data_3H4B
# 
_entry.id   3H4B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H4B         
NDB   PD1286       
RCSB  RCSB052674   
WWPDB D_1000052674 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3H40 . unspecified 
PDB 3H4O . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H4B 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jain, R.'       1 
'Nair, D.T.'     2 
'Johnson, R.E.'  3 
'Prakash, L.'    4 
'Prakash, S.'    5 
'Aggarwal, A.K.' 6 
# 
_citation.id                        primary 
_citation.title                     'Replication across template T/U by human DNA polymerase-iota.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            17 
_citation.page_first                974 
_citation.page_last                 980 
_citation.year                      2009 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19604477 
_citation.pdbx_database_id_DOI      10.1016/j.str.2009.04.011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jain, R.'       1 
primary 'Nair, D.T.'     2 
primary 'Johnson, R.E.'  3 
primary 'Prakash, L.'    4 
primary 'Prakash, S.'    5 
primary 'Aggarwal, A.K.' 6 
# 
_cell.entry_id           3H4B 
_cell.length_a           97.998 
_cell.length_b           97.998 
_cell.length_c           203.670 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H4B 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase iota'                     44037.047 1   2.7.7.7 ? ? ?                     
2 polymer     syn "5'-D(*AP*GP*GP*AP*CP*CP*(DOC))-3'"       2091.414  1   ?       ? ? 'primer DNA strand'   
3 polymer     syn "5'-D(*TP*(BRU)P*GP*GP*GP*TP*CP*CP*T)-3'" 2802.665  1   ?       ? ? 'template DNA strand' 
4 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ?                     
5 non-polymer syn 'MAGNESIUM ION'                           24.305    1   ?       ? ? ?                     
6 water       nat water                                     18.015    156 ?       ? ? ?                     
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog B, Eta2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYRE
MSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMR
EAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTF
SPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRL
IIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK
;
;ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYRE
MSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMR
EAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTF
SPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRL
IIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK
;
A ? 
2 polydeoxyribonucleotide no yes '(DA)(DG)(DG)(DA)(DC)(DC)(DOC)' AGGACCC P ? 
3 polydeoxyribonucleotide no yes '(DT)(BRU)(DG)(DG)(DG)(DT)(DC)(DC)(DT)' TUGGGTCCT T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   SER n 
1 4   ARG n 
1 5   VAL n 
1 6   ILE n 
1 7   VAL n 
1 8   HIS n 
1 9   VAL n 
1 10  ASP n 
1 11  LEU n 
1 12  ASP n 
1 13  CYS n 
1 14  PHE n 
1 15  TYR n 
1 16  ALA n 
1 17  GLN n 
1 18  VAL n 
1 19  GLU n 
1 20  MET n 
1 21  ILE n 
1 22  SER n 
1 23  ASN n 
1 24  PRO n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ASP n 
1 29  LYS n 
1 30  PRO n 
1 31  LEU n 
1 32  GLY n 
1 33  VAL n 
1 34  GLN n 
1 35  GLN n 
1 36  LYS n 
1 37  TYR n 
1 38  LEU n 
1 39  VAL n 
1 40  VAL n 
1 41  THR n 
1 42  CYS n 
1 43  ASN n 
1 44  TYR n 
1 45  GLU n 
1 46  ALA n 
1 47  ARG n 
1 48  LYS n 
1 49  LEU n 
1 50  GLY n 
1 51  VAL n 
1 52  LYS n 
1 53  LYS n 
1 54  LEU n 
1 55  MET n 
1 56  ASN n 
1 57  VAL n 
1 58  ARG n 
1 59  ASP n 
1 60  ALA n 
1 61  LYS n 
1 62  GLU n 
1 63  LYS n 
1 64  CYS n 
1 65  PRO n 
1 66  GLN n 
1 67  LEU n 
1 68  VAL n 
1 69  LEU n 
1 70  VAL n 
1 71  ASN n 
1 72  GLY n 
1 73  GLU n 
1 74  ASP n 
1 75  LEU n 
1 76  THR n 
1 77  ARG n 
1 78  TYR n 
1 79  ARG n 
1 80  GLU n 
1 81  MET n 
1 82  SER n 
1 83  TYR n 
1 84  LYS n 
1 85  VAL n 
1 86  THR n 
1 87  GLU n 
1 88  LEU n 
1 89  LEU n 
1 90  GLU n 
1 91  GLU n 
1 92  PHE n 
1 93  SER n 
1 94  PRO n 
1 95  VAL n 
1 96  VAL n 
1 97  GLU n 
1 98  ARG n 
1 99  LEU n 
1 100 GLY n 
1 101 PHE n 
1 102 ASP n 
1 103 GLU n 
1 104 ASN n 
1 105 PHE n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 THR n 
1 110 GLU n 
1 111 MET n 
1 112 VAL n 
1 113 GLU n 
1 114 LYS n 
1 115 ARG n 
1 116 LEU n 
1 117 GLN n 
1 118 GLN n 
1 119 LEU n 
1 120 GLN n 
1 121 SER n 
1 122 ASP n 
1 123 GLU n 
1 124 LEU n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 THR n 
1 129 VAL n 
1 130 SER n 
1 131 GLY n 
1 132 HIS n 
1 133 VAL n 
1 134 TYR n 
1 135 ASN n 
1 136 ASN n 
1 137 GLN n 
1 138 SER n 
1 139 ILE n 
1 140 ASN n 
1 141 LEU n 
1 142 LEU n 
1 143 ASP n 
1 144 VAL n 
1 145 LEU n 
1 146 HIS n 
1 147 ILE n 
1 148 ARG n 
1 149 LEU n 
1 150 LEU n 
1 151 VAL n 
1 152 GLY n 
1 153 SER n 
1 154 GLN n 
1 155 ILE n 
1 156 ALA n 
1 157 ALA n 
1 158 GLU n 
1 159 MET n 
1 160 ARG n 
1 161 GLU n 
1 162 ALA n 
1 163 MET n 
1 164 TYR n 
1 165 ASN n 
1 166 GLN n 
1 167 LEU n 
1 168 GLY n 
1 169 LEU n 
1 170 THR n 
1 171 GLY n 
1 172 CYS n 
1 173 ALA n 
1 174 GLY n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 ASN n 
1 179 LYS n 
1 180 LEU n 
1 181 LEU n 
1 182 ALA n 
1 183 LYS n 
1 184 LEU n 
1 185 VAL n 
1 186 SER n 
1 187 GLY n 
1 188 VAL n 
1 189 PHE n 
1 190 LYS n 
1 191 PRO n 
1 192 ASN n 
1 193 GLN n 
1 194 GLN n 
1 195 THR n 
1 196 VAL n 
1 197 LEU n 
1 198 LEU n 
1 199 PRO n 
1 200 GLU n 
1 201 SER n 
1 202 CYS n 
1 203 GLN n 
1 204 HIS n 
1 205 LEU n 
1 206 ILE n 
1 207 HIS n 
1 208 SER n 
1 209 LEU n 
1 210 ASN n 
1 211 HIS n 
1 212 ILE n 
1 213 LYS n 
1 214 GLU n 
1 215 ILE n 
1 216 PRO n 
1 217 GLY n 
1 218 ILE n 
1 219 GLY n 
1 220 TYR n 
1 221 LYS n 
1 222 THR n 
1 223 ALA n 
1 224 LYS n 
1 225 CYS n 
1 226 LEU n 
1 227 GLU n 
1 228 ALA n 
1 229 LEU n 
1 230 GLY n 
1 231 ILE n 
1 232 ASN n 
1 233 SER n 
1 234 VAL n 
1 235 ARG n 
1 236 ASP n 
1 237 LEU n 
1 238 GLN n 
1 239 THR n 
1 240 PHE n 
1 241 SER n 
1 242 PRO n 
1 243 LYS n 
1 244 ILE n 
1 245 LEU n 
1 246 GLU n 
1 247 LYS n 
1 248 GLU n 
1 249 LEU n 
1 250 GLY n 
1 251 ILE n 
1 252 SER n 
1 253 VAL n 
1 254 ALA n 
1 255 GLN n 
1 256 ARG n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 SER n 
1 262 PHE n 
1 263 GLY n 
1 264 GLU n 
1 265 ASP n 
1 266 ASN n 
1 267 SER n 
1 268 PRO n 
1 269 VAL n 
1 270 ILE n 
1 271 LEU n 
1 272 SER n 
1 273 GLY n 
1 274 PRO n 
1 275 PRO n 
1 276 GLN n 
1 277 SER n 
1 278 PHE n 
1 279 SER n 
1 280 GLU n 
1 281 GLU n 
1 282 ASP n 
1 283 SER n 
1 284 PHE n 
1 285 LYS n 
1 286 LYS n 
1 287 CYS n 
1 288 SER n 
1 289 SER n 
1 290 GLU n 
1 291 VAL n 
1 292 GLU n 
1 293 ALA n 
1 294 LYS n 
1 295 ASN n 
1 296 LYS n 
1 297 ILE n 
1 298 GLU n 
1 299 GLU n 
1 300 LEU n 
1 301 LEU n 
1 302 ALA n 
1 303 SER n 
1 304 LEU n 
1 305 LEU n 
1 306 ASN n 
1 307 ARG n 
1 308 VAL n 
1 309 CYS n 
1 310 GLN n 
1 311 ASP n 
1 312 GLY n 
1 313 ARG n 
1 314 LYS n 
1 315 PRO n 
1 316 HIS n 
1 317 THR n 
1 318 VAL n 
1 319 ARG n 
1 320 LEU n 
1 321 ILE n 
1 322 ILE n 
1 323 ARG n 
1 324 ARG n 
1 325 TYR n 
1 326 SER n 
1 327 SER n 
1 328 GLU n 
1 329 LYS n 
1 330 HIS n 
1 331 TYR n 
1 332 GLY n 
1 333 ARG n 
1 334 GLU n 
1 335 SER n 
1 336 ARG n 
1 337 GLN n 
1 338 CYS n 
1 339 PRO n 
1 340 ILE n 
1 341 PRO n 
1 342 SER n 
1 343 HIS n 
1 344 VAL n 
1 345 ILE n 
1 346 GLN n 
1 347 LYS n 
1 348 LEU n 
1 349 GLY n 
1 350 THR n 
1 351 GLY n 
1 352 ASN n 
1 353 TYR n 
1 354 ASP n 
1 355 VAL n 
1 356 MET n 
1 357 THR n 
1 358 PRO n 
1 359 MET n 
1 360 VAL n 
1 361 ASP n 
1 362 ILE n 
1 363 LEU n 
1 364 MET n 
1 365 LYS n 
1 366 LEU n 
1 367 PHE n 
1 368 ARG n 
1 369 ASN n 
1 370 MET n 
1 371 VAL n 
1 372 ASN n 
1 373 VAL n 
1 374 LYS n 
1 375 MET n 
1 376 PRO n 
1 377 PHE n 
1 378 HIS n 
1 379 LEU n 
1 380 THR n 
1 381 LEU n 
1 382 LEU n 
1 383 SER n 
1 384 VAL n 
1 385 CYS n 
1 386 PHE n 
1 387 CYS n 
1 388 ASN n 
1 389 LEU n 
1 390 LYS n 
2 1   DA  n 
2 2   DG  n 
2 3   DG  n 
2 4   DA  n 
2 5   DC  n 
2 6   DC  n 
2 7   DOC n 
3 1   DT  n 
3 2   BRU n 
3 3   DG  n 
3 4   DG  n 
3 5   DG  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLI, RAD30B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLI_HUMAN Q9UNA4 1 
;ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYRE
MSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMR
EAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTF
SPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRL
IIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK
;
25 ? 
2 PDB 3H4B       3H4B   3 AGGACCC 1  ? 
3 PDB 3H4B       3H4B   2 TUGGGTCCT 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H4B A 1 ? 390 ? Q9UNA4 25  ? 414 ? 25  414 
2 2 3H4B T 1 ? 9   ? 3H4B   839 ? 847 ? 839 847 
3 3 3H4B P 1 ? 7   ? 3H4B   867 ? 873 ? 867 873 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"   ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3H4B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.density_percent_sol   57.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'10-15% PEG 5K MME, 0.2-0.4 M Ammonium sulfate, 0.1 M MES , pH 6.5 , VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-08-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92017 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92017 
# 
_reflns.entry_id                     3H4B 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.85 
_reflns.number_obs                   14231 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.631 
_reflns.B_iso_Wilson_estimate        83.2 
_reflns.pdbx_redundancy              7.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.380 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.1 
_reflns_shell.pdbx_redundancy        7.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1374 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3H4B 
_refine.ls_number_reflns_obs                     13690 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               32120.51 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.73 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          0.240 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.240 
_refine.ls_R_factor_R_free                       0.281 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.0 
_refine.ls_number_reflns_R_free                  1094 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               52.5 
_refine.aniso_B[1][1]                            2.68 
_refine.aniso_B[2][2]                            2.68 
_refine.aniso_B[3][3]                            -5.37 
_refine.aniso_B[1][2]                            7.58 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.328589 
_refine.solvent_model_param_bsol                 42.2426 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ALZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3H4B 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2877 
_refine_hist.pdbx_number_atoms_nucleic_acid   320 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             156 
_refine_hist.number_atoms_total               3384 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        39.73 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.16  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.39  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.47  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.16  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.85 
_refine_ls_shell.d_res_low                        3.03 
_refine_ls_shell.number_reflns_R_work             1937 
_refine_ls_shell.R_factor_R_work                  0.290 
_refine_ls_shell.percent_reflns_obs               91.2 
_refine_ls_shell.R_factor_R_free                  0.333 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            7.0 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top     'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna_rep.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water_rep.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top         'X-RAY DIFFRACTION' 
5 lig.par           lig.top         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H4B 
_struct.title                     'Ternary complex of human DNA polymerase iota with template U/T and incoming dATP' 
_struct.pdbx_descriptor           'DNA polymerase iota (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H4B 
_struct_keywords.pdbx_keywords   REPLICATION/DNA 
_struct_keywords.text            
;DNA polymerase iota, replication, DNA damage, DNA repair, DNA replication, DNA synthesis, DNA-binding, DNA-directed DNA polymerase, Magnesium, Metal-binding, Mutator protein, Nucleotidyltransferase, Nucleus, Schiff base, Transferase, REPLICATION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 13  ? ASN A 23  ? CYS A 37  ASN A 47  1 ? 11 
HELX_P HELX_P2  2  PRO A 24  ? LYS A 27  ? PRO A 48  LYS A 51  5 ? 4  
HELX_P HELX_P3  3  ASN A 43  ? LEU A 49  ? ASN A 67  LEU A 73  1 ? 7  
HELX_P HELX_P4  4  VAL A 57  ? GLU A 62  ? VAL A 81  GLU A 86  1 ? 6  
HELX_P HELX_P5  5  LEU A 75  ? SER A 93  ? LEU A 99  SER A 117 1 ? 19 
HELX_P HELX_P6  6  LEU A 108 ? LEU A 119 ? LEU A 132 LEU A 143 1 ? 12 
HELX_P HELX_P7  7  ASP A 122 ? ALA A 126 ? ASP A 146 ALA A 150 5 ? 5  
HELX_P HELX_P8  8  ASN A 135 ? GLN A 137 ? ASN A 159 GLN A 161 5 ? 3  
HELX_P HELX_P9  9  ASP A 143 ? GLY A 168 ? ASP A 167 GLY A 192 1 ? 26 
HELX_P HELX_P10 10 ASN A 178 ? GLY A 187 ? ASN A 202 GLY A 211 1 ? 10 
HELX_P HELX_P11 11 LEU A 198 ? GLU A 200 ? LEU A 222 GLU A 224 5 ? 3  
HELX_P HELX_P12 12 SER A 201 ? SER A 208 ? SER A 225 SER A 232 1 ? 8  
HELX_P HELX_P13 13 HIS A 211 ? ILE A 215 ? HIS A 235 ILE A 239 5 ? 5  
HELX_P HELX_P14 14 GLY A 219 ? ALA A 228 ? GLY A 243 ALA A 252 1 ? 10 
HELX_P HELX_P15 15 SER A 233 ? PHE A 240 ? SER A 257 PHE A 264 1 ? 8  
HELX_P HELX_P16 16 SER A 241 ? GLY A 250 ? SER A 265 GLY A 274 1 ? 10 
HELX_P HELX_P17 17 GLY A 250 ? SER A 261 ? GLY A 274 SER A 285 1 ? 12 
HELX_P HELX_P18 18 LYS A 294 ? GLY A 312 ? LYS A 318 GLY A 336 1 ? 19 
HELX_P HELX_P19 19 PRO A 341 ? GLN A 346 ? PRO A 365 GLN A 370 1 ? 6  
HELX_P HELX_P20 20 VAL A 355 ? ASN A 369 ? VAL A 379 ASN A 393 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DC  6 "O3'" ? ? ? 1_555 B DOC 7 P  ? ? P DC  872 P DOC 873 1_555 ? ? ? ? ? ? ?            1.604 ? 
covale2  covale ? ? C DT  1 "O3'" ? ? ? 1_555 C BRU 2 P  A ? T DT  839 T BRU 840 1_555 ? ? ? ? ? ? ?            1.618 ? 
covale3  covale ? ? C DT  1 "O3'" ? ? ? 1_555 C BRU 2 P  B ? T DT  839 T BRU 840 1_555 ? ? ? ? ? ? ?            1.601 ? 
covale4  covale ? ? C BRU 2 "O3'" A ? ? 1_555 C DG  3 P  ? ? T BRU 840 T DG  841 1_555 ? ? ? ? ? ? ?            1.614 ? 
covale5  covale ? ? C BRU 2 "O3'" B ? ? 1_555 C DG  3 P  ? ? T BRU 840 T DG  841 1_555 ? ? ? ? ? ? ?            1.592 ? 
metalc1  metalc ? ? D DTP . O3G   ? ? ? 1_555 E MG  . MG ? ? A DTP 875 A MG  871 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc2  metalc ? ? D DTP . O2A   ? ? ? 1_555 E MG  . MG ? ? A DTP 875 A MG  871 1_555 ? ? ? ? ? ? ?            2.094 ? 
metalc3  metalc ? ? E MG  . MG    ? ? ? 1_555 F HOH . O  ? ? A MG  871 A HOH 529 1_555 ? ? ? ? ? ? ?            2.805 ? 
hydrog1  hydrog ? ? B DA  1 N1    ? ? ? 1_555 C DT  9 N3 ? ? P DA  867 T DT  847 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  1 N6    ? ? ? 1_555 C DT  9 O4 ? ? P DA  867 T DT  847 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  2 N1    ? ? ? 1_555 C DC  8 N3 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2 N2    ? ? ? 1_555 C DC  8 O2 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2 O6    ? ? ? 1_555 C DC  8 N4 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  3 N1    ? ? ? 1_555 C DC  7 N3 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3 N2    ? ? ? 1_555 C DC  7 O2 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3 O6    ? ? ? 1_555 C DC  7 N4 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  4 N1    ? ? ? 1_555 C DT  6 N3 ? ? P DA  870 T DT  844 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4 N6    ? ? ? 1_555 C DT  6 O4 ? ? P DA  870 T DT  844 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  5 N3    ? ? ? 1_555 C DG  5 N1 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5 N4    ? ? ? 1_555 C DG  5 O6 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5 O2    ? ? ? 1_555 C DG  5 N2 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  6 N3    ? ? ? 1_555 C DG  4 N1 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  6 N4    ? ? ? 1_555 C DG  4 O6 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  6 O2    ? ? ? 1_555 C DG  4 N2 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DOC 7 N3    ? ? ? 1_555 C DG  3 N1 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DOC 7 N4    ? ? ? 1_555 C DG  3 O6 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DOC 7 O2    ? ? ? 1_555 C DG  3 N2 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 96  ? ARG A 98  ? VAL A 120 ARG A 122 
A 2 GLU A 103 ? ASP A 107 ? GLU A 127 ASP A 131 
A 3 ILE A 6   ? LEU A 11  ? ILE A 30  LEU A 35  
A 4 GLY A 171 ? ALA A 176 ? GLY A 195 ALA A 200 
A 5 GLN A 194 ? VAL A 196 ? GLN A 218 VAL A 220 
A 6 HIS A 132 ? VAL A 133 ? HIS A 156 VAL A 157 
B 1 MET A 55  ? ASN A 56  ? MET A 79  ASN A 80  
B 2 LEU A 38  ? CYS A 42  ? LEU A 62  CYS A 66  
B 3 LEU A 31  ? GLN A 35  ? LEU A 55  GLN A 59  
B 4 VAL A 68  ? ASN A 71  ? VAL A 92  ASN A 95  
C 1 SER A 277 ? GLU A 280 ? SER A 301 GLU A 304 
C 2 LEU A 382 ? LYS A 390 ? LEU A 406 LYS A 414 
C 3 LYS A 314 ? ILE A 322 ? LYS A 338 ILE A 346 
C 4 GLU A 334 ? SER A 335 ? GLU A 358 SER A 359 
D 1 SER A 277 ? GLU A 280 ? SER A 301 GLU A 304 
D 2 LEU A 382 ? LYS A 390 ? LEU A 406 LYS A 414 
D 3 LYS A 314 ? ILE A 322 ? LYS A 338 ILE A 346 
D 4 CYS A 338 ? PRO A 339 ? CYS A 362 PRO A 363 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 97  ? N GLU A 121 O PHE A 105 ? O PHE A 129 
A 2 3 O ASN A 104 ? O ASN A 128 N VAL A 9   ? N VAL A 33  
A 3 4 N ILE A 6   ? N ILE A 30  O ALA A 176 ? O ALA A 200 
A 4 5 N VAL A 175 ? N VAL A 199 O THR A 195 ? O THR A 219 
A 5 6 O GLN A 194 ? O GLN A 218 N HIS A 132 ? N HIS A 156 
B 1 2 O MET A 55  ? O MET A 79  N VAL A 39  ? N VAL A 63  
B 2 3 O THR A 41  ? O THR A 65  N VAL A 33  ? N VAL A 57  
B 3 4 N GLN A 34  ? N GLN A 58  O VAL A 70  ? O VAL A 94  
C 1 2 N PHE A 278 ? N PHE A 302 O PHE A 386 ? O PHE A 410 
C 2 3 O ASN A 388 ? O ASN A 412 N HIS A 316 ? N HIS A 340 
C 3 4 N ILE A 322 ? N ILE A 346 O GLU A 334 ? O GLU A 358 
D 1 2 N PHE A 278 ? N PHE A 302 O PHE A 386 ? O PHE A 410 
D 2 3 O ASN A 388 ? O ASN A 412 N HIS A 316 ? N HIS A 340 
D 3 4 N VAL A 318 ? N VAL A 342 O CYS A 338 ? O CYS A 362 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE DTP A 875' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 871'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 CYS A 13  ? CYS A 37  . ? 1_555 ? 
2  AC1 12 THR A 41  ? THR A 65  . ? 1_555 ? 
3  AC1 12 ARG A 47  ? ARG A 71  . ? 1_555 ? 
4  AC1 12 LYS A 53  ? LYS A 77  . ? 1_555 ? 
5  AC1 12 LEU A 54  ? LEU A 78  . ? 1_555 ? 
6  AC1 12 LYS A 190 ? LYS A 214 . ? 1_555 ? 
7  AC1 12 HOH F .   ? HOH A 526 . ? 1_555 ? 
8  AC1 12 HOH F .   ? HOH A 533 . ? 1_555 ? 
9  AC1 12 MG  E .   ? MG  A 871 . ? 1_555 ? 
10 AC1 12 DOC B 7   ? DOC P 873 . ? 1_555 ? 
11 AC1 12 BRU C 2   ? BRU T 840 . ? 1_555 ? 
12 AC1 12 DG  C 3   ? DG  T 841 . ? 1_555 ? 
13 AC2 3  ASP A 102 ? ASP A 126 . ? 1_555 ? 
14 AC2 3  HOH F .   ? HOH A 529 . ? 1_555 ? 
15 AC2 3  DTP D .   ? DTP A 875 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H4B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H4B 
_atom_sites.fract_transf_matrix[1][1]   0.010204 
_atom_sites.fract_transf_matrix[1][2]   0.005891 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011783 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004910 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 1   ? 28.586  28.611 -5.090  1.00 74.34  ? 25  ALA A N     1 
ATOM   2    C  CA    . ALA A 1 1   ? 27.243  28.528 -4.434  1.00 72.96  ? 25  ALA A CA    1 
ATOM   3    C  C     . ALA A 1 1   ? 26.110  28.853 -5.421  1.00 71.75  ? 25  ALA A C     1 
ATOM   4    O  O     . ALA A 1 1   ? 26.237  29.753 -6.256  1.00 71.91  ? 25  ALA A O     1 
ATOM   5    C  CB    . ALA A 1 1   ? 27.196  29.481 -3.235  1.00 72.82  ? 25  ALA A CB    1 
ATOM   6    N  N     . SER A 1 2   ? 25.010  28.109 -5.323  1.00 69.74  ? 26  SER A N     1 
ATOM   7    C  CA    . SER A 1 2   ? 23.853  28.310 -6.198  1.00 66.63  ? 26  SER A CA    1 
ATOM   8    C  C     . SER A 1 2   ? 22.695  27.368 -5.860  1.00 62.70  ? 26  SER A C     1 
ATOM   9    O  O     . SER A 1 2   ? 21.584  27.810 -5.583  1.00 63.24  ? 26  SER A O     1 
ATOM   10   C  CB    . SER A 1 2   ? 24.260  28.111 -7.663  1.00 68.27  ? 26  SER A CB    1 
ATOM   11   O  OG    . SER A 1 2   ? 23.136  28.216 -8.523  1.00 70.25  ? 26  SER A OG    1 
ATOM   12   N  N     . SER A 1 3   ? 22.964  26.068 -5.889  1.00 57.65  ? 27  SER A N     1 
ATOM   13   C  CA    . SER A 1 3   ? 21.955  25.059 -5.595  1.00 52.62  ? 27  SER A CA    1 
ATOM   14   C  C     . SER A 1 3   ? 22.044  24.542 -4.166  1.00 48.36  ? 27  SER A C     1 
ATOM   15   O  O     . SER A 1 3   ? 23.020  23.901 -3.786  1.00 47.92  ? 27  SER A O     1 
ATOM   16   C  CB    . SER A 1 3   ? 22.104  23.885 -6.559  1.00 53.57  ? 27  SER A CB    1 
ATOM   17   O  OG    . SER A 1 3   ? 21.246  22.824 -6.190  1.00 55.29  ? 27  SER A OG    1 
ATOM   18   N  N     . ARG A 1 4   ? 21.011  24.796 -3.379  1.00 43.37  ? 28  ARG A N     1 
ATOM   19   C  CA    . ARG A 1 4   ? 21.013  24.354 -1.996  1.00 38.83  ? 28  ARG A CA    1 
ATOM   20   C  C     . ARG A 1 4   ? 20.217  23.079 -1.744  1.00 36.59  ? 28  ARG A C     1 
ATOM   21   O  O     . ARG A 1 4   ? 19.365  22.685 -2.541  1.00 37.25  ? 28  ARG A O     1 
ATOM   22   C  CB    . ARG A 1 4   ? 20.456  25.456 -1.096  1.00 38.01  ? 28  ARG A CB    1 
ATOM   23   C  CG    . ARG A 1 4   ? 21.333  26.687 -0.958  1.00 37.09  ? 28  ARG A CG    1 
ATOM   24   C  CD    . ARG A 1 4   ? 20.648  27.713 -0.074  1.00 34.47  ? 28  ARG A CD    1 
ATOM   25   N  NE    . ARG A 1 4   ? 19.397  28.147 -0.680  1.00 35.53  ? 28  ARG A NE    1 
ATOM   26   C  CZ    . ARG A 1 4   ? 18.410  28.737 -0.019  1.00 36.32  ? 28  ARG A CZ    1 
ATOM   27   N  NH1   . ARG A 1 4   ? 18.532  28.963 1.283   1.00 38.33  ? 28  ARG A NH1   1 
ATOM   28   N  NH2   . ARG A 1 4   ? 17.302  29.097 -0.657  1.00 35.16  ? 28  ARG A NH2   1 
ATOM   29   N  N     . VAL A 1 5   ? 20.521  22.438 -0.618  1.00 32.50  ? 29  VAL A N     1 
ATOM   30   C  CA    . VAL A 1 5   ? 19.827  21.237 -0.179  1.00 27.18  ? 29  VAL A CA    1 
ATOM   31   C  C     . VAL A 1 5   ? 19.414  21.553 1.246   1.00 24.97  ? 29  VAL A C     1 
ATOM   32   O  O     . VAL A 1 5   ? 20.203  21.468 2.169   1.00 24.26  ? 29  VAL A O     1 
ATOM   33   C  CB    . VAL A 1 5   ? 20.734  20.003 -0.196  1.00 25.83  ? 29  VAL A CB    1 
ATOM   34   C  CG1   . VAL A 1 5   ? 19.953  18.775 0.253   1.00 23.03  ? 29  VAL A CG1   1 
ATOM   35   C  CG2   . VAL A 1 5   ? 21.281  19.801 -1.585  1.00 22.16  ? 29  VAL A CG2   1 
ATOM   36   N  N     . ILE A 1 6   ? 18.161  21.953 1.398   1.00 23.95  ? 30  ILE A N     1 
ATOM   37   C  CA    . ILE A 1 6   ? 17.616  22.330 2.689   1.00 21.93  ? 30  ILE A CA    1 
ATOM   38   C  C     . ILE A 1 6   ? 16.716  21.227 3.226   1.00 21.96  ? 30  ILE A C     1 
ATOM   39   O  O     . ILE A 1 6   ? 16.115  20.469 2.459   1.00 22.24  ? 30  ILE A O     1 
ATOM   40   C  CB    . ILE A 1 6   ? 16.774  23.626 2.551   1.00 20.24  ? 30  ILE A CB    1 
ATOM   41   C  CG1   . ILE A 1 6   ? 17.566  24.674 1.768   1.00 19.53  ? 30  ILE A CG1   1 
ATOM   42   C  CG2   . ILE A 1 6   ? 16.364  24.146 3.926   1.00 18.99  ? 30  ILE A CG2   1 
ATOM   43   C  CD1   . ILE A 1 6   ? 18.918  25.044 2.377   1.00 20.73  ? 30  ILE A CD1   1 
ATOM   44   N  N     . VAL A 1 7   ? 16.625  21.134 4.544   1.00 20.72  ? 31  VAL A N     1 
ATOM   45   C  CA    . VAL A 1 7   ? 15.757  20.144 5.143   1.00 21.02  ? 31  VAL A CA    1 
ATOM   46   C  C     . VAL A 1 7   ? 14.887  20.783 6.221   1.00 20.67  ? 31  VAL A C     1 
ATOM   47   O  O     . VAL A 1 7   ? 15.342  21.586 7.030   1.00 18.33  ? 31  VAL A O     1 
ATOM   48   C  CB    . VAL A 1 7   ? 16.560  18.935 5.736   1.00 21.68  ? 31  VAL A CB    1 
ATOM   49   C  CG1   . VAL A 1 7   ? 17.523  19.407 6.821   1.00 22.48  ? 31  VAL A CG1   1 
ATOM   50   C  CG2   . VAL A 1 7   ? 15.594  17.899 6.286   1.00 19.99  ? 31  VAL A CG2   1 
ATOM   51   N  N     . HIS A 1 8   ? 13.614  20.424 6.209   1.00 22.12  ? 32  HIS A N     1 
ATOM   52   C  CA    . HIS A 1 8   ? 12.677  20.942 7.179   1.00 21.71  ? 32  HIS A CA    1 
ATOM   53   C  C     . HIS A 1 8   ? 12.225  19.811 8.089   1.00 22.11  ? 32  HIS A C     1 
ATOM   54   O  O     . HIS A 1 8   ? 11.594  18.871 7.625   1.00 22.33  ? 32  HIS A O     1 
ATOM   55   C  CB    . HIS A 1 8   ? 11.475  21.549 6.474   1.00 20.26  ? 32  HIS A CB    1 
ATOM   56   C  CG    . HIS A 1 8   ? 10.421  22.029 7.413   1.00 20.58  ? 32  HIS A CG    1 
ATOM   57   N  ND1   . HIS A 1 8   ? 9.205   21.397 7.552   1.00 19.37  ? 32  HIS A ND1   1 
ATOM   58   C  CD2   . HIS A 1 8   ? 10.419  23.053 8.299   1.00 19.97  ? 32  HIS A CD2   1 
ATOM   59   C  CE1   . HIS A 1 8   ? 8.499   22.013 8.484   1.00 20.94  ? 32  HIS A CE1   1 
ATOM   60   N  NE2   . HIS A 1 8   ? 9.213   23.021 8.953   1.00 19.13  ? 32  HIS A NE2   1 
ATOM   61   N  N     . VAL A 1 9   ? 12.564  19.908 9.378   1.00 21.96  ? 33  VAL A N     1 
ATOM   62   C  CA    . VAL A 1 9   ? 12.193  18.894 10.365  1.00 21.36  ? 33  VAL A CA    1 
ATOM   63   C  C     . VAL A 1 9   ? 11.032  19.400 11.190  1.00 22.74  ? 33  VAL A C     1 
ATOM   64   O  O     . VAL A 1 9   ? 11.141  20.441 11.819  1.00 22.64  ? 33  VAL A O     1 
ATOM   65   C  CB    . VAL A 1 9   ? 13.355  18.575 11.342  1.00 21.29  ? 33  VAL A CB    1 
ATOM   66   C  CG1   . VAL A 1 9   ? 12.933  17.453 12.304  1.00 17.80  ? 33  VAL A CG1   1 
ATOM   67   C  CG2   . VAL A 1 9   ? 14.612  18.208 10.567  1.00 13.65  ? 33  VAL A CG2   1 
ATOM   68   N  N     . ASP A 1 10  ? 9.939   18.640 11.203  1.00 25.90  ? 34  ASP A N     1 
ATOM   69   C  CA    . ASP A 1 10  ? 8.719   19.006 11.930  1.00 29.54  ? 34  ASP A CA    1 
ATOM   70   C  C     . ASP A 1 10  ? 8.205   17.858 12.813  1.00 30.83  ? 34  ASP A C     1 
ATOM   71   O  O     . ASP A 1 10  ? 7.693   16.846 12.316  1.00 31.86  ? 34  ASP A O     1 
ATOM   72   C  CB    . ASP A 1 10  ? 7.658   19.444 10.899  1.00 31.66  ? 34  ASP A CB    1 
ATOM   73   C  CG    . ASP A 1 10  ? 6.278   19.713 11.502  1.00 34.47  ? 34  ASP A CG    1 
ATOM   74   O  OD1   . ASP A 1 10  ? 5.447   20.287 10.763  1.00 35.50  ? 34  ASP A OD1   1 
ATOM   75   O  OD2   . ASP A 1 10  ? 6.006   19.356 12.672  1.00 35.36  ? 34  ASP A OD2   1 
ATOM   76   N  N     . LEU A 1 11  ? 8.340   18.024 14.127  1.00 31.38  ? 35  LEU A N     1 
ATOM   77   C  CA    . LEU A 1 11  ? 7.901   17.004 15.076  1.00 31.99  ? 35  LEU A CA    1 
ATOM   78   C  C     . LEU A 1 11  ? 6.395   16.833 15.209  1.00 32.51  ? 35  LEU A C     1 
ATOM   79   O  O     . LEU A 1 11  ? 5.640   17.804 15.297  1.00 33.56  ? 35  LEU A O     1 
ATOM   80   C  CB    . LEU A 1 11  ? 8.485   17.284 16.453  1.00 33.79  ? 35  LEU A CB    1 
ATOM   81   C  CG    . LEU A 1 11  ? 9.902   16.773 16.643  1.00 35.33  ? 35  LEU A CG    1 
ATOM   82   C  CD1   . LEU A 1 11  ? 10.827  17.527 15.739  1.00 37.71  ? 35  LEU A CD1   1 
ATOM   83   C  CD2   . LEU A 1 11  ? 10.312  16.939 18.083  1.00 38.54  ? 35  LEU A CD2   1 
ATOM   84   N  N     . ASP A 1 12  ? 5.974   15.577 15.249  1.00 32.65  ? 36  ASP A N     1 
ATOM   85   C  CA    . ASP A 1 12  ? 4.568   15.216 15.372  1.00 32.91  ? 36  ASP A CA    1 
ATOM   86   C  C     . ASP A 1 12  ? 4.003   15.570 16.749  1.00 31.97  ? 36  ASP A C     1 
ATOM   87   O  O     . ASP A 1 12  ? 4.627   15.279 17.768  1.00 30.64  ? 36  ASP A O     1 
ATOM   88   C  CB    . ASP A 1 12  ? 4.414   13.716 15.113  1.00 35.97  ? 36  ASP A CB    1 
