26.81 ? 44  GLY H C   1 
ATOM   312  O  O   . GLY A 1 46  ? 7.180   -31.703 4.001   1.00 26.45 ? 44  GLY H O   1 
ATOM   313  N  N   . LEU A 1 47  ? 7.648   -29.583 3.419   1.00 26.36 ? 45  LEU H N   1 
ATOM   314  C  CA  . LEU A 1 47  ? 7.124   -29.704 2.043   1.00 26.37 ? 45  LEU H CA  1 
ATOM   315  C  C   . LEU A 1 47  ? 8.006   -30.569 1.132   1.00 25.95 ? 45  LEU H C   1 
ATOM   316  O  O   . LEU A 1 47  ? 9.231   -30.556 1.242   1.00 25.27 ? 45  LEU H O   1 
ATOM   317  C  CB  . LEU A 1 47  ? 6.918   -28.326 1.406   1.00 26.08 ? 45  LEU H CB  1 
ATOM   318  C  CG  . LEU A 1 47  ? 5.936   -27.362 2.096   1.00 26.61 ? 45  LEU H CG  1 
ATOM   319  C  CD1 . LEU A 1 47  ? 6.000   -25.950 1.494   1.00 25.61 ? 45  LEU H CD1 1 
ATOM   320  C  CD2 . LEU A 1 47  ? 4.502   -27.873 2.072   1.00 24.99 ? 45  LEU H CD2 1 
ATOM   321  N  N   . GLU A 1 48  ? 7.346   -31.330 0.254   1.00 26.22 ? 46  GLU H N   1 
ATOM   322  C  CA  . GLU A 1 48  ? 7.999   -32.206 -0.736  1.00 26.16 ? 46  GLU H CA  1 
ATOM   323  C  C   . GLU A 1 48  ? 7.347   -32.042 -2.121  1.00 26.57 ? 46  GLU H C   1 
ATOM   324  O  O   . GLU A 1 48  ? 6.152   -32.294 -2.304  1.00 26.11 ? 46  GLU H O   1 
ATOM   325  C  CB  . GLU A 1 48  ? 7.958   -33.685 -0.320  1.00 25.19 ? 46  GLU H CB  1 
ATOM   326  N  N   . TRP A 1 49  ? 8.159   -31.603 -3.080  1.00 26.50 ? 47  TRP H N   1 
ATOM   327  C  CA  . TRP A 1 49  ? 7.766   -31.521 -4.475  1.00 26.32 ? 47  TRP H CA  1 
ATOM   328  C  C   . TRP A 1 49  ? 7.724   -32.898 -5.158  1.00 25.89 ? 47  TRP H C   1 
ATOM   329  O  O   . TRP A 1 49  ? 8.717   -33.625 -5.160  1.00 24.73 ? 47  TRP H O   1 
ATOM   330  C  CB  . TRP A 1 49  ? 8.746   -30.625 -5.227  1.00 26.52 ? 47  TRP H CB  1 
ATOM   331  C  CG  . TRP A 1 49  ? 8.308   -30.333 -6.612  1.00 26.27 ? 47  TRP H CG  1 
ATOM   332  C  CD1 . TRP A 1 49  ? 7.411   -29.405 -6.988  1.00 27.59 ? 47  TRP H CD1 1 
ATOM   333  C  CD2 . TRP A 1 49  ? 8.743   -30.985 -7.808  1.00 27.48 ? 47  TRP H CD2 1 
ATOM   334  N  NE1 . TRP A 1 49  ? 7.249   -29.425 -8.350  1.00 29.48 ? 47  TRP H NE1 1 
ATOM   335  C  CE2 . TRP A 1 49  ? 8.060   -30.389 -8.877  1.00 27.15 ? 47  TRP H CE2 1 
ATOM   336  C  CE3 . TRP A 1 49  ? 9.644   -32.020 -8.078  1.00 28.88 ? 47  TRP H CE3 1 
ATOM   337  C  CZ2 . TRP A 1 49  ? 8.242   -30.781 -10.192 1.00 26.94 ? 47  TRP H CZ2 1 
ATOM   338  C  CZ3 . TRP A 1 49  ? 9.823   -32.417 -9.391  1.00 27.51 ? 47  TRP H CZ3 1 
ATOM   339  C  CH2 . TRP A 1 49  ? 9.133   -31.793 -10.431 1.00 27.68 ? 47  TRP H CH2 1 
ATOM   340  N  N   . MET A 1 50  ? 6.585   -33.210 -5.786  1.00 25.74 ? 48  MET H N   1 
ATOM   341  C  CA  . MET A 1 50  ? 6.316   -34.544 -6.366  1.00 24.87 ? 48  MET H CA  1 
ATOM   342  C  C   . MET A 1 50  ? 6.399   -34.562 -7.886  1.00 24.31 ? 48  MET H C   1 
ATOM   343  O  O   . MET A 1 50  ? 6.825   -35.542 -8.497  1.00 24.51 ? 48  MET H O   1 
ATOM   344  C  CB  . MET A 1 50  ? 4.921   -35.025 -5.969  1.00 24.60 ? 48  MET H CB  1 
ATOM   345  C  CG  . MET A 1 50  ? 4.581   -34.864 -4.503  1.00 24.78 ? 48  MET H CG  1 
ATOM   346  S  SD  . MET A 1 50  ? 2.943   -35.521 -4.138  1.00 27.64 ? 48  MET H SD  1 
ATOM   347  C  CE  . MET A 1 50  ? 3.173   -37.284 -4.417  1.00 20.92 ? 48  MET H CE  1 
ATOM   348  N  N   . GLY A 1 51  ? 5.961   -33.481 -8.502  1.00 24.11 ? 49  GLY H N   1 
ATOM   349  C  CA  . GLY A 1 51  ? 5.974   -33.378 -9.956  1.00 24.15 ? 49  GLY H CA  1 
ATOM   350  C  C   . GLY A 1 51  ? 5.071   -32.252 -10.390 1.00 23.87 ? 49  GLY H C   1 
ATOM   351  O  O   . GLY A 1 51  ? 4.513   -31.552 -9.562  1.00 24.69 ? 49  GLY H O   1 
ATOM   352  N  N   . GLY A 1 52  ? 4.912   -32.078 -11.690 1.00 23.56 ? 50  GLY H N   1 
ATOM   353  C  CA  . GLY A 1 52  ? 4.038   -31.038 -12.194 1.00 22.79 ? 50  GLY H CA  1 
ATOM   354  C  C   . GLY A 1 52  ? 3.730   -31.270 -13.648 1.00 23.21 ? 50  GLY H C   1 
ATOM   355  O  O   . GLY A 1 52  ? 4.297   -32.179 -14.277 1.00 23.66 ? 50  GLY H O   1 
ATOM   356  N  N   . VAL A 1 53  ? 2.824   -30.450 -14.170 1.00 23.11 ? 51  VAL H N   1 
ATOM   357  C  CA  . VAL A 1 53  ? 2.423   -30.498 -15.573 1.00 23.63 ? 51  VAL H CA  1 
ATOM   358  C  C   . VAL A 1 53  ? 2.233   -29.100 -16.171 1.00 23.87 ? 51  VAL H C   1 
ATOM   359  O  O   . VAL A 1 53  ? 1.904   -28.151 -15.461 1.00 24.24 ? 51  VAL H O   1 
ATOM   360  C  CB  . VAL A 1 53  ? 1.092   -31.254 -15.758 1.00 23.70 ? 51  VAL H CB  1 
ATOM   361  C  CG1 . VAL A 1 53  ? -0.021  -30.597 -14.940 1.00 23.49 ? 51  VAL H CG1 1 
ATOM   362  C  CG2 . VAL A 1 53  ? 0.721   -31.301 -17.242 1.00 22.36 ? 51  VAL H CG2 1 
ATOM   363  N  N   . ILE A 1 54  ? 2.474   -28.991 -17.477 1.00 23.79 ? 52  ILE H N   1 
ATOM   364  C  CA  . ILE A 1 54  ? 2.011   -27.859 -18.275 1.00 23.53 ? 52  ILE H CA  1 
ATOM   365  C  C   . ILE A 1 54  ? 0.823   -28.341 -19.104 1.00 23.87 ? 52  ILE H C   1 
ATOM   366  O  O   . ILE A 1 54  ? 0.980   -29.200 -19.950 1.00 24.72 ? 52  ILE H O   1 
ATOM   367  C  CB  . ILE A 1 54  ? 3.067   -27.393 -19.247 1.00 23.47 ? 52  ILE H CB  1 
ATOM   368  C  CG1 . ILE A 1 54  ? 4.317   -26.913 -18.500 1.00 23.53 ? 52  ILE H CG1 1 
ATOM   369  C  CG2 . ILE A 1 54  ? 2.489   -26.301 -20.130 1.00 23.46 ? 52  ILE H CG2 1 
ATOM   370  C  CD1 . ILE A 1 54  ? 5.611   -27.125 -19.279 1.00 19.96 ? 52  ILE H CD1 1 
ATOM   371  N  N   . PRO A 1 55  ? -0.379  -27.823 -18.848 1.00 23.94 ? 53  PRO H N   1 
ATOM   372  C  CA  . PRO A 1 55  ? -1.525  -28.424 -19.548 1.00 23.71 ? 53  PRO H CA  1 
ATOM   373  C  C   . PRO A 1 55  ? -1.426  -28.431 -21.085 1.00 23.70 ? 53  PRO H C   1 
ATOM   374  O  O   . PRO A 1 55  ? -1.826  -29.414 -21.720 1.00 23.50 ? 53  PRO H O   1 
ATOM   375  C  CB  . PRO A 1 55  ? -2.721  -27.577 -19.082 1.00 23.81 ? 53  PRO H CB  1 
ATOM   376  C  CG  . PRO A 1 55  ? -2.276  -26.935 -17.792 1.00 24.64 ? 53  PRO H CG  1 
ATOM   377  C  CD  . PRO A 1 55  ? -0.773  -26.746 -17.921 1.00 23.85 ? 53  PRO H CD  1 
ATOM   378  N  N   . LEU A 1 56  ? -0.917  -27.354 -21.678 1.00 23.26 ? 54  LEU H N   1 
ATOM   379  C  CA  . LEU A 1 56  ? -0.735  -27.319 -23.122 1.00 23.00 ? 54  LEU H CA  1 
ATOM   380  C  C   . LEU A 1 56  ? 0.261   -28.417 -23.524 1.00 23.49 ? 54  LEU H C   1 
ATOM   381  O  O   . LEU A 1 56  ? 1.447   -28.358 -23.174 1.00 23.65 ? 54  LEU H O   1 
ATOM   382  C  CB  . LEU A 1 56  ? -0.229  -25.951 -23.599 1.00 22.75 ? 54  LEU H CB  1 
ATOM   383  C  CG  . LEU A 1 56  ? -0.201  -25.740 -25.129 1.00 22.82 ? 54  LEU H CG  1 
ATOM   384  C  CD1 . LEU A 1 56  ? -1.607  -25.852 -25.735 1.00 21.74 ? 54  LEU H CD1 1 
ATOM   385  C  CD2 . LEU A 1 56  ? 0.415   -24.388 -25.510 1.00 21.03 ? 54  LEU H CD2 1 
ATOM   386  N  N   . LEU A 1 57  ? -0.239  -29.410 -24.257 1.00 22.93 ? 55  LEU H N   1 
ATOM   387  C  CA  . LEU A 1 57  ? 0.543   -30.574 -24.672 1.00 22.56 ? 55  LEU H CA  1 
ATOM   388  C  C   . LEU A 1 57  ? 0.777   -31.583 -23.541 1.00 22.52 ? 55  LEU H C   1 
ATOM   389  O  O   . LEU A 1 57  ? 1.477   -32.569 -23.735 1.00 22.73 ? 55  LEU H O   1 
ATOM   390  C  CB  . LEU A 1 57  ? 1.882   -30.150 -25.291 1.00 22.19 ? 55  LEU H CB  1 
ATOM   391  C  CG  . LEU A 1 57  ? 1.802   -29.181 -26.477 1.00 22.27 ? 55  LEU H CG  1 
ATOM   392  C  CD1 . LEU A 1 57  ? 3.170   -29.020 -27.137 1.00 19.34 ? 55  LEU H CD1 1 
ATOM   393  C  CD2 . LEU A 1 57  ? 0.756   -29.636 -27.500 1.00 22.26 ? 55  LEU H CD2 1 
ATOM   394  N  N   . THR A 1 58  ? 0.185   -31.350 -22.373 1.00 22.63 ? 56  THR H N   1 
ATOM   395  C  CA  . THR A 1 58  ? 0.424   -32.205 -21.203 1.00 23.27 ? 56  THR H CA  1 
ATOM   396  C  C   . THR A 1 58  ? 1.913   -32.534 -21.101 1.00 23.17 ? 56  THR H C   1 
ATOM   397  O  O   . THR A 1 58  ? 2.303   -33.704 -21.208 1.00 23.84 ? 56  THR H O   1 
ATOM   398  C  CB  . THR A 1 58  ? -0.364  -33.564 -21.272 1.00 23.51 ? 56  THR H CB  1 
ATOM   399  O  OG1 . THR A 1 58  ? -1.696  -33.338 -21.719 1.00 25.39 ? 56  THR H OG1 1 
ATOM   400  C  CG2 . THR A 1 58  ? -0.425  -34.258 -19.911 1.00 23.85 ? 56  THR H CG2 1 
ATOM   401  N  N   . ILE A 1 59  ? 2.747   -31.516 -20.922 1.00 22.49 ? 57  ILE H N   1 
ATOM   402  C  CA  . ILE A 1 59  ? 4.177   -31.742 -20.706 1.00 21.91 ? 57  ILE H CA  1 
ATOM   403  C  C   . ILE A 1 59  ? 4.422   -32.032 -19.212 1.00 21.63 ? 57  ILE H C   1 
ATOM   404  O  O   . ILE A 1 59  ? 4.340   -31.132 -18.355 1.00 20.81 ? 57  ILE H O   1 
ATOM   405  C  CB  . ILE A 1 59  ? 5.043   -30.550 -21.187 1.00 22.27 ? 57  ILE H CB  1 
ATOM   406  C  CG1 . ILE A 1 59  ? 4.623   -30.093 -22.598 1.00 23.19 ? 57  ILE H CG1 1 
ATOM   407  C  CG2 . ILE A 1 59  ? 6.513   -30.934 -21.196 1.00 20.59 ? 57  ILE H CG2 1 
ATOM   408  C  CD1 . ILE A 1 59  ? 5.373   -28.840 -23.113 1.00 21.67 ? 57  ILE H CD1 1 
ATOM   409  N  N   . THR A 1 60  ? 4.698   -33.299 -18.903 1.00 20.98 ? 58  THR H N   1 
ATOM   410  C  CA  . THR A 1 60  ? 4.898   -33.709 -17.516 1.00 20.72 ? 58  THR H CA  1 
ATOM   411  C  C   . THR A 1 60  ? 6.365   -33.727 -17.098 1.00 21.28 ? 58  THR H C   1 
ATOM   412  O  O   . THR A 1 60  ? 7.274   -33.690 -17.917 1.00 19.93 ? 58  THR H O   1 
ATOM   413  C  CB  . THR A 1 60  ? 4.300   -35.088 -17.218 1.00 20.83 ? 58  THR H CB  1 
ATOM   414  O  OG1 . THR A 1 60  ? 4.768   -36.020 -18.188 1.00 17.87 ? 58  THR H OG1 1 
ATOM   415  C  CG2 . THR A 1 60  ? 2.755   -35.041 -17.225 1.00 20.89 ? 58  THR H CG2 1 
ATOM   416  N  N   . ASN A 1 61  ? 6.551   -33.775 -15.789 1.00 22.73 ? 59  ASN H N   1 
ATOM   417  C  CA  . ASN A 1 61  ? 7.839   -33.728 -15.146 1.00 23.82 ? 59  ASN H CA  1 
ATOM   418  C  C   . ASN A 1 61  ? 7.559   -34.381 -13.793 1.00 25.03 ? 59  ASN H C   1 
ATOM   419  O  O   . ASN A 1 61  ? 6.642   -33.942 -13.057 1.00 27.14 ? 59  ASN H O   1 
ATOM   420  C  CB  . ASN A 1 61  ? 8.271   -32.266 -15.021 1.00 24.73 ? 59  ASN H CB  1 
ATOM   421  C  CG  . ASN A 1 61  ? 9.532   -32.073 -14.187 1.00 25.76 ? 59  ASN H CG  1 
ATOM   422  O  OD1 . ASN A 1 61  ? 10.331  -32.989 -14.012 1.00 28.34 ? 59  ASN H OD1 1 
ATOM   423  N  ND2 . ASN A 1 61  ? 9.719   -30.857 -13.687 1.00 23.80 ? 59  ASN H ND2 1 
ATOM   424  N  N   . TYR A 1 62  ? 8.269   -35.466 -13.485 1.00 25.34 ? 60  TYR H N   1 
ATOM   425  C  CA  . TYR A 1 62  ? 8.018   -36.198 -12.236 1.00 25.49 ? 60  TYR H CA  1 
ATOM   426  C  C   . TYR A 1 62  ? 9.278   -36.333 -11.414 1.00 26.08 ? 60  TYR H C   1 
ATOM   427  O  O   . TYR A 1 62  ? 10.329  -36.677 -11.933 1.00 26.10 ? 60  TYR H O   1 
ATOM   428  C  CB  . TYR A 1 62  ? 7.489   -37.617 -12.498 1.00 25.67 ? 60  TYR H CB  1 
ATOM   429  C  CG  . TYR A 1 62  ? 6.160   -37.703 -13.213 1.00 24.08 ? 60  TYR H CG  1 
ATOM   430  C  CD1 . TYR A 1 62  ? 5.957   -38.639 -14.226 1.00 23.75 ? 60  TYR H CD1 1 
ATOM   431  C  CD2 . TYR A 1 62  ? 5.119   -36.858 -12.882 1.00 22.33 ? 60  TYR H CD2 1 
ATOM   432  C  CE1 . TYR A 1 62  ? 4.740   -38.735 -14.883 1.00 24.28 ? 60  TYR H CE1 1 
ATOM   433  C  CE2 . TYR A 1 62  ? 3.904   -36.932 -13.537 1.00 24.68 ? 60  TYR H CE2 1 
ATOM   434  C  CZ  . TYR A 1 62  ? 3.713   -37.866 -14.537 1.00 25.60 ? 60  TYR H CZ  1 
ATOM   435  O  OH  . TYR A 1 62  ? 2.496   -37.917 -15.176 1.00 25.46 ? 60  TYR H OH  1 
ATOM   436  N  N   . ALA A 1 63  ? 9.175   -36.069 -10.123 1.00 26.85 ? 61  ALA H N   1 
ATOM   437  C  CA  . ALA A 1 63  ? 10.270  -36.398 -9.224  1.00 27.34 ? 61  ALA H CA  1 
ATOM   438  C  C   . ALA A 1 63  ? 10.577  -37.905 -9.353  1.00 27.66 ? 61  ALA H C   1 
ATOM   439  O  O   . ALA A 1 63  ? 9.668   -38.739 -9.346  1.00 28.26 ? 61  ALA H O   1 
ATOM   440  C  CB  . ALA A 1 63  ? 9.883   -36.049 -7.797  1.00 27.30 ? 61  ALA H CB  1 
ATOM   441  N  N   . PRO A 1 64  ? 11.852  -38.263 -9.492  1.00 28.18 ? 62  PRO H N   1 
ATOM   442  C  CA  . PRO A 1 64  ? 12.262  -39.679 -9.564  1.00 28.80 ? 62  PRO H CA  1 
ATOM   443  C  C   . PRO A 1 64  ? 11.672  -40.631 -8.515  1.00 29.32 ? 62  PRO H C   1 
ATOM   444  O  O   . PRO A 1 64  ? 11.277  -41.740 -8.866  1.00 29.47 ? 62  PRO H O   1 
ATOM   445  C  CB  . PRO A 1 64  ? 13.787  -39.601 -9.416  1.00 28.44 ? 62  PRO H CB  1 
ATOM   446  C  CG  . PRO A 1 64  ? 14.136  -38.289 -10.039 1.00 27.91 ? 62  PRO H CG  1 
ATOM   447  C  CD  . PRO A 1 64  ? 13.004  -37.353 -9.653  1.00 28.55 ? 62  PRO H CD  1 
ATOM   448  N  N   . ARG A 1 65  ? 11.598  -40.221 -7.254  1.00 30.31 ? 63  ARG H N   1 
ATOM   449  C  CA  . ARG A 1 65  ? 11.113  -41.125 -6.199  1.00 31.32 ? 63  ARG H CA  1 
ATOM   450  C  C   . ARG A 1 65  ? 9.620   -41.505 -6.315  1.00 31.87 ? 63  ARG H C   1 
ATOM   451  O  O   . ARG A 1 65  ? 9.133   -42.380 -5.587  1.00 31.95 ? 63  ARG H O   1 
ATOM   452  C  CB  . ARG A 1 65  ? 11.389  -40.537 -4.808  1.00 31.65 ? 63  ARG H CB  1 
ATOM   453  C  CG  . ARG A 1 65  ? 10.402  -39.450 -4.384  1.00 32.86 ? 63  ARG H CG  1 
ATOM   454  C  CD  . ARG A 1 65  ? 10.865  -38.709 -3.123  1.00 34.12 ? 63  ARG H CD  1 
ATOM   455  N  NE  . ARG A 1 65  ? 12.249  -38.237 -3.226  1.00 33.75 ? 63  ARG H NE  1 
ATOM   456  C  CZ  . ARG A 1 65  ? 13.192  -38.443 -2.311  1.00 33.19 ? 63  ARG H CZ  1 
ATOM   457  N  NH1 . ARG A 1 65  ? 12.919  -39.101 -1.192  1.00 32.55 ? 63  ARG H NH1 1 
ATOM   458  N  NH2 . ARG A 1 65  ? 14.415  -37.977 -2.512  1.00 33.87 ? 63  ARG H NH2 1 
ATOM   459  N  N   . PHE A 1 66  ? 8.885   -40.844 -7.203  1.00 32.31 ? 64  PHE H N   1 
ATOM   460  C  CA  . PHE A 1 66  ? 7.498   -41.221 -7.448  1.00 32.46 ? 64  PHE H CA  1 
ATOM   461  C  C   . PHE A 1 66  ? 7.333   -41.835 -8.825  1.00 32.95 ? 64  PHE H C   1 
ATOM   462  O  O   . PHE A 1 66  ? 6.249   -42.283 -9.192  1.00 32.20 ? 64  PHE H O   1 
ATOM   463  C  CB  . PHE A 1 66  ? 6.567   -40.015 -7.272  1.00 32.83 ? 64  PHE H CB  1 
ATOM   464  C  CG  . PHE A 1 66  ? 6.632   -39.416 -5.903  1.00 34.08 ? 64  PHE H CG  1 
ATOM   465  C  CD1 . PHE A 1 66  ? 7.353   -38.271 -5.670  1.00 36.81 ? 64  PHE H CD1 1 
ATOM   466  C  CD2 . PHE A 1 66  ? 6.025   -40.039 -4.835  1.00 36.33 ? 64  PHE H CD2 1 
ATOM   467  C  CE1 . PHE A 1 66  ? 7.444   -37.738 -4.400  1.00 36.88 ? 64  PHE H CE1 1 
ATOM   468  C  CE2 . PHE A 1 66  ? 6.118   -39.509 -3.565  1.00 37.04 ? 64  PHE H CE2 1 
ATOM   469  C  CZ  . PHE A 1 66  ? 6.831   -38.354 -3.354  1.00 36.18 ? 64  PHE H CZ  1 
ATOM   470  N  N   . GLN A 1 67  ? 8.405   -41.871 -9.604  1.00 34.22 ? 65  GLN H N   1 
ATOM   471  C  CA  . GLN A 1 67  ? 8.274   -42.396 -10.955 1.00 35.61 ? 65  GLN H CA  1 
ATOM   472  C  C   . GLN A 1 67  ? 7.710   -43.809 -10.886 1.00 35.23 ? 65  GLN H C   1 
ATOM   473  O  O   . GLN A 1 67  ? 8.179   -44.632 -10.101 1.00 35.84 ? 65  GLN H O   1 
ATOM   474  C  CB  . GLN A 1 67  ? 9.599   -42.387 -11.704 1.00 36.15 ? 65  GLN H CB  1 
ATOM   475  C  CG  . GLN A 1 67  ? 9.498   -43.009 -13.089 1.00 40.12 ? 65  GLN H CG  1 
ATOM   476  C  CD  . GLN A 1 67  ? 8.891   -42.057 -14.119 1.00 45.42 ? 65  GLN H CD  1 
ATOM   477  O  OE1 . GLN A 1 67  ? 9.072   -40.836 -14.044 1.00 47.77 ? 65  GLN H OE1 1 
ATOM   478  N  NE2 . GLN A 1 67  ? 8.175   -42.620 -15.096 1.00 47.44 ? 65  GLN H NE2 1 
ATOM   479  N  N   . GLY A 1 68  ? 6.696   -44.079 -11.702 1.00 34.62 ? 66  GLY H N   1 
ATOM   480  C  CA  . GLY A 1 68  ? 6.075   -45.405 -11.740 1.00 33.70 ? 66  GLY H CA  1 
ATOM   481  C  C   . GLY A 1 68  ? 4.823   -45.524 -10.890 1.00 32.83 ? 66  GLY H C   1 
ATOM   482  O  O   . GLY A 1 68  ? 3.993   -46.375 -11.149 1.00 33.04 ? 66  GLY H O   1 
ATOM   483  N  N   . ARG A 1 69  ? 4.692   -44.673 -9.876  1.00 32.08 ? 67  ARG H N   1 
ATOM   484  C  CA  . ARG A 1 69  ? 3.513   -44.659 -9.009  1.00 31.85 ? 67  ARG H CA  1 
ATOM   485  C  C   . ARG A 1 69  ? 2.594   -43.482 -9.281  1.00 31.72 ? 67  ARG H C   1 
ATOM   486  O  O   . ARG A 1 69  ? 1.442   -43.474 -8.829  1.00 32.13 ? 67  ARG H O   1 
ATOM   487  C  CB  . ARG A 1 69  ? 3.923   -44.552 -7.543  1.00 31.75 ? 67  ARG H CB  1 
ATOM   488  C  CG  . ARG A 1 69  ? 4.784   -45.672 -7.023  1.00 33.15 ? 67  ARG H CG  1 
ATOM   489  C  CD  . ARG A 1 69  ? 5.279   -45.318 -5.639  1.00 34.77 ? 67  ARG H CD  1 
ATOM   490  N  NE  . ARG A 1 69  ? 4.164   -45.257 -4.700  1.00 35.06 ? 67  ARG H NE  1 
ATOM   491  C  CZ  . ARG A 1 69  ? 4.049   -44.380 -3.707  1.00 35.08 ? 67  ARG H CZ  1 
ATOM   492  N  NH1 . ARG A 1 69  ? 2.984   -44.426 -2.921  1.00 36.72 ? 67  ARG H NH1 1 
ATOM   493  N  NH2 . ARG A 1 69  ? 4.975   -43.455 -3.500  1.00 33.08 ? 67  ARG H NH2 1 
ATOM   494  N  N   . ILE A 1 70  ? 3.114   -42.488 -10.000 1.00 31.24 ? 68  ILE H N   1 
ATOM   495  C  CA  . ILE A 1 70  ? 2.460   -41.190 -10.141 1.00 30.40 ? 68  ILE H CA  1 
ATOM   496  C  C   . ILE A 1 70  ? 2.012   -40.917 -11.570 1.00 30.03 ? 68  ILE H C   1 
ATOM   497  O  O   . ILE A 1 70  ? 2.656   -41.333 -12.518 1.00 29.74 ? 68  ILE H O   1 
ATOM   498  C  CB  . ILE A 1 70  ? 3.398   -40.058 -9.681  1.00 30.24 ? 68  ILE H CB  1 
ATOM   499  C  CG1 . ILE A 1 70  ? 2.681   -38.712 -9.740  1.00 29.30 ? 68  ILE H CG1 1 
ATOM   500  C  CG2 . ILE A 1 70  ? 4.673   -40.033 -10.525 1.00 30.10 ? 68  ILE H CG2 1 
ATOM   501  C  CD1 . ILE A 1 70  ? 3.442   -37.613 -9.043  1.00 29.36 ? 68  ILE H CD1 1 
ATOM   502  N  N   . THR A 1 71  ? 0.882   -40.232 -11.707 1.00 30.34 ? 69  THR H N   1 
ATOM   503  C  CA  . THR A 1 71  ? 0.401   -39.766 -13.007 1.00 30.26 ? 69  THR H CA  1 
ATOM   504  C  C   . THR A 1 71  ? -0.214  -38.400 -12.799 1.00 29.35 ? 69  THR H C   1 
ATOM   505  O  O   . THR A 1 71  ? -1.051  -38.232 -11.902 1.00 28.51 ? 69  THR H O   1 
ATOM   506  C  CB  . THR A 1 71  ? -0.704  -40.668 -13.613 1.00 31.00 ? 69  THR H CB  1 
ATOM   507  O  OG1 . THR A 1 71  ? -0.279  -42.042 -13.644 1.00 32.82 ? 69  THR H OG1 1 
ATOM   508  C  CG2 . THR A 1 71  ? -1.046  -40.198 -15.036 1.00 30.51 ? 69  THR H CG2 1 
ATOM   509  N  N   . ILE A 1 72  ? 0.213   -37.428 -13.607 1.00 27.84 ? 70  ILE H N   1 
ATOM   510  C  CA  . ILE A 1 72  ? -0.396  -36.103 -13.575 1.00 27.16 ? 70  ILE H CA  1 
ATOM   511  C  C   . ILE A 1 72  ? -1.063  -35.799 -14.909 1.00 27.09 ? 70  ILE H C   1 
ATOM   512  O  O   . ILE A 1 72  ? -0.467  -35.980 -15.966 1.00 26.69 ? 70  ILE H O   1 
ATOM   513  C  CB  . ILE A 1 72  ? 0.603   -34.969 -13.240 1.00 26.72 ? 70  ILE H CB  1 
ATOM   514  C  CG1 . ILE A 1 72  ? 1.329   -35.235 -11.926 1.00 24.91 ? 70  ILE H CG1 1 
ATOM   515  C  CG2 . ILE A 1 72  ? -0.127  -33.658 -13.126 1.00 26.63 ? 70  ILE H CG2 1 
ATOM   516  C  CD1 . ILE A 1 72  ? 2.335   -34.184 -11.581 1.00 23.32 ? 70  ILE H CD1 1 
ATOM   517  N  N   . THR A 1 73  ? -2.311  -35.343 -14.844 1.00 27.20 ? 71  THR H N   1 
ATOM   518  C  CA  . THR A 1 73  ? -3.070  -35.027 -16.036 1.00 26.93 ? 71  THR H CA  1 
ATOM   519  C  C   . THR A 1 73  ? -3.806  -33.694 -15.869 1.00 27.87 ? 71  THR H C   1 
ATOM   520  O  O   . THR A 1 73  ? -4.070  -33.231 -14.756 1.00 28.05 ? 71  THR H O   1 
ATOM   521  C  CB  . THR A 1 73  ? -4.092  -36.128 -16.372 1.00 27.23 ? 71  THR H CB  1 
ATOM   522  O  OG1 . THR A 1 73  ? -4.978  -36.291 -15.261 1.00 27.40 ? 71  THR H OG1 1 
ATOM   523  C  CG2 . THR A 1 73  ? -3.406  -37.471 -16.724 1.00 22.65 ? 71  THR H CG2 1 
ATOM   524  N  N   . ALA A 1 74  ? -4.125  -33.083 -17.002 1.00 28.45 ? 72  ALA H N   1 
ATOM   525  C  CA  . ALA A 1 74  ? -4.697  -31.746 -17.038 1.00 29.06 ? 72  ALA H CA  1 
ATOM   526  C  C   . ALA A 1 74  ? -5.822  -31.734 -18.059 1.00 29.75 ? 72  ALA H C   1 
ATOM   527  O  O   . ALA A 1 74  ? -5.713  -32.351 -19.124 1.00 30.60 ? 72  ALA H O   1 
ATOM   528  C  CB  . ALA A 1 74  ? -3.623  -30.712 -17.407 1.00 28.41 ? 72  ALA H CB  1 
ATOM   529  N  N   . ASP A 1 75  ? -6.899  -31.033 -17.734 1.00 29.92 ? 73  ASP H N   1 
ATOM   530  C  CA  . ASP A 1 75  ? -8.089  -31.012 -18.581 1.00 30.18 ? 73  ASP H CA  1 
ATOM   531  C  C   . ASP A 1 75  ? -8.391  -29.560 -18.946 1.00 30.20 ? 73  ASP H C   1 
ATOM   532  O  O   . ASP A 1 75  ? -8.755  -28.754 -18.085 1.00 30.43 ? 73  ASP H O   1 
ATOM   533  C  CB  . ASP A 1 75  ? -9.255  -31.628 -17.819 1.00 30.56 ? 73  ASP H CB  1 
ATOM   534  C  CG  . ASP A 1 75  ? -10.443 -31.959 -18.707 1.00 31.91 ? 73  ASP H CG  1 
ATOM   535  O  OD1 . ASP A 1 75  ? -10.843 -31.134 -19.566 1.00 32.12 ? 73  ASP H OD1 1 
ATOM   536  O  OD2 . ASP A 1 75  ? -10.995 -33.061 -18.508 1.00 34.42 ? 73  ASP H OD2 1 
ATOM   537  N  N   . ARG A 1 76  ? -8.232  -29.229 -20.220 1.00 29.84 ? 74  ARG H N   1 
ATOM   538  C  CA  . ARG A 1 76  ? -8.222  -27.839 -20.634 1.00 30.04 ? 74  ARG H CA  1 
ATOM   539  C  C   . ARG A 1 76  ? -9.605  -27.204 -20.636 1.00 28.92 ? 74  ARG H C   1 
ATOM   540  O  O   . ARG A 1 76  ? -9.725  -26.000 -20.433 1.00 27.91 ? 74  ARG H O   1 
ATOM   541  C  CB  . ARG A 1 76  ? -7.513  -27.681 -21.985 1.00 31.12 ? 74  ARG H CB  1 
ATOM   542  C  CG  . ARG A 1 76  ? -5.973  -27.611 -21.818 1.00 35.43 ? 74  ARG H CG  1 
ATOM   543  C  CD  . ARG A 1 76  ? -5.176  -28.270 -22.948 1.00 40.03 ? 74  ARG H CD  1 
ATOM   544  N  NE  . ARG A 1 76  ? -5.116  -27.427 -24.138 1.00 43.83 ? 74  ARG H NE  1 
ATOM   545  C  CZ  . ARG A 1 76  ? -5.824  -27.632 -25.247 1.00 47.60 ? 74  ARG H CZ  1 
ATOM   546  N  NH1 . ARG A 1 76  ? -6.652  -28.670 -25.340 1.00 48.44 ? 74  ARG H NH1 1 
ATOM   547  N  NH2 . ARG A 1 76  ? -5.698  -26.795 -26.275 1.00 48.73 ? 74  ARG H NH2 1 
ATOM   548  N  N   . SER A 1 77  ? -10.649 -28.004 -20.820 1.00 27.87 ? 75  SER H N   1 
ATOM   549  C  CA  . SER A 1 77  ? -11.994 -27.451 -20.859 1.00 27.49 ? 75  SER H CA  1 
ATOM   550  C  C   . SER A 1 77  ? -12.548 -27.151 -19.459 1.00 26.73 ? 75  SER H C   1 
ATOM   551  O  O   . SER A 1 77  ? -13.506 -26.393 -19.302 1.00 26.17 ? 75  SER H O   1 
ATOM   552  C  CB  . SER A 1 77  ? -12.930 -28.394 -21.603 1.00 27.70 ? 75  SER H CB  1 
ATOM   553  O  OG  . SER A 1 77  ? -13.090 -29.602 -20.884 1.00 30.50 ? 75  SER H OG  1 
ATOM   554  N  N   . THR A 1 78  ? -11.948 -27.738 -18.436 1.00 26.02 ? 76  THR H N   1 
ATOM   555  C  CA  . THR A 1 78  ? -12.437 -27.524 -17.083 1.00 25.79 ? 76  THR H CA  1 
ATOM   556  C  C   . THR A 1 78  ? -11.408 -26.879 -16.185 1.00 25.66 ? 76  THR H C   1 
ATOM   557  O  O   . THR A 1 78  ? -11.644 -26.720 -14.987 1.00 25.26 ? 76  THR H O   1 
ATOM   558  C  CB  . THR A 1 78  ? -12.917 -28.844 -16.436 1.00 26.23 ? 76  THR H CB  1 
ATOM   559  O  OG1 . THR A 1 78  ? -11.865 -29.825 -16.483 1.00 24.88 ? 76  THR H OG1 1 
ATOM   560  C  CG2 . THR A 1 78  ? -14.179 -29.367 -17.162 1.00 25.14 ? 76  THR H CG2 1 
ATOM   561  N  N   . SER A 1 79  ? -10.279 -26.495 -16.772 1.00 26.03 ? 77  SER H N   1 
ATOM   562  C  CA  . SER A 1 79  ? -9.180  -25.865 -16.042 1.00 26.64 ? 77  SER H CA  1 
ATOM   563  C  C   . SER A 1 79  ? -8.791  -26.670 -14.809 1.00 27.67 ? 77  SER H C   1 
ATOM   564  O  O   . SER A 1 79  ? -8.453  -26.103 -13.769 1.00 28.81 ? 77  SER H O   1 
ATOM   565  C  CB  . SER A 1 79  ? -9.560  -24.444 -15.626 1.00 26.44 ? 77  SER H CB  1 
ATOM   566  O  OG  . SER A 1 79  ? -9.643  -23.592 -16.750 1.00 26.70 ? 77  SER H OG  1 
ATOM   567  N  N   . THR A 1 80  ? -8.847  -27.992 -14.923 1.00 27.90 ? 78  THR H N   1 
ATOM   568  C  CA  . THR A 1 80  ? -8.658  -28.860 -13.773 1.00 27.86 ? 78  THR H CA  1 
ATOM   569  C  C   . THR A 1 80  ? -7.472  -29.782 -14.004 1.00 28.32 ? 78  THR H C   1 
ATOM   570  O  O   . THR A 1 80  ? -7.364  -30.419 -15.058 1.00 28.94 ? 78  THR H O   1 
ATOM   571  C  CB  . THR A 1 80  ? -9.899  -29.729 -13.524 1.00 27.83 ? 78  THR H CB  1 
ATOM   572  O  OG1 . THR A 1 80  ? -11.059 -28.900 -13.417 1.00 28.33 ? 78  THR H OG1 1 
ATOM   573  C  CG2 . THR A 1 80  ? -9.743  -30.542 -12.251 1.00 28.08 ? 78  THR H CG2 1 
ATOM   574  N  N   . ALA A 1 81  ? -6.596  -29.852 -13.008 1.00 28.48 ? 79  ALA H N   1 
ATOM   575  C  CA  . ALA A 1 81  ? -5.444  -30.745 -13.032 1.00 28.85 ? 79  ALA H CA  1 
ATOM   576  C  C   . ALA A 1 81  ? -5.679  -31.851 -12.011 1.00 29.65 ? 79  ALA H C   1 
ATOM   577  O  O   . ALA A 1 81  ? -6.378  -31.641 -11.002 1.00 29.27 ? 79  ALA H O   1 
ATOM   578  C  CB  . ALA A 1 81  ? -4.161  -29.983 -12.712 1.00 28.53 ? 79  ALA H CB  1 
ATOM   579  N  N   . TYR A 1 82  ? -5.091  -33.020 -12.281 1.00 29.95 ? 80  TYR H N   1 
ATOM   580  C  CA  . TYR A 1 82  ? -5.303  -34.220 -11.467 1.00 29.99 ? 80  TYR H CA  1 
ATOM   581  C  C   . TYR A 1 82  ? -3.991  -34.895 -11.085 1.00 30.17 ? 80  TYR H C   1 
ATOM   582  O  O   . TYR A 1 82  ? -3.114  -35.078 -11.921 1.00 30.33 ? 80  TYR H O   1 
ATOM   583  C  CB  . TYR A 1 82  ? -6.165  -35.242 -12.226 1.00 29.85 ? 80  TYR H CB  1 
ATOM   584  C  CG  . TYR A 1 82  ? -7.547  -34.756 -12.622 1.00 30.67 ? 80  TYR H CG  1 
ATOM   585  C  CD1 . TYR A 1 82  ? -7.772  -34.185 -13.870 1.00 31.80 ? 80  TYR H CD1 1 
ATOM   586  C  CD2 . TYR A 1 82  ? -8.632  -34.881 -11.755 1.00 29.27 ? 80  TYR H CD2 1 
ATOM   587  C  CE1 . TYR A 1 82  ? -9.036  -33.742 -14.235 1.00 31.45 ? 80  TYR H CE1 1 
ATOM   588  C  CE2 . TYR A 1 82  ? -9.895  -34.441 -12.109 1.00 28.10 ? 80  TYR H CE2 1 
ATOM   589  C  CZ  . TYR A 1 82  ? -10.092 -33.872 -13.348 1.00 29.53 ? 80  TYR H CZ  1 
ATOM   590  O  OH  . TYR A 1 82  ? -11.338 -33.421 -13.717 1.00 28.37 ? 80  TYR H OH  1 
ATOM   591  N  N   . LEU A 1 83  ? -3.881  -35.294 -9.821  1.00 30.72 ? 81  LEU H N   1 
ATOM   592  C  CA  . LEU A 1 83  ? -2.765  -36.134 -9.347  1.00 30.71 ? 81  LEU H CA  1 
ATOM   593  C  C   . LEU A 1 83  ? -3.242  -37.539 -8.974  1.00 30.71 ? 81  LEU H C   1 
ATOM   594  O  O   . LEU A 1 83  ? -4.158  -37.699 -8.162  1.00 31.41 ? 81  LEU H O   1 
ATOM   595  C  CB  . LEU A 1 83  ? -2.092  -35.498 -8.127  1.00 30.81 ? 81  LEU H CB  1 
ATOM   596  C  CG  . LEU A 1 83  ? -1.274  -36.432 -7.233  1.00 29.11 ? 81  LEU H CG  1 
ATOM   597  C  CD1 . LEU A 1 83  ? -0.014  -36.883 -7.948  1.00 29.22 ? 81  LEU H CD1 1 
ATOM   598  C  CD2 . LEU A 1 83  ? -0.955  -35.716 -5.930  1.00 27.97 ? 81  LEU H CD2 1 
ATOM   599  N  N   . GLU A 1 84  ? -2.615  -38.548 -9.572  1.00 30.37 ? 82  GLU H N   1 
ATOM   600  C  CA  . GLU A 1 84  ? -2.936  -39.946 -9.297  1.00 29.40 ? 82  GLU H CA  1 
ATOM   601  C  C   . GLU A 1 84  ? -1.699  -40.573 -8.679  1.00 28.45 ? 82  GLU H C   1 
ATOM   602  O  O   . GLU A 1 84  ? -0.627  -40.560 -9.274  1.00 28.26 ? 82  GLU H O   1 
ATOM   603  C  CB  . GLU A 1 84  ? -3.337  -40.696 -10.576 1.00 29.49 ? 82  GLU H CB  1 
ATOM   604  C  CG  . GLU A 1 84  ? -4.129  -41.993 -10.314 1.00 32.21 ? 82  GLU H CG  1 
ATOM   605  C  CD  . GLU A 1 84  ? -4.016  -43.031 -11.433 1.00 33.81 ? 82  GLU H CD  1 
ATOM   606  O  OE1 . GLU A 1 84  ? -4.759  -42.937 -12.432 1.00 33.47 ? 82  GLU H OE1 1 
ATOM   607  O  OE2 . GLU A 1 84  ? -3.188  -43.958 -11.297 1.00 36.94 ? 82  GLU H OE2 1 
ATOM   608  N  N   . LEU A 1 85  ? -1.842  -41.078 -7.462  1.00 27.73 ? 83  LEU H N   1 
ATOM   609  C  CA  . LEU A 1 85  ? -0.749  -41.743 -6.774  1.00 26.89 ? 83  LEU H CA  1 
ATOM   610  C  C   . LEU A 1 85  ? -1.241  -43.120 -6.400  1.00 27.67 ? 83  LEU H C   1 
ATOM   611  O  O   . LEU A 1 85  ? -2.275  -43.245 -5.729  1.00 27.82 ? 83  LEU H O   1 
ATOM   612  C  CB  . LEU A 1 85  ? -0.368  -40.988 -5.522  1.00 26.13 ? 83  LEU H CB  1 
ATOM   613  C  CG  . LEU A 1 85  ? 0.895   -41.488 -4.832  1.00 25.61 ? 83  LEU H CG  1 
ATOM   614  C  CD1 . LEU A 1 85  ? 2.122   -41.210 -5.659  1.00 24.39 ? 83  LEU H CD1 1 
ATOM   615  C  CD2 . LEU A 1 85  ? 0.999   -40.817 -3.475  1.00 25.60 ? 83  LEU H CD2 1 
ATOM   616  N  N   . ASN A 1 86  ? -0.539  -44.162 -6.847  1.00 27.55 ? 84  ASN H N   1 
ATOM   617  C  CA  . ASN A 1 86  ? -0.988  -45.512 -6.523  1.00 27.89 ? 84  ASN H CA  1 
ATOM   618  C  C   . ASN A 1 86  ? 0.015   -46.275 -5.666  1.00 26.87 ? 84  ASN H C   1 
ATOM   619  O  O   . ASN A 1 86  ? 0.998   -45.705 -5.207  1.00 27.44 ? 84  ASN H O   1 
ATOM   620  C  CB  . ASN A 1 86  ? -1.423  -46.279 -7.783  1.00 28.44 ? 84  ASN H CB  1 
ATOM   621  C  CG  . ASN A 1 86  ? -0.390  -46.273 -8.867  1.00 30.73 ? 84  ASN H CG  1 
ATOM   622  O  OD1 . ASN A 1 86  ? 0.793   -46.505 -8.610  1.00 34.18 ? 84  ASN H OD1 1 
ATOM   623  N  ND2 . ASN A 1 86  ? -0.834  -46.048 -10.108 1.00 30.44 ? 84  ASN H ND2 1 
ATOM   624  N  N   . SER A 1 87  ? -0.261  -47.543 -5.412  1.00 25.98 ? 85  SER H N   1 
ATOM   625  C  CA  . SER A 1 87  ? 0.546   -48.345 -4.503  1.00 25.80 ? 85  SER H CA  1 
ATOM   626  C  C   . SER A 1 87  ? 0.763   -47.613 -3.178  1.00 26.21 ? 85  SER H C   1 
ATOM   627  O  O   . SER A 1 87  ? 1.885   -47.504 -2.697  1.00 26.39 ? 85  SER H O   1 
ATOM   628  C  CB  . SER A 1 87  ? 1.885   -48.677 -5.149  1.00 25.77 ? 85  SER H CB  1 
ATOM   629  O  OG  . SER A 1 87  ? 1.693   -49.286 -6.410  1.00 25.43 ? 85  SER H OG  1 
ATOM   630  N  N   . LEU A 1 88  ? -0.324  -47.119 -2.588  1.00 26.68 ? 86  LEU H N   1 
ATOM   631  C  CA  . LEU A 1 88  ? -0.243  -46.289 -1.387  1.00 26.53 ? 86  LEU H CA  1 
ATOM   632  C  C   . LEU A 1 88  ? 0.155   -47.090 -0.150  1.00 27.85 ? 86  LEU H C   1 
ATOM   633  O  O   . LEU A 1 88  ? -0.214  -48.250 0.005   1.00 28.79 ? 86  LEU H O   1 
ATOM   634  C  CB  . LEU A 1 88  ? -1.578  -45.587 -1.122  1.00 26.04 ? 86  LEU H CB  1 
ATOM   635  C  CG  . LEU A 1 88  ? -2.138  -44.545 -2.095  1.00 24.17 ? 86  LEU H CG  1 
ATOM   636  C  CD1 . LEU A 1 88  ? -3.533  -44.163 -1.644  1.00 23.14 ? 86  LEU H CD1 1 
ATOM   637  C  CD2 . LEU A 1 88  ? -1.273  -43.299 -2.232  1.00 22.36 ? 86  LEU H CD2 1 
ATOM   638  N  N   . ARG A 1 89  ? 0.915   -46.449 0.726   1.00 29.33 ? 87  ARG H N   1 
ATOM   639  C  CA  . ARG A 1 89  ? 1.312   -47.017 2.015   1.00 30.43 ? 87  ARG H CA  1 
ATOM   640  C  C   . ARG A 1 89  ? 1.072   -45.923 3.061   1.00 30.52 ? 87  ARG H C   1 
ATOM   641  O  O   . ARG A 1 89  ? 0.944   -44.757 2.704   1.00 30.48 ? 87  ARG H O   1 
ATOM   642  C  CB  . ARG A 1 89  ? 2.788   -47.435 1.990   1.00 30.96 ? 87  ARG H CB  1 
ATOM   643  C  CG  . ARG A 1 89  ? 3.064   -48.812 1.343   1.00 34.09 ? 87  ARG H CG  1 
ATOM   644  C  CD  . ARG A 1 89  ? 4.494   -48.938 0.786   1.00 36.56 ? 87  ARG H CD  1 
ATOM   645  N  NE  . ARG A 1 89  ? 4.770   -47.856 -0.168  1.00 41.41 ? 87  ARG H NE  1 
ATOM   646  C  CZ  . ARG A 1 89  ? 5.695   -46.900 -0.014  1.00 43.49 ? 87  ARG H CZ  1 
ATOM   647  N  NH1 . ARG A 1 89  ? 6.501   -46.879 1.047   1.00 44.30 ? 87  ARG H NH1 1 
ATOM   648  N  NH2 . ARG A 1 89  ? 5.828   -45.960 -0.944  1.00 43.64 ? 87  ARG H NH2 1 
ATOM   649  N  N   . PRO A 1 90  ? 1.000   -46.292 4.352   1.00 30.84 ? 88  PRO H N   1 
ATOM   650  C  CA  . PRO A 1 90  ? 0.740   -45.316 5.417   1.00 30.53 ? 88  PRO H CA  1 
ATOM   651  C  C   . PRO A 1 90  ? 1.705   -44.139 5.408   1.00 30.74 ? 88  PRO H C   1 
ATOM   652  O  O   . PRO A 1 90  ? 1.309   -43.026 5.749   1.00 30.88 ? 88  PRO H O   1 
ATOM   653  C  CB  . PRO A 1 90  ? 0.911   -46.132 6.694   1.00 30.37 ? 88  PRO H CB  1 
ATOM   654  C  CG  . PRO A 1 90  ? 0.659   -47.538 6.281   1.00 30.60 ? 88  PRO H CG  1 
ATOM   655  C  CD  . PRO A 1 90  ? 1.161   -47.658 4.884   1.00 30.88 ? 88  PRO H CD  1 
ATOM   656  N  N   . GLU A 1 91  ? 2.953   -44.381 5.017   1.00 30.87 ? 89  GLU H N   1 
ATOM   657  C  CA  . GLU A 1 91  ? 3.924   -43.297 4.801   1.00 31.20 ? 89  GLU H CA  1 
ATOM   658  C  C   . GLU A 1 91  ? 3.449   -42.225 3.796   1.00 30.44 ? 89  GLU H C   1 
ATOM   659  O  O   . GLU A 1 91  ? 4.027   -41.142 3.708   1.00 30.42 ? 89  GLU H O   1 
ATOM   660  C  CB  . GLU A 1 91  ? 5.247   -43.892 4.323   1.00 31.93 ? 89  GLU H CB  1 
ATOM   661  C  CG  . GLU A 1 91  ? 6.022   -43.007 3.361   1.00 35.44 ? 89  GLU H CG  1 
ATOM   662  C  CD  . GLU A 1 91  ? 7.508   -43.316 3.348   1.00 39.98 ? 89  GLU H CD  1 
ATOM   663  O  OE1 . GLU A 1 91  ? 7.904   -44.409 3.837   1.00 39.30 ? 89  GLU H OE1 1 
ATOM   664  O  OE2 . GLU A 1 91  ? 8.271   -42.447 2.859   1.00 41.32 ? 89  GLU H OE2 1 
ATOM   665  N  N   . ASP A 1 92  ? 2.416   -42.530 3.018   1.00 29.50 ? 90  ASP H N   1 
ATOM   666  C  CA  . ASP A 1 92  ? 1.891   -41.572 2.049   1.00 28.84 ? 90  ASP H CA  1 
ATOM   667  C  C   . ASP A 1 92  ? 0.847   -40.648 2.654   1.00 28.01 ? 90  ASP H C   1 
ATOM   668  O  O   . ASP A 1 92  ? 0.379   -39.723 1.981   1.00 28.46 ? 90  ASP H O   1 
ATOM   669  C  CB  . ASP A 1 92  ? 1.287   -42.290 0.841   1.00 28.69 ? 90  ASP H CB  1 
ATOM   670  C  CG  . ASP A 1 92  ? 2.335   -42.934 -0.027  1.00 28.45 ? 90  ASP H CG  1 
ATOM   671  O  OD1 . ASP A 1 92  ? 3.343   -42.270 -0.344  1.00 25.35 ? 90  ASP H OD1 1 
ATOM   672  O  OD2 . ASP A 1 92  ? 2.148   -44.111 -0.395  1.00 30.59 ? 90  ASP H OD2 1 
ATOM   673  N  N   . THR A 1 93  ? 0.479   -40.909 3.907   1.00 26.79 ? 91  THR H N   1 
ATOM   674  C  CA  . THR A 1 93  ? -0.437  -40.041 4.646   1.00 26.05 ? 91  THR H CA  1 
ATOM   675  C  C   . THR A 1 93  ? 0.100   -38.633 4.655   1.00 25.45 ? 91  THR H C   1 
ATOM   676  O  O   . THR A 1 93  ? 1.202   -38.411 5.117   1.00 25.27 ? 91  THR H O   1 
ATOM   677  C  CB  . THR A 1 93  ? -0.594  -40.483 6.111   1.00 25.95 ? 91  THR H CB  1 
ATOM   678  O  OG1 . THR A 1 93  ? -1.388  -41.676 6.168   1.00 26.23 ? 91  THR H OG1 1 
ATOM   679  C  CG2 . THR A 1 93  ? -1.270  -39.390 6.934   1.00 25.20 ? 91  THR H CG2 1 
ATOM   680  N  N   . ALA A 1 94  ? -0.680  -37.683 4.154   1.00 24.95 ? 92  ALA H N   1 
ATOM   681  C  CA  . ALA A 1 94  ? -0.221  -36.303 4.099   1.00 24.91 ? 92  ALA H CA  1 
ATOM   682  C  C   . ALA A 1 94  ? -1.288  -35.367 3.530   1.00 25.08 ? 92  ALA H C   1 
ATOM   683  O  O   . ALA A 1 94  ? -2.341  -35.818 3.058   1.00 24.97 ? 92  ALA H O   1 
ATOM   684  C  CB  . ALA A 1 94  ? 1.033   -36.220 3.265   1.00 24.42 ? 92  ALA H CB  1 
ATOM   685  N  N   . VAL A 1 95  ? -1.011  -34.066 3.586   1.00 24.72 ? 93  VAL H N   1 
ATOM   686  C  CA  . VAL A 1 95  ? -1.854  -33.083 2.915   1.00 25.00 ? 93  VAL H CA  1 
ATOM   687  C  C   . VAL A 1 95  ? -1.236  -32.799 1.565   1.00 25.15 ? 93  VAL H C   1 
ATOM   688  O  O   . VAL A 1 95  ? -0.055  -32.538 1.483   1.00 25.81 ? 93  VAL H O   1 
ATOM   689  C  CB  . VAL A 1 95  ? -1.969  -31.748 3.698   1.00 25.27 ? 93  VAL H CB  1 
ATOM   690  C  CG1 . VAL A 1 95  ? -2.504  -30.667 2.788   1.00 23.23 ? 93  VAL H CG1 1 
ATOM   691  C  CG2 . VAL A 1 95  ? -2.862  -31.896 4.957   1.00 21.81 ? 93  VAL H CG2 1 
ATOM   692  N  N   . TYR A 1 96  ? -2.030  -32.862 0.507   1.00 25.56 ? 94  TYR H N   1 
ATOM   693  C  CA  . TYR A 1 96  ? -1.504  -32.708 -0.850  1.00 26.38 ? 94  TYR H CA  1 
ATOM   694  C  C   . TYR A 1 96  ? -1.960  -31.378 -1.417  1.00 26.64 ? 94  TYR H C   1 
ATOM   695  O  O   . TYR A 1 96  ? -3.132  -31.037 -1.317  1.00 26.69 ? 94  TYR H O   1 
ATOM   696  C  CB  . TYR A 1 96  ? -1.947  -33.869 -1.765  1.00 26.30 ? 94  TYR H CB  1 
ATOM   697  C  CG  . TYR A 1 96  ? -1.253  -35.191 -1.472  1.00 25.73 ? 94  TYR H CG  1 
ATOM   698  C  CD1 . TYR A 1 96  ? -1.668  -35.982 -0.415  1.00 27.55 ? 94  TYR H CD1 1 
ATOM   699  C  CD2 . TYR A 1 96  ? -0.199  -35.650 -2.255  1.00 25.84 ? 94  TYR H CD2 1 
ATOM   700  C  CE1 . TYR A 1 96  ? -1.054  -37.190 -0.121  1.00 27.40 ? 94  TYR H CE1 1 
ATOM   701  C  CE2 . TYR A 1 96  ? 0.427   -36.869 -1.974  1.00 27.10 ? 94  TYR H CE2 1 
ATOM   702  C  CZ  . TYR A 1 96  ? -0.011  -37.632 -0.891  1.00 27.05 ? 94  TYR H CZ  1 
ATOM   703  O  OH  . TYR A 1 96  ? 0.574   -38.835 -0.549  1.00 24.36 ? 94  TYR H OH  1 
ATOM   704  N  N   . TYR A 1 97  ? -1.025  -30.630 -2.000  1.00 27.17 ? 95  TYR H N   1 
ATOM   705  C  CA  . TYR A 1 97  ? -1.301  -29.279 -2.495  1.00 27.40 ? 95  TYR H CA  1 
ATOM   706  C  C   . TYR A 1 97  ? -1.047  -29.149 -3.980  1.00 28.43 ? 95  TYR H C   1 
ATOM   707  O  O   . TYR A 1 97  ? -0.029  -29.631 -4.474  1.00 28.95 ? 95  TYR H O   1 
ATOM   708  C  CB  . TYR A 1 97  ? -0.371  -28.273 -1.859  1.00 26.56 ? 95  TYR H CB  1 
ATOM   709  C  CG  . TYR A 1 97  ? -0.618  -27.970 -0.423  1.00 26.24 ? 95  TYR H CG  1 
ATOM   710  C  CD1 . TYR A 1 97  ? 0.111   -28.610 0.567   1.00 26.11 ? 95  TYR H CD1 1 
ATOM   711  C  CD2 . TYR A 1 97  ? -1.528  -26.997 -0.045  1.00 24.32 ? 95  TYR H CD2 1 
ATOM   712  C  CE1 . TYR A 1 97  ? -0.080  -28.314 1.888   1.00 24.21 ? 95  TYR H CE1 1 
ATOM   713  C  CE2 . TYR A 1 97  ? -1.719  -26.693 1.272   1.00 23.00 ? 95  TYR H CE2 1 
ATOM   714  C  CZ  . TYR A 1 97  ? -0.990  -27.359 2.239   1.00 23.30 ? 95  TYR H CZ  1 
ATOM   715  O  OH  . TYR A 1 97  ? -1.169  -27.085 3.572   1.00 22.12 ? 95  TYR H OH  1 
ATOM   716  N  N   . CYS A 1 98  ? -1.936  -28.451 -4.680  1.00 28.94 ? 96  CYS H N   1 
ATOM   717  C  CA  . CYS A 1 98  ? -1.650  -28.046 -6.052  1.00 29.68 ? 96  CYS H CA  1 
ATOM   718  C  C   . CYS A 1 98  ? -1.066  -26.650 -5.976  1.00 28.55 ? 96  CYS H C   1 
ATOM   719  O  O   . CYS A 1 98  ? -1.388  -25.893 -5.071  1.00 28.09 ? 96  CYS H O   1 
ATOM   720  C  CB  . CYS A 1 98  ? -2.888  -28.102 -6.957  1.00 30.12 ? 96  CYS H CB  1 
ATOM   721  S  SG  . CYS A 1 98  ? -4.256  -26.968 -6.554  1.00 34.48 ? 96  CYS H SG  1 
ATOM   722  N  N   . ALA A 1 99  ? -0.175  -26.339 -6.908  1.00 28.05 ? 97  ALA H N   1 
ATOM   723  C  CA  . ALA A 1 99  ? 0.599   -25.097 -6.871  1.00 27.50 ? 97  ALA H CA  1 
ATOM   724  C  C   . ALA A 1 99  ? 0.898   -24.666 -8.290  1.00 27.39 ? 97  ALA H C   1 
ATOM   725  O  O   . ALA A 1 99  ? 1.420   -25.428 -9.101  1.00 26.78 ? 97  ALA H O   1 
ATOM   726  C  CB  . ALA A 1 99  ? 1.888   -25.281 -6.093  1.00 27.02 ? 97  ALA H CB  1 
ATOM   727  N  N   . ARG A 1 100 ? 0.542   -23.434 -8.594  1.00 27.76 ? 98  ARG H N   1 
ATOM   728  C  CA  . ARG A 1 100 ? 0.650   -22.951 -9.936  1.00 28.36 ? 98  ARG H CA  1 
ATOM   729  C  C   . ARG A 1 100 ? 1.607   -21.778 -10.017 1.00 28.39 ? 98  ARG H C   1 
ATOM   730  O  O   . ARG A 1 100 ? 1.774   -21.008 -9.069  1.00 29.51 ? 98  ARG H O   1 
ATOM   731  C  CB  . ARG A 1 100 ? -0.746  -22.633 -10.458 1.00 28.86 ? 98  ARG H CB  1 
ATOM   732  C  CG  . ARG A 1 100 ? -0.926  -21.258 -11.002 1.00 31.91 ? 98  ARG H CG  1 
ATOM   733  C  CD  . ARG A 1 100 ? -0.723  -21.194 -12.483 1.00 33.83 ? 98  ARG H CD  1 
ATOM   734  N  NE  . ARG A 1 100 ? -0.515  -19.803 -12.882 1.00 36.51 ? 98  ARG H NE  1 
ATOM   735  C  CZ  . ARG A 1 100 ? -1.435  -19.011 -13.413 1.00 37.04 ? 98  ARG H CZ  1 
ATOM   736  N  NH1 . ARG A 1 100 ? -2.668  -19.455 -13.643 1.00 37.62 ? 98  ARG H NH1 1 
ATOM   737  N  NH2 . ARG A 1 100 ? -1.105  -17.767 -13.724 1.00 38.10 ? 98  ARG H NH2 1 
ATOM   738  N  N   . GLU A 1 101 ? 2.256   -21.680 -11.163 1.00 28.29 ? 99  GLU H N   1 
ATOM   739  C  CA  . GLU A 1 101 ? 3.240   -20.641 -11.455 1.00 28.03 ? 99  GLU H CA  1 
ATOM   740  C  C   . GLU A 1 101 ? 2.682   -19.261 -11.131 1.00 27.36 ? 99  GLU H C   1 
ATOM   741  O  O   . GLU A 1 101 ? 1.485   -19.032 -11.215 1.00 27.08 ? 99  GLU H O   1 
ATOM   742  C  CB  . GLU A 1 101 ? 3.606   -20.725 -12.949 1.00 28.05 ? 99  GLU H CB  1 
ATOM   743  C  CG  . GLU A 1 101 ? 5.049   -20.479 -13.277 1.00 28.90 ? 99  GLU H CG  1 
ATOM   744  C  CD  . GLU A 1 101 ? 5.471   -21.123 -14.594 1.00 32.23 ? 99  GLU H CD  1 
ATOM   745  O  OE1 . GLU A 1 101 ? 4.628   -21.247 -15.518 1.00 33.46 ? 99  GLU H OE1 1 
ATOM   746  O  OE2 . GLU A 1 101 ? 6.655   -21.524 -14.704 1.00 35.57 ? 99  GLU H OE2 1 
ATOM   747  N  N   . GLY A 1 102 ? 3.553   -18.336 -10.758 1.00 27.34 ? 100 GLY H N   1 
ATOM   748  C  CA  . GLY A 1 102 ? 3.161   -16.929 -10.618 1.00 27.21 ? 100 GLY H CA  1 
ATOM   749  C  C   . GLY A 1 102 ? 3.411   -16.188 -11.916 1.00 27.31 ? 100 GLY H C   1 
ATOM   750  O  O   . GLY A 1 102 ? 3.957   -16.756 -12.863 1.00 26.92 ? 100 GLY H O   1 
ATOM   751  N  N   . THR A 1 103 ? 3.011   -14.922 -11.970 1.00 27.64 ? 101 THR H N   1 
ATOM   752  C  CA  . THR A 1 103 ? 3.263   -14.097 -13.151 1.00 28.08 ? 101 THR H CA  1 
ATOM   753  C  C   . THR A 1 103 ? 3.740   -12.706 -12.745 1.00 29.42 ? 101 THR H C   1 
ATOM   754  O  O   . THR A 1 103 ? 3.534   -12.279 -11.607 1.00 30.03 ? 101 THR H O   1 
ATOM   755  C  CB  . THR A 1 103 ? 2.019   -13.964 -14.040 1.00 27.81 ? 101 THR H CB  1 
ATOM   756  O  OG1 . THR A 1 103 ? 0.962   -13.355 -13.296 1.00 26.70 ? 101 THR H OG1 1 
ATOM   757  C  CG2 . THR A 1 103 ? 1.565   -15.315 -14.551 1.00 26.65 ? 101 THR H CG2 1 
ATOM   758  N  N   . THR A 1 104 ? 4.372   -12.000 -13.678 1.00 30.27 ? 102 THR H N   1 
ATOM   759  C  CA  . THR A 1 104 ? 5.047   -10.748 -13.358 1.00 30.99 ? 102 THR H CA  1 
ATOM   760  C  C   . THR A 1 104 ? 4.177   -9.559  -13.684 1.00 31.92 ? 102 THR H C   1 
ATOM   761  O  O   . THR A 1 104 ? 3.495   -9.540  -14.710 1.00 32.32 ? 102 THR H O   1 
ATOM   762  C  CB  . THR A 1 104 ? 6.358   -10.579 -14.142 1.00 31.04 ? 102 THR H CB  1 
ATOM   763  O  OG1 . THR A 1 104 ? 6.072   -10.526 -15.545 1.00 31.38 ? 102 THR H OG1 1 
ATOM   764  C  CG2 . THR A 1 104 ? 7.317   -11.725 -13.857 1.00 30.61 ? 102 THR H CG2 1 
ATOM   765  N  N   . GLY A 1 105 ? 4.233   -8.557  -12.814 1.00 32.79 ? 103 GLY H N   1 
ATOM   766  C  CA  . GLY A 1 105 ? 3.456   -7.332  -12.981 1.00 33.16 ? 103 GLY H CA  1 
ATOM   767  C  C   . GLY A 1 105 ? 2.077   -7.471  -12.365 1.00 33.33 ? 103 GLY H C   1 
ATOM   768  O  O   . GLY A 1 105 ? 1.772   -8.490  -11.737 1.00 33.24 ? 103 GLY H O   1 
ATOM   769  N  N   . TRP A 1 108 ? -2.499  -10.860 -14.965 1.00 39.96 ? 106 TRP H N   1 
ATOM   770  C  CA  . TRP A 1 108 ? -2.675  -12.303 -14.788 1.00 39.89 ? 106 TRP H CA  1 
ATOM   771  C  C   . TRP A 1 108 ? -2.143  -13.092 -15.994 1.00 39.75 ? 106 TRP H C   1 
ATOM   772  O  O   . TRP A 1 108 ? -1.756  -14.257 -15.862 1.00 40.15 ? 106 TRP H O   1 
ATOM   773  C  CB  . TRP A 1 108 ? -4.158  -12.641 -14.538 1.00 39.99 ? 106 TRP H CB  1 
ATOM   774  N  N   . LEU A 1 109 ? -2.121  -12.447 -17.158 1.00 39.29 ? 107 LEU H N   1 
ATOM   775  C  CA  . LEU A 1 109 ? -1.550  -13.033 -18.377 1.00 38.65 ? 107 LEU H CA  1 
ATOM   776  C  C   . LEU A 1 109 ? -0.073  -12.632 -18.592 1.00 37.59 ? 107 LEU H C   1 
ATOM   777  O  O   . LEU A 1 109 ? 0.439   -12.713 -19.713 1.00 37.39 ? 107 LEU H O   1 
ATOM   778  C  CB  . LEU A 1 109 ? -2.389  -12.611 -19.595 1.00 38.89 ? 107 LEU H CB  1 
ATOM   779  N  N   . GLY A 1 110 ? 0.594   -12.210 -17.517 1.00 36.04 ? 108 GLY H N   1 
ATOM   780  C  CA  . GLY A 1 110 ? 1.996   -11.787 -17.564 1.00 34.87 ? 108 GLY H CA  1 
ATOM   781  C  C   . GLY A 1 110 ? 3.006   -12.923 -17.505 1.00 33.88 ? 108 GLY H C   1 
ATOM   782  O  O   . GLY A 1 110 ? 2.656   -14.077 -17.254 1.00 33.43 ? 108 GLY H O   1 
ATOM   783  N  N   . LYS A 1 111 ? 4.270   -12.577 -17.740 1.00 32.92 ? 109 LYS H N   1 
ATOM   784  C  CA  . LYS A 1 111 ? 5.370   -13.549 -17.815 1.00 31.92 ? 109 LYS H CA  1 
ATOM   785  C  C   . LYS A 1 111 ? 5.428   -14.486 -16.589 1.00 30.78 ? 109 LYS H C   1 
ATOM   786  O  O   . LYS A 1 111 ? 5.448   -14.025 -15.451 1.00 31.10 ? 109 LYS H O   1 
ATOM   787  C  CB  . LYS A 1 111 ? 6.708   -12.807 -17.959 1.00 32.07 ? 109 LYS H CB  1 
ATOM   788  C  CG  . LYS A 1 111 ? 7.803   -13.628 -18.636 1.00 33.80 ? 109 LYS H CG  1 
ATOM   789  C  CD  . LYS A 1 111 ? 9.215   -13.233 -18.211 1.00 35.22 ? 109 LYS H CD  1 
ATOM   790  C  CE  . LYS A 1 111 ? 10.262  -14.094 -18.927 1.00 36.11 ? 109 LYS H CE  1 
ATOM   791  N  NZ  . LYS A 1 111 ? 11.222  -14.751 -17.981 1.00 35.65 ? 109 LYS H NZ  1 
ATOM   792  N  N   . PRO A 1 112 ? 5.470   -15.809 -16.816 1.00 29.06 ? 110 PRO H N   1 
ATOM   793  C  CA  . PRO A 1 112 ? 5.536   -16.734 -15.691 1.00 28.17 ? 110 PRO H CA  1 
ATOM   794  C  C   . PRO A 1 112 ? 6.839   -16.602 -14.925 1.00 27.46 ? 110 PRO H C   1 
ATOM   795  O  O   . PRO A 1 112 ? 7.870   -16.331 -15.524 1.00 28.04 ? 110 PRO H O   1 
ATOM   796  C  CB  . PRO A 1 112 ? 5.485   -18.107 -16.360 1.00 28.27 ? 110 PRO H CB  1 
ATOM   797  C  CG  . PRO A 1 112 ? 5.959   -17.872 -17.751 1.00 28.90 ? 110 PRO H CG  1 
ATOM   798  C  CD  . PRO A 1 112 ? 5.470   -16.512 -18.107 1.00 28.94 ? 110 PRO H CD  1 
ATOM   799  N  N   . ILE A 1 113 ? 6.800   -16.820 -13.618 1.00 26.02 ? 111 ILE H N   1 
ATOM   800  C  CA  . ILE A 1 113 ? 7.998   -16.675 -12.796 1.00 25.01 ? 111 ILE H CA  1 
ATOM   801  C  C   . ILE A 1 113 ? 8.619   -18.002 -12.322 1.00 24.57 ? 111 ILE H C   1 
ATOM   802  O  O   . ILE A 1 113 ? 9.683   -18.007 -11.698 1.00 23.99 ? 111 ILE H O   1 
ATOM   803  C  CB  . ILE A 1 113 ? 7.713   -15.776 -11.576 1.00 25.05 ? 111 ILE H CB  1 
ATOM   804  C  CG1 . ILE A 1 113 ? 6.719   -16.452 -10.623 1.00 23.06 ? 111 ILE H CG1 1 
ATOM   805  C  CG2 . ILE A 1 113 ? 7.210   -14.412 -12.044 1.00 24.71 ? 111 ILE H CG2 1 
ATOM   806  C  CD1 . ILE A 1 113 ? 6.431   -15.655 -9.391  1.00 19.31 ? 111 ILE H CD1 1 
ATOM   807  N  N   . GLY A 1 114 ? 7.964   -19.120 -12.625 1.00 24.04 ? 112 GLY H N   1 
ATOM   808  C  CA  . GLY A 1 114 ? 8.447   -20.441 -12.224 1.00 23.13 ? 112 GLY H CA  1 
ATOM   809  C  C   . GLY A 1 114 ? 8.006   -20.785 -10.818 1.00 23.42 ? 112 GLY H C   1 
ATOM   810  O  O   . GLY A 1 114 ? 7.393   -21.827 -10.580 1.00 23.50 ? 112 GLY H O   1 
ATOM   811  N  N   . ALA A 1 115 ? 8.309   -19.891 -9.878  1.00 23.68 ? 113 ALA H N   1 
ATOM   812  C  CA  . ALA A 1 115 ? 8.019   -20.118 -8.463  1.00 22.91 ? 113 ALA H CA  1 
ATOM   813  C  C   . ALA A 1 115 ? 6.526   -20.040 -8.193  1.00 22.59 ? 113 ALA H C   1 
ATOM   814  O  O   . ALA A 1 115 ? 5.785   -19.414 -8.933  1.00 22.40 ? 113 ALA H O   1 
ATOM   815  C  CB  . ALA A 1 115 ? 8.778   -19.124 -7.604  1.00 22.53 ? 113 ALA H CB  1 
ATOM   816  N  N   . PHE A 1 116 ? 6.091   -20.671 -7.113  1.00 22.78 ? 114 PHE H N   1 
ATOM   817  C  CA  . PHE A 1 116 ? 4.675   -20.934 -6.925  1.00 22.89 ? 114 PHE H CA  1 
ATOM   818  C  C   . PHE A 1 116 ? 3.963   -19.834 -6.174  1.00 22.07 ? 114 PHE H C   1 
ATOM   819  O  O   . PHE A 1 116 ? 3.983   -19.805 -4.945  1.00 21.93 ? 114 PHE H O   1 
ATOM   820  C  CB  . PHE A 1 116 ? 4.460   -22.270 -6.199  1.00 23.05 ? 114 PHE H CB  1 
ATOM   821  C  CG  . PHE A 1 116 ? 5.201   -23.419 -6.806  1.00 25.23 ? 114 PHE H CG  1 
ATOM   822  C  CD1 . PHE A 1 116 ? 5.587   -23.403 -8.149  1.00 26.59 ? 114 PHE H CD1 1 
ATOM   823  C  CD2 . PHE A 1 116 ? 5.499   -24.543 -6.041  1.00 26.55 ? 114 PHE H CD2 1 
ATOM   824  C  CE1 . PHE A 1 116 ? 6.273   -24.487 -8.711  1.00 25.17 ? 114 PHE H CE1 1 
ATOM   825  C  CE2 . PHE A 1 116 ? 6.184   -25.620 -6.596  1.00 25.95 ? 114 PHE H CE2 1 
ATOM   826  C  CZ  . PHE A 1 116 ? 6.569   -25.587 -7.933  1.00 25.45 ? 114 PHE H CZ  1 
ATOM   827  N  N   . ALA A 1 117 ? 3.280   -18.971 -6.920  1.00 21.50 ? 115 ALA H N   1 
ATOM   828  C  CA  . ALA A 1 117 ? 2.501   -17.880 -6.329  1.00 20.58 ? 115 ALA H CA  1 
ATOM   829  C  C   . ALA A 1 117 ? 1.131   -18.314 -5.812  1.00 20.77 ? 115 ALA H C   1 
ATOM   830  O  O   . ALA A 1 117 ? 0.609   -17.683 -4.925  1.00 20.93 ? 115 ALA H O   1 
ATOM   831  C  CB  . ALA A 1 117 ? 2.333   -16.779 -7.320  1.00 19.64 ? 115 ALA H CB  1 
ATOM   832  N  N   . HIS A 1 118 ? 0.547   -19.380 -6.357  1.00 21.59 ? 116 HIS H N   1 
ATOM   833  C  CA  . HIS A 1 118 ? -0.880  -19.694 -6.102  1.00 21.50 ? 116 HIS H CA  1 
ATOM   834  C  C   . HIS A 1 118 ? -1.137  -21.122 -5.611  1.00 22.78 ? 116 HIS H C   1 
ATOM   835  O  O   . HIS A 1 118 ? -0.847  -22.089 -6.314  1.00 22.98 ? 116 HIS H O   1 
ATOM   836  C  CB  . HIS A 1 118 ? -1.687  -19.521 -7.382  1.00 21.11 ? 116 HIS H CB  1 
ATOM   837  C  CG  . HIS A 1 118 ? -1.513  -18.191 -8.041  1.00 19.37 ? 116 HIS H CG  1 
ATOM   838  N  ND1 . HIS A 1 118 ? -1.944  -17.014 -7.469  1.00 17.48 ? 116 HIS H ND1 1 
ATOM   839  C  CD2 . HIS A 1 118 ? -0.969  -17.853 -9.231  1.00 16.00 ? 116 HIS H CD2 1 
ATOM   840  C  CE1 . HIS A 1 118 ? -1.673  -16.009 -8.282  1.00 16.25 ? 116 HIS H CE1 1 
ATOM   841  N  NE2 . HIS A 1 118 ? -1.080  -16.491 -9.356  1.00 14.71 ? 116 HIS H NE2 1 
ATOM   842  N  N   . TRP A 1 119 ? -1.723  -21.258 -4.428  1.00 23.45 ? 117 TRP H N   1 
ATOM   843  C  CA  . TRP A 1 119 ? -1.917  -22.576 -3.852  1.00 23.98 ? 117 TRP H CA  1 
ATOM   844  C  C   . TRP A 1 119 ? -3.388  -22.932 -3.727  1.00 24.64 ? 117 TRP H C   1 
ATOM   845  O  O   . TRP A 1 119 ? -4.257  -22.061 -3.582  1.00 25.15 ? 117 TRP H O   1 
ATOM   846  C  CB  . TRP A 1 119 ? -1.233  -22.656 -2.488  1.00 24.50 ? 117 TRP H CB  1 
ATOM   847  C  CG  . TRP A 1 119 ? 0.280   -22.560 -2.596  1.00 26.32 ? 117 TRP H CG  1 
ATOM   848  C  CD1 . TRP A 1 119 ? 0.996   -21.466 -2.960  1.00 26.71 ? 117 TRP H CD1 1 
ATOM   849  C  CD2 . TRP A 1 119 ? 1.239   -23.604 -2.350  1.00 26.78 ? 117 TRP H CD2 1 
ATOM   850  N  NE1 . TRP A 1 119 ? 2.334   -21.756 -2.957  1.00 28.31 ? 117 TRP H NE1 1 
ATOM   851  C  CE2 . TRP A 1 119 ? 2.509   -23.062 -2.584  1.00 26.64 ? 117 TRP H CE2 1 
ATOM   852  C  CE3 . TRP A 1 119 ? 1.141   -24.941 -1.953  1.00 27.88 ? 117 TRP H CE3 1 
ATOM   853  C  CZ2 . TRP A 1 119 ? 3.674   -23.802 -2.439  1.00 25.77 ? 117 TRP H CZ2 1 
ATOM   854  C  CZ3 . TRP A 1 119 ? 2.307   -25.679 -1.807  1.00 27.87 ? 117 TRP H CZ3 1 
ATOM   855  C  CH2 . TRP A 1 119 ? 3.554   -25.105 -2.048  1.00 26.69 ? 117 TRP H CH2 1 
ATOM   856  N  N   . GLY A 1 120 ? -3.665  -24.224 -3.834  1.00 24.82 ? 118 GLY H N   1 
ATOM   857  C  CA  . GLY A 1 120 ? -4.970  -24.758 -3.471  1.00 24.98 ? 118 GLY H CA  1 
ATOM   858  C  C   . GLY A 1 120 ? -4.978  -24.873 -1.963  1.00 24.92 ? 118 GLY H C   1 
ATOM   859  O  O   . GLY A 1 120 ? -3.963  -24.588 -1.327  1.00 23.99 ? 118 GLY H O   1 
ATOM   860  N  N   . GLN A 1 121 ? -6.115  -25.280 -1.398  1.00 25.25 ? 119 GLN H N   1 
ATOM   861  C  CA  . GLN A 1 121 ? -6.309  -25.272 0.064   1.00 25.27 ? 119 GLN H CA  1 
ATOM   862  C  C   . GLN A 1 121 ? -5.719  -26.508 0.723   1.00 25.15 ? 119 GLN H C   1 
ATOM   863  O  O   . GLN A 1 121 ? -5.565  -26.557 1.934   1.00 24.92 ? 119 GLN H O   1 
ATOM   864  C  CB  . GLN A 1 121 ? -7.796  -25.145 0.425   1.00 25.73 ? 119 GLN H CB  1 
ATOM   865  C  CG  . GLN A 1 121 ? -8.588  -26.458 0.466   1.00 25.68 ? 119 GLN H CG  1 
ATOM   866  C  CD  . GLN A 1 121 ? -9.075  -26.897 -0.898  1.00 25.68 ? 119 GLN H CD  1 
ATOM   867  O  OE1 . GLN A 1 121 ? -8.759  -26.276 -1.911  1.00 28.50 ? 119 GLN H OE1 1 
ATOM   868  N  NE2 . GLN A 1 121 ? -9.854  -27.969 -0.933  1.00 26.74 ? 119 GLN H NE2 1 
ATOM   869  N  N   . GLY A 1 122 ? -5.384  -27.503 -0.086  1.00 25.65 ? 120 GLY H N   1 
ATOM   870  C  CA  . GLY A 1 122 ? -4.782  -28.736 0.419   1.00 25.90 ? 120 GLY H CA  1 
ATOM   871  C  C   . GLY A 1 122 ? -5.806  -29.859 0.482   1.00 26.15 ? 120 GLY H C   1 
ATOM   872  O  O   . GLY A 1 122 ? -7.012  -29.618 0.603   1.00 26.80 ? 120 GLY H O   1 
ATOM   873  N  N   . THR A 1 123 ? -5.328  -31.089 0.397   1.00 26.01 ? 121 THR H N   1 
ATOM   874  C  CA  . THR A 1 123 ? -6.191  -32.246 0.548   1.00 26.48 ? 121 THR H CA  1 
ATOM   875  C  C   . THR A 1 123 ? -5.524  -33.283 1.427   1.00 26.39 ? 121 THR H C   1 
ATOM   876  O  O   . THR A 1 123 ? -4.551  -33.898 1.011   1.00 27.07 ? 121 THR H O   1 
ATOM   877  C  CB  . THR A 1 123 ? -6.462  -32.910 -0.806  1.00 26.91 ? 121 THR H CB  1 
ATOM   878  O  OG1 . THR A 1 123 ? -6.964  -31.933 -1.734  1.00 26.16 ? 121 THR H OG1 1 
ATOM   879  C  CG2 . THR A 1 123 ? -7.468  -34.037 -0.633  1.00 26.48 ? 121 THR H CG2 1 
ATOM   880  N  N   . LEU A 1 124 ? -6.027  -33.474 2.638   1.00 26.12 ? 122 LEU H N   1 
ATOM   881  C  CA  . LEU A 1 124 ? -5.524  -34.537 3.507   1.00 25.81 ? 122 LEU H CA  1 
ATOM   882  C  C   . LEU A 1 124 ? -5.942  -35.898 2.943   1.00 25.71 ? 122 LEU H C   1 
ATOM   883  O  O   . LEU A 1 124 ? -7.125  -36.166 2.756   1.00 25.79 ? 122 LEU H O   1 
ATOM   884  C  CB  . LEU A 1 124 ? -6.041  -34.359 4.939   1.00 25.80 ? 122 LEU H CB  1 
ATOM   885  C  CG  . LEU A 1 124 ? -5.590  -35.364 6.022   1.00 27.19 ? 122 LEU H CG  1 
ATOM   886  C  CD1 . LEU A 1 124 ? -4.123  -35.171 6.462   1.00 26.06 ? 122 LEU H CD1 1 
ATOM   887  C  CD2 . LEU A 1 124 ? -6.535  -35.304 7.238   1.00 23.16 ? 122 LEU H CD2 1 
ATOM   888  N  N   . VAL A 1 125 ? -4.957  -36.730 2.620   1.00 26.13 ? 123 VAL H N   1 
ATOM   889  C  CA  . VAL A 1 125 ? -5.197  -38.131 2.267   1.00 26.28 ? 123 VAL H CA  1 
ATOM   890  C  C   . VAL A 1 125 ? -4.584  -38.986 3.357   1.00 27.44 ? 123 VAL H C   1 
ATOM   891  O  O   . VAL A 1 125 ? -3.374  -38.903 3.605   1.00 28.86 ? 123 VAL H O   1 
ATOM   892  C  CB  . VAL A 1 125 ? -4.553  -38.547 0.912   1.00 26.15 ? 123 VAL H CB  1 
ATOM   893  C  CG1 . VAL A 1 125 ? -4.884  -39.988 0.591   1.00 23.56 ? 123 VAL H CG1 1 
ATOM   894  C  CG2 . VAL A 1 125 ? -5.001  -37.638 -0.216  1.00 23.92 ? 123 VAL H CG2 1 
ATOM   895  N  N   . THR A 1 126 ? -5.407  -39.796 4.016   1.00 28.08 ? 124 THR H N   1 
ATOM   896  C  CA  . THR A 1 126 ? -4.917  -40.708 5.048   1.00 28.18 ? 124 THR H CA  1 
ATOM   897  C  C   . THR A 1 126 ? -4.884  -42.136 4.513   1.00 28.44 ? 124 THR H C   1 
ATOM   898  O  O   . THR A 1 126 ? -5.867  -42.622 3.965   1.00 28.18 ? 124 THR H O   1 
ATOM   899  C  CB  . THR A 1 126 ? -5.776  -40.630 6.336   1.00 28.15 ? 124 THR H CB  1 
ATOM   900  O  OG1 . THR A 1 126 ? -5.877  -39.264 6.757   1.00 29.07 ? 124 THR H OG1 1 
ATOM   901  C  CG2 . THR A 1 126 ? -5.150  -41.455 7.473   1.00 27.64 ? 124 THR H CG2 1 
ATOM   902  N  N   . VAL A 1 127 ? -3.740  -42.794 4.667   1.00 29.42 ? 125 VAL H N   1 
ATOM   903  C  CA  . VAL A 1 127 ? -3.601  -44.201 4.299   1.00 30.26 ? 125 VAL H CA  1 
ATOM   904  C  C   . VAL A 1 127 ? -3.407  -45.048 5.550   1.00 31.47 ? 125 VAL H C   1 
ATOM   905  O  O   . VAL A 1 127 ? -2.426  -44.899 6.263   1.00 31.82 ? 125 VAL H O   1 
ATOM   906  C  CB  . VAL A 1 127 ? -2.411  -44.435 3.356   1.00 30.21 ? 125 VAL H CB  1 
ATOM   907  C  CG1 . VAL A 1 127 ? -2.308  -45.905 3.033   1.00 30.43 ? 125 VAL H CG1 1 
ATOM   908  C  CG2 . VAL A 1 127 ? -2.558  -43.610 2.075   1.00 29.27 ? 125 VAL H CG2 1 
ATOM   909  N  N   . SER A 1 128 ? -4.348  -45.942 5.822   1.00 33.51 ? 126 SER H N   1 
ATOM   910  C  CA  . SER A 1 128 ? -4.308  -46.725 7.057   1.00 34.32 ? 126 SER H CA  1 
ATOM   911  C  C   . SER A 1 128 ? -5.108  -48.005 6.958   1.00 34.80 ? 126 SER H C   1 
ATOM   912  O  O   . SER A 1 128 ? -5.985  -48.140 6.104   1.00 34.38 ? 126 SER H O   1 
ATOM   913  C  CB  . SER A 1 128 ? -4.861  -45.900 8.216   1.00 34.82 ? 126 SER H CB  1 
ATOM   914  O  OG  . SER A 1 128 ? -6.178  -45.461 7.928   1.00 36.17 ? 126 SER H OG  1 
ATOM   915  N  N   . SER A 1 129 ? -4.801  -48.925 7.870   1.00 36.03 ? 127 SER H N   1 
ATOM   916  C  CA  . SER A 1 129 ? -5.451  -50.235 7.947   1.00 36.44 ? 127 SER H CA  1 
ATOM   917  C  C   . SER A 1 129 ? -5.919  -50.516 9.368   1.00 36.69 ? 127 SER H C   1 
ATOM   918  O  O   . SER A 1 129 ? -6.906  -49.944 9.829   1.00 37.25 ? 127 SER H O   1 
ATOM   919  C  CB  . SER A 1 129 ? -4.485  -51.337 7.486   1.00 36.51 ? 127 SER H CB  1 
ATOM   920  O  OG  . SER A 1 129 ? -3.152  -51.044 7.873   1.00 36.61 ? 127 SER H OG  1 
ATOM   921  N  N   . GLN B 1 3   ? -14.551 -8.117  -2.266  1.00 35.53 ? 1   GLN I N   1 
ATOM   922  C  CA  . GLN B 1 3   ? -15.727 -8.761  -2.943  1.00 35.95 ? 1   GLN I CA  1 
ATOM   923  C  C   . GLN B 1 3   ? -16.094 -10.098 -2.279  1.00 35.84 ? 1   GLN I C   1 
ATOM   924  O  O   . GLN B 1 3   ? -15.964 -10.254 -1.061  1.00 36.95 ? 1   GLN I O   1 
ATOM   925  C  CB  . GLN B 1 3   ? -15.451 -8.950  -4.442  1.00 35.73 ? 1   GLN I CB  1 
ATOM   926  N  N   . VAL B 1 4   ? -16.569 -11.059 -3.052  1.00 35.16 ? 2   VAL I N   1 
ATOM   927  C  CA  . VAL B 1 4   ? -16.947 -12.341 -2.465  1.00 34.86 ? 2   VAL I CA  1 
ATOM   928  C  C   . VAL B 1 4   ? -17.142 -13.289 -3.606  1.00 34.05 ? 2   VAL I C   1 
ATOM   929  O  O   . VAL B 1 4   ? -17.955 -13.057 -4.486  1.00 34.56 ? 2   VAL I O   1 
ATOM   930  C  CB  . VAL B 1 4   ? -18.256 -12.259 -1.661  1.00 35.21 ? 2   VAL I CB  1 
ATOM   931  C  CG1 . VAL B 1 4   ? -18.516 -13.579 -0.886  1.00 35.13 ? 2   VAL I CG1 1 
ATOM   932  C  CG2 . VAL B 1 4   ? -18.227 -11.068 -0.715  1.00 34.78 ? 2   VAL I CG2 1 
ATOM   933  N  N   . GLN B 1 5   ? -16.374 -14.351 -3.616  1.00 33.08 ? 3   GLN I N   1 
ATOM   934  C  CA  . GLN B 1 5   ? -16.411 -15.237 -4.739  1.00 32.01 ? 3   GLN I CA  1 
ATOM   935  C  C   . GLN B 1 5   ? -16.246 -16.601 -4.154  1.00 30.78 ? 3   GLN I C   1 
ATOM   936  O  O   . GLN B 1 5   ? -15.233 -16.878 -3.522  1.00 30.76 ? 3   GLN I O   1 
ATOM   937  C  CB  . GLN B 1 5   ? -15.271 -14.918 -5.705  1.00 31.10 ? 3   GLN I CB  1 
ATOM   938  N  N   . LEU B 1 6   ? -17.254 -17.436 -4.320  1.00 29.29 ? 4   LEU I N   1 
ATOM   939  C  CA  . LEU B 1 6   ? -17.126 -18.827 -3.937  1.00 28.84 ? 4   LEU I CA  1 
ATOM   940  C  C   . LEU B 1 6   ? -16.700 -19.635 -5.173  1.00 28.51 ? 4   LEU I C   1 
ATOM   941  O  O   . LEU B 1 6   ? -17.260 -19.448 -6.247  1.00 28.21 ? 4   LEU I O   1 
ATOM   942  C  CB  . LEU B 1 6   ? -18.449 -19.329 -3.350  1.00 28.39 ? 4   LEU I CB  1 
ATOM   943  C  CG  . LEU B 1 6   ? -19.007 -18.491 -2.187  1.00 27.42 ? 4   LEU I CG  1 
ATOM   944  C  CD1 . LEU B 1 6   ? -20.304 -19.092 -1.650  1.00 25.66 ? 4   LEU I CD1 1 
ATOM   945  C  CD2 . LEU B 1 6   ? -17.980 -18.335 -1.056  1.00 24.69 ? 4   LEU I CD2 1 
ATOM   946  N  N   . VAL B 1 7   ? -15.686 -20.493 -5.030  1.00 28.29 ? 5   VAL I N   1 
ATOM   947  C  CA  . VAL B 1 7   ? -15.250 -21.390 -6.124  1.00 27.81 ? 5   VAL I CA  1 
ATOM   948  C  C   . VAL B 1 7   ? -15.226 -22.835 -5.652  1.00 27.84 ? 5   VAL I C   1 
ATOM   949  O  O   . VAL B 1 7   ? -14.642 -23.141 -4.627  1.00 28.03 ? 5   VAL I O   1 
ATOM   950  C  CB  . VAL B 1 7   ? -13.834 -21.055 -6.658  1.00 28.00 ? 5   VAL I CB  1 
ATOM   951  C  CG1 . VAL B 1 7   ? -13.791 -19.653 -7.267  1.00 25.36 ? 5   VAL I CG1 1 
ATOM   952  C  CG2 . VAL B 1 7   ? -12.789 -21.221 -5.549  1.00 27.06 ? 5   VAL I CG2 1 
ATOM   953  N  N   . GLN B 1 8   ? -15.839 -23.724 -6.422  1.00 27.80 ? 6   GLN I N   1 
ATOM   954  C  CA  . GLN B 1 8   ? -16.036 -25.105 -5.994  1.00 27.65 ? 6   GLN I CA  1 
ATOM   955  C  C   . GLN B 1 8   ? -15.164 -26.137 -6.704  1.00 27.50 ? 6   GLN I C   1 
ATOM   956  O  O   . GLN B 1 8   ? -14.732 -25.942 -7.851  1.00 27.36 ? 6   GLN I O   1 
ATOM   957  C  CB  . GLN B 1 8   ? -17.491 -25.492 -6.196  1.00 27.90 ? 6   GLN I CB  1 
ATOM   958  C  CG  . GLN B 1 8   ? -18.443 -24.665 -5.364  1.00 29.43 ? 6   GLN I CG  1 
ATOM   959  C  CD  . GLN B 1 8   ? -19.833 -25.235 -5.349  1.00 29.91 ? 6   GLN I CD  1 
ATOM   960  O  OE1 . GLN B 1 8   ? -20.804 -24.513 -5.543  1.00 34.10 ? 6   GLN I OE1 1 
ATOM   961  N  NE2 . GLN B 1 8   ? -19.940 -26.539 -5.120  1.00 29.83 ? 6   GLN I NE2 1 
ATOM   962  N  N   . SER B 1 9   ? -14.928 -27.247 -6.006  1.00 26.64 ? 7   SER I N   1 
ATOM   963  C  CA  . SER B 1 9   ? -14.124 -28.338 -6.525  1.00 25.72 ? 7   SER I CA  1 
ATOM   964  C  C   . SER B 1 9   ? -14.828 -28.989 -7.703  1.00 25.34 ? 7   SER I C   1 
ATOM   965  O  O   . SER B 1 9   ? -16.038 -28.887 -7.841  1.00 25.59 ? 7   SER I O   1 
ATOM   966  C  CB  . SER B 1 9   ? -13.903 -29.374 -5.436  1.00 25.95 ? 7   SER I CB  1 
ATOM   967  O  OG  . SER B 1 9   ? -15.124 -29.692 -4.788  1.00 26.49 ? 7   SER I OG  1 
ATOM   968  N  N   . GLY B 1 10  ? -14.059 -29.673 -8.538  1.00 25.06 ? 8   GLY I N   1 
ATOM   969  C  CA  . GLY B 1 10  ? -14.568 -30.274 -9.754  1.00 25.36 ? 8   GLY I CA  1 
ATOM   970  C  C   . GLY B 1 10  ? -15.396 -31.544 -9.638  1.00 25.82 ? 8   GLY I C   1 
ATOM   971  O  O   . GLY B 1 10  ? -15.493 -32.174 -8.589  1.00 26.61 ? 8   GLY I O   1 
ATOM   972  N  N   . ALA B 1 11  ? -15.996 -31.910 -10.757 1.00 26.64 ? 9   ALA I N   1 
ATOM   973  C  CA  . ALA B 1 11  ? -16.860 -33.079 -10.846 1.00 28.06 ? 9   ALA I CA  1 
ATOM   974  C  C   . ALA B 1 11  ? -16.196 -34.325 -10.246 1.00 28.35 ? 9   ALA I C   1 
ATOM   975  O  O   . ALA B 1 11  ? -15.007 -34.541 -10.404 1.00 28.69 ? 9   ALA I O   1 
ATOM   976  C  CB  . ALA B 1 11  ? -17.253 -33.328 -12.318 1.00 27.59 ? 9   ALA I CB  1 
ATOM   977  N  N   . GLU B 1 12  ? -16.983 -35.132 -9.557  1.00 29.07 ? 10  GLU I N   1 
ATOM   978  C  CA  . GLU B 1 12  ? -16.498 -36.363 -8.947  1.00 29.86 ? 10  GLU I CA  1 
ATOM   979  C  C   . GLU B 1 12  ? -17.420 -37.520 -9.399  1.00 29.27 ? 10  GLU I C   1 
ATOM   980  O  O   . GLU B 1 12  ? -18.594 -37.312 -9.657  1.00 30.52 ? 10  GLU I O   1 
ATOM   981  C  CB  . GLU B 1 12  ? -16.466 -36.198 -7.411  1.00 30.36 ? 10  GLU I CB  1 
ATOM   982  C  CG  . GLU B 1 12  ? -15.337 -36.969 -6.689  1.00 32.90 ? 10  GLU I CG  1 
ATOM   983  C  CD  . GLU B 1 12  ? -14.099 -36.131 -6.349  1.00 35.12 ? 10  GLU I CD  1 
ATOM   984  O  OE1 . GLU B 1 12  ? -14.009 -34.959 -6.762  1.00 39.56 ? 10  GLU I OE1 1 
ATOM   985  O  OE2 . GLU B 1 12  ? -13.200 -36.658 -5.661  1.00 36.65 ? 10  GLU I OE2 1 
ATOM   986  N  N   . VAL B 1 13  ? -16.878 -38.715 -9.553  1.00 29.04 ? 11  VAL I N   1 
ATOM   987  C  CA  . VAL B 1 13  ? -17.673 -39.884 -9.940  1.00 28.89 ? 11  VAL I CA  1 
ATOM   988  C  C   . VAL B 1 13  ? -17.524 -40.971 -8.881  1.00 29.02 ? 11  VAL I C   1 
ATOM   989  O  O   . VAL B 1 13  ? -16.410 -41.319 -8.464  1.00 28.65 ? 11  VAL I O   1 
ATOM   990  C  CB  . VAL B 1 13  ? -17.256 -40.456 -11.316 1.00 29.25 ? 11  VAL I CB  1 
ATOM   991  C  CG1 . VAL B 1 13  ? -18.136 -41.665 -11.683 1.00 27.26 ? 11  VAL I CG1 1 
ATOM   992  C  CG2 . VAL B 1 13  ? -17.361 -39.378 -12.397 1.00 28.57 ? 11  VAL I CG2 1 
ATOM   993  N  N   . LYS B 1 14  ? -18.651 -41.499 -8.430  1.00 28.69 ? 12  LYS I N   1 
ATOM   994  C  CA  . LYS B 1 14  ? -18.647 -42.305 -7.225  1.00 28.63 ? 12  LYS I CA  1 
ATOM   995  C  C   . LYS B 1 14  ? -19.523 -43.526 -7.358  1.00 29.00 ? 12  LYS I C   1 
ATOM   996  O  O   . LYS B 1 14  ? -20.502 -43.533 -8.093  1.00 29.32 ? 12  LYS I O   1 
ATOM   997  C  CB  . LYS B 1 14  ? -19.110 -41.460 -6.045  1.00 28.51 ? 12  LYS I CB  1 
ATOM   998  C  CG  . LYS B 1 14  ? -18.136 -40.352 -5.655  1.00 27.89 ? 12  LYS I CG  1 
ATOM   999  C  CD  . LYS B 1 14  ? -17.150 -40.825 -4.600  1.00 28.66 ? 12  LYS I CD  1 
ATOM   1000 C  CE  . LYS B 1 14  ? -15.843 -41.302 -5.190  1.00 28.93 ? 12  LYS I CE  1 
ATOM   1001 N  NZ  . LYS B 1 14  ? -14.810 -41.479 -4.128  1.00 27.94 ? 12  LYS I NZ  1 
ATOM   1002 N  N   . ARG B 1 15  ? -19.166 -44.565 -6.629  1.00 29.65 ? 13  ARG I N   1 
ATOM   1003 C  CA  . ARG B 1 15  ? -19.951 -45.785 -6.648  1.00 30.47 ? 13  ARG I CA  1 
ATOM   1004 C  C   . ARG B 1 15  ? -20.866 -45.864 -5.423  1.00 29.61 ? 13  ARG I C   1 
ATOM   1005 O  O   . ARG B 1 15  ? -20.576 -45.304 -4.361  1.00 29.40 ? 13  ARG I O   1 
ATOM   1006 C  CB  . ARG B 1 15  ? -19.058 -47.035 -6.795  1.00 31.40 ? 13  ARG I CB  1 
ATOM   1007 C  CG  . ARG B 1 15  ? -17.994 -47.219 -5.716  1.00 34.45 ? 13  ARG I CG  1 
ATOM   1008 C  CD  . ARG B 1 15  ? -17.080 -45.997 -5.541  1.00 36.07 ? 13  ARG I CD  1 
ATOM   1009 N  NE  . ARG B 1 15  ? -16.096 -46.193 -4.481  1.00 37.96 ? 13  ARG I NE  1 
ATOM   1010 N  N   . PRO B 1 16  ? -21.997 -46.547 -5.585  1.00 28.75 ? 14  PRO I N   1 
ATOM   1011 C  CA  . PRO B 1 16  ? -22.980 -46.684 -4.532  1.00 27.84 ? 14  PRO I CA  1 
ATOM   1012 C  C   . PRO B 1 16  ? -22.347 -47.180 -3.235  1.00 26.55 ? 14  PRO I C   1 
ATOM   1013 O  O   . PRO B 1 16  ? -21.511 -48.090 -3.242  1.00 25.12 ? 14  PRO I O   1 
ATOM   1014 C  CB  . PRO B 1 16  ? -23.947 -47.732 -5.088  1.00 28.01 ? 14  PRO I CB  1 
ATOM   1015 C  CG  . PRO B 1 16  ? -23.778 -47.691 -6.545  1.00 28.65 ? 14  PRO I CG  1 
ATOM   1016 C  CD  . PRO B 1 16  ? -22.386 -47.253 -6.816  1.00 28.91 ? 14  PRO I CD  1 
ATOM   1017 N  N   . GLY B 1 17  ? -22.757 -46.576 -2.130  1.00 25.97 ? 15  GLY I N   1 
ATOM   1018 C  CA  . GLY B 1 17  ? -22.259 -46.963 -0.808  1.00 25.82 ? 15  GLY I CA  1 
ATOM   1019 C  C   . GLY B 1 17  ? -21.021 -46.197 -0.375  1.00 25.34 ? 15  GLY I C   1 
ATOM   1020 O  O   . GLY B 1 17  ? -20.526 -46.381 0.734   1.00 24.49 ? 15  GLY I O   1 
ATOM   1021 N  N   . SER B 1 18  ? -20.536 -45.321 -1.246  1.00 25.49 ? 16  SER I N   1 
ATOM   1022 C  CA  . SER B 1 18  ? -19.290 -44.606 -0.991  1.00 25.80 ? 16  SER I CA  1 
ATOM   1023 C  C   . SER B 1 18  ? -19.561 -43.221 -0.388  1.00 25.58 ? 16  SER I C   1 
ATOM   1024 O  O   . SER B 1 18  ? -20.709 -42.818 -0.219  1.00 25.64 ? 16  SER I O   1 
ATOM   1025 C  CB  . SER B 1 18  ? -18.454 -44.495 -2.278  1.00 25.74 ? 16  SER I CB  1 
ATOM   1026 O  OG  . SER B 1 18  ? -19.082 -43.686 -3.271  1.00 25.11 ? 16  SER I OG  1 
ATOM   1027 N  N   . SER B 1 19  ? -18.493 -42.515 -0.053  1.00 25.39 ? 17  SER I N   1 
ATOM   1028 C  CA  . SER B 1 19  ? -18.601 -41.172 0.469   1.00 25.94 ? 17  SER I CA  1 
ATOM   1029 C  C   . SER B 1 19  ? -17.676 -40.261 -0.312  1.00 26.24 ? 17  SER I C   1 
ATOM   1030 O  O   . SER B 1 19  ? -16.697 -40.706 -0.900  1.00 26.43 ? 17  SER I O   1 
ATOM   1031 C  CB  . SER B 1 19  ? -18.214 -41.134 1.942   1.00 26.17 ? 17  SER I CB  1 
ATOM   1032 O  OG  . SER B 1 19  ? -18.818 -42.194 2.662   1.00 27.68 ? 17  SER I OG  1 
ATOM   1033 N  N   . VAL B 1 20  ? -17.986 -38.973 -0.303  1.00 26.08 ? 18  VAL I N   1 
ATOM   1034 C  CA  . VAL B 1 20  ? -17.173 -38.007 -0.985  1.00 26.23 ? 18  VAL I CA  1 
ATOM   1035 C  C   . VAL B 1 20  ? -17.337 -36.681 -0.293  1.00 26.52 ? 18  VAL I C   1 
ATOM   1036 O  O   . VAL B 1 20  ? -18.413 -36.368 0.199   1.00 27.50 ? 18  VAL I O   1 
ATOM   1037 C  CB  . VAL B 1 20  ? -17.590 -37.883 -2.459  1.00 26.47 ? 18  VAL I CB  1 
ATOM   1038 C  CG1 . VAL B 1 20  ? -18.837 -37.037 -2.592  1.00 25.62 ? 18  VAL I CG1 1 
ATOM   1039 C  CG2 . VAL B 1 20  ? -16.435 -37.325 -3.298  1.00 25.61 ? 18  VAL I CG2 1 
ATOM   1040 N  N   . THR B 1 21  ? -16.270 -35.900 -0.265  1.00 26.54 ? 19  THR I N   1 
ATOM   1041 C  CA  . THR B 1 21  ? -16.299 -34.597 0.370   1.00 26.28 ? 19  THR I CA  1 
ATOM   1042 C  C   . THR B 1 21  ? -15.989 -33.519 -0.637  1.00 25.98 ? 19  THR I C   1 
ATOM   1043 O  O   . THR B 1 21  ? -14.996 -33.575 -1.335  1.00 24.12 ? 19  THR I O   1 
ATOM   1044 C  CB  . THR B 1 21  ? -15.281 -34.508 1.505   1.00 26.60 ? 19  THR I CB  1 
ATOM   1045 O  OG1 . THR B 1 21  ? -15.558 -35.532 2.461   1.00 25.79 ? 19  THR I OG1 1 
ATOM   1046 C  CG2 . THR B 1 21  ? -15.339 -33.124 2.182   1.00 26.52 ? 19  THR I CG2 1 
ATOM   1047 N  N   . VAL B 1 22  ? -16.837 -32.506 -0.655  1.00 27.18 ? 20  VAL I N   1 
ATOM   1048 C  CA  . VAL B 1 22  ? -16.830 -31.503 -1.711  1.00 27.97 ? 20  VAL I CA  1 
ATOM   1049 C  C   . VAL B 1 22  ? -16.456 -30.152 -1.118  1.00 28.13 ? 20  VAL I C   1 
ATOM   1050 O  O   . VAL B 1 22  ? -16.806 -29.850 0.009   1.00 28.35 ? 20  VAL I O   1 
ATOM   1051 C  CB  . VAL B 1 22  ? -18.200 -31.494 -2.420  1.00 28.37 ? 20  VAL I CB  1 
ATOM   1052 C  CG1 . VAL B 1 22  ? -18.623 -30.090 -2.831  1.00 31.50 ? 20  VAL I CG1 1 
ATOM   1053 C  CG2 . VAL B 1 22  ? -18.158 -32.447 -3.615  1.00 28.05 ? 20  VAL I CG2 1 
ATOM   1054 N  N   . SER B 1 23  ? -15.715 -29.355 -1.874  1.00 28.76 ? 21  SER I N   1 
ATOM   1055 C  CA  . SER B 1 23  ? -15.129 -28.132 -1.340  1.00 28.90 ? 21  SER I CA  1 
ATOM   1056 C  C   . SER B 1 23  ? -15.725 -26.848 -1.905  1.00 29.29 ? 21  SER I C   1 
ATOM   1057 O  O   . SER B 1 23  ? -15.989 -26.729 -3.104  1.00 30.06 ? 21  SER I O   1 
ATOM   1058 C  CB  . SER B 1 23  ? -13.628 -28.139 -1.609  1.00 28.79 ? 21  SER I CB  1 
ATOM   1059 O  OG  . SER B 1 23  ? -13.070 -29.381 -1.208  1.00 29.91 ? 21  SER I OG  1 
ATOM   1060 N  N   . CYS B 1 24  ? -15.908 -25.877 -1.022  1.00 29.51 ? 22  CYS I N   1 
ATOM   1061 C  CA  . CYS B 1 24  ? -16.284 -24.528 -1.417  1.00 29.31 ? 22  CYS I CA  1 
ATOM   1062 C  C   . CYS B 1 24  ? -15.321 -23.522 -0.806  1.00 29.12 ? 22  CYS I C   1 
ATOM   1063 O  O   . CYS B 1 24  ? -15.290 -23.350 0.405   1.00 28.59 ? 22  CYS I O   1 
ATOM   1064 C  CB  . CYS B 1 24  ? -17.698 -24.225 -0.952  1.00 29.27 ? 22  CYS I CB  1 
ATOM   1065 S  SG  . CYS B 1 24  ? -18.184 -22.576 -1.376  1.00 29.12 ? 22  CYS I SG  1 
ATOM   1066 N  N   . LYS B 1 25  ? -14.536 -22.863 -1.649  1.00 29.43 ? 23  LYS I N   1 
ATOM   1067 C  CA  . LYS B 1 25  ? -13.484 -21.952 -1.184  1.00 29.93 ? 23  LYS I CA  1 
ATOM   1068 C  C   . LYS B 1 25  ? -13.893 -20.483 -1.367  1.00 29.66 ? 23  LYS I C   1 
ATOM   1069 O  O   . LYS B 1 25  ? -14.406 -20.090 -2.409  1.00 29.65 ? 23  LYS I O   1 
ATOM   1070 C  CB  . LYS B 1 25  ? -12.155 -22.263 -1.897  1.00 30.25 ? 23  LYS I CB  1 
ATOM   1071 C  CG  . LYS B 1 25  ? -11.008 -21.271 -1.619  1.00 31.55 ? 23  LYS I CG  1 
ATOM   1072 C  CD  . LYS B 1 25  ? -9.636  -21.836 -2.042  1.00 31.50 ? 23  LYS I CD  1 
ATOM   1073 C  CE  . LYS B 1 25  ? -8.647  -20.716 -2.382  1.00 32.07 ? 23  LYS I CE  1 
ATOM   1074 N  NZ  . LYS B 1 25  ? -7.207  -21.113 -2.229  1.00 32.31 ? 23  LYS I NZ  1 
ATOM   1075 N  N   . ALA B 1 26  ? -13.655 -19.681 -0.336  1.00 29.66 ? 24  ALA I N   1 
ATOM   1076 C  CA  . ALA B 1 26  ? -14.147 -18.307 -0.287  1.00 29.21 ? 24  ALA I CA  1 
ATOM   1077 C  C   . ALA B 1 26  ? -13.020 -17.268 -0.310  1.00 29.18 ? 24  ALA I C   1 
ATOM   1078 O  O   . ALA B 1 26  ? -12.022 -17.390 0.386   1.00 28.14 ? 24  ALA I O   1 
ATOM   1079 C  CB  . ALA B 1 26  ? -15.009 -18.113 0.948   1.00 29.02 ? 24  ALA I CB  1 
ATOM   1080 N  N   . SER B 1 27  ? -13.203 -16.237 -1.119  1.00 30.04 ? 25  SER I N   1 
ATOM   1081 C  CA  . SER B 1 27  ? -12.262 -15.132 -1.182  1.00 31.22 ? 25  SER I CA  1 
ATOM   1082 C  C   . SER B 1 27  ? -13.011 -13.824 -0.934  1.00 32.28 ? 25  SER I C   1 
ATOM   1083 O  O   . SER B 1 27  ? -14.167 -13.687 -1.305  1.00 32.35 ? 25  SER I O   1 
ATOM   1084 C  CB  . SER B 1 27  ? -11.565 -15.102 -2.547  1.00 31.14 ? 25  SER I CB  1 
ATOM   1085 N  N   . GLY B 1 28  ? -12.349 -12.871 -0.292  1.00 34.23 ? 26  GLY I N   1 
ATOM   1086 C  CA  . GLY B 1 28  ? -12.963 -11.585 0.028   1.00 35.56 ? 26  GLY I CA  1 
ATOM   1087 C  C   . GLY B 1 28  ? -14.023 -11.716 1.100   1.00 36.94 ? 26  GLY I C   1 
ATOM   1088 O  O   . GLY B 1 28  ? -14.644 -12.771 1.257   1.00 38.01 ? 26  GLY I O   1 
ATOM   1089 N  N   . GLY B 1 29  ? -14.223 -10.640 1.850   1.00 38.15 ? 27  GLY I N   1 
ATOM   1090 C  CA  . GLY B 1 29  ? -15.218 -10.613 2.925   1.00 38.49 ? 27  GLY I CA  1 
ATOM   1091 C  C   . GLY B 1 29  ? -14.778 -11.363 4.174   1.00 39.03 ? 27  GLY I C   1 
ATOM   1092 O  O   . GLY B 1 29  ? -13.671 -11.911 4.241   1.00 39.30 ? 27  GLY I O   1 
ATOM   1093 N  N   . SER B 1 30  ? -15.649 -11.368 5.178   1.00 39.10 ? 28  SER I N   1 
ATOM   1094 C  CA  . SER B 1 30  ? -15.403 -12.125 6.393   1.00 38.35 ? 28  SER I CA  1 
ATOM   1095 C  C   . SER B 1 30  ? -15.959 -13.525 6.190   1.00 37.44 ? 28  SER I C   1 
ATOM   1096 O  O   . SER B 1 30  ? -17.149 -13.702 5.946   1.00 37.67 ? 28  SER I O   1 
ATOM   1097 C  CB  . SER B 1 30  ? -16.065 -11.461 7.602   1.00 38.48 ? 28  SER I CB  1 
ATOM   1098 O  OG  . SER B 1 30  ? -15.621 -12.054 8.815   1.00 39.17 ? 28  SER I OG  1 
ATOM   1099 N  N   . PHE B 1 31  ? -15.079 -14.514 6.273   1.00 36.26 ? 29  PHE I N   1 
ATOM   1100 C  CA  . PHE B 1 31  ? -15.463 -15.922 6.205   1.00 34.41 ? 29  PHE I CA  1 
ATOM   1101 C  C   . PHE B 1 31  ? -16.199 -16.370 7.476   1.00 33.52 ? 29  PHE I C   1 
ATOM   1102 O  O   . PHE B 1 31  ? -17.172 -17.115 7.424   1.00 32.98 ? 29  PHE I O   1 
ATOM   1103 C  CB  . PHE B 1 31  ? -14.201 -16.767 6.024   1.00 33.80 ? 29  PHE I CB  1 
ATOM   1104 C  CG  . PHE B 1 31  ? -14.449 -18.258 6.008   1.00 31.65 ? 29  PHE I CG  1 
ATOM   1105 C  CD1 . PHE B 1 31  ? -15.119 -18.848 4.968   1.00 29.87 ? 29  PHE I CD1 1 
ATOM   1106 C  CD2 . PHE B 1 31  ? -13.978 -19.065 7.023   1.00 29.80 ? 29  PHE I CD2 1 
ATOM   1107 C  CE1 . PHE B 1 31  ? -15.325 -20.200 4.945   1.00 29.97 ? 29  PHE I CE1 1 
ATOM   1108 C  CE2 . PHE B 1 31  ? -14.183 -20.422 6.994   1.00 28.50 ? 29  PHE I CE2 1 
ATOM   1109 C  CZ  . PHE B 1 31  ? -14.852 -20.987 5.958   1.00 28.70 ? 29  PHE I CZ  1 
ATOM   1110 N  N   . SER B 1 32  ? -15.720 -15.905 8.615   1.00 32.24 ? 30  SER I N   1 
ATOM   1111 C  CA  . SER B 1 32  ? -16.118 -16.474 9.886   1.00 31.92 ? 30  SER I CA  1 
ATOM   1112 C  C   . SER B 1 32  ? -17.509 -16.101 10.343  1.00 30.93 ? 30  SER I C   1 
ATOM   1113 O  O   . SER B 1 32  ? -18.141 -16.873 11.057  1.00 30.81 ? 30  SER I O   1 
ATOM   1114 C  CB  . SER B 1 32  ? -15.112 -16.057 10.945  1.00 32.10 ? 30  SER I CB  1 
ATOM   1115 O  OG  . SER B 1 32  ? -13.822 -16.421 10.494  1.00 33.22 ? 30  SER I OG  1 
ATOM   1116 N  N   . THR B 1 33  ? -17.980 -14.929 9.926   1.00 30.10 ? 31  THR I N   1 
ATOM   1117 C  CA  . THR B 1 33  ? -19.189 -14.339 10.496  1.00 29.27 ? 31  THR I CA  1 
ATOM   1118 C  C   . THR B 1 33  ? -20.345 -14.175 9.506   1.00 29.02 ? 31  THR I C   1 
ATOM   1119 O  O   . THR B 1 33  ? -21.242 -13.354 9.730   1.00 29.42 ? 31  THR I O   1 
ATOM   1120 C  CB  . THR B 1 33  ? -18.891 -12.956 11.129  1.00 29.29 ? 31  THR I CB  1 
ATOM   1121 O  OG1 . THR B 1 33  ? -18.385 -12.056 10.138  1.00 28.92 ? 31  THR I OG1 1 
ATOM   1122 C  CG2 . THR B 1 33  ? -17.885 -13.082 12.262  1.00 29.19 ? 31  THR I CG2 1 
ATOM   1123 N  N   . TYR B 1 34  ? -20.332 -14.944 8.419   1.00 27.99 ? 32  TYR I N   1 
ATOM   1124 C  CA  . TYR B 1 34  ? -21.441 -14.927 7.460   1.00 27.52 ? 32  TYR I CA  1 
ATOM   1125 C  C   . TYR B 1 34  ? -21.912 -16.343 7.145   1.00 26.85 ? 32  TYR I C   1 
ATOM   1126 O  O   . TYR B 1 34  ? -21.115 -17.279 7.072   1.00 26.09 ? 32  TYR I O   1 
ATOM   1127 C  CB  . TYR B 1 34  ? -21.057 -14.161 6.183   1.00 27.52 ? 32  TYR I CB  1 
ATOM   1128 C  CG  . TYR B 1 34  ? -20.938 -12.664 6.417   1.00 29.06 ? 32  TYR I CG  1 
ATOM   1129 C  CD1 . TYR B 1 34  ? -19.742 -12.098 6.837   1.00 30.22 ? 32  TYR I CD1 1 
ATOM   1130 C  CD2 . TYR B 1 34  ? -22.027 -11.822 6.249   1.00 30.20 ? 32  TYR I CD2 1 
ATOM   1131 C  CE1 . TYR B 1 34  ? -19.628 -10.744 7.066   1.00 28.54 ? 32  TYR I CE1 1 
ATOM   1132 C  CE2 . TYR B 1 34  ? -21.919 -10.463 6.483   1.00 30.49 ? 32  TYR I CE2 1 
ATOM   1133 C  CZ  . TYR B 1 34  ? -20.714 -9.932  6.892   1.00 29.00 ? 32  TYR I CZ  1 
ATOM   1134 O  OH  . TYR B 1 34  ? -20.592 -8.580  7.127   1.00 29.75 ? 32  TYR I OH  1 
ATOM   1135 N  N   . ALA B 1 35  ? -23.220 -16.491 6.976   1.00 26.85 ? 33  ALA I N   1 
ATOM   1136 C  CA  . ALA B 1 35  ? -23.834 -17.818 6.823   1.00 26.84 ? 33  ALA I CA  1 
ATOM   1137 C  C   . ALA B 1 35  ? -23.542 -18.461 5.470   1.00 26.72 ? 33  ALA I C   1 
ATOM   1138 O  O   . ALA B 1 35  ? -23.743 -17.861 4.420   1.00 26.33 ? 33  ALA I O   1 
ATOM   1139 C  CB  . ALA B 1 35  ? -25.339 -17.756 7.070   1.00 26.30 ? 33  ALA I CB  1 
ATOM   1140 N  N   . LEU B 1 36  ? -23.072 -19.700 5.525   1.00 27.24 ? 34  LEU I N   1 
ATOM   1141 C  CA  . LEU B 1 36  ? -22.754 -20.474 4.333   1.00 28.00 ? 34  LEU I CA  1 
ATOM   1142 C  C   . LEU B 1 36  ? -23.654 -21.718 4.217   1.00 27.42 ? 34  LEU I C   1 
ATOM   1143 O  O   . LEU B 1 36  ? -23.868 -22.429 5.194   1.00 27.03 ? 34  LEU I O   1 
ATOM   1144 C  CB  . LEU B 1 36  ? -21.288 -20.880 4.399   1.00 29.02 ? 34  LEU I CB  1 
ATOM   1145 C  CG  . LEU B 1 36  ? -20.703 -21.363 3.094   1.00 30.68 ? 34  LEU I CG  1 
ATOM   1146 C  CD1 . LEU B 1 36  ? -19.272 -20.867 2.969   1.00 33.93 ? 34  LEU I CD1 1 
ATOM   1147 C  CD2 . LEU B 1 36  ? -20.807 -22.887 3.060   1.00 33.66 ? 34  LEU I CD2 1 
ATOM   1148 N  N   . SER B 1 37  ? -24.185 -21.966 3.026   1.00 27.15 ? 35  SER I N   1 
ATOM   1149 C  CA  . SER B 1 37  ? -25.165 -23.035 2.842   1.00 27.64 ? 35  SER I CA  1 
ATOM   1150 C  C   . SER B 1 37  ? -24.875 -23.935 1.661   1.00 26.92 ? 35  SER I C   1 
ATOM   1151 O  O   . SER B 1 37  ? -24.181 -23.545 0.721   1.00 26.48 ? 35  SER I O   1 
ATOM   1152 C  CB  . SER B 1 37  ? -26.574 -22.467 2.660   1.00 28.43 ? 35  SER I CB  1 
ATOM   1153 O  OG  . SER B 1 37  ? -27.228 -22.303 3.906   1.00 30.54 ? 35  SER I OG  1 
ATOM   1154 N  N   . TRP B 1 38  ? -25.442 -25.141 1.723   1.00 25.92 ? 36  TRP I N   1 
ATOM   1155 C  CA  . TRP B 1 38  ? -25.350 -26.096 0.639   1.00 24.97 ? 36  TRP I CA  1 
ATOM   1156 C  C   . TRP B 1 38  ? -26.730 -26.370 0.082   1.00 25.13 ? 36  TRP I C   1 
ATOM   1157 O  O   . TRP B 1 38  ? -27.654 -26.712 0.820   1.00 26.20 ? 36  TRP I O   1 
ATOM   1158 C  CB  . TRP B 1 38  ? -24.700 -27.386 1.112   1.00 24.42 ? 36  TRP I CB  1 
ATOM   1159 C  CG  . TRP B 1 38  ? -23.253 -27.220 1.384   1.00 22.14 ? 36  TRP I CG  1 
ATOM   1160 C  CD1 . TRP B 1 38  ? -22.682 -26.955 2.573   1.00 23.42 ? 36  TRP I CD1 1 
ATOM   1161 C  CD2 . TRP B 1 38  ? -22.194 -27.289 0.436   1.00 19.44 ? 36  TRP I CD2 1 
ATOM   1162 N  NE1 . TRP B 1 38  ? -21.320 -26.857 2.437   1.00 22.06 ? 36  TRP I NE1 1 
ATOM   1163 C  CE2 . TRP B 1 38  ? -21.001 -27.060 1.126   1.00 19.95 ? 36  TRP I CE2 1 
ATOM   1164 C  CE3 . TRP B 1 38  ? -22.143 -27.510 -0.936  1.00 21.23 ? 36  TRP I CE3 1 
ATOM   1165 C  CZ2 . TRP B 1 38  ? -19.776 -27.054 0.502   1.00 20.17 ? 36  TRP I CZ2 1 
ATOM   1166 C  CZ3 . TRP B 1 38  ? -20.933 -27.504 -1.554  1.00 21.14 ? 36  TRP I CZ3 1 
ATOM   1167 C  CH2 . TRP B 1 38  ? -19.761 -27.283 -0.839  1.00 22.10 ? 36  TRP I CH2 1 
ATOM   1168 N  N   . VAL B 1 39  ? -26.850 -26.204 -1.228  1.00 24.54 ? 37  VAL I N   1 
ATOM   1169 C  CA  . VAL B 1 39  ? -28.088 -26.394 -1.941  1.00 23.65 ? 37  VAL I CA  1 
ATOM   1170 C  C   . VAL B 1 39  ? -27.868 -27.342 -3.088  1.00 24.39 ? 37  VAL I C   1 
ATOM   1171 O  O   . VAL B 1 39  ? -26.923 -27.183 -3.847  1.00 23.62 ? 37  VAL I O   1 
ATOM   1172 C  CB  . VAL B 1 39  ? -28.551 -25.088 -2.553  1.00 23.91 ? 37  VAL I CB  1 
ATOM   1173 C  CG1 . VAL B 1 39  ? -29.559 -25.355 -3.665  1.00 21.23 ? 37  VAL I CG1 1 
ATOM   1174 C  CG2 . VAL B 1 39  ? -29.115 -24.161 -1.470  1.00 24.57 ? 37  VAL I CG2 1 
ATOM   1175 N  N   . ARG B 1 40  ? -28.756 -28.318 -3.238  1.00 25.55 ? 38  ARG I N   1 
ATOM   1176 C  CA  . ARG B 1 40  ? -28.584 -29.314 -4.277  1.00 25.81 ? 38  ARG I CA  1 
ATOM   1177 C  C   . ARG B 1 40  ? -29.670 -29.252 -5.325  1.00 25.38 ? 38  ARG I C   1 
ATOM   1178 O  O   . ARG B 1 40  ? -30.787 -28.801 -5.054  1.00 25.52 ? 38  ARG I O   1 
ATOM   1179 C  CB  . ARG B 1 40  ? -28.512 -30.709 -3.654  1.00 26.88 ? 38  ARG I CB  1 
ATOM   1180 C  CG  . ARG B 1 40  ? -29.739 -31.579 -3.810  1.00 27.42 ? 38  ARG I CG  1 
ATOM   1181 C  CD  . ARG B 1 40  ? -29.319 -33.019 -3.683  1.00 28.05 ? 38  ARG I CD  1 
ATOM   1182 N  NE  . ARG B 1 40  ? -30.444 -33.922 -3.473  1.00 28.75 ? 38  ARG I NE  1 
ATOM   1183 C  CZ  . ARG B 1 40  ? -30.310 -35.184 -3.082  1.00 29.77 ? 38  ARG I CZ  1 
ATOM   1184 N  NH1 . ARG B 1 40  ? -31.380 -35.946 -2.899  1.00 30.91 ? 38  ARG I NH1 1 
ATOM   1185 N  NH2 . ARG B 1 40  ? -29.102 -35.682 -2.852  1.00 30.25 ? 38  ARG I NH2 1 
ATOM   1186 N  N   . GLN B 1 41  ? -29.311 -29.716 -6.518  1.00 24.93 ? 39  GLN I N   1 
ATOM   1187 C  CA  . GLN B 1 41  ? -30.197 -29.741 -7.675  1.00 25.31 ? 39  GLN I CA  1 
ATOM   1188 C  C   . GLN B 1 41  ? -29.925 -30.976 -8.551  1.00 26.03 ? 39  GLN I C   1 
ATOM   1189 O  O   . GLN B 1 41  ? -28.812 -31.157 -9.061  1.00 25.36 ? 39  GLN I O   1 
ATOM   1190 C  CB  . GLN B 1 41  ? -29.980 -28.489 -8.509  1.00 25.30 ? 39  GLN I CB  1 
ATOM   1191 C  CG  . GLN B 1 41  ? -30.917 -28.352 -9.675  1.00 26.14 ? 39  GLN I CG  1 
ATOM   1192 C  CD  . GLN B 1 41  ? -30.924 -26.941 -10.228 1.00 27.28 ? 39  GLN I CD  1 
ATOM   1193 O  OE1 . GLN B 1 41  ? -29.867 -26.357 -10.456 1.00 27.58 ? 39  GLN I OE1 1 
ATOM   1194 N  NE2 . GLN B 1 41  ? -32.118 -26.380 -10.430 1.00 27.85 ? 39  GLN I NE2 1 
ATOM   1195 N  N   . ALA B 1 42  ? -30.942 -31.823 -8.718  1.00 26.46 ? 40  ALA I N   1 
ATOM   1196 C  CA  . ALA B 1 42  ? -30.826 -33.014 -9.563  1.00 26.62 ? 40  ALA I CA  1 
ATOM   1197 C  C   . ALA B 1 42  ? -31.174 -32.676 -11.008 1.00 26.80 ? 40  ALA I C   1 
ATOM   1198 O  O   . ALA B 1 42  ? -31.951 -31.772 -11.272 1.00 27.12 ? 40  ALA I O   1 
ATOM   1199 C  CB  . ALA B 1 42  ? -31.712 -34.142 -9.038  1.00 26.30 ? 40  ALA I CB  1 
ATOM   1200 N  N   . PRO B 1 43  ? -30.580 -33.391 -11.960 1.00 27.65 ? 41  PRO I N   1 
ATOM   1201 C  CA  . PRO B 1 43  ? -30.863 -33.102 -13.363 1.00 27.37 ? 41  PRO I CA  1 
ATOM   1202 C  C   . PRO B 1 43  ? -32.339 -32.860 -13.668 1.00 26.76 ? 41  PRO I C   1 
ATOM   1203 O  O   . PRO B 1 43  ? -33.179 -33.705 -13.397 1.00 26.57 ? 41  PRO I O   1 
ATOM   1204 C  CB  . PRO B 1 43  ? -30.352 -34.354 -14.073 1.00 27.18 ? 41  PRO I CB  1 
ATOM   1205 C  CG  . PRO B 1 43  ? -29.177 -34.762 -13.239 1.00 27.73 ? 41  PRO I CG  1 
ATOM   1206 C  CD  . PRO B 1 43  ? -29.590 -34.474 -11.812 1.00 27.83 ? 41  PRO I CD  1 
ATOM   1207 N  N   . GLY B 1 44  ? -32.630 -31.698 -14.239 1.00 27.05 ? 42  GLY I N   1 
ATOM   1208 C  CA  . GLY B 1 44  ? -33.996 -31.316 -14.615 1.00 26.82 ? 42  GLY I CA  1 
ATOM   1209 C  C   . GLY B 1 44  ? -34.981 -31.251 -13.455 1.00 26.51 ? 42  GLY I C   1 
ATOM   1210 O  O   . GLY B 1 44  ? -36.181 -31.468 -13.645 1.00 26.33 ? 42  GLY I O   1 
ATOM   1211 N  N   . ARG B 1 45  ? -34.474 -30.956 -12.256 1.00 26.22 ? 43  ARG I N   1 
ATOM   1212 C  CA  . ARG B 1 45  ? -35.307 -30.873 -11.046 1.00 25.84 ? 43  ARG I CA  1 
ATOM   1213 C  C   . ARG B 1 45  ? -34.992 -29.585 -10.309 1.00 25.66 ? 43  ARG I C   1 
ATOM   1214 O  O   . ARG B 1 45  ? -34.095 -28.837 -10.716 1.00 26.43 ? 43  ARG I O   1 
ATOM   1215 C  CB  . ARG B 1 45  ? -35.081 -32.078 -10.119 1.00 25.91 ? 43  ARG I CB  1 
ATOM   1216 C  CG  . ARG B 1 45  ? -35.491 -33.421 -10.715 1.00 26.25 ? 43  ARG I CG  1 
ATOM   1217 C  CD  . ARG B 1 45  ? -35.825 -34.423 -9.633  1.00 28.74 ? 43  ARG I CD  1 
ATOM   1218 N  N   . GLY B 1 46  ? -35.705 -29.342 -9.212  1.00 24.68 ? 44  GLY I N   1 
ATOM   1219 C  CA  . GLY B 1 46  ? -35.621 -28.071 -8.505  1.00 24.38 ? 44  GLY I CA  1 
ATOM   1220 C  C   . GLY B 1 46  ? -34.554 -28.017 -7.431  1.00 24.43 ? 44  GLY I C   1 
ATOM   1221 O  O   . GLY B 1 46  ? -33.913 -29.010 -7.138  1.00 24.13 ? 44  GLY I O   1 
ATOM   1222 N  N   . LEU B 1 47  ? -34.382 -26.832 -6.844  1.00 24.91 ? 45  LEU I N   1 
ATOM   1223 C  CA  . LEU B 1 47  ? -33.401 -26.592 -5.792  1.00 24.82 ? 45  LEU I CA  1 
ATOM   1224 C  C   . LEU B 1 47  ? -33.857 -27.124 -4.432  1.00 24.94 ? 45  LEU I C   1 
ATOM   1225 O  O   . LEU B 1 47  ? -35.039 -27.098 -4.101  1.00 23.56 ? 45  LEU I O   1 
ATOM   1226 C  CB  . LEU B 1 47  ? -33.136 -25.092 -5.659  1.00 25.12 ? 45  LEU I CB  1 
ATOM   1227 C  CG  . LEU B 1 47  ? -32.489 -24.341 -6.840  1.00 25.93 ? 45  LEU I CG  1 
ATOM   1228 C  CD1 . LEU B 1 47  ? -32.596 -22.828 -6.598  1.00 25.64 ? 45  LEU I CD1 1 
ATOM   1229 C  CD2 . LEU B 1 47  ? -31.036 -24.756 -7.109  1.00 20.68 ? 45  LEU I CD2 1 
ATOM   1230 N  N   . GLU B 1 48  ? -32.890 -27.584 -3.642  1.00 25.77 ? 46  GLU I N   1 
ATOM   1231 C  CA  . GLU B 1 48  ? -33.152 -28.178 -2.331  1.00 26.21 ? 46  GLU I CA  1 
ATOM   1232 C  C   . GLU B 1 48  ? -32.138 -27.687 -1.315  1.00 25.42 ? 46  GLU I C   1 
ATOM   1233 O  O   . GLU B 1 48  ? -30.962 -27.942 -1.467  1.00 25.43 ? 46  GLU I O   1 
ATOM   1234 C  CB  . GLU B 1 48  ? -33.033 -29.707 -2.406  1.00 26.73 ? 46  GLU I CB  1 
ATOM   1235 C  CG  . GLU B 1 48  ? -34.161 -30.415 -3.133  1.00 29.12 ? 46  GLU I CG  1 
ATOM   1236 C  CD  . GLU B 1 48  ? -33.810 -31.853 -3.457  1.00 33.76 ? 46  GLU I CD  1 
ATOM   1237 O  OE1 . GLU B 1 48  ? -33.067 -32.070 -4.435  1.00 36.52 ? 46  GLU I OE1 1 
ATOM   1238 O  OE2 . GLU B 1 48  ? -34.271 -32.768 -2.737  1.00 37.79 ? 46  GLU I OE2 1 
ATOM   1239 N  N   . TRP B 1 49  ? -32.588 -27.022 -0.263  1.00 25.34 ? 47  TRP I N   1 
ATOM   1240 C  CA  . TRP B 1 49  ? -31.674 -26.567 0.780   1.00 25.18 ? 47  TRP I CA  1 
ATOM   1241 C  C   . TRP B 1 49  ? -31.281 -27.776 1.600   1.00 25.18 ? 47  TRP I C   1 
ATOM   1242 O  O   . TRP B 1 49  ? -32.147 -28.521 2.051   1.00 25.62 ? 47  TRP I O   1 
ATOM   1243 C  CB  . TRP B 1 49  ? -32.337 -25.514 1.677   1.00 25.37 ? 47  TRP I CB  1 
ATOM   1244 C  CG  . TRP B 1 49  ? -31.456 -25.016 2.787   1.00 24.68 ? 47  TRP I CG  1 
ATOM   1245 C  CD1 . TRP B 1 49  ? -30.534 -24.020 2.707   1.00 24.71 ? 47  TRP I CD1 1 
ATOM   1246 C  CD2 . TRP B 1 49  ? -31.420 -25.492 4.139   1.00 23.96 ? 47  TRP I CD2 1 
ATOM   1247 N  NE1 . TRP B 1 49  ? -29.916 -23.847 3.923   1.00 24.97 ? 47  TRP I NE1 1 
ATOM   1248 C  CE2 . TRP B 1 49  ? -30.434 -24.742 4.819   1.00 23.97 ? 47  TRP I CE2 1 
ATOM   1249 C  CE3 . TRP B 1 49  ? -32.105 -26.495 4.834   1.00 24.96 ? 47  TRP I CE3 1 
ATOM   1250 C  CZ2 . TRP B 1 49  ? -30.129 -24.945 6.167   1.00 23.74 ? 47  TRP I CZ2 1 
ATOM   1251 C  CZ3 . TRP B 1 49  ? -31.803 -26.702 6.178   1.00 25.08 ? 47  TRP I CZ3 1 
ATOM   1252 C  CH2 . TRP B 1 49  ? -30.822 -25.924 6.829   1.00 25.51 ? 47  TRP I CH2 1 
ATOM   1253 N  N   . MET B 1 50  ? -29.980 -27.953 1.808   1.00 24.61 ? 48  MET I N   1 
ATOM   1254 C  CA  . MET B 1 50  ? -29.460 -29.132 2.481   1.00 24.15 ? 48  MET I CA  1 
ATOM   1255 C  C   . MET B 1 50  ? -29.122 -28.840 3.931   1.00 24.51 ? 48  MET I C   1 
ATOM   1256 O  O   . MET B 1 50  ? -29.560 -29.554 4.852   1.00 24.24 ? 48  MET I O   1 
ATOM   1257 C  CB  . MET B 1 50  ? -28.209 -29.631 1.757   1.00 24.34 ? 48  MET I CB  1 
ATOM   1258 C  CG  . MET B 1 50  ? -28.499 -30.169 0.348   1.00 24.98 ? 48  MET I CG  1 
ATOM   1259 S  SD  . MET B 1 50  ? -27.169 -31.134 -0.390  1.00 23.99 ? 48  MET I SD  1 
ATOM   1260 C  CE  . MET B 1 50  ? -27.252 -32.608 0.604   1.00 25.21 ? 48  MET I CE  1 
ATOM   1261 N  N   . GLY B 1 51  ? -28.319 -27.794 4.125   1.00 24.29 ? 49  GLY I N   1 
ATOM   1262 C  CA  . GLY B 1 51  ? -27.847 -27.413 5.448   1.00 23.40 ? 49  GLY I CA  1 
ATOM   1263 C  C   . GLY B 1 51  ? -26.858 -26.288 5.315   1.00 23.29 ? 49  GLY I C   1 
ATOM   1264 O  O   . GLY B 1 51  ? -26.550 -25.862 4.208   1.00 23.83 ? 49  GLY I O   1 
ATOM   1265 N  N   . GLY B 1 52  ? -26.358 -25.798 6.437   1.00 23.17 ? 50  GLY I N   1 
ATOM   1266 C  CA  . GLY B 1 52  ? -25.407 -24.694 6.410   1.00 23.75 ? 50  GLY I CA  1 
ATOM   1267 C  C   . GLY B 1 52  ? -24.517 -24.607 7.644   1.00 24.01 ? 50  GLY I C   1 
ATOM   1268 O  O   . GLY B 1 52  ? -24.719 -25.336 8.626   1.00 24.96 ? 50  GLY I O   1 
ATOM   1269 N  N   . VAL B 1 53  ? -23.536 -23.711 7.589   1.00 23.04 ? 51  VAL I N   1 
ATOM   1270 C  CA  . VAL B 1 53  ? -22.582 -23.556 8.664   1.00 23.27 ? 51  VAL I CA  1 
ATOM   1271 C  C   . VAL B 1 53  ? -22.159 -22.095 8.809   1.00 23.73 ? 51  VAL I C   1 
ATOM   1272 O  O   . VAL B 1 53  ? -21.836 -21.435 7.824   1.00 24.27 ? 51  VAL I O   1 
ATOM   1273 C  CB  . VAL B 1 53  ? -21.328 -24.372 8.381   1.00 23.90 ? 51  VAL I CB  1 
ATOM   1274 C  CG1 . VAL B 1 53  ? -20.604 -23.829 7.119   1.00 23.45 ? 51  VAL I CG1 1 
ATOM   1275 C  CG2 . VAL B 1 53  ? -20.411 -24.372 9.581   1.00 22.96 ? 51  VAL I CG2 1 
ATOM   1276 N  N   . ILE B 1 54  ? -22.197 -21.598 10.041  1.00 22.89 ? 52  ILE I N   1 
ATOM   1277 C  CA  . ILE B 1 54  ? -21.587 -20.333 10.400  1.00 22.20 ? 52  ILE I CA  1 
ATOM   1278 C  C   . ILE B 1 54  ? -20.245 -20.720 11.029  1.00 21.82 ? 52  ILE I C   1 
ATOM   1279 O  O   . ILE B 1 54  ? -20.235 -21.340 12.090  1.00 22.35 ? 52  ILE I O   1 
ATOM   1280 C  CB  . ILE B 1 54  ? -22.478 -19.562 11.411  1.00 22.55 ? 52  ILE I CB  1 
ATOM   1281 C  CG1 . ILE B 1 54  ? -23.879 -19.330 10.819  1.00 23.04 ? 52  ILE I CG1 1 
ATOM   1282 C  CG2 . ILE B 1 54  ? -21.831 -18.234 11.812  1.00 22.33 ? 52  ILE I CG2 1 
ATOM   1283 C  CD1 . ILE B 1 54  ? -24.932 -18.832 11.819  1.00 21.20 ? 52  ILE I CD1 1 
ATOM   1284 N  N   . PRO B 1 55  ? -19.120 -20.442 10.343  1.00 20.93 ? 53  PRO I N   1 
ATOM   1285 C  CA  . PRO B 1 55  ? -17.796 -20.868 10.813  1.00 20.05 ? 53  PRO I CA  1 
ATOM   1286 C  C   . PRO B 1 55  ? -17.424 -20.463 12.231  1.00 20.76 ? 53  PRO I C   1 
ATOM   1287 O  O   . PRO B 1 55  ? -16.907 -21.292 12.980  1.00 20.21 ? 53  PRO I O   1 
ATOM   1288 C  CB  . PRO B 1 55  ? -16.834 -20.229 9.809   1.00 19.73 ? 53  PRO I CB  1 
ATOM   1289 C  CG  . PRO B 1 55  ? -17.621 -20.118 8.538   1.00 20.11 ? 53  PRO I CG  1 
ATOM   1290 C  CD  . PRO B 1 55  ? -19.039 -19.777 9.026   1.00 21.63 ? 53  PRO I CD  1 
ATOM   1291 N  N   . LEU B 1 56  ? -17.666 -19.219 12.626  1.00 21.98 ? 54  LEU I N   1 
ATOM   1292 C  CA  . LEU B 1 56  ? -17.377 -18.864 14.013  1.00 22.10 ? 54  LEU I CA  1 
ATOM   1293 C  C   . LEU B 1 56  ? -18.166 -19.835 14.884  1.00 23.10 ? 54  LEU I C   1 
ATOM   1294 O  O   . LEU B 1 56  ? -19.405 -19.845 14.852  1.00 22.17 ? 54  LEU I O   1 
ATOM   1295 C  CB  . LEU B 1 56  ? -17.738 -17.415 14.350  1.00 21.85 ? 54  LEU I CB  1 
ATOM   1296 C  CG  . LEU B 1 56  ? -17.285 -16.977 15.754  1.00 21.69 ? 54  LEU I CG  1 
ATOM   1297 C  CD1 . LEU B 1 56  ? -15.772 -17.140 15.914  1.00 20.72 ? 54  LEU I CD1 1 
ATOM   1298 C  CD2 . LEU B 1 56  ? -17.683 -15.545 16.062  1.00 21.63 ? 54  LEU I CD2 1 
ATOM   1299 N  N   . LEU B 1 57  ? -17.430 -20.666 15.629  1.00 24.51 ? 55  LEU I N   1 
ATOM   1300 C  CA  . LEU B 1 57  ? -17.998 -21.710 16.513  1.00 25.04 ? 55  LEU I CA  1 
ATOM   1301 C  C   . LEU B 1 57  ? -18.601 -22.921 15.782  1.00 25.40 ? 55  LEU I C   1 
ATOM   1302 O  O   . LEU B 1 57  ? -19.162 -23.802 16.420  1.00 26.70 ? 55  LEU I O   1 
ATOM   1303 C  CB  . LEU B 1 57  ? -19.044 -21.122 17.458  1.00 24.31 ? 55  LEU I CB  1 
ATOM   1304 C  CG  . LEU B 1 57  ? -18.539 -19.972 18.320  1.00 24.09 ? 55  LEU I CG  1 
ATOM   1305 C  CD1 . LEU B 1 57  ? -19.648 -19.495 19.229  1.00 22.77 ? 55  LEU I CD1 1 
ATOM   1306 C  CD2 . LEU B 1 57  ? -17.336 -20.405 19.135  1.00 25.04 ? 55  LEU I CD2 1 
ATOM   1307 N  N   . THR B 1 58  ? -18.477 -22.973 14.462  1.00 25.50 ? 56  THR I N   1 
ATOM   1308 C  CA  . THR B 1 58  ? -19.048 -24.075 13.677  1.00 25.82 ? 56  THR I CA  1 
ATOM   1309 C  C   . THR B 1 58  ? -20.483 -24.354 14.129  1.00 25.65 ? 56  THR I C   1 
ATOM   1310 O  O   . THR B 1 58  ? -20.792 -25.443 14.633  1.00 26.06 ? 56  THR I O   1 
ATOM   1311 C  CB  . THR B 1 58  ? -18.198 -25.380 13.822  1.00 25.99 ? 56  THR I CB  1 
ATOM   1312 O  OG1 . THR B 1 58  ? -16.809 -25.051 13.802  1.00 27.21 ? 56  THR I OG1 1 
ATOM   1313 C  CG2 . THR B 1 58  ? -18.481 -26.367 12.697  1.00 25.67 ? 56  THR I CG2 1 
ATOM   1314 N  N   . ILE B 1 59  ? -21.346 -23.352 13.985  1.00 24.92 ? 57  ILE I N   1 