ATOM   89   C  CG    . ASP A 1 12  ? 4.931   13.304 13.737  1.00 38.73  ? 36  ASP A CG    1 
ATOM   90   O  OD1   . ASP A 1 12  ? 4.405   13.822 12.726  1.00 39.48  ? 36  ASP A OD1   1 
ATOM   91   O  OD2   . ASP A 1 12  ? 5.859   12.465 13.670  1.00 39.31  ? 36  ASP A OD2   1 
ATOM   92   N  N     . CYS A 1 13  ? 2.822   16.192 16.765  1.00 31.79  ? 37  CYS A N     1 
ATOM   93   C  CA    . CYS A 1 13  ? 2.152   16.607 18.006  1.00 31.58  ? 37  CYS A CA    1 
ATOM   94   C  C     . CYS A 1 13  ? 3.127   16.693 19.183  1.00 30.98  ? 37  CYS A C     1 
ATOM   95   O  O     . CYS A 1 13  ? 2.919   16.096 20.245  1.00 29.77  ? 37  CYS A O     1 
ATOM   96   C  CB    . CYS A 1 13  ? 1.001   15.641 18.330  1.00 33.10  ? 37  CYS A CB    1 
ATOM   97   S  SG    . CYS A 1 13  ? 1.424   13.862 18.254  1.00 33.19  ? 37  CYS A SG    1 
ATOM   98   N  N     . PHE A 1 14  ? 4.192   17.459 18.971  1.00 30.90  ? 38  PHE A N     1 
ATOM   99   C  CA    . PHE A 1 14  ? 5.257   17.653 19.953  1.00 30.35  ? 38  PHE A CA    1 
ATOM   100  C  C     . PHE A 1 14  ? 4.915   17.579 21.439  1.00 30.33  ? 38  PHE A C     1 
ATOM   101  O  O     . PHE A 1 14  ? 5.535   16.803 22.165  1.00 32.79  ? 38  PHE A O     1 
ATOM   102  C  CB    . PHE A 1 14  ? 5.973   18.967 19.686  1.00 29.23  ? 38  PHE A CB    1 
ATOM   103  C  CG    . PHE A 1 14  ? 7.217   19.138 20.485  1.00 28.48  ? 38  PHE A CG    1 
ATOM   104  C  CD1   . PHE A 1 14  ? 8.245   18.199 20.397  1.00 27.93  ? 38  PHE A CD1   1 
ATOM   105  C  CD2   . PHE A 1 14  ? 7.382   20.245 21.306  1.00 27.17  ? 38  PHE A CD2   1 
ATOM   106  C  CE1   . PHE A 1 14  ? 9.429   18.364 21.114  1.00 26.13  ? 38  PHE A CE1   1 
ATOM   107  C  CE2   . PHE A 1 14  ? 8.557   20.419 22.025  1.00 27.30  ? 38  PHE A CE2   1 
ATOM   108  C  CZ    . PHE A 1 14  ? 9.583   19.476 21.927  1.00 27.14  ? 38  PHE A CZ    1 
ATOM   109  N  N     . TYR A 1 15  ? 3.958   18.375 21.907  1.00 28.46  ? 39  TYR A N     1 
ATOM   110  C  CA    . TYR A 1 15  ? 3.616   18.344 23.328  1.00 28.30  ? 39  TYR A CA    1 
ATOM   111  C  C     . TYR A 1 15  ? 3.084   16.992 23.788  1.00 27.45  ? 39  TYR A C     1 
ATOM   112  O  O     . TYR A 1 15  ? 3.454   16.504 24.847  1.00 27.24  ? 39  TYR A O     1 
ATOM   113  C  CB    . TYR A 1 15  ? 2.593   19.434 23.679  1.00 28.87  ? 39  TYR A CB    1 
ATOM   114  C  CG    . TYR A 1 15  ? 3.122   20.855 23.618  1.00 27.30  ? 39  TYR A CG    1 
ATOM   115  C  CD1   . TYR A 1 15  ? 4.456   21.121 23.262  1.00 26.71  ? 39  TYR A CD1   1 
ATOM   116  C  CD2   . TYR A 1 15  ? 2.275   21.937 23.859  1.00 24.62  ? 39  TYR A CD2   1 
ATOM   117  C  CE1   . TYR A 1 15  ? 4.918   22.427 23.141  1.00 24.47  ? 39  TYR A CE1   1 
ATOM   118  C  CE2   . TYR A 1 15  ? 2.730   23.241 23.742  1.00 25.07  ? 39  TYR A CE2   1 
ATOM   119  C  CZ    . TYR A 1 15  ? 4.044   23.478 23.383  1.00 24.88  ? 39  TYR A CZ    1 
ATOM   120  O  OH    . TYR A 1 15  ? 4.471   24.770 23.267  1.00 28.26  ? 39  TYR A OH    1 
ATOM   121  N  N     . ALA A 1 16  ? 2.206   16.390 23.001  1.00 27.26  ? 40  ALA A N     1 
ATOM   122  C  CA    . ALA A 1 16  ? 1.664   15.093 23.372  1.00 27.19  ? 40  ALA A CA    1 
ATOM   123  C  C     . ALA A 1 16  ? 2.825   14.122 23.447  1.00 27.58  ? 40  ALA A C     1 
ATOM   124  O  O     . ALA A 1 16  ? 2.919   13.314 24.367  1.00 26.79  ? 40  ALA A O     1 
ATOM   125  C  CB    . ALA A 1 16  ? 0.657   14.620 22.332  1.00 26.32  ? 40  ALA A CB    1 
ATOM   126  N  N     . GLN A 1 17  ? 3.724   14.222 22.476  1.00 28.10  ? 41  GLN A N     1 
ATOM   127  C  CA    . GLN A 1 17  ? 4.875   13.336 22.423  1.00 28.05  ? 41  GLN A CA    1 
ATOM   128  C  C     . GLN A 1 17  ? 5.715   13.428 23.702  1.00 28.10  ? 41  GLN A C     1 
ATOM   129  O  O     . GLN A 1 17  ? 6.258   12.433 24.168  1.00 27.49  ? 41  GLN A O     1 
ATOM   130  C  CB    . GLN A 1 17  ? 5.710   13.663 21.182  1.00 27.29  ? 41  GLN A CB    1 
ATOM   131  C  CG    . GLN A 1 17  ? 6.392   12.449 20.563  1.00 28.22  ? 41  GLN A CG    1 
ATOM   132  C  CD    . GLN A 1 17  ? 7.010   12.721 19.187  1.00 27.73  ? 41  GLN A CD    1 
ATOM   133  O  OE1   . GLN A 1 17  ? 7.940   12.039 18.784  1.00 29.86  ? 41  GLN A OE1   1 
ATOM   134  N  NE2   . GLN A 1 17  ? 6.484   13.702 18.466  1.00 24.79  ? 41  GLN A NE2   1 
ATOM   135  N  N     . VAL A 1 18  ? 5.804   14.616 24.285  1.00 28.67  ? 42  VAL A N     1 
ATOM   136  C  CA    . VAL A 1 18  ? 6.577   14.792 25.509  1.00 29.92  ? 42  VAL A CA    1 
ATOM   137  C  C     . VAL A 1 18  ? 5.801   14.234 26.714  1.00 32.95  ? 42  VAL A C     1 
ATOM   138  O  O     . VAL A 1 18  ? 6.356   13.529 27.555  1.00 31.20  ? 42  VAL A O     1 
ATOM   139  C  CB    . VAL A 1 18  ? 6.889   16.280 25.745  1.00 28.42  ? 42  VAL A CB    1 
ATOM   140  C  CG1   . VAL A 1 18  ? 7.730   16.451 26.998  1.00 27.11  ? 42  VAL A CG1   1 
ATOM   141  C  CG2   . VAL A 1 18  ? 7.598   16.849 24.543  1.00 26.55  ? 42  VAL A CG2   1 
ATOM   142  N  N     . GLU A 1 19  ? 4.515   14.559 26.788  1.00 35.88  ? 43  GLU A N     1 
ATOM   143  C  CA    . GLU A 1 19  ? 3.670   14.076 27.867  1.00 40.20  ? 43  GLU A CA    1 
ATOM   144  C  C     . GLU A 1 19  ? 3.641   12.549 27.875  1.00 44.09  ? 43  GLU A C     1 
ATOM   145  O  O     . GLU A 1 19  ? 3.721   11.924 28.934  1.00 46.34  ? 43  GLU A O     1 
ATOM   146  C  CB    . GLU A 1 19  ? 2.242   14.605 27.705  1.00 40.01  ? 43  GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 19  ? 2.097   16.103 27.915  1.00 40.20  ? 43  GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 19  ? 2.710   16.541 29.223  1.00 40.72  ? 43  GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 19  ? 2.744   15.704 30.146  1.00 40.70  ? 43  GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 19  ? 3.150   17.708 29.338  1.00 40.09  ? 43  GLU A OE2   1 
ATOM   151  N  N     . MET A 1 20  ? 3.526   11.947 26.694  1.00 46.68  ? 44  MET A N     1 
ATOM   152  C  CA    . MET A 1 20  ? 3.480   10.492 26.588  1.00 48.18  ? 44  MET A CA    1 
ATOM   153  C  C     . MET A 1 20  ? 4.761   9.834  27.059  1.00 49.13  ? 44  MET A C     1 
ATOM   154  O  O     . MET A 1 20  ? 4.729   8.772  27.678  1.00 49.35  ? 44  MET A O     1 
ATOM   155  C  CB    . MET A 1 20  ? 3.200   10.063 25.152  1.00 48.37  ? 44  MET A CB    1 
ATOM   156  C  CG    . MET A 1 20  ? 1.847   10.466 24.664  1.00 48.41  ? 44  MET A CG    1 
ATOM   157  S  SD    . MET A 1 20  ? 1.576   9.822  23.044  1.00 51.09  ? 44  MET A SD    1 
ATOM   158  C  CE    . MET A 1 20  ? 0.110   8.862  23.340  1.00 51.33  ? 44  MET A CE    1 
ATOM   159  N  N     . ILE A 1 21  ? 5.896   10.445 26.751  1.00 50.26  ? 45  ILE A N     1 
ATOM   160  C  CA    . ILE A 1 21  ? 7.157   9.875  27.189  1.00 52.05  ? 45  ILE A CA    1 
ATOM   161  C  C     . ILE A 1 21  ? 7.195   9.954  28.713  1.00 55.32  ? 45  ILE A C     1 
ATOM   162  O  O     . ILE A 1 21  ? 7.730   9.065  29.370  1.00 56.39  ? 45  ILE A O     1 
ATOM   163  C  CB    . ILE A 1 21  ? 8.346   10.621 26.565  1.00 49.56  ? 45  ILE A CB    1 
ATOM   164  C  CG1   . ILE A 1 21  ? 8.368   10.336 25.059  1.00 48.53  ? 45  ILE A CG1   1 
ATOM   165  C  CG2   . ILE A 1 21  ? 9.640   10.201 27.231  1.00 47.57  ? 45  ILE A CG2   1 
ATOM   166  C  CD1   . ILE A 1 21  ? 9.480   11.011 24.282  1.00 46.95  ? 45  ILE A CD1   1 
ATOM   167  N  N     . SER A 1 22  ? 6.596   11.006 29.269  1.00 58.10  ? 46  SER A N     1 
ATOM   168  C  CA    . SER A 1 22  ? 6.540   11.185 30.720  1.00 60.45  ? 46  SER A CA    1 
ATOM   169  C  C     . SER A 1 22  ? 5.785   10.020 31.342  1.00 62.36  ? 46  SER A C     1 
ATOM   170  O  O     . SER A 1 22  ? 6.387   9.160  31.979  1.00 63.79  ? 46  SER A O     1 
ATOM   171  C  CB    . SER A 1 22  ? 5.830   12.491 31.086  1.00 59.58  ? 46  SER A CB    1 
ATOM   172  O  OG    . SER A 1 22  ? 6.570   13.616 30.652  1.00 62.06  ? 46  SER A OG    1 
ATOM   173  N  N     . ASN A 1 23  ? 4.467   10.000 31.159  1.00 63.93  ? 47  ASN A N     1 
ATOM   174  C  CA    . ASN A 1 23  ? 3.633   8.929  31.692  1.00 65.74  ? 47  ASN A CA    1 
ATOM   175  C  C     . ASN A 1 23  ? 3.164   8.029  30.544  1.00 67.60  ? 47  ASN A C     1 
ATOM   176  O  O     . ASN A 1 23  ? 2.162   8.320  29.879  1.00 67.72  ? 47  ASN A O     1 
ATOM   177  C  CB    . ASN A 1 23  ? 2.428   9.513  32.435  1.00 66.57  ? 47  ASN A CB    1 
ATOM   178  C  CG    . ASN A 1 23  ? 1.557   8.437  33.076  1.00 68.26  ? 47  ASN A CG    1 
ATOM   179  O  OD1   . ASN A 1 23  ? 0.912   7.648  32.385  1.00 68.37  ? 47  ASN A OD1   1 
ATOM   180  N  ND2   . ASN A 1 23  ? 1.544   8.399  34.406  1.00 69.29  ? 47  ASN A ND2   1 
ATOM   181  N  N     . PRO A 1 24  ? 3.887   6.916  30.302  1.00 68.20  ? 48  PRO A N     1 
ATOM   182  C  CA    . PRO A 1 24  ? 3.603   5.936  29.248  1.00 68.70  ? 48  PRO A CA    1 
ATOM   183  C  C     . PRO A 1 24  ? 2.160   5.463  29.182  1.00 69.79  ? 48  PRO A C     1 
ATOM   184  O  O     . PRO A 1 24  ? 1.620   5.274  28.092  1.00 69.96  ? 48  PRO A O     1 
ATOM   185  C  CB    . PRO A 1 24  ? 4.570   4.803  29.567  1.00 67.95  ? 48  PRO A CB    1 
ATOM   186  C  CG    . PRO A 1 24  ? 5.741   5.538  30.109  1.00 68.57  ? 48  PRO A CG    1 
ATOM   187  C  CD    . PRO A 1 24  ? 5.085   6.514  31.056  1.00 67.99  ? 48  PRO A CD    1 
ATOM   188  N  N     . GLU A 1 25  ? 1.540   5.272  30.344  1.00 71.47  ? 49  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 0.152   4.820  30.409  1.00 73.64  ? 49  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? -0.736  5.653  29.495  1.00 73.22  ? 49  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? -1.839  5.242  29.141  1.00 72.59  ? 49  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? -0.369  4.898  31.851  1.00 76.76  ? 49  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 0.162   3.794  32.770  1.00 81.22  ? 49  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 0.020   4.128  34.252  1.00 83.93  ? 49  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? -1.117  4.383  34.711  1.00 85.47  ? 49  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 1.055   4.132  34.960  1.00 85.28  ? 49  GLU A OE2   1 
ATOM   197  N  N     . LEU A 1 26  ? -0.237  6.821  29.104  1.00 73.20  ? 50  LEU A N     1 
ATOM   198  C  CA    . LEU A 1 26  ? -0.976  7.722  28.230  1.00 72.60  ? 50  LEU A CA    1 
ATOM   199  C  C     . LEU A 1 26  ? -0.928  7.314  26.755  1.00 72.49  ? 50  LEU A C     1 
ATOM   200  O  O     . LEU A 1 26  ? -1.759  7.759  25.960  1.00 72.09  ? 50  LEU A O     1 
ATOM   201  C  CB    . LEU A 1 26  ? -0.445  9.148  28.402  1.00 72.07  ? 50  LEU A CB    1 
ATOM   202  C  CG    . LEU A 1 26  ? -0.701  9.760  29.785  1.00 71.29  ? 50  LEU A CG    1 
ATOM   203  C  CD1   . LEU A 1 26  ? 0.095   11.045 29.952  1.00 70.40  ? 50  LEU A CD1   1 
ATOM   204  C  CD2   . LEU A 1 26  ? -2.193  10.015 29.955  1.00 70.22  ? 50  LEU A CD2   1 
ATOM   205  N  N     . LYS A 1 27  ? 0.035   6.471  26.386  1.00 72.26  ? 51  LYS A N     1 
ATOM   206  C  CA    . LYS A 1 27  ? 0.149   6.021  25.001  1.00 72.45  ? 51  LYS A CA    1 
ATOM   207  C  C     . LYS A 1 27  ? -1.123  5.301  24.565  1.00 72.79  ? 51  LYS A C     1 
ATOM   208  O  O     . LYS A 1 27  ? -1.981  5.001  25.395  1.00 71.75  ? 51  LYS A O     1 
ATOM   209  C  CB    . LYS A 1 27  ? 1.345   5.083  24.828  1.00 72.01  ? 51  LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 27  ? 2.682   5.731  25.113  1.00 72.59  ? 51  LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 27  ? 3.753   5.252  24.141  1.00 72.50  ? 51  LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 27  ? 4.077   3.780  24.321  1.00 72.76  ? 51  LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 27  ? 5.065   3.309  23.302  1.00 72.63  ? 51  LYS A NZ    1 
ATOM   214  N  N     . ASP A 1 28  ? -1.233  5.035  23.263  1.00 73.87  ? 52  ASP A N     1 
ATOM   215  C  CA    . ASP A 1 28  ? -2.384  4.344  22.663  1.00 74.72  ? 52  ASP A CA    1 
ATOM   216  C  C     . ASP A 1 28  ? -3.758  4.846  23.118  1.00 74.25  ? 52  ASP A C     1 
ATOM   217  O  O     . ASP A 1 28  ? -4.785  4.475  22.542  1.00 74.03  ? 52  ASP A O     1 
ATOM   218  C  CB    . ASP A 1 28  ? -2.295  2.839  22.917  1.00 75.66  ? 52  ASP A CB    1 
ATOM   219  C  CG    . ASP A 1 28  ? -2.250  2.501  24.390  1.00 77.18  ? 52  ASP A CG    1 
ATOM   220  O  OD1   . ASP A 1 28  ? -1.147  2.564  24.977  1.00 78.11  ? 52  ASP A OD1   1 
ATOM   221  O  OD2   . ASP A 1 28  ? -3.321  2.191  24.964  1.00 77.76  ? 52  ASP A OD2   1 
ATOM   222  N  N     . LYS A 1 29  ? -3.772  5.674  24.160  1.00 73.28  ? 53  LYS A N     1 
ATOM   223  C  CA    . LYS A 1 29  ? -5.004  6.250  24.684  1.00 71.99  ? 53  LYS A CA    1 
ATOM   224  C  C     . LYS A 1 29  ? -5.093  7.645  24.101  1.00 69.82  ? 53  LYS A C     1 
ATOM   225  O  O     . LYS A 1 29  ? -4.093  8.353  24.041  1.00 69.86  ? 53  LYS A O     1 
ATOM   226  C  CB    . LYS A 1 29  ? -4.946  6.400  26.205  1.00 73.94  ? 53  LYS A CB    1 
ATOM   227  C  CG    . LYS A 1 29  ? -4.722  5.133  27.019  1.00 76.55  ? 53  LYS A CG    1 
ATOM   228  C  CD    . LYS A 1 29  ? -4.626  5.499  28.504  1.00 76.79  ? 53  LYS A CD    1 
ATOM   229  C  CE    . LYS A 1 29  ? -4.478  4.284  29.408  1.00 77.42  ? 53  LYS A CE    1 
ATOM   230  N  NZ    . LYS A 1 29  ? -4.335  4.699  30.840  1.00 77.86  ? 53  LYS A NZ    1 
ATOM   231  N  N     . PRO A 1 30  ? -6.287  8.065  23.669  1.00 68.54  ? 54  PRO A N     1 
ATOM   232  C  CA    . PRO A 1 30  ? -6.400  9.414  23.107  1.00 66.77  ? 54  PRO A CA    1 
ATOM   233  C  C     . PRO A 1 30  ? -5.949  10.472 24.124  1.00 64.45  ? 54  PRO A C     1 
ATOM   234  O  O     . PRO A 1 30  ? -6.578  10.665 25.169  1.00 63.60  ? 54  PRO A O     1 
ATOM   235  C  CB    . PRO A 1 30  ? -7.885  9.518  22.749  1.00 67.92  ? 54  PRO A CB    1 
ATOM   236  C  CG    . PRO A 1 30  ? -8.550  8.566  23.722  1.00 68.65  ? 54  PRO A CG    1 
ATOM   237  C  CD    . PRO A 1 30  ? -7.598  7.394  23.712  1.00 69.11  ? 54  PRO A CD    1 
ATOM   238  N  N     . LEU A 1 31  ? -4.844  11.145 23.813  1.00 61.44  ? 55  LEU A N     1 
ATOM   239  C  CA    . LEU A 1 31  ? -4.296  12.163 24.695  1.00 56.83  ? 55  LEU A CA    1 
ATOM   240  C  C     . LEU A 1 31  ? -4.302  13.543 24.079  1.00 54.72  ? 55  LEU A C     1 
ATOM   241  O  O     . LEU A 1 31  ? -3.780  13.753 22.987  1.00 54.43  ? 55  LEU A O     1 
ATOM   242  C  CB    . LEU A 1 31  ? -2.869  11.805 25.092  1.00 55.65  ? 55  LEU A CB    1 
ATOM   243  C  CG    . LEU A 1 31  ? -2.157  12.897 25.885  1.00 55.20  ? 55  LEU A CG    1 
ATOM   244  C  CD1   . LEU A 1 31  ? -2.999  13.292 27.086  1.00 55.67  ? 55  LEU A CD1   1 
ATOM   245  C  CD2   . LEU A 1 31  ? -0.797  12.402 26.326  1.00 54.73  ? 55  LEU A CD2   1 
ATOM   246  N  N     . GLY A 1 32  ? -4.900  14.484 24.796  1.00 53.06  ? 56  GLY A N     1 
ATOM   247  C  CA    . GLY A 1 32  ? -4.956  15.854 24.329  1.00 51.31  ? 56  GLY A CA    1 
ATOM   248  C  C     . GLY A 1 32  ? -4.274  16.747 25.348  1.00 49.82  ? 56  GLY A C     1 
ATOM   249  O  O     . GLY A 1 32  ? -4.419  16.525 26.549  1.00 50.39  ? 56  GLY A O     1 
ATOM   250  N  N     . VAL A 1 33  ? -3.512  17.736 24.888  1.00 47.88  ? 57  VAL A N     1 
ATOM   251  C  CA    . VAL A 1 33  ? -2.842  18.639 25.812  1.00 45.01  ? 57  VAL A CA    1 
ATOM   252  C  C     . VAL A 1 33  ? -3.674  19.906 25.904  1.00 44.28  ? 57  VAL A C     1 
ATOM   253  O  O     . VAL A 1 33  ? -4.056  20.500 24.895  1.00 42.20  ? 57  VAL A O     1 
ATOM   254  C  CB    . VAL A 1 33  ? -1.406  18.957 25.364  1.00 43.92  ? 57  VAL A CB    1 
ATOM   255  C  CG1   . VAL A 1 33  ? -0.696  19.755 26.443  1.00 43.64  ? 57  VAL A CG1   1 
ATOM   256  C  CG2   . VAL A 1 33  ? -0.647  17.670 25.115  1.00 43.17  ? 57  VAL A CG2   1 
ATOM   257  N  N     . GLN A 1 34  ? -3.952  20.307 27.136  1.00 44.57  ? 58  GLN A N     1 
ATOM   258  C  CA    . GLN A 1 34  ? -4.789  21.460 27.397  1.00 46.02  ? 58  GLN A CA    1 
ATOM   259  C  C     . GLN A 1 34  ? -4.104  22.676 28.016  1.00 46.32  ? 58  GLN A C     1 
ATOM   260  O  O     . GLN A 1 34  ? -3.228  22.555 28.876  1.00 45.79  ? 58  GLN A O     1 
ATOM   261  C  CB    . GLN A 1 34  ? -5.933  21.017 28.304  1.00 47.86  ? 58  GLN A CB    1 
ATOM   262  C  CG    . GLN A 1 34  ? -6.994  22.057 28.570  1.00 51.24  ? 58  GLN A CG    1 
ATOM   263  C  CD    . GLN A 1 34  ? -7.963  21.627 29.661  1.00 52.23  ? 58  GLN A CD    1 
ATOM   264  O  OE1   . GLN A 1 34  ? -8.996  22.259 29.875  1.00 53.20  ? 58  GLN A OE1   1 
ATOM   265  N  NE2   . GLN A 1 34  ? -7.624  20.552 30.364  1.00 53.69  ? 58  GLN A NE2   1 
ATOM   266  N  N     . GLN A 1 35  ? -4.527  23.848 27.553  1.00 46.33  ? 59  GLN A N     1 
ATOM   267  C  CA    . GLN A 1 35  ? -4.053  25.137 28.046  1.00 46.76  ? 59  GLN A CA    1 
ATOM   268  C  C     . GLN A 1 35  ? -5.340  25.926 28.191  1.00 46.86  ? 59  GLN A C     1 
ATOM   269  O  O     . GLN A 1 35  ? -5.986  26.255 27.197  1.00 46.41  ? 59  GLN A O     1 
ATOM   270  C  CB    . GLN A 1 35  ? -3.136  25.827 27.034  1.00 47.87  ? 59  GLN A CB    1 
ATOM   271  C  CG    . GLN A 1 35  ? -1.789  25.151 26.847  1.00 48.17  ? 59  GLN A CG    1 
ATOM   272  C  CD    . GLN A 1 35  ? -0.865  25.932 25.933  1.00 48.30  ? 59  GLN A CD    1 
ATOM   273  O  OE1   . GLN A 1 35  ? -1.313  26.561 24.974  1.00 48.47  ? 59  GLN A OE1   1 
ATOM   274  N  NE2   . GLN A 1 35  ? 0.436   25.879 26.214  1.00 46.41  ? 59  GLN A NE2   1 
ATOM   275  N  N     . LYS A 1 36  ? -5.716  26.221 29.429  1.00 47.31  ? 60  LYS A N     1 
ATOM   276  C  CA    . LYS A 1 36  ? -6.963  26.924 29.680  1.00 48.07  ? 60  LYS A CA    1 
ATOM   277  C  C     . LYS A 1 36  ? -8.110  26.074 29.137  1.00 48.95  ? 60  LYS A C     1 
ATOM   278  O  O     . LYS A 1 36  ? -8.257  24.911 29.508  1.00 48.69  ? 60  LYS A O     1 
ATOM   279  C  CB    . LYS A 1 36  ? -6.957  28.305 29.018  1.00 47.42  ? 60  LYS A CB    1 
ATOM   280  C  CG    . LYS A 1 36  ? -6.040  29.295 29.721  1.00 48.40  ? 60  LYS A CG    1 
ATOM   281  C  CD    . LYS A 1 36  ? -6.382  29.372 31.207  1.00 48.78  ? 60  LYS A CD    1 
ATOM   282  C  CE    . LYS A 1 36  ? -5.404  30.224 31.998  1.00 47.83  ? 60  LYS A CE    1 
ATOM   283  N  NZ    . LYS A 1 36  ? -4.092  29.555 32.209  1.00 49.43  ? 60  LYS A NZ    1 
ATOM   284  N  N     . TYR A 1 37  ? -8.918  26.639 28.253  1.00 50.15  ? 61  TYR A N     1 
ATOM   285  C  CA    . TYR A 1 37  ? -10.041 25.893 27.707  1.00 52.12  ? 61  TYR A CA    1 
ATOM   286  C  C     . TYR A 1 37  ? -9.758  25.407 26.299  1.00 52.78  ? 61  TYR A C     1 
ATOM   287  O  O     . TYR A 1 37  ? -10.670 25.236 25.488  1.00 53.62  ? 61  TYR A O     1 
ATOM   288  C  CB    . TYR A 1 37  ? -11.273 26.774 27.697  1.00 53.19  ? 61  TYR A CB    1 
ATOM   289  C  CG    . TYR A 1 37  ? -11.107 28.007 26.845  1.00 55.63  ? 61  TYR A CG    1 
ATOM   290  C  CD1   . TYR A 1 37  ? -11.328 27.965 25.464  1.00 56.18  ? 61  TYR A CD1   1 
ATOM   291  C  CD2   . TYR A 1 37  ? -10.755 29.225 27.419  1.00 55.77  ? 61  TYR A CD2   1 
ATOM   292  C  CE1   . TYR A 1 37  ? -11.210 29.111 24.677  1.00 55.57  ? 61  TYR A CE1   1 
ATOM   293  C  CE2   . TYR A 1 37  ? -10.634 30.375 26.641  1.00 56.64  ? 61  TYR A CE2   1 
ATOM   294  C  CZ    . TYR A 1 37  ? -10.864 30.313 25.272  1.00 55.67  ? 61  TYR A CZ    1 
ATOM   295  O  OH    . TYR A 1 37  ? -10.760 31.460 24.516  1.00 53.54  ? 61  TYR A OH    1 
ATOM   296  N  N     . LEU A 1 38  ? -8.490  25.183 26.002  1.00 52.26  ? 62  LEU A N     1 
ATOM   297  C  CA    . LEU A 1 38  ? -8.138  24.728 24.675  1.00 51.22  ? 62  LEU A CA    1 
ATOM   298  C  C     . LEU A 1 38  ? -7.340  23.446 24.689  1.00 49.98  ? 62  LEU A C     1 
ATOM   299  O  O     . LEU A 1 38  ? -6.630  23.136 25.650  1.00 50.24  ? 62  LEU A O     1 
ATOM   300  C  CB    . LEU A 1 38  ? -7.341  25.805 23.943  1.00 52.48  ? 62  LEU A CB    1 
ATOM   301  C  CG    . LEU A 1 38  ? -8.097  26.820 23.089  1.00 53.73  ? 62  LEU A CG    1 
ATOM   302  C  CD1   . LEU A 1 38  ? -7.712  28.207 23.528  1.00 55.55  ? 62  LEU A CD1   1 
ATOM   303  C  CD2   . LEU A 1 38  ? -7.746  26.631 21.616  1.00 55.37  ? 62  LEU A CD2   1 
ATOM   304  N  N     . VAL A 1 39  ? -7.489  22.688 23.613  1.00 47.83  ? 63  VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? -6.747  21.455 23.441  1.00 45.58  ? 63  VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? -5.793  21.842 22.323  1.00 43.21  ? 63  VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? -6.092  21.686 21.138  1.00 43.37  ? 63  VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? -7.665  20.284 23.009  1.00 45.29  ? 63  VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? -6.819  19.066 22.674  1.00 44.73  ? 63  VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? -8.644  19.947 24.136  1.00 43.76  ? 63  VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? -4.657  22.395 22.728  1.00 40.50  ? 64  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? -3.643  22.866 21.807  1.00 38.08  ? 64  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? -3.108  21.783 20.867  1.00 37.79  ? 64  VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? -2.898  22.028 19.687  1.00 37.21  ? 64  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? -2.495  23.552 22.602  1.00 37.75  ? 64  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 40  ? -3.031  24.807 23.285  1.00 36.21  ? 64  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 40  ? -1.926  22.606 23.650  1.00 35.02  ? 64  VAL A CG2   1 
ATOM   318  N  N     . THR A 1 41  ? -2.903  20.580 21.381  1.00 39.06  ? 65  THR A N     1 
ATOM   319  C  CA    . THR A 1 41  ? -2.416  19.479 20.555  1.00 40.48  ? 65  THR A CA    1 
ATOM   320  C  C     . THR A 1 41  ? -2.895  18.155 21.160  1.00 42.05  ? 65  THR A C     1 
ATOM   321  O  O     . THR A 1 41  ? -3.361  18.120 22.298  1.00 41.84  ? 65  THR A O     1 
ATOM   322  C  CB    . THR A 1 41  ? -0.859  19.482 20.459  1.00 39.76  ? 65  THR A CB    1 
ATOM   323  O  OG1   . THR A 1 41  ? -0.433  18.478 19.525  1.00 40.13  ? 65  THR A OG1   1 
ATOM   324  C  CG2   . THR A 1 41  ? -0.233  19.194 21.818  1.00 36.86  ? 65  THR A CG2   1 
ATOM   325  N  N     . CYS A 1 42  ? -2.791  17.074 20.392  1.00 43.87  ? 66  CYS A N     1 
ATOM   326  C  CA    . CYS A 1 42  ? -3.211  15.750 20.852  1.00 45.24  ? 66  CYS A CA    1 
ATOM   327  C  C     . CYS A 1 42  ? -2.491  14.681 20.049  1.00 46.47  ? 66  CYS A C     1 
ATOM   328  O  O     . CYS A 1 42  ? -2.042  14.938 18.927  1.00 45.97  ? 66  CYS A O     1 
ATOM   329  C  CB    . CYS A 1 42  ? -4.720  15.575 20.679  1.00 45.67  ? 66  CYS A CB    1 
ATOM   330  S  SG    . CYS A 1 42  ? -5.311  15.880 18.993  1.00 46.68  ? 66  CYS A SG    1 
ATOM   331  N  N     . ASN A 1 43  ? -2.368  13.487 20.622  1.00 47.40  ? 67  ASN A N     1 
ATOM   332  C  CA    . ASN A 1 43  ? -1.703  12.400 19.916  1.00 50.01  ? 67  ASN A CA    1 
ATOM   333  C  C     . ASN A 1 43  ? -2.605  11.954 18.772  1.00 51.59  ? 67  ASN A C     1 
ATOM   334  O  O     . ASN A 1 43  ? -3.792  12.282 18.751  1.00 51.58  ? 67  ASN A O     1 
ATOM   335  C  CB    . ASN A 1 43  ? -1.402  11.228 20.857  1.00 49.33  ? 67  ASN A CB    1 
ATOM   336  C  CG    . ASN A 1 43  ? -2.633  10.710 21.558  1.00 49.66  ? 67  ASN A CG    1 
ATOM   337  O  OD1   . ASN A 1 43  ? -3.762  11.042 21.195  1.00 50.59  ? 67  ASN A OD1   1 
ATOM   338  N  ND2   . ASN A 1 43  ? -2.423  9.883  22.569  1.00 49.27  ? 67  ASN A ND2   1 
ATOM   339  N  N     . TYR A 1 44  ? -2.046  11.211 17.822  1.00 54.19  ? 68  TYR A N     1 
ATOM   340  C  CA    . TYR A 1 44  ? -2.813  10.769 16.666  1.00 57.38  ? 68  TYR A CA    1 
ATOM   341  C  C     . TYR A 1 44  ? -4.007  9.898  16.983  1.00 59.02  ? 68  TYR A C     1 
ATOM   342  O  O     . TYR A 1 44  ? -5.024  9.959  16.292  1.00 58.28  ? 68  TYR A O     1 
ATOM   343  C  CB    . TYR A 1 44  ? -1.886  10.088 15.669  1.00 58.35  ? 68  TYR A CB    1 
ATOM   344  C  CG    . TYR A 1 44  ? -1.238  11.098 14.757  1.00 60.76  ? 68  TYR A CG    1 
ATOM   345  C  CD1   . TYR A 1 44  ? -1.907  11.563 13.623  1.00 61.27  ? 68  TYR A CD1   1 
ATOM   346  C  CD2   . TYR A 1 44  ? 0.019   11.633 15.050  1.00 60.98  ? 68  TYR A CD2   1 
ATOM   347  C  CE1   . TYR A 1 44  ? -1.342  12.535 12.797  1.00 62.41  ? 68  TYR A CE1   1 
ATOM   348  C  CE2   . TYR A 1 44  ? 0.595   12.609 14.233  1.00 62.35  ? 68  TYR A CE2   1 
ATOM   349  C  CZ    . TYR A 1 44  ? -0.091  13.052 13.103  1.00 63.67  ? 68  TYR A CZ    1 
ATOM   350  O  OH    . TYR A 1 44  ? 0.485   13.981 12.260  1.00 63.96  ? 68  TYR A OH    1 
ATOM   351  N  N     . GLU A 1 45  ? -3.886  9.097  18.035  1.00 61.65  ? 69  GLU A N     1 
ATOM   352  C  CA    . GLU A 1 45  ? -4.976  8.235  18.468  1.00 62.90  ? 69  GLU A CA    1 
ATOM   353  C  C     . GLU A 1 45  ? -6.233  9.104  18.580  1.00 62.48  ? 69  GLU A C     1 
ATOM   354  O  O     . GLU A 1 45  ? -7.287  8.751  18.059  1.00 63.39  ? 69  GLU A O     1 
ATOM   355  C  CB    . GLU A 1 45  ? -4.621  7.617  19.824  1.00 65.57  ? 69  GLU A CB    1 
ATOM   356  C  CG    . GLU A 1 45  ? -5.587  6.564  20.360  1.00 70.89  ? 69  GLU A CG    1 
ATOM   357  C  CD    . GLU A 1 45  ? -5.617  5.291  19.525  1.00 74.27  ? 69  GLU A CD    1 
ATOM   358  O  OE1   . GLU A 1 45  ? -4.530  4.814  19.118  1.00 76.32  ? 69  GLU A OE1   1 
ATOM   359  O  OE2   . GLU A 1 45  ? -6.730  4.760  19.291  1.00 75.24  ? 69  GLU A OE2   1 
ATOM   360  N  N     . ALA A 1 46  ? -6.100  10.256 19.235  1.00 62.31  ? 70  ALA A N     1 
ATOM   361  C  CA    . ALA A 1 46  ? -7.209  11.193 19.425  1.00 62.84  ? 70  ALA A CA    1 
ATOM   362  C  C     . ALA A 1 46  ? -7.653  11.907 18.140  1.00 63.57  ? 70  ALA A C     1 
ATOM   363  O  O     . ALA A 1 46  ? -8.841  12.164 17.946  1.00 61.97  ? 70  ALA A O     1 
ATOM   364  C  CB    . ALA A 1 46  ? -6.833  12.225 20.486  1.00 62.36  ? 70  ALA A CB    1 
ATOM   365  N  N     . ARG A 1 47  ? -6.699  12.247 17.275  1.00 64.93  ? 71  ARG A N     1 
ATOM   366  C  CA    . ARG A 1 47  ? -7.024  12.921 16.022  1.00 66.18  ? 71  ARG A CA    1 
ATOM   367  C  C     . ARG A 1 47  ? -7.932  12.033 15.203  1.00 66.28  ? 71  ARG A C     1 
ATOM   368  O  O     . ARG A 1 47  ? -8.793  12.518 14.467  1.00 66.29  ? 71  ARG A O     1 
ATOM   369  C  CB    . ARG A 1 47  ? -5.762  13.227 15.215  1.00 67.39  ? 71  ARG A CB    1 
ATOM   370  C  CG    . ARG A 1 47  ? -4.879  14.256 15.864  1.00 70.56  ? 71  ARG A CG    1 
ATOM   371  C  CD    . ARG A 1 47  ? -3.693  14.648 14.996  1.00 73.17  ? 71  ARG A CD    1 
ATOM   372  N  NE    . ARG A 1 47  ? -2.800  15.537 15.735  1.00 74.88  ? 71  ARG A NE    1 
ATOM   373  C  CZ    . ARG A 1 47  ? -1.787  16.211 15.202  1.00 76.01  ? 71  ARG A CZ    1 
ATOM   374  N  NH1   . ARG A 1 47  ? -1.522  16.108 13.906  1.00 76.35  ? 71  ARG A NH1   1 
ATOM   375  N  NH2   . ARG A 1 47  ? -1.041  16.995 15.972  1.00 77.29  ? 71  ARG A NH2   1 
ATOM   376  N  N     . LYS A 1 48  ? -7.723  10.726 15.332  1.00 66.38  ? 72  LYS A N     1 
ATOM   377  C  CA    . LYS A 1 48  ? -8.528  9.744  14.618  1.00 66.40  ? 72  LYS A CA    1 
ATOM   378  C  C     . LYS A 1 48  ? -9.980  9.867  15.053  1.00 66.43  ? 72  LYS A C     1 
ATOM   379  O  O     . LYS A 1 48  ? -10.898 9.743  14.241  1.00 65.99  ? 72  LYS A O     1 
ATOM   380  C  CB    . LYS A 1 48  ? -8.031  8.324  14.915  1.00 65.56  ? 72  LYS A CB    1 
ATOM   381  C  CG    . LYS A 1 48  ? -6.657  8.032  14.361  1.00 65.87  ? 72  LYS A CG    1 
ATOM   382  C  CD    . LYS A 1 48  ? -6.248  6.603  14.624  1.00 66.52  ? 72  LYS A CD    1 
ATOM   383  C  CE    . LYS A 1 48  ? -4.863  6.325  14.062  1.00 66.37  ? 72  LYS A CE    1 
ATOM   384  N  NZ    . LYS A 1 48  ? -4.436  4.917  14.300  1.00 66.64  ? 72  LYS A NZ    1 
ATOM   385  N  N     . LEU A 1 49  ? -10.174 10.130 16.342  1.00 66.44  ? 73  LEU A N     1 
ATOM   386  C  CA    . LEU A 1 49  ? -11.506 10.252 16.915  1.00 65.80  ? 73  LEU A CA    1 
ATOM   387  C  C     . LEU A 1 49  ? -12.140 11.641 16.750  1.00 66.00  ? 73  LEU A C     1 
ATOM   388  O  O     . LEU A 1 49  ? -13.156 11.944 17.377  1.00 66.86  ? 73  LEU A O     1 
ATOM   389  C  CB    . LEU A 1 49  ? -11.461 9.842  18.397  1.00 64.48  ? 73  LEU A CB    1 
ATOM   390  C  CG    . LEU A 1 49  ? -11.223 8.360  18.754  1.00 63.41  ? 73  LEU A CG    1 
ATOM   391  C  CD1   . LEU A 1 49  ? -9.983  7.802  18.073  1.00 62.58  ? 73  LEU A CD1   1 
ATOM   392  C  CD2   . LEU A 1 49  ? -11.073 8.244  20.256  1.00 63.23  ? 73  LEU A CD2   1 
ATOM   393  N  N     . GLY A 1 50  ? -11.542 12.482 15.912  1.00 65.99  ? 74  GLY A N     1 
ATOM   394  C  CA    . GLY A 1 50  ? -12.105 13.803 15.680  1.00 66.95  ? 74  GLY A CA    1 
ATOM   395  C  C     . GLY A 1 50  ? -11.492 14.998 16.396  1.00 67.69  ? 74  GLY A C     1 
ATOM   396  O  O     . GLY A 1 50  ? -11.874 16.143 16.130  1.00 66.82  ? 74  GLY A O     1 
ATOM   397  N  N     . VAL A 1 51  ? -10.548 14.753 17.301  1.00 68.92  ? 75  VAL A N     1 
ATOM   398  C  CA    . VAL A 1 51  ? -9.909  15.844 18.034  1.00 68.31  ? 75  VAL A CA    1 
ATOM   399  C  C     . VAL A 1 51  ? -8.958  16.618 17.120  1.00 69.09  ? 75  VAL A C     1 
ATOM   400  O  O     . VAL A 1 51  ? -7.960  16.077 16.651  1.00 68.92  ? 75  VAL A O     1 
ATOM   401  C  CB    . VAL A 1 51  ? -9.123  15.315 19.266  1.00 67.10  ? 75  VAL A CB    1 
ATOM   402  C  CG1   . VAL A 1 51  ? -8.509  16.472 20.034  1.00 64.77  ? 75  VAL A CG1   1 
ATOM   403  C  CG2   . VAL A 1 51  ? -10.047 14.520 20.171  1.00 65.50  ? 75  VAL A CG2   1 
ATOM   404  N  N     . LYS A 1 52  ? -9.289  17.880 16.856  1.00 70.53  ? 76  LYS A N     1 
ATOM   405  C  CA    . LYS A 1 52  ? -8.462  18.741 16.012  1.00 71.77  ? 76  LYS A CA    1 
ATOM   406  C  C     . LYS A 1 52  ? -7.752  19.737 16.904  1.00 71.96  ? 76  LYS A C     1 
ATOM   407  O  O     . LYS A 1 52  ? -8.323  20.200 17.888  1.00 72.46  ? 76  LYS A O     1 
ATOM   408  C  CB    . LYS A 1 52  ? -9.328  19.490 15.001  1.00 73.27  ? 76  LYS A CB    1 
ATOM   409  C  CG    . LYS A 1 52  ? -9.957  18.596 13.948  1.00 75.59  ? 76  LYS A CG    1 
ATOM   410  C  CD    . LYS A 1 52  ? -8.892  17.925 13.084  1.00 76.84  ? 76  LYS A CD    1 
ATOM   411  C  CE    . LYS A 1 52  ? -9.523  17.041 12.021  1.00 77.36  ? 76  LYS A CE    1 
ATOM   412  N  NZ    . LYS A 1 52  ? -10.508 17.797 11.190  1.00 78.30  ? 76  LYS A NZ    1 
ATOM   413  N  N     . LYS A 1 53  ? -6.512  20.071 16.567  1.00 72.64  ? 77  LYS A N     1 
ATOM   414  C  CA    . LYS A 1 53  ? -5.745  21.005 17.381  1.00 74.06  ? 77  LYS A CA    1 
ATOM   415  C  C     . LYS A 1 53  ? -6.472  22.311 17.565  1.00 74.55  ? 77  LYS A C     1 
ATOM   416  O  O     . LYS A 1 53  ? -7.248  22.727 16.705  1.00 74.34  ? 77  LYS A O     1 
ATOM   417  C  CB    . LYS A 1 53  ? -4.387  21.274 16.760  1.00 74.88  ? 77  LYS A CB    1 
ATOM   418  C  CG    . LYS A 1 53  ? -3.511  20.053 16.703  1.00 77.20  ? 77  LYS A CG    1 
ATOM   419  C  CD    . LYS A 1 53  ? -2.539  20.163 15.563  1.00 79.03  ? 77  LYS A CD    1 
ATOM   420  C  CE    . LYS A 1 53  ? -3.272  20.388 14.241  1.00 81.37  ? 77  LYS A CE    1 
ATOM   421  N  NZ    . LYS A 1 53  ? -3.835  21.770 14.122  1.00 83.24  ? 77  LYS A NZ    1 
ATOM   422  N  N     . LEU A 1 54  ? -6.203  22.957 18.694  1.00 75.26  ? 78  LEU A N     1 
ATOM   423  C  CA    . LEU A 1 54  ? -6.843  24.219 19.027  1.00 77.13  ? 78  LEU A CA    1 
ATOM   424  C  C     . LEU A 1 54  ? -8.357  24.061 18.900  1.00 78.59  ? 78  LEU A C     1 
ATOM   425  O  O     . LEU A 1 54  ? -9.008  24.746 18.108  1.00 79.27  ? 78  LEU A O     1 
ATOM   426  C  CB    . LEU A 1 54  ? -6.338  25.333 18.105  1.00 76.97  ? 78  LEU A CB    1 
ATOM   427  C  CG    . LEU A 1 54  ? -4.861  25.713 18.268  1.00 76.43  ? 78  LEU A CG    1 
ATOM   428  C  CD1   . LEU A 1 54  ? -4.435  26.630 17.138  1.00 75.36  ? 78  LEU A CD1   1 
ATOM   429  C  CD2   . LEU A 1 54  ? -4.652  26.386 19.615  1.00 76.00  ? 78  LEU A CD2   1 
ATOM   430  N  N     . MET A 1 55  ? -8.899  23.134 19.689  1.00 79.20  ? 79  MET A N     1 
ATOM   431  C  CA    . MET A 1 55  ? -10.327 22.845 19.717  1.00 79.05  ? 79  MET A CA    1 
ATOM   432  C  C     . MET A 1 55  ? -10.824 23.006 21.154  1.00 79.42  ? 79  MET A C     1 
ATOM   433  O  O     . MET A 1 55  ? -10.139 22.612 22.098  1.00 79.03  ? 79  MET A O     1 
ATOM   434  C  CB    . MET A 1 55  ? -10.570 21.418 19.220  1.00 79.01  ? 79  MET A CB    1 
ATOM   435  C  CG    . MET A 1 55  ? -11.989 20.913 19.400  1.00 80.55  ? 79  MET A CG    1 
ATOM   436  S  SD    . MET A 1 55  ? -12.302 19.399 18.455  1.00 83.11  ? 79  MET A SD    1 
ATOM   437  C  CE    . MET A 1 55  ? -11.804 18.142 19.576  1.00 81.44  ? 79  MET A CE    1 
ATOM   438  N  N     . ASN A 1 56  ? -12.002 23.603 21.321  1.00 80.09  ? 80  ASN A N     1 
ATOM   439  C  CA    . ASN A 1 56  ? -12.569 23.807 22.654  1.00 81.35  ? 80  ASN A CA    1 
ATOM   440  C  C     . ASN A 1 56  ? -12.597 22.490 23.416  1.00 81.65  ? 80  ASN A C     1 
ATOM   441  O  O     . ASN A 1 56  ? -12.883 21.446 22.839  1.00 82.32  ? 80  ASN A O     1 
ATOM   442  C  CB    . ASN A 1 56  ? -13.991 24.370 22.545  1.00 81.88  ? 80  ASN A CB    1 
ATOM   443  C  CG    . ASN A 1 56  ? -14.009 25.867 22.305  1.00 82.97  ? 80  ASN A CG    1 
ATOM   444  O  OD1   . ASN A 1 56  ? -13.992 26.658 23.250  1.00 82.80  ? 80  ASN A OD1   1 
ATOM   445  N  ND2   . ASN A 1 56  ? -14.031 26.265 21.034  1.00 83.17  ? 80  ASN A ND2   1 
ATOM   446  N  N     . VAL A 1 57  ? -12.293 22.535 24.708  1.00 81.78  ? 81  VAL A N     1 
ATOM   447  C  CA    . VAL A 1 57  ? -12.298 21.325 25.513  1.00 82.12  ? 81  VAL A CA    1 
ATOM   448  C  C     . VAL A 1 57  ? -13.645 20.626 25.391  1.00 82.84  ? 81  VAL A C     1 
ATOM   449  O  O     . VAL A 1 57  ? -13.714 19.400 25.321  1.00 83.12  ? 81  VAL A O     1 
ATOM   450  C  CB    . VAL A 1 57  ? -12.028 21.640 26.985  1.00 81.75  ? 81  VAL A CB    1 
ATOM   451  C  CG1   . VAL A 1 57  ? -12.128 20.374 27.812  1.00 81.97  ? 81  VAL A CG1   1 
ATOM   452  C  CG2   . VAL A 1 57  ? -10.652 22.254 27.126  1.00 81.93  ? 81  VAL A CG2   1 
ATOM   453  N  N     . ARG A 1 58  ? -14.715 21.412 25.364  1.00 83.71  ? 82  ARG A N     1 
ATOM   454  C  CA    . ARG A 1 58  ? -16.058 20.865 25.231  1.00 85.14  ? 82  ARG A CA    1 
ATOM   455  C  C     . ARG A 1 58  ? -16.222 20.197 23.867  1.00 84.62  ? 82  ARG A C     1 
ATOM   456  O  O     . ARG A 1 58  ? -16.418 18.987 23.792  1.00 85.20  ? 82  ARG A O     1 
ATOM   457  C  CB    . ARG A 1 58  ? -17.097 21.973 25.414  1.00 87.81  ? 82  ARG A CB    1 
ATOM   458  C  CG    . ARG A 1 58  ? -16.836 23.221 24.581  1.00 92.19  ? 82  ARG A CG    1 
ATOM   459  C  CD    . ARG A 1 58  ? -17.707 24.385 25.037  1.00 95.33  ? 82  ARG A CD    1 
ATOM   460  N  NE    . ARG A 1 58  ? -19.126 24.149 24.781  1.00 99.04  ? 82  ARG A NE    1 
ATOM   461  C  CZ    . ARG A 1 58  ? -20.107 24.935 25.217  1.00 100.44 ? 82  ARG A CZ    1 
ATOM   462  N  NH1   . ARG A 1 58  ? -19.827 26.013 25.940  1.00 101.37 ? 82  ARG A NH1   1 
ATOM   463  N  NH2   . ARG A 1 58  ? -21.368 24.647 24.925  1.00 101.32 ? 82  ARG A NH2   1 
ATOM   464  N  N     . ASP A 1 59  ? -16.135 20.980 22.793  1.00 84.03  ? 83  ASP A N     1 
ATOM   465  C  CA    . ASP A 1 59  ? -16.254 20.445 21.437  1.00 83.74  ? 83  ASP A CA    1 
ATOM   466  C  C     . ASP A 1 59  ? -15.362 19.215 21.307  1.00 84.54  ? 83  ASP A C     1 
ATOM   467  O  O     . ASP A 1 59  ? -15.580 18.368 20.442  1.00 84.87  ? 83  ASP A O     1 
ATOM   468  C  CB    . ASP A 1 59  ? -15.800 21.486 20.407  1.00 83.38  ? 83  ASP A CB    1 
ATOM   469  C  CG    . ASP A 1 59  ? -16.719 22.692 20.338  1.00 83.63  ? 83  ASP A CG    1 
ATOM   470  O  OD1   . ASP A 1 59  ? -17.182 23.147 21.404  1.00 84.15  ? 83  ASP A OD1   1 
ATOM   471  O  OD2   . ASP A 1 59  ? -16.966 23.196 19.219  1.00 81.93  ? 83  ASP A OD2   1 
ATOM   472  N  N     . ALA A 1 60  ? -14.359 19.130 22.182  1.00 85.77  ? 84  ALA A N     1 
ATOM   473  C  CA    . ALA A 1 60  ? -13.389 18.033 22.191  1.00 86.70  ? 84  ALA A CA    1 
ATOM   474  C  C     . ALA A 1 60  ? -13.870 16.763 22.879  1.00 87.07  ? 84  ALA A C     1 
ATOM   475  O  O     . ALA A 1 60  ? -13.582 15.656 22.427  1.00 86.46  ? 84  ALA A O     1 
ATOM   476  C  CB    . ALA A 1 60  ? -12.085 18.501 22.838  1.00 86.32  ? 84  ALA A CB    1 
ATOM   477  N  N     . LYS A 1 61  ? -14.585 16.920 23.984  1.00 88.04  ? 85  LYS A N     1 
ATOM   478  C  CA    . LYS A 1 61  ? -15.088 15.764 24.699  1.00 89.05  ? 85  LYS A CA    1 
ATOM   479  C  C     . LYS A 1 61  ? -16.429 15.302 24.144  1.00 89.72  ? 85  LYS A C     1 
ATOM   480  O  O     . LYS A 1 61  ? -16.773 14.132 24.260  1.00 89.60  ? 85  LYS A O     1 
ATOM   481  C  CB    . LYS A 1 61  ? -15.187 16.069 26.192  1.00 89.24  ? 85  LYS A CB    1 
ATOM   482  C  CG    . LYS A 1 61  ? -13.829 16.127 26.874  1.00 90.27  ? 85  LYS A CG    1 
ATOM   483  C  CD    . LYS A 1 61  ? -13.945 16.342 28.377  1.00 91.81  ? 85  LYS A CD    1 
ATOM   484  C  CE    . LYS A 1 61  ? -14.364 17.771 28.730  1.00 92.86  ? 85  LYS A CE    1 
ATOM   485  N  NZ    . LYS A 1 61  ? -15.721 18.157 28.237  1.00 93.01  ? 85  LYS A NZ    1 
ATOM   486  N  N     . GLU A 1 62  ? -17.186 16.213 23.538  1.00 90.53  ? 86  GLU A N     1 
ATOM   487  C  CA    . GLU A 1 62  ? -18.470 15.837 22.952  1.00 91.31  ? 86  GLU A CA    1 
ATOM   488  C  C     . GLU A 1 62  ? -18.209 15.352 21.525  1.00 91.23  ? 86  GLU A C     1 
ATOM   489  O  O     . GLU A 1 62  ? -19.106 15.331 20.680  1.00 91.60  ? 86  GLU A O     1 
ATOM   490  C  CB    . GLU A 1 62  ? -19.449 17.021 22.936  1.00 92.87  ? 86  GLU A CB    1 
ATOM   491  C  CG    . GLU A 1 62  ? -19.282 17.996 21.768  1.00 95.43  ? 86  GLU A CG    1 
ATOM   492  C  CD    . GLU A 1 62  ? -20.507 18.881 21.557  1.00 96.62  ? 86  GLU A CD    1 
ATOM   493  O  OE1   . GLU A 1 62  ? -20.832 19.691 22.459  1.00 96.59  ? 86  GLU A OE1   1 
ATOM   494  O  OE2   . GLU A 1 62  ? -21.148 18.759 20.487  1.00 96.75  ? 86  GLU A OE2   1 
ATOM   495  N  N     . LYS A 1 63  ? -16.958 14.976 21.274  1.00 90.60  ? 87  LYS A N     1 
ATOM   496  C  CA    . LYS A 1 63  ? -16.521 14.466 19.979  1.00 89.40  ? 87  LYS A CA    1 
ATOM   497  C  C     . LYS A 1 63  ? -15.773 13.176 20.307  1.00 88.56  ? 87  LYS A C     1 
ATOM   498  O  O     . LYS A 1 63  ? -15.659 12.268 19.483  1.00 88.44  ? 87  LYS A O     1 
ATOM   499  C  CB    . LYS A 1 63  ? -15.569 15.458 19.310  1.00 89.44  ? 87  LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 63  ? -15.434 15.295 17.801  1.00 90.13  ? 87  LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 63  ? -16.595 15.968 17.077  1.00 91.03  ? 87  LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 63  ? -16.358 16.057 15.575  1.00 90.59  ? 87  LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 63  ? -17.385 16.908 14.902  1.00 90.25  ? 87  LYS A NZ    1 
ATOM   504  N  N     . CYS A 1 64  ? -15.266 13.123 21.536  1.00 87.49  ? 88  CYS A N     1 
ATOM   505  C  CA    . CYS A 1 64  ? -14.524 11.978 22.055  1.00 87.20  ? 88  CYS A CA    1 
ATOM   506  C  C     . CYS A 1 64  ? -14.627 11.994 23.577  1.00 86.55  ? 88  CYS A C     1 
ATOM   507  O  O     . CYS A 1 64  ? -13.680 12.354 24.275  1.00 86.75  ? 88  CYS A O     1 
ATOM   508  C  CB    . CYS A 1 64  ? -13.050 12.050 21.644  1.00 87.06  ? 88  CYS A CB    1 
ATOM   509  S  SG    . CYS A 1 64  ? -11.974 10.889 22.535  1.00 87.03  ? 88  CYS A SG    1 
ATOM   510  N  N     . PRO A 1 65  ? -15.796 11.614 24.107  1.00 85.83  ? 89  PRO A N     1 
ATOM   511  C  CA    . PRO A 1 65  ? -16.077 11.570 25.548  1.00 84.59  ? 89  PRO A CA    1 
ATOM   512  C  C     . PRO A 1 65  ? -15.214 10.554 26.304  1.00 82.86  ? 89  PRO A C     1 
ATOM   513  O  O     . PRO A 1 65  ? -15.704 9.822  27.162  1.00 83.03  ? 89  PRO A O     1 
ATOM   514  C  CB    . PRO A 1 65  ? -17.563 11.208 25.597  1.00 85.50  ? 89  PRO A CB    1 
ATOM   515  C  CG    . PRO A 1 65  ? -18.102 11.732 24.282  1.00 85.73  ? 89  PRO A CG    1 
ATOM   516  C  CD    . PRO A 1 65  ? -17.013 11.337 23.323  1.00 86.01  ? 89  PRO A CD    1 
ATOM   517  N  N     . GLN A 1 66  ? -13.925 10.522 25.994  1.00 80.49  ? 90  GLN A N     1 
ATOM   518  C  CA    . GLN A 1 66  ? -13.015 9.583  26.636  1.00 77.99  ? 90  GLN A CA    1 
ATOM   519  C  C     . GLN A 1 66  ? -11.601 10.147 26.627  1.00 76.14  ? 90  GLN A C     1 
ATOM   520  O  O     . GLN A 1 66  ? -10.708 9.662  27.323  1.00 75.63  ? 90  GLN A O     1 
ATOM   521  C  CB    . GLN A 1 66  ? -13.052 8.269  25.873  1.00 78.45  ? 90  GLN A CB    1 
ATOM   522  C  CG    . GLN A 1 66  ? -13.283 8.480  24.392  1.00 78.87  ? 90  GLN A CG    1 
ATOM   523  C  CD    . GLN A 1 66  ? -12.839 7.302  23.563  1.00 80.60  ? 90  GLN A CD    1 
ATOM   524  O  OE1   . GLN A 1 66  ? -13.115 7.234  22.368  1.00 81.31  ? 90  GLN A OE1   1 
ATOM   525  N  NE2   . GLN A 1 66  ? -12.134 6.366  24.191  1.00 81.60  ? 90  GLN A NE2   1 
ATOM   526  N  N     . LEU A 1 67  ? -11.416 11.178 25.814  1.00 73.76  ? 91  LEU A N     1 
ATOM   527  C  CA    . LEU A 1 67  ? -10.139 11.861 25.670  1.00 71.18  ? 91  LEU A CA    1 
ATOM   528  C  C     . LEU A 1 67  ? -9.482  12.166 27.013  1.00 68.68  ? 91  LEU A C     1 
ATOM   529  O  O     . LEU A 1 67  ? -10.121 12.695 27.915  1.00 69.02  ? 91  LEU A O     1 
ATOM   530  C  CB    . LEU A 1 67  ? -10.361 13.170 24.907  1.00 71.67  ? 91  LEU A CB    1 
ATOM   531  C  CG    . LEU A 1 67  ? -9.175  14.084 24.600  1.00 71.66  ? 91  LEU A CG    1 
ATOM   532  C  CD1   . LEU A 1 67  ? -8.162  13.350 23.729  1.00 72.71  ? 91  LEU A CD1   1 
ATOM   533  C  CD2   . LEU A 1 67  ? -9.682  15.332 23.891  1.00 70.93  ? 91  LEU A CD2   1 
ATOM   534  N  N     . VAL A 1 68  ? -8.206  11.822 27.148  1.00 65.84  ? 92  VAL A N     1 
ATOM   535  C  CA    . VAL A 1 68  ? -7.477  12.119 28.376  1.00 63.34  ? 92  VAL A CA    1 
ATOM   536  C  C     . VAL A 1 68  ? -6.798  13.474 28.169  1.00 62.04  ? 92  VAL A C     1 
ATOM   537  O  O     . VAL A 1 68  ? -6.194  13.722 27.123  1.00 62.26  ? 92  VAL A O     1 
ATOM   538  C  CB    . VAL A 1 68  ? -6.390  11.067 28.678  1.00 62.30  ? 92  VAL A CB    1 
ATOM   539  C  CG1   . VAL A 1 68  ? -5.521  11.538 29.828  1.00 60.66  ? 92  VAL A CG1   1 
ATOM   540  C  CG2   . VAL A 1 68  ? -7.031  9.749  29.028  1.00 62.05  ? 92  VAL A CG2   1 
ATOM   541  N  N     . LEU A 1 69  ? -6.899  14.349 29.162  1.00 58.92  ? 93  LEU A N     1 
ATOM   542  C  CA    . LEU A 1 69  ? -6.294  15.665 29.057  1.00 56.18  ? 93  LEU A CA    1 
ATOM   543  C  C     . LEU A 1 69  ? -5.237  15.911 30.126  1.00 54.24  ? 93  LEU A C     1 
ATOM   544  O  O     . LEU A 1 69  ? -5.414  15.526 31.277  1.00 53.87  ? 93  LEU A O     1 
ATOM   545  C  CB    . LEU A 1 69  ? -7.371  16.747 29.176  1.00 56.51  ? 93  LEU A CB    1 
ATOM   546  C  CG    . LEU A 1 69  ? -8.515  16.757 28.161  1.00 57.41  ? 93  LEU A CG    1 
ATOM   547  C  CD1   . LEU A 1 69  ? -9.562  17.765 28.603  1.00 58.15  ? 93  LEU A CD1   1 
ATOM   548  C  CD2   . LEU A 1 69  ? -7.993  17.106 26.776  1.00 58.49  ? 93  LEU A CD2   1 
ATOM   549  N  N     . VAL A 1 70  ? -4.125  16.527 29.732  1.00 51.89  ? 94  VAL A N     1 
ATOM   550  C  CA    . VAL A 1 70  ? -3.071  16.889 30.676  1.00 48.90  ? 94  VAL A CA    1 
ATOM   551  C  C     . VAL A 1 70  ? -2.878  18.373 30.446  1.00 47.67  ? 94  VAL A C     1 
ATOM   552  O  O     . VAL A 1 70  ? -3.167  18.885 29.360  1.00 46.68  ? 94  VAL A O     1 
ATOM   553  C  CB    . VAL A 1 70  ? -1.731  16.164 30.421  1.00 46.92  ? 94  VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 70  ? -1.936  14.674 30.458  1.00 46.94  ? 94  VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 70  ? -1.146  16.595 29.098  1.00 48.76  ? 94  VAL A CG2   1 
ATOM   556  N  N     . ASN A 1 71  ? -2.409  19.069 31.468  1.00 46.61  ? 95  ASN A N     1 
ATOM   557  C  CA    . ASN A 1 71  ? -2.200  20.493 31.349  1.00 46.20  ? 95  ASN A CA    1 
ATOM   558  C  C     . ASN A 1 71  ? -0.846  20.801 30.748  1.00 46.14  ? 95  ASN A C     1 
ATOM   559  O  O     . ASN A 1 71  ? 0.176   20.262 31.182  1.00 46.51  ? 95  ASN A O     1 
ATOM   560  C  CB    . ASN A 1 71  ? -2.317  21.158 32.711  1.00 47.72  ? 95  ASN A CB    1 
ATOM   561  C  CG    . ASN A 1 71  ? -2.080  22.645 32.642  1.00 50.31  ? 95  ASN A CG    1 
ATOM   562  O  OD1   . ASN A 1 71  ? -0.931  23.105 32.630  1.00 52.02  ? 95  ASN A OD1   1 
ATOM   563  N  ND2   . ASN A 1 71  ? -3.166  23.414 32.570  1.00 49.41  ? 95  ASN A ND2   1 
ATOM   564  N  N     . GLY A 1 72  ? -0.846  21.673 29.744  1.00 45.33  ? 96  GLY A N     1 
ATOM   565  C  CA    . GLY A 1 72  ? 0.394   22.055 29.092  1.00 44.52  ? 96  GLY A CA    1 
ATOM   566  C  C     . GLY A 1 72  ? 0.624   23.555 29.140  1.00 43.44  ? 96  GLY A C     1 
ATOM   567  O  O     . GLY A 1 72  ? 1.164   24.140 28.197  1.00 41.83  ? 96  GLY A O     1 
ATOM   568  N  N     . GLU A 1 73  ? 0.206   24.176 30.240  1.00 42.80  ? 97  GLU A N     1 
ATOM   569  C  CA    . GLU A 1 73  ? 0.363   25.612 30.421  1.00 43.11  ? 97  GLU A CA    1 
ATOM   570  C  C     . GLU A 1 73  ? 1.793   25.984 30.785  1.00 42.34  ? 97  GLU A C     1 
ATOM   571  O  O     . GLU A 1 73  ? 2.214   27.135 30.633  1.00 43.35  ? 97  GLU A O     1 
ATOM   572  C  CB    . GLU A 1 73  ? -0.615  26.103 31.488  1.00 45.04  ? 97  GLU A CB    1 
ATOM   573  C  CG    . GLU A 1 73  ? -1.987  26.427 30.913  1.00 47.75  ? 97  GLU A CG    1 
ATOM   574  C  CD    . GLU A 1 73  ? -3.042  26.669 31.963  1.00 48.35  ? 97  GLU A CD    1 
ATOM   575  O  OE1   . GLU A 1 73  ? -2.750  27.356 32.969  1.00 49.87  ? 97  GLU A OE1   1 
ATOM   576  O  OE2   . GLU A 1 73  ? -4.173  26.178 31.767  1.00 49.62  ? 97  GLU A OE2   1 
ATOM   577  N  N     . ASP A 1 74  ? 2.535   24.989 31.253  1.00 41.48  ? 98  ASP A N     1 
ATOM   578  C  CA    . ASP A 1 74  ? 3.927   25.152 31.632  1.00 39.89  ? 98  ASP A CA    1 
ATOM   579  C  C     . ASP A 1 74  ? 4.788   24.569 30.508  1.00 39.01  ? 98  ASP A C     1 
ATOM   580  O  O     . ASP A 1 74  ? 4.903   23.349 30.364  1.00 38.60  ? 98  ASP A O     1 
ATOM   581  C  CB    . ASP A 1 74  ? 4.189   24.407 32.937  1.00 42.31  ? 98  ASP A CB    1 
ATOM   582  C  CG    . ASP A 1 74  ? 5.633   24.492 33.381  1.00 45.19  ? 98  ASP A CG    1 
ATOM   583  O  OD1   . ASP A 1 74  ? 5.965   23.898 34.432  1.00 46.04  ? 98  ASP A OD1   1 
ATOM   584  O  OD2   . ASP A 1 74  ? 6.436   25.147 32.681  1.00 47.08  ? 98  ASP A OD2   1 
ATOM   585  N  N     . LEU A 1 75  ? 5.397   25.449 29.719  1.00 37.31  ? 99  LEU A N     1 
ATOM   586  C  CA    . LEU A 1 75  ? 6.226   25.028 28.597  1.00 36.02  ? 99  LEU A CA    1 
ATOM   587  C  C     . LEU A 1 75  ? 7.668   24.667 28.951  1.00 34.97  ? 99  LEU A C     1 
ATOM   588  O  O     . LEU A 1 75  ? 8.524   24.651 28.072  1.00 36.35  ? 99  LEU A O     1 
ATOM   589  C  CB    . LEU A 1 75  ? 6.254   26.130 27.543  1.00 34.22  ? 99  LEU A CB    1 
ATOM   590  C  CG    . LEU A 1 75  ? 4.925   26.807 27.230  1.00 35.22  ? 99  LEU A CG    1 
ATOM   591  C  CD1   . LEU A 1 75  ? 5.139   27.831 26.129  1.00 35.21  ? 99  LEU A CD1   1 
ATOM   592  C  CD2   . LEU A 1 75  ? 3.905   25.777 26.810  1.00 35.51  ? 99  LEU A CD2   1 
ATOM   593  N  N     . THR A 1 76  ? 7.943   24.363 30.213  1.00 33.28  ? 100 THR A N     1 
ATOM   594  C  CA    . THR A 1 76  ? 9.312   24.048 30.619  1.00 31.58  ? 100 THR A CA    1 
ATOM   595  C  C     . THR A 1 76  ? 9.911   22.798 30.008  1.00 31.58  ? 100 THR A C     1 
ATOM   596  O  O     . THR A 1 76  ? 11.016  22.838 29.459  1.00 29.90  ? 100 THR A O     1 
ATOM   597  C  CB    . THR A 1 76  ? 9.436   23.939 32.154  1.00 29.84  ? 100 THR A CB    1 
ATOM   598  O  OG1   . THR A 1 76  ? 9.229   25.229 32.728  1.00 27.80  ? 100 THR A OG1   1 
ATOM   599  C  CG2   . THR A 1 76  ? 10.823  23.428 32.557  1.00 27.37  ? 100 THR A CG2   1 
ATOM   600  N  N     . ARG A 1 77  ? 9.196   21.686 30.119  1.00 33.32  ? 101 ARG A N     1 
ATOM   601  C  CA    . ARG A 1 77  ? 9.702   20.440 29.579  1.00 34.92  ? 101 ARG A CA    1 
ATOM   602  C  C     . ARG A 1 77  ? 9.713   20.444 28.063  1.00 32.66  ? 101 ARG A C     1 
ATOM   603  O  O     . ARG A 1 77  ? 10.645  19.920 27.452  1.00 32.57  ? 101 ARG A O     1 
ATOM   604  C  CB    . ARG A 1 77  ? 8.888   19.258 30.093  1.00 38.70  ? 101 ARG A CB    1 
ATOM   605  C  CG    . ARG A 1 77  ? 9.167   18.913 31.534  1.00 45.73  ? 101 ARG A CG    1 
ATOM   606  C  CD    . ARG A 1 77  ? 8.463   17.621 31.907  1.00 53.60  ? 101 ARG A CD    1 
ATOM   607  N  NE    . ARG A 1 77  ? 7.050   17.649 31.523  1.00 59.39  ? 101 ARG A NE    1 
ATOM   608  C  CZ    . ARG A 1 77  ? 6.192   16.655 31.735  1.00 61.85  ? 101 ARG A CZ    1 
ATOM   609  N  NH1   . ARG A 1 77  ? 6.593   15.540 32.335  1.00 63.25  ? 101 ARG A NH1   1 
ATOM   610  N  NH2   . ARG A 1 77  ? 4.932   16.777 31.340  1.00 63.71  ? 101 ARG A NH2   1 
ATOM   611  N  N     . TYR A 1 78  ? 8.685   21.037 27.464  1.00 29.42  ? 102 TYR A N     1 
ATOM   612  C  CA    . TYR A 1 78  ? 8.590   21.109 26.014  1.00 27.97  ? 102 TYR A CA    1 
ATOM   613  C  C     . TYR A 1 78  ? 9.780   21.890 25.474  1.00 29.21  ? 102 TYR A C     1 
ATOM   614  O  O     . TYR A 1 78  ? 10.461  21.463 24.534  1.00 27.60  ? 102 TYR A O     1 
ATOM   615  C  CB    . TYR A 1 78  ? 7.306   21.820 25.619  1.00 26.14  ? 102 TYR A CB    1 
ATOM   616  C  CG    . TYR A 1 78  ? 6.062   21.218 26.217  1.00 26.74  ? 102 TYR A CG    1 
ATOM   617  C  CD1   . TYR A 1 78  ? 4.965   22.024 26.525  1.00 25.63  ? 102 TYR A CD1   1 
ATOM   618  C  CD2   . TYR A 1 78  ? 5.982   19.848 26.501  1.00 24.56  ? 102 TYR A CD2   1 
ATOM   619  C  CE1   . TYR A 1 78  ? 3.822   21.491 27.107  1.00 24.67  ? 102 TYR A CE1   1 
ATOM   620  C  CE2   . TYR A 1 78  ? 4.843   19.308 27.083  1.00 24.06  ? 102 TYR A CE2   1 
ATOM   621  C  CZ    . TYR A 1 78  ? 3.768   20.141 27.385  1.00 23.99  ? 102 TYR A CZ    1 
ATOM   622  O  OH    . TYR A 1 78  ? 2.643   19.651 27.991  1.00 23.40  ? 102 TYR A OH    1 
ATOM   623  N  N     . ARG A 1 79  ? 10.016  23.046 26.086  1.00 30.50  ? 103 ARG A N     1 
ATOM   624  C  CA    . ARG A 1 79  ? 11.104  23.924 25.702  1.00 31.26  ? 103 ARG A CA    1 
ATOM   625  C  C     . ARG A 1 79  ? 12.411  23.165 25.838  1.00 31.46  ? 103 ARG A C     1 
ATOM   626  O  O     . ARG A 1 79  ? 13.238  23.150 24.927  1.00 31.98  ? 103 ARG A O     1 
ATOM   627  C  CB    . ARG A 1 79  ? 11.132  25.160 26.609  1.00 33.29  ? 103 ARG A CB    1 
ATOM   628  C  CG    . ARG A 1 79  ? 12.078  26.268 26.137  1.00 35.75  ? 103 ARG A CG    1 
ATOM   629  C  CD    . ARG A 1 79  ? 12.327  27.309 27.206  1.00 35.44  ? 103 ARG A CD    1 
ATOM   630  N  NE    . ARG A 1 79  ? 11.104  27.732 27.885  1.00 37.77  ? 103 ARG A NE    1 
ATOM   631  C  CZ    . ARG A 1 79  ? 10.905  27.595 29.200  1.00 41.23  ? 103 ARG A CZ    1 
ATOM   632  N  NH1   . ARG A 1 79  ? 11.845  27.042 29.963  1.00 40.25  ? 103 ARG A NH1   1 
ATOM   633  N  NH2   . ARG A 1 79  ? 9.782   28.025 29.769  1.00 41.27  ? 103 ARG A NH2   1 
ATOM   634  N  N     . GLU A 1 80  ? 12.604  22.530 26.984  1.00 31.81  ? 104 GLU A N     1 
ATOM   635  C  CA    . GLU A 1 80  ? 13.834  21.796 27.193  1.00 32.41  ? 104 GLU A CA    1 
ATOM   636  C  C     . GLU A 1 80  ? 14.046  20.740 26.122  1.00 31.65  ? 104 GLU A C     1 
ATOM   637  O  O     . GLU A 1 80  ? 15.159  20.545 25.652  1.00 31.37  ? 104 GLU A O     1 
ATOM   638  C  CB    . GLU A 1 80  ? 13.841  21.178 28.585  1.00 32.89  ? 104 GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 80  ? 14.002  22.221 29.676  1.00 37.84  ? 104 GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 80  ? 14.058  21.625 31.077  1.00 41.48  ? 104 GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 80  ? 14.331  22.381 32.038  1.00 44.25  ? 104 GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 80  ? 13.825  20.405 31.220  1.00 40.54  ? 104 GLU A OE2   1 
ATOM   643  N  N     . MET A 1 81  ? 12.973  20.070 25.720  1.00 31.54  ? 105 MET A N     1 
ATOM   644  C  CA    . MET A 1 81  ? 13.076  19.038 24.705  1.00 30.61  ? 105 MET A CA    1 
ATOM   645  C  C     . MET A 1 81  ? 13.301  19.668 23.327  1.00 29.55  ? 105 MET A C     1 
ATOM   646  O  O     . MET A 1 81  ? 13.997  19.106 22.483  1.00 30.76  ? 105 MET A O     1 
ATOM   647  C  CB    . MET A 1 81  ? 11.808  18.182 24.708  1.00 30.99  ? 105 MET A CB    1 
ATOM   648  C  CG    . MET A 1 81  ? 11.900  16.917 23.850  1.00 34.07  ? 105 MET A CG    1 
ATOM   649  S  SD    . MET A 1 81  ? 13.282  15.811 24.307  1.00 36.67  ? 105 MET A SD    1 
ATOM   650  C  CE    . MET A 1 81  ? 13.031  15.688 26.092  1.00 33.17  ? 105 MET A CE    1 
ATOM   651  N  N     . SER A 1 82  ? 12.714  20.839 23.111  1.00 26.89  ? 106 SER A N     1 
ATOM   652  C  CA    . SER A 1 82  ? 12.850  21.551 21.849  1.00 24.08  ? 106 SER A CA    1 
ATOM   653  C  C     . SER A 1 82  ? 14.315  21.874 21.559  1.00 23.85  ? 106 SER A C     1 
ATOM   654  O  O     . SER A 1 82  ? 14.751  21.787 20.408  1.00 25.67  ? 106 SER A O     1 
ATOM   655  C  CB    . SER A 1 82  ? 12.017  22.835 21.891  1.00 24.48  ? 106 SER A CB    1 
ATOM   656  O  OG    . SER A 1 82  ? 11.964  23.475 20.631  1.00 24.22  ? 106 SER A OG    1 
ATOM   657  N  N     . TYR A 1 83  ? 15.080  22.243 22.589  1.00 22.42  ? 107 TYR A N     1 
ATOM   658  C  CA    . TYR A 1 83  ? 16.503  22.551 22.399  1.00 21.78  ? 107 TYR A CA    1 
ATOM   659  C  C     . TYR A 1 83  ? 17.357  21.309 22.264  1.00 22.18  ? 107 TYR A C     1 
ATOM   660  O  O     . TYR A 1 83  ? 18.407  21.326 21.611  1.00 21.62  ? 107 TYR A O     1 
ATOM   661  C  CB    . TYR A 1 83  ? 17.045  23.433 23.522  1.00 20.63  ? 107 TYR A CB    1 
ATOM   662  C  CG    . TYR A 1 83  ? 16.697  24.878 23.296  1.00 22.01  ? 107 TYR A CG    1 
ATOM   663  C  CD1   . TYR A 1 83  ? 15.634  25.474 23.971  1.00 21.69  ? 107 TYR A CD1   1 
ATOM   664  C  CD2   . TYR A 1 83  ? 17.365  25.626 22.327  1.00 22.09  ? 107 TYR A CD2   1 
ATOM   665  C  CE1   . TYR A 1 83  ? 15.242  26.780 23.686  1.00 22.42  ? 107 TYR A CE1   1 
ATOM   666  C  CE2   . TYR A 1 83  ? 16.972  26.933 22.029  1.00 22.43  ? 107 TYR A CE2   1 
ATOM   667  C  CZ    . TYR A 1 83  ? 15.913  27.502 22.714  1.00 22.44  ? 107 TYR A CZ    1 
ATOM   668  O  OH    . TYR A 1 83  ? 15.527  28.794 22.443  1.00 24.59  ? 107 TYR A OH    1 
ATOM   669  N  N     . LYS A 1 84  ? 16.908  20.226 22.880  1.00 23.56  ? 108 LYS A N     1 
ATOM   670  C  CA    . LYS A 1 84  ? 17.628  18.981 22.761  1.00 25.21  ? 108 LYS A CA    1 
ATOM   671  C  C     . LYS A 1 84  ? 17.558  18.565 21.294  1.00 25.86  ? 108 LYS A C     1 
ATOM   672  O  O     . LYS A 1 84  ? 18.544  18.078 20.742  1.00 27.48  ? 108 LYS A O     1 
ATOM   673  C  CB    . LYS A 1 84  ? 17.024  17.915 23.674  1.00 26.52  ? 108 LYS A CB    1 
ATOM   674  C  CG    . LYS A 1 84  ? 17.401  18.137 25.144  1.00 30.92  ? 108 LYS A CG    1 
ATOM   675  C  CD    . LYS A 1 84  ? 17.126  16.927 26.025  1.00 30.31  ? 108 LYS A CD    1 
ATOM   676  C  CE    . LYS A 1 84  ? 17.565  17.172 27.471  1.00 29.62  ? 108 LYS A CE    1 
ATOM   677  N  NZ    . LYS A 1 84  ? 17.268  16.008 28.371  1.00 28.01  ? 108 LYS A NZ    1 
ATOM   678  N  N     . VAL A 1 85  ? 16.412  18.795 20.653  1.00 24.43  ? 109 VAL A N     1 
ATOM   679  C  CA    . VAL A 1 85  ? 16.261  18.443 19.248  1.00 23.81  ? 109 VAL A CA    1 
ATOM   680  C  C     . VAL A 1 85  ? 17.136  19.339 18.368  1.00 25.68  ? 109 VAL A C     1 
ATOM   681  O  O     . VAL A 1 85  ? 17.876  18.858 17.492  1.00 24.27  ? 109 VAL A O     1 
ATOM   682  C  CB    . VAL A 1 85  ? 14.797  18.545 18.794  1.00 23.13  ? 109 VAL A CB    1 
ATOM   683  C  CG1   . VAL A 1 85  ? 14.698  18.327 17.282  1.00 21.83  ? 109 VAL A CG1   1 
ATOM   684  C  CG2   . VAL A 1 85  ? 13.972  17.494 19.504  1.00 22.46  ? 109 VAL A CG2   1 
ATOM   685  N  N     . THR A 1 86  ? 17.055  20.643 18.598  1.00 25.31  ? 110 THR A N     1 
ATOM   686  C  CA    . THR A 1 86  ? 17.866  21.580 17.830  1.00 24.42  ? 110 THR A CA    1 
ATOM   687  C  C     . THR A 1 86  ? 19.366  21.253 17.945  1.00 23.31  ? 110 THR A C     1 
ATOM   688  O  O     . THR A 1 86  ? 20.066  21.199 16.939  1.00 21.62  ? 110 THR A O     1 