ATOM   1315 C  CA  . ILE B 1 59  ? -22.770 -23.528 14.261  1.00 24.03 ? 57  ILE I CA  1 
ATOM   1316 C  C   . ILE B 1 59  ? -23.437 -24.109 13.021  1.00 23.87 ? 57  ILE I C   1 
ATOM   1317 O  O   . ILE B 1 59  ? -23.575 -23.429 12.003  1.00 23.68 ? 57  ILE I O   1 
ATOM   1318 C  CB  . ILE B 1 59  ? -23.461 -22.206 14.586  1.00 24.03 ? 57  ILE I CB  1 
ATOM   1319 C  CG1 . ILE B 1 59  ? -22.765 -21.496 15.746  1.00 24.25 ? 57  ILE I CG1 1 
ATOM   1320 C  CG2 . ILE B 1 59  ? -24.927 -22.459 14.914  1.00 23.31 ? 57  ILE I CG2 1 
ATOM   1321 C  CD1 . ILE B 1 59  ? -23.006 -20.004 15.773  1.00 23.07 ? 57  ILE I CD1 1 
ATOM   1322 N  N   . THR B 1 60  ? -23.834 -25.368 13.086  1.00 23.62 ? 58  THR I N   1 
ATOM   1323 C  CA  . THR B 1 60  ? -24.352 -26.021 11.895  1.00 24.15 ? 58  THR I CA  1 
ATOM   1324 C  C   . THR B 1 60  ? -25.864 -26.097 11.967  1.00 24.51 ? 58  THR I C   1 
ATOM   1325 O  O   . THR B 1 60  ? -26.455 -25.877 13.016  1.00 23.98 ? 58  THR I O   1 
ATOM   1326 C  CB  . THR B 1 60  ? -23.742 -27.439 11.683  1.00 24.75 ? 58  THR I CB  1 
ATOM   1327 O  OG1 . THR B 1 60  ? -24.023 -28.273 12.818  1.00 25.27 ? 58  THR I OG1 1 
ATOM   1328 C  CG2 . THR B 1 60  ? -22.225 -27.354 11.467  1.00 23.31 ? 58  THR I CG2 1 
ATOM   1329 N  N   . ASN B 1 61  ? -26.476 -26.409 10.832  1.00 24.94 ? 59  ASN I N   1 
ATOM   1330 C  CA  . ASN B 1 61  ? -27.929 -26.467 10.713  1.00 25.07 ? 59  ASN I CA  1 
ATOM   1331 C  C   . ASN B 1 61  ? -28.302 -27.389 9.549   1.00 24.75 ? 59  ASN I C   1 
ATOM   1332 O  O   . ASN B 1 61  ? -28.113 -27.048 8.392   1.00 25.70 ? 59  ASN I O   1 
ATOM   1333 C  CB  . ASN B 1 61  ? -28.483 -25.055 10.499  1.00 25.24 ? 59  ASN I CB  1 
ATOM   1334 C  CG  . ASN B 1 61  ? -29.948 -25.041 10.044  1.00 26.82 ? 59  ASN I CG  1 
ATOM   1335 O  OD1 . ASN B 1 61  ? -30.748 -25.937 10.374  1.00 27.58 ? 59  ASN I OD1 1 
ATOM   1336 N  ND2 . ASN B 1 61  ? -30.308 -24.001 9.298   1.00 25.64 ? 59  ASN I ND2 1 
ATOM   1337 N  N   . TYR B 1 62  ? -28.816 -28.567 9.863   1.00 24.28 ? 60  TYR I N   1 
ATOM   1338 C  CA  . TYR B 1 62  ? -29.079 -29.577 8.857   1.00 23.39 ? 60  TYR I CA  1 
ATOM   1339 C  C   . TYR B 1 62  ? -30.553 -29.686 8.572   1.00 23.08 ? 60  TYR I C   1 
ATOM   1340 O  O   . TYR B 1 62  ? -31.375 -29.566 9.477   1.00 22.84 ? 60  TYR I O   1 
ATOM   1341 C  CB  . TYR B 1 62  ? -28.576 -30.932 9.327   1.00 23.01 ? 60  TYR I CB  1 
ATOM   1342 C  CG  . TYR B 1 62  ? -27.078 -31.015 9.476   1.00 24.19 ? 60  TYR I CG  1 
ATOM   1343 C  CD1 . TYR B 1 62  ? -26.483 -30.993 10.727  1.00 23.82 ? 60  TYR I CD1 1 
ATOM   1344 C  CD2 . TYR B 1 62  ? -26.256 -31.140 8.363   1.00 25.15 ? 60  TYR I CD2 1 
ATOM   1345 C  CE1 . TYR B 1 62  ? -25.121 -31.086 10.866  1.00 25.13 ? 60  TYR I CE1 1 
ATOM   1346 C  CE2 . TYR B 1 62  ? -24.887 -31.214 8.493   1.00 25.64 ? 60  TYR I CE2 1 
ATOM   1347 C  CZ  . TYR B 1 62  ? -24.322 -31.190 9.747   1.00 26.06 ? 60  TYR I CZ  1 
ATOM   1348 O  OH  . TYR B 1 62  ? -22.945 -31.276 9.881   1.00 28.46 ? 60  TYR I OH  1 
ATOM   1349 N  N   . ALA B 1 63  ? -30.885 -29.913 7.306   1.00 23.23 ? 61  ALA I N   1 
ATOM   1350 C  CA  . ALA B 1 63  ? -32.244 -30.263 6.931   1.00 23.58 ? 61  ALA I CA  1 
ATOM   1351 C  C   . ALA B 1 63  ? -32.412 -31.715 7.319   1.00 24.37 ? 61  ALA I C   1 
ATOM   1352 O  O   . ALA B 1 63  ? -31.601 -32.543 6.937   1.00 24.31 ? 61  ALA I O   1 
ATOM   1353 C  CB  . ALA B 1 63  ? -32.455 -30.085 5.437   1.00 23.27 ? 61  ALA I CB  1 
ATOM   1354 N  N   . PRO B 1 64  ? -33.449 -32.033 8.099   1.00 26.05 ? 62  PRO I N   1 
ATOM   1355 C  CA  . PRO B 1 64  ? -33.763 -33.414 8.497   1.00 27.23 ? 62  PRO I CA  1 
ATOM   1356 C  C   . PRO B 1 64  ? -33.799 -34.418 7.341   1.00 28.55 ? 62  PRO I C   1 
ATOM   1357 O  O   . PRO B 1 64  ? -33.371 -35.554 7.503   1.00 28.32 ? 62  PRO I O   1 
ATOM   1358 C  CB  . PRO B 1 64  ? -35.154 -33.280 9.119   1.00 27.04 ? 62  PRO I CB  1 
ATOM   1359 C  CG  . PRO B 1 64  ? -35.176 -31.885 9.664   1.00 26.30 ? 62  PRO I CG  1 
ATOM   1360 C  CD  . PRO B 1 64  ? -34.396 -31.065 8.678   1.00 26.00 ? 62  PRO I CD  1 
ATOM   1361 N  N   . ARG B 1 65  ? -34.301 -33.994 6.185   1.00 30.46 ? 63  ARG I N   1 
ATOM   1362 C  CA  . ARG B 1 65  ? -34.334 -34.842 4.992   1.00 31.82 ? 63  ARG I CA  1 
ATOM   1363 C  C   . ARG B 1 65  ? -32.937 -35.385 4.639   1.00 32.59 ? 63  ARG I C   1 
ATOM   1364 O  O   . ARG B 1 65  ? -32.807 -36.402 3.966   1.00 32.71 ? 63  ARG I O   1 
ATOM   1365 C  CB  . ARG B 1 65  ? -34.930 -34.040 3.827   1.00 32.43 ? 63  ARG I CB  1 
ATOM   1366 C  CG  . ARG B 1 65  ? -34.880 -34.708 2.468   1.00 34.10 ? 63  ARG I CG  1 
ATOM   1367 C  CD  . ARG B 1 65  ? -35.575 -33.855 1.409   1.00 36.94 ? 63  ARG I CD  1 
ATOM   1368 N  NE  . ARG B 1 65  ? -35.137 -34.209 0.054   1.00 38.62 ? 63  ARG I NE  1 
ATOM   1369 N  N   . PHE B 1 66  ? -31.896 -34.701 5.096   1.00 33.90 ? 64  PHE I N   1 
ATOM   1370 C  CA  . PHE B 1 66  ? -30.516 -35.137 4.867   1.00 34.75 ? 64  PHE I CA  1 
ATOM   1371 C  C   . PHE B 1 66  ? -29.769 -35.460 6.167   1.00 35.91 ? 64  PHE I C   1 
ATOM   1372 O  O   . PHE B 1 66  ? -28.712 -36.071 6.146   1.00 36.41 ? 64  PHE I O   1 
ATOM   1373 C  CB  . PHE B 1 66  ? -29.734 -34.051 4.125   1.00 34.83 ? 64  PHE I CB  1 
ATOM   1374 C  CG  . PHE B 1 66  ? -30.291 -33.701 2.778   1.00 34.42 ? 64  PHE I CG  1 
ATOM   1375 C  CD1 . PHE B 1 66  ? -31.061 -32.567 2.605   1.00 34.24 ? 64  PHE I CD1 1 
ATOM   1376 C  CD2 . PHE B 1 66  ? -30.029 -34.495 1.678   1.00 35.14 ? 64  PHE I CD2 1 
ATOM   1377 C  CE1 . PHE B 1 66  ? -31.569 -32.238 1.360   1.00 34.14 ? 64  PHE I CE1 1 
ATOM   1378 C  CE2 . PHE B 1 66  ? -30.541 -34.164 0.420   1.00 34.53 ? 64  PHE I CE2 1 
ATOM   1379 C  CZ  . PHE B 1 66  ? -31.307 -33.038 0.267   1.00 33.23 ? 64  PHE I CZ  1 
ATOM   1380 N  N   . GLN B 1 67  ? -30.288 -35.026 7.303   1.00 37.58 ? 65  GLN I N   1 
ATOM   1381 C  CA  . GLN B 1 67  ? -29.640 -35.322 8.566   1.00 38.64 ? 65  GLN I CA  1 
ATOM   1382 C  C   . GLN B 1 67  ? -29.205 -36.783 8.547   1.00 39.09 ? 65  GLN I C   1 
ATOM   1383 O  O   . GLN B 1 67  ? -29.983 -37.665 8.178   1.00 39.20 ? 65  GLN I O   1 
ATOM   1384 C  CB  . GLN B 1 67  ? -30.593 -35.067 9.734   1.00 39.24 ? 65  GLN I CB  1 
ATOM   1385 C  CG  . GLN B 1 67  ? -30.024 -35.426 11.116  1.00 42.10 ? 65  GLN I CG  1 
ATOM   1386 C  CD  . GLN B 1 67  ? -29.229 -34.286 11.755  1.00 45.37 ? 65  GLN I CD  1 
ATOM   1387 O  OE1 . GLN B 1 67  ? -29.769 -33.206 12.027  1.00 48.24 ? 65  GLN I OE1 1 
ATOM   1388 N  NE2 . GLN B 1 67  ? -27.948 -34.531 12.020  1.00 46.05 ? 65  GLN I NE2 1 
ATOM   1389 N  N   . GLY B 1 68  ? -27.953 -37.029 8.929   1.00 39.46 ? 66  GLY I N   1 
ATOM   1390 C  CA  . GLY B 1 68  ? -27.423 -38.393 9.038   1.00 39.50 ? 66  GLY I CA  1 
ATOM   1391 C  C   . GLY B 1 68  ? -26.584 -38.844 7.851   1.00 39.31 ? 66  GLY I C   1 
ATOM   1392 O  O   . GLY B 1 68  ? -25.691 -39.677 7.997   1.00 39.57 ? 66  GLY I O   1 
ATOM   1393 N  N   . ARG B 1 69  ? -26.881 -38.301 6.676   1.00 38.99 ? 67  ARG I N   1 
ATOM   1394 C  CA  . ARG B 1 69  ? -26.195 -38.677 5.437   1.00 38.82 ? 67  ARG I CA  1 
ATOM   1395 C  C   . ARG B 1 69  ? -25.287 -37.567 4.925   1.00 37.77 ? 67  ARG I C   1 
ATOM   1396 O  O   . ARG B 1 69  ? -24.679 -37.703 3.864   1.00 38.16 ? 67  ARG I O   1 
ATOM   1397 C  CB  . ARG B 1 69  ? -27.211 -39.043 4.352   1.00 39.20 ? 67  ARG I CB  1 
ATOM   1398 C  CG  . ARG B 1 69  ? -27.983 -40.328 4.647   1.00 42.46 ? 67  ARG I CG  1 
ATOM   1399 C  CD  . ARG B 1 69  ? -29.188 -40.489 3.731   1.00 45.65 ? 67  ARG I CD  1 
ATOM   1400 N  NE  . ARG B 1 69  ? -28.866 -40.067 2.368   1.00 48.05 ? 67  ARG I NE  1 
ATOM   1401 C  CZ  . ARG B 1 69  ? -29.380 -39.000 1.756   1.00 48.64 ? 67  ARG I CZ  1 
ATOM   1402 N  NH1 . ARG B 1 69  ? -30.282 -38.233 2.368   1.00 49.31 ? 67  ARG I NH1 1 
ATOM   1403 N  NH2 . ARG B 1 69  ? -29.000 -38.709 0.515   1.00 47.16 ? 67  ARG I NH2 1 
ATOM   1404 N  N   . ILE B 1 70  ? -25.205 -36.466 5.670   1.00 36.44 ? 68  ILE I N   1 
ATOM   1405 C  CA  . ILE B 1 70  ? -24.302 -35.376 5.314   1.00 34.65 ? 68  ILE I CA  1 
ATOM   1406 C  C   . ILE B 1 70  ? -23.626 -34.781 6.549   1.00 33.25 ? 68  ILE I C   1 
ATOM   1407 O  O   . ILE B 1 70  ? -24.098 -34.953 7.660   1.00 32.64 ? 68  ILE I O   1 
ATOM   1408 C  CB  . ILE B 1 70  ? -25.018 -34.283 4.487   1.00 34.70 ? 68  ILE I CB  1 
ATOM   1409 C  CG1 . ILE B 1 70  ? -26.012 -33.484 5.328   1.00 34.49 ? 68  ILE I CG1 1 
ATOM   1410 C  CG2 . ILE B 1 70  ? -25.748 -34.903 3.326   1.00 34.69 ? 68  ILE I CG2 1 
ATOM   1411 C  CD1 . ILE B 1 70  ? -26.442 -32.188 4.660   1.00 31.52 ? 68  ILE I CD1 1 
ATOM   1412 N  N   . THR B 1 71  ? -22.495 -34.114 6.334   1.00 32.42 ? 69  THR I N   1 
ATOM   1413 C  CA  . THR B 1 71  ? -21.730 -33.474 7.401   1.00 31.73 ? 69  THR I CA  1 
ATOM   1414 C  C   . THR B 1 71  ? -21.101 -32.204 6.831   1.00 31.85 ? 69  THR I C   1 
ATOM   1415 O  O   . THR B 1 71  ? -20.397 -32.249 5.818   1.00 31.98 ? 69  THR I O   1 
ATOM   1416 C  CB  . THR B 1 71  ? -20.606 -34.387 7.936   1.00 31.62 ? 69  THR I CB  1 
ATOM   1417 O  OG1 . THR B 1 71  ? -21.169 -35.623 8.370   1.00 32.45 ? 69  THR I OG1 1 
ATOM   1418 C  CG2 . THR B 1 71  ? -19.877 -33.747 9.113   1.00 30.18 ? 69  THR I CG2 1 
ATOM   1419 N  N   . ILE B 1 72  ? -21.355 -31.072 7.474   1.00 31.35 ? 70  ILE I N   1 
ATOM   1420 C  CA  . ILE B 1 72  ? -20.808 -29.813 7.005   1.00 30.94 ? 70  ILE I CA  1 
ATOM   1421 C  C   . ILE B 1 72  ? -19.742 -29.325 7.978   1.00 31.08 ? 70  ILE I C   1 
ATOM   1422 O  O   . ILE B 1 72  ? -19.916 -29.389 9.189   1.00 31.47 ? 70  ILE I O   1 
ATOM   1423 C  CB  . ILE B 1 72  ? -21.906 -28.766 6.828   1.00 30.97 ? 70  ILE I CB  1 
ATOM   1424 C  CG1 . ILE B 1 72  ? -22.895 -29.250 5.761   1.00 30.84 ? 70  ILE I CG1 1 
ATOM   1425 C  CG2 . ILE B 1 72  ? -21.311 -27.423 6.436   1.00 30.52 ? 70  ILE I CG2 1 
ATOM   1426 C  CD1 . ILE B 1 72  ? -24.084 -28.356 5.578   1.00 29.30 ? 70  ILE I CD1 1 
ATOM   1427 N  N   . THR B 1 73  ? -18.621 -28.870 7.432   1.00 30.81 ? 71  THR I N   1 
ATOM   1428 C  CA  . THR B 1 73  ? -17.544 -28.339 8.232   1.00 30.68 ? 71  THR I CA  1 
ATOM   1429 C  C   . THR B 1 73  ? -16.946 -27.128 7.541   1.00 30.60 ? 71  THR I C   1 
ATOM   1430 O  O   . THR B 1 73  ? -17.192 -26.875 6.355   1.00 31.22 ? 71  THR I O   1 
ATOM   1431 C  CB  . THR B 1 73  ? -16.446 -29.388 8.487   1.00 30.85 ? 71  THR I CB  1 
ATOM   1432 O  OG1 . THR B 1 73  ? -16.088 -30.024 7.253   1.00 32.52 ? 71  THR I OG1 1 
ATOM   1433 C  CG2 . THR B 1 73  ? -16.928 -30.435 9.467   1.00 30.11 ? 71  THR I CG2 1 
ATOM   1434 N  N   . ALA B 1 74  ? -16.161 -26.379 8.302   1.00 29.85 ? 72  ALA I N   1 
ATOM   1435 C  CA  . ALA B 1 74  ? -15.638 -25.116 7.845   1.00 29.67 ? 72  ALA I CA  1 
ATOM   1436 C  C   . ALA B 1 74  ? -14.219 -25.007 8.347   1.00 29.88 ? 72  ALA I C   1 
ATOM   1437 O  O   . ALA B 1 74  ? -13.965 -25.281 9.513   1.00 30.66 ? 72  ALA I O   1 
ATOM   1438 C  CB  . ALA B 1 74  ? -16.484 -23.975 8.390   1.00 29.13 ? 72  ALA I CB  1 
ATOM   1439 N  N   . ASP B 1 75  ? -13.289 -24.620 7.477   1.00 29.87 ? 73  ASP I N   1 
ATOM   1440 C  CA  . ASP B 1 75  ? -11.876 -24.497 7.873   1.00 29.72 ? 73  ASP I CA  1 
ATOM   1441 C  C   . ASP B 1 75  ? -11.451 -23.031 7.799   1.00 29.71 ? 73  ASP I C   1 
ATOM   1442 O  O   . ASP B 1 75  ? -11.238 -22.476 6.720   1.00 29.86 ? 73  ASP I O   1 
ATOM   1443 C  CB  . ASP B 1 75  ? -10.983 -25.386 6.998   1.00 29.60 ? 73  ASP I CB  1 
ATOM   1444 C  CG  . ASP B 1 75  ? -9.531  -25.389 7.447   1.00 29.98 ? 73  ASP I CG  1 
ATOM   1445 O  OD1 . ASP B 1 75  ? -9.211  -24.646 8.391   1.00 31.58 ? 73  ASP I OD1 1 
ATOM   1446 O  OD2 . ASP B 1 75  ? -8.701  -26.127 6.852   1.00 29.62 ? 73  ASP I OD2 1 
ATOM   1447 N  N   . ARG B 1 76  ? -11.329 -22.398 8.955   1.00 29.94 ? 74  ARG I N   1 
ATOM   1448 C  CA  . ARG B 1 76  ? -11.117 -20.957 8.985   1.00 29.77 ? 74  ARG I CA  1 
ATOM   1449 C  C   . ARG B 1 76  ? -9.708  -20.595 8.572   1.00 28.98 ? 74  ARG I C   1 
ATOM   1450 O  O   . ARG B 1 76  ? -9.474  -19.504 8.056   1.00 28.92 ? 74  ARG I O   1 
ATOM   1451 C  CB  . ARG B 1 76  ? -11.452 -20.385 10.356  1.00 30.16 ? 74  ARG I CB  1 
ATOM   1452 C  CG  . ARG B 1 76  ? -12.785 -20.879 10.870  1.00 32.87 ? 74  ARG I CG  1 
ATOM   1453 C  CD  . ARG B 1 76  ? -13.537 -19.839 11.658  1.00 36.09 ? 74  ARG I CD  1 
ATOM   1454 N  NE  . ARG B 1 76  ? -12.894 -19.543 12.939  1.00 40.38 ? 74  ARG I NE  1 
ATOM   1455 C  CZ  . ARG B 1 76  ? -12.544 -18.326 13.345  1.00 41.69 ? 74  ARG I CZ  1 
ATOM   1456 N  NH1 . ARG B 1 76  ? -12.780 -17.279 12.576  1.00 44.61 ? 74  ARG I NH1 1 
ATOM   1457 N  NH2 . ARG B 1 76  ? -11.970 -18.150 14.524  1.00 40.99 ? 74  ARG I NH2 1 
ATOM   1458 N  N   . SER B 1 77  ? -8.768  -21.509 8.767   1.00 28.16 ? 75  SER I N   1 
ATOM   1459 C  CA  . SER B 1 77  ? -7.397  -21.220 8.364   1.00 28.00 ? 75  SER I CA  1 
ATOM   1460 C  C   . SER B 1 77  ? -7.221  -21.260 6.850   1.00 27.29 ? 75  SER I C   1 
ATOM   1461 O  O   . SER B 1 77  ? -6.171  -20.855 6.351   1.00 26.59 ? 75  SER I O   1 
ATOM   1462 C  CB  . SER B 1 77  ? -6.402  -22.141 9.064   1.00 28.00 ? 75  SER I CB  1 
ATOM   1463 O  OG  . SER B 1 77  ? -6.951  -23.426 9.219   1.00 30.22 ? 75  SER I OG  1 
ATOM   1464 N  N   . THR B 1 78  ? -8.247  -21.730 6.131   1.00 26.53 ? 76  THR I N   1 
ATOM   1465 C  CA  . THR B 1 78  ? -8.240  -21.734 4.658   1.00 25.93 ? 76  THR I CA  1 
ATOM   1466 C  C   . THR B 1 78  ? -9.452  -21.060 3.987   1.00 25.92 ? 76  THR I C   1 
ATOM   1467 O  O   . THR B 1 78  ? -9.479  -20.910 2.770   1.00 25.68 ? 76  THR I O   1 
ATOM   1468 C  CB  . THR B 1 78  ? -8.140  -23.165 4.096   1.00 25.97 ? 76  THR I CB  1 
ATOM   1469 O  OG1 . THR B 1 78  ? -9.091  -24.019 4.754   1.00 27.07 ? 76  THR I OG1 1 
ATOM   1470 C  CG2 . THR B 1 78  ? -6.746  -23.723 4.278   1.00 24.50 ? 76  THR I CG2 1 
ATOM   1471 N  N   . SER B 1 79  ? -10.450 -20.655 4.766   1.00 26.11 ? 77  SER I N   1 
ATOM   1472 C  CA  . SER B 1 79  ? -11.683 -20.067 4.209   1.00 25.83 ? 77  SER I CA  1 
ATOM   1473 C  C   . SER B 1 79  ? -12.367 -21.037 3.253   1.00 25.78 ? 77  SER I C   1 
ATOM   1474 O  O   . SER B 1 79  ? -12.958 -20.622 2.240   1.00 25.29 ? 77  SER I O   1 
ATOM   1475 C  CB  . SER B 1 79  ? -11.406 -18.760 3.461   1.00 25.87 ? 77  SER I CB  1 
ATOM   1476 O  OG  . SER B 1 79  ? -10.727 -17.821 4.262   1.00 25.79 ? 77  SER I OG  1 
ATOM   1477 N  N   . THR B 1 80  ? -12.281 -22.325 3.575   1.00 25.20 ? 78  THR I N   1 
ATOM   1478 C  CA  . THR B 1 80  ? -12.889 -23.351 2.752   1.00 25.04 ? 78  THR I CA  1 
ATOM   1479 C  C   . THR B 1 80  ? -13.968 -24.074 3.559   1.00 25.31 ? 78  THR I C   1 
ATOM   1480 O  O   . THR B 1 80  ? -13.721 -24.521 4.692   1.00 26.67 ? 78  THR I O   1 
ATOM   1481 C  CB  . THR B 1 80  ? -11.825 -24.344 2.253   1.00 25.09 ? 78  THR I CB  1 
ATOM   1482 O  OG1 . THR B 1 80  ? -10.713 -23.616 1.707   1.00 24.26 ? 78  THR I OG1 1 
ATOM   1483 C  CG2 . THR B 1 80  ? -12.403 -25.290 1.198   1.00 23.70 ? 78  THR I CG2 1 
ATOM   1484 N  N   . ALA B 1 81  ? -15.168 -24.157 2.993   1.00 24.06 ? 79  ALA I N   1 
ATOM   1485 C  CA  . ALA B 1 81  ? -16.253 -24.935 3.591   1.00 24.05 ? 79  ALA I CA  1 
ATOM   1486 C  C   . ALA B 1 81  ? -16.359 -26.249 2.833   1.00 24.18 ? 79  ALA I C   1 
ATOM   1487 O  O   . ALA B 1 81  ? -16.135 -26.283 1.622   1.00 23.29 ? 79  ALA I O   1 
ATOM   1488 C  CB  . ALA B 1 81  ? -17.578 -24.178 3.526   1.00 23.14 ? 79  ALA I CB  1 
ATOM   1489 N  N   . TYR B 1 82  ? -16.713 -27.314 3.551   1.00 24.33 ? 80  TYR I N   1 
ATOM   1490 C  CA  . TYR B 1 82  ? -16.768 -28.662 2.990   1.00 23.82 ? 80  TYR I CA  1 
ATOM   1491 C  C   . TYR B 1 82  ? -18.100 -29.334 3.270   1.00 24.31 ? 80  TYR I C   1 
ATOM   1492 O  O   . TYR B 1 82  ? -18.689 -29.151 4.331   1.00 24.27 ? 80  TYR I O   1 
ATOM   1493 C  CB  . TYR B 1 82  ? -15.682 -29.549 3.605   1.00 23.61 ? 80  TYR I CB  1 
ATOM   1494 C  CG  . TYR B 1 82  ? -14.267 -29.122 3.349   1.00 21.96 ? 80  TYR I CG  1 
ATOM   1495 C  CD1 . TYR B 1 82  ? -13.557 -28.452 4.313   1.00 23.33 ? 80  TYR I CD1 1 
ATOM   1496 C  CD2 . TYR B 1 82  ? -13.629 -29.420 2.154   1.00 21.44 ? 80  TYR I CD2 1 
ATOM   1497 C  CE1 . TYR B 1 82  ? -12.253 -28.065 4.098   1.00 23.90 ? 80  TYR I CE1 1 
ATOM   1498 C  CE2 . TYR B 1 82  ? -12.321 -29.040 1.928   1.00 20.61 ? 80  TYR I CE2 1 
ATOM   1499 C  CZ  . TYR B 1 82  ? -11.641 -28.352 2.902   1.00 22.50 ? 80  TYR I CZ  1 
ATOM   1500 O  OH  . TYR B 1 82  ? -10.334 -27.949 2.714   1.00 23.73 ? 80  TYR I OH  1 
ATOM   1501 N  N   . LEU B 1 83  ? -18.532 -30.172 2.338   1.00 25.06 ? 81  LEU I N   1 
ATOM   1502 C  CA  . LEU B 1 83  ? -19.776 -30.924 2.474   1.00 25.74 ? 81  LEU I CA  1 
ATOM   1503 C  C   . LEU B 1 83  ? -19.493 -32.393 2.251   1.00 27.15 ? 81  LEU I C   1 
ATOM   1504 O  O   . LEU B 1 83  ? -19.101 -32.796 1.155   1.00 28.26 ? 81  LEU I O   1 
ATOM   1505 C  CB  . LEU B 1 83  ? -20.793 -30.435 1.447   1.00 25.61 ? 81  LEU I CB  1 
ATOM   1506 C  CG  . LEU B 1 83  ? -21.968 -31.338 1.099   1.00 24.55 ? 81  LEU I CG  1 
ATOM   1507 C  CD1 . LEU B 1 83  ? -22.860 -31.498 2.317   1.00 26.72 ? 81  LEU I CD1 1 
ATOM   1508 C  CD2 . LEU B 1 83  ? -22.744 -30.762 -0.063  1.00 22.18 ? 81  LEU I CD2 1 
ATOM   1509 N  N   . GLU B 1 84  ? -19.659 -33.202 3.288   1.00 28.53 ? 82  GLU I N   1 
ATOM   1510 C  CA  . GLU B 1 84  ? -19.467 -34.650 3.143   1.00 29.23 ? 82  GLU I CA  1 
ATOM   1511 C  C   . GLU B 1 84  ? -20.821 -35.343 2.986   1.00 29.26 ? 82  GLU I C   1 
ATOM   1512 O  O   . GLU B 1 84  ? -21.679 -35.233 3.862   1.00 28.68 ? 82  GLU I O   1 
ATOM   1513 C  CB  . GLU B 1 84  ? -18.700 -35.248 4.327   1.00 29.21 ? 82  GLU I CB  1 
ATOM   1514 C  CG  . GLU B 1 84  ? -18.529 -36.755 4.203   1.00 30.77 ? 82  GLU I CG  1 
ATOM   1515 C  CD  . GLU B 1 84  ? -17.882 -37.430 5.417   1.00 32.61 ? 82  GLU I CD  1 
ATOM   1516 O  OE1 . GLU B 1 84  ? -18.003 -36.932 6.562   1.00 32.32 ? 82  GLU I OE1 1 
ATOM   1517 O  OE2 . GLU B 1 84  ? -17.260 -38.491 5.208   1.00 34.21 ? 82  GLU I OE2 1 
ATOM   1518 N  N   . LEU B 1 85  ? -21.005 -36.038 1.861   1.00 29.58 ? 83  LEU I N   1 
ATOM   1519 C  CA  . LEU B 1 85  ? -22.192 -36.859 1.635   1.00 29.57 ? 83  LEU I CA  1 
ATOM   1520 C  C   . LEU B 1 85  ? -21.742 -38.280 1.739   1.00 29.48 ? 83  LEU I C   1 
ATOM   1521 O  O   . LEU B 1 85  ? -20.911 -38.706 0.956   1.00 30.05 ? 83  LEU I O   1 
ATOM   1522 C  CB  . LEU B 1 85  ? -22.787 -36.700 0.244   1.00 29.83 ? 83  LEU I CB  1 
ATOM   1523 C  CG  . LEU B 1 85  ? -22.711 -35.404 -0.548  1.00 31.29 ? 83  LEU I CG  1 
ATOM   1524 C  CD1 . LEU B 1 85  ? -21.273 -35.017 -0.776  1.00 34.71 ? 83  LEU I CD1 1 
ATOM   1525 C  CD2 . LEU B 1 85  ? -23.385 -35.604 -1.884  1.00 30.35 ? 83  LEU I CD2 1 
ATOM   1526 N  N   . ASN B 1 86  ? -22.296 -39.015 2.693   1.00 29.37 ? 84  ASN I N   1 
ATOM   1527 C  CA  . ASN B 1 86  ? -21.978 -40.425 2.860   1.00 29.04 ? 84  ASN I CA  1 
ATOM   1528 C  C   . ASN B 1 86  ? -23.155 -41.292 2.415   1.00 28.38 ? 84  ASN I C   1 
ATOM   1529 O  O   . ASN B 1 86  ? -24.281 -40.795 2.287   1.00 27.30 ? 84  ASN I O   1 
ATOM   1530 C  CB  . ASN B 1 86  ? -21.621 -40.715 4.326   1.00 29.17 ? 84  ASN I CB  1 
ATOM   1531 C  CG  . ASN B 1 86  ? -22.813 -40.535 5.272   1.00 30.56 ? 84  ASN I CG  1 
ATOM   1532 O  OD1 . ASN B 1 86  ? -23.843 -41.213 5.144   1.00 30.35 ? 84  ASN I OD1 1 
ATOM   1533 N  ND2 . ASN B 1 86  ? -22.670 -39.632 6.237   1.00 31.41 ? 84  ASN I ND2 1 
ATOM   1534 N  N   . SER B 1 87  ? -22.883 -42.581 2.192   1.00 28.05 ? 85  SER I N   1 
ATOM   1535 C  CA  . SER B 1 87  ? -23.932 -43.580 1.936   1.00 27.85 ? 85  SER I CA  1 
ATOM   1536 C  C   . SER B 1 87  ? -24.710 -43.268 0.661   1.00 27.19 ? 85  SER I C   1 
ATOM   1537 O  O   . SER B 1 87  ? -25.939 -43.165 0.667   1.00 26.23 ? 85  SER I O   1 
ATOM   1538 C  CB  . SER B 1 87  ? -24.901 -43.662 3.124   1.00 28.07 ? 85  SER I CB  1 
ATOM   1539 O  OG  . SER B 1 87  ? -24.234 -44.060 4.305   1.00 28.71 ? 85  SER I OG  1 
ATOM   1540 N  N   . LEU B 1 88  ? -23.970 -43.145 -0.432  1.00 27.16 ? 86  LEU I N   1 
ATOM   1541 C  CA  . LEU B 1 88  ? -24.507 -42.641 -1.688  1.00 27.10 ? 86  LEU I CA  1 
ATOM   1542 C  C   . LEU B 1 88  ? -25.328 -43.676 -2.445  1.00 27.56 ? 86  LEU I C   1 
ATOM   1543 O  O   . LEU B 1 88  ? -25.060 -44.884 -2.378  1.00 27.58 ? 86  LEU I O   1 
ATOM   1544 C  CB  . LEU B 1 88  ? -23.367 -42.125 -2.572  1.00 26.63 ? 86  LEU I CB  1 
ATOM   1545 C  CG  . LEU B 1 88  ? -22.791 -40.778 -2.127  1.00 26.28 ? 86  LEU I CG  1 
ATOM   1546 C  CD1 . LEU B 1 88  ? -21.460 -40.467 -2.808  1.00 25.83 ? 86  LEU I CD1 1 
ATOM   1547 C  CD2 . LEU B 1 88  ? -23.801 -39.677 -2.397  1.00 23.67 ? 86  LEU I CD2 1 
ATOM   1548 N  N   . ARG B 1 89  ? -26.349 -43.187 -3.145  1.00 28.10 ? 87  ARG I N   1 
ATOM   1549 C  CA  . ARG B 1 89  ? -27.081 -43.993 -4.122  1.00 28.62 ? 87  ARG I CA  1 
ATOM   1550 C  C   . ARG B 1 89  ? -27.203 -43.156 -5.395  1.00 28.67 ? 87  ARG I C   1 
ATOM   1551 O  O   . ARG B 1 89  ? -26.982 -41.946 -5.361  1.00 27.25 ? 87  ARG I O   1 
ATOM   1552 C  CB  . ARG B 1 89  ? -28.466 -44.395 -3.610  1.00 28.40 ? 87  ARG I CB  1 
ATOM   1553 C  CG  . ARG B 1 89  ? -28.634 -44.300 -2.109  1.00 30.46 ? 87  ARG I CG  1 
ATOM   1554 C  CD  . ARG B 1 89  ? -29.911 -44.998 -1.640  1.00 32.74 ? 87  ARG I CD  1 
ATOM   1555 N  NE  . ARG B 1 89  ? -29.785 -46.464 -1.633  1.00 34.74 ? 87  ARG I NE  1 
ATOM   1556 C  CZ  . ARG B 1 89  ? -29.655 -47.220 -0.537  1.00 37.55 ? 87  ARG I CZ  1 
ATOM   1557 N  NH1 . ARG B 1 89  ? -29.639 -46.672 0.683   1.00 38.19 ? 87  ARG I NH1 1 
ATOM   1558 N  NH2 . ARG B 1 89  ? -29.557 -48.547 -0.653  1.00 37.94 ? 87  ARG I NH2 1 
ATOM   1559 N  N   . PRO B 1 90  ? -27.537 -43.802 -6.524  1.00 29.93 ? 88  PRO I N   1 
ATOM   1560 C  CA  . PRO B 1 90  ? -27.774 -43.152 -7.822  1.00 30.70 ? 88  PRO I CA  1 
ATOM   1561 C  C   . PRO B 1 90  ? -28.715 -41.952 -7.760  1.00 31.56 ? 88  PRO I C   1 
ATOM   1562 O  O   . PRO B 1 90  ? -28.605 -41.034 -8.570  1.00 32.45 ? 88  PRO I O   1 
ATOM   1563 C  CB  . PRO B 1 90  ? -28.419 -44.264 -8.633  1.00 30.64 ? 88  PRO I CB  1 
ATOM   1564 C  CG  . PRO B 1 90  ? -27.755 -45.488 -8.111  1.00 31.20 ? 88  PRO I CG  1 
ATOM   1565 C  CD  . PRO B 1 90  ? -27.688 -45.263 -6.627  1.00 30.00 ? 88  PRO I CD  1 
ATOM   1566 N  N   . GLU B 1 91  ? -29.618 -41.956 -6.791  1.00 31.61 ? 89  GLU I N   1 
ATOM   1567 C  CA  . GLU B 1 91  ? -30.571 -40.866 -6.606  1.00 31.99 ? 89  GLU I CA  1 
ATOM   1568 C  C   . GLU B 1 91  ? -29.906 -39.610 -6.027  1.00 30.49 ? 89  GLU I C   1 
ATOM   1569 O  O   . GLU B 1 91  ? -30.483 -38.529 -6.031  1.00 29.71 ? 89  GLU I O   1 
ATOM   1570 C  CB  . GLU B 1 91  ? -31.671 -41.344 -5.674  1.00 33.23 ? 89  GLU I CB  1 
ATOM   1571 C  CG  . GLU B 1 91  ? -31.943 -42.872 -5.797  1.00 37.37 ? 89  GLU I CG  1 
ATOM   1572 C  CD  . GLU B 1 91  ? -32.792 -43.414 -4.653  1.00 41.19 ? 89  GLU I CD  1 
ATOM   1573 O  OE1 . GLU B 1 91  ? -33.198 -42.612 -3.770  1.00 44.32 ? 89  GLU I OE1 1 
ATOM   1574 O  OE2 . GLU B 1 91  ? -33.047 -44.638 -4.633  1.00 42.15 ? 89  GLU I OE2 1 
ATOM   1575 N  N   . ASP B 1 92  ? -28.684 -39.771 -5.533  1.00 29.36 ? 90  ASP I N   1 
ATOM   1576 C  CA  . ASP B 1 92  ? -27.920 -38.666 -4.963  1.00 28.05 ? 90  ASP I CA  1 
ATOM   1577 C  C   . ASP B 1 92  ? -27.227 -37.837 -6.049  1.00 27.40 ? 90  ASP I C   1 
ATOM   1578 O  O   . ASP B 1 92  ? -26.720 -36.741 -5.776  1.00 26.52 ? 90  ASP I O   1 
ATOM   1579 C  CB  . ASP B 1 92  ? -26.905 -39.193 -3.945  1.00 27.76 ? 90  ASP I CB  1 
ATOM   1580 C  CG  . ASP B 1 92  ? -27.558 -39.575 -2.632  1.00 27.30 ? 90  ASP I CG  1 
ATOM   1581 O  OD1 . ASP B 1 92  ? -28.508 -38.875 -2.235  1.00 27.93 ? 90  ASP I OD1 1 
ATOM   1582 O  OD2 . ASP B 1 92  ? -27.140 -40.567 -1.999  1.00 26.61 ? 90  ASP I OD2 1 
ATOM   1583 N  N   . THR B 1 93  ? -27.225 -38.372 -7.276  1.00 26.33 ? 91  THR I N   1 
ATOM   1584 C  CA  . THR B 1 93  ? -26.724 -37.663 -8.452  1.00 24.49 ? 91  THR I CA  1 
ATOM   1585 C  C   . THR B 1 93  ? -27.334 -36.278 -8.534  1.00 24.29 ? 91  THR I C   1 
ATOM   1586 O  O   . THR B 1 93  ? -28.547 -36.110 -8.531  1.00 23.45 ? 91  THR I O   1 
ATOM   1587 C  CB  . THR B 1 93  ? -27.045 -38.436 -9.735  1.00 24.04 ? 91  THR I CB  1 
ATOM   1588 O  OG1 . THR B 1 93  ? -26.461 -39.744 -9.662  1.00 22.99 ? 91  THR I OG1 1 
ATOM   1589 C  CG2 . THR B 1 93  ? -26.494 -37.711 -10.960 1.00 23.69 ? 91  THR I CG2 1 
ATOM   1590 N  N   . ALA B 1 94  ? -26.483 -35.273 -8.587  1.00 25.35 ? 92  ALA I N   1 
ATOM   1591 C  CA  . ALA B 1 94  ? -26.958 -33.890 -8.583  1.00 26.26 ? 92  ALA I CA  1 
ATOM   1592 C  C   . ALA B 1 94  ? -25.788 -32.933 -8.736  1.00 26.65 ? 92  ALA I C   1 
ATOM   1593 O  O   . ALA B 1 94  ? -24.633 -33.347 -8.662  1.00 27.15 ? 92  ALA I O   1 
ATOM   1594 C  CB  . ALA B 1 94  ? -27.714 -33.579 -7.293  1.00 26.02 ? 92  ALA I CB  1 
ATOM   1595 N  N   . VAL B 1 95  ? -26.112 -31.662 -8.976  1.00 27.07 ? 93  VAL I N   1 
ATOM   1596 C  CA  . VAL B 1 95  ? -25.160 -30.580 -8.815  1.00 27.61 ? 93  VAL I CA  1 
ATOM   1597 C  C   . VAL B 1 95  ? -25.369 -30.054 -7.410  1.00 28.52 ? 93  VAL I C   1 
ATOM   1598 O  O   . VAL B 1 95  ? -26.508 -30.023 -6.919  1.00 29.29 ? 93  VAL I O   1 
ATOM   1599 C  CB  . VAL B 1 95  ? -25.372 -29.462 -9.854  1.00 28.00 ? 93  VAL I CB  1 
ATOM   1600 C  CG1 . VAL B 1 95  ? -24.503 -28.238 -9.519  1.00 25.66 ? 93  VAL I CG1 1 
ATOM   1601 C  CG2 . VAL B 1 95  ? -25.069 -29.986 -11.264 1.00 25.98 ? 93  VAL I CG2 1 
ATOM   1602 N  N   . TYR B 1 96  ? -24.270 -29.683 -6.756  1.00 28.61 ? 94  TYR I N   1 
ATOM   1603 C  CA  . TYR B 1 96  ? -24.284 -29.264 -5.346  1.00 27.95 ? 94  TYR I CA  1 
ATOM   1604 C  C   . TYR B 1 96  ? -23.660 -27.876 -5.246  1.00 28.18 ? 94  TYR I C   1 
ATOM   1605 O  O   . TYR B 1 96  ? -22.449 -27.722 -5.369  1.00 29.03 ? 94  TYR I O   1 
ATOM   1606 C  CB  . TYR B 1 96  ? -23.509 -30.262 -4.460  1.00 27.80 ? 94  TYR I CB  1 
ATOM   1607 C  CG  . TYR B 1 96  ? -24.211 -31.592 -4.273  1.00 26.86 ? 94  TYR I CG  1 
ATOM   1608 C  CD1 . TYR B 1 96  ? -24.027 -32.631 -5.169  1.00 25.59 ? 94  TYR I CD1 1 
ATOM   1609 C  CD2 . TYR B 1 96  ? -25.063 -31.805 -3.201  1.00 28.34 ? 94  TYR I CD2 1 
ATOM   1610 C  CE1 . TYR B 1 96  ? -24.690 -33.836 -5.021  1.00 24.78 ? 94  TYR I CE1 1 
ATOM   1611 C  CE2 . TYR B 1 96  ? -25.737 -33.020 -3.041  1.00 27.31 ? 94  TYR I CE2 1 
ATOM   1612 C  CZ  . TYR B 1 96  ? -25.547 -34.025 -3.958  1.00 25.75 ? 94  TYR I CZ  1 
ATOM   1613 O  OH  . TYR B 1 96  ? -26.210 -35.225 -3.797  1.00 26.26 ? 94  TYR I OH  1 
ATOM   1614 N  N   . TYR B 1 97  ? -24.486 -26.862 -5.045  1.00 28.50 ? 95  TYR I N   1 
ATOM   1615 C  CA  . TYR B 1 97  ? -23.997 -25.481 -4.913  1.00 28.28 ? 95  TYR I CA  1 
ATOM   1616 C  C   . TYR B 1 97  ? -23.712 -25.132 -3.464  1.00 28.73 ? 95  TYR I C   1 
ATOM   1617 O  O   . TYR B 1 97  ? -24.394 -25.605 -2.559  1.00 28.91 ? 95  TYR I O   1 
ATOM   1618 C  CB  . TYR B 1 97  ? -25.040 -24.496 -5.414  1.00 27.76 ? 95  TYR I CB  1 
ATOM   1619 C  CG  . TYR B 1 97  ? -25.435 -24.668 -6.857  1.00 26.75 ? 95  TYR I CG  1 
ATOM   1620 C  CD1 . TYR B 1 97  ? -26.569 -25.389 -7.206  1.00 26.78 ? 95  TYR I CD1 1 
ATOM   1621 C  CD2 . TYR B 1 97  ? -24.694 -24.087 -7.870  1.00 25.42 ? 95  TYR I CD2 1 
ATOM   1622 C  CE1 . TYR B 1 97  ? -26.951 -25.527 -8.535  1.00 27.48 ? 95  TYR I CE1 1 
ATOM   1623 C  CE2 . TYR B 1 97  ? -25.062 -24.232 -9.200  1.00 26.30 ? 95  TYR I CE2 1 
ATOM   1624 C  CZ  . TYR B 1 97  ? -26.186 -24.950 -9.524  1.00 26.34 ? 95  TYR I CZ  1 
ATOM   1625 O  OH  . TYR B 1 97  ? -26.541 -25.090 -10.835 1.00 27.76 ? 95  TYR I OH  1 
ATOM   1626 N  N   . CYS B 1 98  ? -22.698 -24.308 -3.246  1.00 29.16 ? 96  CYS I N   1 
ATOM   1627 C  CA  . CYS B 1 98  ? -22.525 -23.658 -1.952  1.00 29.46 ? 96  CYS I CA  1 
ATOM   1628 C  C   . CYS B 1 98  ? -22.982 -22.233 -2.188  1.00 29.26 ? 96  CYS I C   1 
ATOM   1629 O  O   . CYS B 1 98  ? -22.881 -21.720 -3.300  1.00 29.17 ? 96  CYS I O   1 
ATOM   1630 C  CB  . CYS B 1 98  ? -21.073 -23.715 -1.427  1.00 29.45 ? 96  CYS I CB  1 
ATOM   1631 S  SG  . CYS B 1 98  ? -19.928 -22.797 -2.433  1.00 30.29 ? 96  CYS I SG  1 
ATOM   1632 N  N   . ALA B 1 99  ? -23.531 -21.614 -1.156  1.00 29.18 ? 97  ALA I N   1 
ATOM   1633 C  CA  . ALA B 1 99  ? -24.052 -20.281 -1.291  1.00 29.36 ? 97  ALA I CA  1 
ATOM   1634 C  C   . ALA B 1 99  ? -23.823 -19.522 0.018   1.00 30.05 ? 97  ALA I C   1 
ATOM   1635 O  O   . ALA B 1 99  ? -23.936 -20.078 1.102   1.00 29.97 ? 97  ALA I O   1 
ATOM   1636 C  CB  . ALA B 1 99  ? -25.522 -20.336 -1.663  1.00 28.16 ? 97  ALA I CB  1 
ATOM   1637 N  N   . ARG B 1 100 ? -23.470 -18.252 -0.108  1.00 30.98 ? 98  ARG I N   1 
ATOM   1638 C  CA  . ARG B 1 100 ? -23.188 -17.406 1.036   1.00 31.81 ? 98  ARG I CA  1 
ATOM   1639 C  C   . ARG B 1 100 ? -24.162 -16.239 1.051   1.00 30.81 ? 98  ARG I C   1 
ATOM   1640 O  O   . ARG B 1 100 ? -24.469 -15.682 0.000   1.00 31.52 ? 98  ARG I O   1 
ATOM   1641 C  CB  . ARG B 1 100 ? -21.741 -16.897 0.962   1.00 32.67 ? 98  ARG I CB  1 
ATOM   1642 C  CG  . ARG B 1 100 ? -21.548 -15.488 1.507   1.00 37.24 ? 98  ARG I CG  1 
ATOM   1643 C  CD  . ARG B 1 100 ? -20.754 -15.448 2.794   1.00 39.65 ? 98  ARG I CD  1 
ATOM   1644 N  NE  . ARG B 1 100 ? -19.953 -14.225 2.891   1.00 42.17 ? 98  ARG I NE  1 
ATOM   1645 C  CZ  . ARG B 1 100 ? -20.459 -12.997 2.986   1.00 45.45 ? 98  ARG I CZ  1 
ATOM   1646 N  NH1 . ARG B 1 100 ? -19.646 -11.948 3.082   1.00 48.56 ? 98  ARG I NH1 1 
ATOM   1647 N  NH2 . ARG B 1 100 ? -21.771 -12.804 2.976   1.00 46.71 ? 98  ARG I NH2 1 
ATOM   1648 N  N   . GLU B 1 101 ? -24.624 -15.865 2.239   1.00 29.44 ? 99  GLU I N   1 
ATOM   1649 C  CA  . GLU B 1 101 ? -25.633 -14.835 2.366   1.00 29.28 ? 99  GLU I CA  1 
ATOM   1650 C  C   . GLU B 1 101 ? -25.099 -13.478 1.976   1.00 28.80 ? 99  GLU I C   1 
ATOM   1651 O  O   . GLU B 1 101 ? -23.928 -13.215 2.115   1.00 29.27 ? 99  GLU I O   1 
ATOM   1652 C  CB  . GLU B 1 101 ? -26.188 -14.787 3.796   1.00 30.28 ? 99  GLU I CB  1 
ATOM   1653 C  CG  . GLU B 1 101 ? -25.195 -14.384 4.894   1.00 29.72 ? 99  GLU I CG  1 
ATOM   1654 C  CD  . GLU B 1 101 ? -25.852 -14.243 6.260   1.00 28.19 ? 99  GLU I CD  1 
ATOM   1655 O  OE1 . GLU B 1 101 ? -25.173 -14.525 7.271   1.00 27.58 ? 99  GLU I OE1 1 
ATOM   1656 O  OE2 . GLU B 1 101 ? -27.037 -13.848 6.322   1.00 26.29 ? 99  GLU I OE2 1 
ATOM   1657 N  N   . GLY B 1 102 ? -25.969 -12.616 1.474   1.00 28.58 ? 100 GLY I N   1 
ATOM   1658 C  CA  . GLY B 1 102 ? -25.579 -11.258 1.091   1.00 27.85 ? 100 GLY I CA  1 
ATOM   1659 C  C   . GLY B 1 102 ? -25.549 -10.229 2.222   1.00 27.40 ? 100 GLY I C   1 
ATOM   1660 O  O   . GLY B 1 102 ? -25.761 -10.542 3.390   1.00 26.36 ? 100 GLY I O   1 
ATOM   1661 N  N   . THR B 1 103 ? -25.286 -8.982  1.851   1.00 27.36 ? 101 THR I N   1 
ATOM   1662 C  CA  . THR B 1 103 ? -25.118 -7.906  2.811   1.00 27.17 ? 101 THR I CA  1 
ATOM   1663 C  C   . THR B 1 103 ? -25.800 -6.610  2.342   1.00 28.68 ? 101 THR I C   1 
ATOM   1664 O  O   . THR B 1 103 ? -25.865 -6.318  1.148   1.00 28.21 ? 101 THR I O   1 
ATOM   1665 C  CB  . THR B 1 103 ? -23.625 -7.616  3.057   1.00 26.41 ? 101 THR I CB  1 
ATOM   1666 O  OG1 . THR B 1 103 ? -22.963 -7.489  1.807   1.00 22.49 ? 101 THR I OG1 1 
ATOM   1667 C  CG2 . THR B 1 103 ? -22.973 -8.719  3.851   1.00 26.11 ? 101 THR I CG2 1 
ATOM   1668 N  N   . THR B 1 104 ? -26.293 -5.830  3.297   1.00 30.06 ? 102 THR I N   1 
ATOM   1669 C  CA  . THR B 1 104 ? -26.971 -4.579  2.983   1.00 32.28 ? 102 THR I CA  1 
ATOM   1670 C  C   . THR B 1 104 ? -25.973 -3.440  2.829   1.00 33.68 ? 102 THR I C   1 
ATOM   1671 O  O   . THR B 1 104 ? -25.392 -2.967  3.809   1.00 33.47 ? 102 THR I O   1 
ATOM   1672 C  CB  . THR B 1 104 ? -27.987 -4.177  4.090   1.00 32.69 ? 102 THR I CB  1 
ATOM   1673 O  OG1 . THR B 1 104 ? -27.366 -4.294  5.376   1.00 34.59 ? 102 THR I OG1 1 
ATOM   1674 C  CG2 . THR B 1 104 ? -29.229 -5.060  4.065   1.00 32.79 ? 102 THR I CG2 1 
ATOM   1675 N  N   . GLY B 1 105 ? -25.792 -2.984  1.594   1.00 35.85 ? 103 GLY I N   1 
ATOM   1676 C  CA  . GLY B 1 105 ? -24.925 -1.822  1.314   1.00 36.81 ? 103 GLY I CA  1 
ATOM   1677 C  C   . GLY B 1 105 ? -23.954 -2.069  0.168   1.00 37.53 ? 103 GLY I C   1 
ATOM   1678 O  O   . GLY B 1 105 ? -24.116 -3.019  -0.604  1.00 38.53 ? 103 GLY I O   1 
ATOM   1679 N  N   . TRP B 1 108 ? -18.853 -4.098  1.332   1.00 39.23 ? 106 TRP I N   1 
ATOM   1680 C  CA  . TRP B 1 108 ? -19.232 -5.515  1.372   1.00 39.15 ? 106 TRP I CA  1 
ATOM   1681 C  C   . TRP B 1 108 ? -19.070 -6.184  2.747   1.00 38.83 ? 106 TRP I C   1 
ATOM   1682 O  O   . TRP B 1 108 ? -19.081 -7.421  2.832   1.00 39.49 ? 106 TRP I O   1 
ATOM   1683 C  CB  . TRP B 1 108 ? -18.436 -6.306  0.326   1.00 39.36 ? 106 TRP I CB  1 
ATOM   1684 N  N   . LEU B 1 109 ? -18.928 -5.381  3.809   1.00 37.96 ? 107 LEU I N   1 
ATOM   1685 C  CA  . LEU B 1 109 ? -18.936 -5.883  5.203   1.00 36.93 ? 107 LEU I CA  1 
ATOM   1686 C  C   . LEU B 1 109 ? -20.157 -5.317  5.957   1.00 35.52 ? 107 LEU I C   1 
ATOM   1687 O  O   . LEU B 1 109 ? -20.092 -4.944  7.132   1.00 34.96 ? 107 LEU I O   1 
ATOM   1688 C  CB  . LEU B 1 109 ? -17.626 -5.532  5.925   1.00 37.04 ? 107 LEU I CB  1 
ATOM   1689 C  CG  . LEU B 1 109 ? -16.379 -6.245  5.389   1.00 37.02 ? 107 LEU I CG  1 
ATOM   1690 N  N   . GLY B 1 110 ? -21.275 -5.275  5.250   1.00 34.15 ? 108 GLY I N   1 
ATOM   1691 C  CA  . GLY B 1 110 ? -22.502 -4.734  5.776   1.00 33.19 ? 108 GLY I CA  1 
ATOM   1692 C  C   . GLY B 1 110 ? -23.321 -5.787  6.485   1.00 32.53 ? 108 GLY I C   1 
ATOM   1693 O  O   . GLY B 1 110 ? -22.853 -6.894  6.763   1.00 32.01 ? 108 GLY I O   1 
ATOM   1694 N  N   . LYS B 1 111 ? -24.560 -5.422  6.774   1.00 32.13 ? 109 LYS I N   1 
ATOM   1695 C  CA  . LYS B 1 111 ? -25.448 -6.244  7.573   1.00 31.63 ? 109 LYS I CA  1 
ATOM   1696 C  C   . LYS B 1 111 ? -25.989 -7.384  6.717   1.00 30.61 ? 109 LYS I C   1 
ATOM   1697 O  O   . LYS B 1 111 ? -26.478 -7.139  5.622   1.00 30.38 ? 109 LYS I O   1 
ATOM   1698 C  CB  . LYS B 1 111 ? -26.586 -5.378  8.119   1.00 31.64 ? 109 LYS I CB  1 
ATOM   1699 C  CG  . LYS B 1 111 ? -27.416 -6.054  9.196   1.00 33.77 ? 109 LYS I CG  1 
ATOM   1700 C  CD  . LYS B 1 111 ? -28.621 -5.209  9.629   1.00 34.36 ? 109 LYS I CD  1 
ATOM   1701 C  CE  . LYS B 1 111 ? -29.771 -6.110  10.110  1.00 35.35 ? 109 LYS I CE  1 
ATOM   1702 N  NZ  . LYS B 1 111 ? -30.185 -7.093  9.054   1.00 33.69 ? 109 LYS I NZ  1 
ATOM   1703 N  N   . PRO B 1 112 ? -25.882 -8.632  7.207   1.00 29.75 ? 110 PRO I N   1 
ATOM   1704 C  CA  . PRO B 1 112 ? -26.299 -9.818  6.463   1.00 29.20 ? 110 PRO I CA  1 
ATOM   1705 C  C   . PRO B 1 112 ? -27.800 -9.888  6.197   1.00 28.76 ? 110 PRO I C   1 
ATOM   1706 O  O   . PRO B 1 112 ? -28.601 -9.464  7.033   1.00 28.85 ? 110 PRO I O   1 
ATOM   1707 C  CB  . PRO B 1 112 ? -25.877 -10.977 7.375   1.00 29.01 ? 110 PRO I CB  1 
ATOM   1708 C  CG  . PRO B 1 112 ? -25.760 -10.400 8.713   1.00 29.77 ? 110 PRO I CG  1 
ATOM   1709 C  CD  . PRO B 1 112 ? -25.330 -8.985  8.526   1.00 29.99 ? 110 PRO I CD  1 
ATOM   1710 N  N   . ILE B 1 113 ? -28.176 -10.445 5.047   1.00 28.04 ? 111 ILE I N   1 
ATOM   1711 C  CA  . ILE B 1 113 ? -29.594 -10.514 4.671   1.00 27.58 ? 111 ILE I CA  1 
ATOM   1712 C  C   . ILE B 1 113 ? -30.195 -11.924 4.683   1.00 27.09 ? 111 ILE I C   1 
ATOM   1713 O  O   . ILE B 1 113 ? -31.385 -12.083 4.440   1.00 27.14 ? 111 ILE I O   1 
ATOM   1714 C  CB  . ILE B 1 113 ? -29.866 -9.875  3.292   1.00 27.05 ? 111 ILE I CB  1 
ATOM   1715 C  CG1 . ILE B 1 113 ? -29.114 -10.620 2.187   1.00 28.02 ? 111 ILE I CG1 1 
ATOM   1716 C  CG2 . ILE B 1 113 ? -29.464 -8.431  3.303   1.00 26.28 ? 111 ILE I CG2 1 
ATOM   1717 C  CD1 . ILE B 1 113 ? -29.570 -10.239 0.784   1.00 28.00 ? 111 ILE I CD1 1 
ATOM   1718 N  N   . GLY B 1 114 ? -29.387 -12.941 4.963   1.00 26.82 ? 112 GLY I N   1 
ATOM   1719 C  CA  . GLY B 1 114 ? -29.882 -14.326 4.973   1.00 26.61 ? 112 GLY I CA  1 
ATOM   1720 C  C   . GLY B 1 114 ? -29.943 -14.980 3.597   1.00 26.63 ? 112 GLY I C   1 
ATOM   1721 O  O   . GLY B 1 114 ? -29.292 -15.998 3.360   1.00 26.44 ? 112 GLY I O   1 
ATOM   1722 N  N   . ALA B 1 115 ? -30.729 -14.403 2.691   1.00 26.50 ? 113 ALA I N   1 
ATOM   1723 C  CA  . ALA B 1 115 ? -30.871 -14.945 1.347   1.00 26.54 ? 113 ALA I CA  1 
ATOM   1724 C  C   . ALA B 1 115 ? -29.504 -15.000 0.714   1.00 26.87 ? 113 ALA I C   1 
ATOM   1725 O  O   . ALA B 1 115 ? -28.608 -14.256 1.110   1.00 27.32 ? 113 ALA I O   1 
ATOM   1726 C  CB  . ALA B 1 115 ? -31.795 -14.087 0.517   1.00 26.68 ? 113 ALA I CB  1 
ATOM   1727 N  N   . PHE B 1 116 ? -29.346 -15.871 -0.274  1.00 26.97 ? 114 PHE I N   1 
ATOM   1728 C  CA  . PHE B 1 116 ? -28.028 -16.144 -0.833  1.00 27.35 ? 114 PHE I CA  1 
ATOM   1729 C  C   . PHE B 1 116 ? -27.763 -15.324 -2.077  1.00 27.65 ? 114 PHE I C   1 
ATOM   1730 O  O   . PHE B 1 116 ? -28.285 -15.623 -3.149  1.00 27.04 ? 114 PHE I O   1 
ATOM   1731 C  CB  . PHE B 1 116 ? -27.885 -17.620 -1.177  1.00 27.72 ? 114 PHE I CB  1 
ATOM   1732 C  CG  . PHE B 1 116 ? -28.542 -18.542 -0.184  1.00 28.78 ? 114 PHE I CG  1 
ATOM   1733 C  CD1 . PHE B 1 116 ? -28.340 -18.382 1.172   1.00 27.82 ? 114 PHE I CD1 1 
ATOM   1734 C  CD2 . PHE B 1 116 ? -29.357 -19.574 -0.613  1.00 27.50 ? 114 PHE I CD2 1 
ATOM   1735 C  CE1 . PHE B 1 116 ? -28.947 -19.229 2.072   1.00 28.58 ? 114 PHE I CE1 1 
ATOM   1736 C  CE2 . PHE B 1 116 ? -29.950 -20.414 0.286   1.00 27.46 ? 114 PHE I CE2 1 
ATOM   1737 C  CZ  . PHE B 1 116 ? -29.750 -20.247 1.623   1.00 27.35 ? 114 PHE I CZ  1 
ATOM   1738 N  N   . ALA B 1 117 ? -26.938 -14.293 -1.927  1.00 27.80 ? 115 ALA I N   1 
ATOM   1739 C  CA  . ALA B 1 117 ? -26.567 -13.434 -3.051  1.00 27.79 ? 115 ALA I CA  1 
ATOM   1740 C  C   . ALA B 1 117 ? -25.354 -13.965 -3.806  1.00 27.79 ? 115 ALA I C   1 
ATOM   1741 O  O   . ALA B 1 117 ? -25.144 -13.609 -4.970  1.00 27.98 ? 115 ALA I O   1 
ATOM   1742 C  CB  . ALA B 1 117 ? -26.277 -12.022 -2.565  1.00 27.27 ? 115 ALA I CB  1 
ATOM   1743 N  N   . HIS B 1 118 ? -24.553 -14.800 -3.146  1.00 27.18 ? 116 HIS I N   1 
ATOM   1744 C  CA  . HIS B 1 118 ? -23.279 -15.237 -3.726  1.00 26.99 ? 116 HIS I CA  1 
ATOM   1745 C  C   . HIS B 1 118 ? -23.250 -16.744 -3.828  1.00 27.05 ? 116 HIS I C   1 
ATOM   1746 O  O   . HIS B 1 118 ? -23.404 -17.448 -2.829  1.00 27.31 ? 116 HIS I O   1 
ATOM   1747 C  CB  . HIS B 1 118 ? -22.096 -14.761 -2.895  1.00 26.68 ? 116 HIS I CB  1 
ATOM   1748 C  CG  . HIS B 1 118 ? -22.188 -13.324 -2.468  1.00 27.89 ? 116 HIS I CG  1 
ATOM   1749 N  ND1 . HIS B 1 118 ? -21.744 -12.282 -3.252  1.00 27.77 ? 116 HIS I ND1 1 
ATOM   1750 C  CD2 . HIS B 1 118 ? -22.657 -12.760 -1.330  1.00 27.19 ? 116 HIS I CD2 1 
ATOM   1751 C  CE1 . HIS B 1 118 ? -21.938 -11.141 -2.618  1.00 26.69 ? 116 HIS I CE1 1 
ATOM   1752 N  NE2 . HIS B 1 118 ? -22.487 -11.403 -1.448  1.00 27.15 ? 116 HIS I NE2 1 
ATOM   1753 N  N   . TRP B 1 119 ? -23.077 -17.233 -5.049  1.00 26.27 ? 117 TRP I N   1 
ATOM   1754 C  CA  . TRP B 1 119 ? -23.101 -18.657 -5.294  1.00 26.12 ? 117 TRP I CA  1 
ATOM   1755 C  C   . TRP B 1 119 ? -21.812 -19.165 -5.927  1.00 26.84 ? 117 TRP I C   1 
ATOM   1756 O  O   . TRP B 1 119 ? -21.090 -18.436 -6.612  1.00 26.05 ? 117 TRP I O   1 
ATOM   1757 C  CB  . TRP B 1 119 ? -24.252 -19.001 -6.219  1.00 25.81 ? 117 TRP I CB  1 
ATOM   1758 C  CG  . TRP B 1 119 ? -25.609 -18.749 -5.653  1.00 23.57 ? 117 TRP I CG  1 
ATOM   1759 C  CD1 . TRP B 1 119 ? -26.187 -17.554 -5.435  1.00 21.28 ? 117 TRP I CD1 1 
ATOM   1760 C  CD2 . TRP B 1 119 ? -26.578 -19.738 -5.287  1.00 22.47 ? 117 TRP I CD2 1 
ATOM   1761 N  NE1 . TRP B 1 119 ? -27.452 -17.723 -4.929  1.00 21.39 ? 117 TRP I NE1 1 
ATOM   1762 C  CE2 . TRP B 1 119 ? -27.713 -19.060 -4.834  1.00 21.00 ? 117 TRP I CE2 1 
ATOM   1763 C  CE3 . TRP B 1 119 ? -26.583 -21.130 -5.285  1.00 21.88 ? 117 TRP I CE3 1 
ATOM   1764 C  CZ2 . TRP B 1 119 ? -28.837 -19.717 -4.391  1.00 22.60 ? 117 TRP I CZ2 1 
ATOM   1765 C  CZ3 . TRP B 1 119 ? -27.697 -21.778 -4.842  1.00 22.57 ? 117 TRP I CZ3 1 
ATOM   1766 C  CH2 . TRP B 1 119 ? -28.809 -21.078 -4.398  1.00 22.95 ? 117 TRP I CH2 1 
ATOM   1767 N  N   . GLY B 1 120 ? -21.544 -20.441 -5.692  1.00 27.71 ? 118 GLY I N   1 
ATOM   1768 C  CA  . GLY B 1 120 ? -20.494 -21.141 -6.414  1.00 28.48 ? 118 GLY I CA  1 
ATOM   1769 C  C   . GLY B 1 120 ? -20.981 -21.538 -7.799  1.00 29.10 ? 118 GLY I C   1 
ATOM   1770 O  O   . GLY B 1 120 ? -22.139 -21.301 -8.164  1.00 29.20 ? 118 GLY I O   1 
ATOM   1771 N  N   . GLN B 1 121 ? -20.087 -22.147 -8.570  1.00 29.60 ? 119 GLN I N   1 
ATOM   1772 C  CA  . GLN B 1 121 ? -20.396 -22.577 -9.937  1.00 29.93 ? 119 GLN I CA  1 
ATOM   1773 C  C   . GLN B 1 121 ? -21.097 -23.938 -9.908  1.00 30.03 ? 119 GLN I C   1 
ATOM   1774 O  O   . GLN B 1 121 ? -21.768 -24.319 -10.874 1.00 29.32 ? 119 GLN I O   1 
ATOM   1775 C  CB  . GLN B 1 121 ? -19.117 -22.664 -10.778 1.00 29.07 ? 119 GLN I CB  1 
ATOM   1776 N  N   . GLY B 1 122 ? -20.928 -24.655 -8.793  1.00 29.85 ? 120 GLY I N   1 
ATOM   1777 C  CA  . GLY B 1 122 ? -21.529 -25.970 -8.610  1.00 29.48 ? 120 GLY I CA  1 
ATOM   1778 C  C   . GLY B 1 122 ? -20.526 -27.097 -8.835  1.00 29.90 ? 120 GLY I C   1 
ATOM   1779 O  O   . GLY B 1 122 ? -19.520 -26.921 -9.527  1.00 29.00 ? 120 GLY I O   1 
ATOM   1780 N  N   . THR B 1 123 ? -20.809 -28.247 -8.224  1.00 29.93 ? 121 THR I N   1 
ATOM   1781 C  CA  . THR B 1 123 ? -19.997 -29.437 -8.347  1.00 30.48 ? 121 THR I CA  1 
ATOM   1782 C  C   . THR B 1 123 ? -20.919 -30.617 -8.600  1.00 30.84 ? 121 THR I C   1 
ATOM   1783 O  O   . THR B 1 123 ? -21.747 -30.961 -7.755  1.00 31.49 ? 121 THR I O   1 
ATOM   1784 C  CB  . THR B 1 123 ? -19.224 -29.722 -7.050  1.00 30.94 ? 121 THR I CB  1 
ATOM   1785 O  OG1 . THR B 1 123 ? -18.263 -28.691 -6.826  1.00 32.75 ? 121 THR I OG1 1 
ATOM   1786 C  CG2 . THR B 1 123 ? -18.497 -31.060 -7.129  1.00 30.57 ? 121 THR I CG2 1 
ATOM   1787 N  N   . LEU B 1 124 ? -20.791 -31.237 -9.761  1.00 30.54 ? 122 LEU I N   1 
ATOM   1788 C  CA  . LEU B 1 124 ? -21.636 -32.372 -10.080 1.00 30.17 ? 122 LEU I CA  1 
ATOM   1789 C  C   . LEU B 1 124 ? -21.038 -33.615 -9.439  1.00 30.32 ? 122 LEU I C   1 
ATOM   1790 O  O   . LEU B 1 124 ? -19.842 -33.882 -9.564  1.00 31.67 ? 122 LEU I O   1 
ATOM   1791 C  CB  . LEU B 1 124 ? -21.774 -32.546 -11.598 1.00 30.20 ? 122 LEU I CB  1 
ATOM   1792 C  CG  . LEU B 1 124 ? -22.549 -33.766 -12.119 1.00 28.66 ? 122 LEU I CG  1 
ATOM   1793 C  CD1 . LEU B 1 124 ? -24.025 -33.738 -11.671 1.00 25.28 ? 122 LEU I CD1 1 
ATOM   1794 C  CD2 . LEU B 1 124 ? -22.428 -33.830 -13.641 1.00 24.82 ? 122 LEU I CD2 1 
ATOM   1795 N  N   . VAL B 1 125 ? -21.869 -34.349 -8.716  1.00 29.72 ? 123 VAL I N   1 
ATOM   1796 C  CA  . VAL B 1 125 ? -21.475 -35.619 -8.158  1.00 29.36 ? 123 VAL I CA  1 
ATOM   1797 C  C   . VAL B 1 125 ? -22.365 -36.662 -8.807  1.00 30.19 ? 123 VAL I C   1 
ATOM   1798 O  O   . VAL B 1 125 ? -23.590 -36.631 -8.662  1.00 30.53 ? 123 VAL I O   1 
ATOM   1799 C  CB  . VAL B 1 125 ? -21.650 -35.645 -6.635  1.00 28.84 ? 123 VAL I CB  1 
ATOM   1800 C  CG1 . VAL B 1 125 ? -21.207 -36.983 -6.071  1.00 26.61 ? 123 VAL I CG1 1 
ATOM   1801 C  CG2 . VAL B 1 125 ? -20.864 -34.513 -6.002  1.00 28.12 ? 123 VAL I CG2 1 
ATOM   1802 N  N   . THR B 1 126 ? -21.745 -37.560 -9.557  1.00 30.05 ? 124 THR I N   1 
ATOM   1803 C  CA  . THR B 1 126 ? -22.471 -38.608 -10.236 1.00 30.44 ? 124 THR I CA  1 
ATOM   1804 C  C   . THR B 1 126 ? -22.246 -39.919 -9.495  1.00 31.17 ? 124 THR I C   1 
ATOM   1805 O  O   . THR B 1 126 ? -21.096 -40.299 -9.231  1.00 31.35 ? 124 THR I O   1 
ATOM   1806 C  CB  . THR B 1 126 ? -21.988 -38.757 -11.699 1.00 30.39 ? 124 THR I CB  1 
ATOM   1807 O  OG1 . THR B 1 126 ? -22.087 -37.488 -12.357 1.00 28.69 ? 124 THR I OG1 1 
ATOM   1808 C  CG2 . THR B 1 126 ? -22.823 -39.801 -12.455 1.00 29.22 ? 124 THR I CG2 1 
ATOM   1809 N  N   . VAL B 1 127 ? -23.341 -40.599 -9.161  1.00 31.03 ? 125 VAL I N   1 
ATOM   1810 C  CA  . VAL B 1 127 ? -23.267 -41.912 -8.526  1.00 31.22 ? 125 VAL I CA  1 
ATOM   1811 C  C   . VAL B 1 127 ? -23.683 -43.015 -9.510  1.00 32.11 ? 125 VAL I C   1 
ATOM   1812 O  O   . VAL B 1 127 ? -24.827 -43.086 -9.943  1.00 31.89 ? 125 VAL I O   1 
ATOM   1813 C  CB  . VAL B 1 127 ? -24.139 -41.974 -7.265  1.00 30.87 ? 125 VAL I CB  1 
ATOM   1814 C  CG1 . VAL B 1 127 ? -23.913 -43.282 -6.543  1.00 30.70 ? 125 VAL I CG1 1 
ATOM   1815 C  CG2 . VAL B 1 127 ? -23.842 -40.788 -6.350  1.00 29.36 ? 125 VAL I CG2 1 