ATOM   689  C  CB    . THR A 1 86  ? 17.623  23.016 18.307  1.00 24.51  ? 110 THR A CB    1 
ATOM   690  O  OG1   . THR A 1 86  ? 16.213  23.255 18.359  1.00 26.73  ? 110 THR A OG1   1 
ATOM   691  C  CG2   . THR A 1 86  ? 18.278  24.014 17.364  1.00 22.45  ? 110 THR A CG2   1 
ATOM   692  N  N     . GLU A 1 87  ? 19.853  21.035 19.165  1.00 23.13  ? 111 GLU A N     1 
ATOM   693  C  CA    . GLU A 1 87  ? 21.266  20.716 19.374  1.00 24.41  ? 111 GLU A CA    1 
ATOM   694  C  C     . GLU A 1 87  ? 21.716  19.496 18.570  1.00 25.01  ? 111 GLU A C     1 
ATOM   695  O  O     . GLU A 1 87  ? 22.721  19.534 17.869  1.00 25.16  ? 111 GLU A O     1 
ATOM   696  C  CB    . GLU A 1 87  ? 21.534  20.461 20.847  1.00 24.51  ? 111 GLU A CB    1 
ATOM   697  C  CG    . GLU A 1 87  ? 21.495  21.691 21.703  1.00 25.79  ? 111 GLU A CG    1 
ATOM   698  C  CD    . GLU A 1 87  ? 21.866  21.386 23.133  1.00 27.63  ? 111 GLU A CD    1 
ATOM   699  O  OE1   . GLU A 1 87  ? 22.881  20.684 23.340  1.00 30.05  ? 111 GLU A OE1   1 
ATOM   700  O  OE2   . GLU A 1 87  ? 21.153  21.843 24.049  1.00 27.86  ? 111 GLU A OE2   1 
ATOM   701  N  N     . LEU A 1 88  ? 20.974  18.405 18.697  1.00 25.27  ? 112 LEU A N     1 
ATOM   702  C  CA    . LEU A 1 88  ? 21.283  17.195 17.962  1.00 24.40  ? 112 LEU A CA    1 
ATOM   703  C  C     . LEU A 1 88  ? 21.392  17.518 16.461  1.00 24.21  ? 112 LEU A C     1 
ATOM   704  O  O     . LEU A 1 88  ? 22.291  17.023 15.786  1.00 25.00  ? 112 LEU A O     1 
ATOM   705  C  CB    . LEU A 1 88  ? 20.195  16.142 18.224  1.00 23.58  ? 112 LEU A CB    1 
ATOM   706  C  CG    . LEU A 1 88  ? 20.246  14.765 17.553  1.00 24.96  ? 112 LEU A CG    1 
ATOM   707  C  CD1   . LEU A 1 88  ? 19.241  13.829 18.204  1.00 26.47  ? 112 LEU A CD1   1 
ATOM   708  C  CD2   . LEU A 1 88  ? 19.914  14.896 16.087  1.00 27.52  ? 112 LEU A CD2   1 
ATOM   709  N  N     . LEU A 1 89  ? 20.494  18.344 15.931  1.00 23.31  ? 113 LEU A N     1 
ATOM   710  C  CA    . LEU A 1 89  ? 20.566  18.670 14.505  1.00 24.49  ? 113 LEU A CA    1 
ATOM   711  C  C     . LEU A 1 89  ? 21.766  19.553 14.202  1.00 25.51  ? 113 LEU A C     1 
ATOM   712  O  O     . LEU A 1 89  ? 22.309  19.507 13.094  1.00 24.86  ? 113 LEU A O     1 
ATOM   713  C  CB    . LEU A 1 89  ? 19.282  19.359 14.012  1.00 22.37  ? 113 LEU A CB    1 
ATOM   714  C  CG    . LEU A 1 89  ? 17.985  18.544 14.081  1.00 21.00  ? 113 LEU A CG    1 
ATOM   715  C  CD1   . LEU A 1 89  ? 16.839  19.416 13.603  1.00 16.62  ? 113 LEU A CD1   1 
ATOM   716  C  CD2   . LEU A 1 89  ? 18.098  17.252 13.252  1.00 15.95  ? 113 LEU A CD2   1 
ATOM   717  N  N     . GLU A 1 90  ? 22.177  20.349 15.190  1.00 27.13  ? 114 GLU A N     1 
ATOM   718  C  CA    . GLU A 1 90  ? 23.330  21.237 15.043  1.00 28.96  ? 114 GLU A CA    1 
ATOM   719  C  C     . GLU A 1 90  ? 24.594  20.400 14.902  1.00 29.01  ? 114 GLU A C     1 
ATOM   720  O  O     . GLU A 1 90  ? 25.590  20.848 14.342  1.00 28.60  ? 114 GLU A O     1 
ATOM   721  C  CB    . GLU A 1 90  ? 23.457  22.175 16.257  1.00 29.68  ? 114 GLU A CB    1 
ATOM   722  C  CG    . GLU A 1 90  ? 22.415  23.297 16.296  1.00 31.85  ? 114 GLU A CG    1 
ATOM   723  C  CD    . GLU A 1 90  ? 22.483  24.161 17.555  1.00 32.47  ? 114 GLU A CD    1 
ATOM   724  O  OE1   . GLU A 1 90  ? 22.526  23.599 18.669  1.00 34.20  ? 114 GLU A OE1   1 
ATOM   725  O  OE2   . GLU A 1 90  ? 22.475  25.405 17.434  1.00 32.31  ? 114 GLU A OE2   1 
ATOM   726  N  N     . GLU A 1 91  ? 24.539  19.175 15.411  1.00 30.76  ? 115 GLU A N     1 
ATOM   727  C  CA    . GLU A 1 91  ? 25.674  18.273 15.341  1.00 31.73  ? 115 GLU A CA    1 
ATOM   728  C  C     . GLU A 1 91  ? 25.924  17.900 13.886  1.00 31.57  ? 115 GLU A C     1 
ATOM   729  O  O     . GLU A 1 91  ? 27.055  17.973 13.418  1.00 31.87  ? 115 GLU A O     1 
ATOM   730  C  CB    . GLU A 1 91  ? 25.409  17.017 16.173  1.00 33.59  ? 115 GLU A CB    1 
ATOM   731  C  CG    . GLU A 1 91  ? 26.686  16.354 16.691  1.00 37.77  ? 115 GLU A CG    1 
ATOM   732  C  CD    . GLU A 1 91  ? 26.429  15.079 17.478  1.00 38.46  ? 115 GLU A CD    1 
ATOM   733  O  OE1   . GLU A 1 91  ? 25.694  15.131 18.485  1.00 39.03  ? 115 GLU A OE1   1 
ATOM   734  O  OE2   . GLU A 1 91  ? 26.972  14.025 17.088  1.00 41.48  ? 115 GLU A OE2   1 
ATOM   735  N  N     . PHE A 1 92  ? 24.868  17.502 13.175  1.00 31.22  ? 116 PHE A N     1 
ATOM   736  C  CA    . PHE A 1 92  ? 24.984  17.140 11.766  1.00 30.62  ? 116 PHE A CA    1 
ATOM   737  C  C     . PHE A 1 92  ? 25.554  18.325 11.004  1.00 31.80  ? 116 PHE A C     1 
ATOM   738  O  O     . PHE A 1 92  ? 26.519  18.193 10.259  1.00 34.78  ? 116 PHE A O     1 
ATOM   739  C  CB    . PHE A 1 92  ? 23.620  16.792 11.160  1.00 29.22  ? 116 PHE A CB    1 
ATOM   740  C  CG    . PHE A 1 92  ? 23.059  15.484 11.622  1.00 27.71  ? 116 PHE A CG    1 
ATOM   741  C  CD1   . PHE A 1 92  ? 22.331  15.398 12.803  1.00 28.37  ? 116 PHE A CD1   1 
ATOM   742  C  CD2   . PHE A 1 92  ? 23.264  14.333 10.881  1.00 25.92  ? 116 PHE A CD2   1 
ATOM   743  C  CE1   . PHE A 1 92  ? 21.814  14.177 13.238  1.00 27.01  ? 116 PHE A CE1   1 
ATOM   744  C  CE2   . PHE A 1 92  ? 22.754  13.110 11.308  1.00 27.90  ? 116 PHE A CE2   1 
ATOM   745  C  CZ    . PHE A 1 92  ? 22.026  13.033 12.492  1.00 26.67  ? 116 PHE A CZ    1 
ATOM   746  N  N     . SER A 1 93  ? 24.940  19.487 11.182  1.00 32.04  ? 117 SER A N     1 
ATOM   747  C  CA    . SER A 1 93  ? 25.396  20.698 10.518  1.00 31.91  ? 117 SER A CA    1 
ATOM   748  C  C     . SER A 1 93  ? 25.006  21.870 11.411  1.00 31.94  ? 117 SER A C     1 
ATOM   749  O  O     . SER A 1 93  ? 23.849  22.046 11.766  1.00 33.14  ? 117 SER A O     1 
ATOM   750  C  CB    . SER A 1 93  ? 24.751  20.818 9.141   1.00 32.87  ? 117 SER A CB    1 
ATOM   751  O  OG    . SER A 1 93  ? 25.522  21.634 8.277   1.00 35.88  ? 117 SER A OG    1 
ATOM   752  N  N     . PRO A 1 94  ? 25.977  22.698 11.772  1.00 31.75  ? 118 PRO A N     1 
ATOM   753  C  CA    . PRO A 1 94  ? 25.778  23.860 12.636  1.00 32.56  ? 118 PRO A CA    1 
ATOM   754  C  C     . PRO A 1 94  ? 24.682  24.857 12.296  1.00 32.48  ? 118 PRO A C     1 
ATOM   755  O  O     . PRO A 1 94  ? 24.026  25.375 13.196  1.00 33.69  ? 118 PRO A O     1 
ATOM   756  C  CB    . PRO A 1 94  ? 27.154  24.513 12.640  1.00 33.85  ? 118 PRO A CB    1 
ATOM   757  C  CG    . PRO A 1 94  ? 27.666  24.189 11.264  1.00 33.14  ? 118 PRO A CG    1 
ATOM   758  C  CD    . PRO A 1 94  ? 27.306  22.739 11.141  1.00 31.78  ? 118 PRO A CD    1 
ATOM   759  N  N     . VAL A 1 95  ? 24.479  25.140 11.017  1.00 32.43  ? 119 VAL A N     1 
ATOM   760  C  CA    . VAL A 1 95  ? 23.473  26.130 10.643  1.00 33.00  ? 119 VAL A CA    1 
ATOM   761  C  C     . VAL A 1 95  ? 22.045  25.609 10.697  1.00 31.75  ? 119 VAL A C     1 
ATOM   762  O  O     . VAL A 1 95  ? 21.502  25.106 9.705   1.00 31.77  ? 119 VAL A O     1 
ATOM   763  C  CB    . VAL A 1 95  ? 23.765  26.712 9.249   1.00 34.73  ? 119 VAL A CB    1 
ATOM   764  C  CG1   . VAL A 1 95  ? 22.763  27.824 8.921   1.00 33.92  ? 119 VAL A CG1   1 
ATOM   765  C  CG2   . VAL A 1 95  ? 25.194  27.255 9.223   1.00 34.65  ? 119 VAL A CG2   1 
ATOM   766  N  N     . VAL A 1 96  ? 21.440  25.780 11.871  1.00 29.40  ? 120 VAL A N     1 
ATOM   767  C  CA    . VAL A 1 96  ? 20.083  25.323 12.145  1.00 26.39  ? 120 VAL A CA    1 
ATOM   768  C  C     . VAL A 1 96  ? 19.151  26.455 12.591  1.00 25.33  ? 120 VAL A C     1 
ATOM   769  O  O     . VAL A 1 96  ? 19.455  27.187 13.531  1.00 25.06  ? 120 VAL A O     1 
ATOM   770  C  CB    . VAL A 1 96  ? 20.116  24.216 13.237  1.00 24.03  ? 120 VAL A CB    1 
ATOM   771  C  CG1   . VAL A 1 96  ? 18.709  23.752 13.572  1.00 22.45  ? 120 VAL A CG1   1 
ATOM   772  C  CG2   . VAL A 1 96  ? 20.976  23.055 12.762  1.00 19.50  ? 120 VAL A CG2   1 
ATOM   773  N  N     . GLU A 1 97  ? 18.013  26.581 11.915  1.00 23.91  ? 121 GLU A N     1 
ATOM   774  C  CA    . GLU A 1 97  ? 17.026  27.603 12.241  1.00 23.49  ? 121 GLU A CA    1 
ATOM   775  C  C     . GLU A 1 97  ? 15.789  26.989 12.904  1.00 23.26  ? 121 GLU A C     1 
ATOM   776  O  O     . GLU A 1 97  ? 15.184  26.053 12.382  1.00 22.86  ? 121 GLU A O     1 
ATOM   777  C  CB    . GLU A 1 97  ? 16.612  28.346 10.976  1.00 24.49  ? 121 GLU A CB    1 
ATOM   778  C  CG    . GLU A 1 97  ? 15.695  29.532 11.200  1.00 24.77  ? 121 GLU A CG    1 
ATOM   779  C  CD    . GLU A 1 97  ? 15.650  30.443 9.980   1.00 25.28  ? 121 GLU A CD    1 
ATOM   780  O  OE1   . GLU A 1 97  ? 16.566  30.340 9.141   1.00 24.69  ? 121 GLU A OE1   1 
ATOM   781  O  OE2   . GLU A 1 97  ? 14.722  31.268 9.858   1.00 23.51  ? 121 GLU A OE2   1 
ATOM   782  N  N     . ARG A 1 98  ? 15.424  27.518 14.064  1.00 22.17  ? 122 ARG A N     1 
ATOM   783  C  CA    . ARG A 1 98  ? 14.265  27.032 14.788  1.00 21.82  ? 122 ARG A CA    1 
ATOM   784  C  C     . ARG A 1 98  ? 13.051  27.822 14.351  1.00 22.37  ? 122 ARG A C     1 
ATOM   785  O  O     . ARG A 1 98  ? 13.131  29.024 14.127  1.00 24.91  ? 122 ARG A O     1 
ATOM   786  C  CB    . ARG A 1 98  ? 14.411  27.255 16.297  1.00 22.54  ? 122 ARG A CB    1 
ATOM   787  C  CG    . ARG A 1 98  ? 15.732  26.866 16.927  1.00 21.60  ? 122 ARG A CG    1 
ATOM   788  C  CD    . ARG A 1 98  ? 15.717  27.224 18.421  1.00 20.97  ? 122 ARG A CD    1 
ATOM   789  N  NE    . ARG A 1 98  ? 15.325  26.071 19.213  1.00 22.51  ? 122 ARG A NE    1 
ATOM   790  C  CZ    . ARG A 1 98  ? 14.222  25.985 19.947  1.00 23.17  ? 122 ARG A CZ    1 
ATOM   791  N  NH1   . ARG A 1 98  ? 13.373  26.997 20.018  1.00 22.20  ? 122 ARG A NH1   1 
ATOM   792  N  NH2   . ARG A 1 98  ? 13.957  24.860 20.591  1.00 22.97  ? 122 ARG A NH2   1 
ATOM   793  N  N     . LEU A 1 99  ? 11.921  27.153 14.228  1.00 21.02  ? 123 LEU A N     1 
ATOM   794  C  CA    . LEU A 1 99  ? 10.710  27.855 13.895  1.00 20.80  ? 123 LEU A CA    1 
ATOM   795  C  C     . LEU A 1 99  ? 9.716   27.338 14.910  1.00 21.15  ? 123 LEU A C     1 
ATOM   796  O  O     . LEU A 1 99  ? 9.073   26.327 14.687  1.00 22.70  ? 123 LEU A O     1 
ATOM   797  C  CB    . LEU A 1 99  ? 10.248  27.533 12.481  1.00 23.41  ? 123 LEU A CB    1 
ATOM   798  C  CG    . LEU A 1 99  ? 9.613   28.726 11.746  1.00 24.29  ? 123 LEU A CG    1 
ATOM   799  C  CD1   . LEU A 1 99  ? 8.510   28.234 10.812  1.00 24.62  ? 123 LEU A CD1   1 
ATOM   800  C  CD2   . LEU A 1 99  ? 9.029   29.706 12.752  1.00 23.66  ? 123 LEU A CD2   1 
ATOM   801  N  N     . GLY A 1 100 ? 9.612   28.024 16.044  1.00 21.49  ? 124 GLY A N     1 
ATOM   802  C  CA    . GLY A 1 100 ? 8.701   27.585 17.082  1.00 21.38  ? 124 GLY A CA    1 
ATOM   803  C  C     . GLY A 1 100 ? 9.396   26.503 17.878  1.00 22.45  ? 124 GLY A C     1 
ATOM   804  O  O     . GLY A 1 100 ? 10.593  26.284 17.684  1.00 22.90  ? 124 GLY A O     1 
ATOM   805  N  N     . PHE A 1 101 ? 8.678   25.822 18.769  1.00 22.70  ? 125 PHE A N     1 
ATOM   806  C  CA    . PHE A 1 101 ? 9.297   24.758 19.560  1.00 23.33  ? 125 PHE A CA    1 
ATOM   807  C  C     . PHE A 1 101 ? 9.433   23.438 18.810  1.00 23.07  ? 125 PHE A C     1 
ATOM   808  O  O     . PHE A 1 101 ? 10.259  22.608 19.178  1.00 24.83  ? 125 PHE A O     1 
ATOM   809  C  CB    . PHE A 1 101 ? 8.500   24.469 20.837  1.00 24.03  ? 125 PHE A CB    1 
ATOM   810  C  CG    . PHE A 1 101 ? 8.671   25.486 21.916  1.00 25.42  ? 125 PHE A CG    1 
ATOM   811  C  CD1   . PHE A 1 101 ? 8.275   25.194 23.213  1.00 24.57  ? 125 PHE A CD1   1 
ATOM   812  C  CD2   . PHE A 1 101 ? 9.234   26.736 21.646  1.00 26.65  ? 125 PHE A CD2   1 
ATOM   813  C  CE1   . PHE A 1 101 ? 8.443   26.126 24.236  1.00 26.81  ? 125 PHE A CE1   1 
ATOM   814  C  CE2   . PHE A 1 101 ? 9.405   27.677 22.659  1.00 25.62  ? 125 PHE A CE2   1 
ATOM   815  C  CZ    . PHE A 1 101 ? 9.010   27.374 23.955  1.00 26.12  ? 125 PHE A CZ    1 
ATOM   816  N  N     . ASP A 1 102 ? 8.637   23.236 17.767  1.00 21.50  ? 126 ASP A N     1 
ATOM   817  C  CA    . ASP A 1 102 ? 8.683   21.967 17.056  1.00 20.89  ? 126 ASP A CA    1 
ATOM   818  C  C     . ASP A 1 102 ? 9.230   21.951 15.623  1.00 19.79  ? 126 ASP A C     1 
ATOM   819  O  O     . ASP A 1 102 ? 9.073   20.949 14.912  1.00 18.27  ? 126 ASP A O     1 
ATOM   820  C  CB    . ASP A 1 102 ? 7.284   21.315 17.081  1.00 21.54  ? 126 ASP A CB    1 
ATOM   821  C  CG    . ASP A 1 102 ? 6.208   22.179 16.417  1.00 22.34  ? 126 ASP A CG    1 
ATOM   822  O  OD1   . ASP A 1 102 ? 6.550   23.066 15.604  1.00 25.81  ? 126 ASP A OD1   1 
ATOM   823  O  OD2   . ASP A 1 102 ? 5.012   21.963 16.701  1.00 19.49  ? 126 ASP A OD2   1 
ATOM   824  N  N     . GLU A 1 103 ? 9.883   23.028 15.193  1.00 19.01  ? 127 GLU A N     1 
ATOM   825  C  CA    . GLU A 1 103 ? 10.420  23.056 13.830  1.00 17.73  ? 127 GLU A CA    1 
ATOM   826  C  C     . GLU A 1 103 ? 11.843  23.556 13.672  1.00 16.91  ? 127 GLU A C     1 
ATOM   827  O  O     . GLU A 1 103 ? 12.278  24.475 14.351  1.00 16.69  ? 127 GLU A O     1 
ATOM   828  C  CB    . GLU A 1 103 ? 9.491   23.846 12.918  1.00 16.32  ? 127 GLU A CB    1 
ATOM   829  C  CG    . GLU A 1 103 ? 8.260   23.070 12.545  1.00 17.96  ? 127 GLU A CG    1 
ATOM   830  C  CD    . GLU A 1 103 ? 7.249   23.907 11.802  1.00 20.01  ? 127 GLU A CD    1 
ATOM   831  O  OE1   . GLU A 1 103 ? 7.637   24.572 10.815  1.00 22.07  ? 127 GLU A OE1   1 
ATOM   832  O  OE2   . GLU A 1 103 ? 6.066   23.891 12.198  1.00 20.17  ? 127 GLU A OE2   1 
ATOM   833  N  N     . ASN A 1 104 ? 12.564  22.935 12.750  1.00 18.15  ? 128 ASN A N     1 
ATOM   834  C  CA    . ASN A 1 104 ? 13.952  23.290 12.495  1.00 19.54  ? 128 ASN A CA    1 
ATOM   835  C  C     . ASN A 1 104 ? 14.292  23.195 11.012  1.00 20.15  ? 128 ASN A C     1 
ATOM   836  O  O     . ASN A 1 104 ? 13.821  22.288 10.318  1.00 19.86  ? 128 ASN A O     1 
ATOM   837  C  CB    . ASN A 1 104 ? 14.894  22.335 13.255  1.00 19.07  ? 128 ASN A CB    1 
ATOM   838  C  CG    . ASN A 1 104 ? 14.849  22.520 14.759  1.00 19.02  ? 128 ASN A CG    1 
ATOM   839  O  OD1   . ASN A 1 104 ? 15.546  23.354 15.316  1.00 21.83  ? 128 ASN A OD1   1 
ATOM   840  N  ND2   . ASN A 1 104 ? 14.026  21.737 15.419  1.00 21.39  ? 128 ASN A ND2   1 
ATOM   841  N  N     . PHE A 1 105 ? 15.106  24.141 10.542  1.00 21.02  ? 129 PHE A N     1 
ATOM   842  C  CA    . PHE A 1 105 ? 15.600  24.148 9.168   1.00 21.89  ? 129 PHE A CA    1 
ATOM   843  C  C     . PHE A 1 105 ? 17.106  23.916 9.277   1.00 23.79  ? 129 PHE A C     1 
ATOM   844  O  O     . PHE A 1 105 ? 17.763  24.432 10.184  1.00 22.99  ? 129 PHE A O     1 
ATOM   845  C  CB    . PHE A 1 105 ? 15.378  25.487 8.472   1.00 21.88  ? 129 PHE A CB    1 
ATOM   846  C  CG    . PHE A 1 105 ? 13.968  25.731 8.033   1.00 21.91  ? 129 PHE A CG    1 
ATOM   847  C  CD1   . PHE A 1 105 ? 13.103  26.467 8.817   1.00 21.93  ? 129 PHE A CD1   1 
ATOM   848  C  CD2   . PHE A 1 105 ? 13.514  25.254 6.818   1.00 23.55  ? 129 PHE A CD2   1 
ATOM   849  C  CE1   . PHE A 1 105 ? 11.810  26.731 8.390   1.00 22.04  ? 129 PHE A CE1   1 
ATOM   850  C  CE2   . PHE A 1 105 ? 12.219  25.518 6.390   1.00 24.29  ? 129 PHE A CE2   1 
ATOM   851  C  CZ    . PHE A 1 105 ? 11.370  26.255 7.178   1.00 21.52  ? 129 PHE A CZ    1 
ATOM   852  N  N     . VAL A 1 106 ? 17.651  23.135 8.354   1.00 25.89  ? 130 VAL A N     1 
ATOM   853  C  CA    . VAL A 1 106 ? 19.074  22.837 8.357   1.00 26.90  ? 130 VAL A CA    1 
ATOM   854  C  C     . VAL A 1 106 ? 19.569  22.916 6.929   1.00 28.62  ? 130 VAL A C     1 
ATOM   855  O  O     . VAL A 1 106 ? 18.978  22.320 6.016   1.00 28.97  ? 130 VAL A O     1 
ATOM   856  C  CB    . VAL A 1 106 ? 19.353  21.414 8.884   1.00 28.36  ? 130 VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1 106 ? 20.854  21.165 8.899   1.00 26.63  ? 130 VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1 106 ? 18.732  21.226 10.282  1.00 28.06  ? 130 VAL A CG2   1 
ATOM   859  N  N     . ASP A 1 107 ? 20.643  23.671 6.730   1.00 29.00  ? 131 ASP A N     1 
ATOM   860  C  CA    . ASP A 1 107 ? 21.206  23.813 5.405   1.00 28.65  ? 131 ASP A CA    1 
ATOM   861  C  C     . ASP A 1 107 ? 22.212  22.691 5.249   1.00 29.21  ? 131 ASP A C     1 
ATOM   862  O  O     . ASP A 1 107 ? 23.325  22.752 5.780   1.00 30.79  ? 131 ASP A O     1 
ATOM   863  C  CB    . ASP A 1 107 ? 21.885  25.172 5.242   1.00 27.30  ? 131 ASP A CB    1 
ATOM   864  C  CG    . ASP A 1 107 ? 22.434  25.371 3.846   1.00 28.83  ? 131 ASP A CG    1 
ATOM   865  O  OD1   . ASP A 1 107 ? 23.125  24.443 3.353   1.00 29.45  ? 131 ASP A OD1   1 
ATOM   866  O  OD2   . ASP A 1 107 ? 22.181  26.441 3.246   1.00 27.10  ? 131 ASP A OD2   1 
ATOM   867  N  N     . LEU A 1 108 ? 21.797  21.660 4.525   1.00 29.16  ? 132 LEU A N     1 
ATOM   868  C  CA    . LEU A 1 108 ? 22.616  20.476 4.279   1.00 29.46  ? 132 LEU A CA    1 
ATOM   869  C  C     . LEU A 1 108 ? 23.503  20.601 3.037   1.00 29.98  ? 132 LEU A C     1 
ATOM   870  O  O     . LEU A 1 108 ? 24.197  19.655 2.673   1.00 28.93  ? 132 LEU A O     1 
ATOM   871  C  CB    . LEU A 1 108 ? 21.702  19.255 4.117   1.00 29.30  ? 132 LEU A CB    1 
ATOM   872  C  CG    . LEU A 1 108 ? 20.804  18.838 5.290   1.00 29.39  ? 132 LEU A CG    1 
ATOM   873  C  CD1   . LEU A 1 108 ? 19.757  17.828 4.822   1.00 27.18  ? 132 LEU A CD1   1 
ATOM   874  C  CD2   . LEU A 1 108 ? 21.666  18.261 6.407   1.00 29.46  ? 132 LEU A CD2   1 
ATOM   875  N  N     . THR A 1 109 ? 23.483  21.768 2.399   1.00 31.18  ? 133 THR A N     1 
ATOM   876  C  CA    . THR A 1 109 ? 24.249  21.989 1.178   1.00 32.41  ? 133 THR A CA    1 
ATOM   877  C  C     . THR A 1 109 ? 25.728  21.602 1.272   1.00 35.81  ? 133 THR A C     1 
ATOM   878  O  O     . THR A 1 109 ? 26.254  20.870 0.426   1.00 35.62  ? 133 THR A O     1 
ATOM   879  C  CB    . THR A 1 109 ? 24.147  23.453 0.748   1.00 29.80  ? 133 THR A CB    1 
ATOM   880  O  OG1   . THR A 1 109 ? 22.774  23.847 0.756   1.00 29.95  ? 133 THR A OG1   1 
ATOM   881  C  CG2   . THR A 1 109 ? 24.686  23.637 -0.642  1.00 27.37  ? 133 THR A CG2   1 
ATOM   882  N  N     . GLU A 1 110 ? 26.398  22.089 2.306   1.00 38.27  ? 134 GLU A N     1 
ATOM   883  C  CA    . GLU A 1 110 ? 27.810  21.805 2.487   1.00 40.52  ? 134 GLU A CA    1 
ATOM   884  C  C     . GLU A 1 110 ? 28.058  20.338 2.831   1.00 40.03  ? 134 GLU A C     1 
ATOM   885  O  O     . GLU A 1 110 ? 29.084  19.772 2.457   1.00 40.36  ? 134 GLU A O     1 
ATOM   886  C  CB    . GLU A 1 110 ? 28.365  22.708 3.585   1.00 44.72  ? 134 GLU A CB    1 
ATOM   887  C  CG    . GLU A 1 110 ? 29.866  22.685 3.760   1.00 51.46  ? 134 GLU A CG    1 
ATOM   888  C  CD    . GLU A 1 110 ? 30.321  23.591 4.906   1.00 56.77  ? 134 GLU A CD    1 
ATOM   889  O  OE1   . GLU A 1 110 ? 30.017  24.812 4.869   1.00 56.86  ? 134 GLU A OE1   1 
ATOM   890  O  OE2   . GLU A 1 110 ? 30.983  23.079 5.842   1.00 58.89  ? 134 GLU A OE2   1 
ATOM   891  N  N     . MET A 1 111 ? 27.115  19.718 3.527   1.00 38.49  ? 135 MET A N     1 
ATOM   892  C  CA    . MET A 1 111 ? 27.265  18.324 3.928   1.00 37.17  ? 135 MET A CA    1 
ATOM   893  C  C     . MET A 1 111 ? 27.086  17.347 2.764   1.00 35.97  ? 135 MET A C     1 
ATOM   894  O  O     . MET A 1 111 ? 27.778  16.334 2.666   1.00 33.40  ? 135 MET A O     1 
ATOM   895  C  CB    . MET A 1 111 ? 26.262  18.009 5.032   1.00 38.91  ? 135 MET A CB    1 
ATOM   896  C  CG    . MET A 1 111 ? 26.616  16.809 5.869   1.00 41.62  ? 135 MET A CG    1 
ATOM   897  S  SD    . MET A 1 111 ? 25.374  16.522 7.128   1.00 46.37  ? 135 MET A SD    1 
ATOM   898  C  CE    . MET A 1 111 ? 25.522  14.745 7.322   1.00 47.56  ? 135 MET A CE    1 
ATOM   899  N  N     . VAL A 1 112 ? 26.149  17.658 1.879   1.00 36.23  ? 136 VAL A N     1 
ATOM   900  C  CA    . VAL A 1 112 ? 25.882  16.808 0.727   1.00 36.82  ? 136 VAL A CA    1 
ATOM   901  C  C     . VAL A 1 112 ? 27.093  16.799 -0.210  1.00 37.61  ? 136 VAL A C     1 
ATOM   902  O  O     . VAL A 1 112 ? 27.436  15.771 -0.795  1.00 36.33  ? 136 VAL A O     1 
ATOM   903  C  CB    . VAL A 1 112 ? 24.606  17.296 -0.015  1.00 35.92  ? 136 VAL A CB    1 
ATOM   904  C  CG1   . VAL A 1 112 ? 24.423  16.547 -1.327  1.00 37.19  ? 136 VAL A CG1   1 
ATOM   905  C  CG2   . VAL A 1 112 ? 23.392  17.069 0.869   1.00 35.03  ? 136 VAL A CG2   1 
ATOM   906  N  N     . GLU A 1 113 ? 27.739  17.952 -0.339  1.00 39.79  ? 137 GLU A N     1 
ATOM   907  C  CA    . GLU A 1 113 ? 28.921  18.078 -1.180  1.00 43.26  ? 137 GLU A CA    1 
ATOM   908  C  C     . GLU A 1 113 ? 30.046  17.185 -0.676  1.00 44.32  ? 137 GLU A C     1 
ATOM   909  O  O     . GLU A 1 113 ? 30.629  16.412 -1.436  1.00 44.84  ? 137 GLU A O     1 
ATOM   910  C  CB    . GLU A 1 113 ? 29.399  19.529 -1.206  1.00 44.57  ? 137 GLU A CB    1 
ATOM   911  C  CG    . GLU A 1 113 ? 28.564  20.397 -2.103  1.00 49.60  ? 137 GLU A CG    1 
ATOM   912  C  CD    . GLU A 1 113 ? 28.457  19.794 -3.485  1.00 53.25  ? 137 GLU A CD    1 
ATOM   913  O  OE1   . GLU A 1 113 ? 29.506  19.682 -4.159  1.00 54.60  ? 137 GLU A OE1   1 
ATOM   914  O  OE2   . GLU A 1 113 ? 27.334  19.414 -3.891  1.00 56.02  ? 137 GLU A OE2   1 
ATOM   915  N  N     . LYS A 1 114 ? 30.349  17.297 0.611   1.00 44.58  ? 138 LYS A N     1 
ATOM   916  C  CA    . LYS A 1 114 ? 31.397  16.493 1.202   1.00 45.60  ? 138 LYS A CA    1 
ATOM   917  C  C     . LYS A 1 114 ? 31.102  15.010 1.003   1.00 45.55  ? 138 LYS A C     1 
ATOM   918  O  O     . LYS A 1 114 ? 31.979  14.248 0.628   1.00 45.56  ? 138 LYS A O     1 
ATOM   919  C  CB    . LYS A 1 114 ? 31.526  16.811 2.690   1.00 46.64  ? 138 LYS A CB    1 
ATOM   920  C  CG    . LYS A 1 114 ? 32.539  15.950 3.425   1.00 50.43  ? 138 LYS A CG    1 
ATOM   921  C  CD    . LYS A 1 114 ? 32.540  16.250 4.928   1.00 52.62  ? 138 LYS A CD    1 
ATOM   922  C  CE    . LYS A 1 114 ? 33.353  15.219 5.721   1.00 52.92  ? 138 LYS A CE    1 
ATOM   923  N  NZ    . LYS A 1 114 ? 33.166  15.377 7.197   1.00 52.17  ? 138 LYS A NZ    1 
ATOM   924  N  N     . ARG A 1 115 ? 29.865  14.599 1.246   1.00 46.39  ? 139 ARG A N     1 
ATOM   925  C  CA    . ARG A 1 115 ? 29.518  13.194 1.074   1.00 47.22  ? 139 ARG A CA    1 
ATOM   926  C  C     . ARG A 1 115 ? 29.704  12.764 -0.369  1.00 48.80  ? 139 ARG A C     1 
ATOM   927  O  O     . ARG A 1 115 ? 30.308  11.731 -0.641  1.00 49.64  ? 139 ARG A O     1 
ATOM   928  C  CB    . ARG A 1 115 ? 28.073  12.925 1.504   1.00 44.94  ? 139 ARG A CB    1 
ATOM   929  C  CG    . ARG A 1 115 ? 27.823  13.164 2.973   1.00 42.48  ? 139 ARG A CG    1 
ATOM   930  C  CD    . ARG A 1 115 ? 26.632  12.377 3.455   1.00 39.72  ? 139 ARG A CD    1 
ATOM   931  N  NE    . ARG A 1 115 ? 26.496  12.437 4.908   1.00 39.56  ? 139 ARG A NE    1 
ATOM   932  C  CZ    . ARG A 1 115 ? 25.648  11.686 5.610   1.00 40.95  ? 139 ARG A CZ    1 
ATOM   933  N  NH1   . ARG A 1 115 ? 24.857  10.810 4.994   1.00 38.92  ? 139 ARG A NH1   1 
ATOM   934  N  NH2   . ARG A 1 115 ? 25.576  11.817 6.928   1.00 39.96  ? 139 ARG A NH2   1 
ATOM   935  N  N     . LEU A 1 116 ? 29.182  13.554 -1.298  1.00 51.41  ? 140 LEU A N     1 
ATOM   936  C  CA    . LEU A 1 116 ? 29.318  13.219 -2.705  1.00 54.30  ? 140 LEU A CA    1 
ATOM   937  C  C     . LEU A 1 116 ? 30.776  13.063 -3.107  1.00 56.49  ? 140 LEU A C     1 
ATOM   938  O  O     . LEU A 1 116 ? 31.122  12.130 -3.819  1.00 57.41  ? 140 LEU A O     1 
ATOM   939  C  CB    . LEU A 1 116 ? 28.655  14.282 -3.580  1.00 53.97  ? 140 LEU A CB    1 
ATOM   940  C  CG    . LEU A 1 116 ? 27.129  14.221 -3.641  1.00 53.96  ? 140 LEU A CG    1 
ATOM   941  C  CD1   . LEU A 1 116 ? 26.614  15.262 -4.621  1.00 53.96  ? 140 LEU A CD1   1 
ATOM   942  C  CD2   . LEU A 1 116 ? 26.699  12.831 -4.073  1.00 53.48  ? 140 LEU A CD2   1 
ATOM   943  N  N     . GLN A 1 117 ? 31.630  13.968 -2.641  1.00 59.29  ? 141 GLN A N     1 
ATOM   944  C  CA    . GLN A 1 117 ? 33.047  13.919 -2.985  1.00 62.27  ? 141 GLN A CA    1 
ATOM   945  C  C     . GLN A 1 117 ? 33.770  12.672 -2.504  1.00 64.45  ? 141 GLN A C     1 
ATOM   946  O  O     . GLN A 1 117 ? 34.887  12.394 -2.942  1.00 65.14  ? 141 GLN A O     1 
ATOM   947  C  CB    . GLN A 1 117 ? 33.759  15.168 -2.464  1.00 62.34  ? 141 GLN A CB    1 
ATOM   948  C  CG    . GLN A 1 117 ? 33.685  16.334 -3.439  1.00 65.06  ? 141 GLN A CG    1 
ATOM   949  C  CD    . GLN A 1 117 ? 34.081  17.657 -2.817  1.00 66.60  ? 141 GLN A CD    1 
ATOM   950  O  OE1   . GLN A 1 117 ? 35.158  17.788 -2.234  1.00 68.87  ? 141 GLN A OE1   1 
ATOM   951  N  NE2   . GLN A 1 117 ? 33.211  18.653 -2.948  1.00 67.26  ? 141 GLN A NE2   1 
ATOM   952  N  N     . GLN A 1 118 ? 33.134  11.915 -1.615  1.00 66.87  ? 142 GLN A N     1 
ATOM   953  C  CA    . GLN A 1 118 ? 33.739  10.698 -1.088  1.00 70.01  ? 142 GLN A CA    1 
ATOM   954  C  C     . GLN A 1 118 ? 33.304  9.475  -1.895  1.00 71.47  ? 142 GLN A C     1 
ATOM   955  O  O     . GLN A 1 118 ? 33.870  8.386  -1.745  1.00 71.62  ? 142 GLN A O     1 
ATOM   956  C  CB    . GLN A 1 118 ? 33.367  10.507 0.388   1.00 72.04  ? 142 GLN A CB    1 
ATOM   957  C  CG    . GLN A 1 118 ? 33.567  11.737 1.265   1.00 76.56  ? 142 GLN A CG    1 
ATOM   958  C  CD    . GLN A 1 118 ? 34.868  12.475 0.981   1.00 79.99  ? 142 GLN A CD    1 
ATOM   959  O  OE1   . GLN A 1 118 ? 35.019  13.124 -0.061  1.00 81.83  ? 142 GLN A OE1   1 
ATOM   960  N  NE2   . GLN A 1 118 ? 35.818  12.381 1.910   1.00 81.33  ? 142 GLN A NE2   1 
ATOM   961  N  N     . LEU A 1 119 ? 32.301  9.660  -2.751  1.00 72.46  ? 143 LEU A N     1 
ATOM   962  C  CA    . LEU A 1 119 ? 31.799  8.578  -3.593  1.00 73.97  ? 143 LEU A CA    1 
ATOM   963  C  C     . LEU A 1 119 ? 32.680  8.375  -4.824  1.00 76.00  ? 143 LEU A C     1 
ATOM   964  O  O     . LEU A 1 119 ? 33.236  9.330  -5.363  1.00 76.09  ? 143 LEU A O     1 
ATOM   965  C  CB    . LEU A 1 119 ? 30.368  8.869  -4.041  1.00 72.69  ? 143 LEU A CB    1 
ATOM   966  C  CG    . LEU A 1 119 ? 29.274  8.829  -2.980  1.00 71.55  ? 143 LEU A CG    1 
ATOM   967  C  CD1   . LEU A 1 119 ? 27.945  9.133  -3.639  1.00 71.36  ? 143 LEU A CD1   1 
ATOM   968  C  CD2   . LEU A 1 119 ? 29.233  7.462  -2.322  1.00 71.65  ? 143 LEU A CD2   1 
ATOM   969  N  N     . GLN A 1 120 ? 32.791  7.128  -5.272  1.00 78.72  ? 144 GLN A N     1 
ATOM   970  C  CA    . GLN A 1 120 ? 33.615  6.800  -6.433  1.00 81.15  ? 144 GLN A CA    1 
ATOM   971  C  C     . GLN A 1 120 ? 32.792  6.760  -7.710  1.00 81.88  ? 144 GLN A C     1 
ATOM   972  O  O     . GLN A 1 120 ? 31.588  6.500  -7.670  1.00 81.48  ? 144 GLN A O     1 
ATOM   973  C  CB    . GLN A 1 120 ? 34.304  5.448  -6.225  1.00 82.53  ? 144 GLN A CB    1 
ATOM   974  C  CG    . GLN A 1 120 ? 34.892  5.265  -4.833  1.00 84.01  ? 144 GLN A CG    1 
ATOM   975  C  CD    . GLN A 1 120 ? 35.814  6.403  -4.425  1.00 85.21  ? 144 GLN A CD    1 
ATOM   976  O  OE1   . GLN A 1 120 ? 35.417  7.572  -4.411  1.00 85.57  ? 144 GLN A OE1   1 
ATOM   977  N  NE2   . GLN A 1 120 ? 37.052  6.064  -4.082  1.00 86.26  ? 144 GLN A NE2   1 
ATOM   978  N  N     . SER A 1 121 ? 33.458  7.012  -8.836  1.00 82.88  ? 145 SER A N     1 
ATOM   979  C  CA    . SER A 1 121 ? 32.819  7.019  -10.152 1.00 83.47  ? 145 SER A CA    1 
ATOM   980  C  C     . SER A 1 121 ? 32.202  5.663  -10.500 1.00 83.47  ? 145 SER A C     1 
ATOM   981  O  O     . SER A 1 121 ? 32.526  5.052  -11.523 1.00 83.36  ? 145 SER A O     1 
ATOM   982  C  CB    . SER A 1 121 ? 33.838  7.416  -11.230 1.00 83.99  ? 145 SER A CB    1 
ATOM   983  O  OG    . SER A 1 121 ? 34.348  8.721  -11.008 1.00 83.84  ? 145 SER A OG    1 
ATOM   984  N  N     . ASP A 1 122 ? 31.305  5.205  -9.636  1.00 83.08  ? 146 ASP A N     1 
ATOM   985  C  CA    . ASP A 1 122 ? 30.623  3.935  -9.817  1.00 82.73  ? 146 ASP A CA    1 
ATOM   986  C  C     . ASP A 1 122 ? 29.469  3.908  -8.830  1.00 82.55  ? 146 ASP A C     1 
ATOM   987  O  O     . ASP A 1 122 ? 28.303  3.918  -9.221  1.00 83.11  ? 146 ASP A O     1 
ATOM   988  C  CB    . ASP A 1 122 ? 31.579  2.780  -9.543  1.00 82.05  ? 146 ASP A CB    1 
ATOM   989  N  N     . GLU A 1 123 ? 29.813  3.893  -7.546  1.00 82.33  ? 147 GLU A N     1 
ATOM   990  C  CA    . GLU A 1 123 ? 28.832  3.869  -6.464  1.00 81.12  ? 147 GLU A CA    1 
ATOM   991  C  C     . GLU A 1 123 ? 27.827  5.012  -6.566  1.00 78.97  ? 147 GLU A C     1 
ATOM   992  O  O     . GLU A 1 123 ? 26.726  4.933  -6.015  1.00 78.65  ? 147 GLU A O     1 
ATOM   993  C  CB    . GLU A 1 123 ? 29.556  3.925  -5.117  1.00 82.46  ? 147 GLU A CB    1 
ATOM   994  C  CG    . GLU A 1 123 ? 30.710  4.921  -5.081  1.00 83.92  ? 147 GLU A CG    1 
ATOM   995  C  CD    . GLU A 1 123 ? 31.566  4.778  -3.835  1.00 84.90  ? 147 GLU A CD    1 
ATOM   996  O  OE1   . GLU A 1 123 ? 32.044  3.656  -3.561  1.00 85.88  ? 147 GLU A OE1   1 
ATOM   997  O  OE2   . GLU A 1 123 ? 31.767  5.788  -3.130  1.00 85.40  ? 147 GLU A OE2   1 
ATOM   998  N  N     . LEU A 1 124 ? 28.209  6.070  -7.273  1.00 76.16  ? 148 LEU A N     1 
ATOM   999  C  CA    . LEU A 1 124 ? 27.333  7.221  -7.457  1.00 73.52  ? 148 LEU A CA    1 
ATOM   1000 C  C     . LEU A 1 124 ? 26.082  6.854  -8.274  1.00 71.78  ? 148 LEU A C     1 
ATOM   1001 O  O     . LEU A 1 124 ? 25.155  7.655  -8.403  1.00 71.71  ? 148 LEU A O     1 
ATOM   1002 C  CB    . LEU A 1 124 ? 28.107  8.356  -8.137  1.00 72.64  ? 148 LEU A CB    1 
ATOM   1003 C  CG    . LEU A 1 124 ? 27.354  9.656  -8.437  1.00 72.63  ? 148 LEU A CG    1 
ATOM   1004 C  CD1   . LEU A 1 124 ? 28.261  10.848 -8.165  1.00 71.73  ? 148 LEU A CD1   1 
ATOM   1005 C  CD2   . LEU A 1 124 ? 26.857  9.648  -9.880  1.00 71.06  ? 148 LEU A CD2   1 
ATOM   1006 N  N     . SER A 1 125 ? 26.060  5.638  -8.814  1.00 69.46  ? 149 SER A N     1 
ATOM   1007 C  CA    . SER A 1 125 ? 24.929  5.155  -9.608  1.00 66.59  ? 149 SER A CA    1 
ATOM   1008 C  C     . SER A 1 125 ? 24.052  4.295  -8.714  1.00 63.87  ? 149 SER A C     1 
ATOM   1009 O  O     . SER A 1 125 ? 22.924  3.947  -9.069  1.00 62.93  ? 149 SER A O     1 
ATOM   1010 C  CB    . SER A 1 125 ? 25.421  4.313  -10.791 1.00 67.65  ? 149 SER A CB    1 
ATOM   1011 O  OG    . SER A 1 125 ? 26.339  5.035  -11.597 1.00 70.16  ? 149 SER A OG    1 
ATOM   1012 N  N     . ALA A 1 126 ? 24.596  3.947  -7.553  1.00 60.86  ? 150 ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 126 ? 23.889  3.127  -6.584  1.00 58.15  ? 150 ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 126 ? 23.234  4.013  -5.526  1.00 56.46  ? 150 ALA A C     1 
ATOM   1015 O  O     . ALA A 1 126 ? 22.664  3.507  -4.554  1.00 55.94  ? 150 ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 126 ? 24.856  2.146  -5.930  1.00 58.27  ? 150 ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 127 ? 23.335  5.332  -5.712  1.00 53.55  ? 151 VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 127 ? 22.732  6.287  -4.786  1.00 49.78  ? 151 VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 127 ? 21.238  6.023  -4.803  1.00 48.11  ? 151 VAL A C     1 
ATOM   1020 O  O     . VAL A 1 127 ? 20.649  5.846  -5.877  1.00 47.76  ? 151 VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 127 ? 22.997  7.744  -5.214  1.00 49.24  ? 151 VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 127 ? 22.238  8.700  -4.313  1.00 48.83  ? 151 VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 127 ? 24.481  8.037  -5.141  1.00 49.39  ? 151 VAL A CG2   1 
ATOM   1024 N  N     . THR A 1 128 ? 20.630  5.983  -3.620  1.00 44.85  ? 152 THR A N     1 
ATOM   1025 C  CA    . THR A 1 128 ? 19.203  5.704  -3.518  1.00 42.85  ? 152 THR A CA    1 
ATOM   1026 C  C     . THR A 1 128 ? 18.494  6.676  -2.601  1.00 40.75  ? 152 THR A C     1 
ATOM   1027 O  O     . THR A 1 128 ? 19.091  7.185  -1.657  1.00 41.93  ? 152 THR A O     1 
ATOM   1028 C  CB    . THR A 1 128 ? 18.957  4.278  -2.988  1.00 43.66  ? 152 THR A CB    1 
ATOM   1029 O  OG1   . THR A 1 128 ? 19.539  4.138  -1.682  1.00 43.95  ? 152 THR A OG1   1 
ATOM   1030 C  CG2   . THR A 1 128 ? 19.578  3.257  -3.923  1.00 43.26  ? 152 THR A CG2   1 
ATOM   1031 N  N     . VAL A 1 129 ? 17.219  6.926  -2.881  1.00 37.75  ? 153 VAL A N     1 
ATOM   1032 C  CA    . VAL A 1 129 ? 16.423  7.836  -2.070  1.00 35.63  ? 153 VAL A CA    1 
ATOM   1033 C  C     . VAL A 1 129 ? 16.081  7.164  -0.752  1.00 35.10  ? 153 VAL A C     1 
ATOM   1034 O  O     . VAL A 1 129 ? 16.150  5.941  -0.630  1.00 34.60  ? 153 VAL A O     1 
ATOM   1035 C  CB    . VAL A 1 129 ? 15.089  8.224  -2.770  1.00 35.97  ? 153 VAL A CB    1 
ATOM   1036 C  CG1   . VAL A 1 129 ? 14.158  7.021  -2.854  1.00 33.82  ? 153 VAL A CG1   1 
ATOM   1037 C  CG2   . VAL A 1 129 ? 14.407  9.344  -2.008  1.00 35.52  ? 153 VAL A CG2   1 
ATOM   1038 N  N     . SER A 1 130 ? 15.715  7.972  0.235   1.00 34.23  ? 154 SER A N     1 
ATOM   1039 C  CA    . SER A 1 130 ? 15.339  7.458  1.540   1.00 33.33  ? 154 SER A CA    1 
ATOM   1040 C  C     . SER A 1 130 ? 13.989  8.062  1.892   1.00 32.44  ? 154 SER A C     1 
ATOM   1041 O  O     . SER A 1 130 ? 13.899  9.221  2.262   1.00 33.59  ? 154 SER A O     1 
ATOM   1042 C  CB    . SER A 1 130 ? 16.378  7.851  2.582   1.00 33.25  ? 154 SER A CB    1 
ATOM   1043 O  OG    . SER A 1 130 ? 16.061  7.282  3.840   1.00 38.94  ? 154 SER A OG    1 
ATOM   1044 N  N     . GLY A 1 131 ? 12.939  7.266  1.768   1.00 31.44  ? 155 GLY A N     1 
ATOM   1045 C  CA    . GLY A 1 131 ? 11.612  7.762  2.050   1.00 30.66  ? 155 GLY A CA    1 
ATOM   1046 C  C     . GLY A 1 131 ? 10.877  8.070  0.755   1.00 30.82  ? 155 GLY A C     1 
ATOM   1047 O  O     . GLY A 1 131 ? 11.269  7.610  -0.324  1.00 30.97  ? 155 GLY A O     1 
ATOM   1048 N  N     . HIS A 1 132 ? 9.809   8.856  0.874   1.00 28.86  ? 156 HIS A N     1 
ATOM   1049 C  CA    . HIS A 1 132 ? 8.972   9.265  -0.246  1.00 26.34  ? 156 HIS A CA    1 
ATOM   1050 C  C     . HIS A 1 132 ? 9.632   10.257 -1.212  1.00 27.34  ? 156 HIS A C     1 
ATOM   1051 O  O     . HIS A 1 132 ? 10.555  10.998 -0.861  1.00 27.46  ? 156 HIS A O     1 
ATOM   1052 C  CB    . HIS A 1 132 ? 7.702   9.921  0.292   1.00 24.75  ? 156 HIS A CB    1 
ATOM   1053 C  CG    . HIS A 1 132 ? 6.874   9.029  1.156   1.00 22.65  ? 156 HIS A CG    1 
ATOM   1054 N  ND1   . HIS A 1 132 ? 5.950   8.143  0.642   1.00 21.96  ? 156 HIS A ND1   1 
ATOM   1055 C  CD2   . HIS A 1 132 ? 6.824   8.887  2.502   1.00 21.58  ? 156 HIS A CD2   1 
ATOM   1056 C  CE1   . HIS A 1 132 ? 5.365   7.495  1.632   1.00 20.23  ? 156 HIS A CE1   1 
ATOM   1057 N  NE2   . HIS A 1 132 ? 5.877   7.927  2.771   1.00 22.18  ? 156 HIS A NE2   1 
ATOM   1058 N  N     . VAL A 1 133 ? 9.136   10.256 -2.442  1.00 27.71  ? 157 VAL A N     1 
ATOM   1059 C  CA    . VAL A 1 133 ? 9.581   11.182 -3.472  1.00 26.89  ? 157 VAL A CA    1 
ATOM   1060 C  C     . VAL A 1 133 ? 8.265   11.838 -3.878  1.00 27.57  ? 157 VAL A C     1 
ATOM   1061 O  O     . VAL A 1 133 ? 7.317   11.141 -4.246  1.00 28.95  ? 157 VAL A O     1 
ATOM   1062 C  CB    . VAL A 1 133 ? 10.201  10.455 -4.679  1.00 25.27  ? 157 VAL A CB    1 
ATOM   1063 C  CG1   . VAL A 1 133 ? 10.373  11.430 -5.824  1.00 25.29  ? 157 VAL A CG1   1 
ATOM   1064 C  CG2   . VAL A 1 133 ? 11.553  9.860  -4.297  1.00 22.48  ? 157 VAL A CG2   1 
ATOM   1065 N  N     . TYR A 1 134 ? 8.195   13.163 -3.785  1.00 27.41  ? 158 TYR A N     1 
ATOM   1066 C  CA    . TYR A 1 134 ? 6.969   13.881 -4.106  1.00 27.49  ? 158 TYR A CA    1 
ATOM   1067 C  C     . TYR A 1 134 ? 6.414   13.660 -5.516  1.00 30.53  ? 158 TYR A C     1 
ATOM   1068 O  O     . TYR A 1 134 ? 7.137   13.686 -6.522  1.00 29.88  ? 158 TYR A O     1 
ATOM   1069 C  CB    . TYR A 1 134 ? 7.139   15.376 -3.855  1.00 25.88  ? 158 TYR A CB    1 
ATOM   1070 C  CG    . TYR A 1 134 ? 5.857   16.130 -4.079  1.00 26.25  ? 158 TYR A CG    1 
ATOM   1071 C  CD1   . TYR A 1 134 ? 5.565   16.698 -5.319  1.00 27.21  ? 158 TYR A CD1   1 
ATOM   1072 C  CD2   . TYR A 1 134 ? 4.899   16.220 -3.075  1.00 26.51  ? 158 TYR A CD2   1 
ATOM   1073 C  CE1   . TYR A 1 134 ? 4.348   17.333 -5.549  1.00 26.23  ? 158 TYR A CE1   1 
ATOM   1074 C  CE2   . TYR A 1 134 ? 3.684   16.853 -3.294  1.00 25.93  ? 158 TYR A CE2   1 
ATOM   1075 C  CZ    . TYR A 1 134 ? 3.413   17.406 -4.533  1.00 25.87  ? 158 TYR A CZ    1 
ATOM   1076 O  OH    . TYR A 1 134 ? 2.205   18.019 -4.757  1.00 25.24  ? 158 TYR A OH    1 
ATOM   1077 N  N     . ASN A 1 135 ? 5.098   13.475 -5.557  1.00 31.79  ? 159 ASN A N     1 
ATOM   1078 C  CA    . ASN A 1 135 ? 4.342   13.213 -6.776  1.00 32.79  ? 159 ASN A CA    1 
ATOM   1079 C  C     . ASN A 1 135 ? 4.930   11.994 -7.458  1.00 34.16  ? 159 ASN A C     1 
ATOM   1080 O  O     . ASN A 1 135 ? 4.834   11.819 -8.676  1.00 35.57  ? 159 ASN A O     1 
ATOM   1081 C  CB    . ASN A 1 135 ? 4.326   14.431 -7.717  1.00 33.33  ? 159 ASN A CB    1 
ATOM   1082 C  CG    . ASN A 1 135 ? 3.290   14.290 -8.849  1.00 31.92  ? 159 ASN A CG    1 
ATOM   1083 O  OD1   . ASN A 1 135 ? 2.200   13.749 -8.653  1.00 31.44  ? 159 ASN A OD1   1 
ATOM   1084 N  ND2   . ASN A 1 135 ? 3.630   14.790 -10.025 1.00 30.49  ? 159 ASN A ND2   1 
ATOM   1085 N  N     . ASN A 1 136 ? 5.564   11.157 -6.649  1.00 35.24  ? 160 ASN A N     1 
ATOM   1086 C  CA    . ASN A 1 136 ? 6.123   9.913  -7.140  1.00 37.32  ? 160 ASN A CA    1 
ATOM   1087 C  C     . ASN A 1 136 ? 6.942   10.127 -8.403  1.00 36.42  ? 160 ASN A C     1 
ATOM   1088 O  O     . ASN A 1 136 ? 6.942   9.297  -9.307  1.00 36.19  ? 160 ASN A O     1 
ATOM   1089 C  CB    . ASN A 1 136 ? 4.967   8.960  -7.426  1.00 40.01  ? 160 ASN A CB    1 
ATOM   1090 C  CG    . ASN A 1 136 ? 5.410   7.541  -7.546  1.00 43.75  ? 160 ASN A CG    1 
ATOM   1091 O  OD1   . ASN A 1 136 ? 5.841   6.929  -6.564  1.00 46.80  ? 160 ASN A OD1   1 
ATOM   1092 N  ND2   . ASN A 1 136 ? 5.319   6.996  -8.754  1.00 46.36  ? 160 ASN A ND2   1 
ATOM   1093 N  N     . GLN A 1 137 ? 7.654   11.243 -8.456  1.00 36.51  ? 161 GLN A N     1 
ATOM   1094 C  CA    . GLN A 1 137 ? 8.443   11.570 -9.630  1.00 35.68  ? 161 GLN A CA    1 
ATOM   1095 C  C     . GLN A 1 137 ? 9.573   10.597 -9.905  1.00 34.87  ? 161 GLN A C     1 
ATOM   1096 O  O     . GLN A 1 137 ? 10.076  9.936  -9.000  1.00 36.02  ? 161 GLN A O     1 
ATOM   1097 C  CB    . GLN A 1 137 ? 9.023   12.974 -9.504  1.00 34.86  ? 161 GLN A CB    1 
ATOM   1098 C  CG    . GLN A 1 137 ? 9.560   13.486 -10.806 1.00 35.88  ? 161 GLN A CG    1 
ATOM   1099 C  CD    . GLN A 1 137 ? 10.443  14.677 -10.626 1.00 37.89  ? 161 GLN A CD    1 
ATOM   1100 O  OE1   . GLN A 1 137 ? 10.104  15.612 -9.894  1.00 37.51  ? 161 GLN A OE1   1 
ATOM   1101 N  NE2   . GLN A 1 137 ? 11.589  14.666 -11.300 1.00 37.85  ? 161 GLN A NE2   1 
ATOM   1102 N  N     . SER A 1 138 ? 9.968   10.514 -11.169 1.00 33.76  ? 162 SER A N     1 
ATOM   1103 C  CA    . SER A 1 138 ? 11.060  9.639  -11.559 1.00 32.64  ? 162 SER A CA    1 
ATOM   1104 C  C     . SER A 1 138 ? 12.391  10.285 -11.242 1.00 30.11  ? 162 SER A C     1 
ATOM   1105 O  O     . SER A 1 138 ? 12.556  11.501 -11.394 1.00 28.71  ? 162 SER A O     1 
ATOM   1106 C  CB    . SER A 1 138 ? 11.001  9.327  -13.048 1.00 33.03  ? 162 SER A CB    1 
ATOM   1107 O  OG    . SER A 1 138 ? 10.077  8.286  -13.291 1.00 39.76  ? 162 SER A OG    1 
ATOM   1108 N  N     . ILE A 1 139 ? 13.334  9.457  -10.803 1.00 27.52  ? 163 ILE A N     1 
ATOM   1109 C  CA    . ILE A 1 139 ? 14.667  9.923  -10.464 1.00 25.56  ? 163 ILE A CA    1 
ATOM   1110 C  C     . ILE A 1 139 ? 15.582  9.734  -11.650 1.00 25.90  ? 163 ILE A C     1 
ATOM   1111 O  O     . ILE A 1 139 ? 15.532  8.708  -12.317 1.00 26.17  ? 163 ILE A O     1 
ATOM   1112 C  CB    . ILE A 1 139 ? 15.272  9.136  -9.287  1.00 22.04  ? 163 ILE A CB    1 
ATOM   1113 C  CG1   . ILE A 1 139 ? 14.376  9.273  -8.060  1.00 21.06  ? 163 ILE A CG1   1 
ATOM   1114 C  CG2   . ILE A 1 139 ? 16.673  9.645  -8.998  1.00 20.16  ? 163 ILE A CG2   1 
ATOM   1115 C  CD1   . ILE A 1 139 ? 14.865  8.509  -6.852  1.00 20.77  ? 163 ILE A CD1   1 
ATOM   1116 N  N     . ASN A 1 140 ? 16.414  10.731 -11.908 1.00 26.06  ? 164 ASN A N     1 
ATOM   1117 C  CA    . ASN A 1 140 ? 17.360  10.665 -12.996 1.00 27.43  ? 164 ASN A CA    1 
ATOM   1118 C  C     . ASN A 1 140 ? 18.722  10.708 -12.338 1.00 28.57  ? 164 ASN A C     1 
ATOM   1119 O  O     . ASN A 1 140 ? 19.193  11.774 -11.945 1.00 27.65  ? 164 ASN A O     1 
ATOM   1120 C  CB    . ASN A 1 140 ? 17.195  11.866 -13.917 1.00 30.03  ? 164 ASN A CB    1 
ATOM   1121 C  CG    . ASN A 1 140 ? 17.886  11.675 -15.248 1.00 32.39  ? 164 ASN A CG    1 
ATOM   1122 O  OD1   . ASN A 1 140 ? 19.045  11.245 -15.313 1.00 33.05  ? 164 ASN A OD1   1 
ATOM   1123 N  ND2   . ASN A 1 140 ? 17.179  11.998 -16.324 1.00 33.15  ? 164 ASN A ND2   1 
ATOM   1124 N  N     . LEU A 1 141 ? 19.351  9.544  -12.219 1.00 30.98  ? 165 LEU A N     1 
ATOM   1125 C  CA    . LEU A 1 141 ? 20.656  9.427  -11.578 1.00 32.32  ? 165 LEU A CA    1 
ATOM   1126 C  C     . LEU A 1 141 ? 21.802  10.165 -12.255 1.00 33.58  ? 165 LEU A C     1 
ATOM   1127 O  O     . LEU A 1 141 ? 22.924  10.162 -11.746 1.00 35.34  ? 165 LEU A O     1 
ATOM   1128 C  CB    . LEU A 1 141 ? 21.020  7.952  -11.417 1.00 33.01  ? 165 LEU A CB    1 
ATOM   1129 C  CG    . LEU A 1 141 ? 20.104  7.195  -10.447 1.00 33.87  ? 165 LEU A CG    1 
ATOM   1130 C  CD1   . LEU A 1 141 ? 20.428  5.721  -10.429 1.00 32.58  ? 165 LEU A CD1   1 
ATOM   1131 C  CD2   . LEU A 1 141 ? 20.277  7.780  -9.066  1.00 35.29  ? 165 LEU A CD2   1 
ATOM   1132 N  N     . LEU A 1 142 ? 21.530  10.802 -13.391 1.00 34.84  ? 166 LEU A N     1 
ATOM   1133 C  CA    . LEU A 1 142 ? 22.568  11.548 -14.102 1.00 34.16  ? 166 LEU A CA    1 
ATOM   1134 C  C     . LEU A 1 142 ? 22.399  13.030 -13.845 1.00 34.38  ? 166 LEU A C     1 
ATOM   1135 O  O     . LEU A 1 142 ? 23.262  13.842 -14.187 1.00 35.80  ? 166 LEU A O     1 
ATOM   1136 C  CB    . LEU A 1 142 ? 22.513  11.264 -15.606 1.00 33.84  ? 166 LEU A CB    1 
ATOM   1137 C  CG    . LEU A 1 142 ? 22.879  9.823  -15.993 1.00 33.99  ? 166 LEU A CG    1 
ATOM   1138 C  CD1   . LEU A 1 142 ? 22.971  9.695  -17.499 1.00 32.76  ? 166 LEU A CD1   1 
ATOM   1139 C  CD2   . LEU A 1 142 ? 24.203  9.445  -15.354 1.00 31.08  ? 166 LEU A CD2   1 
ATOM   1140 N  N     . ASP A 1 143 ? 21.268  13.379 -13.249 1.00 33.49  ? 167 ASP A N     1 
ATOM   1141 C  CA    . ASP A 1 143 ? 20.994  14.762 -12.914 1.00 33.88  ? 167 ASP A CA    1 
ATOM   1142 C  C     . ASP A 1 143 ? 21.721  15.024 -11.592 1.00 34.96  ? 167 ASP A C     1 
ATOM   1143 O  O     . ASP A 1 143 ? 21.396  14.416 -10.564 1.00 37.61  ? 167 ASP A O     1 
ATOM   1144 C  CB    . ASP A 1 143 ? 19.492  14.964 -12.730 1.00 33.39  ? 167 ASP A CB    1 
ATOM   1145 C  CG    . ASP A 1 143 ? 19.130  16.412 -12.515 1.00 33.10  ? 167 ASP A CG    1 
ATOM   1146 O  OD1   . ASP A 1 143 ? 19.829  17.088 -11.732 1.00 34.76  ? 167 ASP A OD1   1 
ATOM   1147 O  OD2   . ASP A 1 143 ? 18.147  16.878 -13.123 1.00 31.86  ? 167 ASP A OD2   1 
ATOM   1148 N  N     . VAL A 1 144 ? 22.703  15.913 -11.601 1.00 33.31  ? 168 VAL A N     1 
ATOM   1149 C  CA    . VAL A 1 144 ? 23.440  16.187 -10.373 1.00 33.06  ? 168 VAL A CA    1 
ATOM   1150 C  C     . VAL A 1 144 ? 22.533  16.674 -9.221  1.00 33.17  ? 168 VAL A C     1 
ATOM   1151 O  O     . VAL A 1 144 ? 22.747  16.320 -8.056  1.00 31.27  ? 168 VAL A O     1 
ATOM   1152 C  CB    . VAL A 1 144 ? 24.579  17.211 -10.638 1.00 33.35  ? 168 VAL A CB    1 
ATOM   1153 C  CG1   . VAL A 1 144 ? 24.009  18.492 -11.226 1.00 32.03  ? 168 VAL A CG1   1 
ATOM   1154 C  CG2   . VAL A 1 144 ? 25.336  17.490 -9.347  1.00 33.81  ? 168 VAL A CG2   1 
ATOM   1155 N  N     . LEU A 1 145 ? 21.521  17.476 -9.557  1.00 33.06  ? 169 LEU A N     1 
ATOM   1156 C  CA    . LEU A 1 145 ? 20.580  18.006 -8.572  1.00 31.95  ? 169 LEU A CA    1 
ATOM   1157 C  C     . LEU A 1 145 ? 19.794  16.875 -7.902  1.00 32.51  ? 169 LEU A C     1 
ATOM   1158 O  O     . LEU A 1 145 ? 19.509  16.919 -6.700  1.00 33.13  ? 169 LEU A O     1 
ATOM   1159 C  CB    . LEU A 1 145 ? 19.601  18.970 -9.242  1.00 31.78  ? 169 LEU A CB    1 
ATOM   1160 C  CG    . LEU A 1 145 ? 20.107  20.234 -9.952  1.00 32.75  ? 169 LEU A CG    1 
ATOM   1161 C  CD1   . LEU A 1 145 ? 18.928  20.915 -10.620 1.00 31.82  ? 169 LEU A CD1   1 
ATOM   1162 C  CD2   . LEU A 1 145 ? 20.770  21.190 -8.976  1.00 32.52  ? 169 LEU A CD2   1 
ATOM   1163 N  N     . HIS A 1 146 ? 19.426  15.869 -8.684  1.00 31.29  ? 170 HIS A N     1 
ATOM   1164 C  CA    . HIS A 1 146 ? 18.696  14.729 -8.144  1.00 29.80  ? 170 HIS A CA    1 
ATOM   1165 C  C     . HIS A 1 146 ? 19.581  13.974 -7.154  1.00 29.30  ? 170 HIS A C     1 
ATOM   1166 O  O     . HIS A 1 146 ? 19.136  13.581 -6.071  1.00 26.49  ? 170 HIS A O     1 
ATOM   1167 C  CB    . HIS A 1 146 ? 18.295  13.786 -9.272  1.00 28.92  ? 170 HIS A CB    1 
ATOM   1168 C  CG    . HIS A 1 146 ? 17.051  14.192 -9.988  1.00 28.20  ? 170 HIS A CG    1 
ATOM   1169 N  ND1   . HIS A 1 146 ? 16.691  15.509 -10.162 1.00 28.46  ? 170 HIS A ND1   1 
ATOM   1170 C  CD2   . HIS A 1 146 ? 16.116  13.455 -10.632 1.00 27.93  ? 170 HIS A CD2   1 
ATOM   1171 C  CE1   . HIS A 1 146 ? 15.588  15.567 -10.887 1.00 28.23  ? 170 HIS A CE1   1 
ATOM   1172 N  NE2   . HIS A 1 146 ? 15.220  14.334 -11.187 1.00 26.59  ? 170 HIS A NE2   1 
ATOM   1173 N  N     . ILE A 1 147 ? 20.838  13.763 -7.548  1.00 29.45  ? 171 ILE A N     1 
ATOM   1174 C  CA    . ILE A 1 147 ? 21.793  13.046 -6.703  1.00 29.40  ? 171 ILE A CA    1 
ATOM   1175 C  C     . ILE A 1 147 ? 21.921  13.765 -5.369  1.00 28.32  ? 171 ILE A C     1 
ATOM   1176 O  O     . ILE A 1 147 ? 21.938  13.139 -4.309  1.00 24.25  ? 171 ILE A O     1 
ATOM   1177 C  CB    . ILE A 1 147 ? 23.197  12.959 -7.368  1.00 29.45  ? 171 ILE A CB    1 
ATOM   1178 C  CG1   . ILE A 1 147 ? 23.151  12.050 -8.595  1.00 27.64  ? 171 ILE A CG1   1 
ATOM   1179 C  CG2   . ILE A 1 147 ? 24.210  12.414 -6.375  1.00 28.86  ? 171 ILE A CG2   1 
ATOM   1180 C  CD1   . ILE A 1 147 ? 22.821  10.614 -8.265  1.00 28.04  ? 171 ILE A CD1   1 
ATOM   1181 N  N     . ARG A 1 148 ? 21.994  15.090 -5.442  1.00 30.05  ? 172 ARG A N     1 
ATOM   1182 C  CA    . ARG A 1 148 ? 22.111  15.925 -4.250  1.00 32.86  ? 172 ARG A CA    1 
ATOM   1183 C  C     . ARG A 1 148 ? 20.899  15.837 -3.304  1.00 32.09  ? 172 ARG A C     1 
ATOM   1184 O  O     . ARG A 1 148 ? 21.064  15.617 -2.100  1.00 31.79  ? 172 ARG A O     1 
ATOM   1185 C  CB    . ARG A 1 148 ? 22.379  17.380 -4.666  1.00 34.06  ? 172 ARG A CB    1 
ATOM   1186 C  CG    . ARG A 1 148 ? 23.860  17.701 -4.792  1.00 36.42  ? 172 ARG A CG    1 
ATOM   1187 C  CD    . ARG A 1 148 ? 24.119  18.788 -5.812  1.00 41.19  ? 172 ARG A CD    1 
ATOM   1188 N  NE    . ARG A 1 148 ? 25.138  19.734 -5.357  1.00 45.93  ? 172 ARG A NE    1 
ATOM   1189 C  CZ    . ARG A 1 148 ? 24.880  20.812 -4.610  1.00 49.76  ? 172 ARG A CZ    1 
ATOM   1190 N  NH1   . ARG A 1 148 ? 23.629  21.084 -4.237  1.00 51.00  ? 172 ARG A NH1   1 
ATOM   1191 N  NH2   . ARG A 1 148 ? 25.870  21.617 -4.225  1.00 48.12  ? 172 ARG A NH2   1 
ATOM   1192 N  N     . LEU A 1 149 ? 19.690  15.990 -3.840  1.00 30.11  ? 173 LEU A N     1 
ATOM   1193 C  CA    . LEU A 1 149 ? 18.497  15.915 -3.009  1.00 29.55  ? 173 LEU A CA    1 
ATOM   1194 C  C     . LEU A 1 149 ? 18.317  14.534 -2.398  1.00 30.07  ? 173 LEU A C     1 
ATOM   1195 O  O     . LEU A 1 149 ? 17.784  14.395 -1.291  1.00 30.11  ? 173 LEU A O     1 
ATOM   1196 C  CB    . LEU A 1 149 ? 17.264  16.312 -3.818  1.00 28.28  ? 173 LEU A CB    1 
ATOM   1197 C  CG    . LEU A 1 149 ? 17.292  17.796 -4.209  1.00 28.34  ? 173 LEU A CG    1 
ATOM   1198 C  CD1   . LEU A 1 149 ? 16.242  18.086 -5.275  1.00 27.94  ? 173 LEU A CD1   1 
ATOM   1199 C  CD2   . LEU A 1 149 ? 17.063  18.652 -2.972  1.00 25.08  ? 173 LEU A CD2   1 
ATOM   1200 N  N     . LEU A 1 150 ? 18.767  13.506 -3.107  1.00 30.79  ? 174 LEU A N     1 
ATOM   1201 C  CA    . LEU A 1 150 ? 18.655  12.157 -2.573  1.00 30.79  ? 174 LEU A CA    1 
ATOM   1202 C  C     . LEU A 1 150 ? 19.601  11.976 -1.400  1.00 29.63  ? 174 LEU A C     1 
ATOM   1203 O  O     . LEU A 1 150 ? 19.246  11.337 -0.410  1.00 30.54  ? 174 LEU A O     1 
ATOM   1204 C  CB    . LEU A 1 150 ? 18.943  11.114 -3.646  1.00 32.33  ? 174 LEU A CB    1 
ATOM   1205 C  CG    . LEU A 1 150 ? 17.842  11.014 -4.702  1.00 33.68  ? 174 LEU A CG    1 
ATOM   1206 C  CD1   . LEU A 1 150 ? 18.075  9.788  -5.574  1.00 34.02  ? 174 LEU A CD1   1 
ATOM   1207 C  CD2   . LEU A 1 150 ? 16.502  10.919 -4.019  1.00 31.36  ? 174 LEU A CD2   1 
ATOM   1208 N  N     . VAL A 1 151 ? 20.807  12.531 -1.512  1.00 28.36  ? 175 VAL A N     1 
ATOM   1209 C  CA    . VAL A 1 151 ? 21.782  12.451 -0.422  1.00 25.98  ? 175 VAL A CA    1 
ATOM   1210 C  C     . VAL A 1 151 ? 21.117  13.142 0.761   1.00 24.65  ? 175 VAL A C     1 
ATOM   1211 O  O     . VAL A 1 151 ? 21.083  12.612 1.866   1.00 21.50  ? 175 VAL A O     1 
ATOM   1212 C  CB    . VAL A 1 151 ? 23.113  13.170 -0.790  1.00 26.51  ? 175 VAL A CB    1 
ATOM   1213 C  CG1   . VAL A 1 151 ? 24.012  13.291 0.433   1.00 24.78  ? 175 VAL A CG1   1 
ATOM   1214 C  CG2   . VAL A 1 151 ? 23.833  12.389 -1.886  1.00 26.44  ? 175 VAL A CG2   1 
ATOM   1215 N  N     . GLY A 1 152 ? 20.565  14.324 0.498   1.00 25.30  ? 176 GLY A N     1 
ATOM   1216 C  CA    . GLY A 1 152 ? 19.862  15.072 1.521   1.00 25.29  ? 176 GLY A CA    1 
ATOM   1217 C  C     . GLY A 1 152 ? 18.764  14.242 2.172   1.00 25.16  ? 176 GLY A C     1 
ATOM   1218 O  O     . GLY A 1 152 ? 18.517  14.382 3.359   1.00 27.79  ? 176 GLY A O     1 
ATOM   1219 N  N     . SER A 1 153 ? 18.094  13.377 1.417   1.00 24.42  ? 177 SER A N     1 
ATOM   1220 C  CA    . SER A 1 153 ? 17.052  12.547 2.018   1.00 23.02  ? 177 SER A CA    1 
ATOM   1221 C  C     . SER A 1 153 ? 17.690  11.523 2.957   1.00 21.25  ? 177 SER A C     1 
ATOM   1222 O  O     . SER A 1 153 ? 17.096  11.144 3.953   1.00 18.37  ? 177 SER A O     1 
ATOM   1223 C  CB    . SER A 1 153 ? 16.211  11.830 0.942   1.00 23.13  ? 177 SER A CB    1 
ATOM   1224 O  OG    . SER A 1 153 ? 16.922  10.778 0.303   1.00 22.20  ? 177 SER A OG    1 
ATOM   1225 N  N     . GLN A 1 154 ? 18.900  11.075 2.631   1.00 23.67  ? 178 GLN A N     1 
ATOM   1226 C  CA    . GLN A 1 154 ? 19.610  10.113 3.478   1.00 27.27  ? 178 GLN A CA    1 
ATOM   1227 C  C     . GLN A 1 154 ? 19.940  10.808 4.804   1.00 27.43  ? 178 GLN A C     1 
ATOM   1228 O  O     . GLN A 1 154 ? 19.653  10.305 5.894   1.00 26.61  ? 178 GLN A O     1 
ATOM   1229 C  CB    . GLN A 1 154 ? 20.923  9.675  2.830   1.00 28.66  ? 178 GLN A CB    1 
ATOM   1230 C  CG    . GLN A 1 154 ? 20.820  8.772  1.623   1.00 35.74  ? 178 GLN A CG    1 
ATOM   1231 C  CD    . GLN A 1 154 ? 22.181  8.617  0.901   1.00 40.86  ? 178 GLN A CD    1 
ATOM   1232 O  OE1   . GLN A 1 154 ? 23.255  8.624  1.540   1.00 37.84  ? 178 GLN A OE1   1 
ATOM   1233 N  NE2   . GLN A 1 154 ? 22.135  8.469  -0.432  1.00 40.73  ? 178 GLN A NE2   1 
ATOM   1234 N  N     . ILE A 1 155 ? 20.564  11.971 4.702   1.00 26.37  ? 179 ILE A N     1 
ATOM   1235 C  CA    . ILE A 1 155 ? 20.906  12.711 5.889   1.00 26.34  ? 179 ILE A CA    1 
ATOM   1236 C  C     . ILE A 1 155 ? 19.626  12.966 6.664   1.00 26.66  ? 179 ILE A C     1 
ATOM   1237 O  O     . ILE A 1 155 ? 19.594  12.826 7.888   1.00 27.54  ? 179 ILE A O     1 
ATOM   1238 C  CB    . ILE A 1 155 ? 21.601  14.012 5.516   1.00 27.16  ? 179 ILE A CB    1 
ATOM   1239 C  CG1   . ILE A 1 155 ? 22.979  13.678 4.932   1.00 24.75  ? 179 ILE A CG1   1 
ATOM   1240 C  CG2   . ILE A 1 155 ? 21.724  14.916 6.744   1.00 28.19  ? 179 ILE A CG2   1 
ATOM   1241 C  CD1   . ILE A 1 155 ? 23.661  14.836 4.258   1.00 26.10  ? 179 ILE A CD1   1 
ATOM   1242 N  N     . ALA A 1 156 ? 18.565  13.314 5.944   1.00 25.72  ? 180 ALA A N     1 
ATOM   1243 C  CA    . ALA A 1 156 ? 17.265  13.555 6.559   1.00 24.94  ? 180 ALA A CA    1 
ATOM   1244 C  C     . ALA A 1 156 ? 16.841  12.313 7.337   1.00 24.87  ? 180 ALA A C     1 
ATOM   1245 O  O     . ALA A 1 156 ? 16.366  12.404 8.465   1.00 24.70  ? 180 ALA A O     1 
ATOM   1246 C  CB    . ALA A 1 156 ? 16.240  13.878 5.492   1.00 25.08  ? 180 ALA A CB    1 
ATOM   1247 N  N     . ALA A 1 157 ? 17.020  11.147 6.727   1.00 26.12  ? 181 ALA A N     1 
ATOM   1248 C  CA    . ALA A 1 157 ? 16.671  9.884  7.375   1.00 27.98  ? 181 ALA A CA    1 
ATOM   1249 C  C     . ALA A 1 157 ? 17.506  9.712  8.644   1.00 29.17  ? 181 ALA A C     1 
ATOM   1250 O  O     . ALA A 1 157 ? 16.991  9.349  9.711   1.00 29.99  ? 181 ALA A O     1 
ATOM   1251 C  CB    . ALA A 1 157 ? 16.917  8.718  6.426   1.00 24.90  ? 181 ALA A CB    1 
ATOM   1252 N  N     . GLU A 1 158 ? 18.799  9.984  8.520   1.00 29.32  ? 182 GLU A N     1 
ATOM   1253 C  CA    . GLU A 1 158 ? 19.710  9.870  9.645   1.00 29.86  ? 182 GLU A CA    1 
ATOM   1254 C  C     . GLU A 1 158 ? 19.294  10.722 10.843  1.00 30.25  ? 182 GLU A C     1 
ATOM   1255 O  O     . GLU A 1 158 ? 19.231  10.230 11.970  1.00 30.52  ? 182 GLU A O     1 
ATOM   1256 C  CB    . GLU A 1 158 ? 21.114  10.238 9.189   1.00 28.68  ? 182 GLU A CB    1 
ATOM   1257 C  CG    . GLU A 1 158 ? 21.858  9.048  8.670   1.00 29.00  ? 182 GLU A CG    1 
ATOM   1258 C  CD    . GLU A 1 158 ? 23.064  9.430  7.878   1.00 31.55  ? 182 GLU A CD    1 
ATOM   1259 O  OE1   . GLU A 1 158 ? 23.797  10.337 8.337   1.00 31.34  ? 182 GLU A OE1   1 
ATOM   1260 O  OE2   . GLU A 1 158 ? 23.276  8.816  6.805   1.00 30.88  ? 182 GLU A OE2   1 
ATOM   1261 N  N     . MET A 1 159 ? 19.008  11.996 10.594  1.00 29.75  ? 183 MET A N     1 
ATOM   1262 C  CA    . MET A 1 159 ? 18.591  12.898 11.651  1.00 28.16  ? 183 MET A CA    1 
ATOM   1263 C  C     . MET A 1 159 ? 17.332  12.340 12.315  1.00 27.85  ? 183 MET A C     1 
ATOM   1264 O  O     . MET A 1 159 ? 17.227  12.297 13.537  1.00 27.13  ? 183 MET A O     1 
ATOM   1265 C  CB    . MET A 1 159 ? 18.307  14.285 11.072  1.00 29.28  ? 183 MET A CB    1 
ATOM   1266 C  CG    . MET A 1 159 ? 19.497  14.960 10.402  1.00 27.94  ? 183 MET A CG    1 
ATOM   1267 S  SD    . MET A 1 159 ? 18.957  16.461 9.578   1.00 24.60  ? 183 MET A SD    1 
ATOM   1268 C  CE    . MET A 1 159 ? 20.197  17.614 10.062  1.00 27.16  ? 183 MET A CE    1 
ATOM   1269 N  N     . ARG A 1 160 ? 16.369  11.901 11.516  1.00 27.75  ? 184 ARG A N     1 
ATOM   1270 C  CA    . ARG A 1 160 ? 15.161  11.355 12.105  1.00 26.18  ? 184 ARG A CA    1 
ATOM   1271 C  C     . ARG A 1 160 ? 15.481  10.129 12.943  1.00 27.50  ? 184 ARG A C     1 
ATOM   1272 O  O     . ARG A 1 160 ? 14.944  9.971  14.031  1.00 27.47  ? 184 ARG A O     1 
ATOM   1273 C  CB    . ARG A 1 160 ? 14.131  11.020 11.029  1.00 22.30  ? 184 ARG A CB    1 
ATOM   1274 C  CG    . ARG A 1 160 ? 13.413  12.251 10.498  1.00 19.90  ? 184 ARG A CG    1 
ATOM   1275 C  CD    . ARG A 1 160 ? 12.078  11.881 9.908   1.00 17.48  ? 184 ARG A CD    1 
ATOM   1276 N  NE    . ARG A 1 160 ? 12.242  10.864 8.878   1.00 19.58  ? 184 ARG A NE    1 
ATOM   1277 C  CZ    . ARG A 1 160 ? 11.531  9.739  8.807   1.00 20.04  ? 184 ARG A CZ    1 
ATOM   1278 N  NH1   . ARG A 1 160 ? 10.592  9.474  9.710   1.00 18.79  ? 184 ARG A NH1   1 
ATOM   1279 N  NH2   . ARG A 1 160 ? 11.766  8.870  7.833   1.00 20.82  ? 184 ARG A NH2   1 
ATOM   1280 N  N     . GLU A 1 161 ? 16.370  9.270  12.455  1.00 30.59  ? 185 GLU A N     1 
ATOM   1281 C  CA    . GLU A 1 161 ? 16.719  8.076  13.209  1.00 33.31  ? 185 GLU A CA    1 
ATOM   1282 C  C     . GLU A 1 161 ? 17.337  8.472  14.537  1.00 33.59  ? 185 GLU A C     1 
ATOM   1283 O  O     . GLU A 1 161 ? 16.932  7.976  15.591  1.00 33.01  ? 185 GLU A O     1 
ATOM   1284 C  CB    . GLU A 1 161 ? 17.704  7.203  12.440  1.00 37.53  ? 185 GLU A CB    1 
ATOM   1285 C  CG    . GLU A 1 161 ? 18.311  6.086  13.298  1.00 46.84  ? 185 GLU A CG    1 
ATOM   1286 C  CD    . GLU A 1 161 ? 17.305  4.989  13.668  1.00 51.87  ? 185 GLU A CD    1 
ATOM   1287 O  OE1   . GLU A 1 161 ? 16.869  4.253  12.756  1.00 54.90  ? 185 GLU A OE1   1 
ATOM   1288 O  OE2   . GLU A 1 161 ? 16.946  4.856  14.864  1.00 52.86  ? 185 GLU A OE2   1 
ATOM   1289 N  N     . ALA A 1 162 ? 18.315  9.375  14.480  1.00 33.10  ? 186 ALA A N     1 