ATOM   1816 N  N   . SER B 1 128 ? -22.741 -43.877 -9.864  1.00 33.45 ? 126 SER I N   1 
ATOM   1817 C  CA  . SER B 1 128 ? -22.976 -44.864 -10.912 1.00 34.07 ? 126 SER I CA  1 
ATOM   1818 C  C   . SER B 1 128 ? -22.215 -46.159 -10.637 1.00 34.73 ? 126 SER I C   1 
ATOM   1819 O  O   . SER B 1 128 ? -21.148 -46.148 -10.014 1.00 34.11 ? 126 SER I O   1 
ATOM   1820 C  CB  . SER B 1 128 ? -22.570 -44.282 -12.270 1.00 34.26 ? 126 SER I CB  1 
ATOM   1821 O  OG  . SER B 1 128 ? -23.365 -44.812 -13.318 1.00 35.00 ? 126 SER I OG  1 
ATOM   1822 N  N   . SER B 1 129 ? -22.775 -47.268 -11.123 1.00 35.93 ? 127 SER I N   1 
ATOM   1823 C  CA  . SER B 1 129 ? -22.242 -48.612 -10.864 1.00 36.89 ? 127 SER I CA  1 
ATOM   1824 C  C   . SER B 1 129 ? -21.233 -49.099 -11.920 1.00 38.04 ? 127 SER I C   1 
ATOM   1825 O  O   . SER B 1 129 ? -20.478 -50.052 -11.676 1.00 38.22 ? 127 SER I O   1 
ATOM   1826 C  CB  . SER B 1 129 ? -23.397 -49.612 -10.748 1.00 36.41 ? 127 SER I CB  1 
ATOM   1827 N  N   . LEU B 1 130 ? -21.223 -48.453 -13.087 1.00 39.45 ? 128 LEU I N   1 
ATOM   1828 C  CA  . LEU B 1 130 ? -20.325 -48.849 -14.192 1.00 40.35 ? 128 LEU I CA  1 
ATOM   1829 C  C   . LEU B 1 130 ? -19.844 -47.637 -14.998 1.00 40.86 ? 128 LEU I C   1 
ATOM   1830 O  O   . LEU B 1 130 ? -20.501 -47.217 -15.954 1.00 41.67 ? 128 LEU I O   1 
ATOM   1831 C  CB  . LEU B 1 130 ? -21.017 -49.858 -15.125 1.00 39.82 ? 128 LEU I CB  1 
ATOM   1832 N  N   . GLU C 2 3   ? 20.025  -34.774 -7.776  1.00 37.36 ? 1   GLU L N   1 
ATOM   1833 C  CA  . GLU C 2 3   ? 19.158  -34.169 -6.723  1.00 38.11 ? 1   GLU L CA  1 
ATOM   1834 C  C   . GLU C 2 3   ? 19.897  -33.234 -5.747  1.00 37.21 ? 1   GLU L C   1 
ATOM   1835 O  O   . GLU C 2 3   ? 20.852  -33.647 -5.079  1.00 36.77 ? 1   GLU L O   1 
ATOM   1836 C  CB  . GLU C 2 3   ? 18.440  -35.263 -5.928  1.00 38.63 ? 1   GLU L CB  1 
ATOM   1837 C  CG  . GLU C 2 3   ? 17.601  -34.704 -4.768  1.00 40.29 ? 1   GLU L CG  1 
ATOM   1838 C  CD  . GLU C 2 3   ? 16.441  -35.604 -4.354  1.00 44.06 ? 1   GLU L CD  1 
ATOM   1839 O  OE1 . GLU C 2 3   ? 15.880  -35.341 -3.259  1.00 44.34 ? 1   GLU L OE1 1 
ATOM   1840 O  OE2 . GLU C 2 3   ? 16.089  -36.553 -5.116  1.00 45.53 ? 1   GLU L OE2 1 
ATOM   1841 N  N   . ILE C 2 4   ? 19.405  -31.994 -5.653  1.00 36.12 ? 2   ILE L N   1 
ATOM   1842 C  CA  . ILE C 2 4   ? 19.994  -30.964 -4.801  1.00 35.52 ? 2   ILE L CA  1 
ATOM   1843 C  C   . ILE C 2 4   ? 19.329  -30.950 -3.430  1.00 35.90 ? 2   ILE L C   1 
ATOM   1844 O  O   . ILE C 2 4   ? 18.104  -30.886 -3.325  1.00 36.44 ? 2   ILE L O   1 
ATOM   1845 C  CB  . ILE C 2 4   ? 19.844  -29.559 -5.418  1.00 34.99 ? 2   ILE L CB  1 
ATOM   1846 C  CG1 . ILE C 2 4   ? 20.607  -29.469 -6.737  1.00 33.68 ? 2   ILE L CG1 1 
ATOM   1847 C  CG2 . ILE C 2 4   ? 20.345  -28.493 -4.461  1.00 33.85 ? 2   ILE L CG2 1 
ATOM   1848 C  CD1 . ILE C 2 4   ? 20.284  -28.239 -7.532  1.00 31.36 ? 2   ILE L CD1 1 
ATOM   1849 N  N   . VAL C 2 5   ? 20.146  -31.010 -2.383  1.00 35.87 ? 3   VAL L N   1 
ATOM   1850 C  CA  . VAL C 2 5   ? 19.653  -30.885 -1.015  1.00 35.67 ? 3   VAL L CA  1 
ATOM   1851 C  C   . VAL C 2 5   ? 19.769  -29.451 -0.531  1.00 35.55 ? 3   VAL L C   1 
ATOM   1852 O  O   . VAL C 2 5   ? 20.827  -28.823 -0.650  1.00 35.37 ? 3   VAL L O   1 
ATOM   1853 C  CB  . VAL C 2 5   ? 20.411  -31.805 -0.031  1.00 35.61 ? 3   VAL L CB  1 
ATOM   1854 C  CG1 . VAL C 2 5   ? 20.090  -31.435 1.410   1.00 33.93 ? 3   VAL L CG1 1 
ATOM   1855 C  CG2 . VAL C 2 5   ? 20.070  -33.264 -0.297  1.00 35.97 ? 3   VAL L CG2 1 
ATOM   1856 N  N   . LEU C 2 6   ? 18.675  -28.945 0.027   1.00 35.54 ? 4   LEU L N   1 
ATOM   1857 C  CA  . LEU C 2 6   ? 18.666  -27.613 0.604   1.00 35.90 ? 4   LEU L CA  1 
ATOM   1858 C  C   . LEU C 2 6   ? 18.590  -27.710 2.120   1.00 36.64 ? 4   LEU L C   1 
ATOM   1859 O  O   . LEU C 2 6   ? 17.533  -27.993 2.687   1.00 37.97 ? 4   LEU L O   1 
ATOM   1860 C  CB  . LEU C 2 6   ? 17.499  -26.794 0.063   1.00 35.38 ? 4   LEU L CB  1 
ATOM   1861 C  CG  . LEU C 2 6   ? 17.523  -26.581 -1.447  1.00 34.00 ? 4   LEU L CG  1 
ATOM   1862 C  CD1 . LEU C 2 6   ? 16.175  -26.035 -1.926  1.00 32.87 ? 4   LEU L CD1 1 
ATOM   1863 C  CD2 . LEU C 2 6   ? 18.680  -25.671 -1.846  1.00 30.57 ? 4   LEU L CD2 1 
ATOM   1864 N  N   . THR C 2 7   ? 19.720  -27.481 2.767   1.00 36.64 ? 5   THR L N   1 
ATOM   1865 C  CA  . THR C 2 7   ? 19.793  -27.536 4.213   1.00 37.22 ? 5   THR L CA  1 
ATOM   1866 C  C   . THR C 2 7   ? 19.518  -26.150 4.804   1.00 37.84 ? 5   THR L C   1 
ATOM   1867 O  O   . THR C 2 7   ? 20.222  -25.173 4.485   1.00 37.14 ? 5   THR L O   1 
ATOM   1868 C  CB  . THR C 2 7   ? 21.181  -28.013 4.657   1.00 37.35 ? 5   THR L CB  1 
ATOM   1869 O  OG1 . THR C 2 7   ? 21.599  -29.107 3.823   1.00 37.96 ? 5   THR L OG1 1 
ATOM   1870 C  CG2 . THR C 2 7   ? 21.159  -28.436 6.115   1.00 36.30 ? 5   THR L CG2 1 
ATOM   1871 N  N   . GLN C 2 8   ? 18.493  -26.071 5.657   1.00 38.16 ? 6   GLN L N   1 
ATOM   1872 C  CA  . GLN C 2 8   ? 18.110  -24.801 6.286   1.00 38.48 ? 6   GLN L CA  1 
ATOM   1873 C  C   . GLN C 2 8   ? 18.655  -24.692 7.682   1.00 38.64 ? 6   GLN L C   1 
ATOM   1874 O  O   . GLN C 2 8   ? 18.640  -25.655 8.442   1.00 38.87 ? 6   GLN L O   1 
ATOM   1875 C  CB  . GLN C 2 8   ? 16.599  -24.627 6.349   1.00 38.51 ? 6   GLN L CB  1 
ATOM   1876 C  CG  . GLN C 2 8   ? 15.963  -24.483 4.989   1.00 40.50 ? 6   GLN L CG  1 
ATOM   1877 C  CD  . GLN C 2 8   ? 14.607  -23.819 5.027   1.00 41.12 ? 6   GLN L CD  1 
ATOM   1878 O  OE1 . GLN C 2 8   ? 13.759  -24.101 4.191   1.00 41.62 ? 6   GLN L OE1 1 
ATOM   1879 N  NE2 . GLN C 2 8   ? 14.397  -22.929 5.994   1.00 41.82 ? 6   GLN L NE2 1 
ATOM   1880 N  N   . SER C 2 9   ? 19.107  -23.489 8.008   1.00 38.85 ? 7   SER L N   1 
ATOM   1881 C  CA  . SER C 2 9   ? 19.707  -23.187 9.298   1.00 39.18 ? 7   SER L CA  1 
ATOM   1882 C  C   . SER C 2 9   ? 19.243  -21.786 9.743   1.00 38.69 ? 7   SER L C   1 
ATOM   1883 O  O   . SER C 2 9   ? 19.177  -20.865 8.919   1.00 38.44 ? 7   SER L O   1 
ATOM   1884 C  CB  . SER C 2 9   ? 21.230  -23.219 9.152   1.00 39.35 ? 7   SER L CB  1 
ATOM   1885 O  OG  . SER C 2 9   ? 21.854  -23.640 10.345  1.00 40.78 ? 7   SER L OG  1 
ATOM   1886 N  N   . PRO C 2 10  ? 18.895  -21.617 11.032  1.00 38.14 ? 8   PRO L N   1 
ATOM   1887 C  CA  . PRO C 2 10  ? 18.830  -22.605 12.103  1.00 38.22 ? 8   PRO L CA  1 
ATOM   1888 C  C   . PRO C 2 10  ? 17.495  -23.344 12.098  1.00 38.18 ? 8   PRO L C   1 
ATOM   1889 O  O   . PRO C 2 10  ? 16.537  -22.885 11.479  1.00 38.98 ? 8   PRO L O   1 
ATOM   1890 C  CB  . PRO C 2 10  ? 18.950  -21.747 13.358  1.00 38.14 ? 8   PRO L CB  1 
ATOM   1891 C  CG  . PRO C 2 10  ? 18.296  -20.467 12.976  1.00 37.63 ? 8   PRO L CG  1 
ATOM   1892 C  CD  . PRO C 2 10  ? 18.497  -20.280 11.506  1.00 37.59 ? 8   PRO L CD  1 
ATOM   1893 N  N   . GLY C 2 11  ? 17.431  -24.481 12.774  1.00 37.98 ? 9   GLY L N   1 
ATOM   1894 C  CA  . GLY C 2 11  ? 16.180  -25.233 12.856  1.00 37.94 ? 9   GLY L CA  1 
ATOM   1895 C  C   . GLY C 2 11  ? 15.064  -24.438 13.518  1.00 37.90 ? 9   GLY L C   1 
ATOM   1896 O  O   . GLY C 2 11  ? 13.920  -24.485 13.087  1.00 37.34 ? 9   GLY L O   1 
ATOM   1897 N  N   . THR C 2 12  ? 15.413  -23.700 14.569  1.00 38.61 ? 10  THR L N   1 
ATOM   1898 C  CA  . THR C 2 12  ? 14.434  -22.960 15.360  1.00 38.42 ? 10  THR L CA  1 
ATOM   1899 C  C   . THR C 2 12  ? 14.979  -21.611 15.817  1.00 38.75 ? 10  THR L C   1 
ATOM   1900 O  O   . THR C 2 12  ? 15.802  -21.541 16.718  1.00 39.39 ? 10  THR L O   1 
ATOM   1901 C  CB  . THR C 2 12  ? 14.000  -23.771 16.584  1.00 38.25 ? 10  THR L CB  1 
ATOM   1902 O  OG1 . THR C 2 12  ? 13.171  -24.855 16.156  1.00 37.37 ? 10  THR L OG1 1 
ATOM   1903 C  CG2 . THR C 2 12  ? 13.220  -22.910 17.560  1.00 38.06 ? 10  THR L CG2 1 
ATOM   1904 N  N   . GLN C 2 13  ? 14.519  -20.553 15.157  1.00 38.93 ? 11  GLN L N   1 
ATOM   1905 C  CA  . GLN C 2 13  ? 14.750  -19.171 15.567  1.00 38.98 ? 11  GLN L CA  1 
ATOM   1906 C  C   . GLN C 2 13  ? 13.777  -18.782 16.664  1.00 38.90 ? 11  GLN L C   1 
ATOM   1907 O  O   . GLN C 2 13  ? 12.565  -18.946 16.510  1.00 38.77 ? 11  GLN L O   1 
ATOM   1908 C  CB  . GLN C 2 13  ? 14.500  -18.230 14.389  1.00 39.47 ? 11  GLN L CB  1 
ATOM   1909 C  CG  . GLN C 2 13  ? 15.703  -17.938 13.549  1.00 40.57 ? 11  GLN L CG  1 
ATOM   1910 C  CD  . GLN C 2 13  ? 16.665  -17.034 14.263  1.00 43.25 ? 11  GLN L CD  1 
ATOM   1911 O  OE1 . GLN C 2 13  ? 16.257  -16.081 14.931  1.00 45.56 ? 11  GLN L OE1 1 
ATOM   1912 N  NE2 . GLN C 2 13  ? 17.955  -17.323 14.140  1.00 44.95 ? 11  GLN L NE2 1 
ATOM   1913 N  N   . SER C 2 14  ? 14.302  -18.238 17.755  1.00 38.99 ? 12  SER L N   1 
ATOM   1914 C  CA  . SER C 2 14  ? 13.470  -17.771 18.860  1.00 39.19 ? 12  SER L CA  1 
ATOM   1915 C  C   . SER C 2 14  ? 13.728  -16.290 19.120  1.00 39.26 ? 12  SER L C   1 
ATOM   1916 O  O   . SER C 2 14  ? 14.753  -15.924 19.702  1.00 39.20 ? 12  SER L O   1 
ATOM   1917 C  CB  . SER C 2 14  ? 13.756  -18.584 20.121  1.00 39.34 ? 12  SER L CB  1 
ATOM   1918 O  OG  . SER C 2 14  ? 13.370  -19.936 19.947  1.00 39.33 ? 12  SER L OG  1 
ATOM   1919 N  N   . LEU C 2 15  ? 12.793  -15.446 18.689  1.00 39.29 ? 13  LEU L N   1 
ATOM   1920 C  CA  . LEU C 2 15  ? 12.967  -13.991 18.760  1.00 39.51 ? 13  LEU L CA  1 
ATOM   1921 C  C   . LEU C 2 15  ? 11.730  -13.270 19.292  1.00 39.62 ? 13  LEU L C   1 
ATOM   1922 O  O   . LEU C 2 15  ? 10.668  -13.869 19.431  1.00 40.28 ? 13  LEU L O   1 
ATOM   1923 C  CB  . LEU C 2 15  ? 13.299  -13.442 17.370  1.00 39.64 ? 13  LEU L CB  1 
ATOM   1924 C  CG  . LEU C 2 15  ? 14.660  -13.821 16.777  1.00 39.78 ? 13  LEU L CG  1 
ATOM   1925 C  CD1 . LEU C 2 15  ? 14.685  -13.566 15.270  1.00 38.42 ? 13  LEU L CD1 1 
ATOM   1926 C  CD2 . LEU C 2 15  ? 15.782  -13.060 17.492  1.00 38.58 ? 13  LEU L CD2 1 
ATOM   1927 N  N   . SER C 2 16  ? 11.884  -11.976 19.571  1.00 39.55 ? 14  SER L N   1 
ATOM   1928 C  CA  . SER C 2 16  ? 10.789  -11.116 20.040  1.00 39.25 ? 14  SER L CA  1 
ATOM   1929 C  C   . SER C 2 16  ? 10.254  -10.199 18.930  1.00 39.35 ? 14  SER L C   1 
ATOM   1930 O  O   . SER C 2 16  ? 10.986  -9.854  18.005  1.00 39.30 ? 14  SER L O   1 
ATOM   1931 C  CB  . SER C 2 16  ? 11.266  -10.242 21.203  1.00 39.09 ? 14  SER L CB  1 
ATOM   1932 O  OG  . SER C 2 16  ? 11.570  -11.010 22.352  1.00 38.19 ? 14  SER L OG  1 
ATOM   1933 N  N   . PRO C 2 17  ? 8.973   -9.790  19.027  1.00 39.47 ? 15  PRO L N   1 
ATOM   1934 C  CA  . PRO C 2 17  ? 8.376   -8.849  18.076  1.00 39.48 ? 15  PRO L CA  1 
ATOM   1935 C  C   . PRO C 2 17  ? 9.188   -7.566  17.920  1.00 39.77 ? 15  PRO L C   1 
ATOM   1936 O  O   . PRO C 2 17  ? 9.548   -6.924  18.916  1.00 39.44 ? 15  PRO L O   1 
ATOM   1937 C  CB  . PRO C 2 17  ? 7.016   -8.522  18.704  1.00 39.54 ? 15  PRO L CB  1 
ATOM   1938 C  CG  . PRO C 2 17  ? 6.698   -9.670  19.571  1.00 39.56 ? 15  PRO L CG  1 
ATOM   1939 C  CD  . PRO C 2 17  ? 8.008   -10.218 20.057  1.00 39.61 ? 15  PRO L CD  1 
ATOM   1940 N  N   . GLY C 2 18  ? 9.466   -7.198  16.675  1.00 39.88 ? 16  GLY L N   1 
ATOM   1941 C  CA  . GLY C 2 18  ? 10.220  -5.980  16.388  1.00 39.96 ? 16  GLY L CA  1 
ATOM   1942 C  C   . GLY C 2 18  ? 11.699  -6.238  16.166  1.00 39.91 ? 16  GLY L C   1 
ATOM   1943 O  O   . GLY C 2 18  ? 12.433  -5.343  15.746  1.00 39.90 ? 16  GLY L O   1 
ATOM   1944 N  N   . GLU C 2 19  ? 12.136  -7.463  16.450  1.00 39.73 ? 17  GLU L N   1 
ATOM   1945 C  CA  . GLU C 2 19  ? 13.534  -7.844  16.255  1.00 39.74 ? 17  GLU L CA  1 
ATOM   1946 C  C   . GLU C 2 19  ? 13.745  -8.361  14.829  1.00 39.56 ? 17  GLU L C   1 
ATOM   1947 O  O   . GLU C 2 19  ? 12.810  -8.411  14.025  1.00 39.33 ? 17  GLU L O   1 
ATOM   1948 C  CB  . GLU C 2 19  ? 13.981  -8.875  17.309  1.00 39.96 ? 17  GLU L CB  1 
ATOM   1949 C  CG  . GLU C 2 19  ? 14.352  -8.247  18.661  1.00 40.98 ? 17  GLU L CG  1 
ATOM   1950 C  CD  . GLU C 2 19  ? 14.892  -9.243  19.690  1.00 42.12 ? 17  GLU L CD  1 
ATOM   1951 O  OE1 . GLU C 2 19  ? 14.370  -10.382 19.762  1.00 41.53 ? 17  GLU L OE1 1 
ATOM   1952 O  OE2 . GLU C 2 19  ? 15.828  -8.866  20.442  1.00 41.34 ? 17  GLU L OE2 1 
ATOM   1953 N  N   . ARG C 2 20  ? 14.982  -8.745  14.530  1.00 39.25 ? 18  ARG L N   1 
ATOM   1954 C  CA  . ARG C 2 20  ? 15.403  -9.066  13.166  1.00 39.02 ? 18  ARG L CA  1 
ATOM   1955 C  C   . ARG C 2 20  ? 15.669  -10.566 12.960  1.00 38.05 ? 18  ARG L C   1 
ATOM   1956 O  O   . ARG C 2 20  ? 16.358  -11.194 13.756  1.00 38.03 ? 18  ARG L O   1 
ATOM   1957 C  CB  . ARG C 2 20  ? 16.665  -8.266  12.851  1.00 39.21 ? 18  ARG L CB  1 
ATOM   1958 C  CG  . ARG C 2 20  ? 17.158  -8.393  11.436  1.00 40.54 ? 18  ARG L CG  1 
ATOM   1959 C  CD  . ARG C 2 20  ? 18.532  -7.750  11.278  1.00 42.86 ? 18  ARG L CD  1 
ATOM   1960 N  NE  . ARG C 2 20  ? 19.017  -7.902  9.910   1.00 44.69 ? 18  ARG L NE  1 
ATOM   1961 C  CZ  . ARG C 2 20  ? 18.827  -7.018  8.932   1.00 45.49 ? 18  ARG L CZ  1 
ATOM   1962 N  NH1 . ARG C 2 20  ? 18.179  -5.876  9.160   1.00 45.23 ? 18  ARG L NH1 1 
ATOM   1963 N  NH2 . ARG C 2 20  ? 19.300  -7.280  7.717   1.00 45.24 ? 18  ARG L NH2 1 
ATOM   1964 N  N   . ALA C 2 21  ? 15.138  -11.130 11.882  1.00 36.85 ? 19  ALA L N   1 
ATOM   1965 C  CA  . ALA C 2 21  ? 15.307  -12.559 11.614  1.00 36.38 ? 19  ALA L CA  1 
ATOM   1966 C  C   . ALA C 2 21  ? 16.148  -12.821 10.366  1.00 35.84 ? 19  ALA L C   1 
ATOM   1967 O  O   . ALA C 2 21  ? 15.792  -12.390 9.270   1.00 35.96 ? 19  ALA L O   1 
ATOM   1968 C  CB  . ALA C 2 21  ? 13.959  -13.222 11.475  1.00 36.23 ? 19  ALA L CB  1 
ATOM   1969 N  N   . THR C 2 22  ? 17.257  -13.536 10.541  1.00 35.06 ? 20  THR L N   1 
ATOM   1970 C  CA  . THR C 2 22  ? 18.127  -13.923 9.427   1.00 34.41 ? 20  THR L CA  1 
ATOM   1971 C  C   . THR C 2 22  ? 18.105  -15.449 9.281   1.00 34.20 ? 20  THR L C   1 
ATOM   1972 O  O   . THR C 2 22  ? 18.544  -16.176 10.172  1.00 33.65 ? 20  THR L O   1 
ATOM   1973 C  CB  . THR C 2 22  ? 19.574  -13.392 9.624   1.00 34.32 ? 20  THR L CB  1 
ATOM   1974 O  OG1 . THR C 2 22  ? 19.560  -11.959 9.592   1.00 34.05 ? 20  THR L OG1 1 
ATOM   1975 C  CG2 . THR C 2 22  ? 20.519  -13.901 8.534   1.00 33.11 ? 20  THR L CG2 1 
ATOM   1976 N  N   . LEU C 2 23  ? 17.560  -15.920 8.160   1.00 34.17 ? 21  LEU L N   1 
ATOM   1977 C  CA  . LEU C 2 23  ? 17.366  -17.352 7.922   1.00 34.14 ? 21  LEU L CA  1 
ATOM   1978 C  C   . LEU C 2 23  ? 18.258  -17.842 6.781   1.00 33.74 ? 21  LEU L C   1 
ATOM   1979 O  O   . LEU C 2 23  ? 18.316  -17.210 5.735   1.00 33.46 ? 21  LEU L O   1 
ATOM   1980 C  CB  . LEU C 2 23  ? 15.903  -17.644 7.576   1.00 34.63 ? 21  LEU L CB  1 
ATOM   1981 C  CG  . LEU C 2 23  ? 14.775  -17.318 8.566   1.00 34.44 ? 21  LEU L CG  1 
ATOM   1982 C  CD1 . LEU C 2 23  ? 14.941  -15.953 9.177   1.00 34.22 ? 21  LEU L CD1 1 
ATOM   1983 C  CD2 . LEU C 2 23  ? 13.431  -17.425 7.853   1.00 32.12 ? 21  LEU L CD2 1 
ATOM   1984 N  N   . SER C 2 24  ? 18.926  -18.978 6.983   1.00 33.60 ? 22  SER L N   1 
ATOM   1985 C  CA  . SER C 2 24  ? 19.899  -19.495 6.014   1.00 34.06 ? 22  SER L CA  1 
ATOM   1986 C  C   . SER C 2 24  ? 19.356  -20.675 5.197   1.00 34.54 ? 22  SER L C   1 
ATOM   1987 O  O   . SER C 2 24  ? 18.577  -21.488 5.690   1.00 33.50 ? 22  SER L O   1 
ATOM   1988 C  CB  . SER C 2 24  ? 21.191  -19.937 6.729   1.00 34.29 ? 22  SER L CB  1 
ATOM   1989 O  OG  . SER C 2 24  ? 21.642  -18.976 7.675   1.00 33.86 ? 22  SER L OG  1 
ATOM   1990 N  N   . CYS C 2 25  ? 19.790  -20.760 3.945   1.00 35.77 ? 23  CYS L N   1 
ATOM   1991 C  CA  . CYS C 2 25  ? 19.467  -21.895 3.074   1.00 36.96 ? 23  CYS L CA  1 
ATOM   1992 C  C   . CYS C 2 25  ? 20.731  -22.296 2.315   1.00 37.89 ? 23  CYS L C   1 
ATOM   1993 O  O   . CYS C 2 25  ? 21.306  -21.510 1.558   1.00 38.09 ? 23  CYS L O   1 
ATOM   1994 C  CB  . CYS C 2 25  ? 18.294  -21.565 2.126   1.00 36.99 ? 23  CYS L CB  1 
ATOM   1995 S  SG  . CYS C 2 25  ? 17.846  -22.832 0.892   1.00 37.38 ? 23  CYS L SG  1 
ATOM   1996 N  N   . ARG C 2 26  ? 21.176  -23.520 2.571   1.00 38.99 ? 24  ARG L N   1 
ATOM   1997 C  CA  . ARG C 2 26  ? 22.408  -24.048 1.989   1.00 39.66 ? 24  ARG L CA  1 
ATOM   1998 C  C   . ARG C 2 26  ? 22.070  -25.143 0.980   1.00 39.19 ? 24  ARG L C   1 
ATOM   1999 O  O   . ARG C 2 26  ? 21.426  -26.134 1.319   1.00 39.29 ? 24  ARG L O   1 
ATOM   2000 C  CB  . ARG C 2 26  ? 23.306  -24.608 3.092   1.00 40.09 ? 24  ARG L CB  1 
ATOM   2001 C  CG  . ARG C 2 26  ? 24.612  -25.200 2.614   1.00 42.60 ? 24  ARG L CG  1 
ATOM   2002 C  CD  . ARG C 2 26  ? 25.533  -24.140 2.033   1.00 45.44 ? 24  ARG L CD  1 
ATOM   2003 N  NE  . ARG C 2 26  ? 25.839  -23.091 2.997   1.00 48.10 ? 24  ARG L NE  1 
ATOM   2004 C  CZ  . ARG C 2 26  ? 26.650  -22.065 2.753   1.00 51.27 ? 24  ARG L CZ  1 
ATOM   2005 N  NH1 . ARG C 2 26  ? 27.240  -21.942 1.567   1.00 51.72 ? 24  ARG L NH1 1 
ATOM   2006 N  NH2 . ARG C 2 26  ? 26.874  -21.159 3.700   1.00 52.77 ? 24  ARG L NH2 1 
ATOM   2007 N  N   . ALA C 2 27  ? 22.504  -24.945 -0.258  1.00 38.79 ? 25  ALA L N   1 
ATOM   2008 C  CA  . ALA C 2 27  ? 22.214  -25.872 -1.346  1.00 38.38 ? 25  ALA L CA  1 
ATOM   2009 C  C   . ALA C 2 27  ? 23.451  -26.715 -1.662  1.00 37.77 ? 25  ALA L C   1 
ATOM   2010 O  O   . ALA C 2 27  ? 24.542  -26.180 -1.794  1.00 37.32 ? 25  ALA L O   1 
ATOM   2011 C  CB  . ALA C 2 27  ? 21.753  -25.096 -2.581  1.00 38.14 ? 25  ALA L CB  1 
ATOM   2012 N  N   . SER C 2 28  ? 23.264  -28.027 -1.802  1.00 37.66 ? 26  SER L N   1 
ATOM   2013 C  CA  . SER C 2 28  ? 24.384  -28.973 -1.969  1.00 38.02 ? 26  SER L CA  1 
ATOM   2014 C  C   . SER C 2 28  ? 25.140  -28.829 -3.293  1.00 38.22 ? 26  SER L C   1 
ATOM   2015 O  O   . SER C 2 28  ? 26.251  -29.320 -3.428  1.00 38.42 ? 26  SER L O   1 
ATOM   2016 C  CB  . SER C 2 28  ? 23.899  -30.421 -1.810  1.00 38.17 ? 26  SER L CB  1 
ATOM   2017 O  OG  . SER C 2 28  ? 22.710  -30.656 -2.548  1.00 36.81 ? 26  SER L OG  1 
ATOM   2018 N  N   . GLN C 2 29  ? 24.515  -28.182 -4.268  1.00 38.57 ? 27  GLN L N   1 
ATOM   2019 C  CA  . GLN C 2 29  ? 25.180  -27.797 -5.509  1.00 38.82 ? 27  GLN L CA  1 
ATOM   2020 C  C   . GLN C 2 29  ? 24.696  -26.406 -5.868  1.00 38.30 ? 27  GLN L C   1 
ATOM   2021 O  O   . GLN C 2 29  ? 23.776  -25.890 -5.239  1.00 38.19 ? 27  GLN L O   1 
ATOM   2022 C  CB  . GLN C 2 29  ? 24.838  -28.754 -6.652  1.00 39.30 ? 27  GLN L CB  1 
ATOM   2023 C  CG  . GLN C 2 29  ? 25.246  -30.204 -6.440  1.00 41.23 ? 27  GLN L CG  1 
ATOM   2024 C  CD  . GLN C 2 29  ? 24.295  -31.165 -7.149  1.00 43.81 ? 27  GLN L CD  1 
ATOM   2025 O  OE1 . GLN C 2 29  ? 23.715  -32.060 -6.522  1.00 46.08 ? 27  GLN L OE1 1 
ATOM   2026 N  NE2 . GLN C 2 29  ? 24.109  -30.964 -8.452  1.00 42.74 ? 27  GLN L NE2 1 
ATOM   2027 N  N   . SER C 2 30  ? 25.305  -25.802 -6.880  1.00 37.94 ? 28  SER L N   1 
ATOM   2028 C  CA  . SER C 2 30  ? 24.884  -24.476 -7.323  1.00 37.89 ? 28  SER L CA  1 
ATOM   2029 C  C   . SER C 2 30  ? 23.483  -24.509 -7.925  1.00 37.49 ? 28  SER L C   1 
ATOM   2030 O  O   . SER C 2 30  ? 23.177  -25.336 -8.781  1.00 38.00 ? 28  SER L O   1 
ATOM   2031 C  CB  . SER C 2 30  ? 25.860  -23.902 -8.344  1.00 38.17 ? 28  SER L CB  1 
ATOM   2032 O  OG  . SER C 2 30  ? 25.290  -22.770 -8.988  1.00 38.72 ? 28  SER L OG  1 
ATOM   2033 N  N   . VAL C 2 31  ? 22.641  -23.595 -7.464  1.00 36.87 ? 29  VAL L N   1 
ATOM   2034 C  CA  . VAL C 2 31  ? 21.268  -23.473 -7.946  1.00 36.12 ? 29  VAL L CA  1 
ATOM   2035 C  C   . VAL C 2 31  ? 21.242  -22.849 -9.344  1.00 36.33 ? 29  VAL L C   1 
ATOM   2036 O  O   . VAL C 2 31  ? 21.651  -21.709 -9.535  1.00 35.86 ? 29  VAL L O   1 
ATOM   2037 C  CB  . VAL C 2 31  ? 20.429  -22.583 -6.997  1.00 35.52 ? 29  VAL L CB  1 
ATOM   2038 C  CG1 . VAL C 2 31  ? 19.031  -22.383 -7.549  1.00 34.98 ? 29  VAL L CG1 1 
ATOM   2039 C  CG2 . VAL C 2 31  ? 20.381  -23.176 -5.597  1.00 33.13 ? 29  VAL L CG2 1 
ATOM   2040 N  N   . GLY C 2 32  ? 20.745  -23.597 -10.318 1.00 36.94 ? 30  GLY L N   1 
ATOM   2041 C  CA  . GLY C 2 32  ? 20.738  -23.132 -11.707 1.00 37.46 ? 30  GLY L CA  1 
ATOM   2042 C  C   . GLY C 2 32  ? 20.039  -21.792 -11.885 1.00 37.54 ? 30  GLY L C   1 
ATOM   2043 O  O   . GLY C 2 32  ? 18.857  -21.657 -11.570 1.00 37.46 ? 30  GLY L O   1 
ATOM   2044 N  N   . ASN C 2 33  ? 20.768  -20.801 -12.393 1.00 37.49 ? 31  ASN L N   1 
ATOM   2045 C  CA  . ASN C 2 33  ? 20.195  -19.478 -12.655 1.00 37.69 ? 31  ASN L CA  1 
ATOM   2046 C  C   . ASN C 2 33  ? 19.603  -18.776 -11.420 1.00 37.82 ? 31  ASN L C   1 
ATOM   2047 O  O   . ASN C 2 33  ? 18.691  -17.958 -11.545 1.00 37.53 ? 31  ASN L O   1 
ATOM   2048 C  CB  . ASN C 2 33  ? 19.104  -19.584 -13.733 1.00 37.63 ? 31  ASN L CB  1 
ATOM   2049 C  CG  . ASN C 2 33  ? 19.604  -19.228 -15.113 1.00 37.84 ? 31  ASN L CG  1 
ATOM   2050 O  OD1 . ASN C 2 33  ? 20.400  -18.293 -15.292 1.00 39.84 ? 31  ASN L OD1 1 
ATOM   2051 N  ND2 . ASN C 2 33  ? 19.123  -19.958 -16.108 1.00 35.93 ? 31  ASN L ND2 1 
ATOM   2052 N  N   . ASN C 2 34  ? 20.115  -19.082 -10.235 1.00 38.03 ? 32  ASN L N   1 
ATOM   2053 C  CA  . ASN C 2 34  ? 19.587  -18.476 -9.011  1.00 38.46 ? 32  ASN L CA  1 
ATOM   2054 C  C   . ASN C 2 34  ? 18.066  -18.613 -8.907  1.00 38.53 ? 32  ASN L C   1 
ATOM   2055 O  O   . ASN C 2 34  ? 17.386  -17.739 -8.371  1.00 38.96 ? 32  ASN L O   1 
ATOM   2056 C  CB  . ASN C 2 34  ? 19.984  -16.995 -8.930  1.00 38.75 ? 32  ASN L CB  1 
ATOM   2057 C  CG  . ASN C 2 34  ? 21.415  -16.794 -8.451  1.00 39.01 ? 32  ASN L CG  1 
ATOM   2058 O  OD1 . ASN C 2 34  ? 22.027  -17.703 -7.888  1.00 41.82 ? 32  ASN L OD1 1 
ATOM   2059 N  ND2 . ASN C 2 34  ? 21.946  -15.601 -8.663  1.00 35.28 ? 32  ASN L ND2 1 
ATOM   2060 N  N   . LYS C 2 35  ? 17.538  -19.712 -9.430  1.00 38.73 ? 33  LYS L N   1 
ATOM   2061 C  CA  . LYS C 2 35  ? 16.107  -20.012 -9.335  1.00 39.02 ? 33  LYS L CA  1 
ATOM   2062 C  C   . LYS C 2 35  ? 15.775  -20.594 -7.964  1.00 39.03 ? 33  LYS L C   1 
ATOM   2063 O  O   . LYS C 2 35  ? 15.537  -21.793 -7.842  1.00 38.79 ? 33  LYS L O   1 
ATOM   2064 C  CB  . LYS C 2 35  ? 15.693  -21.017 -10.411 1.00 39.05 ? 33  LYS L CB  1 
ATOM   2065 C  CG  . LYS C 2 35  ? 15.819  -20.504 -11.837 1.00 40.18 ? 33  LYS L CG  1 
ATOM   2066 C  CD  . LYS C 2 35  ? 15.037  -19.212 -12.045 1.00 41.50 ? 33  LYS L CD  1 
ATOM   2067 C  CE  . LYS C 2 35  ? 14.576  -19.067 -13.487 1.00 42.38 ? 33  LYS L CE  1 
ATOM   2068 N  NZ  . LYS C 2 35  ? 13.771  -20.250 -13.910 1.00 43.45 ? 33  LYS L NZ  1 
ATOM   2069 N  N   . LEU C 2 36  ? 15.773  -19.734 -6.944  1.00 38.95 ? 34  LEU L N   1 
ATOM   2070 C  CA  . LEU C 2 36  ? 15.481  -20.135 -5.565  1.00 38.44 ? 34  LEU L CA  1 
ATOM   2071 C  C   . LEU C 2 36  ? 14.366  -19.261 -4.999  1.00 37.54 ? 34  LEU L C   1 
ATOM   2072 O  O   . LEU C 2 36  ? 14.425  -18.034 -5.108  1.00 38.32 ? 34  LEU L O   1 
ATOM   2073 C  CB  . LEU C 2 36  ? 16.728  -19.978 -4.687  1.00 38.74 ? 34  LEU L CB  1 
ATOM   2074 C  CG  . LEU C 2 36  ? 16.548  -20.329 -3.204  1.00 38.27 ? 34  LEU L CG  1 
ATOM   2075 C  CD1 . LEU C 2 36  ? 17.141  -21.716 -2.898  1.00 37.58 ? 34  LEU L CD1 1 
ATOM   2076 C  CD2 . LEU C 2 36  ? 17.195  -19.261 -2.344  1.00 38.35 ? 34  LEU L CD2 1 
ATOM   2077 N  N   . ALA C 2 37  ? 13.365  -19.885 -4.384  1.00 36.13 ? 35  ALA L N   1 
ATOM   2078 C  CA  . ALA C 2 37  ? 12.272  -19.134 -3.752  1.00 35.63 ? 35  ALA L CA  1 
ATOM   2079 C  C   . ALA C 2 37  ? 12.148  -19.377 -2.240  1.00 34.87 ? 35  ALA L C   1 
ATOM   2080 O  O   . ALA C 2 37  ? 12.674  -20.347 -1.698  1.00 34.29 ? 35  ALA L O   1 
ATOM   2081 C  CB  . ALA C 2 37  ? 10.945  -19.427 -4.443  1.00 35.48 ? 35  ALA L CB  1 
ATOM   2082 N  N   . TRP C 2 38  ? 11.442  -18.469 -1.575  1.00 34.47 ? 36  TRP L N   1 
ATOM   2083 C  CA  . TRP C 2 38  ? 11.176  -18.569 -0.136  1.00 34.05 ? 36  TRP L CA  1 
ATOM   2084 C  C   . TRP C 2 38  ? 9.672   -18.550 0.089   1.00 33.46 ? 36  TRP L C   1 
ATOM   2085 O  O   . TRP C 2 38  ? 8.954   -17.819 -0.589  1.00 33.97 ? 36  TRP L O   1 
ATOM   2086 C  CB  . TRP C 2 38  ? 11.814  -17.402 0.622   1.00 33.91 ? 36  TRP L CB  1 
ATOM   2087 C  CG  . TRP C 2 38  ? 13.295  -17.512 0.807   1.00 33.17 ? 36  TRP L CG  1 
ATOM   2088 C  CD1 . TRP C 2 38  ? 14.271  -16.985 0.006   1.00 32.84 ? 36  TRP L CD1 1 
ATOM   2089 C  CD2 . TRP C 2 38  ? 13.972  -18.174 1.875   1.00 33.23 ? 36  TRP L CD2 1 
ATOM   2090 N  NE1 . TRP C 2 38  ? 15.515  -17.292 0.504   1.00 30.82 ? 36  TRP L NE1 1 
ATOM   2091 C  CE2 . TRP C 2 38  ? 15.359  -18.020 1.653   1.00 32.11 ? 36  TRP L CE2 1 
ATOM   2092 C  CE3 . TRP C 2 38  ? 13.543  -18.892 2.997   1.00 33.32 ? 36  TRP L CE3 1 
ATOM   2093 C  CZ2 . TRP C 2 38  ? 16.313  -18.550 2.514   1.00 32.42 ? 36  TRP L CZ2 1 
ATOM   2094 C  CZ3 . TRP C 2 38  ? 14.495  -19.419 3.852   1.00 33.12 ? 36  TRP L CZ3 1 
ATOM   2095 C  CH2 . TRP C 2 38  ? 15.862  -19.247 3.607   1.00 32.93 ? 36  TRP L CH2 1 
ATOM   2096 N  N   . TYR C 2 39  ? 9.196   -19.340 1.043   1.00 33.04 ? 37  TYR L N   1 
ATOM   2097 C  CA  . TYR C 2 39  ? 7.755   -19.421 1.329   1.00 32.60 ? 37  TYR L CA  1 
ATOM   2098 C  C   . TYR C 2 39  ? 7.445   -19.319 2.820   1.00 32.22 ? 37  TYR L C   1 
ATOM   2099 O  O   . TYR C 2 39  ? 8.191   -19.835 3.641   1.00 32.29 ? 37  TYR L O   1 
ATOM   2100 C  CB  . TYR C 2 39  ? 7.183   -20.745 0.832   1.00 32.01 ? 37  TYR L CB  1 
ATOM   2101 C  CG  . TYR C 2 39  ? 7.229   -20.940 -0.657  1.00 31.66 ? 37  TYR L CG  1 
ATOM   2102 C  CD1 . TYR C 2 39  ? 8.311   -21.552 -1.257  1.00 29.98 ? 37  TYR L CD1 1 
ATOM   2103 C  CD2 . TYR C 2 39  ? 6.172   -20.540 -1.467  1.00 31.30 ? 37  TYR L CD2 1 
ATOM   2104 C  CE1 . TYR C 2 39  ? 8.349   -21.743 -2.615  1.00 28.00 ? 37  TYR L CE1 1 
ATOM   2105 C  CE2 . TYR C 2 39  ? 6.209   -20.734 -2.827  1.00 28.16 ? 37  TYR L CE2 1 
ATOM   2106 C  CZ  . TYR C 2 39  ? 7.300   -21.334 -3.393  1.00 27.22 ? 37  TYR L CZ  1 
ATOM   2107 O  OH  . TYR C 2 39  ? 7.348   -21.534 -4.752  1.00 26.76 ? 37  TYR L OH  1 
ATOM   2108 N  N   . GLN C 2 40  ? 6.319   -18.685 3.144   1.00 32.31 ? 38  GLN L N   1 
ATOM   2109 C  CA  . GLN C 2 40  ? 5.835   -18.567 4.529   1.00 32.30 ? 38  GLN L CA  1 
ATOM   2110 C  C   . GLN C 2 40  ? 4.666   -19.508 4.711   1.00 32.23 ? 38  GLN L C   1 
ATOM   2111 O  O   . GLN C 2 40  ? 3.792   -19.551 3.854   1.00 32.96 ? 38  GLN L O   1 
ATOM   2112 C  CB  . GLN C 2 40  ? 5.363   -17.138 4.833   1.00 31.84 ? 38  GLN L CB  1 
ATOM   2113 C  CG  . GLN C 2 40  ? 5.081   -16.877 6.312   1.00 31.80 ? 38  GLN L CG  1 
ATOM   2114 C  CD  . GLN C 2 40  ? 4.366   -15.542 6.569   1.00 32.81 ? 38  GLN L CD  1 
ATOM   2115 O  OE1 . GLN C 2 40  ? 3.135   -15.488 6.669   1.00 33.73 ? 38  GLN L OE1 1 
ATOM   2116 N  NE2 . GLN C 2 40  ? 5.135   -14.470 6.680   1.00 32.80 ? 38  GLN L NE2 1 
ATOM   2117 N  N   . GLN C 2 41  ? 4.627   -20.248 5.816   1.00 31.97 ? 39  GLN L N   1 
ATOM   2118 C  CA  . GLN C 2 41  ? 3.445   -21.065 6.115   1.00 31.55 ? 39  GLN L CA  1 
ATOM   2119 C  C   . GLN C 2 41  ? 2.986   -20.968 7.574   1.00 31.48 ? 39  GLN L C   1 
ATOM   2120 O  O   . GLN C 2 41  ? 3.722   -21.334 8.495   1.00 31.47 ? 39  GLN L O   1 
ATOM   2121 C  CB  . GLN C 2 41  ? 3.680   -22.530 5.742   1.00 31.21 ? 39  GLN L CB  1 
ATOM   2122 C  CG  . GLN C 2 41  ? 2.386   -23.341 5.641   1.00 30.95 ? 39  GLN L CG  1 
ATOM   2123 C  CD  . GLN C 2 41  ? 2.631   -24.819 5.469   1.00 31.19 ? 39  GLN L CD  1 
ATOM   2124 O  OE1 . GLN C 2 41  ? 3.709   -25.315 5.773   1.00 34.83 ? 39  GLN L OE1 1 
ATOM   2125 N  NE2 . GLN C 2 41  ? 1.636   -25.531 4.964   1.00 31.38 ? 39  GLN L NE2 1 
ATOM   2126 N  N   . ARG C 2 42  ? 1.755   -20.493 7.760   1.00 31.60 ? 40  ARG L N   1 
ATOM   2127 C  CA  . ARG C 2 42  ? 1.115   -20.436 9.079   1.00 32.18 ? 40  ARG L CA  1 
ATOM   2128 C  C   . ARG C 2 42  ? 0.313   -21.708 9.330   1.00 31.99 ? 40  ARG L C   1 
ATOM   2129 O  O   . ARG C 2 42  ? -0.160  -22.331 8.387   1.00 31.81 ? 40  ARG L O   1 
ATOM   2130 C  CB  . ARG C 2 42  ? 0.194   -19.229 9.171   1.00 32.53 ? 40  ARG L CB  1 
ATOM   2131 C  CG  . ARG C 2 42  ? 0.862   -17.929 8.763   1.00 34.89 ? 40  ARG L CG  1 
ATOM   2132 C  CD  . ARG C 2 42  ? 0.129   -16.721 9.307   1.00 37.86 ? 40  ARG L CD  1 
ATOM   2133 N  NE  . ARG C 2 42  ? 0.806   -15.480 8.928   1.00 40.94 ? 40  ARG L NE  1 
ATOM   2134 C  CZ  . ARG C 2 42  ? 0.348   -14.599 8.038   1.00 42.41 ? 40  ARG L CZ  1 
ATOM   2135 N  NH1 . ARG C 2 42  ? -0.808  -14.795 7.419   1.00 43.75 ? 40  ARG L NH1 1 
ATOM   2136 N  NH2 . ARG C 2 42  ? 1.049   -13.507 7.763   1.00 42.46 ? 40  ARG L NH2 1 
ATOM   2137 N  N   . PRO C 2 43  ? 0.160   -22.107 10.607  1.00 32.10 ? 41  PRO L N   1 
ATOM   2138 C  CA  . PRO C 2 43  ? -0.520  -23.382 10.872  1.00 31.85 ? 41  PRO L CA  1 
ATOM   2139 C  C   . PRO C 2 43  ? -1.846  -23.521 10.136  1.00 31.12 ? 41  PRO L C   1 
ATOM   2140 O  O   . PRO C 2 43  ? -2.671  -22.600 10.144  1.00 30.24 ? 41  PRO L O   1 
ATOM   2141 C  CB  . PRO C 2 43  ? -0.744  -23.361 12.389  1.00 31.59 ? 41  PRO L CB  1 
ATOM   2142 C  CG  . PRO C 2 43  ? 0.332   -22.498 12.913  1.00 31.74 ? 41  PRO L CG  1 
ATOM   2143 C  CD  . PRO C 2 43  ? 0.600   -21.452 11.851  1.00 31.99 ? 41  PRO L CD  1 
ATOM   2144 N  N   . GLY C 2 44  ? -2.020  -24.668 9.489   1.00 30.58 ? 42  GLY L N   1 
ATOM   2145 C  CA  . GLY C 2 44  ? -3.257  -24.988 8.788   1.00 30.51 ? 42  GLY L CA  1 
ATOM   2146 C  C   . GLY C 2 44  ? -3.422  -24.290 7.451   1.00 30.44 ? 42  GLY L C   1 
ATOM   2147 O  O   . GLY C 2 44  ? -4.361  -24.581 6.711   1.00 29.91 ? 42  GLY L O   1 
ATOM   2148 N  N   . GLN C 2 45  ? -2.523  -23.362 7.140   1.00 30.47 ? 43  GLN L N   1 
ATOM   2149 C  CA  . GLN C 2 45  ? -2.632  -22.584 5.914   1.00 30.85 ? 43  GLN L CA  1 
ATOM   2150 C  C   . GLN C 2 45  ? -1.731  -23.154 4.845   1.00 30.62 ? 43  GLN L C   1 
ATOM   2151 O  O   . GLN C 2 45  ? -0.765  -23.862 5.146   1.00 30.53 ? 43  GLN L O   1 
ATOM   2152 C  CB  . GLN C 2 45  ? -2.256  -21.115 6.154   1.00 31.33 ? 43  GLN L CB  1 
ATOM   2153 C  CG  . GLN C 2 45  ? -3.239  -20.358 7.040   1.00 33.29 ? 43  GLN L CG  1 
ATOM   2154 C  CD  . GLN C 2 45  ? -3.085  -18.833 6.965   1.00 35.96 ? 43  GLN L CD  1 
ATOM   2155 O  OE1 . GLN C 2 45  ? -3.173  -18.227 5.891   1.00 36.58 ? 43  GLN L OE1 1 
ATOM   2156 N  NE2 . GLN C 2 45  ? -2.882  -18.211 8.121   1.00 38.00 ? 43  GLN L NE2 1 
ATOM   2157 N  N   . ALA C 2 46  ? -2.045  -22.838 3.593   1.00 29.84 ? 44  ALA L N   1 
ATOM   2158 C  CA  . ALA C 2 46  ? -1.156  -23.180 2.496   1.00 29.52 ? 44  ALA L CA  1 
ATOM   2159 C  C   . ALA C 2 46  ? -0.007  -22.193 2.510   1.00 29.31 ? 44  ALA L C   1 
ATOM   2160 O  O   . ALA C 2 46  ? -0.188  -21.059 2.936   1.00 29.77 ? 44  ALA L O   1 
ATOM   2161 C  CB  . ALA C 2 46  ? -1.885  -23.111 1.183   1.00 29.78 ? 44  ALA L CB  1 
ATOM   2162 N  N   . PRO C 2 47  ? 1.175   -22.605 2.023   1.00 29.07 ? 45  PRO L N   1 
ATOM   2163 C  CA  . PRO C 2 47  ? 2.312   -21.705 2.060   1.00 29.25 ? 45  PRO L CA  1 
ATOM   2164 C  C   . PRO C 2 47  ? 2.107   -20.529 1.130   1.00 29.28 ? 45  PRO L C   1 
ATOM   2165 O  O   . PRO C 2 47  ? 1.308   -20.625 0.193   1.00 30.26 ? 45  PRO L O   1 
ATOM   2166 C  CB  . PRO C 2 47  ? 3.477   -22.561 1.548   1.00 29.72 ? 45  PRO L CB  1 
ATOM   2167 C  CG  . PRO C 2 47  ? 2.965   -23.949 1.459   1.00 30.04 ? 45  PRO L CG  1 
ATOM   2168 C  CD  . PRO C 2 47  ? 1.496   -23.885 1.378   1.00 29.30 ? 45  PRO L CD  1 
ATOM   2169 N  N   . ARG C 2 48  ? 2.845   -19.447 1.373   1.00 28.56 ? 46  ARG L N   1 
ATOM   2170 C  CA  . ARG C 2 48  ? 2.693   -18.202 0.617   1.00 27.96 ? 46  ARG L CA  1 
ATOM   2171 C  C   . ARG C 2 48  ? 4.021   -17.721 0.032   1.00 27.81 ? 46  ARG L C   1 
ATOM   2172 O  O   . ARG C 2 48  ? 5.033   -17.714 0.733   1.00 28.88 ? 46  ARG L O   1 
ATOM   2173 C  CB  . ARG C 2 48  ? 2.130   -17.125 1.529   1.00 27.28 ? 46  ARG L CB  1 
ATOM   2174 C  CG  . ARG C 2 48  ? 1.991   -15.795 0.859   1.00 27.60 ? 46  ARG L CG  1 
ATOM   2175 C  CD  . ARG C 2 48  ? 1.066   -14.913 1.651   1.00 29.41 ? 46  ARG L CD  1 
ATOM   2176 N  NE  . ARG C 2 48  ? 1.657   -14.583 2.938   1.00 29.72 ? 46  ARG L NE  1 
ATOM   2177 C  CZ  . ARG C 2 48  ? 2.414   -13.517 3.162   1.00 30.25 ? 46  ARG L CZ  1 
ATOM   2178 N  NH1 . ARG C 2 48  ? 2.668   -12.665 2.174   1.00 30.23 ? 46  ARG L NH1 1 
ATOM   2179 N  NH2 . ARG C 2 48  ? 2.918   -13.308 4.375   1.00 29.64 ? 46  ARG L NH2 1 
ATOM   2180 N  N   . LEU C 2 49  ? 4.020   -17.302 -1.234  1.00 27.06 ? 47  LEU L N   1 
ATOM   2181 C  CA  . LEU C 2 49  ? 5.269   -16.890 -1.903  1.00 26.62 ? 47  LEU L CA  1 
ATOM   2182 C  C   . LEU C 2 49  ? 5.723   -15.515 -1.429  1.00 26.41 ? 47  LEU L C   1 
ATOM   2183 O  O   . LEU C 2 49  ? 4.974   -14.539 -1.519  1.00 26.05 ? 47  LEU L O   1 
ATOM   2184 C  CB  . LEU C 2 49  ? 5.145   -16.895 -3.439  1.00 26.24 ? 47  LEU L CB  1 
ATOM   2185 C  CG  . LEU C 2 49  ? 6.476   -16.598 -4.164  1.00 27.79 ? 47  LEU L CG  1 
ATOM   2186 C  CD1 . LEU C 2 49  ? 7.518   -17.701 -3.897  1.00 26.61 ? 47  LEU L CD1 1 
ATOM   2187 C  CD2 . LEU C 2 49  ? 6.292   -16.384 -5.677  1.00 26.21 ? 47  LEU L CD2 1 
ATOM   2188 N  N   . LEU C 2 50  ? 6.962   -15.471 -0.931  1.00 26.57 ? 48  LEU L N   1 
ATOM   2189 C  CA  . LEU C 2 50  ? 7.597   -14.260 -0.407  1.00 26.42 ? 48  LEU L CA  1 
ATOM   2190 C  C   . LEU C 2 50  ? 8.639   -13.717 -1.378  1.00 26.69 ? 48  LEU L C   1 
ATOM   2191 O  O   . LEU C 2 50  ? 8.606   -12.547 -1.785  1.00 26.43 ? 48  LEU L O   1 
ATOM   2192 C  CB  . LEU C 2 50  ? 8.309   -14.576 0.907   1.00 26.36 ? 48  LEU L CB  1 
ATOM   2193 C  CG  . LEU C 2 50  ? 7.441   -14.913 2.119   1.00 26.15 ? 48  LEU L CG  1 
ATOM   2194 C  CD1 . LEU C 2 50  ? 8.318   -15.373 3.281   1.00 25.08 ? 48  LEU L CD1 1 
ATOM   2195 C  CD2 . LEU C 2 50  ? 6.597   -13.715 2.521   1.00 25.00 ? 48  LEU L CD2 1 
ATOM   2196 N  N   . ILE C 2 51  ? 9.570   -14.587 -1.742  1.00 26.80 ? 49  ILE L N   1 
ATOM   2197 C  CA  . ILE C 2 51  ? 10.707  -14.206 -2.571  1.00 26.92 ? 49  ILE L CA  1 
ATOM   2198 C  C   . ILE C 2 51  ? 10.862  -15.176 -3.734  1.00 27.43 ? 49  ILE L C   1 
ATOM   2199 O  O   . ILE C 2 51  ? 10.798  -16.384 -3.558  1.00 28.71 ? 49  ILE L O   1 
ATOM   2200 C  CB  . ILE C 2 51  ? 11.987  -14.194 -1.725  1.00 26.48 ? 49  ILE L CB  1 
ATOM   2201 C  CG1 . ILE C 2 51  ? 11.983  -12.977 -0.803  1.00 25.79 ? 49  ILE L CG1 1 
ATOM   2202 C  CG2 . ILE C 2 51  ? 13.221  -14.185 -2.598  1.00 26.79 ? 49  ILE L CG2 1 
ATOM   2203 C  CD1 . ILE C 2 51  ? 12.316  -11.672 -1.509  1.00 24.26 ? 49  ILE L CD1 1 
ATOM   2204 N  N   . TYR C 2 52  ? 11.041  -14.654 -4.935  1.00 27.94 ? 50  TYR L N   1 
ATOM   2205 C  CA  . TYR C 2 52  ? 11.294  -15.525 -6.079  1.00 28.17 ? 50  TYR L CA  1 
ATOM   2206 C  C   . TYR C 2 52  ? 12.530  -15.043 -6.837  1.00 28.37 ? 50  TYR L C   1 
ATOM   2207 O  O   . TYR C 2 52  ? 12.905  -13.871 -6.747  1.00 28.87 ? 50  TYR L O   1 
ATOM   2208 C  CB  . TYR C 2 52  ? 10.063  -15.621 -6.993  1.00 27.79 ? 50  TYR L CB  1 
ATOM   2209 C  CG  . TYR C 2 52  ? 9.796   -14.417 -7.853  1.00 26.80 ? 50  TYR L CG  1 
ATOM   2210 C  CD1 . TYR C 2 52  ? 10.360  -14.312 -9.122  1.00 27.33 ? 50  TYR L CD1 1 
ATOM   2211 C  CD2 . TYR C 2 52  ? 8.954   -13.398 -7.420  1.00 26.57 ? 50  TYR L CD2 1 
ATOM   2212 C  CE1 . TYR C 2 52  ? 10.116  -13.215 -9.927  1.00 26.28 ? 50  TYR L CE1 1 
ATOM   2213 C  CE2 . TYR C 2 52  ? 8.695   -12.295 -8.224  1.00 26.28 ? 50  TYR L CE2 1 
ATOM   2214 C  CZ  . TYR C 2 52  ? 9.284   -12.213 -9.476  1.00 26.05 ? 50  TYR L CZ  1 
ATOM   2215 O  OH  . TYR C 2 52  ? 9.042   -11.138 -10.292 1.00 27.21 ? 50  TYR L OH  1 
ATOM   2216 N  N   . GLY C 2 53  ? 13.169  -15.953 -7.564  1.00 28.21 ? 51  GLY L N   1 
ATOM   2217 C  CA  . GLY C 2 53  ? 14.412  -15.635 -8.260  1.00 28.48 ? 51  GLY L CA  1 
ATOM   2218 C  C   . GLY C 2 53  ? 15.484  -15.106 -7.318  1.00 28.39 ? 51  GLY L C   1 
ATOM   2219 O  O   . GLY C 2 53  ? 16.279  -14.238 -7.690  1.00 27.42 ? 51  GLY L O   1 
ATOM   2220 N  N   . ALA C 2 54  ? 15.482  -15.625 -6.088  1.00 28.55 ? 52  ALA L N   1 
ATOM   2221 C  CA  . ALA C 2 54  ? 16.523  -15.317 -5.093  1.00 28.57 ? 52  ALA L CA  1 
ATOM   2222 C  C   . ALA C 2 54  ? 16.259  -14.023 -4.328  1.00 27.93 ? 52  ALA L C   1 
ATOM   2223 O  O   . ALA C 2 54  ? 16.382  -13.986 -3.106  1.00 27.68 ? 52  ALA L O   1 
ATOM   2224 C  CB  . ALA C 2 54  ? 17.906  -15.262 -5.756  1.00 28.49 ? 52  ALA L CB  1 
ATOM   2225 N  N   . SER C 2 55  ? 15.909  -12.961 -5.047  1.00 27.54 ? 53  SER L N   1 
ATOM   2226 C  CA  . SER C 2 55  ? 15.724  -11.660 -4.412  1.00 26.95 ? 53  SER L CA  1 
ATOM   2227 C  C   . SER C 2 55  ? 14.496  -10.864 -4.864  1.00 26.61 ? 53  SER L C   1 
ATOM   2228 O  O   . SER C 2 55  ? 14.249  -9.788  -4.330  1.00 26.17 ? 53  SER L O   1 
ATOM   2229 C  CB  . SER C 2 55  ? 16.970  -10.815 -4.625  1.00 26.59 ? 53  SER L CB  1 
ATOM   2230 O  OG  . SER C 2 55  ? 17.157  -10.568 -6.001  1.00 27.08 ? 53  SER L OG  1 
ATOM   2231 N  N   . SER C 2 56  ? 13.725  -11.374 -5.822  1.00 26.43 ? 54  SER L N   1 
ATOM   2232 C  CA  . SER C 2 56  ? 12.558  -10.633 -6.302  1.00 26.50 ? 54  SER L CA  1 
ATOM   2233 C  C   . SER C 2 56  ? 11.367  -10.808 -5.367  1.00 26.86 ? 54  SER L C   1 
ATOM   2234 O  O   . SER C 2 56  ? 11.268  -11.794 -4.646  1.00 26.78 ? 54  SER L O   1 
ATOM   2235 C  CB  . SER C 2 56  ? 12.177  -11.040 -7.726  1.00 26.46 ? 54  SER L CB  1 
ATOM   2236 O  OG  . SER C 2 56  ? 13.233  -10.789 -8.632  1.00 26.23 ? 54  SER L OG  1 
ATOM   2237 N  N   . ARG C 2 57  ? 10.463  -9.837  -5.399  1.00 27.74 ? 55  ARG L N   1 
ATOM   2238 C  CA  . ARG C 2 57  ? 9.330   -9.796  -4.482  1.00 28.49 ? 55  ARG L CA  1 
ATOM   2239 C  C   . ARG C 2 57  ? 8.004   -9.592  -5.196  1.00 28.80 ? 55  ARG L C   1 
ATOM   2240 O  O   . ARG C 2 57  ? 7.788   -8.548  -5.809  1.00 29.35 ? 55  ARG L O   1 
ATOM   2241 C  CB  . ARG C 2 57  ? 9.505   -8.660  -3.482  1.00 28.61 ? 55  ARG L CB  1 
ATOM   2242 C  CG  . ARG C 2 57  ? 10.350  -9.025  -2.300  1.00 29.35 ? 55  ARG L CG  1 
ATOM   2243 C  CD  . ARG C 2 57  ? 10.113  -8.075  -1.151  1.00 31.16 ? 55  ARG L CD  1 
ATOM   2244 N  NE  . ARG C 2 57  ? 10.217  -6.674  -1.558  1.00 31.76 ? 55  ARG L NE  1 
ATOM   2245 C  CZ  . ARG C 2 57  ? 9.254   -5.767  -1.418  1.00 31.44 ? 55  ARG L CZ  1 
ATOM   2246 N  NH1 . ARG C 2 57  ? 8.092   -6.087  -0.861  1.00 32.22 ? 55  ARG L NH1 1 
ATOM   2247 N  NH2 . ARG C 2 57  ? 9.459   -4.525  -1.828  1.00 31.46 ? 55  ARG L NH2 1 
ATOM   2248 N  N   . PRO C 2 58  ? 7.092   -10.567 -5.078  1.00 29.18 ? 56  PRO L N   1 
ATOM   2249 C  CA  . PRO C 2 58  ? 5.791   -10.451 -5.718  1.00 29.53 ? 56  PRO L CA  1 
ATOM   2250 C  C   . PRO C 2 58  ? 5.035   -9.265  -5.162  1.00 30.23 ? 56  PRO L C   1 
ATOM   2251 O  O   . PRO C 2 58  ? 5.248   -8.882  -4.007  1.00 30.43 ? 56  PRO L O   1 
ATOM   2252 C  CB  . PRO C 2 58  ? 5.070   -11.743 -5.321  1.00 29.50 ? 56  PRO L CB  1 
ATOM   2253 C  CG  . PRO C 2 58  ? 6.093   -12.640 -4.764  1.00 29.32 ? 56  PRO L CG  1 
ATOM   2254 C  CD  . PRO C 2 58  ? 7.228   -11.808 -4.298  1.00 29.24 ? 56  PRO L CD  1 
ATOM   2255 N  N   . SER C 2 59  ? 4.164   -8.687  -5.979  1.00 30.93 ? 57  SER L N   1 
ATOM   2256 C  CA  . SER C 2 59  ? 3.289   -7.608  -5.523  1.00 31.38 ? 57  SER L CA  1 
ATOM   2257 C  C   . SER C 2 59  ? 2.472   -8.117  -4.330  1.00 32.10 ? 57  SER L C   1 
ATOM   2258 O  O   . SER C 2 59  ? 2.144   -9.314  -4.259  1.00 32.02 ? 57  SER L O   1 
ATOM   2259 C  CB  . SER C 2 59  ? 2.376   -7.145  -6.660  1.00 31.17 ? 57  SER L CB  1 
ATOM   2260 O  OG  . SER C 2 59  ? 1.487   -6.140  -6.219  1.00 30.20 ? 57  SER L OG  1 
ATOM   2261 N  N   . GLY C 2 60  ? 2.186   -7.220  -3.381  1.00 32.53 ? 58  GLY L N   1 
ATOM   2262 C  CA  . GLY C 2 60  ? 1.435   -7.574  -2.161  1.00 32.74 ? 58  GLY L CA  1 
ATOM   2263 C  C   . GLY C 2 60  ? 2.278   -8.122  -1.010  1.00 33.05 ? 58  GLY L C   1 
ATOM   2264 O  O   . GLY C 2 60  ? 1.841   -8.117  0.142   1.00 33.24 ? 58  GLY L O   1 
ATOM   2265 N  N   . VAL C 2 61  ? 3.479   -8.612  -1.314  1.00 32.69 ? 59  VAL L N   1 
ATOM   2266 C  CA  . VAL C 2 61  ? 4.404   -9.047  -0.277  1.00 32.52 ? 59  VAL L CA  1 
ATOM   2267 C  C   . VAL C 2 61  ? 5.050   -7.848  0.416   1.00 32.39 ? 59  VAL L C   1 
ATOM   2268 O  O   . VAL C 2 61  ? 5.410   -6.859  -0.221  1.00 31.58 ? 59  VAL L O   1 
ATOM   2269 C  CB  . VAL C 2 61  ? 5.522   -9.954  -0.844  1.00 32.88 ? 59  VAL L CB  1 
ATOM   2270 C  CG1 . VAL C 2 61  ? 6.584   -10.228 0.219   1.00 32.85 ? 59  VAL L CG1 1 
ATOM   2271 C  CG2 . VAL C 2 61  ? 4.938   -11.262 -1.363  1.00 32.80 ? 59  VAL L CG2 1 
ATOM   2272 N  N   . ALA C 2 62  ? 5.221   -7.979  1.727   1.00 32.59 ? 60  ALA L N   1 
ATOM   2273 C  CA  . ALA C 2 62  ? 5.663   -6.889  2.584   1.00 32.38 ? 60  ALA L CA  1 
ATOM   2274 C  C   . ALA C 2 62  ? 7.106   -6.430  2.330   1.00 32.45 ? 60  ALA L C   1 
ATOM   2275 O  O   . ALA C 2 62  ? 7.997   -7.224  2.018   1.00 32.15 ? 60  ALA L O   1 
ATOM   2276 C  CB  . ALA C 2 62  ? 5.484   -7.290  4.037   1.00 32.51 ? 60  ALA L CB  1 
ATOM   2277 N  N   . ASP C 2 63  ? 7.305   -5.126  2.494   1.00 32.76 ? 61  ASP L N   1 
ATOM   2278 C  CA  . ASP C 2 63  ? 8.588   -4.458  2.259   1.00 33.08 ? 61  ASP L CA  1 
ATOM   2279 C  C   . ASP C 2 63  ? 9.708   -4.996  3.161   1.00 32.93 ? 61  ASP L C   1 
ATOM   2280 O  O   . ASP C 2 63  ? 10.867  -5.094  2.750   1.00 32.83 ? 61  ASP L O   1 
ATOM   2281 C  CB  . ASP C 2 63  ? 8.422   -2.948  2.494   1.00 33.20 ? 61  ASP L CB  1 
ATOM   2282 C  CG  . ASP C 2 63  ? 9.290   -2.102  1.574   1.00 33.66 ? 61  ASP L CG  1 
ATOM   2283 O  OD1 . ASP C 2 63  ? 10.288  -2.619  1.033   1.00 33.36 ? 61  ASP L OD1 1 
ATOM   2284 O  OD2 . ASP C 2 63  ? 8.969   -0.906  1.398   1.00 34.42 ? 61  ASP L OD2 1 
ATOM   2285 N  N   . ARG C 2 64  ? 9.353   -5.353  4.388   1.00 32.75 ? 62  ARG L N   1 
ATOM   2286 C  CA  . ARG C 2 64  ? 10.344  -5.804  5.362   1.00 32.64 ? 62  ARG L CA  1 
ATOM   2287 C  C   . ARG C 2 64  ? 11.059  -7.116  4.980   1.00 32.24 ? 62  ARG L C   1 
ATOM   2288 O  O   . ARG C 2 64  ? 12.123  -7.416  5.537   1.00 32.37 ? 62  ARG L O   1 
ATOM   2289 C  CB  . ARG C 2 64  ? 9.695   -5.939  6.741   1.00 32.71 ? 62  ARG L CB  1 
ATOM   2290 C  CG  . ARG C 2 64  ? 8.611   -6.998  6.813   1.00 32.71 ? 62  ARG L CG  1 
ATOM   2291 C  CD  . ARG C 2 64  ? 8.295   -7.349  8.256   1.00 32.40 ? 62  ARG L CD  1 
ATOM   2292 N  NE  . ARG C 2 64  ? 7.121   -8.207  8.358   1.00 31.89 ? 62  ARG L NE  1 
ATOM   2293 C  CZ  . ARG C 2 64  ? 5.869   -7.767  8.291   1.00 31.84 ? 62  ARG L CZ  1 
ATOM   2294 N  NH1 . ARG C 2 64  ? 5.624   -6.475  8.116   1.00 31.03 ? 62  ARG L NH1 1 
ATOM   2295 N  NH2 . ARG C 2 64  ? 4.858   -8.622  8.392   1.00 32.56 ? 62  ARG L NH2 1 
ATOM   2296 N  N   . PHE C 2 65  ? 10.483  -7.880  4.045   1.00 31.59 ? 63  PHE L N   1 
ATOM   2297 C  CA  . PHE C 2 65  ? 11.090  -9.137  3.565   1.00 31.26 ? 63  PHE L CA  1 
ATOM   2298 C  C   . PHE C 2 65  ? 12.102  -8.897  2.464   1.00 31.40 ? 63  PHE L C   1 
ATOM   2299 O  O   . PHE C 2 65  ? 11.843  -8.156  1.521   1.00 31.74 ? 63  PHE L O   1 
ATOM   2300 C  CB  . PHE C 2 65  ? 10.035  -10.090 3.007   1.00 31.05 ? 63  PHE L CB  1 
ATOM   2301 C  CG  . PHE C 2 65  ? 9.029   -10.534 4.011   1.00 30.60 ? 63  PHE L CG  1 
ATOM   2302 C  CD1 . PHE C 2 65  ? 7.798   -9.909  4.091   1.00 30.49 ? 63  PHE L CD1 1 
ATOM   2303 C  CD2 . PHE C 2 65  ? 9.309   -11.574 4.874   1.00 30.42 ? 63  PHE L CD2 1 
ATOM   2304 C  CE1 . PHE C 2 65  ? 6.872   -10.302 5.015   1.00 30.71 ? 63  PHE L CE1 1 
ATOM   2305 C  CE2 . PHE C 2 65  ? 8.385   -11.979 5.800   1.00 31.43 ? 63  PHE L CE2 1 
ATOM   2306 C  CZ  . PHE C 2 65  ? 7.160   -11.341 5.872   1.00 31.79 ? 63  PHE L CZ  1 
ATOM   2307 N  N   . SER C 2 66  ? 13.244  -9.559  2.567   1.00 31.53 ? 64  SER L N   1 
ATOM   2308 C  CA  . SER C 2 66  ? 14.319  -9.360  1.614   1.00 31.32 ? 64  SER L CA  1 
ATOM   2309 C  C   . SER C 2 66  ? 15.029  -10.676 1.339   1.00 31.23 ? 64  SER L C   1 
ATOM   2310 O  O   . SER C 2 66  ? 15.348  -11.426 2.264   1.00 30.78 ? 64  SER L O   1 
ATOM   2311 C  CB  . SER C 2 66  ? 15.309  -8.331  2.163   1.00 31.16 ? 64  SER L CB  1 
ATOM   2312 O  OG  . SER C 2 66  ? 15.862  -7.553  1.122   1.00 30.79 ? 64  SER L OG  1 
ATOM   2313 N  N   . GLY C 2 67  ? 15.271  -10.948 0.062   1.00 31.56 ? 65  GLY L N   1 
ATOM   2314 C  CA  . GLY C 2 67  ? 16.024  -12.138 -0.350  1.00 31.99 ? 65  GLY L CA  1 
ATOM   2315 C  C   . GLY C 2 67  ? 17.406  -11.779 -0.864  1.00 32.48 ? 65  GLY L C   1 
ATOM   2316 O  O   . GLY C 2 67  ? 17.612  -10.693 -1.396  1.00 32.25 ? 65  GLY L O   1 
ATOM   2317 N  N   . SER C 2 68  ? 18.362  -12.685 -0.705  1.00 33.21 ? 66  SER L N   1 
ATOM   2318 C  CA  . SER C 2 68  ? 19.707  -12.443 -1.226  1.00 33.99 ? 66  SER L CA  1 
ATOM   2319 C  C   . SER C 2 68  ? 20.519  -13.724 -1.338  1.00 33.87 ? 66  SER L C   1 
ATOM   2320 O  O   . SER C 2 68  ? 20.191  -14.732 -0.718  1.00 33.81 ? 66  SER L O   1 
ATOM   2321 C  CB  . SER C 2 68  ? 20.450  -11.421 -0.354  1.00 33.99 ? 66  SER L CB  1 
ATOM   2322 O  OG  . SER C 2 68  ? 20.310  -11.740 1.020   1.00 35.80 ? 66  SER L OG  1 
ATOM   2323 N  N   . GLY C 2 69  ? 21.578  -13.666 -2.140  1.00 34.11 ? 67  GLY L N   1 
ATOM   2324 C  CA  . GLY C 2 69  ? 22.499  -14.790 -2.298  1.00 34.36 ? 67  GLY L CA  1 
ATOM   2325 C  C   . GLY C 2 69  ? 22.671  -15.246 -3.738  1.00 34.60 ? 67  GLY L C   1 
ATOM   2326 O  O   . GLY C 2 69  ? 21.970  -14.781 -4.646  1.00 34.54 ? 67  GLY L O   1 
ATOM   2327 N  N   . SER C 2 70  ? 23.604  -16.175 -3.934  1.00 34.50 ? 68  SER L N   1 
ATOM   2328 C  CA  . SER C 2 70  ? 23.948  -16.679 -5.263  1.00 34.35 ? 68  SER L CA  1 
ATOM   2329 C  C   . SER C 2 70  ? 24.709  -18.004 -5.167  1.00 34.50 ? 68  SER L C   1 
ATOM   2330 O  O   . SER C 2 70  ? 25.598  -18.172 -4.325  1.00 34.73 ? 68  SER L O   1 
ATOM   2331 C  CB  . SER C 2 70  ? 24.803  -15.654 -6.013  1.00 34.42 ? 68  SER L CB  1 
ATOM   2332 O  OG  . SER C 2 70  ? 26.054  -15.460 -5.370  1.00 34.10 ? 68  SER L OG  1 
ATOM   2333 N  N   . GLY C 2 71  ? 24.364  -18.944 -6.037  1.00 34.20 ? 69  GLY L N   1 
ATOM   2334 C  CA  . GLY C 2 71  ? 25.021  -20.243 -6.044  1.00 34.02 ? 69  GLY L CA  1 
ATOM   2335 C  C   . GLY C 2 71  ? 24.510  -21.178 -4.955  1.00 33.99 ? 69  GLY L C   1 
ATOM   2336 O  O   . GLY C 2 71  ? 23.474  -21.828 -5.111  1.00 32.88 ? 69  GLY L O   1 
ATOM   2337 N  N   . THR C 2 72  ? 25.236  -21.243 -3.845  1.00 34.00 ? 70  THR L N   1 
ATOM   2338 C  CA  . THR C 2 72  ? 24.977  -22.271 -2.838  1.00 33.77 ? 70  THR L CA  1 
ATOM   2339 C  C   . THR C 2 72  ? 24.480  -21.727 -1.501  1.00 33.73 ? 70  THR L C   1 
ATOM   2340 O  O   . THR C 2 72  ? 23.798  -22.437 -0.774  1.00 33.43 ? 70  THR L O   1 
ATOM   2341 C  CB  . THR C 2 72  ? 26.216  -23.205 -2.637  1.00 33.63 ? 70  THR L CB  1 
ATOM   2342 O  OG1 . THR C 2 72  ? 27.389  -22.437 -2.333  1.00 33.25 ? 70  THR L OG1 1 
ATOM   2343 C  CG2 . THR C 2 72  ? 26.469  -24.014 -3.895  1.00 32.41 ? 70  THR L CG2 1 
ATOM   2344 N  N   . ASP C 2 73  ? 24.808  -20.478 -1.178  1.00 34.26 ? 71  ASP L N   1 
ATOM   2345 C  CA  . ASP C 2 73  ? 24.290  -19.850 0.048   1.00 34.94 ? 71  ASP L CA  1 
ATOM   2346 C  C   . ASP C 2 73  ? 23.221  -18.802 -0.260  1.00 34.88 ? 71  ASP L C   1 
ATOM   2347 O  O   . ASP C 2 73  ? 23.416  -17.936 -1.116  1.00 34.97 ? 71  ASP L O   1 
ATOM   2348 C  CB  . ASP C 2 73  ? 25.414  -19.207 0.873   1.00 34.99 ? 71  ASP L CB  1 
ATOM   2349 C  CG  . ASP C 2 73  ? 24.969  -18.835 2.302   1.00 36.68 ? 71  ASP L CG  1 
ATOM   2350 O  OD1 . ASP C 2 73  ? 24.046  -19.476 2.867   1.00 37.24 ? 71  ASP L OD1 1 
ATOM   2351 O  OD2 . ASP C 2 73  ? 25.561  -17.894 2.871   1.00 38.53 ? 71  ASP L OD2 1 
ATOM   2352 N  N   . PHE C 2 74  ? 22.092  -18.896 0.446   1.00 34.66 ? 72  PHE L N   1 
ATOM   2353 C  CA  . PHE C 2 74  ? 21.037  -17.887 0.353   1.00 34.48 ? 72  PHE L CA  1 
ATOM   2354 C  C   . PHE C 2 74  ? 20.513  -17.513 1.716   1.00 33.82 ? 72  PHE L C   1 
ATOM   2355 O  O   . PHE C 2 74  ? 20.470  -18.339 2.631   1.00 33.18 ? 72  PHE L O   1 
ATOM   2356 C  CB  . PHE C 2 74  ? 19.869  -18.385 -0.483  1.00 34.88 ? 72  PHE L CB  1 
ATOM   2357 C  CG  . PHE C 2 74  ? 20.251  -18.802 -1.856  1.00 36.25 ? 72  PHE L CG  1 
ATOM   2358 C  CD1 . PHE C 2 74  ? 20.652  -20.096 -2.107  1.00 36.78 ? 72  PHE L CD1 1 
ATOM   2359 C  CD2 . PHE C 2 74  ? 20.204  -17.899 -2.904  1.00 37.45 ? 72  PHE L CD2 1 
ATOM   2360 C  CE1 . PHE C 2 74  ? 20.998  -20.484 -3.380  1.00 37.90 ? 72  PHE L CE1 1 
ATOM   2361 C  CE2 . PHE C 2 74  ? 20.553  -18.283 -4.179  1.00 37.74 ? 72  PHE L CE2 1 
ATOM   2362 C  CZ  . PHE C 2 74  ? 20.951  -19.576 -4.416  1.00 37.72 ? 72  PHE L CZ  1 
ATOM   2363 N  N   . THR C 2 75  ? 20.097  -16.258 1.826   1.00 33.67 ? 73  THR L N   1 
ATOM   2364 C  CA  . THR C 2 75  ? 19.575  -15.717 3.073   1.00 33.67 ? 73  THR L CA  1 
ATOM   2365 C  C   . THR C 2 75  ? 18.212  -15.045 2.890   1.00 34.08 ? 73  THR L C   1 
ATOM   2366 O  O   . THR C 2 75  ? 18.010  -14.261 1.955   1.00 34.41 ? 73  THR L O   1 
ATOM   2367 C  CB  . THR C 2 75  ? 20.527  -14.685 3.670   1.00 33.24 ? 73  THR L CB  1 
ATOM   2368 O  OG1 . THR C 2 75  ? 21.697  -15.344 4.160   1.00 32.69 ? 73  THR L OG1 1 
ATOM   2369 C  CG2 . THR C 2 75  ? 19.847  -13.949 4.808   1.00 33.12 ? 73  THR L CG2 1 
ATOM   2370 N  N   . LEU C 2 76  ? 17.281  -15.366 3.786   1.00 33.96 ? 74  LEU L N   1 
ATOM   2371 C  CA  . LEU C 2 76  ? 16.034  -14.622 3.890   1.00 34.16 ? 74  LEU L CA  1 
ATOM   2372 C  C   . LEU C 2 76  ? 16.095  -13.799 5.157   1.00 34.77 ? 74  LEU L C   1 
ATOM   2373 O  O   . LEU C 2 76  ? 16.293  -14.336 6.249   1.00 34.62 ? 74  LEU L O   1 
ATOM   2374 C  CB  . LEU C 2 76  ? 14.806  -15.539 3.928   1.00 33.98 ? 74  LEU L CB  1 
ATOM   2375 C  CG  . LEU C 2 76  ? 13.464  -14.843 4.216   1.00 33.38 ? 74  LEU L CG  1 
ATOM   2376 C  CD1 . LEU C 2 76  ? 13.075  -13.897 3.079   1.00 32.50 ? 74  LEU L CD1 1 
ATOM   2377 C  CD2 . LEU C 2 76  ? 12.354  -15.858 4.467   1.00 31.69 ? 74  LEU L CD2 1 
ATOM   2378 N  N   . THR C 2 77  ? 15.927  -12.492 4.998   1.00 35.31 ? 75  THR L N   1 
ATOM   2379 C  CA  . THR C 2 77  ? 15.953  -11.582 6.121   1.00 35.58 ? 75  THR L CA  1 
ATOM   2380 C  C   . THR C 2 77  ? 14.573  -10.986 6.329   1.00 36.11 ? 75  THR L C   1 
ATOM   2381 O  O   . THR C 2 77  ? 13.858  -10.686 5.372   1.00 35.63 ? 75  THR L O   1 
ATOM   2382 C  CB  . THR C 2 77  ? 16.942  -10.439 5.880   1.00 35.61 ? 75  THR L CB  1 
ATOM   2383 O  OG1 . THR C 2 77  ? 17.876  -10.830 4.867   1.00 36.38 ? 75  THR L OG1 1 
ATOM   2384 C  CG2 . THR C 2 77  ? 17.687  -10.086 7.169   1.00 35.29 ? 75  THR L CG2 1 
ATOM   2385 N  N   . ILE C 2 78  ? 14.203  -10.840 7.595   1.00 36.92 ? 76  ILE L N   1 
ATOM   2386 C  CA  . ILE C 2 78  ? 13.072  -10.009 7.982   1.00 37.69 ? 76  ILE L CA  1 
ATOM   2387 C  C   . ILE C 2 78  ? 13.608  -8.893  8.884   1.00 38.27 ? 76  ILE L C   1 
ATOM   2388 O  O   . ILE C 2 78  ? 14.300  -9.156  9.873   1.00 38.52 ? 76  ILE L O   1 
ATOM   2389 C  CB  . ILE C 2 78  ? 11.988  -10.813 8.712   1.00 37.65 ? 76  ILE L CB  1 
ATOM   2390 C  CG1 . ILE C 2 78  ? 11.904  -12.233 8.139   1.00 37.83 ? 76  ILE L CG1 1 
ATOM   2391 C  CG2 . ILE C 2 78  ? 10.654  -10.106 8.589   1.00 37.74 ? 76  ILE L CG2 1 
ATOM   2392 C  CD1 . ILE C 2 78  ? 10.717  -13.041 8.641   1.00 36.78 ? 76  ILE L CD1 1 
ATOM   2393 N  N   . SER C 2 79  ? 13.308  -7.649  8.533   1.00 38.57 ? 77  SER L N   1 
ATOM   2394 C  CA  . SER C 2 79  ? 13.917  -6.517  9.221   1.00 39.00 ? 77  SER L CA  1 
ATOM   2395 C  C   . SER C 2 79  ? 13.241  -6.223  10.564  1.00 39.15 ? 77  SER L C   1 
ATOM   2396 O  O   . SER C 2 79  ? 13.916  -6.110  11.590  1.00 39.49 ? 77  SER L O   1 
ATOM   2397 C  CB  . SER C 2 79  ? 13.895  -5.276  8.328   1.00 39.10 ? 77  SER L CB  1 
ATOM   2398 O  OG  . SER C 2 79  ? 12.572  -4.805  8.141   1.00 40.62 ? 77  SER L OG  1 
ATOM   2399 N  N   . ARG C 2 80  ? 11.915  -6.098  10.555  1.00 39.11 ? 78  ARG L N   1 
ATOM   2400 C  CA  . ARG C 2 80  ? 11.158  -5.788  11.779  1.00 38.89 ? 78  ARG L CA  1 
ATOM   2401 C  C   . ARG C 2 80  ? 10.015  -6.782  12.011  1.00 38.76 ? 78  ARG L C   1 
ATOM   2402 O  O   . ARG C 2 80  ? 8.867   -6.515  11.650  1.00 38.53 ? 78  ARG L O   1 
ATOM   2403 C  CB  . ARG C 2 80  ? 10.612  -4.352  11.732  1.00 38.87 ? 78  ARG L CB  1 
ATOM   2404 N  N   . LEU C 2 81  ? 10.345  -7.919  12.626  1.00 38.59 ? 79  LEU L N   1 
ATOM   2405 C  CA  . LEU C 2 81  ? 9.368   -8.974  12.932  1.00 38.33 ? 79  LEU L CA  1 
ATOM   2406 C  C   . LEU C 2 81  ? 8.044   -8.442  13.492  1.00 38.24 ? 79  LEU L C   1 
ATOM   2407 O  O   . LEU C 2 81  ? 7.989   -7.896  14.595  1.00 38.06 ? 79  LEU L O   1 
ATOM   2408 C  CB  . LEU C 2 81  ? 9.959   -9.989  13.922  1.00 38.24 ? 79  LEU L CB  1 
ATOM   2409 C  CG  . LEU C 2 81  ? 10.708  -11.184 13.326  1.00 38.07 ? 79  LEU L CG  1 
ATOM   2410 C  CD1 . LEU C 2 81  ? 11.433  -11.968 14.405  1.00 38.22 ? 79  LEU L CD1 1 
ATOM   2411 C  CD2 . LEU C 2 81  ? 9.753   -12.089 12.580  1.00 37.38 ? 79  LEU L CD2 1 
ATOM   2412 N  N   . GLU C 2 82  ? 6.985   -8.615  12.711  1.00 38.32 ? 80  GLU L N   1 
ATOM   2413 C  CA  . GLU C 2 82  ? 5.623   -8.309  13.140  1.00 38.54 ? 80  GLU L CA  1 
ATOM   2414 C  C   . GLU C 2 82  ? 5.038   -9.603  13.723  1.00 38.41 ? 80  GLU L C   1 
ATOM   2415 O  O   . GLU C 2 82  ? 5.548   -10.683 13.445  1.00 38.33 ? 80  GLU L O   1 
ATOM   2416 C  CB  . GLU C 2 82  ? 4.786   -7.819  11.949  1.00 38.50 ? 80  GLU L CB  1 
ATOM   2417 C  CG  . GLU C 2 82  ? 3.809   -6.687  12.261  1.00 38.98 ? 80  GLU L CG  1 
ATOM   2418 C  CD  . GLU C 2 82  ? 4.467   -5.314  12.295  1.00 39.11 ? 80  GLU L CD  1 
ATOM   2419 O  OE1 . GLU C 2 82  ? 3.807   -4.342  11.874  1.00 37.96 ? 80  GLU L OE1 1 
ATOM   2420 O  OE2 . GLU C 2 82  ? 5.633   -5.204  12.734  1.00 39.58 ? 80  GLU L OE2 1 
ATOM   2421 N  N   . PRO C 2 83  ? 3.972   -9.508  14.538  1.00 38.24 ? 81  PRO L N   1 
ATOM   2422 C  CA  . PRO C 2 83  ? 3.504   -10.739 15.175  1.00 37.83 ? 81  PRO L CA  1 
ATOM   2423 C  C   . PRO C 2 83  ? 3.074   -11.772 14.155  1.00 37.24 ? 81  PRO L C   1 
ATOM   2424 O  O   . PRO C 2 83  ? 3.228   -12.971 14.379  1.00 36.86 ? 81  PRO L O   1 
ATOM   2425 C  CB  . PRO C 2 83  ? 2.297   -10.276 15.998  1.00 37.69 ? 81  PRO L CB  1 
ATOM   2426 C  CG  . PRO C 2 83  ? 2.481   -8.814  16.165  1.00 37.93 ? 81  PRO L CG  1 
ATOM   2427 C  CD  . PRO C 2 83  ? 3.153   -8.348  14.924  1.00 38.13 ? 81  PRO L CD  1 
ATOM   2428 N  N   . GLU C 2 84  ? 2.550   -11.290 13.035  1.00 36.95 ? 82  GLU L N   1 
ATOM   2429 C  CA  . GLU C 2 84  ? 2.040   -12.153 11.972  1.00 36.68 ? 82  GLU L CA  1 
ATOM   2430 C  C   . GLU C 2 84  ? 3.141   -12.885 11.185  1.00 36.11 ? 82  GLU L C   1 
ATOM   2431 O  O   . GLU C 2 84  ? 2.872   -13.467 10.141  1.00 36.50 ? 82  GLU L O   1 
ATOM   2432 C  CB  . GLU C 2 84  ? 1.167   -11.325 11.014  1.00 36.26 ? 82  GLU L CB  1 
ATOM   2433 N  N   . ASP C 2 85  ? 4.371   -12.877 11.684  1.00 35.54 ? 83  ASP L N   1 
ATOM   2434 C  CA  . ASP C 2 85  ? 5.483   -13.491 10.956  1.00 35.03 ? 83  ASP L CA  1 
ATOM   2435 C  C   . ASP C 2 85  ? 5.987   -14.762 11.627  1.00 35.15 ? 83  ASP L C   1 
ATOM   2436 O  O   . ASP C 2 85  ? 6.825   -15.481 11.080  1.00 35.41 ? 83  ASP L O   1 
ATOM   2437 C  CB  . ASP C 2 85  ? 6.632   -12.494 10.807  1.00 34.78 ? 83  ASP L CB  1 
ATOM   2438 C  CG  . ASP C 2 85  ? 6.218   -11.234 10.076  1.00 34.55 ? 83  ASP L CG  1 
ATOM   2439 O  OD1 . ASP C 2 85  ? 5.299   -11.312 9.239   1.00 35.34 ? 83  ASP L OD1 1 
ATOM   2440 O  OD2 . ASP C 2 85  ? 6.805   -10.167 10.336  1.00 32.23 ? 83  ASP L OD2 1 
ATOM   2441 N  N   . PHE C 2 86  ? 5.480   -15.047 12.816  1.00 35.22 ? 84  PHE L N   1 
ATOM   2442 C  CA  . PHE C 2 86  ? 5.910   -16.238 13.528  1.00 35.49 ? 84  PHE L CA  1 
ATOM   2443 C  C   . PHE C 2 86  ? 5.251   -17.473 12.911  1.00 35.14 ? 84  PHE L C   1 
ATOM   2444 O  O   . PHE C 2 86  ? 4.216   -17.955 13.361  1.00 35.80 ? 84  PHE L O   1 
ATOM   2445 C  CB  . PHE C 2 86  ? 5.643   -16.091 15.023  1.00 35.65 ? 84  PHE L CB  1 
ATOM   2446 C  CG  . PHE C 2 86  ? 6.579   -15.109 15.703  1.00 37.34 ? 84  PHE L CG  1 
ATOM   2447 C  CD1 . PHE C 2 86  ? 7.630   -15.555 16.484  1.00 37.30 ? 84  PHE L CD1 1 
ATOM   2448 C  CD2 . PHE C 2 86  ? 6.418   -13.740 15.534  1.00 38.58 ? 84  PHE L CD2 1 
ATOM   2449 C  CE1 . PHE C 2 86  ? 8.485   -14.657 17.098  1.00 37.98 ? 84  PHE L CE1 1 
ATOM   2450 C  CE2 . PHE C 2 86  ? 7.277   -12.838 16.150  1.00 38.41 ? 84  PHE L CE2 1 
ATOM   2451 C  CZ  . PHE C 2 86  ? 8.307   -13.299 16.928  1.00 37.99 ? 84  PHE L CZ  1 
ATOM   2452 N  N   . ALA C 2 87  ? 5.872   -17.946 11.842  1.00 34.50 ? 85  ALA L N   1 
ATOM   2453 C  CA  . ALA C 2 87  ? 5.388   -19.083 11.075  1.00 34.06 ? 85  ALA L CA  1 
ATOM   2454 C  C   . ALA C 2 87  ? 6.554   -20.021 10.800  1.00 33.16 ? 85  ALA L C   1 
ATOM   2455 O  O   . ALA C 2 87  ? 7.594   -19.927 11.446  1.00 33.77 ? 85  ALA L O   1 
ATOM   2456 C  CB  . ALA C 2 87  ? 4.788   -18.604 9.771   1.00 33.87 ? 85  ALA L CB  1 
ATOM   2457 N  N   . VAL C 2 88  ? 6.374   -20.934 9.856   1.00 32.12 ? 86  VAL L N   1 
ATOM   2458 C  CA  . VAL C 2 88  ? 7.476   -21.766 9.367   1.00 31.38 ? 86  VAL L CA  1 
ATOM   2459 C  C   . VAL C 2 88  ? 7.851   -21.284 7.968   1.00 31.09 ? 86  VAL L C   1 
ATOM   2460 O  O   . VAL C 2 88  ? 6.982   -20.900 7.178   1.00 30.47 ? 86  VAL L O   1 
ATOM   2461 C  CB  . VAL C 2 88  ? 7.085   -23.259 9.307   1.00 31.40 ? 86  VAL L CB  1 
ATOM   2462 C  CG1 . VAL C 2 88  ? 8.150   -24.064 8.559   1.00 30.67 ? 86  VAL L CG1 1 
ATOM   2463 C  CG2 . VAL C 2 88  ? 6.847   -23.813 10.714  1.00 29.36 ? 86  VAL L CG2 1 
ATOM   2464 N  N   . TYR C 2 89  ? 9.141   -21.284 7.664   1.00 31.01 ? 87  TYR L N   1 
ATOM   2465 C  CA  . TYR C 2 89  ? 9.607   -20.785 6.365   1.00 31.39 ? 87  TYR L CA  1 
ATOM   2466 C  C   . TYR C 2 89  ? 10.381  -21.834 5.592   1.00 32.27 ? 87  TYR L C   1 
ATOM   2467 O  O   . TYR C 2 89  ? 11.320  -22.435 6.118   1.00 32.95 ? 87  TYR L O   1 
ATOM   2468 C  CB  . TYR C 2 89  ? 10.486  -19.550 6.541   1.00 31.02 ? 87  TYR L CB  1 
ATOM   2469 C  CG  . TYR C 2 89  ? 9.730   -18.371 7.083   1.00 30.23 ? 87  TYR L CG  1 
ATOM   2470 C  CD1 . TYR C 2 89  ? 9.466   -18.259 8.443   1.00 30.11 ? 87  TYR L CD1 1 
ATOM   2471 C  CD2 . TYR C 2 89  ? 9.265   -17.378 6.237   1.00 30.15 ? 87  TYR L CD2 1 
ATOM   2472 C  CE1 . TYR C 2 89  ? 8.758   -17.184 8.945   1.00 30.11 ? 87  TYR L CE1 1 
ATOM   2473 C  CE2 . TYR C 2 89  ? 8.566   -16.299 6.726   1.00 30.47 ? 87  TYR L CE2 1 
ATOM   2474 C  CZ  . TYR C 2 89  ? 8.312   -16.210 8.080   1.00 30.21 ? 87  TYR L CZ  1 
ATOM   2475 O  OH  . TYR C 2 89  ? 7.614   -15.143 8.564   1.00 30.02 ? 87  TYR L OH  1 
ATOM   2476 N  N   . TYR C 2 90  ? 10.002  -22.026 4.332   1.00 32.81 ? 88  TYR L N   1 
ATOM   2477 C  CA  . TYR C 2 90  ? 10.684  -22.980 3.461   1.00 33.23 ? 88  TYR L CA  1 
ATOM   2478 C  C   . TYR C 2 90  ? 11.428  -22.284 2.304   1.00 33.68 ? 88  TYR L C   1 
ATOM   2479 O  O   . TYR C 2 90  ? 10.935  -21.306 1.757   1.00 33.86 ? 88  TYR L O   1 
ATOM   2480 C  CB  . TYR C 2 90  ? 9.666   -23.978 2.909   1.00 33.32 ? 88  TYR L CB  1 
ATOM   2481 C  CG  . TYR C 2 90  ? 8.982   -24.822 3.967   1.00 33.67 ? 88  TYR L CG  1 
ATOM   2482 C  CD1 . TYR C 2 90  ? 7.731   -24.481 4.463   1.00 33.40 ? 88  TYR L CD1 1 
ATOM   2483 C  CD2 . TYR C 2 90  ? 9.588   -25.964 4.467   1.00 33.78 ? 88  TYR L CD2 1 
ATOM   2484 C  CE1 . TYR C 2 90  ? 7.103   -25.259 5.430   1.00 31.99 ? 88  TYR L CE1 1 
ATOM   2485 C  CE2 . TYR C 2 90  ? 8.970   -26.744 5.434   1.00 32.78 ? 88  TYR L CE2 1 
ATOM   2486 C  CZ  . TYR C 2 90  ? 7.731   -26.391 5.907   1.00 31.87 ? 88  TYR L CZ  1 
ATOM   2487 O  OH  . TYR C 2 90  ? 7.127   -27.178 6.865   1.00 31.44 ? 88  TYR L OH  1 
ATOM   2488 N  N   . CYS C 2 91  ? 12.619  -22.780 1.955   1.00 34.76 ? 89  CYS L N   1 
ATOM   2489 C  CA  . CYS C 2 91  ? 13.286  -22.409 0.694   1.00 35.69 ? 89  CYS L CA  1 
ATOM   2490 C  C   . CYS C 2 91  ? 13.071  -23.482 -0.373  1.00 36.54 ? 89  CYS L C   1 
ATOM   2491 O  O   . CYS C 2 91  ? 12.867  -24.666 -0.063  1.00 36.87 ? 89  CYS L O   1 
ATOM   2492 C  CB  . CYS C 2 91  ? 14.791  -22.108 0.882   1.00 36.10 ? 89  CYS L CB  1 
ATOM   2493 S  SG  . CYS C 2 91  ? 15.898  -23.495 1.305   1.00 37.85 ? 89  CYS L SG  1 
ATOM   2494 N  N   . GLN C 2 92  ? 13.093  -23.057 -1.633  1.00 37.27 ? 90  GLN L N   1 
ATOM   2495 C  CA  . GLN C 2 92  ? 12.891  -23.971 -2.762  1.00 38.17 ? 90  GLN L CA  1 
ATOM   2496 C  C   . GLN C 2 92  ? 13.799  -23.620 -3.919  1.00 38.29 ? 90  GLN L C   1 
ATOM   2497 O  O   . GLN C 2 92  ? 14.016  -22.439 -4.200  1.00 38.33 ? 90  GLN L O   1 
ATOM   2498 C  CB  . GLN C 2 92  ? 11.443  -23.902 -3.265  1.00 38.64 ? 90  GLN L CB  1 
ATOM   2499 C  CG  . GLN C 2 92  ? 11.148  -24.788 -4.471  1.00 38.53 ? 90  GLN L CG  1 
ATOM   2500 C  CD  . GLN C 2 92  ? 9.959   -24.305 -5.269  1.00 39.40 ? 90  GLN L CD  1 
ATOM   2501 O  OE1 . GLN C 2 92  ? 9.435   -23.229 -5.011  1.00 41.54 ? 90  GLN L OE1 1 
ATOM   2502 N  NE2 . GLN C 2 92  ? 9.535   -25.094 -6.258  1.00 39.01 ? 90  GLN L NE2 1 
ATOM   2503 N  N   . GLN C 2 93  ? 14.306  -24.651 -4.600  1.00 38.23 ? 91  GLN L N   1 
ATOM   2504 C  CA  . GLN C 2 93  ? 15.053  -24.468 -5.856  1.00 37.59 ? 91  GLN L CA  1 
ATOM   2505 C  C   . GLN C 2 93  ? 14.277  -25.040 -7.044  1.00 37.09 ? 91  GLN L C   1 
ATOM   2506 O  O   . GLN C 2 93  ? 13.677  -26.118 -6.965  1.00 37.86 ? 91  GLN L O   1 
ATOM   2507 C  CB  . GLN C 2 93  ? 16.452  -25.097 -5.769  1.00 37.25 ? 91  GLN L CB  1 
ATOM   2508 C  CG  . GLN C 2 93  ? 16.473  -26.612 -5.631  1.00 38.03 ? 91  GLN L CG  1 
ATOM   2509 C  CD  . GLN C 2 93  ? 16.592  -27.360 -6.966  1.00 38.88 ? 91  GLN L CD  1 
ATOM   2510 O  OE1 . GLN C 2 93  ? 17.132  -26.845 -7.948  1.00 39.41 ? 91  GLN L OE1 1 
ATOM   2511 N  NE2 . GLN C 2 93  ? 16.108  -28.594 -6.987  1.00 37.74 ? 91  GLN L NE2 1 
ATOM   2512 N  N   . TYR C 2 94  ? 14.275  -24.307 -8.144  1.00 36.02 ? 92  TYR L N   1 
ATOM   2513 C  CA  . TYR C 2 94  ? 13.632  -24.773 -9.361  1.00 34.95 ? 92  TYR L CA  1 
ATOM   2514 C  C   . TYR C 2 94  ? 14.569  -24.551 -10.546 1.00 34.74 ? 92  TYR L C   1 
ATOM   2515 O  O   . TYR C 2 94  ? 14.136  -24.327 -11.671 1.00 34.40 ? 92  TYR L O   1 
ATOM   2516 C  CB  . TYR C 2 94  ? 12.269  -24.098 -9.544  1.00 34.62 ? 92  TYR L CB  1 
ATOM   2517 C  CG  . TYR C 2 94  ? 12.258  -22.598 -9.341  1.00 33.75 ? 92  TYR L CG  1 
ATOM   2518 C  CD1 . TYR C 2 94  ? 12.149  -21.733 -10.426 1.00 32.55 ? 92  TYR L CD1 1 
ATOM   2519 C  CD2 . TYR C 2 94  ? 12.340  -22.042 -8.070  1.00 33.28 ? 92  TYR L CD2 1 
ATOM   2520 C  CE1 . TYR C 2 94  ? 12.146  -20.356 -10.255 1.00 32.51 ? 92  TYR L CE1 1 
ATOM   2521 C  CE2 . TYR C 2 94  ? 12.341  -20.654 -7.889  1.00 33.02 ? 92  TYR L CE2 1 
ATOM   2522 C  CZ  . TYR C 2 94  ? 12.238  -19.821 -8.987  1.00 32.33 ? 92  TYR L CZ  1 
ATOM   2523 O  OH  . TYR C 2 94  ? 12.230  -18.452 -8.825  1.00 31.22 ? 92  TYR L OH  1 
ATOM   2524 N  N   . GLY C 2 95  ? 15.866  -24.640 -10.271 1.00 35.11 ? 93  GLY L N   1 
ATOM   2525 C  CA  . GLY C 2 95  ? 16.909  -24.409 -11.271 1.00 35.59 ? 93  GLY L CA  1 
ATOM   2526 C  C   . GLY C 2 95  ? 17.123  -25.570 -12.222 1.00 35.93 ? 93  GLY L C   1 
ATOM   2527 O  O   . GLY C 2 95  ? 17.722  -25.409 -13.279 1.00 35.81 ? 93  GLY L O   1 
ATOM   2528 N  N   . GLN C 2 96  ? 16.641  -26.745 -11.841 1.00 36.55 ? 94  GLN L N   1 
ATOM   2529 C  CA  . GLN C 2 96  ? 16.597  -27.888 -12.748 1.00 37.08 ? 94  GLN L CA  1 
ATOM   2530 C  C   . GLN C 2 96  ? 15.253  -28.597 -12.644 1.00 37.02 ? 94  GLN L C   1 
ATOM   2531 O  O   . GLN C 2 96  ? 14.502  -28.355 -11.697 1.00 37.66 ? 94  GLN L O   1 
ATOM   2532 C  CB  . GLN C 2 96  ? 17.745  -28.855 -12.454 1.00 37.52 ? 94  GLN L CB  1 
ATOM   2533 C  CG  . GLN C 2 96  ? 18.029  -29.088 -10.992 1.00 37.73 ? 94  GLN L CG  1 
ATOM   2534 C  CD  . GLN C 2 96  ? 19.109  -30.135 -10.783 1.00 37.50 ? 94  GLN L CD  1 
ATOM   2535 O  OE1 . GLN C 2 96  ? 20.243  -29.809 -10.450 1.00 37.45 ? 94  GLN L OE1 1 
ATOM   2536 N  NE2 . GLN C 2 96  ? 18.761  -31.397 -10.990 1.00 38.17 ? 94  GLN L NE2 1 
ATOM   2537 N  N   . SER C 2 97  ? 14.946  -29.465 -13.608 1.00 36.51 ? 95  SER L N   1 
ATOM   2538 C  CA  . SER C 2 97  ? 13.630  -30.137 -13.636 1.00 36.23 ? 95  SER L CA  1 
ATOM   2539 C  C   . SER C 2 97  ? 13.224  -30.687 -12.268 1.00 35.64 ? 95  SER L C   1 
ATOM   2540 O  O   . SER C 2 97  ? 12.077  -30.571 -11.864 1.00 35.31 ? 95  SER L O   1 
ATOM   2541 C  CB  . SER C 2 97  ? 13.598  -31.264 -14.672 1.00 36.19 ? 95  SER L CB  1 
ATOM   2542 O  OG  . SER C 2 97  ? 13.817  -30.764 -15.980 1.00 36.68 ? 95  SER L OG  1 
ATOM   2543 N  N   . LEU C 2 98  ? 14.177  -31.279 -11.559 1.00 36.02 ? 96  LEU L N   1 
ATOM   2544 C  CA  . LEU C 2 98  ? 13.914  -31.886 -10.253 1.00 35.79 ? 96  LEU L CA  1 
ATOM   2545 C  C   . LEU C 2 98  ? 14.009  -30.840 -9.163  1.00 36.07 ? 96  LEU L C   1 
ATOM   2546 O  O   . LEU C 2 98  ? 15.104  -30.512 -8.708  1.00 35.48 ? 96  LEU L O   1 
ATOM   2547 C  CB  . LEU C 2 98  ? 14.902  -33.028 -9.969  1.00 35.59 ? 96  LEU L CB  1 
ATOM   2548 C  CG  . LEU C 2 98  ? 14.766  -33.716 -8.604  1.00 35.36 ? 96  LEU L CG  1 
ATOM   2549 C  CD1 . LEU C 2 98  ? 13.297  -33.954 -8.275  1.00 34.06 ? 96  LEU L CD1 1 
ATOM   2550 C  CD2 . LEU C 2 98  ? 15.536  -35.017 -8.551  1.00 32.29 ? 96  LEU L CD2 1 
ATOM   2551 N  N   . SER C 2 99  ? 12.850  -30.329 -8.749  1.00 36.90 ? 97  SER L N   1 
ATOM   2552 C  CA  . SER C 2 99  ? 12.760  -29.293 -7.706  1.00 37.02 ? 97  SER L CA  1 
ATOM   2553 C  C   . SER C 2 99  ? 12.718  -29.905 -6.307  1.00 37.23 ? 97  SER L C   1 
ATOM   2554 O  O   . SER C 2 99  ? 12.098  -30.958 -6.070  1.00 37.24 ? 97  SER L O   1 
ATOM   2555 C  CB  . SER C 2 99  ? 11.522  -28.414 -7.924  1.00 37.31 ? 97  SER L CB  1 
ATOM   2556 O  OG  . SER C 2 99  ? 11.394  -27.410 -6.921  1.00 37.45 ? 97  SER L OG  1 
ATOM   2557 N  N   . THR C 2 100 ? 13.379  -29.224 -5.379  1.00 37.19 ? 98  THR L N   1 
ATOM   2558 C  CA  . THR C 2 100 ? 13.461  -29.677 -3.997  1.00 36.97 ? 98  THR L CA  1 
ATOM   2559 C  C   . THR C 2 100 ? 13.189  -28.528 -3.032  1.00 36.94 ? 98  THR L C   1 
ATOM   2560 O  O   . THR C 2 100 ? 13.402  -27.353 -3.366  1.00 36.43 ? 98  THR L O   1 
ATOM   2561 C  CB  . THR C 2 100 ? 14.846  -30.285 -3.689  1.00 37.03 ? 98  THR L CB  1 
ATOM   2562 O  OG1 . THR C 2 100 ? 15.880  -29.471 -4.270  1.00 37.05 ? 98  THR L OG1 1 
ATOM   2563 C  CG2 . THR C 2 100 ? 14.946  -31.701 -4.243  1.00 36.55 ? 98  THR L CG2 1 
ATOM   2564 N  N   . PHE C 2 101 ? 12.709  -28.894 -1.844  1.00 37.29 ? 99  PHE L N   1 
ATOM   2565 C  CA  . PHE C 2 101 ? 12.466  -27.960 -0.750  1.00 37.82 ? 99  PHE L CA  1 
ATOM   2566 C  C   . PHE C 2 101 ? 13.435  -28.214 0.395   1.00 38.36 ? 99  PHE L C   1 
ATOM   2567 O  O   . PHE C 2 101 ? 13.928  -29.326 0.561   1.00 38.85 ? 99  PHE L O   1 
ATOM   2568 C  CB  . PHE C 2 101 ? 11.041  -28.136 -0.204  1.00 37.85 ? 99  PHE L CB  1 
ATOM   2569 C  CG  . PHE C 2 101 ? 9.979   -27.498 -1.045  1.00 37.18 ? 99  PHE L CG  1 
ATOM   2570 C  CD1 . PHE C 2 101 ? 9.312   -28.228 -2.007  1.00 37.17 ? 99  PHE L CD1 1 
ATOM   2571 C  CD2 . PHE C 2 101 ? 9.650   -26.165 -0.873  1.00 37.40 ? 99  PHE L CD2 1 
ATOM   2572 C  CE1 . PHE C 2 101 ? 8.331   -27.649 -2.779  1.00 36.83 ? 99  PHE L CE1 1 
ATOM   2573 C  CE2 . PHE C 2 101 ? 8.686   -25.576 -1.645  1.00 37.55 ? 99  PHE L CE2 1 
ATOM   2574 C  CZ  . PHE C 2 101 ? 8.019   -26.325 -2.603  1.00 38.05 ? 99  PHE L CZ  1 
ATOM   2575 N  N   . GLY C 2 102 ? 13.685  -27.183 1.192   1.00 39.01 ? 100 GLY L N   1 
ATOM   2576 C  CA  . GLY C 2 102 ? 14.403  -27.345 2.453   1.00 39.56 ? 100 GLY L CA  1 
ATOM   2577 C  C   . GLY C 2 102 ? 13.491  -27.861 3.562   1.00 39.96 ? 100 GLY L C   1 
ATOM   2578 O  O   . GLY C 2 102 ? 12.271  -27.817 3.436   1.00 40.21 ? 100 GLY L O   1 
ATOM   2579 N  N   . GLN C 2 103 ? 14.087  -28.335 4.656   1.00 40.38 ? 101 GLN L N   1 
ATOM   2580 C  CA  . GLN C 2 103 ? 13.332  -28.906 5.773   1.00 40.64 ? 101 GLN L CA  1 
ATOM   2581 C  C   . GLN C 2 103 ? 12.612  -27.843 6.591   1.00 40.67 ? 101 GLN L C   1 
ATOM   2582 O  O   . GLN C 2 103 ? 11.767  -28.166 7.420   1.00 40.43 ? 101 GLN L O   1 
ATOM   2583 C  CB  . GLN C 2 103 ? 14.248  -29.702 6.704   1.00 41.35 ? 101 GLN L CB  1 
ATOM   2584 C  CG  . GLN C 2 103 ? 14.918  -28.878 7.829   1.00 42.18 ? 101 GLN L CG  1 
ATOM   2585 C  CD  . GLN C 2 103 ? 16.231  -28.230 7.402   1.00 43.78 ? 101 GLN L CD  1 
ATOM   2586 O  OE1 . GLN C 2 103 ? 16.599  -28.257 6.223   1.00 43.99 ? 101 GLN L OE1 1 
ATOM   2587 N  NE2 . GLN C 2 103 ? 16.945  -27.637 8.367   1.00 44.33 ? 101 GLN L NE2 1 
ATOM   2588 N  N   . GLY C 2 104 ? 12.984  -26.583 6.389   1.00 40.81 ? 102 GLY L N   1 
ATOM   2589 C  CA  . GLY C 2 104 ? 12.246  -25.461 6.966   1.00 40.42 ? 102 GLY L CA  1 
ATOM   2590 C  C   . GLY C 2 104 ? 12.772  -24.966 8.295   1.00 40.23 ? 102 GLY L C   1 
ATOM   2591 O  O   . GLY C 2 104 ? 13.420  -25.703 9.035   1.00 39.93 ? 102 GLY L O   1 
ATOM   2592 N  N   . THR C 2 105 ? 12.478  -23.703 8.592   1.00 40.43 ? 103 THR L N   1 
ATOM   2593 C  CA  . THR C 2 105 ? 12.889  -23.078 9.848   1.00 40.69 ? 103 THR L CA  1 
ATOM   2594 C  C   . THR C 2 105 ? 11.685  -22.567 10.639  1.00 40.80 ? 103 THR L C   1 
ATOM   2595 O  O   . THR C 2 105 ? 10.940  -21.712 10.162  1.00 40.31 ? 103 THR L O   1 
ATOM   2596 C  CB  . THR C 2 105 ? 13.821  -21.881 9.603   1.00 40.49 ? 103 THR L CB  1 
ATOM   2597 O  OG1 . THR C 2 105 ? 14.909  -22.273 8.757   1.00 41.91 ? 103 THR L OG1 1 
ATOM   2598 C  CG2 . THR C 2 105 ? 14.367  -21.355 10.925  1.00 40.58 ? 103 THR L CG2 1 
ATOM   2599 N  N   . LYS C 2 106 ? 11.519  -23.082 11.854  1.00 41.27 ? 104 LYS L N   1 
ATOM   2600 C  CA  . LYS C 2 106 ? 10.455  -22.638 12.751  1.00 41.93 ? 104 LYS L CA  1 
ATOM   2601 C  C   . LYS C 2 106 ? 10.860  -21.331 13.410  1.00 42.62 ? 104 LYS L C   1 
ATOM   2602 O  O   . LYS C 2 106 ? 11.807  -21.309 14.201  1.00 43.53 ? 104 LYS L O   1 
ATOM   2603 C  CB  . LYS C 2 106 ? 10.179  -23.686 13.838  1.00 41.64 ? 104 LYS L CB  1 
ATOM   2604 N  N   . VAL C 2 107 ? 10.161  -20.241 13.091  1.00 42.84 ? 105 VAL L N   1 
ATOM   2605 C  CA  . VAL C 2 107 ? 10.411  -18.966 13.770  1.00 42.96 ? 105 VAL L CA  1 
ATOM   2606 C  C   . VAL C 2 107 ? 9.357   -18.751 14.847  1.00 43.43 ? 105 VAL L C   1 
ATOM   2607 O  O   . VAL C 2 107 ? 8.238   -18.352 14.550  1.00 43.57 ? 105 VAL L O   1 
ATOM   2608 C  CB  . VAL C 2 107 ? 10.410  -17.767 12.806  1.00 42.84 ? 105 VAL L CB  1 
ATOM   2609 C  CG1 . VAL C 2 107 ? 10.675  -16.475 13.572  1.00 41.61 ? 105 VAL L CG1 1 
ATOM   2610 C  CG2 . VAL C 2 107 ? 11.457  -17.948 11.727  1.00 42.28 ? 105 VAL L CG2 1 
ATOM   2611 N  N   . GLU C 2 108 ? 9.724   -19.014 16.097  1.00 44.03 ? 106 GLU L N   1 
ATOM   2612 C  CA  . GLU C 2 108 ? 8.758   -19.013 17.200  1.00 44.42 ? 106 GLU L CA  1 
ATOM   2613 C  C   . GLU C 2 108 ? 9.019   -17.897 18.210  1.00 44.22 ? 106 GLU L C   1 
ATOM   2614 O  O   . GLU C 2 108 ? 10.153  -17.461 18.398  1.00 44.14 ? 106 GLU L O   1 
ATOM   2615 C  CB  . GLU C 2 108 ? 8.748   -20.381 17.907  1.00 44.72 ? 106 GLU L CB  1 
ATOM   2616 C  CG  . GLU C 2 108 ? 10.042  -20.728 18.665  1.00 46.10 ? 106 GLU L CG  1 
ATOM   2617 C  CD  . GLU C 2 108 ? 10.054  -22.153 19.226  1.00 46.98 ? 106 GLU L CD  1 
ATOM   2618 O  OE1 . GLU C 2 108 ? 10.487  -22.322 20.394  1.00 46.30 ? 106 GLU L OE1 1 
ATOM   2619 O  OE2 . GLU C 2 108 ? 9.634   -23.092 18.499  1.00 46.30 ? 106 GLU L OE2 1 
ATOM   2620 N  N   . VAL C 2 109 ? 7.950   -17.439 18.853  1.00 44.35 ? 107 VAL L N   1 
ATOM   2621 C  CA  . VAL C 2 109 ? 8.045   -16.376 19.850  1.00 44.47 ? 107 VAL L CA  1 
ATOM   2622 C  C   . VAL C 2 109 ? 8.728   -16.886 21.119  1.00 44.62 ? 107 VAL L C   1 
ATOM   2623 O  O   . VAL C 2 109 ? 8.261   -17.839 21.750  1.00 44.80 ? 107 VAL L O   1 
ATOM   2624 C  CB  . VAL C 2 109 ? 6.659   -15.792 20.209  1.00 44.40 ? 107 VAL L CB  1 
ATOM   2625 C  CG1 . VAL C 2 109 ? 5.783   -16.847 20.900  1.00 43.75 ? 107 VAL L CG1 1 
ATOM   2626 C  CG2 . VAL C 2 109 ? 6.823   -14.561 21.084  1.00 43.99 ? 107 VAL L CG2 1 
ATOM   2627 N  N   . LYS C 2 110 ? 9.842   -16.251 21.472  1.00 44.46 ? 108 LYS L N   1 
ATOM   2628 C  CA  . LYS C 2 110 ? 10.594  -16.603 22.672  1.00 44.33 ? 108 LYS L CA  1 
ATOM   2629 C  C   . LYS C 2 110 ? 9.963   -15.953 23.901  1.00 43.83 ? 108 LYS L C   1 
ATOM   2630 O  O   . LYS C 2 110 ? 9.411   -14.859 23.811  1.00 43.24 ? 108 LYS L O   1 
ATOM   2631 C  CB  . LYS C 2 110 ? 12.055  -16.155 22.534  1.00 44.45 ? 108 LYS L CB  1 
ATOM   2632 N  N   . LEU C 2 111 ? 10.051  -16.646 25.034  1.00 43.76 ? 109 LEU L N   1 
ATOM   2633 C  CA  . LEU C 2 111 ? 9.533   -16.170 26.326  1.00 43.93 ? 109 LEU L CA  1 
ATOM   2634 C  C   . LEU C 2 111 ? 8.531   -17.180 26.880  1.00 44.10 ? 109 LEU L C   1 
ATOM   2635 O  O   . LEU C 2 111 ? 8.298   -18.232 26.269  1.00 44.18 ? 109 LEU L O   1 
ATOM   2636 C  CB  . LEU C 2 111 ? 8.882   -14.783 26.206  1.00 43.89 ? 109 LEU L CB  1 
ATOM   2637 C  CG  . LEU C 2 111 ? 8.794   -13.963 27.499  1.00 43.41 ? 109 LEU L CG  1 
ATOM   2638 C  CD1 . LEU C 2 111 ? 10.186  -13.703 28.072  1.00 43.15 ? 109 LEU L CD1 1 
ATOM   2639 C  CD2 . LEU C 2 111 ? 8.060   -12.645 27.282  1.00 42.81 ? 109 LEU L CD2 1 
ATOM   2640 N  N   . GLU D 2 3   ? -42.133 -28.452 8.681   1.00 35.54 ? 1   GLU M N   1 
ATOM   2641 C  CA  . GLU D 2 3   ? -41.531 -28.161 7.333   1.00 36.02 ? 1   GLU M CA  1 
ATOM   2642 C  C   . GLU D 2 3   ? -42.500 -27.495 6.345   1.00 35.38 ? 1   GLU M C   1 
ATOM   2643 O  O   . GLU D 2 3   ? -43.554 -28.045 6.033   1.00 35.58 ? 1   GLU M O   1 
ATOM   2644 C  CB  . GLU D 2 3   ? -40.989 -29.436 6.683   1.00 36.24 ? 1   GLU M CB  1 
ATOM   2645 C  CG  . GLU D 2 3   ? -40.683 -29.237 5.197   1.00 37.36 ? 1   GLU M CG  1 
ATOM   2646 C  CD  . GLU D 2 3   ? -39.888 -30.367 4.584   1.00 39.70 ? 1   GLU M CD  1 
ATOM   2647 O  OE1 . GLU D 2 3   ? -39.570 -31.348 5.296   1.00 43.15 ? 1   GLU M OE1 1 
ATOM   2648 O  OE2 . GLU D 2 3   ? -39.582 -30.277 3.375   1.00 40.79 ? 1   GLU M OE2 1 
ATOM   2649 N  N   . ILE D 2 4   ? -42.097 -26.343 5.812   1.00 34.97 ? 2   ILE M N   1 
ATOM   2650 C  CA  . ILE D 2 4   ? -42.967 -25.499 4.982   1.00 33.94 ? 2   ILE M CA  1 
ATOM   2651 C  C   . ILE D 2 4   ? -42.856 -25.864 3.501   1.00 34.52 ? 2   ILE M C   1 
ATOM   2652 O  O   . ILE D 2 4   ? -41.819 -25.677 2.875   1.00 34.37 ? 2   ILE M O   1 
ATOM   2653 C  CB  . ILE D 2 4   ? -42.632 -24.005 5.160   1.00 33.32 ? 2   ILE M CB  1 
ATOM   2654 C  CG1 . ILE D 2 4   ? -43.016 -23.551 6.576   1.00 33.04 ? 2   ILE M CG1 1 
ATOM   2655 C  CG2 . ILE D 2 4   ? -43.349 -23.162 4.102   1.00 30.61 ? 2   ILE M CG2 1 
ATOM   2656 C  CD1 . ILE D 2 4   ? -42.235 -22.352 7.115   1.00 30.13 ? 2   ILE M CD1 1 
ATOM   2657 N  N   . VAL D 2 5   ? -43.935 -26.414 2.957   1.00 34.74 ? 3   VAL M N   1 
ATOM   2658 C  CA  . VAL D 2 5   ? -44.022 -26.677 1.529   1.00 34.43 ? 3   VAL M CA  1 
ATOM   2659 C  C   . VAL D 2 5   ? -44.405 -25.394 0.803   1.00 33.92 ? 3   VAL M C   1 
ATOM   2660 O  O   . VAL D 2 5   ? -45.463 -24.803 1.080   1.00 33.70 ? 3   VAL M O   1 
ATOM   2661 C  CB  . VAL D 2 5   ? -45.085 -27.755 1.200   1.00 34.46 ? 3   VAL M CB  1 
ATOM   2662 C  CG1 . VAL D 2 5   ? -45.098 -28.031 -0.290  1.00 34.33 ? 3   VAL M CG1 1 
ATOM   2663 C  CG2 . VAL D 2 5   ? -44.811 -29.028 1.967   1.00 34.56 ? 3   VAL M CG2 1 
ATOM   2664 N  N   . LEU D 2 6   ? -43.542 -24.977 -0.123  1.00 32.94 ? 4   LEU M N   1 
ATOM   2665 C  CA  . LEU D 2 6   ? -43.818 -23.839 -0.992  1.00 32.61 ? 4   LEU M CA  1 
ATOM   2666 C  C   . LEU D 2 6   ? -44.266 -24.341 -2.364  1.00 32.77 ? 4   LEU M C   1 
ATOM   2667 O  O   . LEU D 2 6   ? -43.564 -25.119 -3.012  1.00 34.00 ? 4   LEU M O   1 
ATOM   2668 C  CB  . LEU D 2 6   ? -42.579 -22.952 -1.154  1.00 32.27 ? 4   LEU M CB  1 
ATOM   2669 C  CG  . LEU D 2 6   ? -42.041 -22.176 0.047   1.00 31.06 ? 4   LEU M CG  1 
ATOM   2670 C  CD1 . LEU D 2 6   ? -41.052 -21.176 -0.486  1.00 33.42 ? 4   LEU M CD1 1 
ATOM   2671 C  CD2 . LEU D 2 6   ? -43.116 -21.456 0.821   1.00 31.71 ? 4   LEU M CD2 1 
ATOM   2672 N  N   . THR D 2 7   ? -45.426 -23.890 -2.811  1.00 32.49 ? 5   THR M N   1 
ATOM   2673 C  CA  . THR D 2 7   ? -45.976 -24.348 -4.072  1.00 33.15 ? 5   THR M CA  1 
ATOM   2674 C  C   . THR D 2 7   ? -46.115 -23.162 -5.014  1.00 33.68 ? 5   THR M C   1 
ATOM   2675 O  O   . THR D 2 7   ? -46.888 -22.237 -4.753  1.00 33.64 ? 5   THR M O   1 
ATOM   2676 C  CB  . THR D 2 7   ? -47.332 -25.064 -3.858  1.00 33.47 ? 5   THR M CB  1 
ATOM   2677 O  OG1 . THR D 2 7   ? -47.106 -26.275 -3.125  1.00 33.68 ? 5   THR M OG1 1 
ATOM   2678 C  CG2 . THR D 2 7   ? -48.012 -25.408 -5.193  1.00 32.89 ? 5   THR M CG2 1 
ATOM   2679 N  N   . GLN D 2 8   ? -45.340 -23.196 -6.095  1.00 34.13 ? 6   GLN M N   1 
ATOM   2680 C  CA  . GLN D 2 8   ? -45.279 -22.102 -7.060  1.00 35.06 ? 6   GLN M CA  1 
ATOM   2681 C  C   . GLN D 2 8   ? -46.280 -22.296 -8.191  1.00 35.48 ? 6   GLN M C   1 
ATOM   2682 O  O   . GLN D 2 8   ? -46.528 -23.411 -8.633  1.00 35.90 ? 6   GLN M O   1 
ATOM   2683 C  CB  . GLN D 2 8   ? -43.867 -21.984 -7.664  1.00 35.17 ? 6   GLN M CB  1 
ATOM   2684 C  CG  . GLN D 2 8   ? -42.801 -21.487 -6.686  1.00 35.87 ? 6   GLN M CG  1 
ATOM   2685 C  CD  . GLN D 2 8   ? -41.445 -21.260 -7.336  1.00 35.61 ? 6   GLN M CD  1 
ATOM   2686 O  OE1 . GLN D 2 8   ? -40.456 -21.913 -6.988  1.00 35.14 ? 6   GLN M OE1 1 
ATOM   2687 N  NE2 . GLN D 2 8   ? -41.392 -20.333 -8.277  1.00 34.14 ? 6   GLN M NE2 1 
ATOM   2688 N  N   . SER D 2 9   ? -46.842 -21.202 -8.678  1.00 35.86 ? 7   SER M N   1 
ATOM   2689 C  CA  . SER D 2 9   ? -47.690 -21.271 -9.854  1.00 36.27 ? 7   SER M CA  1 
ATOM   2690 C  C   . SER D 2 9   ? -47.483 -20.060 -10.757 1.00 36.70 ? 7   SER M C   1 
ATOM   2691 O  O   . SER D 2 9   ? -47.053 -19.001 -10.294 1.00 36.84 ? 7   SER M O   1 
ATOM   2692 C  CB  . SER D 2 9   ? -49.152 -21.345 -9.434  1.00 36.38 ? 7   SER M CB  1 
ATOM   2693 O  OG  . SER D 2 9   ? -49.552 -20.120 -8.854  1.00 36.71 ? 7   SER M OG  1 
ATOM   2694 N  N   . PRO D 2 10  ? -47.768 -20.218 -12.061 1.00 36.84 ? 8   PRO M N   1 
ATOM   2695 C  CA  . PRO D 2 10  ? -48.027 -21.500 -12.701 1.00 36.96 ? 8   PRO M CA  1 
ATOM   2696 C  C   . PRO D 2 10  ? -46.736 -22.293 -12.882 1.00 37.14 ? 8   PRO M C   1 
ATOM   2697 O  O   . PRO D 2 10  ? -45.670 -21.855 -12.436 1.00 36.03 ? 8   PRO M O   1 
ATOM   2698 C  CB  . PRO D 2 10  ? -48.597 -21.095 -14.063 1.00 36.67 ? 8   PRO M CB  1 
ATOM   2699 C  CG  . PRO D 2 10  ? -47.984 -19.795 -14.337 1.00 36.52 ? 8   PRO M CG  1 
ATOM   2700 C  CD  . PRO D 2 10  ? -47.898 -19.104 -13.013 1.00 36.67 ? 8   PRO M CD  1 
ATOM   2701 N  N   . GLY D 2 11  ? -46.844 -23.450 -13.530 1.00 37.82 ? 9   GLY M N   1 
ATOM   2702 C  CA  . GLY D 2 11  ? -45.668 -24.263 -13.848 1.00 38.41 ? 9   GLY M CA  1 
ATOM   2703 C  C   . GLY D 2 11  ? -44.831 -23.605 -14.930 1.00 38.92 ? 9   GLY M C   1 
ATOM   2704 O  O   . GLY D 2 11  ? -43.653 -23.328 -14.731 1.00 38.95 ? 9   GLY M O   1 
ATOM   2705 N  N   . THR D 2 12  ? -45.457 -23.355 -16.075 1.00 39.60 ? 10  THR M N   1 
ATOM   2706 C  CA  . THR D 2 12  ? -44.810 -22.689 -17.195 1.00 40.34 ? 10  THR M CA  1 
ATOM   2707 C  C   . THR D 2 12  ? -45.426 -21.318 -17.405 1.00 40.99 ? 10  THR M C   1 
ATOM   2708 O  O   . THR D 2 12  ? -46.470 -20.998 -16.834 1.00 41.71 ? 10  THR M O   1 
ATOM   2709 C  CB  . THR D 2 12  ? -44.981 -23.494 -18.500 1.00 40.32 ? 10  THR M CB  1 
ATOM   2710 O  OG1 . THR D 2 12  ? -44.422 -24.798 -18.325 1.00 42.04 ? 10  THR M OG1 1 
ATOM   2711 C  CG2 . THR D 2 12  ? -44.297 -22.808 -19.686 1.00 38.77 ? 10  THR M CG2 1 
ATOM   2712 N  N   . GLN D 2 13  ? -44.771 -20.508 -18.227 1.00 41.12 ? 11  GLN M N   1 
ATOM   2713 C  CA  . GLN D 2 13  ? -45.313 -19.223 -18.618 1.00 41.02 ? 11  GLN M CA  1 
ATOM   2714 C  C   . GLN D 2 13  ? -44.671 -18.723 -19.910 1.00 40.57 ? 11  GLN M C   1 
ATOM   2715 O  O   . GLN D 2 13  ? -43.448 -18.639 -20.019 1.00 40.42 ? 11  GLN M O   1 
ATOM   2716 C  CB  . GLN D 2 13  ? -45.092 -18.222 -17.507 1.00 41.32 ? 11  GLN M CB  1 
ATOM   2717 C  CG  . GLN D 2 13  ? -46.189 -17.226 -17.398 1.00 43.34 ? 11  GLN M CG  1 
ATOM   2718 C  CD  . GLN D 2 13  ? -46.112 -16.487 -16.107 1.00 45.78 ? 11  GLN M CD  1 
ATOM   2719 O  OE1 . GLN D 2 13  ? -45.186 -15.704 -15.889 1.00 47.87 ? 11  GLN M OE1 1 
ATOM   2720 N  NE2 . GLN D 2 13  ? -47.073 -16.738 -15.218 1.00 47.13 ? 11  GLN M NE2 1 
ATOM   2721 N  N   . SER D 2 14  ? -45.512 -18.383 -20.881 1.00 39.97 ? 12  SER M N   1 
ATOM   2722 C  CA  . SER D 2 14  ? -45.050 -17.982 -22.204 1.00 39.23 ? 12  SER M CA  1 
ATOM   2723 C  C   . SER D 2 14  ? -45.423 -16.542 -22.511 1.00 38.45 ? 12  SER M C   1 
ATOM   2724 O  O   . SER D 2 14  ? -46.586 -16.182 -22.566 1.00 38.01 ? 12  SER M O   1 
ATOM   2725 C  CB  . SER D 2 14  ? -45.627 -18.905 -23.277 1.00 39.21 ? 12  SER M CB  1 
ATOM   2726 O  OG  . SER D 2 14  ? -45.043 -20.195 -23.185 1.00 39.79 ? 12  SER M OG  1 
ATOM   2727 N  N   . LEU D 2 15  ? -44.407 -15.725 -22.724 1.00 38.28 ? 13  LEU M N   1 
ATOM   2728 C  CA  . LEU D 2 15  ? -44.598 -14.311 -22.992 1.00 37.87 ? 13  LEU M CA  1 
ATOM   2729 C  C   . LEU D 2 15  ? -43.563 -13.839 -24.009 1.00 37.27 ? 13  LEU M C   1 
ATOM   2730 O  O   . LEU D 2 15  ? -42.598 -14.550 -24.308 1.00 36.89 ? 13  LEU M O   1 
ATOM   2731 C  CB  . LEU D 2 15  ? -44.465 -13.512 -21.689 1.00 37.99 ? 13  LEU M CB  1 
ATOM   2732 C  CG  . LEU D 2 15  ? -45.279 -14.024 -20.493 1.00 37.76 ? 13  LEU M CG  1 
ATOM   2733 C  CD1 . LEU D 2 15  ? -44.924 -13.255 -19.241 1.00 37.07 ? 13  LEU M CD1 1 
ATOM   2734 C  CD2 . LEU D 2 15  ? -46.782 -13.943 -20.776 1.00 37.78 ? 13  LEU M CD2 1 
ATOM   2735 N  N   . SER D 2 16  ? -43.775 -12.647 -24.550 1.00 36.66 ? 14  SER M N   1 
ATOM   2736 C  CA  . SER D 2 16  ? -42.778 -12.027 -25.405 1.00 36.88 ? 14  SER M CA  1 
ATOM   2737 C  C   . SER D 2 16  ? -42.098 -10.902 -24.630 1.00 37.33 ? 14  SER M C   1 
ATOM   2738 O  O   . SER D 2 16  ? -42.635 -10.423 -23.631 1.00 37.32 ? 14  SER M O   1 
ATOM   2739 C  CB  . SER D 2 16  ? -43.421 -11.490 -26.679 1.00 36.71 ? 14  SER M CB  1 
ATOM   2740 O  OG  . SER D 2 16  ? -44.054 -12.527 -27.404 1.00 36.84 ? 14  SER M OG  1 
ATOM   2741 N  N   . PRO D 2 17  ? -40.900 -10.487 -25.068 1.00 37.90 ? 15  PRO M N   1 
ATOM   2742 C  CA  . PRO D 2 17  ? -40.280 -9.329  -24.429 1.00 38.11 ? 15  PRO M CA  1 
ATOM   2743 C  C   . PRO D 2 17  ? -41.218 -8.130  -24.424 1.00 37.89 ? 15  PRO M C   1 
ATOM   2744 O  O   . PRO D 2 17  ? -41.981 -7.946  -25.368 1.00 37.63 ? 15  PRO M O   1 
ATOM   2745 C  CB  . PRO D 2 17  ? -39.057 -9.057  -25.309 1.00 38.33 ? 15  PRO M CB  1 
ATOM   2746 C  CG  . PRO D 2 17  ? -38.723 -10.391 -25.901 1.00 38.48 ? 15  PRO M CG  1 
ATOM   2747 C  CD  . PRO D 2 17  ? -40.052 -11.052 -26.133 1.00 38.03 ? 15  PRO M CD  1 
ATOM   2748 N  N   . GLY D 2 18  ? -41.168 -7.337  -23.359 1.00 37.95 ? 16  GLY M N   1 
ATOM   2749 C  CA  . GLY D 2 18  ? -42.047 -6.175  -23.217 1.00 38.08 ? 16  GLY M CA  1 
ATOM   2750 C  C   . GLY D 2 18  ? -43.284 -6.461  -22.383 1.00 38.20 ? 16  GLY M C   1 
ATOM   2751 O  O   . GLY D 2 18  ? -43.862 -5.555  -21.787 1.00 38.20 ? 16  GLY M O   1 
ATOM   2752 N  N   . GLU D 2 19  ? -43.692 -7.724  -22.338 1.00 38.53 ? 17  GLU M N   1 
ATOM   2753 C  CA  . GLU D 2 19  ? -44.858 -8.126  -21.550 1.00 39.13 ? 17  GLU M CA  1 
ATOM   2754 C  C   . GLU D 2 19  ? -44.509 -8.324  -20.077 1.00 38.99 ? 17  GLU M C   1 
ATOM   2755 O  O   . GLU D 2 19  ? -43.343 -8.465  -19.713 1.00 38.25 ? 17  GLU M O   1 
ATOM   2756 C  CB  . GLU D 2 19  ? -45.478 -9.414  -22.104 1.00 39.44 ? 17  GLU M CB  1 
ATOM   2757 C  CG  . GLU D 2 19  ? -46.540 -9.197  -23.162 1.00 40.51 ? 17  GLU M CG  1 
ATOM   2758 C  CD  . GLU D 2 19  ? -47.023 -10.500 -23.778 1.00 41.87 ? 17  GLU M CD  1 
ATOM   2759 O  OE1 . GLU D 2 19  ? -48.134 -10.505 -24.349 1.00 43.47 ? 17  GLU M OE1 1 
ATOM   2760 O  OE2 . GLU D 2 19  ? -46.296 -11.514 -23.696 1.00 41.13 ? 17  GLU M OE2 1 
ATOM   2761 N  N   . ARG D 2 20  ? -45.546 -8.353  -19.250 1.00 39.35 ? 18  ARG M N   1 
ATOM   2762 C  CA  . ARG D 2 20  ? -45.400 -8.394  -17.796 1.00 40.01 ? 18  ARG M CA  1 
ATOM   2763 C  C   . ARG D 2 20  ? -45.771 -9.754  -17.225 1.00 39.64 ? 18  ARG M C   1 
ATOM   2764 O  O   . ARG D 2 20  ? -46.865 -10.272 -17.475 1.00 40.31 ? 18  ARG M O   1 
ATOM   2765 C  CB  . ARG D 2 20  ? -46.285 -7.323  -17.164 1.00 40.51 ? 18  ARG M CB  1 
ATOM   2766 C  CG  . ARG D 2 20  ? -46.748 -7.619  -15.749 1.00 42.19 ? 18  ARG M CG  1 
ATOM   2767 C  CD  . ARG D 2 20  ? -48.191 -7.180  -15.586 1.00 44.77 ? 18  ARG M CD  1 
ATOM   2768 N  NE  . ARG D 2 20  ? -48.567 -7.027  -14.186 1.00 47.45 ? 18  ARG M NE  1 
ATOM   2769 C  CZ  . ARG D 2 20  ? -48.543 -5.876  -13.518 1.00 49.67 ? 18  ARG M CZ  1 
ATOM   2770 N  NH1 . ARG D 2 20  ? -48.159 -4.751  -14.117 1.00 50.16 ? 18  ARG M NH1 1 
ATOM   2771 N  NH2 . ARG D 2 20  ? -48.906 -5.851  -12.240 1.00 49.96 ? 18  ARG M NH2 1 
ATOM   2772 N  N   . ALA D 2 21  ? -44.863 -10.307 -16.428 1.00 38.86 ? 19  ALA M N   1 
ATOM   2773 C  CA  . ALA D 2 21  ? -45.051 -11.624 -15.826 1.00 38.30 ? 19  ALA M CA  1 
ATOM   2774 C  C   . ALA D 2 21  ? -45.359 -11.524 -14.330 1.00 37.54 ? 19  ALA M C   1 
ATOM   2775 O  O   . ALA D 2 21  ? -44.775 -10.718 -13.619 1.00 36.50 ? 19  ALA M O   1 
ATOM   2776 C  CB  . ALA D 2 21  ? -43.813 -12.485 -16.058 1.00 38.29 ? 19  ALA M CB  1 
ATOM   2777 N  N   . THR D 2 22  ? -46.283 -12.366 -13.879 1.00 37.64 ? 20  THR M N   1 
ATOM   2778 C  CA  . THR D 2 22  ? -46.715 -12.417 -12.481 1.00 37.67 ? 20  THR M CA  1 
ATOM   2779 C  C   . THR D 2 22  ? -46.583 -13.852 -11.944 1.00 37.65 ? 20  THR M C   1 
ATOM   2780 O  O   . THR D 2 22  ? -47.356 -14.744 -12.308 1.00 38.10 ? 20  THR M O   1 
ATOM   2781 C  CB  . THR D 2 22  ? -48.176 -11.926 -12.351 1.00 37.54 ? 20  THR M CB  1 
ATOM   2782 O  OG1 . THR D 2 22  ? -48.217 -10.519 -12.590 1.00 38.07 ? 20  THR M OG1 1 
ATOM   2783 C  CG2 . THR D 2 22  ? -48.746 -12.205 -10.971 1.00 37.37 ? 20  THR M CG2 1 
ATOM   2784 N  N   . LEU D 2 23  ? -45.586 -14.067 -11.092 1.00 37.29 ? 21  LEU M N   1 
ATOM   2785 C  CA  . LEU D 2 23  ? -45.320 -15.384 -10.522 1.00 36.92 ? 21  LEU M CA  1 
ATOM   2786 C  C   . LEU D 2 23  ? -45.848 -15.442 -9.098  1.00 36.78 ? 21  LEU M C   1 
ATOM   2787 O  O   . LEU D 2 23  ? -45.779 -14.459 -8.364  1.00 36.27 ? 21  LEU M O   1 
ATOM   2788 C  CB  . LEU D 2 23  ? -43.819 -15.657 -10.514 1.00 37.38 ? 21  LEU M CB  1 
ATOM   2789 C  CG  . LEU D 2 23  ? -43.100 -15.802 -11.863 1.00 38.29 ? 21  LEU M CG  1 
ATOM   2790 C  CD1 . LEU D 2 23  ? -43.667 -14.867 -12.917 1.00 38.04 ? 21  LEU M CD1 1 
ATOM   2791 C  CD2 . LEU D 2 23  ? -41.599 -15.572 -11.706 1.00 37.82 ? 21  LEU M CD2 1 
ATOM   2792 N  N   . SER D 2 24  ? -46.373 -16.594 -8.705  1.00 36.90 ? 22  SER M N   1 
ATOM   2793 C  CA  . SER D 2 24  ? -46.896 -16.768 -7.353  1.00 37.45 ? 22  SER M CA  1 
ATOM   2794 C  C   . SER D 2 24  ? -46.141 -17.847 -6.571  1.00 38.16 ? 22  SER M C   1 
ATOM   2795 O  O   . SER D 2 24  ? -45.817 -18.910 -7.109  1.00 38.14 ? 22  SER M O   1 
ATOM   2796 C  CB  . SER D 2 24  ? -48.377 -17.141 -7.400  1.00 37.48 ? 22  SER M CB  1 
ATOM   2797 O  OG  . SER D 2 24  ? -49.076 -16.364 -8.355  1.00 38.46 ? 22  SER M OG  1 
ATOM   2798 N  N   . CYS D 2 25  ? -45.876 -17.568 -5.297  1.00 38.61 ? 23  CYS M N   1 
ATOM   2799 C  CA  . CYS D 2 25  ? -45.360 -18.572 -4.369  1.00 39.14 ? 23  CYS M CA  1 
ATOM   2800 C  C   . CYS D 2 25  ? -46.309 -18.662 -3.180  1.00 38.70 ? 23  CYS M C   1 
ATOM   2801 O  O   . CYS D 2 25  ? -46.544 -17.663 -2.516  1.00 39.05 ? 23  CYS M O   1 
ATOM   2802 C  CB  . CYS D 2 25  ? -43.942 -18.205 -3.903  1.00 39.19 ? 23  CYS M CB  1 
ATOM   2803 S  SG  . CYS D 2 25  ? -43.157 -19.385 -2.735  1.00 42.86 ? 23  CYS M SG  1 
ATOM   2804 N  N   . ARG D 2 26  ? -46.849 -19.856 -2.932  1.00 38.69 ? 24  ARG M N   1 
ATOM   2805 C  CA  . ARG D 2 26  ? -47.757 -20.127 -1.792  1.00 38.80 ? 24  ARG M CA  1 
ATOM   2806 C  C   . ARG D 2 26  ? -47.153 -21.044 -0.688  1.00 37.94 ? 24  ARG M C   1 
ATOM   2807 O  O   . ARG D 2 26  ? -46.755 -22.181 -0.948  1.00 37.96 ? 24  ARG M O   1 
ATOM   2808 C  CB  . ARG D 2 26  ? -49.056 -20.744 -2.320  1.00 39.13 ? 24  ARG M CB  1 
ATOM   2809 C  CG  . ARG D 2 26  ? -49.991 -21.336 -1.258  1.00 40.79 ? 24  ARG M CG  1 
ATOM   2810 C  CD  . ARG D 2 26  ? -51.144 -20.375 -0.880  1.00 42.11 ? 24  ARG M CD  1 
ATOM   2811 N  N   . ALA D 2 27  ? -47.111 -20.545 0.546   1.00 36.82 ? 25  ALA M N   1 
ATOM   2812 C  CA  . ALA D 2 27  ? -46.617 -21.325 1.698   1.00 35.76 ? 25  ALA M CA  1 
ATOM   2813 C  C   . ALA D 2 27  ? -47.733 -22.086 2.446   1.00 34.81 ? 25  ALA M C   1 
ATOM   2814 O  O   . ALA D 2 27  ? -48.813 -21.554 2.687   1.00 34.35 ? 25  ALA M O   1 
ATOM   2815 C  CB  . ALA D 2 27  ? -45.873 -20.415 2.661   1.00 35.25 ? 25  ALA M CB  1 
ATOM   2816 N  N   . SER D 2 28  ? -47.437 -23.328 2.823   1.00 34.36 ? 26  SER M N   1 
ATOM   2817 C  CA  . SER D 2 28  ? -48.380 -24.217 3.528   1.00 33.80 ? 26  SER M CA  1 
ATOM   2818 C  C   . SER D 2 28  ? -48.634 -23.773 4.971   1.00 33.15 ? 26  SER M C   1 