ATOM   1290 C  CA    . ALA A 1 162 ? 19.003  9.846  15.681  1.00 33.10  ? 186 ALA A CA    1 
ATOM   1291 C  C     . ALA A 1 162 ? 18.042  10.458 16.699  1.00 33.83  ? 186 ALA A C     1 
ATOM   1292 O  O     . ALA A 1 162 ? 18.149  10.199 17.894  1.00 36.21  ? 186 ALA A O     1 
ATOM   1293 C  CB    . ALA A 1 162 ? 20.072  10.861 15.308  1.00 30.73  ? 186 ALA A CB    1 
ATOM   1294 N  N     . MET A 1 163 ? 17.107  11.275 16.226  1.00 33.44  ? 187 MET A N     1 
ATOM   1295 C  CA    . MET A 1 163 ? 16.151  11.915 17.109  1.00 31.40  ? 187 MET A CA    1 
ATOM   1296 C  C     . MET A 1 163 ? 15.389  10.889 17.924  1.00 31.43  ? 187 MET A C     1 
ATOM   1297 O  O     . MET A 1 163 ? 15.154  11.066 19.119  1.00 32.13  ? 187 MET A O     1 
ATOM   1298 C  CB    . MET A 1 163 ? 15.173  12.753 16.292  1.00 30.30  ? 187 MET A CB    1 
ATOM   1299 C  CG    . MET A 1 163 ? 15.734  14.092 15.883  1.00 33.63  ? 187 MET A CG    1 
ATOM   1300 S  SD    . MET A 1 163 ? 14.554  15.156 15.016  1.00 37.29  ? 187 MET A SD    1 
ATOM   1301 C  CE    . MET A 1 163 ? 14.725  14.530 13.349  1.00 35.89  ? 187 MET A CE    1 
ATOM   1302 N  N     . TYR A 1 164 ? 15.012  9.803  17.266  1.00 30.80  ? 188 TYR A N     1 
ATOM   1303 C  CA    . TYR A 1 164 ? 14.251  8.759  17.915  1.00 28.35  ? 188 TYR A CA    1 
ATOM   1304 C  C     . TYR A 1 164 ? 15.082  7.900  18.864  1.00 27.79  ? 188 TYR A C     1 
ATOM   1305 O  O     . TYR A 1 164 ? 14.650  7.620  19.976  1.00 28.31  ? 188 TYR A O     1 
ATOM   1306 C  CB    . TYR A 1 164 ? 13.586  7.877  16.864  1.00 27.01  ? 188 TYR A CB    1 
ATOM   1307 C  CG    . TYR A 1 164 ? 12.725  6.819  17.486  1.00 28.47  ? 188 TYR A CG    1 
ATOM   1308 C  CD1   . TYR A 1 164 ? 11.515  7.151  18.085  1.00 28.09  ? 188 TYR A CD1   1 
ATOM   1309 C  CD2   . TYR A 1 164 ? 13.147  5.494  17.536  1.00 28.51  ? 188 TYR A CD2   1 
ATOM   1310 C  CE1   . TYR A 1 164 ? 10.748  6.197  18.717  1.00 28.26  ? 188 TYR A CE1   1 
ATOM   1311 C  CE2   . TYR A 1 164 ? 12.387  4.529  18.168  1.00 28.86  ? 188 TYR A CE2   1 
ATOM   1312 C  CZ    . TYR A 1 164 ? 11.186  4.886  18.759  1.00 30.26  ? 188 TYR A CZ    1 
ATOM   1313 O  OH    . TYR A 1 164 ? 10.423  3.930  19.403  1.00 34.56  ? 188 TYR A OH    1 
ATOM   1314 N  N     . ASN A 1 165 ? 16.264  7.469  18.434  1.00 26.72  ? 189 ASN A N     1 
ATOM   1315 C  CA    . ASN A 1 165 ? 17.099  6.645  19.296  1.00 26.37  ? 189 ASN A CA    1 
ATOM   1316 C  C     . ASN A 1 165 ? 17.565  7.416  20.521  1.00 26.31  ? 189 ASN A C     1 
ATOM   1317 O  O     . ASN A 1 165 ? 17.397  6.958  21.656  1.00 26.80  ? 189 ASN A O     1 
ATOM   1318 C  CB    . ASN A 1 165 ? 18.326  6.112  18.547  1.00 25.52  ? 189 ASN A CB    1 
ATOM   1319 C  CG    . ASN A 1 165 ? 17.965  5.088  17.492  0.50 27.12  ? 189 ASN A CG    1 
ATOM   1320 O  OD1   . ASN A 1 165 ? 16.951  4.385  17.606  0.50 26.37  ? 189 ASN A OD1   1 
ATOM   1321 N  ND2   . ASN A 1 165 ? 18.802  4.983  16.460  0.50 26.41  ? 189 ASN A ND2   1 
ATOM   1322 N  N     . GLN A 1 166 ? 18.136  8.591  20.282  1.00 25.04  ? 190 GLN A N     1 
ATOM   1323 C  CA    . GLN A 1 166 ? 18.657  9.441  21.343  1.00 25.54  ? 190 GLN A CA    1 
ATOM   1324 C  C     . GLN A 1 166 ? 17.654  10.240 22.182  1.00 25.59  ? 190 GLN A C     1 
ATOM   1325 O  O     . GLN A 1 166 ? 17.901  10.469 23.369  1.00 26.33  ? 190 GLN A O     1 
ATOM   1326 C  CB    . GLN A 1 166 ? 19.695  10.400 20.765  1.00 25.09  ? 190 GLN A CB    1 
ATOM   1327 C  CG    . GLN A 1 166 ? 20.983  9.724  20.335  1.00 27.85  ? 190 GLN A CG    1 
ATOM   1328 C  CD    . GLN A 1 166 ? 21.968  10.694 19.718  1.00 28.56  ? 190 GLN A CD    1 
ATOM   1329 O  OE1   . GLN A 1 166 ? 22.391  11.661 20.353  1.00 31.79  ? 190 GLN A OE1   1 
ATOM   1330 N  NE2   . GLN A 1 166 ? 22.339  10.443 18.475  1.00 27.73  ? 190 GLN A NE2   1 
ATOM   1331 N  N     . LEU A 1 167 ? 16.534  10.657 21.592  1.00 24.29  ? 191 LEU A N     1 
ATOM   1332 C  CA    . LEU A 1 167 ? 15.551  11.445 22.339  1.00 23.12  ? 191 LEU A CA    1 
ATOM   1333 C  C     . LEU A 1 167 ? 14.135  10.861 22.385  1.00 25.20  ? 191 LEU A C     1 
ATOM   1334 O  O     . LEU A 1 167 ? 13.235  11.458 22.967  1.00 27.66  ? 191 LEU A O     1 
ATOM   1335 C  CB    . LEU A 1 167 ? 15.505  12.868 21.782  1.00 19.56  ? 191 LEU A CB    1 
ATOM   1336 C  CG    . LEU A 1 167 ? 16.856  13.592 21.727  1.00 17.06  ? 191 LEU A CG    1 
ATOM   1337 C  CD1   . LEU A 1 167 ? 16.737  14.848 20.870  1.00 12.20  ? 191 LEU A CD1   1 
ATOM   1338 C  CD2   . LEU A 1 167 ? 17.325  13.909 23.134  1.00 12.38  ? 191 LEU A CD2   1 
ATOM   1339 N  N     . GLY A 1 168 ? 13.942  9.693  21.779  1.00 26.35  ? 192 GLY A N     1 
ATOM   1340 C  CA    . GLY A 1 168 ? 12.638  9.052  21.781  1.00 25.61  ? 192 GLY A CA    1 
ATOM   1341 C  C     . GLY A 1 168 ? 11.566  9.813  21.031  1.00 26.63  ? 192 GLY A C     1 
ATOM   1342 O  O     . GLY A 1 168 ? 10.378  9.634  21.285  1.00 27.27  ? 192 GLY A O     1 
ATOM   1343 N  N     . LEU A 1 169 ? 11.979  10.647 20.085  1.00 26.93  ? 193 LEU A N     1 
ATOM   1344 C  CA    . LEU A 1 169 ? 11.030  11.446 19.326  1.00 25.77  ? 193 LEU A CA    1 
ATOM   1345 C  C     . LEU A 1 169 ? 10.898  11.076 17.850  1.00 25.04  ? 193 LEU A C     1 
ATOM   1346 O  O     . LEU A 1 169 ? 11.885  10.777 17.179  1.00 25.79  ? 193 LEU A O     1 
ATOM   1347 C  CB    . LEU A 1 169 ? 11.421  12.915 19.434  1.00 27.10  ? 193 LEU A CB    1 
ATOM   1348 C  CG    . LEU A 1 169 ? 11.387  13.547 20.820  1.00 27.51  ? 193 LEU A CG    1 
ATOM   1349 C  CD1   . LEU A 1 169 ? 12.022  14.919 20.773  1.00 27.38  ? 193 LEU A CD1   1 
ATOM   1350 C  CD2   . LEU A 1 169 ? 9.946   13.628 21.293  1.00 28.74  ? 193 LEU A CD2   1 
ATOM   1351 N  N     . THR A 1 170 ? 9.665   11.110 17.356  1.00 23.26  ? 194 THR A N     1 
ATOM   1352 C  CA    . THR A 1 170 ? 9.370   10.830 15.958  1.00 23.19  ? 194 THR A CA    1 
ATOM   1353 C  C     . THR A 1 170 ? 8.960   12.135 15.305  1.00 22.77  ? 194 THR A C     1 
ATOM   1354 O  O     . THR A 1 170 ? 8.484   13.046 15.978  1.00 23.67  ? 194 THR A O     1 
ATOM   1355 C  CB    . THR A 1 170 ? 8.191   9.867  15.792  1.00 23.14  ? 194 THR A CB    1 
ATOM   1356 O  OG1   . THR A 1 170 ? 7.040   10.406 16.455  1.00 23.79  ? 194 THR A OG1   1 
ATOM   1357 C  CG2   . THR A 1 170 ? 8.525   8.516  16.350  1.00 19.97  ? 194 THR A CG2   1 
ATOM   1358 N  N     . GLY A 1 171 ? 9.132   12.220 13.994  1.00 22.81  ? 195 GLY A N     1 
ATOM   1359 C  CA    . GLY A 1 171 ? 8.750   13.431 13.284  1.00 24.16  ? 195 GLY A CA    1 
ATOM   1360 C  C     . GLY A 1 171 ? 8.893   13.315 11.779  1.00 24.10  ? 195 GLY A C     1 
ATOM   1361 O  O     . GLY A 1 171 ? 9.273   12.260 11.258  1.00 24.74  ? 195 GLY A O     1 
ATOM   1362 N  N     . CYS A 1 172 ? 8.593   14.396 11.068  1.00 23.68  ? 196 CYS A N     1 
ATOM   1363 C  CA    . CYS A 1 172 ? 8.715   14.378 9.616   1.00 23.29  ? 196 CYS A CA    1 
ATOM   1364 C  C     . CYS A 1 172 ? 9.912   15.199 9.163   1.00 24.62  ? 196 CYS A C     1 
ATOM   1365 O  O     . CYS A 1 172 ? 10.518  15.947 9.946   1.00 26.11  ? 196 CYS A O     1 
ATOM   1366 C  CB    . CYS A 1 172 ? 7.450   14.932 8.974   1.00 21.20  ? 196 CYS A CB    1 
ATOM   1367 S  SG    . CYS A 1 172 ? 5.956   13.974 9.330   1.00 26.55  ? 196 CYS A SG    1 
ATOM   1368 N  N     . ALA A 1 173 ? 10.273  15.034 7.897   1.00 23.55  ? 197 ALA A N     1 
ATOM   1369 C  CA    . ALA A 1 173 ? 11.367  15.794 7.316   1.00 20.96  ? 197 ALA A CA    1 
ATOM   1370 C  C     . ALA A 1 173 ? 10.963  16.088 5.880   1.00 20.10  ? 197 ALA A C     1 
ATOM   1371 O  O     . ALA A 1 173 ? 10.182  15.354 5.284   1.00 19.71  ? 197 ALA A O     1 
ATOM   1372 C  CB    . ALA A 1 173 ? 12.665  14.997 7.359   1.00 19.57  ? 197 ALA A CB    1 
ATOM   1373 N  N     . GLY A 1 174 ? 11.477  17.189 5.348   1.00 20.53  ? 198 GLY A N     1 
ATOM   1374 C  CA    . GLY A 1 174 ? 11.202  17.574 3.978   1.00 17.89  ? 198 GLY A CA    1 
ATOM   1375 C  C     . GLY A 1 174 ? 12.514  18.038 3.374   1.00 18.34  ? 198 GLY A C     1 
ATOM   1376 O  O     . GLY A 1 174 ? 13.227  18.829 3.977   1.00 20.41  ? 198 GLY A O     1 
ATOM   1377 N  N     . VAL A 1 175 ? 12.864  17.534 2.202   1.00 17.39  ? 199 VAL A N     1 
ATOM   1378 C  CA    . VAL A 1 175 ? 14.101  17.952 1.569   1.00 16.20  ? 199 VAL A CA    1 
ATOM   1379 C  C     . VAL A 1 175 ? 13.790  18.664 0.257   1.00 17.45  ? 199 VAL A C     1 
ATOM   1380 O  O     . VAL A 1 175 ? 13.059  18.135 -0.589  1.00 15.08  ? 199 VAL A O     1 
ATOM   1381 C  CB    . VAL A 1 175 ? 15.030  16.742 1.299   1.00 15.50  ? 199 VAL A CB    1 
ATOM   1382 C  CG1   . VAL A 1 175 ? 16.275  17.193 0.567   1.00 13.50  ? 199 VAL A CG1   1 
ATOM   1383 C  CG2   . VAL A 1 175 ? 15.417  16.078 2.611   1.00 15.71  ? 199 VAL A CG2   1 
ATOM   1384 N  N     . ALA A 1 176 ? 14.343  19.869 0.109   1.00 18.19  ? 200 ALA A N     1 
ATOM   1385 C  CA    . ALA A 1 176 ? 14.150  20.679 -1.092  1.00 19.78  ? 200 ALA A CA    1 
ATOM   1386 C  C     . ALA A 1 176 ? 15.316  21.656 -1.332  1.00 21.83  ? 200 ALA A C     1 
ATOM   1387 O  O     . ALA A 1 176 ? 16.314  21.651 -0.605  1.00 20.95  ? 200 ALA A O     1 
ATOM   1388 C  CB    . ALA A 1 176 ? 12.839  21.440 -0.994  1.00 18.16  ? 200 ALA A CB    1 
ATOM   1389 N  N     . SER A 1 177 ? 15.182  22.503 -2.351  1.00 23.45  ? 201 SER A N     1 
ATOM   1390 C  CA    . SER A 1 177 ? 16.235  23.457 -2.675  1.00 24.91  ? 201 SER A CA    1 
ATOM   1391 C  C     . SER A 1 177 ? 16.139  24.830 -1.988  1.00 24.86  ? 201 SER A C     1 
ATOM   1392 O  O     . SER A 1 177 ? 16.985  25.699 -2.219  1.00 24.77  ? 201 SER A O     1 
ATOM   1393 C  CB    . SER A 1 177 ? 16.323  23.632 -4.187  1.00 25.18  ? 201 SER A CB    1 
ATOM   1394 O  OG    . SER A 1 177 ? 15.059  23.968 -4.717  1.00 30.49  ? 201 SER A OG    1 
ATOM   1395 N  N     . ASN A 1 178 ? 15.105  25.029 -1.174  1.00 23.59  ? 202 ASN A N     1 
ATOM   1396 C  CA    . ASN A 1 178 ? 14.951  26.266 -0.405  1.00 25.41  ? 202 ASN A CA    1 
ATOM   1397 C  C     . ASN A 1 178 ? 14.032  26.042 0.808   1.00 26.89  ? 202 ASN A C     1 
ATOM   1398 O  O     . ASN A 1 178 ? 13.379  24.996 0.911   1.00 27.01  ? 202 ASN A O     1 
ATOM   1399 C  CB    . ASN A 1 178 ? 14.476  27.447 -1.281  1.00 24.21  ? 202 ASN A CB    1 
ATOM   1400 C  CG    . ASN A 1 178 ? 13.085  27.264 -1.864  1.00 23.54  ? 202 ASN A CG    1 
ATOM   1401 O  OD1   . ASN A 1 178 ? 12.906  27.367 -3.073  1.00 24.06  ? 202 ASN A OD1   1 
ATOM   1402 N  ND2   . ASN A 1 178 ? 12.094  27.031 -1.014  1.00 24.07  ? 202 ASN A ND2   1 
ATOM   1403 N  N     . LYS A 1 179 ? 13.994  26.995 1.736   1.00 27.27  ? 203 LYS A N     1 
ATOM   1404 C  CA    . LYS A 1 179 ? 13.169  26.814 2.929   1.00 28.43  ? 203 LYS A CA    1 
ATOM   1405 C  C     . LYS A 1 179 ? 11.672  26.672 2.694   1.00 27.97  ? 203 LYS A C     1 
ATOM   1406 O  O     . LYS A 1 179 ? 11.020  25.890 3.383   1.00 28.21  ? 203 LYS A O     1 
ATOM   1407 C  CB    . LYS A 1 179 ? 13.419  27.941 3.936   1.00 30.92  ? 203 LYS A CB    1 
ATOM   1408 C  CG    . LYS A 1 179 ? 14.833  27.962 4.491   1.00 32.67  ? 203 LYS A CG    1 
ATOM   1409 C  CD    . LYS A 1 179 ? 14.889  28.645 5.832   1.00 33.71  ? 203 LYS A CD    1 
ATOM   1410 C  CE    . LYS A 1 179 ? 14.363  30.054 5.765   1.00 36.02  ? 203 LYS A CE    1 
ATOM   1411 N  NZ    . LYS A 1 179 ? 14.349  30.663 7.122   1.00 39.67  ? 203 LYS A NZ    1 
ATOM   1412 N  N     . LEU A 1 180 ? 11.130  27.424 1.736   1.00 27.13  ? 204 LEU A N     1 
ATOM   1413 C  CA    . LEU A 1 180 ? 9.699   27.383 1.412   1.00 25.19  ? 204 LEU A CA    1 
ATOM   1414 C  C     . LEU A 1 180 ? 9.247   26.005 0.934   1.00 24.61  ? 204 LEU A C     1 
ATOM   1415 O  O     . LEU A 1 180 ? 8.243   25.473 1.393   1.00 24.54  ? 204 LEU A O     1 
ATOM   1416 C  CB    . LEU A 1 180 ? 9.386   28.417 0.326   1.00 26.42  ? 204 LEU A CB    1 
ATOM   1417 C  CG    . LEU A 1 180 ? 7.975   28.813 -0.152  1.00 26.26  ? 204 LEU A CG    1 
ATOM   1418 C  CD1   . LEU A 1 180 ? 7.990   28.723 -1.663  1.00 25.20  ? 204 LEU A CD1   1 
ATOM   1419 C  CD2   . LEU A 1 180 ? 6.861   27.944 0.417   1.00 24.98  ? 204 LEU A CD2   1 
ATOM   1420 N  N     . LEU A 1 181 ? 9.988   25.423 0.003   1.00 24.30  ? 205 LEU A N     1 
ATOM   1421 C  CA    . LEU A 1 181 ? 9.623   24.115 -0.522  1.00 24.24  ? 205 LEU A CA    1 
ATOM   1422 C  C     . LEU A 1 181 ? 9.785   22.998 0.506   1.00 25.20  ? 205 LEU A C     1 
ATOM   1423 O  O     . LEU A 1 181 ? 8.925   22.109 0.627   1.00 25.42  ? 205 LEU A O     1 
ATOM   1424 C  CB    . LEU A 1 181 ? 10.462  23.803 -1.763  1.00 22.84  ? 205 LEU A CB    1 
ATOM   1425 C  CG    . LEU A 1 181 ? 10.056  24.320 -3.151  1.00 20.24  ? 205 LEU A CG    1 
ATOM   1426 C  CD1   . LEU A 1 181 ? 8.864   25.235 -3.085  1.00 19.82  ? 205 LEU A CD1   1 
ATOM   1427 C  CD2   . LEU A 1 181 ? 11.243  25.013 -3.766  1.00 18.58  ? 205 LEU A CD2   1 
ATOM   1428 N  N     . ALA A 1 182 ? 10.894  23.046 1.242   1.00 25.16  ? 206 ALA A N     1 
ATOM   1429 C  CA    . ALA A 1 182 ? 11.182  22.040 2.251   1.00 23.54  ? 206 ALA A CA    1 
ATOM   1430 C  C     . ALA A 1 182 ? 10.072  22.049 3.283   1.00 23.67  ? 206 ALA A C     1 
ATOM   1431 O  O     . ALA A 1 182 ? 9.599   20.998 3.713   1.00 24.05  ? 206 ALA A O     1 
ATOM   1432 C  CB    . ALA A 1 182 ? 12.530  22.318 2.904   1.00 22.08  ? 206 ALA A CB    1 
ATOM   1433 N  N     . LYS A 1 183 ? 9.635   23.235 3.680   1.00 23.76  ? 207 LYS A N     1 
ATOM   1434 C  CA    . LYS A 1 183 ? 8.564   23.296 4.658   1.00 24.43  ? 207 LYS A CA    1 
ATOM   1435 C  C     . LYS A 1 183 ? 7.257   22.792 4.034   1.00 24.50  ? 207 LYS A C     1 
ATOM   1436 O  O     . LYS A 1 183 ? 6.478   22.104 4.685   1.00 24.61  ? 207 LYS A O     1 
ATOM   1437 C  CB    . LYS A 1 183 ? 8.390   24.722 5.185   1.00 22.95  ? 207 LYS A CB    1 
ATOM   1438 C  CG    . LYS A 1 183 ? 7.366   24.829 6.294   1.00 20.37  ? 207 LYS A CG    1 
ATOM   1439 C  CD    . LYS A 1 183 ? 7.375   26.203 6.884   1.00 22.67  ? 207 LYS A CD    1 
ATOM   1440 C  CE    . LYS A 1 183 ? 6.174   26.427 7.763   1.00 22.36  ? 207 LYS A CE    1 
ATOM   1441 N  NZ    . LYS A 1 183 ? 6.203   25.545 8.945   1.00 24.35  ? 207 LYS A NZ    1 
ATOM   1442 N  N     . LEU A 1 184 ? 7.026   23.118 2.769   1.00 23.76  ? 208 LEU A N     1 
ATOM   1443 C  CA    . LEU A 1 184 ? 5.809   22.675 2.110   1.00 24.17  ? 208 LEU A CA    1 
ATOM   1444 C  C     . LEU A 1 184 ? 5.768   21.182 1.878   1.00 24.77  ? 208 LEU A C     1 
ATOM   1445 O  O     . LEU A 1 184 ? 4.706   20.569 1.969   1.00 26.08  ? 208 LEU A O     1 
ATOM   1446 C  CB    . LEU A 1 184 ? 5.631   23.369 0.766   1.00 25.12  ? 208 LEU A CB    1 
ATOM   1447 C  CG    . LEU A 1 184 ? 5.148   24.811 0.800   1.00 26.24  ? 208 LEU A CG    1 
ATOM   1448 C  CD1   . LEU A 1 184 ? 5.113   25.325 -0.624  1.00 27.97  ? 208 LEU A CD1   1 
ATOM   1449 C  CD2   . LEU A 1 184 ? 3.774   24.895 1.465   1.00 24.46  ? 208 LEU A CD2   1 
ATOM   1450 N  N     . VAL A 1 185 ? 6.909   20.581 1.579   1.00 24.03  ? 209 VAL A N     1 
ATOM   1451 C  CA    . VAL A 1 185 ? 6.904   19.151 1.327   1.00 23.54  ? 209 VAL A CA    1 
ATOM   1452 C  C     . VAL A 1 185 ? 7.064   18.274 2.576   1.00 23.66  ? 209 VAL A C     1 
ATOM   1453 O  O     . VAL A 1 185 ? 6.769   17.095 2.535   1.00 22.53  ? 209 VAL A O     1 
ATOM   1454 C  CB    . VAL A 1 185 ? 7.985   18.785 0.291   1.00 22.47  ? 209 VAL A CB    1 
ATOM   1455 C  CG1   . VAL A 1 185 ? 9.315   18.557 0.975   1.00 21.62  ? 209 VAL A CG1   1 
ATOM   1456 C  CG2   . VAL A 1 185 ? 7.549   17.572 -0.499  1.00 22.00  ? 209 VAL A CG2   1 
ATOM   1457 N  N     . SER A 1 186 ? 7.513   18.843 3.689   1.00 25.91  ? 210 SER A N     1 
ATOM   1458 C  CA    . SER A 1 186 ? 7.696   18.050 4.907   1.00 28.39  ? 210 SER A CA    1 
ATOM   1459 C  C     . SER A 1 186 ? 6.380   17.477 5.400   1.00 29.67  ? 210 SER A C     1 
ATOM   1460 O  O     . SER A 1 186 ? 6.357   16.476 6.121   1.00 30.79  ? 210 SER A O     1 
ATOM   1461 C  CB    . SER A 1 186 ? 8.308   18.893 6.027   1.00 28.99  ? 210 SER A CB    1 
ATOM   1462 O  OG    . SER A 1 186 ? 7.407   19.907 6.437   1.00 28.65  ? 210 SER A OG    1 
ATOM   1463 N  N     . GLY A 1 187 ? 5.281   18.110 5.012   1.00 29.05  ? 211 GLY A N     1 
ATOM   1464 C  CA    . GLY A 1 187 ? 3.997   17.621 5.454   1.00 29.15  ? 211 GLY A CA    1 
ATOM   1465 C  C     . GLY A 1 187 ? 3.278   16.641 4.546   1.00 29.60  ? 211 GLY A C     1 
ATOM   1466 O  O     . GLY A 1 187 ? 2.265   16.094 4.950   1.00 31.50  ? 211 GLY A O     1 
ATOM   1467 N  N     . VAL A 1 188 ? 3.787   16.387 3.345   1.00 29.98  ? 212 VAL A N     1 
ATOM   1468 C  CA    . VAL A 1 188 ? 3.104   15.495 2.412   1.00 31.11  ? 212 VAL A CA    1 
ATOM   1469 C  C     . VAL A 1 188 ? 2.648   14.144 2.990   1.00 32.63  ? 212 VAL A C     1 
ATOM   1470 O  O     . VAL A 1 188 ? 1.499   13.755 2.808   1.00 32.68  ? 212 VAL A O     1 
ATOM   1471 C  CB    . VAL A 1 188 ? 3.958   15.294 1.139   1.00 32.86  ? 212 VAL A CB    1 
ATOM   1472 C  CG1   . VAL A 1 188 ? 3.161   14.549 0.071   1.00 31.41  ? 212 VAL A CG1   1 
ATOM   1473 C  CG2   . VAL A 1 188 ? 4.398   16.655 0.605   1.00 31.35  ? 212 VAL A CG2   1 
ATOM   1474 N  N     . PHE A 1 189 ? 3.533   13.423 3.669   1.00 34.35  ? 213 PHE A N     1 
ATOM   1475 C  CA    . PHE A 1 189 ? 3.155   12.152 4.304   1.00 35.65  ? 213 PHE A CA    1 
ATOM   1476 C  C     . PHE A 1 189 ? 3.304   12.397 5.785   1.00 37.35  ? 213 PHE A C     1 
ATOM   1477 O  O     . PHE A 1 189 ? 4.362   12.228 6.383   1.00 37.29  ? 213 PHE A O     1 
ATOM   1478 C  CB    . PHE A 1 189 ? 4.042   11.021 3.816   1.00 34.53  ? 213 PHE A CB    1 
ATOM   1479 C  CG    . PHE A 1 189 ? 3.871   10.749 2.356   1.00 34.29  ? 213 PHE A CG    1 
ATOM   1480 C  CD1   . PHE A 1 189 ? 4.531   11.530 1.406   1.00 30.89  ? 213 PHE A CD1   1 
ATOM   1481 C  CD2   . PHE A 1 189 ? 2.989   9.761  1.923   1.00 32.02  ? 213 PHE A CD2   1 
ATOM   1482 C  CE1   . PHE A 1 189 ? 4.312   11.330 0.055   1.00 28.50  ? 213 PHE A CE1   1 
ATOM   1483 C  CE2   . PHE A 1 189 ? 2.764   9.558  0.572   1.00 29.25  ? 213 PHE A CE2   1 
ATOM   1484 C  CZ    . PHE A 1 189 ? 3.427   10.342 -0.364  1.00 28.79  ? 213 PHE A CZ    1 
ATOM   1485 N  N     . LYS A 1 190 ? 2.180   12.805 6.344   1.00 41.09  ? 214 LYS A N     1 
ATOM   1486 C  CA    . LYS A 1 190 ? 2.045   13.243 7.716   1.00 43.83  ? 214 LYS A CA    1 
ATOM   1487 C  C     . LYS A 1 190 ? 2.608   12.595 8.952   1.00 44.06  ? 214 LYS A C     1 
ATOM   1488 O  O     . LYS A 1 190 ? 3.469   13.188 9.601   1.00 47.31  ? 214 LYS A O     1 
ATOM   1489 C  CB    . LYS A 1 190 ? 0.578   13.564 7.991   1.00 46.49  ? 214 LYS A CB    1 
ATOM   1490 C  CG    . LYS A 1 190 ? 0.365   15.010 8.408   1.00 47.23  ? 214 LYS A CG    1 
ATOM   1491 C  CD    . LYS A 1 190 ? 1.250   15.331 9.597   1.00 49.07  ? 214 LYS A CD    1 
ATOM   1492 C  CE    . LYS A 1 190 ? 0.924   16.678 10.197  1.00 48.16  ? 214 LYS A CE    1 
ATOM   1493 N  NZ    . LYS A 1 190 ? 1.341   17.789 9.320   1.00 49.45  ? 214 LYS A NZ    1 
ATOM   1494 N  N     . PRO A 1 191 ? 2.137   11.397 9.325   1.00 41.98  ? 215 PRO A N     1 
ATOM   1495 C  CA    . PRO A 1 191 ? 2.722   10.844 10.559  1.00 38.61  ? 215 PRO A CA    1 
ATOM   1496 C  C     . PRO A 1 191 ? 4.110   10.230 10.433  1.00 36.13  ? 215 PRO A C     1 
ATOM   1497 O  O     . PRO A 1 191 ? 4.310   9.275  9.690   1.00 34.96  ? 215 PRO A O     1 
ATOM   1498 C  CB    . PRO A 1 191 ? 1.679   9.826  11.020  1.00 37.32  ? 215 PRO A CB    1 
ATOM   1499 C  CG    . PRO A 1 191 ? 0.418   10.221 10.248  1.00 40.80  ? 215 PRO A CG    1 
ATOM   1500 C  CD    . PRO A 1 191 ? 0.958   10.632 8.910   1.00 40.15  ? 215 PRO A CD    1 
ATOM   1501 N  N     . ASN A 1 192 ? 5.069   10.817 11.136  1.00 33.46  ? 216 ASN A N     1 
ATOM   1502 C  CA    . ASN A 1 192 ? 6.434   10.310 11.167  1.00 33.18  ? 216 ASN A CA    1 
ATOM   1503 C  C     . ASN A 1 192 ? 6.999   9.733  9.861   1.00 32.82  ? 216 ASN A C     1 
ATOM   1504 O  O     . ASN A 1 192 ? 7.292   8.543  9.772   1.00 30.81  ? 216 ASN A O     1 
ATOM   1505 C  CB    . ASN A 1 192 ? 6.516   9.260  12.281  1.00 33.22  ? 216 ASN A CB    1 
ATOM   1506 C  CG    . ASN A 1 192 ? 7.902   8.680  12.450  1.00 33.26  ? 216 ASN A CG    1 
ATOM   1507 O  OD1   . ASN A 1 192 ? 8.898   9.404  12.495  1.00 32.62  ? 216 ASN A OD1   1 
ATOM   1508 N  ND2   . ASN A 1 192 ? 7.972   7.362  12.563  1.00 31.70  ? 216 ASN A ND2   1 
ATOM   1509 N  N     . GLN A 1 193 ? 7.172   10.581 8.851   1.00 33.31  ? 217 GLN A N     1 
ATOM   1510 C  CA    . GLN A 1 193 ? 7.712   10.131 7.566   1.00 32.00  ? 217 GLN A CA    1 
ATOM   1511 C  C     . GLN A 1 193 ? 8.471   11.266 6.900   1.00 31.36  ? 217 GLN A C     1 
ATOM   1512 O  O     . GLN A 1 193 ? 8.542   12.368 7.450   1.00 33.01  ? 217 GLN A O     1 
ATOM   1513 C  CB    . GLN A 1 193 ? 6.581   9.667  6.648   1.00 32.04  ? 217 GLN A CB    1 
ATOM   1514 C  CG    . GLN A 1 193 ? 5.817   8.477  7.179   1.00 30.99  ? 217 GLN A CG    1 
ATOM   1515 C  CD    . GLN A 1 193 ? 4.651   8.113  6.305   1.00 31.45  ? 217 GLN A CD    1 
ATOM   1516 O  OE1   . GLN A 1 193 ? 4.824   7.708  5.160   1.00 34.33  ? 217 GLN A OE1   1 
ATOM   1517 N  NE2   . GLN A 1 193 ? 3.448   8.261  6.835   1.00 32.79  ? 217 GLN A NE2   1 
ATOM   1518 N  N     . GLN A 1 194 ? 9.039   11.006 5.725   1.00 29.28  ? 218 GLN A N     1 
ATOM   1519 C  CA    . GLN A 1 194 ? 9.778   12.045 5.020   1.00 28.49  ? 218 GLN A CA    1 
ATOM   1520 C  C     . GLN A 1 194 ? 9.593   12.039 3.499   1.00 27.87  ? 218 GLN A C     1 
ATOM   1521 O  O     . GLN A 1 194 ? 9.496   10.992 2.865   1.00 27.88  ? 218 GLN A O     1 
ATOM   1522 C  CB    . GLN A 1 194 ? 11.268  11.960 5.373   1.00 28.01  ? 218 GLN A CB    1 
ATOM   1523 C  CG    . GLN A 1 194 ? 11.973  10.701 4.901   1.00 25.87  ? 218 GLN A CG    1 
ATOM   1524 C  CD    . GLN A 1 194 ? 13.428  10.676 5.318   1.00 24.87  ? 218 GLN A CD    1 
ATOM   1525 O  OE1   . GLN A 1 194 ? 13.741  10.595 6.504   1.00 26.90  ? 218 GLN A OE1   1 
ATOM   1526 N  NE2   . GLN A 1 194 ? 14.326  10.756 4.348   1.00 22.34  ? 218 GLN A NE2   1 
ATOM   1527 N  N     . THR A 1 195 ? 9.555   13.233 2.923   1.00 26.57  ? 219 THR A N     1 
ATOM   1528 C  CA    . THR A 1 195 ? 9.368   13.390 1.493   1.00 25.01  ? 219 THR A CA    1 
ATOM   1529 C  C     . THR A 1 195 ? 10.479  14.277 0.941   1.00 25.13  ? 219 THR A C     1 
ATOM   1530 O  O     . THR A 1 195 ? 10.952  15.178 1.625   1.00 25.46  ? 219 THR A O     1 
ATOM   1531 C  CB    . THR A 1 195 ? 8.016   14.067 1.206   1.00 24.06  ? 219 THR A CB    1 
ATOM   1532 O  OG1   . THR A 1 195 ? 7.011   13.501 2.057   1.00 23.94  ? 219 THR A OG1   1 
ATOM   1533 C  CG2   . THR A 1 195 ? 7.613   13.877 -0.244  1.00 21.84  ? 219 THR A CG2   1 
ATOM   1534 N  N     . VAL A 1 196 ? 10.904  14.007 -0.289  1.00 23.69  ? 220 VAL A N     1 
ATOM   1535 C  CA    . VAL A 1 196 ? 11.937  14.806 -0.938  1.00 22.62  ? 220 VAL A CA    1 
ATOM   1536 C  C     . VAL A 1 196 ? 11.291  15.343 -2.207  1.00 24.44  ? 220 VAL A C     1 
ATOM   1537 O  O     . VAL A 1 196 ? 10.488  14.661 -2.850  1.00 24.86  ? 220 VAL A O     1 
ATOM   1538 C  CB    . VAL A 1 196 ? 13.223  13.965 -1.272  1.00 20.61  ? 220 VAL A CB    1 
ATOM   1539 C  CG1   . VAL A 1 196 ? 12.889  12.790 -2.160  1.00 19.01  ? 220 VAL A CG1   1 
ATOM   1540 C  CG2   . VAL A 1 196 ? 14.271  14.844 -1.917  1.00 16.52  ? 220 VAL A CG2   1 
ATOM   1541 N  N     . LEU A 1 197 ? 11.623  16.577 -2.561  1.00 24.36  ? 221 LEU A N     1 
ATOM   1542 C  CA    . LEU A 1 197 ? 11.025  17.194 -3.728  1.00 22.15  ? 221 LEU A CA    1 
ATOM   1543 C  C     . LEU A 1 197 ? 12.029  17.411 -4.831  1.00 21.94  ? 221 LEU A C     1 
ATOM   1544 O  O     . LEU A 1 197 ? 13.051  18.036 -4.614  1.00 22.69  ? 221 LEU A O     1 
ATOM   1545 C  CB    . LEU A 1 197 ? 10.417  18.538 -3.340  1.00 20.21  ? 221 LEU A CB    1 
ATOM   1546 C  CG    . LEU A 1 197 ? 9.823   19.337 -4.501  1.00 20.73  ? 221 LEU A CG    1 
ATOM   1547 C  CD1   . LEU A 1 197 ? 8.455   18.783 -4.897  1.00 20.86  ? 221 LEU A CD1   1 
ATOM   1548 C  CD2   . LEU A 1 197 ? 9.700   20.779 -4.082  1.00 20.61  ? 221 LEU A CD2   1 
ATOM   1549 N  N     . LEU A 1 198 ? 11.743  16.894 -6.019  1.00 22.51  ? 222 LEU A N     1 
ATOM   1550 C  CA    . LEU A 1 198 ? 12.639  17.097 -7.150  1.00 21.58  ? 222 LEU A CA    1 
ATOM   1551 C  C     . LEU A 1 198 ? 12.142  18.312 -7.931  1.00 23.22  ? 222 LEU A C     1 
ATOM   1552 O  O     . LEU A 1 198 ? 10.930  18.538 -8.051  1.00 24.30  ? 222 LEU A O     1 
ATOM   1553 C  CB    . LEU A 1 198 ? 12.648  15.876 -8.053  1.00 19.60  ? 222 LEU A CB    1 
ATOM   1554 C  CG    . LEU A 1 198 ? 13.127  14.589 -7.400  1.00 18.66  ? 222 LEU A CG    1 
ATOM   1555 C  CD1   . LEU A 1 198 ? 13.120  13.473 -8.420  1.00 17.03  ? 222 LEU A CD1   1 
ATOM   1556 C  CD2   . LEU A 1 198 ? 14.526  14.799 -6.841  1.00 18.94  ? 222 LEU A CD2   1 
ATOM   1557 N  N     . PRO A 1 199 ? 13.072  19.110 -8.473  1.00 23.21  ? 223 PRO A N     1 
ATOM   1558 C  CA    . PRO A 1 199 ? 12.779  20.318 -9.252  1.00 24.53  ? 223 PRO A CA    1 
ATOM   1559 C  C     . PRO A 1 199 ? 11.565  20.210 -10.180 1.00 26.67  ? 223 PRO A C     1 
ATOM   1560 O  O     . PRO A 1 199 ? 10.635  21.027 -10.118 1.00 28.45  ? 223 PRO A O     1 
ATOM   1561 C  CB    . PRO A 1 199 ? 14.073  20.543 -10.015 1.00 24.25  ? 223 PRO A CB    1 
ATOM   1562 C  CG    . PRO A 1 199 ? 15.106  20.110 -9.003  1.00 22.92  ? 223 PRO A CG    1 
ATOM   1563 C  CD    . PRO A 1 199 ? 14.517  18.818 -8.481  1.00 22.96  ? 223 PRO A CD    1 
ATOM   1564 N  N     . GLU A 1 200 ? 11.572  19.202 -11.042 1.00 27.55  ? 224 GLU A N     1 
ATOM   1565 C  CA    . GLU A 1 200 ? 10.465  18.999 -11.974 1.00 28.16  ? 224 GLU A CA    1 
ATOM   1566 C  C     . GLU A 1 200 ? 9.092   19.063 -11.298 1.00 27.90  ? 224 GLU A C     1 
ATOM   1567 O  O     . GLU A 1 200 ? 8.101   19.392 -11.949 1.00 29.64  ? 224 GLU A O     1 
ATOM   1568 C  CB    . GLU A 1 200 ? 10.615  17.649 -12.709 1.00 28.58  ? 224 GLU A CB    1 
ATOM   1569 C  CG    . GLU A 1 200 ? 11.904  17.505 -13.554 1.00 31.30  ? 224 GLU A CG    1 
ATOM   1570 C  CD    . GLU A 1 200 ? 13.181  17.391 -12.710 1.00 33.73  ? 224 GLU A CD    1 
ATOM   1571 O  OE1   . GLU A 1 200 ? 14.288  17.668 -13.236 1.00 32.90  ? 224 GLU A OE1   1 
ATOM   1572 O  OE2   . GLU A 1 200 ? 13.077  17.014 -11.521 1.00 34.63  ? 224 GLU A OE2   1 
ATOM   1573 N  N     . SER A 1 201 ? 9.020   18.778 -9.998  1.00 26.30  ? 225 SER A N     1 
ATOM   1574 C  CA    . SER A 1 201 ? 7.722   18.783 -9.322  1.00 24.47  ? 225 SER A CA    1 
ATOM   1575 C  C     . SER A 1 201 ? 7.356   20.033 -8.529  1.00 23.95  ? 225 SER A C     1 
ATOM   1576 O  O     . SER A 1 201 ? 6.335   20.051 -7.836  1.00 22.64  ? 225 SER A O     1 
ATOM   1577 C  CB    . SER A 1 201 ? 7.613   17.565 -8.410  1.00 23.26  ? 225 SER A CB    1 
ATOM   1578 O  OG    . SER A 1 201 ? 7.832   16.376 -9.136  1.00 21.80  ? 225 SER A OG    1 
ATOM   1579 N  N     . CYS A 1 202 ? 8.160   21.082 -8.648  1.00 23.10  ? 226 CYS A N     1 
ATOM   1580 C  CA    . CYS A 1 202 ? 7.896   22.303 -7.905  1.00 24.87  ? 226 CYS A CA    1 
ATOM   1581 C  C     . CYS A 1 202 ? 6.534   22.971 -8.118  1.00 25.18  ? 226 CYS A C     1 
ATOM   1582 O  O     . CYS A 1 202 ? 5.866   23.332 -7.153  1.00 24.32  ? 226 CYS A O     1 
ATOM   1583 C  CB    . CYS A 1 202 ? 8.978   23.334 -8.169  1.00 27.47  ? 226 CYS A CB    1 
ATOM   1584 S  SG    . CYS A 1 202 ? 8.540   24.899 -7.402  1.00 37.98  ? 226 CYS A SG    1 
ATOM   1585 N  N     . GLN A 1 203 ? 6.118   23.170 -9.365  1.00 24.72  ? 227 GLN A N     1 
ATOM   1586 C  CA    . GLN A 1 203 ? 4.826   23.791 -9.579  1.00 24.53  ? 227 GLN A CA    1 
ATOM   1587 C  C     . GLN A 1 203 ? 3.698   22.877 -9.063  1.00 24.85  ? 227 GLN A C     1 
ATOM   1588 O  O     . GLN A 1 203 ? 2.745   23.334 -8.436  1.00 26.58  ? 227 GLN A O     1 
ATOM   1589 C  CB    . GLN A 1 203 ? 4.638   24.131 -11.057 1.00 25.64  ? 227 GLN A CB    1 
ATOM   1590 C  CG    . GLN A 1 203 ? 5.648   25.160 -11.598 1.00 30.18  ? 227 GLN A CG    1 
ATOM   1591 C  CD    . GLN A 1 203 ? 5.718   26.463 -10.777 1.00 34.15  ? 227 GLN A CD    1 