ATOM   2819 O  O   . SER D 2 28  ? -49.652 -24.107 5.564   1.00 31.55 ? 26  SER M O   1 
ATOM   2820 C  CB  . SER D 2 28  ? -47.838 -25.657 3.535   1.00 34.17 ? 26  SER M CB  1 
ATOM   2821 O  OG  . SER D 2 28  ? -46.631 -25.756 4.292   1.00 33.42 ? 26  SER M OG  1 
ATOM   2822 N  N   . GLN D 2 29  ? -47.666 -23.068 5.544   1.00 33.43 ? 27  GLN M N   1 
ATOM   2823 C  CA  . GLN D 2 29  ? -47.899 -22.271 6.751   1.00 33.89 ? 27  GLN M CA  1 
ATOM   2824 C  C   . GLN D 2 29  ? -47.206 -20.919 6.582   1.00 33.35 ? 27  GLN M C   1 
ATOM   2825 O  O   . GLN D 2 29  ? -46.426 -20.722 5.660   1.00 32.56 ? 27  GLN M O   1 
ATOM   2826 C  CB  . GLN D 2 29  ? -47.470 -23.002 8.041   1.00 34.05 ? 27  GLN M CB  1 
ATOM   2827 C  CG  . GLN D 2 29  ? -46.057 -23.546 8.054   1.00 35.34 ? 27  GLN M CG  1 
ATOM   2828 C  CD  . GLN D 2 29  ? -45.735 -24.311 9.330   1.00 36.67 ? 27  GLN M CD  1 
ATOM   2829 O  OE1 . GLN D 2 29  ? -46.470 -25.214 9.722   1.00 40.11 ? 27  GLN M OE1 1 
ATOM   2830 N  NE2 . GLN D 2 29  ? -44.634 -23.952 9.983   1.00 36.55 ? 27  GLN M NE2 1 
ATOM   2831 N  N   . SER D 2 30  ? -47.526 -19.978 7.454   1.00 33.58 ? 28  SER M N   1 
ATOM   2832 C  CA  . SER D 2 30  ? -47.028 -18.623 7.311   1.00 34.15 ? 28  SER M CA  1 
ATOM   2833 C  C   . SER D 2 30  ? -45.505 -18.584 7.510   1.00 33.81 ? 28  SER M C   1 
ATOM   2834 O  O   . SER D 2 30  ? -44.935 -19.395 8.256   1.00 32.35 ? 28  SER M O   1 
ATOM   2835 C  CB  . SER D 2 30  ? -47.767 -17.708 8.297   1.00 34.22 ? 28  SER M CB  1 
ATOM   2836 O  OG  . SER D 2 30  ? -47.241 -16.400 8.308   1.00 38.21 ? 28  SER M OG  1 
ATOM   2837 N  N   . VAL D 2 31  ? -44.857 -17.652 6.816   1.00 33.96 ? 29  VAL M N   1 
ATOM   2838 C  CA  . VAL D 2 31  ? -43.394 -17.563 6.815   1.00 34.12 ? 29  VAL M CA  1 
ATOM   2839 C  C   . VAL D 2 31  ? -42.940 -16.521 7.828   1.00 33.96 ? 29  VAL M C   1 
ATOM   2840 O  O   . VAL D 2 31  ? -43.444 -15.397 7.853   1.00 34.42 ? 29  VAL M O   1 
ATOM   2841 C  CB  . VAL D 2 31  ? -42.847 -17.202 5.416   1.00 33.81 ? 29  VAL M CB  1 
ATOM   2842 C  CG1 . VAL D 2 31  ? -41.343 -17.364 5.377   1.00 35.83 ? 29  VAL M CG1 1 
ATOM   2843 C  CG2 . VAL D 2 31  ? -43.472 -18.091 4.372   1.00 33.46 ? 29  VAL M CG2 1 
ATOM   2844 N  N   . GLY D 2 32  ? -42.006 -16.915 8.681   1.00 33.53 ? 30  GLY M N   1 
ATOM   2845 C  CA  . GLY D 2 32  ? -41.508 -16.044 9.733   1.00 33.21 ? 30  GLY M CA  1 
ATOM   2846 C  C   . GLY D 2 32  ? -40.802 -14.790 9.235   1.00 33.33 ? 30  GLY M C   1 
ATOM   2847 O  O   . GLY D 2 32  ? -39.804 -14.851 8.501   1.00 33.12 ? 30  GLY M O   1 
ATOM   2848 N  N   . ASN D 2 33  ? -41.339 -13.647 9.637   1.00 32.96 ? 31  ASN M N   1 
ATOM   2849 C  CA  . ASN D 2 33  ? -40.709 -12.365 9.379   1.00 33.02 ? 31  ASN M CA  1 
ATOM   2850 C  C   . ASN D 2 33  ? -40.615 -12.034 7.894   1.00 32.30 ? 31  ASN M C   1 
ATOM   2851 O  O   . ASN D 2 33  ? -39.748 -11.275 7.451   1.00 31.98 ? 31  ASN M O   1 
ATOM   2852 C  CB  . ASN D 2 33  ? -39.335 -12.337 10.049  1.00 33.39 ? 31  ASN M CB  1 
ATOM   2853 C  CG  . ASN D 2 33  ? -39.438 -12.453 11.551  1.00 34.08 ? 31  ASN M CG  1 
ATOM   2854 O  OD1 . ASN D 2 33  ? -40.100 -11.644 12.204  1.00 36.09 ? 31  ASN M OD1 1 
ATOM   2855 N  ND2 . ASN D 2 33  ? -38.802 -13.467 12.109  1.00 36.69 ? 31  ASN M ND2 1 
ATOM   2856 N  N   . ASN D 2 34  ? -41.537 -12.593 7.132   1.00 31.79 ? 32  ASN M N   1 
ATOM   2857 C  CA  . ASN D 2 34  ? -41.534 -12.415 5.692   1.00 32.10 ? 32  ASN M CA  1 
ATOM   2858 C  C   . ASN D 2 34  ? -40.162 -12.712 5.099   1.00 31.18 ? 32  ASN M C   1 
ATOM   2859 O  O   . ASN D 2 34  ? -39.720 -12.076 4.139   1.00 30.94 ? 32  ASN M O   1 
ATOM   2860 C  CB  . ASN D 2 34  ? -42.002 -11.004 5.322   1.00 32.66 ? 32  ASN M CB  1 
ATOM   2861 C  CG  . ASN D 2 34  ? -43.507 -10.884 5.312   1.00 34.39 ? 32  ASN M CG  1 
ATOM   2862 O  OD1 . ASN D 2 34  ? -44.216 -11.726 5.878   1.00 36.74 ? 32  ASN M OD1 1 
ATOM   2863 N  ND2 . ASN D 2 34  ? -44.011 -9.841  4.659   1.00 36.53 ? 32  ASN M ND2 1 
ATOM   2864 N  N   . LYS D 2 35  ? -39.488 -13.697 5.666   1.00 30.56 ? 33  LYS M N   1 
ATOM   2865 C  CA  . LYS D 2 35  ? -38.185 -14.053 5.152   1.00 30.52 ? 33  LYS M CA  1 
ATOM   2866 C  C   . LYS D 2 35  ? -38.389 -14.948 3.931   1.00 30.02 ? 33  LYS M C   1 
ATOM   2867 O  O   . LYS D 2 35  ? -38.351 -16.163 4.027   1.00 29.81 ? 33  LYS M O   1 
ATOM   2868 C  CB  . LYS D 2 35  ? -37.348 -14.725 6.233   1.00 30.68 ? 33  LYS M CB  1 
ATOM   2869 C  CG  . LYS D 2 35  ? -36.987 -13.794 7.412   1.00 30.31 ? 33  LYS M CG  1 
ATOM   2870 C  CD  . LYS D 2 35  ? -35.727 -12.969 7.141   1.00 29.64 ? 33  LYS M CD  1 
ATOM   2871 C  CE  . LYS D 2 35  ? -35.325 -12.103 8.327   1.00 27.16 ? 33  LYS M CE  1 
ATOM   2872 N  NZ  . LYS D 2 35  ? -35.306 -12.890 9.584   1.00 26.18 ? 33  LYS M NZ  1 
ATOM   2873 N  N   . LEU D 2 36  ? -38.620 -14.316 2.783   1.00 29.38 ? 34  LEU M N   1 
ATOM   2874 C  CA  . LEU D 2 36  ? -38.912 -15.021 1.545   1.00 28.60 ? 34  LEU M CA  1 
ATOM   2875 C  C   . LEU D 2 36  ? -38.164 -14.407 0.380   1.00 28.03 ? 34  LEU M C   1 
ATOM   2876 O  O   . LEU D 2 36  ? -38.375 -13.236 0.052   1.00 28.84 ? 34  LEU M O   1 
ATOM   2877 C  CB  . LEU D 2 36  ? -40.402 -14.958 1.255   1.00 29.20 ? 34  LEU M CB  1 
ATOM   2878 C  CG  . LEU D 2 36  ? -40.760 -15.476 -0.140  1.00 29.42 ? 34  LEU M CG  1 
ATOM   2879 C  CD1 . LEU D 2 36  ? -41.862 -16.512 -0.052  1.00 29.23 ? 34  LEU M CD1 1 
ATOM   2880 C  CD2 . LEU D 2 36  ? -41.125 -14.325 -1.058  1.00 28.00 ? 34  LEU M CD2 1 
ATOM   2881 N  N   . ALA D 2 37  ? -37.305 -15.197 -0.256  1.00 27.30 ? 35  ALA M N   1 
ATOM   2882 C  CA  . ALA D 2 37  ? -36.447 -14.699 -1.333  1.00 27.37 ? 35  ALA M CA  1 
ATOM   2883 C  C   . ALA D 2 37  ? -36.853 -15.253 -2.704  1.00 27.73 ? 35  ALA M C   1 
ATOM   2884 O  O   . ALA D 2 37  ? -37.449 -16.337 -2.803  1.00 27.13 ? 35  ALA M O   1 
ATOM   2885 C  CB  . ALA D 2 37  ? -35.010 -15.044 -1.043  1.00 26.89 ? 35  ALA M CB  1 
ATOM   2886 N  N   . TRP D 2 38  ? -36.523 -14.512 -3.759  1.00 27.58 ? 36  TRP M N   1 
ATOM   2887 C  CA  . TRP D 2 38  ? -36.753 -15.001 -5.112  1.00 27.67 ? 36  TRP M CA  1 
ATOM   2888 C  C   . TRP D 2 38  ? -35.449 -15.086 -5.889  1.00 27.32 ? 36  TRP M C   1 
ATOM   2889 O  O   . TRP D 2 38  ? -34.634 -14.176 -5.830  1.00 26.99 ? 36  TRP M O   1 
ATOM   2890 C  CB  . TRP D 2 38  ? -37.670 -14.076 -5.884  1.00 27.56 ? 36  TRP M CB  1 
ATOM   2891 C  CG  . TRP D 2 38  ? -39.079 -14.060 -5.489  1.00 27.60 ? 36  TRP M CG  1 
ATOM   2892 C  CD1 . TRP D 2 38  ? -39.668 -13.158 -4.667  1.00 29.97 ? 36  TRP M CD1 1 
ATOM   2893 C  CD2 . TRP D 2 38  ? -40.123 -14.921 -5.955  1.00 28.40 ? 36  TRP M CD2 1 
ATOM   2894 N  NE1 . TRP D 2 38  ? -41.011 -13.409 -4.563  1.00 30.04 ? 36  TRP M NE1 1 
ATOM   2895 C  CE2 . TRP D 2 38  ? -41.321 -14.489 -5.341  1.00 28.37 ? 36  TRP M CE2 1 
ATOM   2896 C  CE3 . TRP D 2 38  ? -40.164 -16.021 -6.814  1.00 28.16 ? 36  TRP M CE3 1 
ATOM   2897 C  CZ2 . TRP D 2 38  ? -42.546 -15.109 -5.565  1.00 26.88 ? 36  TRP M CZ2 1 
ATOM   2898 C  CZ3 . TRP D 2 38  ? -41.384 -16.636 -7.040  1.00 28.59 ? 36  TRP M CZ3 1 
ATOM   2899 C  CH2 . TRP D 2 38  ? -42.562 -16.172 -6.423  1.00 28.22 ? 36  TRP M CH2 1 
ATOM   2900 N  N   . TYR D 2 39  ? -35.301 -16.152 -6.669  1.00 27.02 ? 37  TYR M N   1 
ATOM   2901 C  CA  . TYR D 2 39  ? -34.078 -16.392 -7.421  1.00 26.65 ? 37  TYR M CA  1 
ATOM   2902 C  C   . TYR D 2 39  ? -34.377 -16.655 -8.881  1.00 26.46 ? 37  TYR M C   1 
ATOM   2903 O  O   . TYR D 2 39  ? -35.429 -17.156 -9.231  1.00 26.03 ? 37  TYR M O   1 
ATOM   2904 C  CB  . TYR D 2 39  ? -33.334 -17.597 -6.869  1.00 26.53 ? 37  TYR M CB  1 
ATOM   2905 C  CG  . TYR D 2 39  ? -32.915 -17.468 -5.437  1.00 27.04 ? 37  TYR M CG  1 
ATOM   2906 C  CD1 . TYR D 2 39  ? -33.757 -17.889 -4.407  1.00 25.03 ? 37  TYR M CD1 1 
ATOM   2907 C  CD2 . TYR D 2 39  ? -31.668 -16.949 -5.108  1.00 26.32 ? 37  TYR M CD2 1 
ATOM   2908 C  CE1 . TYR D 2 39  ? -33.386 -17.770 -3.095  1.00 25.32 ? 37  TYR M CE1 1 
ATOM   2909 C  CE2 . TYR D 2 39  ? -31.280 -16.836 -3.798  1.00 27.37 ? 37  TYR M CE2 1 
ATOM   2910 C  CZ  . TYR D 2 39  ? -32.142 -17.245 -2.787  1.00 27.36 ? 37  TYR M CZ  1 
ATOM   2911 O  OH  . TYR D 2 39  ? -31.742 -17.128 -1.467  1.00 28.87 ? 37  TYR M OH  1 
ATOM   2912 N  N   . GLN D 2 40  ? -33.409 -16.322 -9.715  1.00 27.18 ? 38  GLN M N   1 
ATOM   2913 C  CA  . GLN D 2 40  ? -33.466 -16.566 -11.146 1.00 27.92 ? 38  GLN M CA  1 
ATOM   2914 C  C   . GLN D 2 40  ? -32.369 -17.546 -11.525 1.00 28.25 ? 38  GLN M C   1 
ATOM   2915 O  O   . GLN D 2 40  ? -31.263 -17.480 -10.999 1.00 28.40 ? 38  GLN M O   1 
ATOM   2916 C  CB  . GLN D 2 40  ? -33.231 -15.263 -11.897 1.00 27.75 ? 38  GLN M CB  1 
ATOM   2917 C  CG  . GLN D 2 40  ? -33.364 -15.379 -13.394 1.00 27.91 ? 38  GLN M CG  1 
ATOM   2918 C  CD  . GLN D 2 40  ? -33.041 -14.070 -14.093 1.00 28.77 ? 38  GLN M CD  1 
ATOM   2919 O  OE1 . GLN D 2 40  ? -31.872 -13.710 -14.261 1.00 27.20 ? 38  GLN M OE1 1 
ATOM   2920 N  NE2 . GLN D 2 40  ? -34.077 -13.349 -14.497 1.00 28.35 ? 38  GLN M NE2 1 
ATOM   2921 N  N   . GLN D 2 41  ? -32.669 -18.454 -12.442 1.00 28.44 ? 39  GLN M N   1 
ATOM   2922 C  CA  . GLN D 2 41  ? -31.665 -19.404 -12.899 1.00 28.45 ? 39  GLN M CA  1 
ATOM   2923 C  C   . GLN D 2 41  ? -31.830 -19.651 -14.376 1.00 28.21 ? 39  GLN M C   1 
ATOM   2924 O  O   . GLN D 2 41  ? -32.841 -20.195 -14.808 1.00 27.50 ? 39  GLN M O   1 
ATOM   2925 C  CB  . GLN D 2 41  ? -31.766 -20.726 -12.136 1.00 28.45 ? 39  GLN M CB  1 
ATOM   2926 C  CG  . GLN D 2 41  ? -30.735 -21.760 -12.546 1.00 29.07 ? 39  GLN M CG  1 
ATOM   2927 C  CD  . GLN D 2 41  ? -30.814 -23.029 -11.715 1.00 31.33 ? 39  GLN M CD  1 
ATOM   2928 O  OE1 . GLN D 2 41  ? -31.904 -23.524 -11.419 1.00 33.62 ? 39  GLN M OE1 1 
ATOM   2929 N  NE2 . GLN D 2 41  ? -29.656 -23.566 -11.341 1.00 30.94 ? 39  GLN M NE2 1 
ATOM   2930 N  N   . ARG D 2 42  ? -30.826 -19.233 -15.138 1.00 28.85 ? 40  ARG M N   1 
ATOM   2931 C  CA  . ARG D 2 42  ? -30.738 -19.547 -16.560 1.00 29.82 ? 40  ARG M CA  1 
ATOM   2932 C  C   . ARG D 2 42  ? -30.081 -20.922 -16.719 1.00 29.43 ? 40  ARG M C   1 
ATOM   2933 O  O   . ARG D 2 42  ? -29.388 -21.394 -15.815 1.00 29.08 ? 40  ARG M O   1 
ATOM   2934 C  CB  . ARG D 2 42  ? -29.912 -18.494 -17.303 1.00 30.32 ? 40  ARG M CB  1 
ATOM   2935 C  CG  . ARG D 2 42  ? -30.310 -17.071 -17.020 1.00 32.98 ? 40  ARG M CG  1 
ATOM   2936 C  CD  . ARG D 2 42  ? -29.541 -16.125 -17.900 1.00 37.22 ? 40  ARG M CD  1 
ATOM   2937 N  NE  . ARG D 2 42  ? -29.836 -14.729 -17.579 1.00 42.94 ? 40  ARG M NE  1 
ATOM   2938 C  CZ  . ARG D 2 42  ? -29.076 -13.931 -16.821 1.00 46.68 ? 40  ARG M CZ  1 
ATOM   2939 N  NH1 . ARG D 2 42  ? -27.933 -14.367 -16.284 1.00 47.79 ? 40  ARG M NH1 1 
ATOM   2940 N  NH2 . ARG D 2 42  ? -29.461 -12.676 -16.600 1.00 47.92 ? 40  ARG M NH2 1 
ATOM   2941 N  N   . PRO D 2 43  ? -30.278 -21.560 -17.877 1.00 29.05 ? 41  PRO M N   1 
ATOM   2942 C  CA  . PRO D 2 43  ? -29.770 -22.909 -18.064 1.00 29.00 ? 41  PRO M CA  1 
ATOM   2943 C  C   . PRO D 2 43  ? -28.285 -23.042 -17.753 1.00 29.26 ? 41  PRO M C   1 
ATOM   2944 O  O   . PRO D 2 43  ? -27.486 -22.184 -18.130 1.00 29.41 ? 41  PRO M O   1 
ATOM   2945 C  CB  . PRO D 2 43  ? -30.019 -23.169 -19.548 1.00 29.22 ? 41  PRO M CB  1 
ATOM   2946 C  CG  . PRO D 2 43  ? -31.170 -22.289 -19.895 1.00 28.91 ? 41  PRO M CG  1 
ATOM   2947 C  CD  . PRO D 2 43  ? -30.969 -21.057 -19.078 1.00 28.79 ? 41  PRO M CD  1 
ATOM   2948 N  N   . GLY D 2 44  ? -27.936 -24.113 -17.047 1.00 29.44 ? 42  GLY M N   1 
ATOM   2949 C  CA  . GLY D 2 44  ? -26.531 -24.459 -16.777 1.00 28.74 ? 42  GLY M CA  1 
ATOM   2950 C  C   . GLY D 2 44  ? -25.785 -23.478 -15.889 1.00 28.21 ? 42  GLY M C   1 
ATOM   2951 O  O   . GLY D 2 44  ? -24.576 -23.598 -15.726 1.00 27.83 ? 42  GLY M O   1 
ATOM   2952 N  N   . GLN D 2 45  ? -26.503 -22.516 -15.311 1.00 27.51 ? 43  GLN M N   1 
ATOM   2953 C  CA  . GLN D 2 45  ? -25.888 -21.469 -14.504 1.00 26.99 ? 43  GLN M CA  1 
ATOM   2954 C  C   . GLN D 2 45  ? -26.398 -21.530 -13.090 1.00 26.18 ? 43  GLN M C   1 
ATOM   2955 O  O   . GLN D 2 45  ? -27.451 -22.112 -12.819 1.00 25.66 ? 43  GLN M O   1 
ATOM   2956 C  CB  . GLN D 2 45  ? -26.227 -20.084 -15.046 1.00 27.65 ? 43  GLN M CB  1 
ATOM   2957 C  CG  . GLN D 2 45  ? -25.442 -19.608 -16.262 1.00 28.72 ? 43  GLN M CG  1 
ATOM   2958 C  CD  . GLN D 2 45  ? -25.861 -18.197 -16.651 1.00 30.89 ? 43  GLN M CD  1 
ATOM   2959 O  OE1 . GLN D 2 45  ? -26.367 -17.440 -15.811 1.00 33.19 ? 43  GLN M OE1 1 
ATOM   2960 N  NE2 . GLN D 2 45  ? -25.684 -17.844 -17.921 1.00 31.43 ? 43  GLN M NE2 1 
ATOM   2961 N  N   . ALA D 2 46  ? -25.654 -20.890 -12.197 1.00 25.73 ? 44  ALA M N   1 
ATOM   2962 C  CA  . ALA D 2 46  ? -26.000 -20.835 -10.778 1.00 24.98 ? 44  ALA M CA  1 
ATOM   2963 C  C   . ALA D 2 46  ? -27.105 -19.825 -10.578 1.00 24.73 ? 44  ALA M C   1 
ATOM   2964 O  O   . ALA D 2 46  ? -27.144 -18.818 -11.280 1.00 25.07 ? 44  ALA M O   1 
ATOM   2965 C  CB  . ALA D 2 46  ? -24.797 -20.432 -9.972  1.00 24.97 ? 44  ALA M CB  1 
ATOM   2966 N  N   . PRO D 2 47  ? -27.999 -20.073 -9.610  1.00 24.58 ? 45  PRO M N   1 
ATOM   2967 C  CA  . PRO D 2 47  ? -29.047 -19.110 -9.323  1.00 24.98 ? 45  PRO M CA  1 
ATOM   2968 C  C   . PRO D 2 47  ? -28.515 -17.731 -8.911  1.00 25.48 ? 45  PRO M C   1 
ATOM   2969 O  O   . PRO D 2 47  ? -27.384 -17.595 -8.436  1.00 24.63 ? 45  PRO M O   1 
ATOM   2970 C  CB  . PRO D 2 47  ? -29.816 -19.751 -8.159  1.00 24.92 ? 45  PRO M CB  1 
ATOM   2971 C  CG  . PRO D 2 47  ? -29.444 -21.167 -8.180  1.00 24.37 ? 45  PRO M CG  1 
ATOM   2972 C  CD  . PRO D 2 47  ? -28.077 -21.242 -8.722  1.00 24.62 ? 45  PRO M CD  1 
ATOM   2973 N  N   . ARG D 2 48  ? -29.355 -16.724 -9.104  1.00 26.73 ? 46  ARG M N   1 
ATOM   2974 C  CA  . ARG D 2 48  ? -29.011 -15.339 -8.811  1.00 27.67 ? 46  ARG M CA  1 
ATOM   2975 C  C   . ARG D 2 48  ? -30.149 -14.691 -8.034  1.00 26.98 ? 46  ARG M C   1 
ATOM   2976 O  O   . ARG D 2 48  ? -31.312 -14.876 -8.371  1.00 27.19 ? 46  ARG M O   1 
ATOM   2977 C  CB  . ARG D 2 48  ? -28.754 -14.571 -10.111 1.00 28.27 ? 46  ARG M CB  1 
ATOM   2978 C  CG  . ARG D 2 48  ? -28.532 -13.076 -9.902  1.00 30.48 ? 46  ARG M CG  1 
ATOM   2979 C  CD  . ARG D 2 48  ? -28.150 -12.394 -11.204 1.00 33.44 ? 46  ARG M CD  1 
ATOM   2980 N  NE  . ARG D 2 48  ? -29.293 -12.243 -12.107 1.00 34.66 ? 46  ARG M NE  1 
ATOM   2981 C  CZ  . ARG D 2 48  ? -29.928 -11.094 -12.345 1.00 35.68 ? 46  ARG M CZ  1 
ATOM   2982 N  NH1 . ARG D 2 48  ? -29.552 -9.965  -11.753 1.00 35.08 ? 46  ARG M NH1 1 
ATOM   2983 N  NH2 . ARG D 2 48  ? -30.951 -11.072 -13.189 1.00 36.40 ? 46  ARG M NH2 1 
ATOM   2984 N  N   . LEU D 2 49  ? -29.804 -13.937 -7.000  1.00 26.65 ? 47  LEU M N   1 
ATOM   2985 C  CA  . LEU D 2 49  ? -30.793 -13.371 -6.090  1.00 26.92 ? 47  LEU M CA  1 
ATOM   2986 C  C   . LEU D 2 49  ? -31.422 -12.090 -6.651  1.00 27.04 ? 47  LEU M C   1 
ATOM   2987 O  O   . LEU D 2 49  ? -30.715 -11.144 -6.997  1.00 27.17 ? 47  LEU M O   1 
ATOM   2988 C  CB  . LEU D 2 49  ? -30.132 -13.088 -4.737  1.00 27.13 ? 47  LEU M CB  1 
ATOM   2989 C  CG  . LEU D 2 49  ? -31.011 -12.446 -3.654  1.00 28.46 ? 47  LEU M CG  1 
ATOM   2990 C  CD1 . LEU D 2 49  ? -32.044 -13.420 -3.110  1.00 25.76 ? 47  LEU M CD1 1 
ATOM   2991 C  CD2 . LEU D 2 49  ? -30.133 -11.910 -2.529  1.00 27.90 ? 47  LEU M CD2 1 
ATOM   2992 N  N   . LEU D 2 50  ? -32.750 -12.065 -6.734  1.00 27.29 ? 48  LEU M N   1 
ATOM   2993 C  CA  . LEU D 2 50  ? -33.492 -10.896 -7.230  1.00 27.60 ? 48  LEU M CA  1 
ATOM   2994 C  C   . LEU D 2 50  ? -34.118 -10.086 -6.113  1.00 27.47 ? 48  LEU M C   1 
ATOM   2995 O  O   . LEU D 2 50  ? -33.959 -8.873  -6.040  1.00 27.81 ? 48  LEU M O   1 
ATOM   2996 C  CB  . LEU D 2 50  ? -34.608 -11.342 -8.174  1.00 28.10 ? 48  LEU M CB  1 
ATOM   2997 C  CG  . LEU D 2 50  ? -34.159 -12.210 -9.358  1.00 29.24 ? 48  LEU M CG  1 
ATOM   2998 C  CD1 . LEU D 2 50  ? -35.362 -12.567 -10.234 1.00 29.31 ? 48  LEU M CD1 1 
ATOM   2999 C  CD2 . LEU D 2 50  ? -33.064 -11.503 -10.175 1.00 27.72 ? 48  LEU M CD2 1 
ATOM   3000 N  N   . ILE D 2 51  ? -34.857 -10.770 -5.251  1.00 27.93 ? 49  ILE M N   1 
ATOM   3001 C  CA  . ILE D 2 51  ? -35.548 -10.141 -4.141  1.00 27.54 ? 49  ILE M CA  1 
ATOM   3002 C  C   . ILE D 2 51  ? -35.300 -10.929 -2.871  1.00 28.10 ? 49  ILE M C   1 
ATOM   3003 O  O   . ILE D 2 51  ? -35.108 -12.153 -2.910  1.00 28.64 ? 49  ILE M O   1 
ATOM   3004 C  CB  . ILE D 2 51  ? -37.052 -10.124 -4.398  1.00 27.65 ? 49  ILE M CB  1 
ATOM   3005 C  CG1 . ILE D 2 51  ? -37.391 -9.137  -5.529  1.00 28.10 ? 49  ILE M CG1 1 
ATOM   3006 C  CG2 . ILE D 2 51  ? -37.808 -9.811  -3.111  1.00 27.68 ? 49  ILE M CG2 1 
ATOM   3007 C  CD1 . ILE D 2 51  ? -36.993 -7.682  -5.250  1.00 28.86 ? 49  ILE M CD1 1 
ATOM   3008 N  N   . TYR D 2 52  ? -35.301 -10.225 -1.743  1.00 28.41 ? 50  TYR M N   1 
ATOM   3009 C  CA  . TYR D 2 52  ? -35.207 -10.868 -0.432  1.00 28.51 ? 50  TYR M CA  1 
ATOM   3010 C  C   . TYR D 2 52  ? -36.064 -10.096 0.551   1.00 29.08 ? 50  TYR M C   1 
ATOM   3011 O  O   . TYR D 2 52  ? -36.428 -8.947  0.292   1.00 28.75 ? 50  TYR M O   1 
ATOM   3012 C  CB  . TYR D 2 52  ? -33.761 -10.903 0.068   1.00 28.51 ? 50  TYR M CB  1 
ATOM   3013 C  CG  . TYR D 2 52  ? -33.220 -9.555  0.456   1.00 26.76 ? 50  TYR M CG  1 
ATOM   3014 C  CD1 . TYR D 2 52  ? -33.470 -9.017  1.709   1.00 25.64 ? 50  TYR M CD1 1 
ATOM   3015 C  CD2 . TYR D 2 52  ? -32.454 -8.814  -0.434  1.00 27.60 ? 50  TYR M CD2 1 
ATOM   3016 C  CE1 . TYR D 2 52  ? -32.975 -7.763  2.061   1.00 25.78 ? 50  TYR M CE1 1 
ATOM   3017 C  CE2 . TYR D 2 52  ? -31.943 -7.567  -0.087  1.00 25.79 ? 50  TYR M CE2 1 
ATOM   3018 C  CZ  . TYR D 2 52  ? -32.213 -7.049  1.159   1.00 25.57 ? 50  TYR M CZ  1 
ATOM   3019 O  OH  . TYR D 2 52  ? -31.721 -5.812  1.507   1.00 28.79 ? 50  TYR M OH  1 
ATOM   3020 N  N   . GLY D 2 53  ? -36.368 -10.723 1.684   1.00 29.35 ? 51  GLY M N   1 
ATOM   3021 C  CA  . GLY D 2 53  ? -37.284 -10.142 2.662   1.00 29.51 ? 51  GLY M CA  1 
ATOM   3022 C  C   . GLY D 2 53  ? -38.599 -9.743  2.012   1.00 29.88 ? 51  GLY M C   1 
ATOM   3023 O  O   . GLY D 2 53  ? -39.190 -8.723  2.373   1.00 29.93 ? 51  GLY M O   1 
ATOM   3024 N  N   . ALA D 2 54  ? -39.030 -10.535 1.028   1.00 30.08 ? 52  ALA M N   1 
ATOM   3025 C  CA  . ALA D 2 54  ? -40.306 -10.331 0.333   1.00 30.38 ? 52  ALA M CA  1 
ATOM   3026 C  C   . ALA D 2 54  ? -40.288 -9.213  -0.724  1.00 30.75 ? 52  ALA M C   1 
ATOM   3027 O  O   . ALA D 2 54  ? -40.728 -9.413  -1.859  1.00 31.11 ? 52  ALA M O   1 
ATOM   3028 C  CB  . ALA D 2 54  ? -41.409 -10.078 1.341   1.00 30.22 ? 52  ALA M CB  1 
ATOM   3029 N  N   . SER D 2 55  ? -39.789 -8.037  -0.354  1.00 30.85 ? 53  SER M N   1 
ATOM   3030 C  CA  . SER D 2 55  ? -39.888 -6.858  -1.231  1.00 31.03 ? 53  SER M CA  1 
ATOM   3031 C  C   . SER D 2 55  ? -38.583 -6.112  -1.488  1.00 31.01 ? 53  SER M C   1 
ATOM   3032 O  O   . SER D 2 55  ? -38.498 -5.348  -2.444  1.00 31.27 ? 53  SER M O   1 
ATOM   3033 C  CB  . SER D 2 55  ? -40.910 -5.871  -0.670  1.00 30.75 ? 53  SER M CB  1 
ATOM   3034 O  OG  . SER D 2 55  ? -40.587 -5.526  0.660   1.00 30.47 ? 53  SER M OG  1 
ATOM   3035 N  N   . SER D 2 56  ? -37.583 -6.312  -0.637  1.00 31.27 ? 54  SER M N   1 
ATOM   3036 C  CA  . SER D 2 56  ? -36.276 -5.697  -0.843  1.00 31.52 ? 54  SER M CA  1 
ATOM   3037 C  C   . SER D 2 56  ? -35.626 -6.169  -2.133  1.00 31.52 ? 54  SER M C   1 
ATOM   3038 O  O   . SER D 2 56  ? -35.828 -7.285  -2.572  1.00 31.33 ? 54  SER M O   1 
ATOM   3039 C  CB  . SER D 2 56  ? -35.340 -5.978  0.335   1.00 31.58 ? 54  SER M CB  1 
ATOM   3040 O  OG  . SER D 2 56  ? -35.339 -4.898  1.252   1.00 32.67 ? 54  SER M OG  1 
ATOM   3041 N  N   . ARG D 2 57  ? -34.834 -5.290  -2.725  1.00 32.69 ? 55  ARG M N   1 
ATOM   3042 C  CA  . ARG D 2 57  ? -34.114 -5.585  -3.955  1.00 33.60 ? 55  ARG M CA  1 
ATOM   3043 C  C   . ARG D 2 57  ? -32.629 -5.283  -3.759  1.00 33.41 ? 55  ARG M C   1 
ATOM   3044 O  O   . ARG D 2 57  ? -32.265 -4.154  -3.442  1.00 33.56 ? 55  ARG M O   1 
ATOM   3045 C  CB  . ARG D 2 57  ? -34.679 -4.742  -5.104  1.00 33.92 ? 55  ARG M CB  1 
ATOM   3046 C  CG  . ARG D 2 57  ? -34.142 -5.125  -6.485  1.00 35.57 ? 55  ARG M CG  1 
ATOM   3047 C  CD  . ARG D 2 57  ? -34.861 -4.385  -7.609  1.00 36.11 ? 55  ARG M CD  1 
ATOM   3048 N  NE  . ARG D 2 57  ? -35.029 -2.973  -7.291  1.00 36.95 ? 55  ARG M NE  1 
ATOM   3049 C  CZ  . ARG D 2 57  ? -36.190 -2.401  -6.990  1.00 37.30 ? 55  ARG M CZ  1 
ATOM   3050 N  NH1 . ARG D 2 57  ? -37.318 -3.108  -6.987  1.00 38.09 ? 55  ARG M NH1 1 
ATOM   3051 N  NH2 . ARG D 2 57  ? -36.220 -1.109  -6.702  1.00 36.16 ? 55  ARG M NH2 1 
ATOM   3052 N  N   . PRO D 2 58  ? -31.767 -6.292  -3.941  1.00 33.61 ? 56  PRO M N   1 
ATOM   3053 C  CA  . PRO D 2 58  ? -30.332 -6.065  -3.819  1.00 33.88 ? 56  PRO M CA  1 
ATOM   3054 C  C   . PRO D 2 58  ? -29.840 -5.095  -4.866  1.00 34.62 ? 56  PRO M C   1 
ATOM   3055 O  O   . PRO D 2 58  ? -30.370 -5.041  -5.977  1.00 34.60 ? 56  PRO M O   1 
ATOM   3056 C  CB  . PRO D 2 58  ? -29.712 -7.437  -4.062  1.00 33.65 ? 56  PRO M CB  1 
ATOM   3057 C  CG  . PRO D 2 58  ? -30.822 -8.409  -4.012  1.00 33.95 ? 56  PRO M CG  1 
ATOM   3058 C  CD  . PRO D 2 58  ? -32.089 -7.682  -4.280  1.00 33.65 ? 56  PRO M CD  1 
ATOM   3059 N  N   . SER D 2 59  ? -28.842 -4.316  -4.486  1.00 35.90 ? 57  SER M N   1 
ATOM   3060 C  CA  . SER D 2 59  ? -28.219 -3.363  -5.384  1.00 36.60 ? 57  SER M CA  1 
ATOM   3061 C  C   . SER D 2 59  ? -27.640 -4.150  -6.547  1.00 37.04 ? 57  SER M C   1 
ATOM   3062 O  O   . SER D 2 59  ? -27.160 -5.276  -6.368  1.00 36.90 ? 57  SER M O   1 
ATOM   3063 C  CB  . SER D 2 59  ? -27.137 -2.566  -4.641  1.00 36.65 ? 57  SER M CB  1 
ATOM   3064 O  OG  . SER D 2 59  ? -26.191 -2.023  -5.536  1.00 37.64 ? 57  SER M OG  1 
ATOM   3065 N  N   . GLY D 2 60  ? -27.726 -3.574  -7.742  1.00 37.58 ? 58  GLY M N   1 
ATOM   3066 C  CA  . GLY D 2 60  ? -27.264 -4.247  -8.956  1.00 37.57 ? 58  GLY M CA  1 
ATOM   3067 C  C   . GLY D 2 60  ? -28.266 -5.231  -9.533  1.00 37.77 ? 58  GLY M C   1 
ATOM   3068 O  O   . GLY D 2 60  ? -27.919 -6.018  -10.417 1.00 38.88 ? 58  GLY M O   1 
ATOM   3069 N  N   . VAL D 2 61  ? -29.502 -5.197  -9.035  1.00 37.26 ? 59  VAL M N   1 
ATOM   3070 C  CA  . VAL D 2 61  ? -30.606 -5.954  -9.635  1.00 36.90 ? 59  VAL M CA  1 
ATOM   3071 C  C   . VAL D 2 61  ? -31.595 -4.942  -10.206 1.00 36.83 ? 59  VAL M C   1 
ATOM   3072 O  O   . VAL D 2 61  ? -32.101 -4.087  -9.485  1.00 36.26 ? 59  VAL M O   1 
ATOM   3073 C  CB  . VAL D 2 61  ? -31.312 -6.867  -8.604  1.00 36.99 ? 59  VAL M CB  1 
ATOM   3074 C  CG1 . VAL D 2 61  ? -32.635 -7.416  -9.157  1.00 35.67 ? 59  VAL M CG1 1 
ATOM   3075 C  CG2 . VAL D 2 61  ? -30.389 -8.003  -8.181  1.00 36.71 ? 59  VAL M CG2 1 
ATOM   3076 N  N   . ALA D 2 62  ? -31.859 -5.039  -11.504 1.00 37.08 ? 60  ALA M N   1 
ATOM   3077 C  CA  . ALA D 2 62  ? -32.636 -4.016  -12.213 1.00 37.38 ? 60  ALA M CA  1 
ATOM   3078 C  C   . ALA D 2 62  ? -34.009 -3.747  -11.580 1.00 37.55 ? 60  ALA M C   1 
ATOM   3079 O  O   . ALA D 2 62  ? -34.536 -4.566  -10.821 1.00 37.61 ? 60  ALA M O   1 
ATOM   3080 C  CB  . ALA D 2 62  ? -32.787 -4.389  -13.684 1.00 37.26 ? 60  ALA M CB  1 
ATOM   3081 N  N   . ASP D 2 63  ? -34.580 -2.597  -11.940 1.00 37.30 ? 61  ASP M N   1 
ATOM   3082 C  CA  . ASP D 2 63  ? -35.782 -2.047  -11.290 1.00 37.26 ? 61  ASP M CA  1 
ATOM   3083 C  C   . ASP D 2 63  ? -37.079 -2.832  -11.578 1.00 36.30 ? 61  ASP M C   1 
ATOM   3084 O  O   . ASP D 2 63  ? -38.031 -2.795  -10.796 1.00 35.43 ? 61  ASP M O   1 
ATOM   3085 C  CB  . ASP D 2 63  ? -35.963 -0.576  -11.728 1.00 37.70 ? 61  ASP M CB  1 
ATOM   3086 C  CG  . ASP D 2 63  ? -36.143 0.383   -10.543 1.00 39.16 ? 61  ASP M CG  1 
ATOM   3087 O  OD1 . ASP D 2 63  ? -36.634 -0.058  -9.482  1.00 41.43 ? 61  ASP M OD1 1 
ATOM   3088 O  OD2 . ASP D 2 63  ? -35.792 1.582   -10.669 1.00 39.30 ? 61  ASP M OD2 1 
ATOM   3089 N  N   . ARG D 2 64  ? -37.104 -3.539  -12.701 1.00 35.71 ? 62  ARG M N   1 
ATOM   3090 C  CA  . ARG D 2 64  ? -38.331 -4.180  -13.182 1.00 35.47 ? 62  ARG M CA  1 
ATOM   3091 C  C   . ARG D 2 64  ? -38.784 -5.351  -12.304 1.00 35.08 ? 62  ARG M C   1 
ATOM   3092 O  O   . ARG D 2 64  ? -39.962 -5.730  -12.311 1.00 34.68 ? 62  ARG M O   1 
ATOM   3093 C  CB  . ARG D 2 64  ? -38.169 -4.626  -14.643 1.00 35.73 ? 62  ARG M CB  1 
ATOM   3094 C  CG  . ARG D 2 64  ? -37.036 -5.621  -14.915 1.00 35.53 ? 62  ARG M CG  1 
ATOM   3095 C  CD  . ARG D 2 64  ? -36.856 -5.853  -16.422 1.00 34.85 ? 62  ARG M CD  1 
ATOM   3096 N  NE  . ARG D 2 64  ? -35.766 -6.781  -16.700 1.00 35.19 ? 62  ARG M NE  1 
ATOM   3097 C  CZ  . ARG D 2 64  ? -34.496 -6.431  -16.900 1.00 35.67 ? 62  ARG M CZ  1 
ATOM   3098 N  NH1 . ARG D 2 64  ? -34.123 -5.156  -16.878 1.00 34.62 ? 62  ARG M NH1 1 
ATOM   3099 N  NH2 . ARG D 2 64  ? -33.587 -7.367  -17.130 1.00 36.21 ? 62  ARG M NH2 1 
ATOM   3100 N  N   . PHE D 2 65  ? -37.841 -5.918  -11.557 1.00 34.72 ? 63  PHE M N   1 
ATOM   3101 C  CA  . PHE D 2 65  ? -38.150 -6.934  -10.556 1.00 34.29 ? 63  PHE M CA  1 
ATOM   3102 C  C   . PHE D 2 65  ? -38.608 -6.249  -9.273  1.00 34.72 ? 63  PHE M C   1 
ATOM   3103 O  O   . PHE D 2 65  ? -37.868 -5.485  -8.649  1.00 35.03 ? 63  PHE M O   1 
ATOM   3104 C  CB  . PHE D 2 65  ? -36.930 -7.813  -10.266 1.00 33.74 ? 63  PHE M CB  1 
ATOM   3105 C  CG  . PHE D 2 65  ? -36.411 -8.553  -11.470 1.00 33.00 ? 63  PHE M CG  1 
ATOM   3106 C  CD1 . PHE D 2 65  ? -35.332 -8.059  -12.192 1.00 34.01 ? 63  PHE M CD1 1 
ATOM   3107 C  CD2 . PHE D 2 65  ? -37.001 -9.738  -11.882 1.00 31.96 ? 63  PHE M CD2 1 
ATOM   3108 C  CE1 . PHE D 2 65  ? -34.848 -8.729  -13.305 1.00 33.32 ? 63  PHE M CE1 1 
ATOM   3109 C  CE2 . PHE D 2 65  ? -36.533 -10.411 -12.988 1.00 32.57 ? 63  PHE M CE2 1 
ATOM   3110 C  CZ  . PHE D 2 65  ? -35.449 -9.905  -13.705 1.00 33.17 ? 63  PHE M CZ  1 
ATOM   3111 N  N   . SER D 2 66  ? -39.849 -6.502  -8.897  1.00 34.80 ? 64  SER M N   1 
ATOM   3112 C  CA  . SER D 2 66  ? -40.320 -6.115  -7.583  1.00 34.92 ? 64  SER M CA  1 
ATOM   3113 C  C   . SER D 2 66  ? -41.065 -7.318  -7.018  1.00 35.16 ? 64  SER M C   1 
ATOM   3114 O  O   . SER D 2 66  ? -41.611 -8.124  -7.774  1.00 35.46 ? 64  SER M O   1 
ATOM   3115 C  CB  . SER D 2 66  ? -41.207 -4.869  -7.646  1.00 34.70 ? 64  SER M CB  1 
ATOM   3116 O  OG  . SER D 2 66  ? -42.558 -5.210  -7.863  1.00 34.54 ? 64  SER M OG  1 
ATOM   3117 N  N   . GLY D 2 67  ? -41.047 -7.455  -5.697  1.00 35.00 ? 65  GLY M N   1 
ATOM   3118 C  CA  . GLY D 2 67  ? -41.725 -8.557  -5.034  1.00 35.04 ? 65  GLY M CA  1 
ATOM   3119 C  C   . GLY D 2 67  ? -42.710 -8.003  -4.032  1.00 35.15 ? 65  GLY M C   1 
ATOM   3120 O  O   . GLY D 2 67  ? -42.545 -6.878  -3.576  1.00 34.90 ? 65  GLY M O   1 
ATOM   3121 N  N   . SER D 2 68  ? -43.741 -8.773  -3.698  1.00 35.12 ? 66  SER M N   1 
ATOM   3122 C  CA  . SER D 2 68  ? -44.697 -8.331  -2.690  1.00 35.71 ? 66  SER M CA  1 
ATOM   3123 C  C   . SER D 2 68  ? -45.374 -9.485  -1.973  1.00 36.19 ? 66  SER M C   1 
ATOM   3124 O  O   . SER D 2 68  ? -45.176 -10.648 -2.317  1.00 36.32 ? 66  SER M O   1 
ATOM   3125 C  CB  . SER D 2 68  ? -45.770 -7.438  -3.316  1.00 35.51 ? 66  SER M CB  1 
ATOM   3126 O  OG  . SER D 2 68  ? -46.720 -8.222  -4.009  1.00 35.25 ? 66  SER M OG  1 
ATOM   3127 N  N   . GLY D 2 69  ? -46.171 -9.143  -0.962  1.00 36.80 ? 67  GLY M N   1 
ATOM   3128 C  CA  . GLY D 2 69  ? -47.018 -10.113 -0.279  1.00 36.62 ? 67  GLY M CA  1 
ATOM   3129 C  C   . GLY D 2 69  ? -46.584 -10.345 1.143   1.00 36.64 ? 67  GLY M C   1 
ATOM   3130 O  O   . GLY D 2 69  ? -45.688 -9.669  1.640   1.00 36.74 ? 67  GLY M O   1 
ATOM   3131 N  N   . SER D 2 70  ? -47.206 -11.337 1.775   1.00 36.79 ? 68  SER M N   1 
ATOM   3132 C  CA  . SER D 2 70  ? -47.055 -11.572 3.207   1.00 36.74 ? 68  SER M CA  1 
ATOM   3133 C  C   . SER D 2 70  ? -47.733 -12.882 3.646   1.00 36.38 ? 68  SER M C   1 
ATOM   3134 O  O   . SER D 2 70  ? -48.665 -13.359 2.994   1.00 36.74 ? 68  SER M O   1 
ATOM   3135 C  CB  . SER D 2 70  ? -47.676 -10.397 3.972   1.00 36.89 ? 68  SER M CB  1 
ATOM   3136 O  OG  . SER D 2 70  ? -47.522 -10.554 5.368   1.00 37.72 ? 68  SER M OG  1 
ATOM   3137 N  N   . GLY D 2 71  ? -47.272 -13.445 4.760   1.00 35.43 ? 69  GLY M N   1 
ATOM   3138 C  CA  . GLY D 2 71  ? -47.911 -14.616 5.361   1.00 35.18 ? 69  GLY M CA  1 
ATOM   3139 C  C   . GLY D 2 71  ? -47.679 -15.888 4.574   1.00 35.60 ? 69  GLY M C   1 
ATOM   3140 O  O   . GLY D 2 71  ? -46.556 -16.408 4.526   1.00 35.90 ? 69  GLY M O   1 
ATOM   3141 N  N   . THR D 2 72  ? -48.739 -16.390 3.947   1.00 35.75 ? 70  THR M N   1 
ATOM   3142 C  CA  . THR D 2 72  ? -48.660 -17.619 3.159   1.00 35.77 ? 70  THR M CA  1 
ATOM   3143 C  C   . THR D 2 72  ? -48.610 -17.354 1.659   1.00 36.29 ? 70  THR M C   1 
ATOM   3144 O  O   . THR D 2 72  ? -48.447 -18.290 0.879   1.00 36.91 ? 70  THR M O   1 
ATOM   3145 C  CB  . THR D 2 72  ? -49.865 -18.562 3.420   1.00 35.78 ? 70  THR M CB  1 
ATOM   3146 O  OG1 . THR D 2 72  ? -51.076 -17.942 2.969   1.00 34.59 ? 70  THR M OG1 1 
ATOM   3147 C  CG2 . THR D 2 72  ? -49.980 -18.906 4.907   1.00 35.42 ? 70  THR M CG2 1 
ATOM   3148 N  N   . ASP D 2 73  ? -48.756 -16.101 1.240   1.00 36.34 ? 71  ASP M N   1 
ATOM   3149 C  CA  . ASP D 2 73  ? -48.818 -15.818 -0.200  1.00 36.64 ? 71  ASP M CA  1 
ATOM   3150 C  C   . ASP D 2 73  ? -47.870 -14.709 -0.666  1.00 36.19 ? 71  ASP M C   1 
ATOM   3151 O  O   . ASP D 2 73  ? -47.797 -13.633 -0.066  1.00 35.88 ? 71  ASP M O   1 
ATOM   3152 C  CB  . ASP D 2 73  ? -50.261 -15.513 -0.629  1.00 36.95 ? 71  ASP M CB  1 
ATOM   3153 C  CG  . ASP D 2 73  ? -50.574 -16.041 -2.026  1.00 37.69 ? 71  ASP M CG  1 
ATOM   3154 N  N   . PHE D 2 74  ? -47.150 -14.986 -1.753  1.00 35.79 ? 72  PHE M N   1 
ATOM   3155 C  CA  . PHE D 2 74  ? -46.152 -14.053 -2.283  1.00 35.34 ? 72  PHE M CA  1 
ATOM   3156 C  C   . PHE D 2 74  ? -46.182 -13.958 -3.809  1.00 35.11 ? 72  PHE M C   1 
ATOM   3157 O  O   . PHE D 2 74  ? -46.553 -14.907 -4.510  1.00 35.18 ? 72  PHE M O   1 
ATOM   3158 C  CB  . PHE D 2 74  ? -44.754 -14.447 -1.804  1.00 34.91 ? 72  PHE M CB  1 
ATOM   3159 C  CG  . PHE D 2 74  ? -44.602 -14.397 -0.314  1.00 34.50 ? 72  PHE M CG  1 
ATOM   3160 C  CD1 . PHE D 2 74  ? -44.997 -15.469 0.470   1.00 34.80 ? 72  PHE M CD1 1 
ATOM   3161 C  CD2 . PHE D 2 74  ? -44.089 -13.278 0.306   1.00 35.34 ? 72  PHE M CD2 1 
ATOM   3162 C  CE1 . PHE D 2 74  ? -44.875 -15.428 1.841   1.00 35.12 ? 72  PHE M CE1 1 
ATOM   3163 C  CE2 . PHE D 2 74  ? -43.957 -13.226 1.679   1.00 36.33 ? 72  PHE M CE2 1 
ATOM   3164 C  CZ  . PHE D 2 74  ? -44.355 -14.303 2.450   1.00 36.40 ? 72  PHE M CZ  1 
ATOM   3165 N  N   . THR D 2 75  ? -45.767 -12.801 -4.309  1.00 34.55 ? 73  THR M N   1 
ATOM   3166 C  CA  . THR D 2 75  ? -45.825 -12.504 -5.731  1.00 34.21 ? 73  THR M CA  1 
ATOM   3167 C  C   . THR D 2 75  ? -44.510 -11.895 -6.230  1.00 33.59 ? 73  THR M C   1 
ATOM   3168 O  O   . THR D 2 75  ? -43.888 -11.086 -5.539  1.00 33.41 ? 73  THR M O   1 
ATOM   3169 C  CB  . THR D 2 75  ? -47.010 -11.552 -5.997  1.00 34.40 ? 73  THR M CB  1 
ATOM   3170 O  OG1 . THR D 2 75  ? -48.180 -12.089 -5.363  1.00 35.32 ? 73  THR M OG1 1 
ATOM   3171 C  CG2 . THR D 2 75  ? -47.276 -11.383 -7.480  1.00 33.36 ? 73  THR M CG2 1 
ATOM   3172 N  N   . LEU D 2 76  ? -44.070 -12.318 -7.414  1.00 33.10 ? 74  LEU M N   1 
ATOM   3173 C  CA  . LEU D 2 76  ? -42.945 -11.662 -8.098  1.00 32.80 ? 74  LEU M CA  1 
ATOM   3174 C  C   . LEU D 2 76  ? -43.448 -11.068 -9.397  1.00 33.43 ? 74  LEU M C   1 
ATOM   3175 O  O   . LEU D 2 76  ? -44.162 -11.719 -10.161 1.00 33.34 ? 74  LEU M O   1 
ATOM   3176 C  CB  . LEU D 2 76  ? -41.793 -12.627 -8.390  1.00 32.35 ? 74  LEU M CB  1 
ATOM   3177 C  CG  . LEU D 2 76  ? -40.584 -12.032 -9.136  1.00 30.70 ? 74  LEU M CG  1 
ATOM   3178 C  CD1 . LEU D 2 76  ? -39.725 -11.163 -8.240  1.00 26.00 ? 74  LEU M CD1 1 
ATOM   3179 C  CD2 . LEU D 2 76  ? -39.725 -13.135 -9.760  1.00 30.23 ? 74  LEU M CD2 1 
ATOM   3180 N  N   . THR D 2 77  ? -43.078 -9.822  -9.644  1.00 34.03 ? 75  THR M N   1 
ATOM   3181 C  CA  . THR D 2 77  ? -43.535 -9.138  -10.835 1.00 34.79 ? 75  THR M CA  1 
ATOM   3182 C  C   . THR D 2 77  ? -42.366 -8.625  -11.640 1.00 35.16 ? 75  THR M C   1 
ATOM   3183 O  O   . THR D 2 77  ? -41.587 -7.798  -11.149 1.00 35.32 ? 75  THR M O   1 
ATOM   3184 C  CB  . THR D 2 77  ? -44.456 -7.968  -10.476 1.00 35.34 ? 75  THR M CB  1 
ATOM   3185 O  OG1 . THR D 2 77  ? -45.738 -8.486  -10.095 1.00 37.11 ? 75  THR M OG1 1 
ATOM   3186 C  CG2 . THR D 2 77  ? -44.610 -7.007  -11.647 1.00 34.27 ? 75  THR M CG2 1 
ATOM   3187 N  N   . ILE D 2 78  ? -42.231 -9.150  -12.861 1.00 35.43 ? 76  ILE M N   1 
ATOM   3188 C  CA  . ILE D 2 78  ? -41.348 -8.562  -13.869 1.00 35.81 ? 76  ILE M CA  1 
ATOM   3189 C  C   . ILE D 2 78  ? -42.228 -7.738  -14.811 1.00 36.13 ? 76  ILE M C   1 
ATOM   3190 O  O   . ILE D 2 78  ? -42.962 -8.292  -15.632 1.00 36.29 ? 76  ILE M O   1 
ATOM   3191 C  CB  . ILE D 2 78  ? -40.554 -9.615  -14.689 1.00 35.98 ? 76  ILE M CB  1 
ATOM   3192 C  CG1 . ILE D 2 78  ? -40.057 -10.766 -13.803 1.00 35.93 ? 76  ILE M CG1 1 
ATOM   3193 C  CG2 . ILE D 2 78  ? -39.377 -8.945  -15.390 1.00 35.03 ? 76  ILE M CG2 1 
ATOM   3194 C  CD1 . ILE D 2 78  ? -39.161 -11.772 -14.536 1.00 32.78 ? 76  ILE M CD1 1 
ATOM   3195 N  N   . SER D 2 79  ? -42.164 -6.416  -14.681 1.00 35.94 ? 77  SER M N   1 
ATOM   3196 C  CA  . SER D 2 79  ? -43.113 -5.543  -15.367 1.00 36.29 ? 77  SER M CA  1 
ATOM   3197 C  C   . SER D 2 79  ? -42.907 -5.454  -16.883 1.00 36.01 ? 77  SER M C   1 
ATOM   3198 O  O   . SER D 2 79  ? -43.832 -5.093  -17.616 1.00 36.01 ? 77  SER M O   1 
ATOM   3199 C  CB  . SER D 2 79  ? -43.053 -4.143  -14.767 1.00 36.45 ? 77  SER M CB  1 
ATOM   3200 O  OG  . SER D 2 79  ? -41.721 -3.810  -14.434 1.00 38.42 ? 77  SER M OG  1 
ATOM   3201 N  N   . ARG D 2 80  ? -41.700 -5.770  -17.343 1.00 35.31 ? 78  ARG M N   1 
ATOM   3202 C  CA  . ARG D 2 80  ? -41.356 -5.640  -18.759 1.00 34.70 ? 78  ARG M CA  1 
ATOM   3203 C  C   . ARG D 2 80  ? -40.195 -6.569  -19.128 1.00 34.53 ? 78  ARG M C   1 
ATOM   3204 O  O   . ARG D 2 80  ? -39.021 -6.199  -19.041 1.00 35.16 ? 78  ARG M O   1 
ATOM   3205 C  CB  . ARG D 2 80  ? -41.002 -4.188  -19.086 1.00 34.44 ? 78  ARG M CB  1 
ATOM   3206 N  N   . LEU D 2 81  ? -40.529 -7.778  -19.558 1.00 33.61 ? 79  LEU M N   1 
ATOM   3207 C  CA  . LEU D 2 81  ? -39.520 -8.784  -19.837 1.00 33.21 ? 79  LEU M CA  1 
ATOM   3208 C  C   . LEU D 2 81  ? -38.465 -8.322  -20.843 1.00 33.56 ? 79  LEU M C   1 
ATOM   3209 O  O   . LEU D 2 81  ? -38.783 -7.716  -21.862 1.00 34.03 ? 79  LEU M O   1 
ATOM   3210 C  CB  . LEU D 2 81  ? -40.192 -10.066 -20.331 1.00 32.95 ? 79  LEU M CB  1 
ATOM   3211 C  CG  . LEU D 2 81  ? -40.907 -10.852 -19.231 1.00 30.73 ? 79  LEU M CG  1 
ATOM   3212 C  CD1 . LEU D 2 81  ? -41.761 -11.958 -19.824 1.00 28.24 ? 79  LEU M CD1 1 
ATOM   3213 C  CD2 . LEU D 2 81  ? -39.885 -11.392 -18.245 1.00 28.08 ? 79  LEU M CD2 1 
ATOM   3214 N  N   . GLU D 2 82  ? -37.207 -8.610  -20.528 1.00 33.87 ? 80  GLU M N   1 
ATOM   3215 C  CA  . GLU D 2 82  ? -36.092 -8.421  -21.452 1.00 34.29 ? 80  GLU M CA  1 
ATOM   3216 C  C   . GLU D 2 82  ? -35.515 -9.791  -21.830 1.00 34.64 ? 80  GLU M C   1 
ATOM   3217 O  O   . GLU D 2 82  ? -35.741 -10.782 -21.136 1.00 35.32 ? 80  GLU M O   1 
ATOM   3218 C  CB  . GLU D 2 82  ? -35.019 -7.534  -20.811 1.00 34.50 ? 80  GLU M CB  1 
ATOM   3219 C  CG  . GLU D 2 82  ? -35.413 -6.055  -20.707 1.00 35.00 ? 80  GLU M CG  1 
ATOM   3220 C  CD  . GLU D 2 82  ? -35.203 -5.298  -22.015 1.00 36.85 ? 80  GLU M CD  1 
ATOM   3221 O  OE1 . GLU D 2 82  ? -34.062 -5.316  -22.524 1.00 38.64 ? 80  GLU M OE1 1 
ATOM   3222 O  OE2 . GLU D 2 82  ? -36.163 -4.682  -22.535 1.00 36.75 ? 80  GLU M OE2 1 
ATOM   3223 N  N   . PRO D 2 83  ? -34.789 -9.866  -22.948 1.00 34.98 ? 81  PRO M N   1 
ATOM   3224 C  CA  . PRO D 2 83  ? -34.216 -11.155 -23.352 1.00 35.29 ? 81  PRO M CA  1 
ATOM   3225 C  C   . PRO D 2 83  ? -33.646 -12.007 -22.212 1.00 35.22 ? 81  PRO M C   1 
ATOM   3226 O  O   . PRO D 2 83  ? -33.837 -13.224 -22.193 1.00 35.73 ? 81  PRO M O   1 
ATOM   3227 C  CB  . PRO D 2 83  ? -33.105 -10.741 -24.327 1.00 35.69 ? 81  PRO M CB  1 
ATOM   3228 C  CG  . PRO D 2 83  ? -33.645 -9.486  -24.986 1.00 35.17 ? 81  PRO M CG  1 
ATOM   3229 C  CD  . PRO D 2 83  ? -34.484 -8.792  -23.918 1.00 35.22 ? 81  PRO M CD  1 
ATOM   3230 N  N   . GLU D 2 84  ? -32.972 -11.376 -21.259 1.00 34.94 ? 82  GLU M N   1 
ATOM   3231 C  CA  . GLU D 2 84  ? -32.256 -12.117 -20.220 1.00 34.90 ? 82  GLU M CA  1 
ATOM   3232 C  C   . GLU D 2 84  ? -33.166 -12.646 -19.112 1.00 34.65 ? 82  GLU M C   1 
ATOM   3233 O  O   . GLU D 2 84  ? -32.683 -13.250 -18.151 1.00 34.37 ? 82  GLU M O   1 
ATOM   3234 C  CB  . GLU D 2 84  ? -31.183 -11.236 -19.580 1.00 35.19 ? 82  GLU M CB  1 
ATOM   3235 C  CG  . GLU D 2 84  ? -30.549 -10.232 -20.514 1.00 36.29 ? 82  GLU M CG  1 
ATOM   3236 C  CD  . GLU D 2 84  ? -31.185 -8.853  -20.423 1.00 37.23 ? 82  GLU M CD  1 
ATOM   3237 O  OE1 . GLU D 2 84  ? -31.257 -8.305  -19.297 1.00 36.14 ? 82  GLU M OE1 1 
ATOM   3238 O  OE2 . GLU D 2 84  ? -31.587 -8.312  -21.482 1.00 37.77 ? 82  GLU M OE2 1 
ATOM   3239 N  N   . ASP D 2 85  ? -34.469 -12.407 -19.232 1.00 34.27 ? 83  ASP M N   1 
ATOM   3240 C  CA  . ASP D 2 85  ? -35.402 -12.747 -18.158 1.00 34.54 ? 83  ASP M CA  1 
ATOM   3241 C  C   . ASP D 2 85  ? -36.062 -14.098 -18.373 1.00 34.21 ? 83  ASP M C   1 
ATOM   3242 O  O   . ASP D 2 85  ? -36.697 -14.638 -17.462 1.00 34.39 ? 83  ASP M O   1 
ATOM   3243 C  CB  . ASP D 2 85  ? -36.460 -11.658 -17.998 1.00 34.81 ? 83  ASP M CB  1 
ATOM   3244 C  CG  . ASP D 2 85  ? -35.857 -10.327 -17.581 1.00 36.91 ? 83  ASP M CG  1 
ATOM   3245 O  OD1 . ASP D 2 85  ? -34.654 -10.314 -17.210 1.00 40.41 ? 83  ASP M OD1 1 
ATOM   3246 O  OD2 . ASP D 2 85  ? -36.574 -9.302  -17.629 1.00 36.15 ? 83  ASP M OD2 1 
ATOM   3247 N  N   . PHE D 2 86  ? -35.896 -14.654 -19.568 1.00 33.26 ? 84  PHE M N   1 
ATOM   3248 C  CA  . PHE D 2 86  ? -36.387 -15.999 -19.838 1.00 32.81 ? 84  PHE M CA  1 
ATOM   3249 C  C   . PHE D 2 86  ? -35.516 -17.025 -19.124 1.00 32.30 ? 84  PHE M C   1 
ATOM   3250 O  O   . PHE D 2 86  ? -34.407 -17.340 -19.549 1.00 31.62 ? 84  PHE M O   1 
ATOM   3251 C  CB  . PHE D 2 86  ? -36.497 -16.245 -21.342 1.00 32.56 ? 84  PHE M CB  1 
ATOM   3252 C  CG  . PHE D 2 86  ? -37.519 -15.375 -21.980 1.00 33.52 ? 84  PHE M CG  1 
ATOM   3253 C  CD1 . PHE D 2 86  ? -37.148 -14.207 -22.633 1.00 34.20 ? 84  PHE M CD1 1 
ATOM   3254 C  CD2 . PHE D 2 86  ? -38.865 -15.667 -21.838 1.00 33.58 ? 84  PHE M CD2 1 
ATOM   3255 C  CE1 . PHE D 2 86  ? -38.100 -13.380 -23.183 1.00 34.53 ? 84  PHE M CE1 1 
ATOM   3256 C  CE2 . PHE D 2 86  ? -39.825 -14.840 -22.376 1.00 34.28 ? 84  PHE M CE2 1 
ATOM   3257 C  CZ  . PHE D 2 86  ? -39.447 -13.699 -23.052 1.00 34.56 ? 84  PHE M CZ  1 
ATOM   3258 N  N   . ALA D 2 87  ? -36.039 -17.512 -18.006 1.00 32.11 ? 85  ALA M N   1 
ATOM   3259 C  CA  . ALA D 2 87  ? -35.325 -18.456 -17.158 1.00 32.00 ? 85  ALA M CA  1 
ATOM   3260 C  C   . ALA D 2 87  ? -36.303 -19.108 -16.190 1.00 31.85 ? 85  ALA M C   1 
ATOM   3261 O  O   . ALA D 2 87  ? -37.512 -18.916 -16.287 1.00 32.39 ? 85  ALA M O   1 
ATOM   3262 C  CB  . ALA D 2 87  ? -34.225 -17.747 -16.403 1.00 31.64 ? 85  ALA M CB  1 
ATOM   3263 N  N   . VAL D 2 88  ? -35.781 -19.897 -15.268 1.00 31.77 ? 86  VAL M N   1 
ATOM   3264 C  CA  . VAL D 2 88  ? -36.602 -20.453 -14.209 1.00 31.92 ? 86  VAL M CA  1 
ATOM   3265 C  C   . VAL D 2 88  ? -36.492 -19.588 -12.957 1.00 32.15 ? 86  VAL M C   1 
ATOM   3266 O  O   . VAL D 2 88  ? -35.413 -19.114 -12.626 1.00 32.70 ? 86  VAL M O   1 
ATOM   3267 C  CB  . VAL D 2 88  ? -36.173 -21.872 -13.878 1.00 31.75 ? 86  VAL M CB  1 
ATOM   3268 C  CG1 . VAL D 2 88  ? -36.899 -22.355 -12.627 1.00 30.86 ? 86  VAL M CG1 1 
ATOM   3269 C  CG2 . VAL D 2 88  ? -36.432 -22.783 -15.078 1.00 30.89 ? 86  VAL M CG2 1 
ATOM   3270 N  N   . TYR D 2 89  ? -37.608 -19.368 -12.274 1.00 32.43 ? 87  TYR M N   1 
ATOM   3271 C  CA  . TYR D 2 89  ? -37.596 -18.583 -11.034 1.00 32.80 ? 87  TYR M CA  1 
ATOM   3272 C  C   . TYR D 2 89  ? -38.017 -19.433 -9.843  1.00 32.90 ? 87  TYR M C   1 
ATOM   3273 O  O   . TYR D 2 89  ? -38.986 -20.186 -9.931  1.00 33.30 ? 87  TYR M O   1 
ATOM   3274 C  CB  . TYR D 2 89  ? -38.484 -17.338 -11.157 1.00 32.67 ? 87  TYR M CB  1 
ATOM   3275 C  CG  . TYR D 2 89  ? -38.016 -16.381 -12.234 1.00 32.67 ? 87  TYR M CG  1 
ATOM   3276 C  CD1 . TYR D 2 89  ? -38.159 -16.705 -13.578 1.00 33.79 ? 87  TYR M CD1 1 
ATOM   3277 C  CD2 . TYR D 2 89  ? -37.426 -15.161 -11.913 1.00 32.62 ? 87  TYR M CD2 1 
ATOM   3278 C  CE1 . TYR D 2 89  ? -37.734 -15.847 -14.579 1.00 33.83 ? 87  TYR M CE1 1 
ATOM   3279 C  CE2 . TYR D 2 89  ? -36.989 -14.291 -12.911 1.00 33.43 ? 87  TYR M CE2 1 
ATOM   3280 C  CZ  . TYR D 2 89  ? -37.152 -14.642 -14.245 1.00 34.57 ? 87  TYR M CZ  1 
ATOM   3281 O  OH  . TYR D 2 89  ? -36.731 -13.808 -15.257 1.00 35.11 ? 87  TYR M OH  1 
ATOM   3282 N  N   . TYR D 2 90  ? -37.270 -19.326 -8.745  1.00 33.16 ? 88  TYR M N   1 
ATOM   3283 C  CA  . TYR D 2 90  ? -37.564 -20.083 -7.520  1.00 33.40 ? 88  TYR M CA  1 
ATOM   3284 C  C   . TYR D 2 90  ? -37.844 -19.154 -6.348  1.00 34.04 ? 88  TYR M C   1 
ATOM   3285 O  O   . TYR D 2 90  ? -37.172 -18.133 -6.191  1.00 34.87 ? 88  TYR M O   1 
ATOM   3286 C  CB  . TYR D 2 90  ? -36.380 -20.962 -7.125  1.00 32.99 ? 88  TYR M CB  1 
ATOM   3287 C  CG  . TYR D 2 90  ? -36.066 -22.048 -8.098  1.00 32.15 ? 88  TYR M CG  1 
ATOM   3288 C  CD1 . TYR D 2 90  ? -35.075 -21.880 -9.048  1.00 30.79 ? 88  TYR M CD1 1 
ATOM   3289 C  CD2 . TYR D 2 90  ? -36.749 -23.251 -8.066  1.00 32.75 ? 88  TYR M CD2 1 
ATOM   3290 C  CE1 . TYR D 2 90  ? -34.775 -22.877 -9.948  1.00 30.91 ? 88  TYR M CE1 1 
ATOM   3291 C  CE2 . TYR D 2 90  ? -36.453 -24.261 -8.966  1.00 33.16 ? 88  TYR M CE2 1 
ATOM   3292 C  CZ  . TYR D 2 90  ? -35.466 -24.065 -9.907  1.00 30.32 ? 88  TYR M CZ  1 
ATOM   3293 O  OH  . TYR D 2 90  ? -35.167 -25.048 -10.804 1.00 29.69 ? 88  TYR M OH  1 
ATOM   3294 N  N   . CYS D 2 91  ? -38.810 -19.525 -5.510  1.00 34.18 ? 89  CYS M N   1 
ATOM   3295 C  CA  . CYS D 2 91  ? -38.973 -18.875 -4.215  1.00 34.09 ? 89  CYS M CA  1 
ATOM   3296 C  C   . CYS D 2 91  ? -38.335 -19.724 -3.108  1.00 33.34 ? 89  CYS M C   1 
ATOM   3297 O  O   . CYS D 2 91  ? -38.275 -20.950 -3.200  1.00 32.36 ? 89  CYS M O   1 
ATOM   3298 C  CB  . CYS D 2 91  ? -40.442 -18.594 -3.914  1.00 34.47 ? 89  CYS M CB  1 
ATOM   3299 S  SG  . CYS D 2 91  ? -41.461 -20.068 -3.713  1.00 38.35 ? 89  CYS M SG  1 
ATOM   3300 N  N   . GLN D 2 92  ? -37.834 -19.041 -2.081  1.00 32.98 ? 90  GLN M N   1 
ATOM   3301 C  CA  . GLN D 2 92  ? -37.251 -19.677 -0.911  1.00 32.54 ? 90  GLN M CA  1 
ATOM   3302 C  C   . GLN D 2 92  ? -37.783 -19.046 0.351   1.00 32.00 ? 90  GLN M C   1 
ATOM   3303 O  O   . GLN D 2 92  ? -37.876 -17.832 0.440   1.00 32.72 ? 90  GLN M O   1 
ATOM   3304 C  CB  . GLN D 2 92  ? -35.739 -19.486 -0.913  1.00 33.16 ? 90  GLN M CB  1 
ATOM   3305 C  CG  . GLN D 2 92  ? -35.009 -20.191 0.227   1.00 33.36 ? 90  GLN M CG  1 
ATOM   3306 C  CD  . GLN D 2 92  ? -33.668 -19.554 0.525   1.00 34.75 ? 90  GLN M CD  1 
ATOM   3307 O  OE1 . GLN D 2 92  ? -33.338 -18.495 -0.014  1.00 33.38 ? 90  GLN M OE1 1 
ATOM   3308 N  NE2 . GLN D 2 92  ? -32.887 -20.193 1.397   1.00 35.97 ? 90  GLN M NE2 1 
ATOM   3309 N  N   . GLN D 2 93  ? -38.116 -19.866 1.341   1.00 31.17 ? 91  GLN M N   1 
ATOM   3310 C  CA  . GLN D 2 93  ? -38.458 -19.343 2.661   1.00 30.27 ? 91  GLN M CA  1 
ATOM   3311 C  C   . GLN D 2 93  ? -37.336 -19.666 3.645   1.00 29.68 ? 91  GLN M C   1 
ATOM   3312 O  O   . GLN D 2 93  ? -36.784 -20.756 3.610   1.00 29.25 ? 91  GLN M O   1 
ATOM   3313 C  CB  . GLN D 2 93  ? -39.817 -19.880 3.135   1.00 30.16 ? 91  GLN M CB  1 
ATOM   3314 C  CG  . GLN D 2 93  ? -39.812 -21.324 3.568   1.00 29.36 ? 91  GLN M CG  1 
ATOM   3315 C  CD  . GLN D 2 93  ? -39.173 -21.508 4.919   1.00 27.44 ? 91  GLN M CD  1 
ATOM   3316 O  OE1 . GLN D 2 93  ? -39.069 -20.566 5.700   1.00 27.36 ? 91  GLN M OE1 1 
ATOM   3317 N  NE2 . GLN D 2 93  ? -38.719 -22.715 5.195   1.00 27.68 ? 91  GLN M NE2 1 
ATOM   3318 N  N   . TYR D 2 94  ? -36.986 -18.702 4.496   1.00 29.49 ? 92  TYR M N   1 
ATOM   3319 C  CA  . TYR D 2 94  ? -35.869 -18.860 5.429   1.00 29.70 ? 92  TYR M CA  1 