ATOM   1592 O  OE1   . GLN A 1 203 ? 4.717   27.180 -10.617 1.00 34.36  ? 227 GLN A OE1   1 
ATOM   1593 N  NE2   . GLN A 1 203 ? 6.911   26.773 -10.261 1.00 32.94  ? 227 GLN A NE2   1 
ATOM   1594 N  N     . HIS A 1 204 ? 3.816   21.580 -9.302  1.00 24.13  ? 228 HIS A N     1 
ATOM   1595 C  CA    . HIS A 1 204 ? 2.811   20.647 -8.836  1.00 23.28  ? 228 HIS A CA    1 
ATOM   1596 C  C     . HIS A 1 204 ? 2.597   20.847 -7.332  1.00 24.58  ? 228 HIS A C     1 
ATOM   1597 O  O     . HIS A 1 204 ? 1.458   20.909 -6.860  1.00 25.36  ? 228 HIS A O     1 
ATOM   1598 C  CB    . HIS A 1 204 ? 3.254   19.208 -9.122  1.00 21.76  ? 228 HIS A CB    1 
ATOM   1599 C  CG    . HIS A 1 204 ? 2.190   18.188 -8.860  1.00 21.83  ? 228 HIS A CG    1 
ATOM   1600 N  ND1   . HIS A 1 204 ? 1.833   17.795 -7.587  1.00 19.98  ? 228 HIS A ND1   1 
ATOM   1601 C  CD2   . HIS A 1 204 ? 1.358   17.532 -9.704  1.00 21.78  ? 228 HIS A CD2   1 
ATOM   1602 C  CE1   . HIS A 1 204 ? 0.823   16.945 -7.658  1.00 20.55  ? 228 HIS A CE1   1 
ATOM   1603 N  NE2   . HIS A 1 204 ? 0.516   16.769 -8.931  1.00 22.62  ? 228 HIS A NE2   1 
ATOM   1604 N  N     . LEU A 1 205 ? 3.689   20.960 -6.583  1.00 23.35  ? 229 LEU A N     1 
ATOM   1605 C  CA    . LEU A 1 205 ? 3.584   21.155 -5.145  1.00 23.49  ? 229 LEU A CA    1 
ATOM   1606 C  C     . LEU A 1 205 ? 2.995   22.534 -4.827  1.00 24.00  ? 229 LEU A C     1 
ATOM   1607 O  O     . LEU A 1 205 ? 2.145   22.674 -3.942  1.00 22.72  ? 229 LEU A O     1 
ATOM   1608 C  CB    . LEU A 1 205 ? 4.964   21.018 -4.489  1.00 24.25  ? 229 LEU A CB    1 
ATOM   1609 C  CG    . LEU A 1 205 ? 5.107   20.698 -2.981  1.00 25.63  ? 229 LEU A CG    1 
ATOM   1610 C  CD1   . LEU A 1 205 ? 5.954   21.758 -2.308  1.00 22.01  ? 229 LEU A CD1   1 
ATOM   1611 C  CD2   . LEU A 1 205 ? 3.747   20.577 -2.306  1.00 22.53  ? 229 LEU A CD2   1 
ATOM   1612 N  N     . ILE A 1 206 ? 3.439   23.554 -5.554  1.00 24.07  ? 230 ILE A N     1 
ATOM   1613 C  CA    . ILE A 1 206 ? 2.943   24.897 -5.299  1.00 24.80  ? 230 ILE A CA    1 
ATOM   1614 C  C     . ILE A 1 206 ? 1.460   24.993 -5.616  1.00 25.46  ? 230 ILE A C     1 
ATOM   1615 O  O     . ILE A 1 206 ? 0.680   25.545 -4.828  1.00 24.81  ? 230 ILE A O     1 
ATOM   1616 C  CB    . ILE A 1 206 ? 3.712   25.966 -6.123  1.00 26.07  ? 230 ILE A CB    1 
ATOM   1617 C  CG1   . ILE A 1 206 ? 3.623   27.316 -5.418  1.00 28.08  ? 230 ILE A CG1   1 
ATOM   1618 C  CG2   . ILE A 1 206 ? 3.104   26.140 -7.517  1.00 24.38  ? 230 ILE A CG2   1 
ATOM   1619 C  CD1   . ILE A 1 206 ? 4.176   27.297 -4.018  1.00 31.42  ? 230 ILE A CD1   1 
ATOM   1620 N  N     . HIS A 1 207 ? 1.070   24.427 -6.757  1.00 25.09  ? 231 HIS A N     1 
ATOM   1621 C  CA    . HIS A 1 207 ? -0.318  24.476 -7.192  1.00 24.64  ? 231 HIS A CA    1 
ATOM   1622 C  C     . HIS A 1 207 ? -1.258  23.567 -6.420  1.00 25.50  ? 231 HIS A C     1 
ATOM   1623 O  O     . HIS A 1 207 ? -2.480  23.689 -6.546  1.00 24.58  ? 231 HIS A O     1 
ATOM   1624 C  CB    . HIS A 1 207 ? -0.412  24.197 -8.690  1.00 21.85  ? 231 HIS A CB    1 
ATOM   1625 C  CG    . HIS A 1 207 ? 0.033   25.350 -9.540  1.00 24.00  ? 231 HIS A CG    1 
ATOM   1626 N  ND1   . HIS A 1 207 ? -0.586  26.584 -9.504  1.00 23.94  ? 231 HIS A ND1   1 
ATOM   1627 C  CD2   . HIS A 1 207 ? 1.063   25.473 -10.412 1.00 23.62  ? 231 HIS A CD2   1 
ATOM   1628 C  CE1   . HIS A 1 207 ? 0.048   27.417 -10.311 1.00 23.77  ? 231 HIS A CE1   1 
ATOM   1629 N  NE2   . HIS A 1 207 ? 1.053   26.769 -10.875 1.00 24.06  ? 231 HIS A NE2   1 
ATOM   1630 N  N     . SER A 1 208 ? -0.705  22.677 -5.599  1.00 24.23  ? 232 SER A N     1 
ATOM   1631 C  CA    . SER A 1 208 ? -1.564  21.793 -4.841  1.00 25.25  ? 232 SER A CA    1 
ATOM   1632 C  C     . SER A 1 208 ? -2.212  22.546 -3.694  1.00 28.16  ? 232 SER A C     1 
ATOM   1633 O  O     . SER A 1 208 ? -3.158  22.051 -3.086  1.00 28.91  ? 232 SER A O     1 
ATOM   1634 C  CB    . SER A 1 208 ? -0.795  20.575 -4.321  1.00 23.03  ? 232 SER A CB    1 
ATOM   1635 O  OG    . SER A 1 208 ? 0.239   20.943 -3.432  1.00 25.05  ? 232 SER A OG    1 
ATOM   1636 N  N     . LEU A 1 209 ? -1.719  23.747 -3.394  1.00 30.46  ? 233 LEU A N     1 
ATOM   1637 C  CA    . LEU A 1 209 ? -2.307  24.540 -2.310  1.00 32.00  ? 233 LEU A CA    1 
ATOM   1638 C  C     . LEU A 1 209 ? -3.678  25.064 -2.734  1.00 34.08  ? 233 LEU A C     1 
ATOM   1639 O  O     . LEU A 1 209 ? -3.909  25.325 -3.915  1.00 34.16  ? 233 LEU A O     1 
ATOM   1640 C  CB    . LEU A 1 209 ? -1.387  25.702 -1.948  1.00 30.42  ? 233 LEU A CB    1 
ATOM   1641 C  CG    . LEU A 1 209 ? -0.101  25.298 -1.233  1.00 27.98  ? 233 LEU A CG    1 
ATOM   1642 C  CD1   . LEU A 1 209 ? 0.834   26.474 -1.127  1.00 26.57  ? 233 LEU A CD1   1 
ATOM   1643 C  CD2   . LEU A 1 209 ? -0.445  24.783 0.135   1.00 28.28  ? 233 LEU A CD2   1 
ATOM   1644 N  N     . ASN A 1 210 ? -4.590  25.217 -1.781  1.00 37.35  ? 234 ASN A N     1 
ATOM   1645 C  CA    . ASN A 1 210 ? -5.928  25.689 -2.120  1.00 42.10  ? 234 ASN A CA    1 
ATOM   1646 C  C     . ASN A 1 210 ? -6.126  27.158 -1.832  1.00 45.38  ? 234 ASN A C     1 
ATOM   1647 O  O     . ASN A 1 210 ? -7.095  27.750 -2.285  1.00 45.71  ? 234 ASN A O     1 
ATOM   1648 C  CB    . ASN A 1 210 ? -6.991  24.829 -1.432  1.00 41.15  ? 234 ASN A CB    1 
ATOM   1649 C  CG    . ASN A 1 210 ? -6.961  23.381 -1.924  1.00 43.03  ? 234 ASN A CG    1 
ATOM   1650 O  OD1   . ASN A 1 210 ? -7.239  23.103 -3.098  1.00 42.12  ? 234 ASN A OD1   1 
ATOM   1651 N  ND2   . ASN A 1 210 ? -6.602  22.454 -1.033  1.00 42.38  ? 234 ASN A ND2   1 
ATOM   1652 N  N     . HIS A 1 211 ? -5.213  27.748 -1.065  1.00 50.71  ? 235 HIS A N     1 
ATOM   1653 C  CA    . HIS A 1 211 ? -5.266  29.189 -0.813  1.00 54.59  ? 235 HIS A CA    1 
ATOM   1654 C  C     . HIS A 1 211 ? -3.915  29.804 -0.433  1.00 54.51  ? 235 HIS A C     1 
ATOM   1655 O  O     . HIS A 1 211 ? -3.157  29.234 0.351   1.00 53.97  ? 235 HIS A O     1 
ATOM   1656 C  CB    . HIS A 1 211 ? -6.302  29.565 0.247   1.00 57.84  ? 235 HIS A CB    1 
ATOM   1657 C  CG    . HIS A 1 211 ? -6.853  30.950 0.060   1.00 62.08  ? 235 HIS A CG    1 
ATOM   1658 N  ND1   . HIS A 1 211 ? -7.895  31.226 -0.799  1.00 63.18  ? 235 HIS A ND1   1 
ATOM   1659 C  CD2   . HIS A 1 211 ? -6.454  32.146 0.560   1.00 63.62  ? 235 HIS A CD2   1 
ATOM   1660 C  CE1   . HIS A 1 211 ? -8.116  32.530 -0.822  1.00 63.48  ? 235 HIS A CE1   1 
ATOM   1661 N  NE2   . HIS A 1 211 ? -7.255  33.111 -0.007  1.00 64.75  ? 235 HIS A NE2   1 
ATOM   1662 N  N     . ILE A 1 212 ? -3.635  30.968 -1.019  1.00 53.96  ? 236 ILE A N     1 
ATOM   1663 C  CA    . ILE A 1 212 ? -2.403  31.723 -0.788  1.00 53.56  ? 236 ILE A CA    1 
ATOM   1664 C  C     . ILE A 1 212 ? -2.044  31.770 0.687   1.00 52.63  ? 236 ILE A C     1 
ATOM   1665 O  O     . ILE A 1 212 ? -0.872  31.857 1.048   1.00 52.02  ? 236 ILE A O     1 
ATOM   1666 C  CB    . ILE A 1 212 ? -2.561  33.164 -1.282  1.00 54.50  ? 236 ILE A CB    1 
ATOM   1667 C  CG1   . ILE A 1 212 ? -3.858  33.740 -0.702  1.00 55.62  ? 236 ILE A CG1   1 
ATOM   1668 C  CG2   . ILE A 1 212 ? -2.547  33.200 -2.802  1.00 53.29  ? 236 ILE A CG2   1 
ATOM   1669 C  CD1   . ILE A 1 212 ? -4.251  35.101 -1.225  1.00 57.57  ? 236 ILE A CD1   1 
ATOM   1670 N  N     . LYS A 1 213 ? -3.068  31.725 1.532   1.00 51.86  ? 237 LYS A N     1 
ATOM   1671 C  CA    . LYS A 1 213 ? -2.886  31.749 2.976   1.00 51.07  ? 237 LYS A CA    1 
ATOM   1672 C  C     . LYS A 1 213 ? -2.075  30.542 3.445   1.00 48.65  ? 237 LYS A C     1 
ATOM   1673 O  O     . LYS A 1 213 ? -1.503  30.541 4.533   1.00 48.63  ? 237 LYS A O     1 
ATOM   1674 C  CB    . LYS A 1 213 ? -4.257  31.764 3.664   1.00 53.37  ? 237 LYS A CB    1 
ATOM   1675 C  CG    . LYS A 1 213 ? -4.223  31.474 5.162   1.00 56.66  ? 237 LYS A CG    1 
ATOM   1676 C  CD    . LYS A 1 213 ? -3.370  32.469 5.934   1.00 59.40  ? 237 LYS A CD    1 
ATOM   1677 C  CE    . LYS A 1 213 ? -3.407  32.152 7.424   1.00 62.74  ? 237 LYS A CE    1 
ATOM   1678 N  NZ    . LYS A 1 213 ? -2.704  33.188 8.231   1.00 66.69  ? 237 LYS A NZ    1 
ATOM   1679 N  N     . GLU A 1 214 ? -2.030  29.515 2.609   1.00 46.38  ? 238 GLU A N     1 
ATOM   1680 C  CA    . GLU A 1 214 ? -1.305  28.300 2.925   1.00 43.89  ? 238 GLU A CA    1 
ATOM   1681 C  C     . GLU A 1 214 ? 0.189   28.439 2.667   1.00 41.15  ? 238 GLU A C     1 
ATOM   1682 O  O     . GLU A 1 214 ? 0.980   27.622 3.125   1.00 40.04  ? 238 GLU A O     1 
ATOM   1683 C  CB    . GLU A 1 214 ? -1.886  27.130 2.122   1.00 45.91  ? 238 GLU A CB    1 
ATOM   1684 C  CG    . GLU A 1 214 ? -3.239  26.637 2.649   1.00 50.24  ? 238 GLU A CG    1 
ATOM   1685 C  CD    . GLU A 1 214 ? -3.875  25.560 1.775   1.00 53.13  ? 238 GLU A CD    1 
ATOM   1686 O  OE1   . GLU A 1 214 ? -3.132  24.689 1.276   1.00 54.57  ? 238 GLU A OE1   1 
ATOM   1687 O  OE2   . GLU A 1 214 ? -5.118  25.573 1.601   1.00 53.43  ? 238 GLU A OE2   1 
ATOM   1688 N  N     . ILE A 1 215 ? 0.579   29.482 1.944   1.00 39.56  ? 239 ILE A N     1 
ATOM   1689 C  CA    . ILE A 1 215 ? 1.993   29.704 1.645   1.00 38.22  ? 239 ILE A CA    1 
ATOM   1690 C  C     . ILE A 1 215 ? 2.754   30.308 2.827   1.00 38.90  ? 239 ILE A C     1 
ATOM   1691 O  O     . ILE A 1 215 ? 2.455   31.415 3.273   1.00 36.66  ? 239 ILE A O     1 
ATOM   1692 C  CB    . ILE A 1 215 ? 2.185   30.647 0.432   1.00 35.23  ? 239 ILE A CB    1 
ATOM   1693 C  CG1   . ILE A 1 215 ? 1.557   30.033 -0.816  1.00 33.23  ? 239 ILE A CG1   1 
ATOM   1694 C  CG2   . ILE A 1 215 ? 3.670   30.908 0.218   1.00 35.73  ? 239 ILE A CG2   1 
ATOM   1695 C  CD1   . ILE A 1 215 ? 1.874   30.770 -2.090  1.00 33.42  ? 239 ILE A CD1   1 
ATOM   1696 N  N     . PRO A 1 216 ? 3.739   29.575 3.364   1.00 40.14  ? 240 PRO A N     1 
ATOM   1697 C  CA    . PRO A 1 216 ? 4.490   30.129 4.489   1.00 41.63  ? 240 PRO A CA    1 
ATOM   1698 C  C     . PRO A 1 216 ? 5.028   31.509 4.109   1.00 42.71  ? 240 PRO A C     1 
ATOM   1699 O  O     . PRO A 1 216 ? 5.726   31.658 3.107   1.00 42.61  ? 240 PRO A O     1 
ATOM   1700 C  CB    . PRO A 1 216 ? 5.599   29.099 4.691   1.00 41.27  ? 240 PRO A CB    1 
ATOM   1701 C  CG    . PRO A 1 216 ? 4.903   27.811 4.358   1.00 40.25  ? 240 PRO A CG    1 
ATOM   1702 C  CD    . PRO A 1 216 ? 4.140   28.179 3.097   1.00 40.85  ? 240 PRO A CD    1 
ATOM   1703 N  N     . GLY A 1 217 ? 4.688   32.519 4.900   1.00 44.29  ? 241 GLY A N     1 
ATOM   1704 C  CA    . GLY A 1 217 ? 5.155   33.858 4.602   1.00 47.64  ? 241 GLY A CA    1 
ATOM   1705 C  C     . GLY A 1 217 ? 3.995   34.809 4.426   1.00 50.27  ? 241 GLY A C     1 
ATOM   1706 O  O     . GLY A 1 217 ? 4.108   36.005 4.680   1.00 52.92  ? 241 GLY A O     1 
ATOM   1707 N  N     . ILE A 1 218 ? 2.869   34.269 3.985   1.00 51.85  ? 242 ILE A N     1 
ATOM   1708 C  CA    . ILE A 1 218 ? 1.669   35.057 3.782   1.00 53.50  ? 242 ILE A CA    1 
ATOM   1709 C  C     . ILE A 1 218 ? 0.769   34.803 4.998   1.00 56.21  ? 242 ILE A C     1 
ATOM   1710 O  O     . ILE A 1 218 ? 0.201   33.725 5.154   1.00 56.27  ? 242 ILE A O     1 
ATOM   1711 C  CB    . ILE A 1 218 ? 0.988   34.635 2.454   1.00 52.11  ? 242 ILE A CB    1 
ATOM   1712 C  CG1   . ILE A 1 218 ? 1.963   34.860 1.289   1.00 50.48  ? 242 ILE A CG1   1 
ATOM   1713 C  CG2   . ILE A 1 218 ? -0.277  35.431 2.231   1.00 52.12  ? 242 ILE A CG2   1 
ATOM   1714 C  CD1   . ILE A 1 218 ? 1.468   34.376 -0.055  1.00 48.73  ? 242 ILE A CD1   1 
ATOM   1715 N  N     . GLY A 1 219 ? 0.656   35.799 5.871   1.00 59.62  ? 243 GLY A N     1 
ATOM   1716 C  CA    . GLY A 1 219 ? -0.151  35.628 7.070   1.00 63.26  ? 243 GLY A CA    1 
ATOM   1717 C  C     . GLY A 1 219 ? -1.635  35.900 6.918   1.00 65.23  ? 243 GLY A C     1 
ATOM   1718 O  O     . GLY A 1 219 ? -2.153  35.977 5.805   1.00 65.64  ? 243 GLY A O     1 
ATOM   1719 N  N     . TYR A 1 220 ? -2.319  36.040 8.050   1.00 66.61  ? 244 TYR A N     1 
ATOM   1720 C  CA    . TYR A 1 220 ? -3.751  36.315 8.057   1.00 67.30  ? 244 TYR A CA    1 
ATOM   1721 C  C     . TYR A 1 220 ? -4.065  37.624 7.342   1.00 66.03  ? 244 TYR A C     1 
ATOM   1722 O  O     . TYR A 1 220 ? -4.995  37.697 6.535   1.00 65.18  ? 244 TYR A O     1 
ATOM   1723 C  CB    . TYR A 1 220 ? -4.271  36.387 9.495   1.00 70.67  ? 244 TYR A CB    1 
ATOM   1724 C  CG    . TYR A 1 220 ? -5.689  36.908 9.598   1.00 74.19  ? 244 TYR A CG    1 
ATOM   1725 C  CD1   . TYR A 1 220 ? -6.711  36.361 8.820   1.00 75.83  ? 244 TYR A CD1   1 
ATOM   1726 C  CD2   . TYR A 1 220 ? -6.006  37.956 10.460  1.00 75.53  ? 244 TYR A CD2   1 
ATOM   1727 C  CE1   . TYR A 1 220 ? -8.013  36.847 8.893   1.00 77.52  ? 244 TYR A CE1   1 
ATOM   1728 C  CE2   . TYR A 1 220 ? -7.306  38.452 10.541  1.00 77.22  ? 244 TYR A CE2   1 
ATOM   1729 C  CZ    . TYR A 1 220 ? -8.304  37.892 9.753   1.00 77.95  ? 244 TYR A CZ    1 
ATOM   1730 O  OH    . TYR A 1 220 ? -9.591  38.380 9.810   1.00 79.30  ? 244 TYR A OH    1 
ATOM   1731 N  N     . LYS A 1 221 ? -3.286  38.656 7.643   1.00 63.97  ? 245 LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 221 ? -3.492  39.952 7.023   1.00 62.42  ? 245 LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 221 ? -3.326  39.888 5.510   1.00 61.08  ? 245 LYS A C     1 
ATOM   1734 O  O     . LYS A 1 221 ? -4.309  39.894 4.778   1.00 62.09  ? 245 LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 221 ? -2.533  40.969 7.610   1.00 62.58  ? 245 LYS A CB    1 
ATOM   1736 N  N     . THR A 1 222 ? -2.083  39.818 5.045   1.00 60.17  ? 246 THR A N     1 
ATOM   1737 C  CA    . THR A 1 222 ? -1.786  39.775 3.611   1.00 58.85  ? 246 THR A CA    1 
ATOM   1738 C  C     . THR A 1 222 ? -2.780  38.953 2.784   1.00 58.33  ? 246 THR A C     1 
ATOM   1739 O  O     . THR A 1 222 ? -3.059  39.283 1.633   1.00 56.48  ? 246 THR A O     1 
ATOM   1740 C  CB    . THR A 1 222 ? -0.380  39.213 3.356   1.00 58.01  ? 246 THR A CB    1 
ATOM   1741 O  OG1   . THR A 1 222 ? 0.519   39.703 4.354   1.00 57.72  ? 246 THR A OG1   1 
ATOM   1742 C  CG2   . THR A 1 222 ? 0.116   39.652 1.994   1.00 57.11  ? 246 THR A CG2   1 
ATOM   1743 N  N     . ALA A 1 223 ? -3.305  37.881 3.371   1.00 58.72  ? 247 ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 223 ? -4.263  37.028 2.677   1.00 59.55  ? 247 ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 223 ? -5.531  37.815 2.374   1.00 60.66  ? 247 ALA A C     1 
ATOM   1746 O  O     . ALA A 1 223 ? -6.052  37.767 1.253   1.00 61.09  ? 247 ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 223 ? -4.597  35.808 3.524   1.00 58.60  ? 247 ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 224 ? -6.018  38.538 3.380   1.00 60.87  ? 248 LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 224 ? -7.223  39.351 3.246   1.00 61.16  ? 248 LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 224 ? -7.025  40.506 2.277   1.00 60.61  ? 248 LYS A C     1 
ATOM   1751 O  O     . LYS A 1 224 ? -7.953  40.901 1.578   1.00 61.99  ? 248 LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 224 ? -7.657  39.889 4.609   1.00 62.01  ? 248 LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 224 ? -8.084  38.802 5.589   1.00 65.31  ? 248 LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 224 ? -9.268  37.997 5.059   1.00 66.57  ? 248 LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 224 ? -9.628  36.857 6.001   1.00 67.59  ? 248 LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 224 ? -10.813 36.085 5.532   1.00 68.42  ? 248 LYS A NZ    1 
ATOM   1757 N  N     . CYS A 1 225 ? -5.817  41.050 2.234   1.00 59.76  ? 249 CYS A N     1 
ATOM   1758 C  CA    . CYS A 1 225 ? -5.533  42.151 1.327   1.00 60.20  ? 249 CYS A CA    1 
ATOM   1759 C  C     . CYS A 1 225 ? -5.637  41.608 -0.096  1.00 59.41  ? 249 CYS A C     1 
ATOM   1760 O  O     . CYS A 1 225 ? -6.278  42.210 -0.962  1.00 58.67  ? 249 CYS A O     1 
ATOM   1761 C  CB    . CYS A 1 225 ? -4.121  42.704 1.589   1.00 61.82  ? 249 CYS A CB    1 
ATOM   1762 S  SG    . CYS A 1 225 ? -3.687  44.276 0.738   1.00 66.18  ? 249 CYS A SG    1 
ATOM   1763 N  N     . LEU A 1 226 ? -5.013  40.454 -0.320  1.00 59.25  ? 250 LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 226 ? -5.013  39.810 -1.629  1.00 57.48  ? 250 LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 226 ? -6.424  39.450 -2.058  1.00 57.54  ? 250 LEU A C     1 
ATOM   1766 O  O     . LEU A 1 226 ? -6.762  39.553 -3.236  1.00 55.54  ? 250 LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 226 ? -4.132  38.554 -1.605  1.00 54.24  ? 250 LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 226 ? -2.621  38.803 -1.594  1.00 52.22  ? 250 LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 226 ? -1.863  37.494 -1.484  1.00 50.99  ? 250 LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 226 ? -2.225  39.536 -2.854  1.00 50.35  ? 250 LEU A CD2   1 
ATOM   1771 N  N     . GLU A 1 227 ? -7.244  39.023 -1.103  1.00 59.05  ? 251 GLU A N     1 
ATOM   1772 C  CA    . GLU A 1 227 ? -8.624  38.667 -1.410  1.00 61.62  ? 251 GLU A CA    1 
ATOM   1773 C  C     . GLU A 1 227 ? -9.316  39.902 -1.950  1.00 62.16  ? 251 GLU A C     1 
ATOM   1774 O  O     . GLU A 1 227 ? -9.931  39.878 -3.021  1.00 62.84  ? 251 GLU A O     1 
ATOM   1775 C  CB    . GLU A 1 227 ? -9.366  38.190 -0.162  1.00 62.73  ? 251 GLU A CB    1 
ATOM   1776 C  CG    . GLU A 1 227 ? -9.089  36.757 0.226   1.00 66.90  ? 251 GLU A CG    1 
ATOM   1777 C  CD    . GLU A 1 227 ? -10.077 36.243 1.256   1.00 69.27  ? 251 GLU A CD    1 
ATOM   1778 O  OE1   . GLU A 1 227 ? -11.302 36.335 0.999   1.00 68.57  ? 251 GLU A OE1   1 
ATOM   1779 O  OE2   . GLU A 1 227 ? -9.628  35.745 2.317   1.00 71.18  ? 251 GLU A OE2   1 
ATOM   1780 N  N     . ALA A 1 228 ? -9.203  40.988 -1.196  1.00 61.49  ? 252 ALA A N     1 
ATOM   1781 C  CA    . ALA A 1 228 ? -9.807  42.248 -1.583  1.00 60.73  ? 252 ALA A CA    1 
ATOM   1782 C  C     . ALA A 1 228 ? -9.403  42.620 -3.008  1.00 59.94  ? 252 ALA A C     1 
ATOM   1783 O  O     . ALA A 1 228 ? -9.985  43.527 -3.604  1.00 61.19  ? 252 ALA A O     1 
ATOM   1784 C  CB    . ALA A 1 228 ? -9.383  43.339 -0.614  1.00 61.39  ? 252 ALA A CB    1 
ATOM   1785 N  N     . LEU A 1 229 ? -8.415  41.914 -3.552  1.00 57.76  ? 253 LEU A N     1 
ATOM   1786 C  CA    . LEU A 1 229 ? -7.935  42.168 -4.906  1.00 56.00  ? 253 LEU A CA    1 
ATOM   1787 C  C     . LEU A 1 229 ? -8.317  41.068 -5.886  1.00 54.45  ? 253 LEU A C     1 
ATOM   1788 O  O     . LEU A 1 229 ? -7.864  41.070 -7.029  1.00 53.93  ? 253 LEU A O     1 
ATOM   1789 C  CB    . LEU A 1 229 ? -6.420  42.302 -4.905  1.00 57.32  ? 253 LEU A CB    1 
ATOM   1790 C  CG    . LEU A 1 229 ? -5.870  43.452 -4.078  1.00 58.25  ? 253 LEU A CG    1 
ATOM   1791 C  CD1   . LEU A 1 229 ? -4.608  43.004 -3.339  1.00 58.39  ? 253 LEU A CD1   1 
ATOM   1792 C  CD2   . LEU A 1 229 ? -5.607  44.626 -5.005  1.00 58.59  ? 253 LEU A CD2   1 
ATOM   1793 N  N     . GLY A 1 230 ? -9.141  40.127 -5.442  1.00 52.78  ? 254 GLY A N     1 
ATOM   1794 C  CA    . GLY A 1 230 ? -9.542  39.043 -6.318  1.00 52.83  ? 254 GLY A CA    1 
ATOM   1795 C  C     . GLY A 1 230 ? -8.463  37.984 -6.503  1.00 52.77  ? 254 GLY A C     1 
ATOM   1796 O  O     . GLY A 1 230 ? -8.534  37.154 -7.405  1.00 53.23  ? 254 GLY A O     1 
ATOM   1797 N  N     . ILE A 1 231 ? -7.443  38.021 -5.656  1.00 51.50  ? 255 ILE A N     1 
ATOM   1798 C  CA    . ILE A 1 231 ? -6.364  37.047 -5.722  1.00 48.53  ? 255 ILE A CA    1 
ATOM   1799 C  C     . ILE A 1 231 ? -6.705  35.964 -4.713  1.00 46.52  ? 255 ILE A C     1 
ATOM   1800 O  O     . ILE A 1 231 ? -6.632  36.200 -3.509  1.00 46.47  ? 255 ILE A O     1 
ATOM   1801 C  CB    . ILE A 1 231 ? -5.034  37.702 -5.349  1.00 48.66  ? 255 ILE A CB    1 
ATOM   1802 C  CG1   . ILE A 1 231 ? -4.695  38.774 -6.384  1.00 48.19  ? 255 ILE A CG1   1 
ATOM   1803 C  CG2   . ILE A 1 231 ? -3.941  36.655 -5.247  1.00 49.51  ? 255 ILE A CG2   1 
ATOM   1804 C  CD1   . ILE A 1 231 ? -3.455  39.576 -6.063  1.00 48.51  ? 255 ILE A CD1   1 
ATOM   1805 N  N     . ASN A 1 232 ? -7.088  34.785 -5.197  1.00 44.65  ? 256 ASN A N     1 
ATOM   1806 C  CA    . ASN A 1 232 ? -7.466  33.691 -4.302  1.00 42.41  ? 256 ASN A CA    1 
ATOM   1807 C  C     . ASN A 1 232 ? -6.639  32.427 -4.442  1.00 40.18  ? 256 ASN A C     1 
ATOM   1808 O  O     . ASN A 1 232 ? -6.269  31.826 -3.441  1.00 41.93  ? 256 ASN A O     1 
ATOM   1809 C  CB    . ASN A 1 232 ? -8.947  33.346 -4.483  1.00 43.65  ? 256 ASN A CB    1 
ATOM   1810 C  CG    . ASN A 1 232 ? -9.870  34.445 -3.969  1.00 46.15  ? 256 ASN A CG    1 
ATOM   1811 O  OD1   . ASN A 1 232 ? -10.080 34.585 -2.758  1.00 47.30  ? 256 ASN A OD1   1 
ATOM   1812 N  ND2   . ASN A 1 232 ? -10.414 35.239 -4.888  1.00 45.24  ? 256 ASN A ND2   1 
ATOM   1813 N  N     . SER A 1 233 ? -6.352  32.019 -5.673  1.00 37.65  ? 257 SER A N     1 
ATOM   1814 C  CA    . SER A 1 233 ? -5.567  30.813 -5.901  1.00 34.61  ? 257 SER A CA    1 
ATOM   1815 C  C     . SER A 1 233 ? -4.097  31.177 -6.021  1.00 33.86  ? 257 SER A C     1 
ATOM   1816 O  O     . SER A 1 233 ? -3.754  32.336 -6.216  1.00 34.08  ? 257 SER A O     1 
ATOM   1817 C  CB    . SER A 1 233 ? -6.025  30.117 -7.178  1.00 33.53  ? 257 SER A CB    1 
ATOM   1818 O  OG    . SER A 1 233 ? -5.699  30.901 -8.309  1.00 31.92  ? 257 SER A OG    1 
ATOM   1819 N  N     . VAL A 1 234 ? -3.219  30.194 -5.900  1.00 33.22  ? 258 VAL A N     1 
ATOM   1820 C  CA    . VAL A 1 234 ? -1.804  30.499 -6.016  1.00 33.59  ? 258 VAL A CA    1 
ATOM   1821 C  C     . VAL A 1 234 ? -1.479  31.010 -7.421  1.00 33.47  ? 258 VAL A C     1 
ATOM   1822 O  O     . VAL A 1 234 ? -0.566  31.813 -7.587  1.00 34.10  ? 258 VAL A O     1 
ATOM   1823 C  CB    . VAL A 1 234 ? -0.922  29.264 -5.717  1.00 32.96  ? 258 VAL A CB    1 
ATOM   1824 C  CG1   . VAL A 1 234 ? 0.533   29.600 -5.956  1.00 32.30  ? 258 VAL A CG1   1 
ATOM   1825 C  CG2   . VAL A 1 234 ? -1.113  28.827 -4.285  1.00 32.50  ? 258 VAL A CG2   1 
ATOM   1826 N  N     . ARG A 1 235 ? -2.224  30.553 -8.428  1.00 32.98  ? 259 ARG A N     1 
ATOM   1827 C  CA    . ARG A 1 235 ? -1.964  30.975 -9.801  1.00 30.94  ? 259 ARG A CA    1 
ATOM   1828 C  C     . ARG A 1 235 ? -2.437  32.411 -10.010 1.00 31.87  ? 259 ARG A C     1 
ATOM   1829 O  O     . ARG A 1 235 ? -1.910  33.124 -10.863 1.00 30.92  ? 259 ARG A O     1 
ATOM   1830 C  CB    . ARG A 1 235 ? -2.638  30.026 -10.804 1.00 28.82  ? 259 ARG A CB    1 
ATOM   1831 C  CG    . ARG A 1 235 ? -2.017  30.091 -12.186 1.00 26.73  ? 259 ARG A CG    1 
ATOM   1832 C  CD    . ARG A 1 235 ? -2.744  29.245 -13.221 1.00 26.85  ? 259 ARG A CD    1 
ATOM   1833 N  NE    . ARG A 1 235 ? -2.564  27.807 -13.039 1.00 27.20  ? 259 ARG A NE    1 
ATOM   1834 C  CZ    . ARG A 1 235 ? -1.432  27.141 -13.273 1.00 26.73  ? 259 ARG A CZ    1 
ATOM   1835 N  NH1   . ARG A 1 235 ? -0.359  27.785 -13.710 1.00 27.05  ? 259 ARG A NH1   1 
ATOM   1836 N  NH2   . ARG A 1 235 ? -1.367  25.829 -13.056 1.00 22.58  ? 259 ARG A NH2   1 
ATOM   1837 N  N     . ASP A 1 236 ? -3.433  32.831 -9.234  1.00 33.09  ? 260 ASP A N     1 
ATOM   1838 C  CA    . ASP A 1 236 ? -3.931  34.201 -9.314  1.00 34.49  ? 260 ASP A CA    1 
ATOM   1839 C  C     . ASP A 1 236 ? -2.779  35.100 -8.914  1.00 35.67  ? 260 ASP A C     1 
ATOM   1840 O  O     . ASP A 1 236 ? -2.518  36.108 -9.557  1.00 38.39  ? 260 ASP A O     1 
ATOM   1841 C  CB    . ASP A 1 236 ? -5.087  34.446 -8.338  1.00 35.71  ? 260 ASP A CB    1 
ATOM   1842 C  CG    . ASP A 1 236 ? -6.381  33.798 -8.785  1.00 37.46  ? 260 ASP A CG    1 
ATOM   1843 O  OD1   . ASP A 1 236 ? -6.629  33.775 -10.013 1.00 38.15  ? 260 ASP A OD1   1 
ATOM   1844 O  OD2   . ASP A 1 236 ? -7.153  33.334 -7.913  1.00 34.07  ? 260 ASP A OD2   1 
ATOM   1845 N  N     . LEU A 1 237 ? -2.099  34.726 -7.834  1.00 35.95  ? 261 LEU A N     1 
ATOM   1846 C  CA    . LEU A 1 237 ? -0.960  35.485 -7.334  1.00 35.50  ? 261 LEU A CA    1 
ATOM   1847 C  C     . LEU A 1 237 ? 0.215   35.428 -8.300  1.00 35.92  ? 261 LEU A C     1 
ATOM   1848 O  O     . LEU A 1 237 ? 0.956   36.391 -8.440  1.00 37.06  ? 261 LEU A O     1 
ATOM   1849 C  CB    . LEU A 1 237 ? -0.534  34.955 -5.963  1.00 34.39  ? 261 LEU A CB    1 
ATOM   1850 C  CG    . LEU A 1 237 ? 0.727   35.551 -5.332  1.00 33.37  ? 261 LEU A CG    1 
ATOM   1851 C  CD1   . LEU A 1 237 ? 0.697   37.064 -5.460  1.00 33.74  ? 261 LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A 1 237 ? 0.817   35.140 -3.864  1.00 31.87  ? 261 LEU A CD2   1 
ATOM   1853 N  N     . GLN A 1 238 ? 0.391   34.297 -8.966  1.00 37.11  ? 262 GLN A N     1 
ATOM   1854 C  CA    . GLN A 1 238 ? 1.485   34.163 -9.913  1.00 39.51  ? 262 GLN A CA    1 
ATOM   1855 C  C     . GLN A 1 238 ? 1.248   35.058 -11.113 1.00 40.89  ? 262 GLN A C     1 
ATOM   1856 O  O     . GLN A 1 238 ? 2.159   35.723 -11.602 1.00 42.49  ? 262 GLN A O     1 
ATOM   1857 C  CB    . GLN A 1 238 ? 1.614   32.718 -10.397 1.00 38.62  ? 262 GLN A CB    1 
ATOM   1858 C  CG    . GLN A 1 238 ? 2.182   31.769 -9.375  1.00 39.59  ? 262 GLN A CG    1 
ATOM   1859 C  CD    . GLN A 1 238 ? 2.349   30.357 -9.906  1.00 40.17  ? 262 GLN A CD    1 
ATOM   1860 O  OE1   . GLN A 1 238 ? 3.032   29.546 -9.295  1.00 42.50  ? 262 GLN A OE1   1 
ATOM   1861 N  NE2   . GLN A 1 238 ? 1.723   30.057 -11.039 1.00 39.29  ? 262 GLN A NE2   1 
ATOM   1862 N  N     . THR A 1 239 ? 0.006   35.079 -11.575 1.00 41.93  ? 263 THR A N     1 
ATOM   1863 C  CA    . THR A 1 239 ? -0.355  35.860 -12.745 1.00 42.15  ? 263 THR A CA    1 
ATOM   1864 C  C     . THR A 1 239 ? -0.766  37.299 -12.468 1.00 41.98  ? 263 THR A C     1 
ATOM   1865 O  O     . THR A 1 239 ? -0.907  38.089 -13.400 1.00 40.74  ? 263 THR A O     1 
ATOM   1866 C  CB    . THR A 1 239 ? -1.492  35.159 -13.538 1.00 42.11  ? 263 THR A CB    1 
ATOM   1867 O  OG1   . THR A 1 239 ? -2.544  34.770 -12.643 1.00 42.82  ? 263 THR A OG1   1 
ATOM   1868 C  CG2   . THR A 1 239 ? -0.966  33.928 -14.251 1.00 41.34  ? 263 THR A CG2   1 
ATOM   1869 N  N     . PHE A 1 240 ? -0.949  37.656 -11.203 1.00 43.21  ? 264 PHE A N     1 
ATOM   1870 C  CA    . PHE A 1 240 ? -1.365  39.018 -10.910 1.00 45.18  ? 264 PHE A CA    1 
ATOM   1871 C  C     . PHE A 1 240 ? -0.304  40.033 -11.281 1.00 47.74  ? 264 PHE A C     1 
ATOM   1872 O  O     . PHE A 1 240 ? 0.889   39.708 -11.342 1.00 48.71  ? 264 PHE A O     1 
ATOM   1873 C  CB    . PHE A 1 240 ? -1.712  39.202 -9.448  1.00 44.21  ? 264 PHE A CB    1 
ATOM   1874 C  CG    . PHE A 1 240 ? -2.554  40.409 -9.201  1.00 45.66  ? 264 PHE A CG    1 
ATOM   1875 C  CD1   . PHE A 1 240 ? -3.936  40.344 -9.351  1.00 44.97  ? 264 PHE A CD1   1 
ATOM   1876 C  CD2   . PHE A 1 240 ? -1.966  41.633 -8.903  1.00 44.94  ? 264 PHE A CD2   1 
ATOM   1877 C  CE1   . PHE A 1 240 ? -4.718  41.472 -9.209  1.00 44.99  ? 264 PHE A CE1   1 
ATOM   1878 C  CE2   . PHE A 1 240 ? -2.738  42.770 -8.761  1.00 44.89  ? 264 PHE A CE2   1 
ATOM   1879 C  CZ    . PHE A 1 240 ? -4.118  42.693 -8.917  1.00 46.68  ? 264 PHE A CZ    1 
ATOM   1880 N  N     . SER A 1 241 ? -0.749  41.266 -11.512 1.00 48.83  ? 265 SER A N     1 
ATOM   1881 C  CA    . SER A 1 241 ? 0.131   42.366 -11.905 1.00 50.57  ? 265 SER A CA    1 
ATOM   1882 C  C     . SER A 1 241 ? 1.179   42.776 -10.884 1.00 51.63  ? 265 SER A C     1 
ATOM   1883 O  O     . SER A 1 241 ? 0.858   43.086 -9.732  1.00 50.68  ? 265 SER A O     1 
ATOM   1884 C  CB    . SER A 1 241 ? -0.693  43.606 -12.267 1.00 50.90  ? 265 SER A CB    1 
ATOM   1885 O  OG    . SER A 1 241 ? 0.136   44.742 -12.463 1.00 52.45  ? 265 SER A OG    1 
ATOM   1886 N  N     . PRO A 1 242 ? 2.457   42.782 -11.302 1.00 53.13  ? 266 PRO A N     1 
ATOM   1887 C  CA    . PRO A 1 242 ? 3.556   43.171 -10.414 1.00 54.39  ? 266 PRO A CA    1 
ATOM   1888 C  C     . PRO A 1 242 ? 3.338   44.603 -9.936  1.00 56.44  ? 266 PRO A C     1 
ATOM   1889 O  O     . PRO A 1 242 ? 3.434   44.899 -8.747  1.00 56.79  ? 266 PRO A O     1 
ATOM   1890 C  CB    . PRO A 1 242 ? 4.781   43.036 -11.311 1.00 53.32  ? 266 PRO A CB    1 