ATOM   3320 C  C   . TYR D 2 94  ? -36.193 -18.287 6.821   1.00 29.92 ? 92  TYR M C   1 
ATOM   3321 O  O   . TYR D 2 94  ? -35.307 -17.864 7.591   1.00 31.54 ? 92  TYR M O   1 
ATOM   3322 C  CB  . TYR D 2 94  ? -34.557 -18.277 4.853   1.00 29.50 ? 92  TYR M CB  1 
ATOM   3323 C  CG  . TYR D 2 94  ? -34.582 -16.829 4.402   1.00 30.02 ? 92  TYR M CG  1 
ATOM   3324 C  CD1 . TYR D 2 94  ? -33.922 -15.850 5.117   1.00 30.10 ? 92  TYR M CD1 1 
ATOM   3325 C  CD2 . TYR D 2 94  ? -35.234 -16.448 3.237   1.00 32.74 ? 92  TYR M CD2 1 
ATOM   3326 C  CE1 . TYR D 2 94  ? -33.933 -14.523 4.708   1.00 30.05 ? 92  TYR M CE1 1 
ATOM   3327 C  CE2 . TYR D 2 94  ? -35.245 -15.115 2.808   1.00 32.16 ? 92  TYR M CE2 1 
ATOM   3328 C  CZ  . TYR D 2 94  ? -34.591 -14.161 3.550   1.00 31.94 ? 92  TYR M CZ  1 
ATOM   3329 O  OH  . TYR D 2 94  ? -34.590 -12.847 3.125   1.00 31.97 ? 92  TYR M OH  1 
ATOM   3330 N  N   . GLY D 2 95  ? -37.477 -18.317 7.144   1.00 29.80 ? 93  GLY M N   1 
ATOM   3331 C  CA  . GLY D 2 95  ? -37.986 -17.725 8.376   1.00 29.36 ? 93  GLY M CA  1 
ATOM   3332 C  C   . GLY D 2 95  ? -37.984 -18.689 9.541   1.00 28.80 ? 93  GLY M C   1 
ATOM   3333 O  O   . GLY D 2 95  ? -38.484 -18.360 10.613  1.00 28.17 ? 93  GLY M O   1 
ATOM   3334 N  N   . GLN D 2 96  ? -37.451 -19.888 9.314   1.00 28.35 ? 94  GLN M N   1 
ATOM   3335 C  CA  . GLN D 2 96  ? -37.124 -20.818 10.391  1.00 28.48 ? 94  GLN M CA  1 
ATOM   3336 C  C   . GLN D 2 96  ? -35.919 -21.623 9.950   1.00 28.11 ? 94  GLN M C   1 
ATOM   3337 O  O   . GLN D 2 96  ? -35.525 -21.565 8.795   1.00 28.13 ? 94  GLN M O   1 
ATOM   3338 C  CB  . GLN D 2 96  ? -38.295 -21.735 10.711  1.00 28.52 ? 94  GLN M CB  1 
ATOM   3339 C  CG  . GLN D 2 96  ? -38.570 -22.799 9.661   1.00 30.17 ? 94  GLN M CG  1 
ATOM   3340 C  CD  . GLN D 2 96  ? -39.917 -23.473 9.878   1.00 31.32 ? 94  GLN M CD  1 
ATOM   3341 O  OE1 . GLN D 2 96  ? -40.939 -22.798 10.018  1.00 33.36 ? 94  GLN M OE1 1 
ATOM   3342 N  NE2 . GLN D 2 96  ? -39.925 -24.806 9.899   1.00 30.25 ? 94  GLN M NE2 1 
ATOM   3343 N  N   . SER D 2 97  ? -35.326 -22.370 10.865  1.00 27.80 ? 95  SER M N   1 
ATOM   3344 C  CA  . SER D 2 97  ? -34.043 -23.015 10.580  1.00 27.79 ? 95  SER M CA  1 
ATOM   3345 C  C   . SER D 2 97  ? -34.095 -23.978 9.377   1.00 27.69 ? 95  SER M C   1 
ATOM   3346 O  O   . SER D 2 97  ? -33.140 -24.085 8.604   1.00 26.89 ? 95  SER M O   1 
ATOM   3347 C  CB  . SER D 2 97  ? -33.537 -23.731 11.833  1.00 27.98 ? 95  SER M CB  1 
ATOM   3348 O  OG  . SER D 2 97  ? -33.022 -22.799 12.777  1.00 27.67 ? 95  SER M OG  1 
ATOM   3349 N  N   . LEU D 2 98  ? -35.226 -24.664 9.227   1.00 27.67 ? 96  LEU M N   1 
ATOM   3350 C  CA  . LEU D 2 98  ? -35.454 -25.562 8.093   1.00 26.72 ? 96  LEU M CA  1 
ATOM   3351 C  C   . LEU D 2 98  ? -35.935 -24.741 6.890   1.00 26.89 ? 96  LEU M C   1 
ATOM   3352 O  O   . LEU D 2 98  ? -37.136 -24.546 6.686   1.00 28.21 ? 96  LEU M O   1 
ATOM   3353 C  CB  . LEU D 2 98  ? -36.454 -26.666 8.483   1.00 25.58 ? 96  LEU M CB  1 
ATOM   3354 C  CG  . LEU D 2 98  ? -36.989 -27.623 7.406   1.00 25.64 ? 96  LEU M CG  1 
ATOM   3355 C  CD1 . LEU D 2 98  ? -35.922 -27.988 6.347   1.00 24.28 ? 96  LEU M CD1 1 
ATOM   3356 C  CD2 . LEU D 2 98  ? -37.591 -28.886 8.047   1.00 20.97 ? 96  LEU M CD2 1 
ATOM   3357 N  N   . SER D 2 99  ? -34.988 -24.240 6.108   1.00 26.56 ? 97  SER M N   1 
ATOM   3358 C  CA  . SER D 2 99  ? -35.318 -23.437 4.940   1.00 26.69 ? 97  SER M CA  1 
ATOM   3359 C  C   . SER D 2 99  ? -35.735 -24.305 3.768   1.00 27.28 ? 97  SER M C   1 
ATOM   3360 O  O   . SER D 2 99  ? -35.229 -25.418 3.594   1.00 27.01 ? 97  SER M O   1 
ATOM   3361 C  CB  . SER D 2 99  ? -34.130 -22.593 4.511   1.00 26.46 ? 97  SER M CB  1 
ATOM   3362 O  OG  . SER D 2 99  ? -34.504 -21.762 3.427   1.00 27.00 ? 97  SER M OG  1 
ATOM   3363 N  N   . THR D 2 100 ? -36.651 -23.799 2.950   1.00 27.41 ? 98  THR M N   1 
ATOM   3364 C  CA  . THR D 2 100 ? -37.080 -24.566 1.792   1.00 27.80 ? 98  THR M CA  1 
ATOM   3365 C  C   . THR D 2 100 ? -37.345 -23.738 0.559   1.00 28.69 ? 98  THR M C   1 
ATOM   3366 O  O   . THR D 2 100 ? -37.640 -22.548 0.633   1.00 28.96 ? 98  THR M O   1 
ATOM   3367 C  CB  . THR D 2 100 ? -38.352 -25.352 2.070   1.00 27.68 ? 98  THR M CB  1 
ATOM   3368 O  OG1 . THR D 2 100 ? -39.382 -24.447 2.474   1.00 25.44 ? 98  THR M OG1 1 
ATOM   3369 C  CG2 . THR D 2 100 ? -38.102 -26.386 3.146   1.00 27.00 ? 98  THR M CG2 1 
ATOM   3370 N  N   . PHE D 2 101 ? -37.260 -24.423 -0.579  1.00 29.79 ? 99  PHE M N   1 
ATOM   3371 C  CA  . PHE D 2 101 ? -37.450 -23.827 -1.890  1.00 29.98 ? 99  PHE M CA  1 
ATOM   3372 C  C   . PHE D 2 101 ? -38.752 -24.290 -2.488  1.00 30.08 ? 99  PHE M C   1 
ATOM   3373 O  O   . PHE D 2 101 ? -39.185 -25.404 -2.230  1.00 30.60 ? 99  PHE M O   1 
ATOM   3374 C  CB  . PHE D 2 101 ? -36.324 -24.257 -2.815  1.00 29.28 ? 99  PHE M CB  1 
ATOM   3375 C  CG  . PHE D 2 101 ? -35.049 -23.493 -2.617  1.00 29.36 ? 99  PHE M CG  1 
ATOM   3376 C  CD1 . PHE D 2 101 ? -34.025 -24.013 -1.857  1.00 29.58 ? 99  PHE M CD1 1 
ATOM   3377 C  CD2 . PHE D 2 101 ? -34.858 -22.273 -3.231  1.00 29.97 ? 99  PHE M CD2 1 
ATOM   3378 C  CE1 . PHE D 2 101 ? -32.830 -23.320 -1.703  1.00 30.92 ? 99  PHE M CE1 1 
ATOM   3379 C  CE2 . PHE D 2 101 ? -33.670 -21.571 -3.076  1.00 30.09 ? 99  PHE M CE2 1 
ATOM   3380 C  CZ  . PHE D 2 101 ? -32.660 -22.090 -2.311  1.00 30.16 ? 99  PHE M CZ  1 
ATOM   3381 N  N   . GLY D 2 102 ? -39.358 -23.442 -3.310  1.00 30.28 ? 100 GLY M N   1 
ATOM   3382 C  CA  . GLY D 2 102 ? -40.482 -23.865 -4.141  1.00 30.66 ? 100 GLY M CA  1 
ATOM   3383 C  C   . GLY D 2 102 ? -40.006 -24.823 -5.219  1.00 30.70 ? 100 GLY M C   1 
ATOM   3384 O  O   . GLY D 2 102 ? -38.820 -25.082 -5.325  1.00 30.26 ? 100 GLY M O   1 
ATOM   3385 N  N   . GLN D 2 103 ? -40.926 -25.361 -6.018  1.00 31.36 ? 101 GLN M N   1 
ATOM   3386 C  CA  . GLN D 2 103 ? -40.544 -26.280 -7.100  1.00 31.81 ? 101 GLN M CA  1 
ATOM   3387 C  C   . GLN D 2 103 ? -40.095 -25.570 -8.399  1.00 31.91 ? 101 GLN M C   1 
ATOM   3388 O  O   . GLN D 2 103 ? -39.635 -26.226 -9.332  1.00 32.49 ? 101 GLN M O   1 
ATOM   3389 C  CB  . GLN D 2 103 ? -41.678 -27.257 -7.407  1.00 32.04 ? 101 GLN M CB  1 
ATOM   3390 C  CG  . GLN D 2 103 ? -42.695 -26.767 -8.458  1.00 33.78 ? 101 GLN M CG  1 
ATOM   3391 C  CD  . GLN D 2 103 ? -43.822 -25.897 -7.886  1.00 33.96 ? 101 GLN M CD  1 
ATOM   3392 O  OE1 . GLN D 2 103 ? -43.715 -25.331 -6.788  1.00 35.47 ? 101 GLN M OE1 1 
ATOM   3393 N  NE2 . GLN D 2 103 ? -44.903 -25.777 -8.649  1.00 31.95 ? 101 GLN M NE2 1 
ATOM   3394 N  N   . GLY D 2 104 ? -40.233 -24.247 -8.459  1.00 31.34 ? 102 GLY M N   1 
ATOM   3395 C  CA  . GLY D 2 104 ? -39.820 -23.479 -9.638  1.00 31.29 ? 102 GLY M CA  1 
ATOM   3396 C  C   . GLY D 2 104 ? -40.894 -23.235 -10.701 1.00 31.15 ? 102 GLY M C   1 
ATOM   3397 O  O   . GLY D 2 104 ? -41.742 -24.101 -10.964 1.00 31.21 ? 102 GLY M O   1 
ATOM   3398 N  N   . THR D 2 105 ? -40.851 -22.047 -11.308 1.00 30.43 ? 103 THR M N   1 
ATOM   3399 C  CA  . THR D 2 105 ? -41.690 -21.708 -12.461 1.00 30.34 ? 103 THR M CA  1 
ATOM   3400 C  C   . THR D 2 105 ? -40.849 -21.350 -13.687 1.00 30.39 ? 103 THR M C   1 
ATOM   3401 O  O   . THR D 2 105 ? -39.938 -20.529 -13.601 1.00 30.38 ? 103 THR M O   1 
ATOM   3402 C  CB  . THR D 2 105 ? -42.556 -20.484 -12.189 1.00 30.00 ? 103 THR M CB  1 
ATOM   3403 O  OG1 . THR D 2 105 ? -43.537 -20.790 -11.197 1.00 31.80 ? 103 THR M OG1 1 
ATOM   3404 C  CG2 . THR D 2 105 ? -43.254 -20.045 -13.463 1.00 30.17 ? 103 THR M CG2 1 
ATOM   3405 N  N   . LYS D 2 106 ? -41.169 -21.936 -14.837 1.00 30.50 ? 104 LYS M N   1 
ATOM   3406 C  CA  . LYS D 2 106 ? -40.432 -21.616 -16.067 1.00 30.42 ? 104 LYS M CA  1 
ATOM   3407 C  C   . LYS D 2 106 ? -41.072 -20.423 -16.770 1.00 30.14 ? 104 LYS M C   1 
ATOM   3408 O  O   . LYS D 2 106 ? -42.294 -20.369 -16.941 1.00 29.29 ? 104 LYS M O   1 
ATOM   3409 C  CB  . LYS D 2 106 ? -40.363 -22.802 -17.038 1.00 30.37 ? 104 LYS M CB  1 
ATOM   3410 C  CG  . LYS D 2 106 ? -40.419 -24.189 -16.403 1.00 30.81 ? 104 LYS M CG  1 
ATOM   3411 C  CD  . LYS D 2 106 ? -40.325 -25.291 -17.457 1.00 30.98 ? 104 LYS M CD  1 
ATOM   3412 C  CE  . LYS D 2 106 ? -41.498 -26.311 -17.352 1.00 31.81 ? 104 LYS M CE  1 
ATOM   3413 N  NZ  . LYS D 2 106 ? -41.886 -26.699 -15.960 1.00 27.99 ? 104 LYS M NZ  1 
ATOM   3414 N  N   . VAL D 2 107 ? -40.239 -19.459 -17.145 1.00 30.19 ? 105 VAL M N   1 
ATOM   3415 C  CA  . VAL D 2 107 ? -40.668 -18.381 -18.026 1.00 30.93 ? 105 VAL M CA  1 
ATOM   3416 C  C   . VAL D 2 107 ? -39.949 -18.549 -19.367 1.00 31.38 ? 105 VAL M C   1 
ATOM   3417 O  O   . VAL D 2 107 ? -38.723 -18.418 -19.466 1.00 31.28 ? 105 VAL M O   1 
ATOM   3418 C  CB  . VAL D 2 107 ? -40.418 -16.967 -17.438 1.00 30.94 ? 105 VAL M CB  1 
ATOM   3419 C  CG1 . VAL D 2 107 ? -40.832 -15.897 -18.442 1.00 30.95 ? 105 VAL M CG1 1 
ATOM   3420 C  CG2 . VAL D 2 107 ? -41.175 -16.786 -16.142 1.00 29.15 ? 105 VAL M CG2 1 
ATOM   3421 N  N   . GLU D 2 108 ? -40.753 -18.861 -20.381 1.00 31.82 ? 106 GLU M N   1 
ATOM   3422 C  CA  . GLU D 2 108 ? -40.288 -19.199 -21.715 1.00 31.63 ? 106 GLU M CA  1 
ATOM   3423 C  C   . GLU D 2 108 ? -40.863 -18.235 -22.761 1.00 31.35 ? 106 GLU M C   1 
ATOM   3424 O  O   . GLU D 2 108 ? -41.918 -17.631 -22.563 1.00 30.56 ? 106 GLU M O   1 
ATOM   3425 C  CB  . GLU D 2 108 ? -40.702 -20.637 -22.050 1.00 31.92 ? 106 GLU M CB  1 
ATOM   3426 C  CG  . GLU D 2 108 ? -40.003 -21.719 -21.215 1.00 32.20 ? 106 GLU M CG  1 
ATOM   3427 N  N   . VAL D 2 109 ? -40.147 -18.116 -23.874 1.00 31.37 ? 107 VAL M N   1 
ATOM   3428 C  CA  . VAL D 2 109 ? -40.527 -17.255 -24.996 1.00 31.10 ? 107 VAL M CA  1 
ATOM   3429 C  C   . VAL D 2 109 ? -41.752 -17.774 -25.759 1.00 30.31 ? 107 VAL M C   1 
ATOM   3430 O  O   . VAL D 2 109 ? -41.930 -18.971 -25.946 1.00 29.83 ? 107 VAL M O   1 
ATOM   3431 C  CB  . VAL D 2 109 ? -39.357 -17.131 -25.997 1.00 31.31 ? 107 VAL M CB  1 
ATOM   3432 C  CG1 . VAL D 2 109 ? -39.311 -18.353 -26.916 1.00 31.57 ? 107 VAL M CG1 1 
ATOM   3433 C  CG2 . VAL D 2 109 ? -39.474 -15.861 -26.807 1.00 31.64 ? 107 VAL M CG2 1 
ATOM   3434 N  N   . LYS D 2 110 ? -42.577 -16.844 -26.217 1.00 30.27 ? 108 LYS M N   1 
ATOM   3435 C  CA  . LYS D 2 110 ? -43.825 -17.156 -26.904 1.00 30.20 ? 108 LYS M CA  1 
ATOM   3436 C  C   . LYS D 2 110 ? -43.589 -17.319 -28.399 1.00 29.64 ? 108 LYS M C   1 
ATOM   3437 O  O   . LYS D 2 110 ? -43.078 -16.409 -29.050 1.00 29.98 ? 108 LYS M O   1 
ATOM   3438 C  CB  . LYS D 2 110 ? -44.814 -16.010 -26.684 1.00 30.49 ? 108 LYS M CB  1 
ATOM   3439 C  CG  . LYS D 2 110 ? -46.274 -16.294 -27.032 1.00 31.39 ? 108 LYS M CG  1 
ATOM   3440 C  CD  . LYS D 2 110 ? -46.987 -14.980 -27.396 1.00 32.41 ? 108 LYS M CD  1 
ATOM   3441 C  CE  . LYS D 2 110 ? -48.455 -14.944 -26.987 1.00 32.78 ? 108 LYS M CE  1 
ATOM   3442 N  NZ  . LYS D 2 110 ? -49.205 -13.906 -27.768 1.00 31.02 ? 108 LYS M NZ  1 
ATOM   3443 N  N   . LEU D 2 111 ? -43.957 -18.481 -28.934 1.00 29.00 ? 109 LEU M N   1 
ATOM   3444 C  CA  . LEU D 2 111 ? -43.986 -18.700 -30.386 1.00 28.03 ? 109 LEU M CA  1 
ATOM   3445 C  C   . LEU D 2 111 ? -45.298 -19.390 -30.731 1.00 27.99 ? 109 LEU M C   1 
ATOM   3446 O  O   . LEU D 2 111 ? -45.550 -20.506 -30.279 1.00 27.30 ? 109 LEU M O   1 
ATOM   3447 C  CB  . LEU D 2 111 ? -42.791 -19.532 -30.867 1.00 27.29 ? 109 LEU M CB  1 
ATOM   3448 C  CG  . LEU D 2 111 ? -42.661 -19.716 -32.389 1.00 26.60 ? 109 LEU M CG  1 
ATOM   3449 C  CD1 . LEU D 2 111 ? -42.323 -18.405 -33.107 1.00 24.73 ? 109 LEU M CD1 1 
ATOM   3450 C  CD2 . LEU D 2 111 ? -41.624 -20.772 -32.722 1.00 25.15 ? 109 LEU M CD2 1 
ATOM   3451 N  N   . VAL D 2 112 ? -46.124 -18.700 -31.519 1.00 28.52 ? 110 VAL M N   1 
ATOM   3452 C  CA  . VAL D 2 112 ? -47.474 -19.156 -31.869 1.00 28.90 ? 110 VAL M CA  1 
ATOM   3453 C  C   . VAL D 2 112 ? -47.711 -19.018 -33.371 1.00 28.90 ? 110 VAL M C   1 
ATOM   3454 O  O   . VAL D 2 112 ? -47.160 -18.115 -33.993 1.00 29.04 ? 110 VAL M O   1 
ATOM   3455 C  CB  . VAL D 2 112 ? -48.542 -18.338 -31.098 1.00 29.00 ? 110 VAL M CB  1 
ATOM   3456 C  CG1 . VAL D 2 112 ? -49.944 -18.676 -31.564 1.00 30.17 ? 110 VAL M CG1 1 
ATOM   3457 C  CG2 . VAL D 2 112 ? -48.419 -18.597 -29.602 1.00 29.16 ? 110 VAL M CG2 1 
ATOM   3458 N  N   . PRO D 2 113 ? -48.538 -19.908 -33.961 1.00 29.39 ? 111 PRO M N   1 
ATOM   3459 C  CA  . PRO D 2 113 ? -48.800 -19.862 -35.403 1.00 29.33 ? 111 PRO M CA  1 
ATOM   3460 C  C   . PRO D 2 113 ? -49.964 -18.946 -35.768 1.00 28.93 ? 111 PRO M C   1 
ATOM   3461 O  O   . PRO D 2 113 ? -50.360 -18.899 -36.932 1.00 28.52 ? 111 PRO M O   1 
ATOM   3462 C  CB  . PRO D 2 113 ? -49.141 -21.322 -35.746 1.00 29.52 ? 111 PRO M CB  1 
ATOM   3463 C  CG  . PRO D 2 113 ? -49.402 -22.028 -34.401 1.00 29.24 ? 111 PRO M CG  1 
ATOM   3464 C  CD  . PRO D 2 113 ? -49.290 -21.004 -33.319 1.00 29.40 ? 111 PRO M CD  1 
ATOM   3465 N  N   . ASP E 3 44  ? 20.016  -31.321 -18.517 1.00 38.65 ? 44  ASP S N   1 
ATOM   3466 C  CA  . ASP E 3 44  ? 20.362  -29.918 -18.919 1.00 38.89 ? 44  ASP S CA  1 
ATOM   3467 C  C   . ASP E 3 44  ? 19.125  -28.996 -18.964 1.00 38.22 ? 44  ASP S C   1 
ATOM   3468 O  O   . ASP E 3 44  ? 18.903  -28.181 -18.062 1.00 37.93 ? 44  ASP S O   1 
ATOM   3469 C  CB  . ASP E 3 44  ? 21.063  -29.927 -20.281 1.00 39.31 ? 44  ASP S CB  1 
ATOM   3470 C  CG  . ASP E 3 44  ? 21.984  -28.743 -20.469 1.00 40.59 ? 44  ASP S CG  1 
ATOM   3471 O  OD1 . ASP E 3 44  ? 21.492  -27.679 -20.929 1.00 42.14 ? 44  ASP S OD1 1 
ATOM   3472 O  OD2 . ASP E 3 44  ? 23.192  -28.879 -20.158 1.00 40.57 ? 44  ASP S OD2 1 
ATOM   3473 N  N   . PRO E 3 45  ? 18.306  -29.137 -20.013 1.00 37.35 ? 45  PRO S N   1 
ATOM   3474 C  CA  . PRO E 3 45  ? 17.108  -28.332 -20.181 1.00 36.88 ? 45  PRO S CA  1 
ATOM   3475 C  C   . PRO E 3 45  ? 16.251  -28.371 -18.935 1.00 36.59 ? 45  PRO S C   1 
ATOM   3476 O  O   . PRO E 3 45  ? 16.067  -29.440 -18.355 1.00 36.92 ? 45  PRO S O   1 
ATOM   3477 C  CB  . PRO E 3 45  ? 16.374  -29.048 -21.313 1.00 36.87 ? 45  PRO S CB  1 
ATOM   3478 C  CG  . PRO E 3 45  ? 17.430  -29.720 -22.071 1.00 37.05 ? 45  PRO S CG  1 
ATOM   3479 C  CD  . PRO E 3 45  ? 18.456  -30.125 -21.095 1.00 37.05 ? 45  PRO S CD  1 
ATOM   3480 N  N   . ASN E 3 46  ? 15.719  -27.220 -18.538 1.00 36.00 ? 46  ASN S N   1 
ATOM   3481 C  CA  . ASN E 3 46  ? 14.938  -27.119 -17.313 1.00 35.27 ? 46  ASN S CA  1 
ATOM   3482 C  C   . ASN E 3 46  ? 13.459  -26.931 -17.603 1.00 35.06 ? 46  ASN S C   1 
ATOM   3483 O  O   . ASN E 3 46  ? 13.037  -25.927 -18.160 1.00 34.94 ? 46  ASN S O   1 
ATOM   3484 C  CB  . ASN E 3 46  ? 15.443  -25.980 -16.424 1.00 35.41 ? 46  ASN S CB  1 
ATOM   3485 C  CG  . ASN E 3 46  ? 14.697  -25.902 -15.095 1.00 35.10 ? 46  ASN S CG  1 
ATOM   3486 O  OD1 . ASN E 3 46  ? 13.858  -26.748 -14.800 1.00 36.67 ? 46  ASN S OD1 1 
ATOM   3487 N  ND2 . ASN E 3 46  ? 14.998  -24.887 -14.296 1.00 32.05 ? 46  ASN S ND2 1 
ATOM   3488 N  N   . TRP E 3 47  ? 12.684  -27.921 -17.188 1.00 35.14 ? 47  TRP S N   1 
ATOM   3489 C  CA  . TRP E 3 47  ? 11.259  -27.957 -17.390 1.00 34.90 ? 47  TRP S CA  1 
ATOM   3490 C  C   . TRP E 3 47  ? 10.628  -26.673 -16.906 1.00 35.33 ? 47  TRP S C   1 
ATOM   3491 O  O   . TRP E 3 47  ? 9.590   -26.270 -17.419 1.00 36.44 ? 47  TRP S O   1 
ATOM   3492 C  CB  . TRP E 3 47  ? 10.683  -29.145 -16.620 1.00 35.10 ? 47  TRP S CB  1 
ATOM   3493 C  CG  . TRP E 3 47  ? 9.183   -29.354 -16.741 1.00 35.35 ? 47  TRP S CG  1 
ATOM   3494 C  CD1 . TRP E 3 47  ? 8.527   -30.077 -17.698 1.00 35.65 ? 47  TRP S CD1 1 
ATOM   3495 C  CD2 . TRP E 3 47  ? 8.175   -28.880 -15.841 1.00 36.01 ? 47  TRP S CD2 1 
ATOM   3496 N  NE1 . TRP E 3 47  ? 7.174   -30.072 -17.455 1.00 36.26 ? 47  TRP S NE1 1 
ATOM   3497 C  CE2 . TRP E 3 47  ? 6.933   -29.339 -16.323 1.00 36.70 ? 47  TRP S CE2 1 
ATOM   3498 C  CE3 . TRP E 3 47  ? 8.201   -28.103 -14.676 1.00 35.10 ? 47  TRP S CE3 1 
ATOM   3499 C  CZ2 . TRP E 3 47  ? 5.731   -29.041 -15.683 1.00 36.07 ? 47  TRP S CZ2 1 
ATOM   3500 C  CZ3 . TRP E 3 47  ? 7.007   -27.818 -14.042 1.00 34.24 ? 47  TRP S CZ3 1 
ATOM   3501 C  CH2 . TRP E 3 47  ? 5.793   -28.282 -14.542 1.00 33.84 ? 47  TRP S CH2 1 
ATOM   3502 N  N   . PHE E 3 48  ? 11.246  -26.021 -15.922 1.00 34.93 ? 48  PHE S N   1 
ATOM   3503 C  CA  . PHE E 3 48  ? 10.664  -24.803 -15.344 1.00 34.25 ? 48  PHE S CA  1 
ATOM   3504 C  C   . PHE E 3 48  ? 10.832  -23.591 -16.255 1.00 34.53 ? 48  PHE S C   1 
ATOM   3505 O  O   . PHE E 3 48  ? 10.304  -22.518 -15.956 1.00 35.20 ? 48  PHE S O   1 
ATOM   3506 C  CB  . PHE E 3 48  ? 11.234  -24.512 -13.943 1.00 34.00 ? 48  PHE S CB  1 
ATOM   3507 C  CG  . PHE E 3 48  ? 10.749  -25.468 -12.877 1.00 33.05 ? 48  PHE S CG  1 
ATOM   3508 C  CD1 . PHE E 3 48  ? 11.554  -26.491 -12.422 1.00 32.10 ? 48  PHE S CD1 1 
ATOM   3509 C  CD2 . PHE E 3 48  ? 9.470   -25.360 -12.356 1.00 33.13 ? 48  PHE S CD2 1 
ATOM   3510 C  CE1 . PHE E 3 48  ? 11.096  -27.378 -11.461 1.00 32.79 ? 48  PHE S CE1 1 
ATOM   3511 C  CE2 . PHE E 3 48  ? 9.009   -26.247 -11.398 1.00 31.78 ? 48  PHE S CE2 1 
ATOM   3512 C  CZ  . PHE E 3 48  ? 9.823   -27.252 -10.948 1.00 32.23 ? 48  PHE S CZ  1 
ATOM   3513 N  N   . ASP E 3 49  ? 11.550  -23.763 -17.367 1.00 34.56 ? 49  ASP S N   1 
ATOM   3514 C  CA  . ASP E 3 49  ? 11.777  -22.670 -18.325 1.00 34.47 ? 49  ASP S CA  1 
ATOM   3515 C  C   . ASP E 3 49  ? 10.793  -22.732 -19.485 1.00 34.54 ? 49  ASP S C   1 
ATOM   3516 O  O   . ASP E 3 49  ? 10.594  -21.757 -20.199 1.00 35.14 ? 49  ASP S O   1 
ATOM   3517 C  CB  . ASP E 3 49  ? 13.205  -22.716 -18.888 1.00 34.42 ? 49  ASP S CB  1 
ATOM   3518 C  CG  . ASP E 3 49  ? 14.259  -22.372 -17.853 1.00 33.93 ? 49  ASP S CG  1 
ATOM   3519 O  OD1 . ASP E 3 49  ? 13.938  -21.606 -16.915 1.00 32.90 ? 49  ASP S OD1 1 
ATOM   3520 O  OD2 . ASP E 3 49  ? 15.409  -22.859 -17.985 1.00 31.01 ? 49  ASP S OD2 1 
ATOM   3521 N  N   . ILE E 3 50  ? 10.171  -23.881 -19.671 1.00 34.50 ? 50  ILE S N   1 
ATOM   3522 C  CA  . ILE E 3 50  ? 9.327   -24.094 -20.838 1.00 34.37 ? 50  ILE S CA  1 
ATOM   3523 C  C   . ILE E 3 50  ? 8.220   -23.056 -21.019 1.00 34.78 ? 50  ILE S C   1 
ATOM   3524 O  O   . ILE E 3 50  ? 7.994   -22.594 -22.137 1.00 36.16 ? 50  ILE S O   1 
ATOM   3525 C  CB  . ILE E 3 50  ? 8.719   -25.491 -20.813 1.00 34.19 ? 50  ILE S CB  1 
ATOM   3526 C  CG1 . ILE E 3 50  ? 9.783   -26.516 -21.265 1.00 33.15 ? 50  ILE S CG1 1 
ATOM   3527 C  CG2 . ILE E 3 50  ? 7.484   -25.527 -21.686 1.00 33.53 ? 50  ILE S CG2 1 
ATOM   3528 C  CD1 . ILE E 3 50  ? 9.495   -27.945 -20.837 1.00 31.48 ? 50  ILE S CD1 1 
ATOM   3529 N  N   . THR E 3 51  ? 7.523   -22.692 -19.947 1.00 34.64 ? 51  THR S N   1 
ATOM   3530 C  CA  . THR E 3 51  ? 6.431   -21.721 -20.053 1.00 34.44 ? 51  THR S CA  1 
ATOM   3531 C  C   . THR E 3 51  ? 6.948   -20.326 -20.426 1.00 34.73 ? 51  THR S C   1 
ATOM   3532 O  O   . THR E 3 51  ? 6.264   -19.568 -21.108 1.00 34.64 ? 51  THR S O   1 
ATOM   3533 C  CB  . THR E 3 51  ? 5.604   -21.618 -18.760 1.00 34.45 ? 51  THR S CB  1 
ATOM   3534 O  OG1 . THR E 3 51  ? 6.473   -21.479 -17.632 1.00 35.66 ? 51  THR S OG1 1 
ATOM   3535 C  CG2 . THR E 3 51  ? 4.729   -22.833 -18.576 1.00 35.02 ? 51  THR S CG2 1 
ATOM   3536 N  N   . ALA E 3 52  ? 8.151   -19.986 -19.971 1.00 35.40 ? 52  ALA S N   1 
ATOM   3537 C  CA  . ALA E 3 52  ? 8.812   -18.734 -20.375 1.00 35.31 ? 52  ALA S CA  1 
ATOM   3538 C  C   . ALA E 3 52  ? 8.819   -18.598 -21.899 1.00 35.62 ? 52  ALA S C   1 
ATOM   3539 O  O   . ALA E 3 52  ? 8.516   -17.533 -22.440 1.00 34.70 ? 52  ALA S O   1 
ATOM   3540 C  CB  . ALA E 3 52  ? 10.216  -18.694 -19.853 1.00 34.84 ? 52  ALA S CB  1 
ATOM   3541 N  N   . GLN E 3 53  ? 9.158   -19.696 -22.571 1.00 36.19 ? 53  GLN S N   1 
ATOM   3542 C  CA  . GLN E 3 53  ? 9.178   -19.760 -24.031 1.00 37.15 ? 53  GLN S CA  1 
ATOM   3543 C  C   . GLN E 3 53  ? 7.778   -19.638 -24.599 1.00 37.92 ? 53  GLN S C   1 
ATOM   3544 O  O   . GLN E 3 53  ? 7.550   -18.891 -25.545 1.00 37.95 ? 53  GLN S O   1 
ATOM   3545 C  CB  . GLN E 3 53  ? 9.783   -21.082 -24.514 1.00 37.84 ? 53  GLN S CB  1 
ATOM   3546 C  CG  . GLN E 3 53  ? 11.135  -21.450 -23.901 1.00 38.44 ? 53  GLN S CG  1 
ATOM   3547 C  CD  . GLN E 3 53  ? 11.761  -22.645 -24.583 1.00 39.94 ? 53  GLN S CD  1 
ATOM   3548 O  OE1 . GLN E 3 53  ? 12.012  -22.619 -25.793 1.00 41.26 ? 53  GLN S OE1 1 
ATOM   3549 N  NE2 . GLN E 3 53  ? 12.017  -23.702 -23.816 1.00 39.61 ? 53  GLN S NE2 1 
ATOM   3550 N  N   . LEU E 3 54  ? 6.837   -20.382 -24.030 1.00 39.10 ? 54  LEU S N   1 
ATOM   3551 C  CA  . LEU E 3 54  ? 5.432   -20.235 -24.412 1.00 40.19 ? 54  LEU S CA  1 
ATOM   3552 C  C   . LEU E 3 54  ? 4.979   -18.770 -24.325 1.00 41.31 ? 54  LEU S C   1 
ATOM   3553 O  O   . LEU E 3 54  ? 4.170   -18.317 -25.130 1.00 42.17 ? 54  LEU S O   1 
ATOM   3554 C  CB  . LEU E 3 54  ? 4.521   -21.128 -23.560 1.00 39.96 ? 54  LEU S CB  1 
ATOM   3555 C  CG  . LEU E 3 54  ? 4.503   -22.625 -23.911 1.00 40.73 ? 54  LEU S CG  1 
ATOM   3556 C  CD1 . LEU E 3 54  ? 3.589   -23.426 -22.969 1.00 40.37 ? 54  LEU S CD1 1 
ATOM   3557 C  CD2 . LEU E 3 54  ? 4.093   -22.838 -25.376 1.00 39.16 ? 54  LEU S CD2 1 
ATOM   3558 N  N   . TRP E 3 55  ? 5.501   -18.018 -23.365 1.00 42.55 ? 55  TRP S N   1 
ATOM   3559 C  CA  . TRP E 3 55  ? 5.133   -16.602 -23.248 1.00 43.52 ? 55  TRP S CA  1 
ATOM   3560 C  C   . TRP E 3 55  ? 5.754   -15.766 -24.366 1.00 44.05 ? 55  TRP S C   1 
ATOM   3561 O  O   . TRP E 3 55  ? 5.038   -15.104 -25.114 1.00 43.41 ? 55  TRP S O   1 
ATOM   3562 C  CB  . TRP E 3 55  ? 5.530   -16.038 -21.887 1.00 43.59 ? 55  TRP S CB  1 
ATOM   3563 C  CG  . TRP E 3 55  ? 4.954   -14.692 -21.617 1.00 43.60 ? 55  TRP S CG  1 
ATOM   3564 C  CD1 . TRP E 3 55  ? 3.684   -14.413 -21.208 1.00 43.16 ? 55  TRP S CD1 1 
ATOM   3565 C  CD2 . TRP E 3 55  ? 5.630   -13.435 -21.724 1.00 44.99 ? 55  TRP S CD2 1 
ATOM   3566 N  NE1 . TRP E 3 55  ? 3.524   -13.054 -21.057 1.00 45.32 ? 55  TRP S NE1 1 
ATOM   3567 C  CE2 . TRP E 3 55  ? 4.704   -12.431 -21.367 1.00 45.51 ? 55  TRP S CE2 1 
ATOM   3568 C  CE3 . TRP E 3 55  ? 6.930   -13.060 -22.085 1.00 45.87 ? 55  TRP S CE3 1 
ATOM   3569 C  CZ2 . TRP E 3 55  ? 5.036   -11.077 -21.359 1.00 46.92 ? 55  TRP S CZ2 1 
ATOM   3570 C  CZ3 . TRP E 3 55  ? 7.264   -11.704 -22.076 1.00 46.39 ? 55  TRP S CZ3 1 
ATOM   3571 C  CH2 . TRP E 3 55  ? 6.319   -10.733 -21.716 1.00 47.00 ? 55  TRP S CH2 1 
ATOM   3572 N  N   . GLU E 3 56  ? 7.081   -15.816 -24.478 1.00 45.27 ? 56  GLU S N   1 
ATOM   3573 C  CA  . GLU E 3 56  ? 7.811   -15.095 -25.534 1.00 46.29 ? 56  GLU S CA  1 
ATOM   3574 C  C   . GLU E 3 56  ? 7.193   -15.339 -26.911 1.00 47.28 ? 56  GLU S C   1 
ATOM   3575 O  O   . GLU E 3 56  ? 7.258   -14.478 -27.789 1.00 46.85 ? 56  GLU S O   1 
ATOM   3576 C  CB  . GLU E 3 56  ? 9.296   -15.497 -25.570 1.00 46.21 ? 56  GLU S CB  1 
ATOM   3577 C  CG  . GLU E 3 56  ? 10.194  -14.843 -24.506 1.00 46.18 ? 56  GLU S CG  1 
ATOM   3578 C  CD  . GLU E 3 56  ? 10.009  -13.331 -24.397 1.00 45.37 ? 56  GLU S CD  1 
ATOM   3579 N  N   . PHE E 3 57  ? 6.600   -16.516 -27.090 1.00 48.69 ? 57  PHE S N   1 
ATOM   3580 C  CA  . PHE E 3 57  ? 5.966   -16.874 -28.351 1.00 49.60 ? 57  PHE S CA  1 
ATOM   3581 C  C   . PHE E 3 57  ? 4.734   -16.023 -28.562 1.00 50.14 ? 57  PHE S C   1 
ATOM   3582 O  O   . PHE E 3 57  ? 4.588   -15.375 -29.594 1.00 50.64 ? 57  PHE S O   1 
ATOM   3583 C  CB  . PHE E 3 57  ? 5.575   -18.353 -28.364 1.00 49.88 ? 57  PHE S CB  1 
ATOM   3584 C  CG  . PHE E 3 57  ? 4.671   -18.728 -29.505 1.00 51.22 ? 57  PHE S CG  1 
ATOM   3585 C  CD1 . PHE E 3 57  ? 4.998   -18.386 -30.805 1.00 52.22 ? 57  PHE S CD1 1 
ATOM   3586 C  CD2 . PHE E 3 57  ? 3.499   -19.427 -29.282 1.00 52.92 ? 57  PHE S CD2 1 
ATOM   3587 C  CE1 . PHE E 3 57  ? 4.169   -18.724 -31.857 1.00 52.65 ? 57  PHE S CE1 1 
ATOM   3588 C  CE2 . PHE E 3 57  ? 2.666   -19.770 -30.337 1.00 52.70 ? 57  PHE S CE2 1 
ATOM   3589 C  CZ  . PHE E 3 57  ? 3.004   -19.415 -31.620 1.00 52.32 ? 57  PHE S CZ  1 
ATOM   3590 N  N   . SER E 3 58  ? 3.849   -16.032 -27.573 1.00 50.68 ? 58  SER S N   1 
ATOM   3591 C  CA  . SER E 3 58  ? 2.607   -15.265 -27.627 1.00 50.90 ? 58  SER S CA  1 
ATOM   3592 C  C   . SER E 3 58  ? 2.873   -13.807 -27.987 1.00 51.06 ? 58  SER S C   1 
ATOM   3593 O  O   . SER E 3 58  ? 2.192   -13.229 -28.829 1.00 51.28 ? 58  SER S O   1 
ATOM   3594 C  CB  . SER E 3 58  ? 1.892   -15.332 -26.278 1.00 51.07 ? 58  SER S CB  1 
ATOM   3595 O  OG  . SER E 3 58  ? 1.968   -16.635 -25.718 1.00 51.57 ? 58  SER S OG  1 
ATOM   3596 N  N   . GLN E 3 59  ? 3.874   -13.213 -27.353 1.00 51.38 ? 59  GLN S N   1 
ATOM   3597 C  CA  . GLN E 3 59  ? 4.197   -11.811 -27.603 1.00 51.68 ? 59  GLN S CA  1 
ATOM   3598 C  C   . GLN E 3 59  ? 4.479   -11.586 -29.089 1.00 52.03 ? 59  GLN S C   1 
ATOM   3599 O  O   . GLN E 3 59  ? 4.543   -10.453 -29.552 1.00 52.04 ? 59  GLN S O   1 
ATOM   3600 C  CB  . GLN E 3 59  ? 5.386   -11.360 -26.748 1.00 51.67 ? 59  GLN S CB  1 
ATOM   3601 C  CG  . GLN E 3 59  ? 5.172   -11.513 -25.245 1.00 52.02 ? 59  GLN S CG  1 
ATOM   3602 C  CD  . GLN E 3 59  ? 4.073   -10.612 -24.704 1.00 52.70 ? 59  GLN S CD  1 
ATOM   3603 O  OE1 . GLN E 3 59  ? 4.209   -9.385  -24.682 1.00 52.44 ? 59  GLN S OE1 1 
ATOM   3604 N  NE2 . GLN E 3 59  ? 2.984   -11.220 -24.244 1.00 52.87 ? 59  GLN S NE2 1 
ATOM   3605 N  N   . GLU E 3 60  ? 4.660   -12.678 -29.823 1.00 52.81 ? 60  GLU S N   1 
ATOM   3606 C  CA  . GLU E 3 60  ? 4.694   -12.651 -31.285 1.00 53.32 ? 60  GLU S CA  1 
ATOM   3607 C  C   . GLU E 3 60  ? 3.277   -12.842 -31.854 1.00 53.97 ? 60  GLU S C   1 
ATOM   3608 O  O   . GLU E 3 60  ? 2.773   -11.989 -32.596 1.00 54.12 ? 60  GLU S O   1 
ATOM   3609 C  CB  . GLU E 3 60  ? 5.622   -13.751 -31.809 1.00 53.21 ? 60  GLU S CB  1 
ATOM   3610 N  N   . LEU E 3 61  ? 2.646   -13.962 -31.497 1.00 54.33 ? 61  LEU S N   1 
ATOM   3611 C  CA  . LEU E 3 61  ? 1.290   -14.285 -31.950 1.00 54.54 ? 61  LEU S CA  1 
ATOM   3612 C  C   . LEU E 3 61  ? 0.244   -13.563 -31.103 1.00 54.59 ? 61  LEU S C   1 
ATOM   3613 O  O   . LEU E 3 61  ? -0.150  -12.435 -31.411 1.00 54.63 ? 61  LEU S O   1 
ATOM   3614 C  CB  . LEU E 3 61  ? 1.052   -15.797 -31.887 1.00 54.48 ? 61  LEU S CB  1 
ATOM   3615 N  N   . ASP F 3 44  ? -37.416 -22.292 18.488  1.00 43.95 ? 44  ASP T N   1 
ATOM   3616 C  CA  . ASP F 3 44  ? -38.021 -21.003 18.054  1.00 43.67 ? 44  ASP T CA  1 
ATOM   3617 C  C   . ASP F 3 44  ? -36.967 -20.026 17.498  1.00 43.32 ? 44  ASP T C   1 
ATOM   3618 O  O   . ASP F 3 44  ? -37.242 -19.306 16.537  1.00 43.96 ? 44  ASP T O   1 
ATOM   3619 C  CB  . ASP F 3 44  ? -38.812 -20.361 19.206  1.00 43.39 ? 44  ASP T CB  1 
ATOM   3620 N  N   . PRO F 3 45  ? -35.761 -19.984 18.099  1.00 42.41 ? 45  PRO T N   1 
ATOM   3621 C  CA  . PRO F 3 45  ? -34.724 -19.141 17.495  1.00 41.30 ? 45  PRO T CA  1 
ATOM   3622 C  C   . PRO F 3 45  ? -34.443 -19.592 16.082  1.00 40.52 ? 45  PRO T C   1 
ATOM   3623 O  O   . PRO F 3 45  ? -34.579 -20.767 15.780  1.00 40.12 ? 45  PRO T O   1 
ATOM   3624 C  CB  . PRO F 3 45  ? -33.496 -19.391 18.382  1.00 40.96 ? 45  PRO T CB  1 
ATOM   3625 C  CG  . PRO F 3 45  ? -34.056 -19.827 19.687  1.00 41.52 ? 45  PRO T CG  1 
ATOM   3626 C  CD  . PRO F 3 45  ? -35.282 -20.638 19.331  1.00 42.41 ? 45  PRO T CD  1 
ATOM   3627 N  N   . ASN F 3 46  ? -34.047 -18.666 15.224  1.00 40.02 ? 46  ASN T N   1 
ATOM   3628 C  CA  . ASN F 3 46  ? -33.827 -18.991 13.830  1.00 39.09 ? 46  ASN T CA  1 
ATOM   3629 C  C   . ASN F 3 46  ? -32.380 -18.811 13.420  1.00 39.29 ? 46  ASN T C   1 
ATOM   3630 O  O   . ASN F 3 46  ? -31.816 -17.705 13.470  1.00 39.37 ? 46  ASN T O   1 
ATOM   3631 C  CB  . ASN F 3 46  ? -34.701 -18.141 12.928  1.00 38.96 ? 46  ASN T CB  1 
ATOM   3632 C  CG  . ASN F 3 46  ? -34.490 -18.462 11.473  1.00 37.78 ? 46  ASN T CG  1 
ATOM   3633 O  OD1 . ASN F 3 46  ? -33.800 -19.421 11.147  1.00 38.31 ? 46  ASN T OD1 1 
ATOM   3634 N  ND2 . ASN F 3 46  ? -35.082 -17.670 10.590  1.00 34.47 ? 46  ASN T ND2 1 
ATOM   3635 N  N   . TRP F 3 47  ? -31.803 -19.910 12.963  1.00 38.28 ? 47  TRP T N   1 
ATOM   3636 C  CA  . TRP F 3 47  ? -30.402 -19.965 12.632  1.00 37.72 ? 47  TRP T CA  1 
ATOM   3637 C  C   . TRP F 3 47  ? -30.030 -18.953 11.564  1.00 38.44 ? 47  TRP T C   1 
ATOM   3638 O  O   . TRP F 3 47  ? -28.856 -18.610 11.396  1.00 38.76 ? 47  TRP T O   1 
ATOM   3639 C  CB  . TRP F 3 47  ? -30.103 -21.366 12.135  1.00 37.34 ? 47  TRP T CB  1 
ATOM   3640 C  CG  . TRP F 3 47  ? -28.716 -21.623 11.706  1.00 33.69 ? 47  TRP T CG  1 
ATOM   3641 C  CD1 . TRP F 3 47  ? -27.712 -22.100 12.471  1.00 33.35 ? 47  TRP T CD1 1 
ATOM   3642 C  CD2 . TRP F 3 47  ? -28.195 -21.488 10.387  1.00 31.62 ? 47  TRP T CD2 1 
ATOM   3643 N  NE1 . TRP F 3 47  ? -26.580 -22.264 11.718  1.00 35.02 ? 47  TRP T NE1 1 
ATOM   3644 C  CE2 . TRP F 3 47  ? -26.856 -21.900 10.427  1.00 34.51 ? 47  TRP T CE2 1 
ATOM   3645 C  CE3 . TRP F 3 47  ? -28.732 -21.064 9.176   1.00 30.99 ? 47  TRP T CE3 1 
ATOM   3646 C  CZ2 . TRP F 3 47  ? -26.044 -21.893 9.300   1.00 33.84 ? 47  TRP T CZ2 1 
ATOM   3647 C  CZ3 . TRP F 3 47  ? -27.939 -21.064 8.067   1.00 30.28 ? 47  TRP T CZ3 1 
ATOM   3648 C  CH2 . TRP F 3 47  ? -26.606 -21.468 8.130   1.00 32.78 ? 47  TRP T CH2 1 
ATOM   3649 N  N   . PHE F 3 48  ? -31.024 -18.496 10.815  1.00 38.40 ? 48  PHE T N   1 
ATOM   3650 C  CA  . PHE F 3 48  ? -30.768 -17.540 9.748   1.00 38.43 ? 48  PHE T CA  1 
ATOM   3651 C  C   . PHE F 3 48  ? -30.599 -16.125 10.287  1.00 37.90 ? 48  PHE T C   1 
ATOM   3652 O  O   . PHE F 3 48  ? -30.143 -15.237 9.570   1.00 37.70 ? 48  PHE T O   1 
ATOM   3653 C  CB  . PHE F 3 48  ? -31.868 -17.630 8.691   1.00 38.85 ? 48  PHE T CB  1 
ATOM   3654 C  CG  . PHE F 3 48  ? -31.748 -18.852 7.812   1.00 38.84 ? 48  PHE T CG  1 
ATOM   3655 C  CD1 . PHE F 3 48  ? -32.405 -20.025 8.140   1.00 38.05 ? 48  PHE T CD1 1 
ATOM   3656 C  CD2 . PHE F 3 48  ? -30.935 -18.834 6.684   1.00 37.61 ? 48  PHE T CD2 1 
ATOM   3657 C  CE1 . PHE F 3 48  ? -32.282 -21.147 7.346   1.00 39.57 ? 48  PHE T CE1 1 
ATOM   3658 C  CE2 . PHE F 3 48  ? -30.804 -19.949 5.881   1.00 37.58 ? 48  PHE T CE2 1 
ATOM   3659 C  CZ  . PHE F 3 48  ? -31.474 -21.109 6.206   1.00 38.99 ? 48  PHE T CZ  1 
ATOM   3660 N  N   . ASP F 3 49  ? -30.927 -15.941 11.565  1.00 37.74 ? 49  ASP T N   1 
ATOM   3661 C  CA  . ASP F 3 49  ? -30.807 -14.634 12.235  1.00 37.54 ? 49  ASP T CA  1 
ATOM   3662 C  C   . ASP F 3 49  ? -29.533 -14.481 13.056  1.00 37.04 ? 49  ASP T C   1 
ATOM   3663 O  O   . ASP F 3 49  ? -29.278 -13.413 13.612  1.00 37.78 ? 49  ASP T O   1 
ATOM   3664 C  CB  . ASP F 3 49  ? -31.992 -14.393 13.175  1.00 36.99 ? 49  ASP T CB  1 
ATOM   3665 C  CG  . ASP F 3 49  ? -33.288 -14.238 12.438  1.00 37.48 ? 49  ASP T CG  1 
ATOM   3666 O  OD1 . ASP F 3 49  ? -33.220 -14.077 11.200  1.00 36.87 ? 49  ASP T OD1 1 
ATOM   3667 O  OD2 . ASP F 3 49  ? -34.365 -14.274 13.088  1.00 37.92 ? 49  ASP T OD2 1 
ATOM   3668 N  N   . ILE F 3 50  ? -28.746 -15.539 13.150  1.00 35.72 ? 50  ILE T N   1 
ATOM   3669 C  CA  . ILE F 3 50  ? -27.634 -15.541 14.083  1.00 35.00 ? 50  ILE T CA  1 
ATOM   3670 C  C   . ILE F 3 50  ? -26.559 -14.577 13.638  1.00 35.34 ? 50  ILE T C   1 
ATOM   3671 O  O   . ILE F 3 50  ? -25.980 -13.858 14.445  1.00 36.06 ? 50  ILE T O   1 
ATOM   3672 C  CB  . ILE F 3 50  ? -27.035 -16.938 14.236  1.00 34.63 ? 50  ILE T CB  1 
ATOM   3673 C  CG1 . ILE F 3 50  ? -27.885 -17.765 15.210  1.00 32.79 ? 50  ILE T CG1 1 
ATOM   3674 C  CG2 . ILE F 3 50  ? -25.606 -16.843 14.714  1.00 33.25 ? 50  ILE T CG2 1 
ATOM   3675 C  CD1 . ILE F 3 50  ? -27.765 -19.230 14.995  1.00 31.39 ? 50  ILE T CD1 1 
ATOM   3676 N  N   . THR F 3 51  ? -26.292 -14.548 12.342  1.00 35.58 ? 51  THR T N   1 
ATOM   3677 C  CA  . THR F 3 51  ? -25.230 -13.691 11.827  1.00 34.50 ? 51  THR T CA  1 
ATOM   3678 C  C   . THR F 3 51  ? -25.569 -12.225 12.014  1.00 33.84 ? 51  THR T C   1 
ATOM   3679 O  O   . THR F 3 51  ? -24.668 -11.400 12.089  1.00 34.54 ? 51  THR T O   1 
ATOM   3680 C  CB  . THR F 3 51  ? -24.910 -13.976 10.351  1.00 33.99 ? 51  THR T CB  1 
ATOM   3681 O  OG1 . THR F 3 51  ? -26.122 -14.132 9.603   1.00 32.42 ? 51  THR T OG1 1 
ATOM   3682 C  CG2 . THR F 3 51  ? -24.077 -15.240 10.242  1.00 35.23 ? 51  THR T CG2 1 
ATOM   3683 N  N   . ALA F 3 52  ? -26.859 -11.903 12.091  1.00 33.21 ? 52  ALA T N   1 
ATOM   3684 C  CA  . ALA F 3 52  ? -27.303 -10.524 12.401  1.00 32.46 ? 52  ALA T CA  1 
ATOM   3685 C  C   . ALA F 3 52  ? -26.773 -10.099 13.759  1.00 31.88 ? 52  ALA T C   1 
ATOM   3686 O  O   . ALA F 3 52  ? -26.306 -8.990  13.926  1.00 32.23 ? 52  ALA T O   1 
ATOM   3687 C  CB  . ALA F 3 52  ? -28.824 -10.413 12.374  1.00 31.90 ? 52  ALA T CB  1 
ATOM   3688 N  N   . GLN F 3 53  ? -26.840 -11.001 14.726  1.00 32.05 ? 53  GLN T N   1 
ATOM   3689 C  CA  . GLN F 3 53  ? -26.318 -10.749 16.057  1.00 32.25 ? 53  GLN T CA  1 
ATOM   3690 C  C   . GLN F 3 53  ? -24.805 -10.564 16.071  1.00 32.91 ? 53  GLN T C   1 
ATOM   3691 O  O   . GLN F 3 53  ? -24.284 -9.645  16.704  1.00 33.77 ? 53  GLN T O   1 
ATOM   3692 C  CB  . GLN F 3 53  ? -26.702 -11.894 16.981  1.00 32.20 ? 53  GLN T CB  1 
ATOM   3693 C  CG  . GLN F 3 53  ? -28.206 -11.998 17.230  1.00 33.87 ? 53  GLN T CG  1 
ATOM   3694 C  CD  . GLN F 3 53  ? -28.562 -13.157 18.145  1.00 35.15 ? 53  GLN T CD  1 
ATOM   3695 O  OE1 . GLN F 3 53  ? -29.194 -14.124 17.719  1.00 36.85 ? 53  GLN T OE1 1 
ATOM   3696 N  NE2 . GLN F 3 53  ? -28.127 -13.077 19.402  1.00 34.73 ? 53  GLN T NE2 1 
ATOM   3697 N  N   . LEU F 3 54  ? -24.088 -11.444 15.388  1.00 33.69 ? 54  LEU T N   1 
ATOM   3698 C  CA  . LEU F 3 54  ? -22.638 -11.327 15.336  1.00 33.59 ? 54  LEU T CA  1 
ATOM   3699 C  C   . LEU F 3 54  ? -22.271 -10.028 14.646  1.00 33.90 ? 54  LEU T C   1 
ATOM   3700 O  O   . LEU F 3 54  ? -21.304 -9.387  15.019  1.00 34.28 ? 54  LEU T O   1 
ATOM   3701 C  CB  . LEU F 3 54  ? -21.999 -12.498 14.587  1.00 33.68 ? 54  LEU T CB  1 
ATOM   3702 C  CG  . LEU F 3 54  ? -22.053 -13.911 15.170  1.00 33.04 ? 54  LEU T CG  1 
ATOM   3703 C  CD1 . LEU F 3 54  ? -21.355 -14.856 14.194  1.00 33.61 ? 54  LEU T CD1 1 
ATOM   3704 C  CD2 . LEU F 3 54  ? -21.411 -14.009 16.545  1.00 30.52 ? 54  LEU T CD2 1 
ATOM   3705 N  N   . TRP F 3 55  ? -23.038 -9.633  13.637  1.00 34.37 ? 55  TRP T N   1 
ATOM   3706 C  CA  . TRP F 3 55  ? -22.752 -8.383  12.932  1.00 35.13 ? 55  TRP T CA  1 
ATOM   3707 C  C   . TRP F 3 55  ? -22.711 -7.190  13.894  1.00 36.09 ? 55  TRP T C   1 
ATOM   3708 O  O   . TRP F 3 55  ? -21.776 -6.374  13.858  1.00 36.01 ? 55  TRP T O   1 
ATOM   3709 C  CB  . TRP F 3 55  ? -23.772 -8.117  11.828  1.00 34.83 ? 55  TRP T CB  1 
ATOM   3710 C  CG  . TRP F 3 55  ? -23.440 -6.879  11.047  1.00 35.75 ? 55  TRP T CG  1 
ATOM   3711 C  CD1 . TRP F 3 55  ? -22.366 -6.690  10.225  1.00 35.10 ? 55  TRP T CD1 1 
ATOM   3712 C  CD2 . TRP F 3 55  ? -24.178 -5.654  11.026  1.00 36.15 ? 55  TRP T CD2 1 
ATOM   3713 N  NE1 . TRP F 3 55  ? -22.392 -5.429  9.700   1.00 35.02 ? 55  TRP T NE1 1 
ATOM   3714 C  CE2 . TRP F 3 55  ? -23.497 -4.773  10.172  1.00 35.55 ? 55  TRP T CE2 1 
ATOM   3715 C  CE3 . TRP F 3 55  ? -25.352 -5.219  11.649  1.00 38.11 ? 55  TRP T CE3 1 
ATOM   3716 C  CZ2 . TRP F 3 55  ? -23.951 -3.486  9.917   1.00 37.87 ? 55  TRP T CZ2 1 
ATOM   3717 C  CZ3 . TRP F 3 55  ? -25.804 -3.936  11.398  1.00 37.88 ? 55  TRP T CZ3 1 
ATOM   3718 C  CH2 . TRP F 3 55  ? -25.106 -3.085  10.540  1.00 38.58 ? 55  TRP T CH2 1 
ATOM   3719 N  N   . GLU F 3 56  ? -23.718 -7.104  14.756  1.00 36.66 ? 56  GLU T N   1 
ATOM   3720 C  CA  . GLU F 3 56  ? -23.826 -6.009  15.712  1.00 37.99 ? 56  GLU T CA  1 
ATOM   3721 C  C   . GLU F 3 56  ? -22.654 -5.927  16.681  1.00 37.72 ? 56  GLU T C   1 
ATOM   3722 O  O   . GLU F 3 56  ? -22.308 -4.853  17.167  1.00 36.91 ? 56  GLU T O   1 
ATOM   3723 C  CB  . GLU F 3 56  ? -25.136 -6.118  16.478  1.00 38.89 ? 56  GLU T CB  1 
ATOM   3724 C  CG  . GLU F 3 56  ? -26.253 -5.378  15.768  1.00 42.86 ? 56  GLU T CG  1 
ATOM   3725 C  CD  . GLU F 3 56  ? -27.626 -5.863  16.153  1.00 46.87 ? 56  GLU T CD  1 
ATOM   3726 O  OE1 . GLU F 3 56  ? -27.728 -6.699  17.080  1.00 49.89 ? 56  GLU T OE1 1 
ATOM   3727 O  OE2 . GLU F 3 56  ? -28.606 -5.394  15.530  1.00 49.61 ? 56  GLU T OE2 1 
ATOM   3728 N  N   . PHE F 3 57  ? -22.050 -7.072  16.953  1.00 38.09 ? 57  PHE T N   1 
ATOM   3729 C  CA  . PHE F 3 57  ? -20.845 -7.128  17.755  1.00 38.64 ? 57  PHE T CA  1 
ATOM   3730 C  C   . PHE F 3 57  ? -19.650 -6.562  16.986  1.00 39.31 ? 57  PHE T C   1 
ATOM   3731 O  O   . PHE F 3 57  ? -18.766 -5.942  17.569  1.00 39.32 ? 57  PHE T O   1 
ATOM   3732 C  CB  . PHE F 3 57  ? -20.575 -8.566  18.178  1.00 38.63 ? 57  PHE T CB  1 
ATOM   3733 C  CG  . PHE F 3 57  ? -19.300 -8.745  18.940  1.00 39.08 ? 57  PHE T CG  1 
ATOM   3734 C  CD1 . PHE F 3 57  ? -18.990 -7.908  20.003  1.00 40.36 ? 57  PHE T CD1 1 
ATOM   3735 C  CD2 . PHE F 3 57  ? -18.419 -9.763  18.612  1.00 38.94 ? 57  PHE T CD2 1 
ATOM   3736 C  CE1 . PHE F 3 57  ? -17.812 -8.069  20.712  1.00 40.57 ? 57  PHE T CE1 1 
ATOM   3737 C  CE2 . PHE F 3 57  ? -17.247 -9.937  19.320  1.00 39.56 ? 57  PHE T CE2 1 
ATOM   3738 C  CZ  . PHE F 3 57  ? -16.938 -9.084  20.371  1.00 40.35 ? 57  PHE T CZ  1 
ATOM   3739 N  N   . SER F 3 58  ? -19.626 -6.781  15.679  1.00 40.42 ? 58  SER T N   1 
ATOM   3740 C  CA  . SER F 3 58  ? -18.588 -6.206  14.830  1.00 41.72 ? 58  SER T CA  1 
ATOM   3741 C  C   . SER F 3 58  ? -18.721 -4.681  14.809  1.00 43.06 ? 58  SER T C   1 
ATOM   3742 O  O   . SER F 3 58  ? -17.741 -3.959  15.019  1.00 43.28 ? 58  SER T O   1 
ATOM   3743 C  CB  . SER F 3 58  ? -18.689 -6.758  13.408  1.00 42.10 ? 58  SER T CB  1 
ATOM   3744 O  OG  . SER F 3 58  ? -19.093 -8.119  13.416  1.00 41.33 ? 58  SER T OG  1 
ATOM   3745 N  N   . GLN F 3 59  ? -19.934 -4.190  14.560  1.00 44.27 ? 59  GLN T N   1 
ATOM   3746 C  CA  . GLN F 3 59  ? -20.198 -2.744  14.620  1.00 45.15 ? 59  GLN T CA  1 
ATOM   3747 C  C   . GLN F 3 59  ? -19.769 -2.138  15.956  1.00 46.16 ? 59  GLN T C   1 
ATOM   3748 O  O   . GLN F 3 59  ? -19.299 -1.002  16.002  1.00 46.40 ? 59  GLN T O   1 
ATOM   3749 C  CB  . GLN F 3 59  ? -21.677 -2.434  14.385  1.00 45.02 ? 59  GLN T CB  1 
ATOM   3750 C  CG  . GLN F 3 59  ? -22.162 -2.729  12.979  1.00 45.45 ? 59  GLN T CG  1 
ATOM   3751 C  CD  . GLN F 3 59  ? -21.321 -2.064  11.912  1.00 45.04 ? 59  GLN T CD  1 
ATOM   3752 O  OE1 . GLN F 3 59  ? -20.783 -2.736  11.034  1.00 45.73 ? 59  GLN T OE1 1 
ATOM   3753 N  NE2 . GLN F 3 59  ? -21.195 -0.745  11.984  1.00 43.67 ? 59  GLN T NE2 1 
ATOM   3754 N  N   . GLU F 3 60  ? -19.939 -2.892  17.038  1.00 47.25 ? 60  GLU T N   1 
ATOM   3755 C  CA  . GLU F 3 60  ? -19.582 -2.406  18.371  1.00 48.10 ? 60  GLU T CA  1 
ATOM   3756 C  C   . GLU F 3 60  ? -18.062 -2.301  18.536  1.00 48.63 ? 60  GLU T C   1 
ATOM   3757 O  O   . GLU F 3 60  ? -17.572 -1.448  19.280  1.00 48.44 ? 60  GLU T O   1 
ATOM   3758 C  CB  . GLU F 3 60  ? -20.189 -3.306  19.455  1.00 48.25 ? 60  GLU T CB  1 
ATOM   3759 C  CG  . GLU F 3 60  ? -19.625 -3.087  20.870  1.00 49.25 ? 60  GLU T CG  1 
ATOM   3760 C  CD  . GLU F 3 60  ? -20.329 -3.943  21.922  1.00 49.69 ? 60  GLU T CD  1 
ATOM   3761 O  OE1 . GLU F 3 60  ? -21.543 -4.219  21.758  1.00 49.60 ? 60  GLU T OE1 1 
ATOM   3762 O  OE2 . GLU F 3 60  ? -19.669 -4.347  22.910  1.00 49.42 ? 60  GLU T OE2 1 
ATOM   3763 N  N   . LEU F 3 61  ? -17.324 -3.165  17.842  1.00 49.10 ? 61  LEU T N   1 
ATOM   3764 C  CA  . LEU F 3 61  ? -15.863 -3.110  17.865  1.00 49.55 ? 61  LEU T CA  1 
ATOM   3765 C  C   . LEU F 3 61  ? -15.354 -1.856  17.166  1.00 49.74 ? 61  LEU T C   1 
ATOM   3766 O  O   . LEU F 3 61  ? -14.678 -1.025  17.774  1.00 50.03 ? 61  LEU T O   1 
ATOM   3767 C  CB  . LEU F 3 61  ? -15.249 -4.340  17.194  1.00 49.62 ? 61  LEU T CB  1 
ATOM   3768 C  CG  . LEU F 3 61  ? -15.159 -5.628  18.015  1.00 50.72 ? 61  LEU T CG  1 
ATOM   3769 C  CD1 . LEU F 3 61  ? -14.685 -6.776  17.119  1.00 51.87 ? 61  LEU T CD1 1 
ATOM   3770 C  CD2 . LEU F 3 61  ? -14.245 -5.474  19.233  1.00 49.80 ? 61  LEU T CD2 1 
ATOM   3771 N  N   . ARG F 3 62  ? -15.666 -1.729  15.883  1.00 49.91 ? 62  ARG T N   1 
ATOM   3772 C  CA  . ARG F 3 62  ? -15.243 -0.559  15.122  1.00 49.97 ? 62  ARG T CA  1 
ATOM   3773 C  C   . ARG F 3 62  ? -15.735 0.719   15.801  1.00 49.40 ? 62  ARG T C   1 
ATOM   3774 O  O   . ARG F 3 62  ? -14.936 1.528   16.283  1.00 49.02 ? 62  ARG T O   1 
ATOM   3775 C  CB  . ARG F 3 62  ? -15.754 -0.637  13.677  1.00 50.43 ? 62  ARG T CB  1 
ATOM   3776 C  CG  . ARG F 3 62  ? -14.927 -1.556  12.773  1.00 51.58 ? 62  ARG T CG  1 
ATOM   3777 C  CD  . ARG F 3 62  ? -15.554 -1.730  11.386  1.00 52.45 ? 62  ARG T CD  1 
ATOM   3778 N  NE  . ARG F 3 62  ? -16.456 -2.884  11.320  1.00 53.41 ? 62  ARG T NE  1 
ATOM   3779 C  CZ  . ARG F 3 62  ? -17.314 -3.119  10.329  1.00 54.07 ? 62  ARG T CZ  1 
ATOM   3780 N  NH1 . ARG F 3 62  ? -17.405 -2.276  9.306   1.00 54.78 ? 62  ARG T NH1 1 
ATOM   3781 N  NH2 . ARG F 3 62  ? -18.091 -4.199  10.363  1.00 54.16 ? 62  ARG T NH2 1 
ATOM   3782 N  N   . ASN F 3 63  ? -17.057 0.867   15.862  1.00 48.98 ? 63  ASN T N   1 
ATOM   3783 C  CA  . ASN F 3 63  ? -17.701 2.084   16.377  1.00 48.75 ? 63  ASN T CA  1 
ATOM   3784 C  C   . ASN F 3 63  ? -17.300 2.434   17.829  1.00 48.55 ? 63  ASN T C   1 
ATOM   3785 O  O   . ASN F 3 63  ? -17.341 3.602   18.232  1.00 48.70 ? 63  ASN T O   1 
ATOM   3786 C  CB  . ASN F 3 63  ? -19.231 1.979   16.205  1.00 48.78 ? 63  ASN T CB  1 
ATOM   3787 C  CG  . ASN F 3 63  ? -19.987 3.139   16.842  1.00 48.86 ? 63  ASN T CG  1 
ATOM   3788 O  OD1 . ASN F 3 63  ? -19.566 4.295   16.763  1.00 49.07 ? 63  ASN T OD1 1 
ATOM   3789 N  ND2 . ASN F 3 63  ? -21.124 2.829   17.464  1.00 49.34 ? 63  ASN T ND2 1 
ATOM   3790 N  N   . ARG F 3 64  ? -16.886 1.438   18.605  1.00 48.30 ? 64  ARG T N   1 
ATOM   3791 C  CA  . ARG F 3 64  ? -16.306 1.714   19.921  1.00 48.03 ? 64  ARG T CA  1 
ATOM   3792 C  C   . ARG F 3 64  ? -14.833 2.078   19.731  1.00 47.87 ? 64  ARG T C   1 
ATOM   3793 O  O   . ARG F 3 64  ? -13.950 1.453   20.335  1.00 48.07 ? 64  ARG T O   1 
ATOM   3794 C  CB  . ARG F 3 64  ? -16.450 0.505   20.859  1.00 47.92 ? 64  ARG T CB  1 
HETATM 3795 CA CA  . CA  G 4 .   ? -10.596 -38.655 -5.609  1.00 57.54 ? 136 CA  H CA  1 
HETATM 3796 O  O   . HOH H 5 .   ? -9.718  -30.512 0.655   1.00 50.88 ? 137 HOH H O   1 
HETATM 3797 O  O   . HOH H 5 .   ? 6.515   -23.756 -12.289 1.00 47.00 ? 138 HOH H O   1 
HETATM 3798 O  O   . HOH H 5 .   ? 4.646   -35.189 -21.502 1.00 47.85 ? 139 HOH H O   1 
HETATM 3799 O  O   . HOH H 5 .   ? 9.211   -36.701 -15.733 1.00 42.12 ? 140 HOH H O   1 
HETATM 3800 O  O   . HOH H 5 .   ? -9.323  -35.198 -2.908  1.00 51.55 ? 141 HOH H O   1 
HETATM 3801 O  O   . HOH H 5 .   ? 7.380   -36.819 -17.623 1.00 43.72 ? 142 HOH H O   1 
HETATM 3802 O  O   . HOH H 5 .   ? 12.947  -35.450 -4.340  1.00 52.21 ? 143 HOH H O   1 
HETATM 3803 O  O   . HOH H 5 .   ? 11.369  -33.230 -4.577  1.00 40.79 ? 144 HOH H O   1 
HETATM 3804 O  O   . HOH H 5 .   ? -8.254  -31.501 3.179   1.00 42.50 ? 145 HOH H O   1 
HETATM 3805 O  O   . HOH H 5 .   ? 6.044   -34.463 4.008   1.00 47.62 ? 146 HOH H O   1 
HETATM 3806 O  O   . HOH H 5 .   ? 7.753   -23.299 -16.141 1.00 65.23 ? 147 HOH H O   1 
HETATM 3807 O  O   . HOH H 5 .   ? -7.052  -37.146 -16.172 1.00 47.58 ? 148 HOH H O   1 
HETATM 3808 O  O   . HOH H 5 .   ? -9.536  -40.708 -5.543  1.00 36.11 ? 149 HOH H O   1 
HETATM 3809 O  O   . HOH H 5 .   ? 6.951   -36.220 2.106   1.00 67.23 ? 150 HOH H O   1 
HETATM 3810 O  O   . HOH H 5 .   ? 10.797  -31.588 -2.566  1.00 47.59 ? 151 HOH H O   1 
HETATM 3811 O  O   . HOH H 5 .   ? -6.868  -43.431 -8.298  1.00 68.75 ? 152 HOH H O   1 
HETATM 3812 O  O   . HOH H 5 .   ? 4.267   -29.403 9.163   1.00 50.45 ? 153 HOH H O   1 
HETATM 3813 O  O   . HOH H 5 .   ? 0.423   -31.395 6.937   1.00 48.12 ? 154 HOH H O   1 
HETATM 3814 O  O   . HOH I 5 .   ? -15.349 -38.308 2.245   1.00 53.50 ? 136 HOH I O   1 
HETATM 3815 O  O   . HOH I 5 .   ? -22.291 -10.962 10.611  1.00 41.86 ? 137 HOH I O   1 
HETATM 3816 O  O   . HOH I 5 .   ? -19.997 -36.016 -12.279 1.00 40.25 ? 138 HOH I O   1 
HETATM 3817 O  O   . HOH I 5 .   ? -14.025 -40.331 -0.746  1.00 49.46 ? 139 HOH I O   1 
HETATM 3818 O  O   . HOH I 5 .   ? -28.109 -17.475 5.573   1.00 35.61 ? 140 HOH I O   1 
HETATM 3819 O  O   . HOH I 5 .   ? -22.945 -15.729 -7.248  1.00 36.98 ? 141 HOH I O   1 
HETATM 3820 O  O   . HOH I 5 .   ? -27.039 -12.951 -6.524  1.00 43.91 ? 142 HOH I O   1 
HETATM 3821 O  O   . HOH I 5 .   ? -32.952 -27.181 9.587   1.00 38.18 ? 143 HOH I O   1 
HETATM 3822 O  O   . HOH I 5 .   ? -32.567 -31.438 -7.059  1.00 42.92 ? 144 HOH I O   1 
HETATM 3823 O  O   . HOH I 5 .   ? -29.757 -11.388 9.019   1.00 42.55 ? 145 HOH I O   1 
HETATM 3824 O  O   . HOH I 5 .   ? -27.952 -15.910 7.799   1.00 39.25 ? 146 HOH I O   1 
HETATM 3825 O  O   . HOH I 5 .   ? -17.554 -32.382 6.115   1.00 45.17 ? 147 HOH I O   1 
HETATM 3826 O  O   . HOH I 5 .   ? -33.062 -28.543 -13.280 1.00 43.42 ? 148 HOH I O   1 
HETATM 3827 O  O   . HOH I 5 .   ? -8.881  -27.118 4.557   1.00 49.74 ? 149 HOH I O   1 
HETATM 3828 O  O   . HOH I 5 .   ? -10.923 -36.455 -6.768  1.00 51.20 ? 150 HOH I O   1 
HETATM 3829 O  O   . HOH I 5 .   ? -6.312  -26.617 7.510   1.00 52.52 ? 151 HOH I O   1 
HETATM 3830 O  O   . HOH I 5 .   ? -5.480  -28.977 6.571   1.00 42.47 ? 152 HOH I O   1 
HETATM 3831 O  O   . HOH I 5 .   ? -35.138 -27.114 -0.065  1.00 53.92 ? 153 HOH I O   1 
HETATM 3832 O  O   . HOH J 5 .   ? 17.453  -15.653 -1.332  1.00 41.66 ? 113 HOH L O   1 
HETATM 3833 O  O   . HOH J 5 .   ? 9.065   -28.385 8.524   1.00 46.53 ? 114 HOH L O   1 
HETATM 3834 O  O   . HOH J 5 .   ? 20.907  -36.939 -7.492  1.00 51.34 ? 115 HOH L O   1 
HETATM 3835 O  O   . HOH J 5 .   ? 12.312  -17.282 -11.143 1.00 47.42 ? 116 HOH L O   1 
HETATM 3836 O  O   . HOH J 5 .   ? 16.687  -32.208 -12.669 1.00 41.79 ? 117 HOH L O   1 
HETATM 3837 O  O   . HOH J 5 .   ? 3.074   -23.207 10.577  1.00 49.62 ? 118 HOH L O   1 
HETATM 3838 O  O   . HOH J 5 .   ? 17.568  -31.633 -8.426  1.00 62.27 ? 119 HOH L O   1 
HETATM 3839 O  O   . HOH K 5 .   ? -47.929 -19.262 -20.747 1.00 47.81 ? 113 HOH M O   1 
HETATM 3840 O  O   . HOH K 5 .   ? -30.862 -7.204  -13.010 1.00 41.85 ? 114 HOH M O   1 
HETATM 3841 O  O   . HOH K 5 .   ? -34.979 -27.861 2.532   1.00 41.61 ? 115 HOH M O   1 
HETATM 3842 O  O   . HOH K 5 .   ? -28.807 -17.515 -13.503 1.00 40.01 ? 116 HOH M O   1 
HETATM 3843 O  O   . HOH K 5 .   ? -33.858 -11.109 4.770   1.00 45.68 ? 117 HOH M O   1 
HETATM 3844 O  O   . HOH K 5 .   ? -50.285 -11.965 0.888   1.00 49.91 ? 118 HOH M O   1 
HETATM 3845 O  O   . HOH K 5 .   ? -29.403 -14.978 -13.464 1.00 65.89 ? 119 HOH M O   1 
HETATM 3846 O  O   . HOH K 5 .   ? -28.235 -10.861 -7.062  1.00 39.13 ? 120 HOH M O   1 
HETATM 3847 O  O   . HOH K 5 .   ? -49.448 -20.895 9.122   1.00 58.51 ? 121 HOH M O   1 
HETATM 3848 O  O   . HOH K 5 .   ? -43.688 -18.738 -8.836  1.00 45.63 ? 122 HOH M O   1 
HETATM 3849 O  O   . HOH L 5 .   ? -27.629 -16.426 10.216  1.00 39.37 ? 86  HOH T O   1 
HETATM 3850 O  O   . HOH L 5 .   ? -28.710 -13.266 10.045  1.00 47.37 ? 87  HOH T O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   H . n 
A 1 2   SER 2   0   ?   ?   ?   H . n 
A 1 3   GLN 3   1   1   GLN GLN H . n 
A 1 4   VAL 4   2   2   VAL VAL H . n 
A 1 5   GLN 5   3   3   GLN GLN H . n 
A 1 6   LEU 6   4   4   LEU LEU H . n 
A 1 7   VAL 7   5   5   VAL VAL H . n 
A 1 8   GLN 8   6   6   GLN GLN H . n 
A 1 9   SER 9   7   7   SER SER H . n 
A 1 10  GLY 10  8   8   GLY GLY H . n 
A 1 11  ALA 11  9   9   ALA ALA H . n 
A 1 12  GLU 12  10  10  GLU GLU H . n 
A 1 13  VAL 13  11  11  VAL VAL H . n 
A 1 14  LYS 14  12  12  LYS LYS H . n 
A 1 15  ARG 15  13  13  ARG ARG H . n 
A 1 16  PRO 16  14  14  PRO PRO H . n 
A 1 17  GLY 17  15  15  GLY GLY H . n 
A 1 18  SER 18  16  16  SER SER H . n 
A 1 19  SER 19  17  17  SER SER H . n 
A 1 20  VAL 20  18  18  VAL VAL H . n 
A 1 21  THR 21  19  19  THR THR H . n 
A 1 22  VAL 22  20  20  VAL VAL H . n 
A 1 23  SER 23  21  21  SER SER H . n 
A 1 24  CYS 24  22  22  CYS CYS H . n 
A 1 25  LYS 25  23  23  LYS LYS H . n 
A 1 26  ALA 26  24  24  ALA ALA H . n 
A 1 27  SER 27  25  25  SER SER H . n 
A 1 28  GLY 28  26  26  GLY GLY H . n 
A 1 29  GLY 29  27  27  GLY GLY H . n 
A 1 30  SER 30  28  28  SER SER H . n 
A 1 31  PHE 31  29  29  PHE PHE H . n 
A 1 32  SER 32  30  30  SER SER H . n 
A 1 33  THR 33  31  31  THR THR H . n 
A 1 34  TYR 34  32  32  TYR TYR H . n 
A 1 35  ALA 35  33  33  ALA ALA H . n 
A 1 36  LEU 36  34  34  LEU LEU H . n 
A 1 37  SER 37  35  35  SER SER H . n 
A 1 38  TRP 38  36  36  TRP TRP H . n 
A 1 39  VAL 39  37  37  VAL VAL H . n 
A 1 40  ARG 40  38  38  ARG ARG H . n 
A 1 41  GLN 41  39  39  GLN GLN H . n 
A 1 42  ALA 42  40  40  ALA ALA H . n 
A 1 43  PRO 43  41  41  PRO PRO H . n 
A 1 44  GLY 44  42  42  GLY GLY H . n 
A 1 45  ARG 45  43  43  ARG ARG H . n 
A 1 46  GLY 46  44  44  GLY GLY H . n 
A 1 47  LEU 47  45  45  LEU LEU H . n 
A 1 48  GLU 48  46  46  GLU GLU H . n 
A 1 49  TRP 49  47  47  TRP TRP H . n 
A 1 50  MET 50  48  48  MET MET H . n 
A 1 51  GLY 51  49  49  GLY GLY H . n 
A 1 52  GLY 52  50  50  GLY GLY H . n 
A 1 53  VAL 53  51  51  VAL VAL H . n 
A 1 54  ILE 54  52  52  ILE ILE H . n 
A 1 55  PRO 55  53  53  PRO PRO H . n 
A 1 56  LEU 56  54  54  LEU LEU H . n 
A 1 57  LEU 57  55  55  LEU LEU H . n 
A 1 58  THR 58  56  56  THR THR H . n 
A 1 59  ILE 59  57  57  ILE ILE H . n 
A 1 60  THR 60  58  58  THR THR H . n 
A 1 61  ASN 61  59  59  ASN ASN H . n 
A 1 62  TYR 62  60  60  TYR TYR H . n 
A 1 63  ALA 63  61  61  ALA ALA H . n 
A 1 64  PRO 64  62  62  PRO PRO H . n 
A 1 65  ARG 65  63  63  ARG ARG H . n 
A 1 66  PHE 66  64  64  PHE PHE H . n 
A 1 67  GLN 67  65  65  GLN GLN H . n 
A 1 68  GLY 68  66  66  GLY GLY H . n 
A 1 69  ARG 69  67  67  ARG ARG H . n 
A 1 70  ILE 70  68  68  ILE ILE H . n 
A 1 71  THR 71  69  69  THR THR H . n 
A 1 72  ILE 72  70  70  ILE ILE H . n 
A 1 73  THR 73  71  71  THR THR H . n 
A 1 74  ALA 74  72  72  ALA ALA H . n 
A 1 75  ASP 75  73  73  ASP ASP H . n 
A 1 76  ARG 76  74  74  ARG ARG H . n 
A 1 77  SER 77  75  75  SER SER H . n 
A 1 78  THR 78  76  76  THR THR H . n 
A 1 79  SER 79  77  77  SER SER H . n 
A 1 80  THR 80  78  78  THR THR H . n 
A 1 81  ALA 81  79  79  ALA ALA H . n 
A 1 82  TYR 82  80  80  TYR TYR H . n 
A 1 83  LEU 83  81  81  LEU LEU H . n 
A 1 84  GLU 84  82  82  GLU GLU H . n 
A 1 85  LEU 85  83  83  LEU LEU H . n 
A 1 86  ASN 86  84  84  ASN ASN H . n 
A 1 87  SER 87  85  85  SER SER H . n 
A 1 88  LEU 88  86  86  LEU LEU H . n 
A 1 89  ARG 89  87  87  ARG ARG H . n 
A 1 90  PRO 90  88  88  PRO PRO H . n 
A 1 91  GLU 91  89  89  GLU GLU H . n 
A 1 92  ASP 92  90  90  ASP ASP H . n 
A 1 93  THR 93  91  91  THR THR H . n 
A 1 94  ALA 94  92  92  ALA ALA H . n 
A 1 95  VAL 95  93  93  VAL VAL H . n 
A 1 96  TYR 96  94  94  TYR TYR H . n 
A 1 97  TYR 97  95  95  TYR TYR H . n 
A 1 98  CYS 98  96  96  CYS CYS H . n 
A 1 99  ALA 99  97  97  ALA ALA H . n 
A 1 100 ARG 100 98  98  ARG ARG H . n 
A 1 101 GLU 101 99  99  GLU GLU H . n 
A 1 102 GLY 102 100 100 GLY GLY H . n 
A 1 103 THR 103 101 101 THR THR H . n 
A 1 104 THR 104 102 102 THR THR H . n 
A 1 105 GLY 105 103 103 GLY GLY H . n 
A 1 106 ALA 106 104 ?   ?   ?   H . n 
A 1 107 GLY 107 105 ?   ?   ?   H . n 
A 1 108 TRP 108 106 106 TRP TRP H . n 
A 1 109 LEU 109 107 107 LEU LEU H . n 
A 1 110 GLY 110 108 108 GLY GLY H . n 
A 1 111 LYS 111 109 109 LYS LYS H . n 
A 1 112 PRO 112 110 110 PRO PRO H . n 
A 1 113 ILE 113 111 111 ILE ILE H . n 
A 1 114 GLY 114 112 112 GLY GLY H . n 
A 1 115 ALA 115 113 113 ALA ALA H . n 
A 1 116 PHE 116 114 114 PHE PHE H . n 
A 1 117 ALA 117 115 115 ALA ALA H . n 
A 1 118 HIS 118 116 116 HIS HIS H . n 
A 1 119 TRP 119 117 117 TRP TRP H . n 
A 1 120 GLY 120 118 118 GLY GLY H . n 
A 1 121 GLN 121 119 119 GLN GLN H . n 
A 1 122 GLY 122 120 120 GLY GLY H . n 
A 1 123 THR 123 121 121 THR THR H . n 
A 1 124 LEU 124 122 122 LEU LEU H . n 
A 1 125 VAL 125 123 123 VAL VAL H . n 
A 1 126 THR 126 124 124 THR THR H . n 
A 1 127 VAL 127 125 125 VAL VAL H . n 
A 1 128 SER 128 126 126 SER SER H . n 
A 1 129 SER 129 127 127 SER SER H . n 
A 1 130 LEU 130 128 ?   ?   ?   H . n 
A 1 131 GLU 131 129 ?   ?   ?   H . n 
A 1 132 HIS 132 130 ?   ?   ?   H . n 
A 1 133 HIS 133 131 ?   ?   ?   H . n 
A 1 134 HIS 134 132 ?   ?   ?   H . n 
A 1 135 HIS 135 133 ?   ?   ?   H . n 
A 1 136 HIS 136 134 ?   ?   ?   H . n 
A 1 137 HIS 137 135 ?   ?   ?   H . n 
B 1 1   GLY 1   -1  ?   ?   ?   I . n 
B 1 2   SER 2   0   ?   ?   ?   I . n 
B 1 3   GLN 3   1   1   GLN GLN I . n 
B 1 4   VAL 4   2   2   VAL VAL I . n 
B 1 5   GLN 5   3   3   GLN GLN I . n 
B 1 6   LEU 6   4   4   LEU LEU I . n 
B 1 7   VAL 7   5   5   VAL VAL I . n 
B 1 8   GLN 8   6   6   GLN GLN I . n 
B 1 9   SER 9   7   7   SER SER I . n 
B 1 10  GLY 10  8   8   GLY GLY I . n 
B 1 11  ALA 11  9   9   ALA ALA I . n 
B 1 12  GLU 12  10  10  GLU GLU I . n 
B 1 13  VAL 13  11  11  VAL VAL I . n 
B 1 14  LYS 14  12  12  LYS LYS I . n 
B 1 15  ARG 15  13  13  ARG ARG I . n 
B 1 16  PRO 16  14  14  PRO PRO I . n 
B 1 17  GLY 17  15  15  GLY GLY I . n 
B 1 18  SER 18  16  16  SER SER I . n 
B 1 19  SER 19  17  17  SER SER I . n 
B 1 20  VAL 20  18  18  VAL VAL I . n 
B 1 21  THR 21  19  19  THR THR I . n 
B 1 22  VAL 22  20  20  VAL VAL I . n 
B 1 23  SER 23  21  21  SER SER I . n 
B 1 24  CYS 24  22  22  CYS CYS I . n 
B 1 25  LYS 25  23  23  LYS LYS I . n 
B 1 26  ALA 26  24  24  ALA ALA I . n 
B 1 27  SER 27  25  25  SER SER I . n 
B 1 28  GLY 28  26  26  GLY GLY I . n 
B 1 29  GLY 29  27  27  GLY GLY I . n 
B 1 30  SER 30  28  28  SER SER I . n 
B 1 31  PHE 31  29  29  PHE PHE I . n 
B 1 32  SER 32  30  30  SER SER I . n 
B 1 33  THR 33  31  31  THR THR I . n 
B 1 34  TYR 34  32  32  TYR TYR I . n 
B 1 35  ALA 35  33  33  ALA ALA I . n 
B 1 36  LEU 36  34  34  LEU LEU I . n 
B 1 37  SER 37  35  35  SER SER I . n 
B 1 38  TRP 38  36  36  TRP TRP I . n 
B 1 39  VAL 39  37  37  VAL VAL I . n 
B 1 40  ARG 40  38  38  ARG ARG I . n 
B 1 41  GLN 41  39  39  GLN GLN I . n 
B 1 42  ALA 42  40  40  ALA ALA I . n 
B 1 43  PRO 43  41  41  PRO PRO I . n 
B 1 44  GLY 44  42  42  GLY GLY I . n 
B 1 45  ARG 45  43  43  ARG ARG I . n 
B 1 46  GLY 46  44  44  GLY GLY I . n 
B 1 47  LEU 47  45  45  LEU LEU I . n 
B 1 48  GLU 48  46  46  GLU GLU I . n 
B 1 49  TRP 49  47  47  TRP TRP I . n 
B 1 50  MET 50  48  48  MET MET I . n 
B 1 51  GLY 51  49  49  GLY GLY I . n 
B 1 52  GLY 52  50  50  GLY GLY I . n 
B 1 53  VAL 53  51  51  VAL VAL I . n 
B 1 54  ILE 54  52  52  ILE ILE I . n 
B 1 55  PRO 55  53  53  PRO PRO I . n 
B 1 56  LEU 56  54  54  LEU LEU I . n 
B 1 57  LEU 57  55  55  LEU LEU I . n 
B 1 58  THR 58  56  56  THR THR I . n 
B 1 59  ILE 59  57  57  ILE ILE I . n 
B 1 60  THR 60  58  58  THR THR I . n 
B 1 61  ASN 61  59  59  ASN ASN I . n 
B 1 62  TYR 62  60  60  TYR TYR I . n 
B 1 63  ALA 63  61  61  ALA ALA I . n 
B 1 64  PRO 64  62  62  PRO PRO I . n 
B 1 65  ARG 65  63  63  ARG ARG I . n 
B 1 66  PHE 66  64  64  PHE PHE I . n 
B 1 67  GLN 67  65  65  GLN GLN I . n 
B 1 68  GLY 68  66  66  GLY GLY I . n 
B 1 69  ARG 69  67  67  ARG ARG I . n 
B 1 70  ILE 70  68  68  ILE ILE I . n 
B 1 71  THR 71  69  69  THR THR I . n 
B 1 72  ILE 72  70  70  ILE ILE I . n 
B 1 73  THR 73  71  71  THR THR I . n 
B 1 74  ALA 74  72  72  ALA ALA I . n 
B 1 75  ASP 75  73  73  ASP ASP I . n 
B 1 76  ARG 76  74  74  ARG ARG I . n 
B 1 77  SER 77  75  75  SER SER I . n 
B 1 78  THR 78  76  76  THR THR I . n 
B 1 79  SER 79  77  77  SER SER I . n 
B 1 80  THR 80  78  78  THR THR I . n 
B 1 81  ALA 81  79  79  ALA ALA I . n 
B 1 82  TYR 82  80  80  TYR TYR I . n 
B 1 83  LEU 83  81  81  LEU LEU I . n 
B 1 84  GLU 84  82  82  GLU GLU I . n 
B 1 85  LEU 85  83  83  LEU LEU I . n 
B 1 86  ASN 86  84  84  ASN ASN I . n 
B 1 87  SER 87  85  85  SER SER I . n 
B 1 88  LEU 88  86  86  LEU LEU I . n 
B 1 89  ARG 89  87  87  ARG ARG I . n 
B 1 90  PRO 90  88  88  PRO PRO I . n 
B 1 91  GLU 91  89  89  GLU GLU I . n 
B 1 92  ASP 92  90  90  ASP ASP I . n 
B 1 93  THR 93  91  91  THR THR I . n 
B 1 94  ALA 94  92  92  ALA ALA I . n 
B 1 95  VAL 95  93  93  VAL VAL I . n 
B 1 96  TYR 96  94  94  TYR TYR I . n 
B 1 97  TYR 97  95  95  TYR TYR I . n 
B 1 98  CYS 98  96  96  CYS CYS I . n 
B 1 99  ALA 99  97  97  ALA ALA I . n 
B 1 100 ARG 100 98  98  ARG ARG I . n 
B 1 101 GLU 101 99  99  GLU GLU I . n 
B 1 102 GLY 102 100 100 GLY GLY I . n 
B 1 103 THR 103 101 101 THR THR I . n 
B 1 104 THR 104 102 102 THR THR I . n 
B 1 105 GLY 105 103 103 GLY GLY I . n 
B 1 106 ALA 106 104 ?   ?   ?   I . n 
B 1 107 GLY 107 105 ?   ?   ?   I . n 
B 1 108 TRP 108 106 106 TRP TRP I . n 
B 1 109 LEU 109 107 107 LEU LEU I . n 
B 1 110 GLY 110 108 108 GLY GLY I . n 
B 1 111 LYS 111 109 109 LYS LYS I . n 
B 1 112 PRO 112 110 110 PRO PRO I . n 
B 1 113 ILE 113 111 111 ILE ILE I . n 
B 1 114 GLY 114 112 112 GLY GLY I . n 
B 1 115 ALA 115 113 113 ALA ALA I . n 
B 1 116 PHE 116 114 114 PHE PHE I . n 
B 1 117 ALA 117 115 115 ALA ALA I . n 
B 1 118 HIS 118 116 116 HIS HIS I . n 
B 1 119 TRP 119 117 117 TRP TRP I . n 
B 1 120 GLY 120 118 118 GLY GLY I . n 
B 1 121 GLN 121 119 119 GLN GLN I . n 
B 1 122 GLY 122 120 120 GLY GLY I . n 
B 1 123 THR 123 121 121 THR THR I . n 
B 1 124 LEU 124 122 122 LEU LEU I . n 
B 1 125 VAL 125 123 123 VAL VAL I . n 
B 1 126 THR 126 124 124 THR THR I . n 
B 1 127 VAL 127 125 125 VAL VAL I . n 
B 1 128 SER 128 126 126 SER SER I . n 
B 1 129 SER 129 127 127 SER SER I . n 
B 1 130 LEU 130 128 128 LEU LEU I . n 
B 1 131 GLU 131 129 ?   ?   ?   I . n 
B 1 132 HIS 132 130 ?   ?   ?   I . n 
B 1 133 HIS 133 131 ?   ?   ?   I . n 
B 1 134 HIS 134 132 ?   ?   ?   I . n 
B 1 135 HIS 135 133 ?   ?   ?   I . n 
B 1 136 HIS 136 134 ?   ?   ?   I . n 
B 1 137 HIS 137 135 ?   ?   ?   I . n 
C 2 1   MET 1   -1  ?   ?   ?   L . n 
C 2 2   ALA 2   0   ?   ?   ?   L . n 
C 2 3   GLU 3   1   1   GLU GLU L . n 
C 2 4   ILE 4   2   2   ILE ILE L . n 
C 2 5   VAL 5   3   3   VAL VAL L . n 
C 2 6   LEU 6   4   4   LEU LEU L . n 
C 2 7   THR 7   5   5   THR THR L . n 
C 2 8   GLN 8   6   6   GLN GLN L . n 
C 2 9   SER 9   7   7   SER SER L . n 
C 2 10  PRO 10  8   8   PRO PRO L . n 
C 2 11  GLY 11  9   9   GLY GLY L . n 
C 2 12  THR 12  10  10  THR THR L . n 
C 2 13  GLN 13  11  11  GLN GLN L . n 
C 2 14  SER 14  12  12  SER SER L . n 
C 2 15  LEU 15  13  13  LEU LEU L . n 
C 2 16  SER 16  14  14  SER SER L . n 
C 2 17  PRO 17  15  15  PRO PRO L . n 
C 2 18  GLY 18  16  16  GLY GLY L . n 
C 2 19  GLU 19  17  17  GLU GLU L . n 
C 2 20  ARG 20  18  18  ARG ARG L . n 
C 2 21  ALA 21  19  19  ALA ALA L . n 
C 2 22  THR 22  20  20  THR THR L . n 
C 2 23  LEU 23  21  21  LEU LEU L . n 
C 2 24  SER 24  22  22  SER SER L . n 
C 2 25  CYS 25  23  23  CYS CYS L . n 
C 2 26  ARG 26  24  24  ARG ARG L . n 
C 2 27  ALA 27  25  25  ALA ALA L . n 
C 2 28  SER 28  26  26  SER SER L . n 
C 2 29  GLN 29  27  27  GLN GLN L . n 
C 2 30  SER 30  28  28  SER SER L . n 
C 2 31  VAL 31  29  29  VAL VAL L . n 
C 2 32  GLY 32  30  30  GLY GLY L . n 
C 2 33  ASN 33  31  31  ASN ASN L . n 
C 2 34  ASN 34  32  32  ASN ASN L . n 
C 2 35  LYS 35  33  33  LYS LYS L . n 
C 2 36  LEU 36  34  34  LEU LEU L . n 
C 2 37  ALA 37  35  35  ALA ALA L . n 
C 2 38  TRP 38  36  36  TRP TRP L . n 
C 2 39  TYR 39  37  37  TYR TYR L . n 
C 2 40  GLN 40  38  38  GLN GLN L . n 
C 2 41  GLN 41  39  39  GLN GLN L . n 
C 2 42  ARG 42  40  40  ARG ARG L . n 
C 2 43  PRO 43  41  41  PRO PRO L . n 
C 2 44  GLY 44  42  42  GLY GLY L . n 
C 2 45  GLN 45  43  43  GLN GLN L . n 
C 2 46  ALA 46  44  44  ALA ALA L . n 
C 2 47  PRO 47  45  45  PRO PRO L . n 
C 2 48  ARG 48  46  46  ARG ARG L . n 
C 2 49  LEU 49  47  47  LEU LEU L . n 
C 2 50  LEU 50  48  48  LEU LEU L . n 
C 2 51  ILE 51  49  49  ILE ILE L . n 
C 2 52  TYR 52  50  50  TYR TYR L . n 
C 2 53  GLY 53  51  51  GLY GLY L . n 
C 2 54  ALA 54  52  52  ALA ALA L . n 
C 2 55  SER 55  53  53  SER SER L . n 
C 2 56  SER 56  54  54  SER SER L . n 
C 2 57  ARG 57  55  55  ARG ARG L . n 
C 2 58  PRO 58  56  56  PRO PRO L . n 
C 2 59  SER 59  57  57  SER SER L . n 
C 2 60  GLY 60  58  58  GLY GLY L . n 
C 2 61  VAL 61  59  59  VAL VAL L . n 
C 2 62  ALA 62  60  60  ALA ALA L . n 
C 2 63  ASP 63  61  61  ASP ASP L . n 
C 2 64  ARG 64  62  62  ARG ARG L . n 
C 2 65  PHE 65  63  63  PHE PHE L . n 
C 2 66  SER 66  64  64  SER SER L . n 
C 2 67  GLY 67  65  65  GLY GLY L . n 
C 2 68  SER 68  66  66  SER SER L . n 
C 2 69  GLY 69  67  67  GLY GLY L . n 
C 2 70  SER 70  68  68  SER SER L . n 
C 2 71  GLY 71  69  69  GLY GLY L . n 
C 2 72  THR 72  70  70  THR THR L . n 
C 2 73  ASP 73  71  71  ASP ASP L . n 
C 2 74  PHE 74  72  72  PHE PHE L . n 
C 2 75  THR 75  73  73  THR THR L . n 
C 2 76  LEU 76  74  74  LEU LEU L . n 
C 2 77  THR 77  75  75  THR THR L . n 
C 2 78  ILE 78  76  76  ILE ILE L . n 
C 2 79  SER 79  77  77  SER SER L . n 
C 2 80  ARG 80  78  78  ARG ARG L . n 
C 2 81  LEU 81  79  79  LEU LEU L . n 
C 2 82  GLU 82  80  80  GLU GLU L . n 
C 2 83  PRO 83  81  81  PRO PRO L . n 
C 2 84  GLU 84  82  82  GLU GLU L . n 
C 2 85  ASP 85  83  83  ASP ASP L . n 
C 2 86  PHE 86  84  84  PHE PHE L . n 
C 2 87  ALA 87  85  85  ALA ALA L . n 
C 2 88  VAL 88  86  86  VAL VAL L . n 
C 2 89  TYR 89  87  87  TYR TYR L . n 
C 2 90  TYR 90  88  88  TYR TYR L . n 
C 2 91  CYS 91  89  89  CYS CYS L . n 
C 2 92  GLN 92  90  90  GLN GLN L . n 
C 2 93  GLN 93  91  91  GLN GLN L . n 
C 2 94  TYR 94  92  92  TYR TYR L . n 
C 2 95  GLY 95  93  93  GLY GLY L . n 
C 2 96  GLN 96  94  94  GLN GLN L . n 
C 2 97  SER 97  95  95  SER SER L . n 
C 2 98  LEU 98  96  96  LEU LEU L . n 
C 2 99  SER 99  97  97  SER SER L . n 
C 2 100 THR 100 98  98  THR THR L . n 
C 2 101 PHE 101 99  99  PHE PHE L . n 
C 2 102 GLY 102 100 100 GLY GLY L . n 
C 2 103 GLN 103 101 101 GLN GLN L . n 
C 2 104 GLY 104 102 102 GLY GLY L . n 
C 2 105 THR 105 103 103 THR THR L . n 
C 2 106 LYS 106 104 104 LYS LYS L . n 
C 2 107 VAL 107 105 105 VAL VAL L . n 
C 2 108 GLU 108 106 106 GLU GLU L . n 
C 2 109 VAL 109 107 107 VAL VAL L . n 
C 2 110 LYS 110 108 108 LYS LYS L . n 
C 2 111 LEU 111 109 109 LEU LEU L . n 
C 2 112 VAL 112 110 ?   ?   ?   L . n 
C 2 113 PRO 113 111 ?   ?   ?   L . n 
C 2 114 ARG 114 112 ?   ?   ?   L . n 
D 2 1   MET 1   -1  ?   ?   ?   M . n 
D 2 2   ALA 2   0   ?   ?   ?   M . n 
D 2 3   GLU 3   1   1   GLU GLU M . n 
D 2 4   ILE 4   2   2   ILE ILE M . n 
D 2 5   VAL 5   3   3   VAL VAL M . n 
D 2 6   LEU 6   4   4   LEU LEU M . n 
D 2 7   THR 7   5   5   THR THR M . n 
D 2 8   GLN 8   6   6   GLN GLN M . n 
D 2 9   SER 9   7   7   SER SER M . n 
D 2 10  PRO 10  8   8   PRO PRO M . n 
D 2 11  GLY 11  9   9   GLY GLY M . n 
D 2 12  THR 12  10  10  THR THR M . n 
D 2 13  GLN 13  11  11  GLN GLN M . n 
D 2 14  SER 14  12  12  SER SER M . n 
D 2 15  LEU 15  13  13  LEU LEU M . n 
D 2 16  SER 16  14  14  SER SER M . n 
D 2 17  PRO 17  15  15  PRO PRO M . n 
D 2 18  GLY 18  16  16  GLY GLY M . n 
D 2 19  GLU 19  17  17  GLU GLU M . n 
D 2 20  ARG 20  18  18  ARG ARG M . n 
D 2 21  ALA 21  19  19  ALA ALA M . n 
D 2 22  THR 22  20  20  THR THR M . n 
D 2 23  LEU 23  21  21  LEU LEU M . n 
D 2 24  SER 24  22  22  SER SER M . n 
D 2 25  CYS 25  23  23  CYS CYS M . n 
D 2 26  ARG 26  24  24  ARG ARG M . n 
D 2 27  ALA 27  25  25  ALA ALA M . n 
D 2 28  SER 28  26  26  SER SER M . n 
D 2 29  GLN 29  27  27  GLN GLN M . n 
D 2 30  SER 30  28  28  SER SER M . n 
D 2 31  VAL 31  29  29  VAL VAL M . n 
D 2 32  GLY 32  30  30  GLY GLY M . n 
D 2 33  ASN 33  31  31  ASN ASN M . n 
D 2 34  ASN 34  32  32  ASN ASN M . n 
D 2 35  LYS 35  33  33  LYS LYS M . n 
D 2 36  LEU 36  34  34  LEU LEU M . n 
D 2 37  ALA 37  35  35  ALA ALA M . n 
D 2 38  TRP 38  36  36  TRP TRP M . n 
D 2 39  TYR 39  37  37  TYR TYR M . n 
D 2 40  GLN 40  38  38  GLN GLN M . n 
D 2 41  GLN 41  39  39  GLN GLN M . n 
D 2 42  ARG 42  40  40  ARG ARG M . n 
D 2 43  PRO 43  41  41  PRO PRO M . n 
D 2 44  GLY 44  42  42  GLY GLY M . n 
D 2 45  GLN 45  43  43  GLN GLN M . n 
D 2 46  ALA 46  44  44  ALA ALA M . n 
D 2 47  PRO 47  45  45  PRO PRO M . n 
D 2 48  ARG 48  46  46  ARG ARG M . n 
D 2 49  LEU 49  47  47  LEU LEU M . n 
D 2 50  LEU 50  48  48  LEU LEU M . n 
D 2 51  ILE 51  49  49  ILE ILE M . n 
D 2 52  TYR 52  50  50  TYR TYR M . n 
D 2 53  GLY 53  51  51  GLY GLY M . n 
D 2 54  ALA 54  52  52  ALA ALA M . n 
D 2 55  SER 55  53  53  SER SER M . n 
D 2 56  SER 56  54  54  SER SER M . n 
D 2 57  ARG 57  55  55  ARG ARG M . n 
D 2 58  PRO 58  56  56  PRO PRO M . n 
D 2 59  SER 59  57  57  SER SER M . n 
D 2 60  GLY 60  58  58  GLY GLY M . n 
D 2 61  VAL 61  59  59  VAL VAL M . n 
D 2 62  ALA 62  60  60  ALA ALA M . n 
D 2 63  ASP 63  61  61  ASP ASP M . n 
D 2 64  ARG 64  62  62  ARG ARG M . n 
D 2 65  PHE 65  63  63  PHE PHE M . n 
D 2 66  SER 66  64  64  SER SER M . n 
D 2 67  GLY 67  65  65  GLY GLY M . n 
D 2 68  SER 68  66  66  SER SER M . n 
D 2 69  GLY 69  67  67  GLY GLY M . n 
D 2 70  SER 70  68  68  SER SER M . n 
D 2 71  GLY 71  69  69  GLY GLY M . n 
D 2 72  THR 72  70  70  THR THR M . n 
D 2 73  ASP 73  71  71  ASP ASP M . n 
D 2 74  PHE 74  72  72  PHE PHE M . n 
D 2 75  THR 75  73  73  THR THR M . n 
D 2 76  LEU 76  74  74  LEU LEU M . n 
D 2 77  THR 77  75  75  THR THR M . n 
D 2 78  ILE 78  76  76  ILE ILE M . n 
D 2 79  SER 79  77  77  SER SER M . n 
D 2 80  ARG 80  78  78  ARG ARG M . n 
D 2 81  LEU 81  79  79  LEU LEU M . n 
D 2 82  GLU 82  80  80  GLU GLU M . n 
D 2 83  PRO 83  81  81  PRO PRO M . n 
D 2 84  GLU 84  82  82  GLU GLU M . n 
D 2 85  ASP 85  83  83  ASP ASP M . n 
D 2 86  PHE 86  84  84  PHE PHE M . n 
D 2 87  ALA 87  85  85  ALA ALA M . n 
D 2 88  VAL 88  86  86  VAL VAL M . n 
D 2 89  TYR 89  87  87  TYR TYR M . n 
D 2 90  TYR 90  88  88  TYR TYR M . n 
D 2 91  CYS 91  89  89  CYS CYS M . n 
D 2 92  GLN 92  90  90  GLN GLN M . n 
D 2 93  GLN 93  91  91  GLN GLN M . n 
D 2 94  TYR 94  92  92  TYR TYR M . n 
D 2 95  GLY 95  93  93  GLY GLY M . n 
D 2 96  GLN 96  94  94  GLN GLN M . n 
D 2 97  SER 97  95  95  SER SER M . n 
D 2 98  LEU 98  96  96  LEU LEU M . n 
D 2 99  SER 99  97  97  SER SER M . n 
D 2 100 THR 100 98  98  THR THR M . n 
D 2 101 PHE 101 99  99  PHE PHE M . n 
D 2 102 GLY 102 100 100 GLY GLY M . n 
D 2 103 GLN 103 101 101 GLN GLN M . n 
D 2 104 GLY 104 102 102 GLY GLY M . n 
D 2 105 THR 105 103 103 THR THR M . n 
D 2 106 LYS 106 104 104 LYS LYS M . n 
D 2 107 VAL 107 105 105 VAL VAL M . n 
D 2 108 GLU 108 106 106 GLU GLU M . n 
D 2 109 VAL 109 107 107 VAL VAL M . n 
D 2 110 LYS 110 108 108 LYS LYS M . n 
D 2 111 LEU 111 109 109 LEU LEU M . n 
D 2 112 VAL 112 110 110 VAL VAL M . n 
D 2 113 PRO 113 111 111 PRO PRO M . n 
D 2 114 ARG 114 112 ?   ?   ?   M . n 
E 3 1   HIS 1   1   ?   ?   ?   S . n 
E 3 2   HIS 2   2   ?   ?   ?   S . n 
E 3 3   HIS 3   3   ?   ?   ?   S . n 
E 3 4   HIS 4   4   ?   ?   ?   S . n 
E 3 5   HIS 5   5   ?   ?   ?   S . n 
E 3 6   HIS 6   6   ?   ?   ?   S . n 
E 3 7   THR 7   7   ?   ?   ?   S . n 
E 3 8   ASN 8   8   ?   ?   ?   S . n 
E 3 9   GLU 9   9   ?   ?   ?   S . n 
E 3 10  ALA 10  10  ?   ?   ?   S . n 
E 3 11  TYR 11  11  ?   ?   ?   S . n 
E 3 12  LEU 12  12  ?   ?   ?   S . n 
E 3 13  ALA 13  13  ?   ?   ?   S . n 
E 3 14  HIS 14  14  ?   ?   ?   S . n 
E 3 15  GLU 15  15  ?   ?   ?   S . n 
E 3 16  ARG 16  16  ?   ?   ?   S . n 
E 3 17  ARG 17  17  ?   ?   ?   S . n 
E 3 18  GLU 18  18  ?   ?   ?   S . n 
E 3 19  LEU 19  19  ?   ?   ?   S . n 
E 3 20  GLU 20  20  ?   ?   ?   S . n 
E 3 21  ALA 21  21  ?   ?   ?   S . n 
E 3 22  LYS 22  22  ?   ?   ?   S . n 
E 3 23  ARG 23  23  ?   ?   ?   S . n 
E 3 24  ASN 24  24  ?   ?   ?   S . n 
E 3 25  GLN 25  25  ?   ?   ?   S . n 
E 3 26  LEU 26  26  ?   ?   ?   S . n 
E 3 27  ARG 27  27  ?   ?   ?   S . n 
E 3 28  ASP 28  28  ?   ?   ?   S . n 
E 3 29  GLU 29  29  ?   ?   ?   S . n 
E 3 30  VAL 30  30  ?   ?   ?   S . n 
E 3 31  ASP 31  31  ?   ?   ?   S . n 
E 3 32  ARG 32  32  ?   ?   ?   S . n 
E 3 33  THR 33  33  ?   ?   ?   S . n 
E 3 34  LYS 34  34  ?   ?   ?   S . n 
E 3 35  THR 35  35  ?   ?   ?   S . n 
E 3 36  HIS 36  36  ?   ?   ?   S . n 
E 3 37  MET 37  37  ?   ?   ?   S . n 
E 3 38  GLN 38  38  ?   ?   ?   S . n 
E 3 39  ASP 39  39  ?   ?   ?   S . n 
E 3 40  GLU 40  40  ?   ?   ?   S . n 
E 3 41  ALA 41  41  ?   ?   ?   S . n 
E 3 42  ALA 42  42  ?   ?   ?   S . n 
E 3 43  ASN 43  43  ?   ?   ?   S . n 
E 3 44  ASP 44  44  44  ASP ASP S . n 
E 3 45  PRO 45  45  45  PRO PRO S . n 
E 3 46  ASN 46  46  46  ASN ASN S . n 
E 3 47  TRP 47  47  47  TRP TRP S . n 
E 3 48  PHE 48  48  48  PHE PHE S . n 
E 3 49  ASP 49  49  49  ASP ASP S . n 
E 3 50  ILE 50  50  50  ILE ILE S . n 
E 3 51  THR 51  51  51  THR THR S . n 
E 3 52  ALA 52  52  52  ALA ALA S . n 
E 3 53  GLN 53  53  53  GLN GLN S . n 
E 3 54  LEU 54  54  54  LEU LEU S . n 
E 3 55  TRP 55  55  55  TRP TRP S . n 
E 3 56  GLU 56  56  56  GLU GLU S . n 
E 3 57  PHE 57  57  57  PHE PHE S . n 
E 3 58  SER 58  58  58  SER SER S . n 
E 3 59  GLN 59  59  59  GLN GLN S . n 
E 3 60  GLU 60  60  60  GLU GLU S . n 
E 3 61  LEU 61  61  61  LEU LEU S . n 
E 3 62  ARG 62  62  ?   ?   ?   S . n 
E 3 63  ASN 63  63  ?   ?   ?   S . n 
E 3 64  ARG 64  64  ?   ?   ?   S . n 
E 3 65  ASP 65  65  ?   ?   ?   S . n 
E 3 66  ARG 66  66  ?   ?   ?   S . n 
E 3 67  GLU 67  67  ?   ?   ?   S . n 
E 3 68  GLU 68  68  ?   ?   ?   S . n 
E 3 69  LYS 69  69  ?   ?   ?   S . n 
E 3 70  LEU 70  70  ?   ?   ?   S . n 
E 3 71  ILE 71  71  ?   ?   ?   S . n 
E 3 72  LYS 72  72  ?   ?   ?   S . n 
E 3 73  LYS 73  73  ?   ?   ?   S . n 
E 3 74  ILE 74  74  ?   ?   ?   S . n 
E 3 75  GLU 75  75  ?   ?   ?   S . n 
E 3 76  GLN 76  76  ?   ?   ?   S . n 
E 3 77  THR 77  77  ?   ?   ?   S . n 
E 3 78  LEU 78  78  ?   ?   ?   S . n 
E 3 79  LYS 79  79  ?   ?   ?   S . n 
E 3 80  LYS 80  80  ?   ?   ?   S . n 
E 3 81  VAL 81  81  ?   ?   ?   S . n 
E 3 82  GLU 82  82  ?   ?   ?   S . n 
E 3 83  ASN 83  83  ?   ?   ?   S . n 
E 3 84  GLU 84  84  ?   ?   ?   S . n 
E 3 85  ASP 85  85  ?   ?   ?   S . n 
F 3 1   HIS 1   1   ?   ?   ?   T . n 
F 3 2   HIS 2   2   ?   ?   ?   T . n 
F 3 3   HIS 3   3   ?   ?   ?   T . n 
F 3 4   HIS 4   4   ?   ?   ?   T . n 
F 3 5   HIS 5   5   ?   ?   ?   T . n 
F 3 6   HIS 6   6   ?   ?   ?   T . n 
F 3 7   THR 7   7   ?   ?   ?   T . n 
F 3 8   ASN 8   8   ?   ?   ?   T . n 
F 3 9   GLU 9   9   ?   ?   ?   T . n 
F 3 10  ALA 10  10  ?   ?   ?   T . n 
F 3 11  TYR 11  11  ?   ?   ?   T . n 
F 3 12  LEU 12  12  ?   ?   ?   T . n 
F 3 13  ALA 13  13  ?   ?   ?   T . n 
F 3 14  HIS 14  14  ?   ?   ?   T . n 
F 3 15  GLU 15  15  ?   ?   ?   T . n 
F 3 16  ARG 16  16  ?   ?   ?   T . n 
F 3 17  ARG 17  17  ?   ?   ?   T . n 
F 3 18  GLU 18  18  ?   ?   ?   T . n 
F 3 19  LEU 19  19  ?   ?   ?   T . n 
F 3 20  GLU 20  20  ?   ?   ?   T . n 
F 3 21  ALA 21  21  ?   ?   ?   T . n 
F 3 22  LYS 22  22  ?   ?   ?   T . n 
F 3 23  ARG 23  23  ?   ?   ?   T . n 
F 3 24  ASN 24  24  ?   ?   ?   T . n 
F 3 25  GLN 25  25  ?   ?   ?   T . n 
F 3 26  LEU 26  26  ?   ?   ?   T . n 
F 3 27  ARG 27  27  ?   ?   ?   T . n 
F 3 28  ASP 28  28  ?   ?   ?   T . n 
F 3 29  GLU 29  29  ?   ?   ?   T . n 
F 3 30  VAL 30  30  ?   ?   ?   T . n 
F 3 31  ASP 31  31  ?   ?   ?   T . n 
F 3 32  ARG 32  32  ?   ?   ?   T . n 
F 3 33  THR 33  33  ?   ?   ?   T . n 
F 3 34  LYS 34  34  ?   ?   ?   T . n 
F 3 35  THR 35  35  ?   ?   ?   T . n 
F 3 36  HIS 36  36  ?   ?   ?   T . n 
F 3 37  MET 37  37  ?   ?   ?   T . n 
F 3 38  GLN 38  38  ?   ?   ?   T . n 
F 3 39  ASP 39  39  ?   ?   ?   T . n 
F 3 40  GLU 40  40  ?   ?   ?   T . n 
F 3 41  ALA 41  41  ?   ?   ?   T . n 
F 3 42  ALA 42  42  ?   ?   ?   T . n 
F 3 43  ASN 43  43  ?   ?   ?   T . n 
F 3 44  ASP 44  44  44  ASP ASP T . n 
F 3 45  PRO 45  45  45  PRO PRO T . n 
F 3 46  ASN 46  46  46  ASN ASN T . n 
F 3 47  TRP 47  47  47  TRP TRP T . n 
F 3 48  PHE 48  48  48  PHE PHE T . n 
F 3 49  ASP 49  49  49  ASP ASP T . n 
F 3 50  ILE 50  50  50  ILE ILE T . n 
F 3 51  THR 51  51  51  THR THR T . n 
F 3 52  ALA 52  52  52  ALA ALA T . n 
F 3 53  GLN 53  53  53  GLN GLN T . n 
F 3 54  LEU 54  54  54  LEU LEU T . n 
F 3 55  TRP 55  55  55  TRP TRP T . n 
F 3 56  GLU 56  56  56  GLU GLU T . n 
F 3 57  PHE 57  57  57  PHE PHE T . n 
F 3 58  SER 58  58  58  SER SER T . n 
F 3 59  GLN 59  59  59  GLN GLN T . n 
F 3 60  GLU 60  60  60  GLU GLU T . n 
F 3 61  LEU 61  61  61  LEU LEU T . n 
F 3 62  ARG 62  62  62  ARG ARG T . n 
F 3 63  ASN 63  63  63  ASN ASN T . n 
F 3 64  ARG 64  64  64  ARG ARG T . n 
F 3 65  ASP 65  65  ?   ?   ?   T . n 
F 3 66  ARG 66  66  ?   ?   ?   T . n 
F 3 67  GLU 67  67  ?   ?   ?   T . n 
F 3 68  GLU 68  68  ?   ?   ?   T . n 
F 3 69  LYS 69  69  ?   ?   ?   T . n 
F 3 70  LEU 70  70  ?   ?   ?   T . n 
F 3 71  ILE 71  71  ?   ?   ?   T . n 
F 3 72  LYS 72  72  ?   ?   ?   T . n 
F 3 73  LYS 73  73  ?   ?   ?   T . n 
F 3 74  ILE 74  74  ?   ?   ?   T . n 
F 3 75  GLU 75  75  ?   ?   ?   T . n 
F 3 76  GLN 76  76  ?   ?   ?   T . n 
F 3 77  THR 77  77  ?   ?   ?   T . n 
F 3 78  LEU 78  78  ?   ?   ?   T . n 
F 3 79  LYS 79  79  ?   ?   ?   T . n 
F 3 80  LYS 80  80  ?   ?   ?   T . n 
F 3 81  VAL 81  81  ?   ?   ?   T . n 
F 3 82  GLU 82  82  ?   ?   ?   T . n 
F 3 83  ASN 83  83  ?   ?   ?   T . n 
F 3 84  GLU 84  84  ?   ?   ?   T . n 
F 3 85  ASP 85  85  ?   ?   ?   T . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_defined_assembly              ?    trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,H,J 
2 1 B,D,F,I,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2960  ? 
1 MORE         -30   ? 
1 'SSA (A^2)'  11270 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 OE2 ? A GLU 12 ? H GLU 10  ? 1_555 44.0  ? 
2  OE1 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? A THR 21 ? H THR 19  ? 1_555 83.5  ? 
3  OE2 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? A THR 21 ? H THR 19  ? 1_555 104.4 ? 
4  OE1 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? H HOH .  ? H HOH 149 ? 1_555 87.7  ? 
5  OE2 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? H HOH .  ? H HOH 149 ? 1_555 53.3  ? 
6  O   ? A THR 21 ? H THR 19  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? H HOH .  ? H HOH 149 ? 1_555 83.4  ? 
7  OE1 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? I HOH .  ? I HOH 150 ? 1_555 108.9 ? 
8  OE2 ? A GLU 12 ? H GLU 10  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? I HOH .  ? I HOH 150 ? 1_555 152.3 ? 
9  O   ? A THR 21 ? H THR 19  ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? I HOH .  ? I HOH 150 ? 1_555 72.5  ? 
10 O   ? H HOH .  ? H HOH 149 ? 1_555 CA ? G CA . ? H CA 136 ? 1_555 O   ? I HOH .  ? I HOH 150 ? 1_555 148.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-01-19 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -0.6710  -31.8160 -7.3130  0.1356 0.2484 0.2433 -0.0056 0.0252  -0.0371 2.9008  2.7051  2.6335  -0.6475 -0.4224 
-0.6816 0.0018  -0.0901 0.0068  -0.0373 -0.0273 -0.1044 -0.1325 -0.0373 0.0255  'X-RAY DIFFRACTION' 
2 ? refined -22.5110 -26.6910 0.6100   0.1880 0.2652 0.2375 0.0153  0.0493  -0.0103 1.5029  1.1644  2.4825  -0.4690 -0.2614 0.4637 
0.0454  0.0368  -0.0485 0.1124  0.0231  0.0301  0.0415  0.1441  -0.0685 'X-RAY DIFFRACTION' 
3 ? refined 12.9950  -19.1060 3.0310   0.2091 0.2694 0.3864 -0.0998 -0.0623 -0.0991 3.6770  2.9619  3.9887  -0.1961 -0.3938 0.6387 
0.0206  -0.4349 0.7887  0.1892  -0.0014 -0.3158 -0.7754 0.1466  -0.0192 'X-RAY DIFFRACTION' 
4 ? refined -39.4860 -15.8260 -8.0780  0.1771 0.2183 0.2971 0.0619  0.0279  -0.0081 1.9202  1.8813  5.8854  -0.0392 -0.3695 
-0.7866 -0.0251 0.0755  0.1291  -0.3485 0.0589  0.0901  -0.4447 -0.1940 -0.0338 'X-RAY DIFFRACTION' 
5 ? refined 8.1910   -21.0500 -21.2500 0.1934 0.1835 0.2983 -0.0067 -0.0205 0.0445  3.2248  8.4697  11.0078 -1.6878 0.5823  
-3.9847 0.2391  0.3977  0.3967  -0.6586 -0.3620 -0.7414 -0.4920 1.0290  0.1229  'X-RAY DIFFRACTION' 
6 ? refined -22.8770 -8.8270  14.7470  0.2859 0.2150 0.3070 -0.0694 0.0693  -0.0454 13.8872 14.2740 9.4377  12.3125 5.2658  1.1649 
0.0171  -0.5361 1.1203  0.6698  -0.4917 0.2708  -1.3708 0.3098  0.4746  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 H 1  ? ? H 127 ? ? ? ? 'X-RAY DIFFRACTION' 
2 2 I 1  ? ? I 128 ? ? ? ? 'X-RAY DIFFRACTION' 
3 3 L 1  ? ? L 109 ? ? ? ? 'X-RAY DIFFRACTION' 
4 4 M 1  ? ? M 111 ? ? ? ? 'X-RAY DIFFRACTION' 
5 5 S 44 ? ? S 61  ? ? ? ? 'X-RAY DIFFRACTION' 
6 6 T 44 ? ? T 64  ? ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' .        ? 1 
PHASER       phasing           .        ? 2 
REFMAC       refinement        5.2.0019 ? 3 
d*TREK       'data reduction'  .        ? 4 
d*TREK       'data scaling'    .        ? 5 
# 
_pdbx_entry_details.sequence_details     
;FV HEAVY CHAIN CONTAINS A REMNANT OF SINGLE-CHAIN LINKER AT N-TERMINUS GS. FV LIGHT CHAIN CONTAINS A REMNANT OF SINGLE-CHAIN LINKER AT C-TERMINUS KLVPR. FV HEAVY CHAIN HAS BEEN MUTATED TO ALA AT POSITION 104 (KABAT POSITION 100)
;
_pdbx_entry_details.entry_id             3H3P 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA L 52 ? ? 84.05 -46.71 
2 1 ALA M 52 ? ? 78.14 -49.57 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 H ARG 13  ? NE  ? A ARG 15  NE  
2   1 Y 1 H ARG 13  ? CZ  ? A ARG 15  CZ  
3   1 Y 1 H ARG 13  ? NH1 ? A ARG 15  NH1 
4   1 Y 1 H ARG 13  ? NH2 ? A ARG 15  NH2 
5   1 Y 1 H SER 28  ? OG  ? A SER 30  OG  
6   1 Y 1 H GLU 46  ? CG  ? A GLU 48  CG  
7   1 Y 1 H GLU 46  ? CD  ? A GLU 48  CD  
8   1 Y 1 H GLU 46  ? OE1 ? A GLU 48  OE1 
9   1 Y 1 H GLU 46  ? OE2 ? A GLU 48  OE2 
10  1 Y 1 H TRP 106 ? CG  ? A TRP 108 CG  
11  1 Y 1 H TRP 106 ? CD1 ? A TRP 108 CD1 
12  1 Y 1 H TRP 106 ? CD2 ? A TRP 108 CD2 
13  1 Y 1 H TRP 106 ? NE1 ? A TRP 108 NE1 
14  1 Y 1 H TRP 106 ? CE2 ? A TRP 108 CE2 
15  1 Y 1 H TRP 106 ? CE3 ? A TRP 108 CE3 
16  1 Y 1 H TRP 106 ? CZ2 ? A TRP 108 CZ2 
17  1 Y 1 H TRP 106 ? CZ3 ? A TRP 108 CZ3 
18  1 Y 1 H TRP 106 ? CH2 ? A TRP 108 CH2 
19  1 Y 1 H LEU 107 ? CG  ? A LEU 109 CG  
20  1 Y 1 H LEU 107 ? CD1 ? A LEU 109 CD1 
21  1 Y 1 H LEU 107 ? CD2 ? A LEU 109 CD2 
22  1 Y 1 I GLN 1   ? CG  ? B GLN 3   CG  
23  1 Y 1 I GLN 1   ? CD  ? B GLN 3   CD  
24  1 Y 1 I GLN 1   ? OE1 ? B GLN 3   OE1 
25  1 Y 1 I GLN 1   ? NE2 ? B GLN 3   NE2 
26  1 Y 1 I GLN 3   ? CG  ? B GLN 5   CG  
27  1 Y 1 I GLN 3   ? CD  ? B GLN 5   CD  
28  1 Y 1 I GLN 3   ? OE1 ? B GLN 5   OE1 
29  1 Y 1 I GLN 3   ? NE2 ? B GLN 5   NE2 
30  1 Y 1 I ARG 13  ? CZ  ? B ARG 15  CZ  
31  1 Y 1 I ARG 13  ? NH1 ? B ARG 15  NH1 
32  1 Y 1 I ARG 13  ? NH2 ? B ARG 15  NH2 
33  1 Y 1 I SER 25  ? OG  ? B SER 27  OG  
34  1 Y 1 I ARG 43  ? NE  ? B ARG 45  NE  
35  1 Y 1 I ARG 43  ? CZ  ? B ARG 45  CZ  
36  1 Y 1 I ARG 43  ? NH1 ? B ARG 45  NH1 
37  1 Y 1 I ARG 43  ? NH2 ? B ARG 45  NH2 
38  1 Y 1 I ARG 63  ? CZ  ? B ARG 65  CZ  
39  1 Y 1 I ARG 63  ? NH1 ? B ARG 65  NH1 
40  1 Y 1 I ARG 63  ? NH2 ? B ARG 65  NH2 
41  1 Y 1 I TRP 106 ? CG  ? B TRP 108 CG  
42  1 Y 1 I TRP 106 ? CD1 ? B TRP 108 CD1 
43  1 Y 1 I TRP 106 ? CD2 ? B TRP 108 CD2 
44  1 Y 1 I TRP 106 ? NE1 ? B TRP 108 NE1 
45  1 Y 1 I TRP 106 ? CE2 ? B TRP 108 CE2 
46  1 Y 1 I TRP 106 ? CE3 ? B TRP 108 CE3 
47  1 Y 1 I TRP 106 ? CZ2 ? B TRP 108 CZ2 
48  1 Y 1 I TRP 106 ? CZ3 ? B TRP 108 CZ3 
49  1 Y 1 I TRP 106 ? CH2 ? B TRP 108 CH2 
50  1 Y 1 I LEU 107 ? CD1 ? B LEU 109 CD1 
51  1 Y 1 I LEU 107 ? CD2 ? B LEU 109 CD2 
52  1 Y 1 I GLN 119 ? CG  ? B GLN 121 CG  
53  1 Y 1 I GLN 119 ? CD  ? B GLN 121 CD  
54  1 Y 1 I GLN 119 ? OE1 ? B GLN 121 OE1 
55  1 Y 1 I GLN 119 ? NE2 ? B GLN 121 NE2 
56  1 Y 1 I SER 127 ? OG  ? B SER 129 OG  
57  1 Y 1 I LEU 128 ? CG  ? B LEU 130 CG  
58  1 Y 1 I LEU 128 ? CD1 ? B LEU 130 CD1 
59  1 Y 1 I LEU 128 ? CD2 ? B LEU 130 CD2 
60  1 Y 1 L ARG 78  ? CG  ? C ARG 80  CG  
61  1 Y 1 L ARG 78  ? CD  ? C ARG 80  CD  
62  1 Y 1 L ARG 78  ? NE  ? C ARG 80  NE  
63  1 Y 1 L ARG 78  ? CZ  ? C ARG 80  CZ  
64  1 Y 1 L ARG 78  ? NH1 ? C ARG 80  NH1 
65  1 Y 1 L ARG 78  ? NH2 ? C ARG 80  NH2 
66  1 Y 1 L GLU 82  ? CG  ? C GLU 84  CG  
67  1 Y 1 L GLU 82  ? CD  ? C GLU 84  CD  
68  1 Y 1 L GLU 82  ? OE1 ? C GLU 84  OE1 
69  1 Y 1 L GLU 82  ? OE2 ? C GLU 84  OE2 
70  1 Y 1 L LYS 104 ? CG  ? C LYS 106 CG  
71  1 Y 1 L LYS 104 ? CD  ? C LYS 106 CD  
72  1 Y 1 L LYS 104 ? CE  ? C LYS 106 CE  
73  1 Y 1 L LYS 104 ? NZ  ? C LYS 106 NZ  
74  1 Y 1 L LYS 108 ? CG  ? C LYS 110 CG  
75  1 Y 1 L LYS 108 ? CD  ? C LYS 110 CD  
76  1 Y 1 L LYS 108 ? CE  ? C LYS 110 CE  
77  1 Y 1 L LYS 108 ? NZ  ? C LYS 110 NZ  
78  1 Y 1 M ARG 24  ? NE  ? D ARG 26  NE  
79  1 Y 1 M ARG 24  ? CZ  ? D ARG 26  CZ  
80  1 Y 1 M ARG 24  ? NH1 ? D ARG 26  NH1 
81  1 Y 1 M ARG 24  ? NH2 ? D ARG 26  NH2 
82  1 Y 1 M ASP 71  ? OD1 ? D ASP 73  OD1 
83  1 Y 1 M ASP 71  ? OD2 ? D ASP 73  OD2 
84  1 Y 1 M ARG 78  ? CG  ? D ARG 80  CG  
85  1 Y 1 M ARG 78  ? CD  ? D ARG 80  CD  
86  1 Y 1 M ARG 78  ? NE  ? D ARG 80  NE  
87  1 Y 1 M ARG 78  ? CZ  ? D ARG 80  CZ  
88  1 Y 1 M ARG 78  ? NH1 ? D ARG 80  NH1 
89  1 Y 1 M ARG 78  ? NH2 ? D ARG 80  NH2 
90  1 Y 1 M GLU 106 ? CD  ? D GLU 108 CD  
91  1 Y 1 M GLU 106 ? OE1 ? D GLU 108 OE1 
92  1 Y 1 M GLU 106 ? OE2 ? D GLU 108 OE2 
93  1 Y 1 S GLU 56  ? OE1 ? E GLU 56  OE1 
94  1 Y 1 S GLU 56  ? OE2 ? E GLU 56  OE2 
95  1 Y 1 S GLU 60  ? CG  ? E GLU 60  CG  
96  1 Y 1 S GLU 60  ? CD  ? E GLU 60  CD  
97  1 Y 1 S GLU 60  ? OE1 ? E GLU 60  OE1 
98  1 Y 1 S GLU 60  ? OE2 ? E GLU 60  OE2 
99  1 Y 1 S LEU 61  ? CG  ? E LEU 61  CG  
100 1 Y 1 S LEU 61  ? CD1 ? E LEU 61  CD1 
101 1 Y 1 S LEU 61  ? CD2 ? E LEU 61  CD2 
102 1 Y 1 T ASP 44  ? CG  ? F ASP 44  CG  
103 1 Y 1 T ASP 44  ? OD1 ? F ASP 44  OD1 
104 1 Y 1 T ASP 44  ? OD2 ? F ASP 44  OD2 
105 1 Y 1 T ARG 64  ? CG  ? F ARG 64  CG  
106 1 Y 1 T ARG 64  ? CD  ? F ARG 64  CD  
107 1 Y 1 T ARG 64  ? NE  ? F ARG 64  NE  
108 1 Y 1 T ARG 64  ? CZ  ? F ARG 64  CZ  
109 1 Y 1 T ARG 64  ? NH1 ? F ARG 64  NH1 
110 1 Y 1 T ARG 64  ? NH2 ? F ARG 64  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 H GLY -1  ? A GLY 1   
2   1 Y 1 H SER 0   ? A SER 2   
3   1 Y 1 H ALA 104 ? A ALA 106 
4   1 Y 1 H GLY 105 ? A GLY 107 
5   1 Y 1 H LEU 128 ? A LEU 130 
6   1 Y 1 H GLU 129 ? A GLU 131 
7   1 Y 1 H HIS 130 ? A HIS 132 
8   1 Y 1 H HIS 131 ? A HIS 133 
9   1 Y 1 H HIS 132 ? A HIS 134 
10  1 Y 1 H HIS 133 ? A HIS 135 
11  1 Y 1 H HIS 134 ? A HIS 136 
12  1 Y 1 H HIS 135 ? A HIS 137 
13  1 Y 1 I GLY -1  ? B GLY 1   
14  1 Y 1 I SER 0   ? B SER 2   
15  1 Y 1 I ALA 104 ? B ALA 106 
16  1 Y 1 I GLY 105 ? B GLY 107 
17  1 Y 1 I GLU 129 ? B GLU 131 
18  1 Y 1 I HIS 130 ? B HIS 132 
19  1 Y 1 I HIS 131 ? B HIS 133 
20  1 Y 1 I HIS 132 ? B HIS 134 
21  1 Y 1 I HIS 133 ? B HIS 135 
22  1 Y 1 I HIS 134 ? B HIS 136 
23  1 Y 1 I HIS 135 ? B HIS 137 
24  1 Y 1 L MET -1  ? C MET 1   
25  1 Y 1 L ALA 0   ? C ALA 2   
26  1 Y 1 L VAL 110 ? C VAL 112 
27  1 Y 1 L PRO 111 ? C PRO 113 
28  1 Y 1 L ARG 112 ? C ARG 114 
29  1 Y 1 M MET -1  ? D MET 1   
30  1 Y 1 M ALA 0   ? D ALA 2   
31  1 Y 1 M ARG 112 ? D ARG 114 
32  1 Y 1 S HIS 1   ? E HIS 1   
33  1 Y 1 S HIS 2   ? E HIS 2   
34  1 Y 1 S HIS 3   ? E HIS 3   
35  1 Y 1 S HIS 4   ? E HIS 4   
36  1 Y 1 S HIS 5   ? E HIS 5   
37  1 Y 1 S HIS 6   ? E HIS 6   
38  1 Y 1 S THR 7   ? E THR 7   
39  1 Y 1 S ASN 8   ? E ASN 8   
40  1 Y 1 S GLU 9   ? E GLU 9   
41  1 Y 1 S ALA 10  ? E ALA 10  
42  1 Y 1 S TYR 11  ? E TYR 11  
43  1 Y 1 S LEU 12  ? E LEU 12  
44  1 Y 1 S ALA 13  ? E ALA 13  
45  1 Y 1 S HIS 14  ? E HIS 14  
46  1 Y 1 S GLU 15  ? E GLU 15  
47  1 Y 1 S ARG 16  ? E ARG 16  
48  1 Y 1 S ARG 17  ? E ARG 17  
49  1 Y 1 S GLU 18  ? E GLU 18  
50  1 Y 1 S LEU 19  ? E LEU 19  
51  1 Y 1 S GLU 20  ? E GLU 20  
52  1 Y 1 S ALA 21  ? E ALA 21  
53  1 Y 1 S LYS 22  ? E LYS 22  
54  1 Y 1 S ARG 23  ? E ARG 23  
55  1 Y 1 S ASN 24  ? E ASN 24  
56  1 Y 1 S GLN 25  ? E GLN 25  
57  1 Y 1 S LEU 26  ? E LEU 26  
58  1 Y 1 S ARG 27  ? E ARG 27  
59  1 Y 1 S ASP 28  ? E ASP 28  
60  1 Y 1 S GLU 29  ? E GLU 29  
61  1 Y 1 S VAL 30  ? E VAL 30  
62  1 Y 1 S ASP 31  ? E ASP 31  
63  1 Y 1 S ARG 32  ? E ARG 32  
64  1 Y 1 S THR 33  ? E THR 33  
65  1 Y 1 S LYS 34  ? E LYS 34  
66  1 Y 1 S THR 35  ? E THR 35  
67  1 Y 1 S HIS 36  ? E HIS 36  
68  1 Y 1 S MET 37  ? E MET 37  
69  1 Y 1 S GLN 38  ? E GLN 38  
70  1 Y 1 S ASP 39  ? E ASP 39  
71  1 Y 1 S GLU 40  ? E GLU 40  
72  1 Y 1 S ALA 41  ? E ALA 41  
73  1 Y 1 S ALA 42  ? E ALA 42  
74  1 Y 1 S ASN 43  ? E ASN 43  
75  1 Y 1 S ARG 62  ? E ARG 62  
76  1 Y 1 S ASN 63  ? E ASN 63  
77  1 Y 1 S ARG 64  ? E ARG 64  
78  1 Y 1 S ASP 65  ? E ASP 65  
79  1 Y 1 S ARG 66  ? E ARG 66  
80  1 Y 1 S GLU 67  ? E GLU 67  
81  1 Y 1 S GLU 68  ? E GLU 68  
82  1 Y 1 S LYS 69  ? E LYS 69  
83  1 Y 1 S LEU 70  ? E LEU 70  
84  1 Y 1 S ILE 71  ? E ILE 71  
85  1 Y 1 S LYS 72  ? E LYS 72  
86  1 Y 1 S LYS 73  ? E LYS 73  
87  1 Y 1 S ILE 74  ? E ILE 74  
88  1 Y 1 S GLU 75  ? E GLU 75  
89  1 Y 1 S GLN 76  ? E GLN 76  
90  1 Y 1 S THR 77  ? E THR 77  
91  1 Y 1 S LEU 78  ? E LEU 78  
92  1 Y 1 S LYS 79  ? E LYS 79  
93  1 Y 1 S LYS 80  ? E LYS 80  
94  1 Y 1 S VAL 81  ? E VAL 81  
95  1 Y 1 S GLU 82  ? E GLU 82  
96  1 Y 1 S ASN 83  ? E ASN 83  
97  1 Y 1 S GLU 84  ? E GLU 84  
98  1 Y 1 S ASP 85  ? E ASP 85  
99  1 Y 1 T HIS 1   ? F HIS 1   
100 1 Y 1 T HIS 2   ? F HIS 2   
101 1 Y 1 T HIS 3   ? F HIS 3   
102 1 Y 1 T HIS 4   ? F HIS 4   
103 1 Y 1 T HIS 5   ? F HIS 5   
104 1 Y 1 T HIS 6   ? F HIS 6   
105 1 Y 1 T THR 7   ? F THR 7   
106 1 Y 1 T ASN 8   ? F ASN 8   
107 1 Y 1 T GLU 9   ? F GLU 9   
108 1 Y 1 T ALA 10  ? F ALA 10  
109 1 Y 1 T TYR 11  ? F TYR 11  
110 1 Y 1 T LEU 12  ? F LEU 12  
111 1 Y 1 T ALA 13  ? F ALA 13  
112 1 Y 1 T HIS 14  ? F HIS 14  
113 1 Y 1 T GLU 15  ? F GLU 15  
114 1 Y 1 T ARG 16  ? F ARG 16  
115 1 Y 1 T ARG 17  ? F ARG 17  
116 1 Y 1 T GLU 18  ? F GLU 18  
117 1 Y 1 T LEU 19  ? F LEU 19  
118 1 Y 1 T GLU 20  ? F GLU 20  
119 1 Y 1 T ALA 21  ? F ALA 21  
120 1 Y 1 T LYS 22  ? F LYS 22  
121 1 Y 1 T ARG 23  ? F ARG 23  
122 1 Y 1 T ASN 24  ? F ASN 24  
123 1 Y 1 T GLN 25  ? F GLN 25  
124 1 Y 1 T LEU 26  ? F LEU 26  
125 1 Y 1 T ARG 27  ? F ARG 27  
126 1 Y 1 T ASP 28  ? F ASP 28  
127 1 Y 1 T GLU 29  ? F GLU 29  
128 1 Y 1 T VAL 30  ? F VAL 30  
129 1 Y 1 T ASP 31  ? F ASP 31  
130 1 Y 1 T ARG 32  ? F ARG 32  
131 1 Y 1 T THR 33  ? F THR 33  
132 1 Y 1 T LYS 34  ? F LYS 34  
133 1 Y 1 T THR 35  ? F THR 35  
134 1 Y 1 T HIS 36  ? F HIS 36  
135 1 Y 1 T MET 37  ? F MET 37  
136 1 Y 1 T GLN 38  ? F GLN 38  
137 1 Y 1 T ASP 39  ? F ASP 39  
138 1 Y 1 T GLU 40  ? F GLU 40  
139 1 Y 1 T ALA 41  ? F ALA 41  
140 1 Y 1 T ALA 42  ? F ALA 42  
141 1 Y 1 T ASN 43  ? F ASN 43  
142 1 Y 1 T ASP 65  ? F ASP 65  
143 1 Y 1 T ARG 66  ? F ARG 66  
144 1 Y 1 T GLU 67  ? F GLU 67  
145 1 Y 1 T GLU 68  ? F GLU 68  
146 1 Y 1 T LYS 69  ? F LYS 69  
147 1 Y 1 T LEU 70  ? F LEU 70  
148 1 Y 1 T ILE 71  ? F ILE 71  
149 1 Y 1 T LYS 72  ? F LYS 72  
150 1 Y 1 T LYS 73  ? F LYS 73  
151 1 Y 1 T ILE 74  ? F ILE 74  
152 1 Y 1 T GLU 75  ? F GLU 75  
153 1 Y 1 T GLN 76  ? F GLN 76  
154 1 Y 1 T THR 77  ? F THR 77  
155 1 Y 1 T LEU 78  ? F LEU 78  
156 1 Y 1 T LYS 79  ? F LYS 79  
157 1 Y 1 T LYS 80  ? F LYS 80  
158 1 Y 1 T VAL 81  ? F VAL 81  
159 1 Y 1 T GLU 82  ? F GLU 82  
160 1 Y 1 T ASN 83  ? F ASN 83  
161 1 Y 1 T GLU 84  ? F GLU 84  
162 1 Y 1 T ASP 85  ? F ASP 85  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION' CA  
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CA  1  136 1  CA  CA  H . 
H 5 HOH 1  137 3  HOH HOH H . 
H 5 HOH 2  138 6  HOH HOH H . 
H 5 HOH 3  139 8  HOH HOH H . 
H 5 HOH 4  140 12 HOH HOH H . 
H 5 HOH 5  141 14 HOH HOH H . 
H 5 HOH 6  142 23 HOH HOH H . 
H 5 HOH 7  143 24 HOH HOH H . 
H 5 HOH 8  144 26 HOH HOH H . 
H 5 HOH 9  145 30 HOH HOH H . 
H 5 HOH 10 146 31 HOH HOH H . 
H 5 HOH 11 147 35 HOH HOH H . 
H 5 HOH 12 148 36 HOH HOH H . 
H 5 HOH 13 149 43 HOH HOH H . 
H 5 HOH 14 150 48 HOH HOH H . 
H 5 HOH 15 151 50 HOH HOH H . 
H 5 HOH 16 152 52 HOH HOH H . 
H 5 HOH 17 153 54 HOH HOH H . 
H 5 HOH 18 154 55 HOH HOH H . 
I 5 HOH 1  136 2  HOH HOH I . 
I 5 HOH 2  137 4  HOH HOH I . 
I 5 HOH 3  138 5  HOH HOH I . 
I 5 HOH 4  139 10 HOH HOH I . 
I 5 HOH 5  140 11 HOH HOH I . 
I 5 HOH 6  141 17 HOH HOH I . 
I 5 HOH 7  142 18 HOH HOH I . 
I 5 HOH 8  143 20 HOH HOH I . 
I 5 HOH 9  144 22 HOH HOH I . 
I 5 HOH 10 145 25 HOH HOH I . 
I 5 HOH 11 146 27 HOH HOH I . 
I 5 HOH 12 147 29 HOH HOH I . 
I 5 HOH 13 148 34 HOH HOH I . 
I 5 HOH 14 149 37 HOH HOH I . 
I 5 HOH 15 150 45 HOH HOH I . 
I 5 HOH 16 151 46 HOH HOH I . 
I 5 HOH 17 152 49 HOH HOH I . 
I 5 HOH 18 153 51 HOH HOH I . 
J 5 HOH 1  113 7  HOH HOH L . 
J 5 HOH 2  114 19 HOH HOH L . 
J 5 HOH 3  115 21 HOH HOH L . 
J 5 HOH 4  116 32 HOH HOH L . 
J 5 HOH 5  117 33 HOH HOH L . 
J 5 HOH 6  118 39 HOH HOH L . 
J 5 HOH 7  119 53 HOH HOH L . 
K 5 HOH 1  113 1  HOH HOH M . 
K 5 HOH 2  114 9  HOH HOH M . 
K 5 HOH 3  115 13 HOH HOH M . 
K 5 HOH 4  116 15 HOH HOH M . 
K 5 HOH 5  117 38 HOH HOH M . 
K 5 HOH 6  118 40 HOH HOH M . 
K 5 HOH 7  119 41 HOH HOH M . 
K 5 HOH 8  120 42 HOH HOH M . 
K 5 HOH 9  121 44 HOH HOH M . 
K 5 HOH 10 122 47 HOH HOH M . 
L 5 HOH 1  86  16 HOH HOH T . 
L 5 HOH 2  87  28 HOH HOH T . 
#