ATOM   1891 C  CG    . PRO A 1 242 ? 4.408   41.874 -12.193 1.00 53.41  ? 266 PRO A CG    1 
ATOM   1892 C  CD    . PRO A 1 242 ? 2.975   42.198 -12.554 1.00 53.05  ? 266 PRO A CD    1 
ATOM   1893 N  N     . LYS A 1 243 ? 3.021   45.485 -10.876 1.00 58.73  ? 267 LYS A N     1 
ATOM   1894 C  CA    . LYS A 1 243 ? 2.786   46.884 -10.556 1.00 61.27  ? 267 LYS A CA    1 
ATOM   1895 C  C     . LYS A 1 243 ? 1.778   47.087 -9.429  1.00 61.85  ? 267 LYS A C     1 
ATOM   1896 O  O     . LYS A 1 243 ? 2.143   47.508 -8.335  1.00 62.67  ? 267 LYS A O     1 
ATOM   1897 C  CB    . LYS A 1 243 ? 2.306   47.625 -11.801 1.00 63.50  ? 267 LYS A CB    1 
ATOM   1898 C  CG    . LYS A 1 243 ? 3.326   47.668 -12.926 1.00 67.14  ? 267 LYS A CG    1 
ATOM   1899 C  CD    . LYS A 1 243 ? 4.581   48.421 -12.500 1.00 69.73  ? 267 LYS A CD    1 
ATOM   1900 C  CE    . LYS A 1 243 ? 5.577   48.544 -13.649 1.00 71.11  ? 267 LYS A CE    1 
ATOM   1901 N  NZ    . LYS A 1 243 ? 6.804   49.300 -13.255 1.00 72.25  ? 267 LYS A NZ    1 
ATOM   1902 N  N     . ILE A 1 244 ? 0.512   46.787 -9.701  1.00 62.46  ? 268 ILE A N     1 
ATOM   1903 C  CA    . ILE A 1 244 ? -0.561  46.968 -8.717  1.00 62.67  ? 268 ILE A CA    1 
ATOM   1904 C  C     . ILE A 1 244 ? -0.220  46.409 -7.339  1.00 63.40  ? 268 ILE A C     1 
ATOM   1905 O  O     . ILE A 1 244 ? -0.382  47.088 -6.314  1.00 63.01  ? 268 ILE A O     1 
ATOM   1906 C  CB    . ILE A 1 244 ? -1.877  46.297 -9.191  1.00 62.05  ? 268 ILE A CB    1 
ATOM   1907 C  CG1   . ILE A 1 244 ? -2.201  46.726 -10.624 1.00 61.35  ? 268 ILE A CG1   1 
ATOM   1908 C  CG2   . ILE A 1 244 ? -3.020  46.663 -8.248  1.00 60.61  ? 268 ILE A CG2   1 
ATOM   1909 C  CD1   . ILE A 1 244 ? -3.439  46.064 -11.192 1.00 62.26  ? 268 ILE A CD1   1 
ATOM   1910 N  N     . LEU A 1 245 ? 0.245   45.162 -7.336  1.00 63.96  ? 269 LEU A N     1 
ATOM   1911 C  CA    . LEU A 1 245 ? 0.603   44.437 -6.118  1.00 63.53  ? 269 LEU A CA    1 
ATOM   1912 C  C     . LEU A 1 245 ? 1.714   45.163 -5.371  1.00 64.30  ? 269 LEU A C     1 
ATOM   1913 O  O     . LEU A 1 245 ? 1.653   45.350 -4.150  1.00 63.05  ? 269 LEU A O     1 
ATOM   1914 C  CB    . LEU A 1 245 ? 1.052   43.017 -6.495  1.00 60.32  ? 269 LEU A CB    1 
ATOM   1915 C  CG    . LEU A 1 245 ? 1.298   41.995 -5.392  1.00 57.76  ? 269 LEU A CG    1 
ATOM   1916 C  CD1   . LEU A 1 245 ? 0.005   41.695 -4.650  1.00 56.14  ? 269 LEU A CD1   1 
ATOM   1917 C  CD2   . LEU A 1 245 ? 1.861   40.743 -6.020  1.00 56.87  ? 269 LEU A CD2   1 
ATOM   1918 N  N     . GLU A 1 246 ? 2.728   45.565 -6.128  1.00 65.86  ? 270 GLU A N     1 
ATOM   1919 C  CA    . GLU A 1 246 ? 3.876   46.278 -5.587  1.00 68.00  ? 270 GLU A CA    1 
ATOM   1920 C  C     . GLU A 1 246 ? 3.363   47.576 -4.989  1.00 67.91  ? 270 GLU A C     1 
ATOM   1921 O  O     . GLU A 1 246 ? 3.776   47.986 -3.901  1.00 66.79  ? 270 GLU A O     1 
ATOM   1922 C  CB    . GLU A 1 246 ? 4.870   46.571 -6.718  1.00 69.93  ? 270 GLU A CB    1 
ATOM   1923 C  CG    . GLU A 1 246 ? 6.244   47.041 -6.276  1.00 73.07  ? 270 GLU A CG    1 
ATOM   1924 C  CD    . GLU A 1 246 ? 7.230   47.113 -7.434  1.00 74.62  ? 270 GLU A CD    1 
ATOM   1925 O  OE1   . GLU A 1 246 ? 7.383   46.098 -8.151  1.00 75.15  ? 270 GLU A OE1   1 
ATOM   1926 O  OE2   . GLU A 1 246 ? 7.854   48.181 -7.624  1.00 76.54  ? 270 GLU A OE2   1 
ATOM   1927 N  N     . LYS A 1 247 ? 2.427   48.188 -5.712  1.00 68.36  ? 271 LYS A N     1 
ATOM   1928 C  CA    . LYS A 1 247 ? 1.823   49.458 -5.338  1.00 68.35  ? 271 LYS A CA    1 
ATOM   1929 C  C     . LYS A 1 247 ? 0.706   49.375 -4.302  1.00 68.64  ? 271 LYS A C     1 
ATOM   1930 O  O     . LYS A 1 247 ? -0.041  50.337 -4.119  1.00 69.52  ? 271 LYS A O     1 
ATOM   1931 C  CB    . LYS A 1 247 ? 1.312   50.164 -6.591  1.00 67.37  ? 271 LYS A CB    1 
ATOM   1932 N  N     . GLU A 1 248 ? 0.578   48.249 -3.616  1.00 68.85  ? 272 GLU A N     1 
ATOM   1933 C  CA    . GLU A 1 248 ? -0.472  48.158 -2.615  1.00 68.84  ? 272 GLU A CA    1 
ATOM   1934 C  C     . GLU A 1 248 ? -0.074  47.388 -1.365  1.00 68.45  ? 272 GLU A C     1 
ATOM   1935 O  O     . GLU A 1 248 ? -0.838  47.315 -0.398  1.00 67.96  ? 272 GLU A O     1 
ATOM   1936 C  CB    . GLU A 1 248 ? -1.726  47.543 -3.222  1.00 69.63  ? 272 GLU A CB    1 
ATOM   1937 C  CG    . GLU A 1 248 ? -2.928  47.707 -2.323  1.00 72.12  ? 272 GLU A CG    1 
ATOM   1938 C  CD    . GLU A 1 248 ? -4.224  47.355 -3.007  1.00 73.73  ? 272 GLU A CD    1 
ATOM   1939 O  OE1   . GLU A 1 248 ? -4.518  47.956 -4.069  1.00 73.67  ? 272 GLU A OE1   1 
ATOM   1940 O  OE2   . GLU A 1 248 ? -4.946  46.481 -2.474  1.00 73.84  ? 272 GLU A OE2   1 
ATOM   1941 N  N     . LEU A 1 249 ? 1.127   46.819 -1.384  1.00 68.34  ? 273 LEU A N     1 
ATOM   1942 C  CA    . LEU A 1 249 ? 1.636   46.058 -0.247  1.00 68.20  ? 273 LEU A CA    1 
ATOM   1943 C  C     . LEU A 1 249 ? 3.073   46.463 0.054   1.00 67.64  ? 273 LEU A C     1 
ATOM   1944 O  O     . LEU A 1 249 ? 3.612   46.164 1.122   1.00 65.80  ? 273 LEU A O     1 
ATOM   1945 C  CB    . LEU A 1 249 ? 1.572   44.559 -0.545  1.00 68.99  ? 273 LEU A CB    1 
ATOM   1946 C  CG    . LEU A 1 249 ? 0.176   43.938 -0.579  1.00 68.66  ? 273 LEU A CG    1 
ATOM   1947 C  CD1   . LEU A 1 249 ? 0.266   42.497 -1.048  1.00 68.83  ? 273 LEU A CD1   1 
ATOM   1948 C  CD2   . LEU A 1 249 ? -0.445  44.026 0.806   1.00 68.39  ? 273 LEU A CD2   1 
ATOM   1949 N  N     . GLY A 1 250 ? 3.681   47.158 -0.901  1.00 68.08  ? 274 GLY A N     1 
ATOM   1950 C  CA    . GLY A 1 250 ? 5.050   47.599 -0.738  1.00 68.35  ? 274 GLY A CA    1 
ATOM   1951 C  C     . GLY A 1 250 ? 5.939   46.763 -1.623  1.00 68.04  ? 274 GLY A C     1 
ATOM   1952 O  O     . GLY A 1 250 ? 5.866   45.539 -1.600  1.00 68.58  ? 274 GLY A O     1 
ATOM   1953 N  N     . ILE A 1 251 ? 6.777   47.421 -2.407  1.00 68.10  ? 275 ILE A N     1 
ATOM   1954 C  CA    . ILE A 1 251 ? 7.677   46.718 -3.306  1.00 68.55  ? 275 ILE A CA    1 
ATOM   1955 C  C     . ILE A 1 251 ? 8.331   45.504 -2.632  1.00 68.60  ? 275 ILE A C     1 
ATOM   1956 O  O     . ILE A 1 251 ? 8.707   44.544 -3.307  1.00 68.73  ? 275 ILE A O     1 
ATOM   1957 C  CB    . ILE A 1 251 ? 8.766   47.677 -3.841  1.00 68.26  ? 275 ILE A CB    1 
ATOM   1958 C  CG1   . ILE A 1 251 ? 9.525   47.014 -4.990  1.00 68.24  ? 275 ILE A CG1   1 
ATOM   1959 C  CG2   . ILE A 1 251 ? 9.709   48.071 -2.713  1.00 68.13  ? 275 ILE A CG2   1 
ATOM   1960 C  CD1   . ILE A 1 251 ? 10.467  47.946 -5.721  1.00 68.50  ? 275 ILE A CD1   1 
ATOM   1961 N  N     . SER A 1 252 ? 8.457   45.546 -1.305  1.00 68.60  ? 276 SER A N     1 
ATOM   1962 C  CA    . SER A 1 252 ? 9.049   44.438 -0.554  1.00 68.77  ? 276 SER A CA    1 
ATOM   1963 C  C     . SER A 1 252 ? 8.084   43.258 -0.507  1.00 67.49  ? 276 SER A C     1 
ATOM   1964 O  O     . SER A 1 252 ? 8.166   42.338 -1.325  1.00 67.59  ? 276 SER A O     1 
ATOM   1965 C  CB    . SER A 1 252 ? 9.377   44.871 0.881   1.00 70.90  ? 276 SER A CB    1 
ATOM   1966 O  OG    . SER A 1 252 ? 9.804   43.767 1.673   1.00 71.17  ? 276 SER A OG    1 
ATOM   1967 N  N     . VAL A 1 253 ? 7.174   43.293 0.462   1.00 65.73  ? 277 VAL A N     1 
ATOM   1968 C  CA    . VAL A 1 253 ? 6.178   42.239 0.619   1.00 64.48  ? 277 VAL A CA    1 
ATOM   1969 C  C     . VAL A 1 253 ? 5.662   41.763 -0.742  1.00 63.31  ? 277 VAL A C     1 
ATOM   1970 O  O     . VAL A 1 253 ? 5.506   40.565 -0.971  1.00 63.46  ? 277 VAL A O     1 
ATOM   1971 C  CB    . VAL A 1 253 ? 4.986   42.736 1.488   1.00 63.47  ? 277 VAL A CB    1 
ATOM   1972 C  CG1   . VAL A 1 253 ? 3.811   41.773 1.391   1.00 62.59  ? 277 VAL A CG1   1 
ATOM   1973 C  CG2   . VAL A 1 253 ? 5.433   42.867 2.941   1.00 63.20  ? 277 VAL A CG2   1 
ATOM   1974 N  N     . ALA A 1 254 ? 5.423   42.705 -1.648  1.00 61.86  ? 278 ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 254 ? 4.920   42.378 -2.977  1.00 60.69  ? 278 ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 254 ? 5.878   41.489 -3.749  1.00 59.58  ? 278 ALA A C     1 
ATOM   1977 O  O     . ALA A 1 254 ? 5.590   40.326 -4.022  1.00 59.91  ? 278 ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 254 ? 4.662   43.653 -3.765  1.00 59.61  ? 278 ALA A CB    1 
ATOM   1979 N  N     . GLN A 1 255 ? 7.023   42.053 -4.099  1.00 58.73  ? 279 GLN A N     1 
ATOM   1980 C  CA    . GLN A 1 255 ? 8.027   41.343 -4.868  1.00 57.52  ? 279 GLN A CA    1 
ATOM   1981 C  C     . GLN A 1 255 ? 8.432   40.016 -4.226  1.00 55.13  ? 279 GLN A C     1 
ATOM   1982 O  O     . GLN A 1 255 ? 8.773   39.057 -4.922  1.00 54.51  ? 279 GLN A O     1 
ATOM   1983 C  CB    . GLN A 1 255 ? 9.239   42.252 -5.048  1.00 59.41  ? 279 GLN A CB    1 
ATOM   1984 C  CG    . GLN A 1 255 ? 10.158  41.856 -6.174  1.00 64.26  ? 279 GLN A CG    1 
ATOM   1985 C  CD    . GLN A 1 255 ? 11.266  42.871 -6.384  1.00 67.56  ? 279 GLN A CD    1 
ATOM   1986 O  OE1   . GLN A 1 255 ? 12.063  42.758 -7.319  1.00 69.35  ? 279 GLN A OE1   1 
ATOM   1987 N  NE2   . GLN A 1 255 ? 11.323  43.874 -5.509  1.00 67.70  ? 279 GLN A NE2   1 
ATOM   1988 N  N     . ARG A 1 256 ? 8.379   39.956 -2.900  1.00 52.21  ? 280 ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 256 ? 8.753   38.741 -2.195  1.00 49.38  ? 280 ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 256 ? 7.703   37.642 -2.254  1.00 47.22  ? 280 ARG A C     1 
ATOM   1991 O  O     . ARG A 1 256 ? 8.029   36.503 -2.593  1.00 48.34  ? 280 ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 256 ? 9.085   39.043 -0.733  1.00 50.45  ? 280 ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 256 ? 9.263   37.800 0.130   1.00 52.35  ? 280 ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 256 ? 9.936   38.134 1.443   1.00 55.11  ? 280 ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 256 ? 9.194   39.138 2.202   1.00 58.40  ? 280 ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 256 ? 8.111   38.888 2.934   1.00 60.20  ? 280 ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 256 ? 7.630   37.648 3.020   1.00 60.09  ? 280 ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 256 ? 7.506   39.887 3.576   1.00 59.70  ? 280 ARG A NH2   1 
ATOM   1999 N  N     . ILE A 1 257 ? 6.452   37.957 -1.928  1.00 43.32  ? 281 ILE A N     1 
ATOM   2000 C  CA    . ILE A 1 257 ? 5.436   36.915 -1.961  1.00 40.01  ? 281 ILE A CA    1 
ATOM   2001 C  C     . ILE A 1 257 ? 5.100   36.458 -3.371  1.00 39.20  ? 281 ILE A C     1 
ATOM   2002 O  O     . ILE A 1 257 ? 4.544   35.372 -3.558  1.00 37.75  ? 281 ILE A O     1 
ATOM   2003 C  CB    . ILE A 1 257 ? 4.131   37.318 -1.248  1.00 38.62  ? 281 ILE A CB    1 
ATOM   2004 C  CG1   . ILE A 1 257 ? 3.470   38.481 -1.961  1.00 37.66  ? 281 ILE A CG1   1 
ATOM   2005 C  CG2   . ILE A 1 257 ? 4.409   37.648 0.200   1.00 37.75  ? 281 ILE A CG2   1 
ATOM   2006 C  CD1   . ILE A 1 257 ? 2.123   38.810 -1.360  1.00 40.41  ? 281 ILE A CD1   1 
ATOM   2007 N  N     . GLN A 1 258 ? 5.440   37.258 -4.374  1.00 37.38  ? 282 GLN A N     1 
ATOM   2008 C  CA    . GLN A 1 258 ? 5.150   36.813 -5.720  1.00 37.80  ? 282 GLN A CA    1 
ATOM   2009 C  C     . GLN A 1 258 ? 6.202   35.793 -6.121  1.00 38.34  ? 282 GLN A C     1 
ATOM   2010 O  O     . GLN A 1 258 ? 5.919   34.878 -6.888  1.00 39.48  ? 282 GLN A O     1 
ATOM   2011 C  CB    . GLN A 1 258 ? 5.117   37.969 -6.714  1.00 39.11  ? 282 GLN A CB    1 
ATOM   2012 C  CG    . GLN A 1 258 ? 4.361   37.601 -7.983  1.00 42.42  ? 282 GLN A CG    1 
ATOM   2013 C  CD    . GLN A 1 258 ? 4.046   38.795 -8.872  1.00 46.33  ? 282 GLN A CD    1 
ATOM   2014 O  OE1   . GLN A 1 258 ? 4.934   39.346 -9.540  1.00 46.49  ? 282 GLN A OE1   1 
ATOM   2015 N  NE2   . GLN A 1 258 ? 2.772   39.205 -8.885  1.00 45.60  ? 282 GLN A NE2   1 
ATOM   2016 N  N     . LYS A 1 259 ? 7.423   35.940 -5.614  1.00 38.00  ? 283 LYS A N     1 
ATOM   2017 C  CA    . LYS A 1 259 ? 8.448   34.952 -5.933  1.00 37.44  ? 283 LYS A CA    1 
ATOM   2018 C  C     . LYS A 1 259 ? 7.997   33.683 -5.234  1.00 35.69  ? 283 LYS A C     1 
ATOM   2019 O  O     . LYS A 1 259 ? 8.122   32.583 -5.762  1.00 34.98  ? 283 LYS A O     1 
ATOM   2020 C  CB    . LYS A 1 259 ? 9.827   35.373 -5.410  1.00 39.39  ? 283 LYS A CB    1 
ATOM   2021 C  CG    . LYS A 1 259 ? 10.544  36.371 -6.298  1.00 43.55  ? 283 LYS A CG    1 
ATOM   2022 C  CD    . LYS A 1 259 ? 11.901  36.751 -5.744  1.00 45.84  ? 283 LYS A CD    1 
ATOM   2023 C  CE    . LYS A 1 259 ? 12.545  37.872 -6.551  1.00 47.38  ? 283 LYS A CE    1 
ATOM   2024 N  NZ    . LYS A 1 259 ? 13.871  38.244 -5.972  1.00 50.76  ? 283 LYS A NZ    1 
ATOM   2025 N  N     . LEU A 1 260 ? 7.450   33.853 -4.039  1.00 33.78  ? 284 LEU A N     1 
ATOM   2026 C  CA    . LEU A 1 260 ? 6.975   32.727 -3.272  1.00 33.31  ? 284 LEU A CA    1 
ATOM   2027 C  C     . LEU A 1 260 ? 5.931   31.927 -4.031  1.00 33.71  ? 284 LEU A C     1 
ATOM   2028 O  O     . LEU A 1 260 ? 6.013   30.705 -4.097  1.00 34.88  ? 284 LEU A O     1 
ATOM   2029 C  CB    . LEU A 1 260 ? 6.394   33.203 -1.942  1.00 32.48  ? 284 LEU A CB    1 
ATOM   2030 C  CG    . LEU A 1 260 ? 7.391   33.501 -0.821  1.00 30.52  ? 284 LEU A CG    1 
ATOM   2031 C  CD1   . LEU A 1 260 ? 6.657   34.016 0.399   1.00 28.97  ? 284 LEU A CD1   1 
ATOM   2032 C  CD2   . LEU A 1 260 ? 8.145   32.228 -0.475  1.00 29.00  ? 284 LEU A CD2   1 
ATOM   2033 N  N     . SER A 1 261 ? 4.960   32.610 -4.620  1.00 33.12  ? 285 SER A N     1 
ATOM   2034 C  CA    . SER A 1 261 ? 3.897   31.911 -5.332  1.00 33.01  ? 285 SER A CA    1 
ATOM   2035 C  C     . SER A 1 261 ? 4.440   30.990 -6.415  1.00 32.37  ? 285 SER A C     1 
ATOM   2036 O  O     . SER A 1 261 ? 3.712   30.156 -6.958  1.00 31.86  ? 285 SER A O     1 
ATOM   2037 C  CB    . SER A 1 261 ? 2.905   32.910 -5.945  1.00 33.70  ? 285 SER A CB    1 
ATOM   2038 O  OG    . SER A 1 261 ? 3.449   33.543 -7.086  1.00 33.83  ? 285 SER A OG    1 
ATOM   2039 N  N     . PHE A 1 262 ? 5.723   31.133 -6.716  1.00 30.95  ? 286 PHE A N     1 
ATOM   2040 C  CA    . PHE A 1 262 ? 6.349   30.310 -7.738  1.00 30.80  ? 286 PHE A CA    1 
ATOM   2041 C  C     . PHE A 1 262 ? 7.239   29.211 -7.181  1.00 31.38  ? 286 PHE A C     1 
ATOM   2042 O  O     . PHE A 1 262 ? 7.790   28.411 -7.937  1.00 31.41  ? 286 PHE A O     1 
ATOM   2043 C  CB    . PHE A 1 262 ? 7.198   31.173 -8.655  1.00 30.24  ? 286 PHE A CB    1 
ATOM   2044 C  CG    . PHE A 1 262 ? 6.410   32.047 -9.564  1.00 31.85  ? 286 PHE A CG    1 
ATOM   2045 C  CD1   . PHE A 1 262 ? 6.176   33.380 -9.241  1.00 32.66  ? 286 PHE A CD1   1 
ATOM   2046 C  CD2   . PHE A 1 262 ? 5.929   31.549 -10.773 1.00 31.32  ? 286 PHE A CD2   1 
ATOM   2047 C  CE1   . PHE A 1 262 ? 5.476   34.211 -10.118 1.00 33.13  ? 286 PHE A CE1   1 
ATOM   2048 C  CE2   . PHE A 1 262 ? 5.233   32.361 -11.651 1.00 29.71  ? 286 PHE A CE2   1 
ATOM   2049 C  CZ    . PHE A 1 262 ? 5.006   33.695 -11.327 1.00 31.72  ? 286 PHE A CZ    1 
ATOM   2050 N  N     . GLY A 1 263 ? 7.392   29.172 -5.865  1.00 31.93  ? 287 GLY A N     1 
ATOM   2051 C  CA    . GLY A 1 263 ? 8.263   28.178 -5.269  1.00 33.01  ? 287 GLY A CA    1 
ATOM   2052 C  C     . GLY A 1 263 ? 9.660   28.748 -5.081  1.00 33.81  ? 287 GLY A C     1 
ATOM   2053 O  O     . GLY A 1 263 ? 10.585  28.034 -4.721  1.00 32.97  ? 287 GLY A O     1 
ATOM   2054 N  N     . GLU A 1 264 ? 9.805   30.047 -5.330  1.00 36.53  ? 288 GLU A N     1 
ATOM   2055 C  CA    . GLU A 1 264 ? 11.089  30.742 -5.193  1.00 38.37  ? 288 GLU A CA    1 
ATOM   2056 C  C     . GLU A 1 264 ? 11.232  31.401 -3.829  1.00 37.02  ? 288 GLU A C     1 
ATOM   2057 O  O     . GLU A 1 264 ? 10.397  32.198 -3.414  1.00 36.98  ? 288 GLU A O     1 
ATOM   2058 C  CB    . GLU A 1 264 ? 11.235  31.832 -6.248  1.00 41.36  ? 288 GLU A CB    1 
ATOM   2059 C  CG    . GLU A 1 264 ? 11.406  31.358 -7.660  1.00 46.10  ? 288 GLU A CG    1 
ATOM   2060 C  CD    . GLU A 1 264 ? 11.435  32.529 -8.628  1.00 51.37  ? 288 GLU A CD    1 
ATOM   2061 O  OE1   . GLU A 1 264 ? 12.238  33.471 -8.391  1.00 52.90  ? 288 GLU A OE1   1 
ATOM   2062 O  OE2   . GLU A 1 264 ? 10.656  32.510 -9.616  1.00 52.41  ? 288 GLU A OE2   1 
ATOM   2063 N  N     . ASP A 1 265 ? 12.314  31.076 -3.143  1.00 35.43  ? 289 ASP A N     1 
ATOM   2064 C  CA    . ASP A 1 265 ? 12.570  31.634 -1.833  1.00 33.95  ? 289 ASP A CA    1 
ATOM   2065 C  C     . ASP A 1 265 ? 14.067  31.583 -1.669  1.00 32.97  ? 289 ASP A C     1 
ATOM   2066 O  O     . ASP A 1 265 ? 14.634  30.502 -1.521  1.00 32.75  ? 289 ASP A O     1 
ATOM   2067 C  CB    . ASP A 1 265 ? 11.873  30.794 -0.757  1.00 34.11  ? 289 ASP A CB    1 
ATOM   2068 C  CG    . ASP A 1 265 ? 12.477  30.990 0.623   1.00 36.03  ? 289 ASP A CG    1 
ATOM   2069 O  OD1   . ASP A 1 265 ? 12.680  32.167 1.019   1.00 33.79  ? 289 ASP A OD1   1 
ATOM   2070 O  OD2   . ASP A 1 265 ? 12.744  29.964 1.302   1.00 34.33  ? 289 ASP A OD2   1 
ATOM   2071 N  N     . ASN A 1 266 ? 14.716  32.745 -1.720  1.00 32.07  ? 290 ASN A N     1 
ATOM   2072 C  CA    . ASN A 1 266 ? 16.161  32.761 -1.580  1.00 32.15  ? 290 ASN A CA    1 
ATOM   2073 C  C     . ASN A 1 266 ? 16.640  32.970 -0.151  1.00 28.86  ? 290 ASN A C     1 
ATOM   2074 O  O     . ASN A 1 266 ? 17.838  32.911 0.115   1.00 27.29  ? 290 ASN A O     1 
ATOM   2075 C  CB    . ASN A 1 266 ? 16.809  33.794 -2.532  1.00 36.45  ? 290 ASN A CB    1 
ATOM   2076 C  CG    . ASN A 1 266 ? 16.317  35.228 -2.309  1.00 42.68  ? 290 ASN A CG    1 
ATOM   2077 O  OD1   . ASN A 1 266 ? 16.224  35.715 -1.175  1.00 44.38  ? 290 ASN A OD1   1 
ATOM   2078 N  ND2   . ASN A 1 266 ? 16.027  35.923 -3.410  1.00 47.13  ? 290 ASN A ND2   1 
ATOM   2079 N  N     . SER A 1 267 ? 15.712  33.165 0.780   1.00 26.96  ? 291 SER A N     1 
ATOM   2080 C  CA    . SER A 1 267 ? 16.109  33.394 2.164   1.00 25.62  ? 291 SER A CA    1 
ATOM   2081 C  C     . SER A 1 267 ? 17.025  32.296 2.705   1.00 25.95  ? 291 SER A C     1 
ATOM   2082 O  O     . SER A 1 267 ? 16.852  31.104 2.426   1.00 22.42  ? 291 SER A O     1 
ATOM   2083 C  CB    . SER A 1 267 ? 14.883  33.559 3.071   1.00 24.21  ? 291 SER A CB    1 
ATOM   2084 O  OG    . SER A 1 267 ? 14.361  32.325 3.507   1.00 25.02  ? 291 SER A OG    1 
ATOM   2085 N  N     . PRO A 1 268 ? 18.037  32.704 3.482   1.00 27.80  ? 292 PRO A N     1 
ATOM   2086 C  CA    . PRO A 1 268 ? 19.007  31.782 4.079   1.00 27.46  ? 292 PRO A CA    1 
ATOM   2087 C  C     . PRO A 1 268 ? 18.493  31.124 5.361   1.00 28.73  ? 292 PRO A C     1 
ATOM   2088 O  O     . PRO A 1 268 ? 17.455  31.518 5.926   1.00 28.58  ? 292 PRO A O     1 
ATOM   2089 C  CB    . PRO A 1 268 ? 20.197  32.691 4.354   1.00 26.53  ? 292 PRO A CB    1 
ATOM   2090 C  CG    . PRO A 1 268 ? 19.526  33.950 4.798   1.00 24.55  ? 292 PRO A CG    1 
ATOM   2091 C  CD    . PRO A 1 268 ? 18.409  34.107 3.768   1.00 26.14  ? 292 PRO A CD    1 
ATOM   2092 N  N     . VAL A 1 269 ? 19.220  30.105 5.801   1.00 27.58  ? 293 VAL A N     1 
ATOM   2093 C  CA    . VAL A 1 269 ? 18.872  29.420 7.020   1.00 27.38  ? 293 VAL A CA    1 
ATOM   2094 C  C     . VAL A 1 269 ? 19.666  30.205 8.021   1.00 27.92  ? 293 VAL A C     1 
ATOM   2095 O  O     . VAL A 1 269 ? 20.889  30.221 7.956   1.00 29.22  ? 293 VAL A O     1 
ATOM   2096 C  CB    . VAL A 1 269 ? 19.354  27.949 7.021   1.00 26.53  ? 293 VAL A CB    1 
ATOM   2097 C  CG1   . VAL A 1 269 ? 19.025  27.287 8.346   1.00 23.48  ? 293 VAL A CG1   1 
ATOM   2098 C  CG2   . VAL A 1 269 ? 18.694  27.194 5.892   1.00 27.38  ? 293 VAL A CG2   1 
ATOM   2099 N  N     . ILE A 1 270 ? 18.971  30.885 8.920   1.00 28.54  ? 294 ILE A N     1 
ATOM   2100 C  CA    . ILE A 1 270 ? 19.631  31.673 9.944   1.00 30.21  ? 294 ILE A CA    1 
ATOM   2101 C  C     . ILE A 1 270 ? 19.959  30.777 11.119  1.00 31.11  ? 294 ILE A C     1 
ATOM   2102 O  O     . ILE A 1 270 ? 19.131  29.965 11.524  1.00 32.65  ? 294 ILE A O     1 
ATOM   2103 C  CB    . ILE A 1 270 ? 18.728  32.789 10.493  1.00 31.44  ? 294 ILE A CB    1 
ATOM   2104 C  CG1   . ILE A 1 270 ? 18.229  33.692 9.360   1.00 29.77  ? 294 ILE A CG1   1 
ATOM   2105 C  CG2   . ILE A 1 270 ? 19.484  33.559 11.565  1.00 31.48  ? 294 ILE A CG2   1 
ATOM   2106 C  CD1   . ILE A 1 270 ? 19.301  34.145 8.422   1.00 32.27  ? 294 ILE A CD1   1 
ATOM   2107 N  N     . LEU A 1 271 ? 21.164  30.931 11.661  1.00 30.90  ? 295 LEU A N     1 
ATOM   2108 C  CA    . LEU A 1 271 ? 21.598  30.155 12.818  1.00 29.65  ? 295 LEU A CA    1 
ATOM   2109 C  C     . LEU A 1 271 ? 20.912  30.752 14.036  1.00 28.23  ? 295 LEU A C     1 
ATOM   2110 O  O     . LEU A 1 271 ? 21.263  31.837 14.474  1.00 30.51  ? 295 LEU A O     1 
ATOM   2111 C  CB    . LEU A 1 271 ? 23.123  30.247 12.978  1.00 30.48  ? 295 LEU A CB    1 
ATOM   2112 C  CG    . LEU A 1 271 ? 23.803  29.181 13.843  1.00 31.02  ? 295 LEU A CG    1 
ATOM   2113 C  CD1   . LEU A 1 271 ? 25.287  29.170 13.584  1.00 29.61  ? 295 LEU A CD1   1 
ATOM   2114 C  CD2   . LEU A 1 271 ? 23.511  29.438 15.292  1.00 32.75  ? 295 LEU A CD2   1 
ATOM   2115 N  N     . SER A 1 272 ? 19.926  30.050 14.575  1.00 27.83  ? 296 SER A N     1 
ATOM   2116 C  CA    . SER A 1 272 ? 19.181  30.538 15.744  1.00 27.12  ? 296 SER A CA    1 
ATOM   2117 C  C     . SER A 1 272 ? 20.011  30.850 16.984  1.00 25.73  ? 296 SER A C     1 
ATOM   2118 O  O     . SER A 1 272 ? 19.862  31.917 17.581  1.00 23.89  ? 296 SER A O     1 
ATOM   2119 C  CB    . SER A 1 272 ? 18.098  29.533 16.147  1.00 24.72  ? 296 SER A CB    1 
ATOM   2120 O  OG    . SER A 1 272 ? 16.930  29.729 15.387  1.00 26.24  ? 296 SER A OG    1 
ATOM   2121 N  N     . GLY A 1 273 ? 20.856  29.898 17.373  1.00 24.70  ? 297 GLY A N     1 
ATOM   2122 C  CA    . GLY A 1 273 ? 21.670  30.067 18.558  1.00 26.73  ? 297 GLY A CA    1 
ATOM   2123 C  C     . GLY A 1 273 ? 20.800  30.212 19.796  1.00 27.84  ? 297 GLY A C     1 
ATOM   2124 O  O     . GLY A 1 273 ? 19.696  29.662 19.841  1.00 26.29  ? 297 GLY A O     1 
ATOM   2125 N  N     . PRO A 1 274 ? 21.279  30.932 20.828  1.00 29.67  ? 298 PRO A N     1 
ATOM   2126 C  CA    . PRO A 1 274 ? 20.544  31.156 22.077  1.00 30.74  ? 298 PRO A CA    1 
ATOM   2127 C  C     . PRO A 1 274 ? 19.339  32.076 21.902  1.00 31.72  ? 298 PRO A C     1 
ATOM   2128 O  O     . PRO A 1 274 ? 19.332  32.961 21.054  1.00 31.24  ? 298 PRO A O     1 
ATOM   2129 C  CB    . PRO A 1 274 ? 21.599  31.771 22.988  1.00 29.44  ? 298 PRO A CB    1 
ATOM   2130 C  CG    . PRO A 1 274 ? 22.831  31.122 22.532  1.00 30.13  ? 298 PRO A CG    1 
ATOM   2131 C  CD    . PRO A 1 274 ? 22.699  31.255 21.028  1.00 30.29  ? 298 PRO A CD    1 
ATOM   2132 N  N     . PRO A 1 275 ? 18.310  31.887 22.731  1.00 33.02  ? 299 PRO A N     1 
ATOM   2133 C  CA    . PRO A 1 275 ? 17.117  32.723 22.628  1.00 33.66  ? 299 PRO A CA    1 
ATOM   2134 C  C     . PRO A 1 275 ? 17.459  34.210 22.649  1.00 36.02  ? 299 PRO A C     1 
ATOM   2135 O  O     . PRO A 1 275 ? 18.433  34.623 23.266  1.00 35.64  ? 299 PRO A O     1 
ATOM   2136 C  CB    . PRO A 1 275 ? 16.312  32.318 23.857  1.00 32.00  ? 299 PRO A CB    1 
ATOM   2137 C  CG    . PRO A 1 275 ? 16.782  30.937 24.150  1.00 31.62  ? 299 PRO A CG    1 
ATOM   2138 C  CD    . PRO A 1 275 ? 18.248  31.026 23.924  1.00 32.06  ? 299 PRO A CD    1 
ATOM   2139 N  N     . GLN A 1 276 ? 16.648  35.008 21.970  1.00 39.38  ? 300 GLN A N     1 
ATOM   2140 C  CA    . GLN A 1 276 ? 16.836  36.450 21.945  1.00 41.99  ? 300 GLN A CA    1 
ATOM   2141 C  C     . GLN A 1 276 ? 16.007  37.070 23.066  1.00 43.16  ? 300 GLN A C     1 
ATOM   2142 O  O     . GLN A 1 276 ? 16.124  38.263 23.339  1.00 43.86  ? 300 GLN A O     1 
ATOM   2143 C  CB    . GLN A 1 276 ? 16.385  37.031 20.600  1.00 44.60  ? 300 GLN A CB    1 
ATOM   2144 C  CG    . GLN A 1 276 ? 17.335  36.748 19.453  1.00 49.38  ? 300 GLN A CG    1 
ATOM   2145 C  CD    . GLN A 1 276 ? 18.760  37.175 19.775  1.00 53.10  ? 300 GLN A CD    1 
ATOM   2146 O  OE1   . GLN A 1 276 ? 19.029  38.351 20.023  1.00 55.55  ? 300 GLN A OE1   1 
ATOM   2147 N  NE2   . GLN A 1 276 ? 19.678  36.218 19.782  1.00 54.48  ? 300 GLN A NE2   1 
ATOM   2148 N  N     . SER A 1 277 ? 15.173  36.250 23.713  1.00 44.12  ? 301 SER A N     1 
ATOM   2149 C  CA    . SER A 1 277 ? 14.308  36.710 24.799  1.00 43.09  ? 301 SER A CA    1 
ATOM   2150 C  C     . SER A 1 277 ? 13.697  35.568 25.609  1.00 44.37  ? 301 SER A C     1 
ATOM   2151 O  O     . SER A 1 277 ? 13.563  34.442 25.120  1.00 44.98  ? 301 SER A O     1 
ATOM   2152 C  CB    . SER A 1 277 ? 13.175  37.554 24.227  1.00 41.66  ? 301 SER A CB    1 
ATOM   2153 O  OG    . SER A 1 277 ? 12.352  36.763 23.395  1.00 39.13  ? 301 SER A OG    1 
ATOM   2154 N  N     . PHE A 1 278 ? 13.314  35.877 26.847  1.00 44.85  ? 302 PHE A N     1 
ATOM   2155 C  CA    . PHE A 1 278 ? 12.691  34.906 27.752  1.00 44.90  ? 302 PHE A CA    1 
ATOM   2156 C  C     . PHE A 1 278 ? 11.419  35.543 28.297  1.00 46.44  ? 302 PHE A C     1 
ATOM   2157 O  O     . PHE A 1 278 ? 11.458  36.677 28.779  1.00 48.38  ? 302 PHE A O     1 
ATOM   2158 C  CB    . PHE A 1 278 ? 13.593  34.603 28.955  1.00 43.11  ? 302 PHE A CB    1 
ATOM   2159 C  CG    . PHE A 1 278 ? 14.985  34.197 28.595  1.00 42.33  ? 302 PHE A CG    1 
ATOM   2160 C  CD1   . PHE A 1 278 ? 15.812  35.046 27.867  1.00 42.88  ? 302 PHE A CD1   1 
ATOM   2161 C  CD2   . PHE A 1 278 ? 15.477  32.961 28.989  1.00 42.26  ? 302 PHE A CD2   1 
ATOM   2162 C  CE1   . PHE A 1 278 ? 17.109  34.663 27.534  1.00 42.31  ? 302 PHE A CE1   1 
ATOM   2163 C  CE2   . PHE A 1 278 ? 16.771  32.566 28.663  1.00 41.73  ? 302 PHE A CE2   1 
ATOM   2164 C  CZ    . PHE A 1 278 ? 17.589  33.417 27.936  1.00 42.39  ? 302 PHE A CZ    1 
ATOM   2165 N  N     . SER A 1 279 ? 10.297  34.834 28.245  1.00 46.64  ? 303 SER A N     1 
ATOM   2166 C  CA    . SER A 1 279 ? 9.068   35.396 28.790  1.00 47.03  ? 303 SER A CA    1 
ATOM   2167 C  C     . SER A 1 279 ? 8.082   34.350 29.269  1.00 49.27  ? 303 SER A C     1 
ATOM   2168 O  O     . SER A 1 279 ? 8.007   33.242 28.744  1.00 49.36  ? 303 SER A O     1 
ATOM   2169 C  CB    . SER A 1 279 ? 8.370   36.279 27.765  1.00 43.90  ? 303 SER A CB    1 
ATOM   2170 O  OG    . SER A 1 279 ? 7.514   35.508 26.957  1.00 43.95  ? 303 SER A OG    1 
ATOM   2171 N  N     . GLU A 1 280 ? 7.333   34.720 30.293  1.00 52.21  ? 304 GLU A N     1 
ATOM   2172 C  CA    . GLU A 1 280 ? 6.313   33.863 30.843  1.00 54.40  ? 304 GLU A CA    1 
ATOM   2173 C  C     . GLU A 1 280 ? 5.042   34.662 30.642  1.00 56.26  ? 304 GLU A C     1 
ATOM   2174 O  O     . GLU A 1 280 ? 5.078   35.883 30.527  1.00 56.16  ? 304 GLU A O     1 
ATOM   2175 C  CB    . GLU A 1 280 ? 6.585   33.589 32.314  1.00 55.04  ? 304 GLU A CB    1 
ATOM   2176 C  CG    . GLU A 1 280 ? 7.874   32.813 32.524  1.00 57.79  ? 304 GLU A CG    1 
ATOM   2177 C  CD    . GLU A 1 280 ? 7.649   31.372 32.945  1.00 58.34  ? 304 GLU A CD    1 
ATOM   2178 O  OE1   . GLU A 1 280 ? 8.624   30.585 32.914  1.00 59.17  ? 304 GLU A OE1   1 
ATOM   2179 O  OE2   . GLU A 1 280 ? 6.506   31.031 33.316  1.00 58.66  ? 304 GLU A OE2   1 
ATOM   2180 N  N     . GLU A 1 281 ? 3.921   33.964 30.588  1.00 58.86  ? 305 GLU A N     1 
ATOM   2181 C  CA    . GLU A 1 281 ? 2.640   34.593 30.341  1.00 59.96  ? 305 GLU A CA    1 
ATOM   2182 C  C     . GLU A 1 281 ? 1.604   33.970 31.264  1.00 62.50  ? 305 GLU A C     1 
ATOM   2183 O  O     . GLU A 1 281 ? 1.865   32.957 31.915  1.00 62.31  ? 305 GLU A O     1 
ATOM   2184 C  CB    . GLU A 1 281 ? 2.275   34.327 28.890  1.00 58.16  ? 305 GLU A CB    1 
ATOM   2185 C  CG    . GLU A 1 281 ? 1.621   35.445 28.161  1.00 56.62  ? 305 GLU A CG    1 
ATOM   2186 C  CD    . GLU A 1 281 ? 1.686   35.219 26.670  1.00 56.35  ? 305 GLU A CD    1 
ATOM   2187 O  OE1   . GLU A 1 281 ? 2.812   35.162 26.138  1.00 56.16  ? 305 GLU A OE1   1 
ATOM   2188 O  OE2   . GLU A 1 281 ? 0.626   35.085 26.030  1.00 56.60  ? 305 GLU A OE2   1 
ATOM   2189 N  N     . ASP A 1 282 ? 0.429   34.578 31.329  1.00 65.53  ? 306 ASP A N     1 
ATOM   2190 C  CA    . ASP A 1 282 ? -0.632  34.043 32.163  1.00 68.80  ? 306 ASP A CA    1 
ATOM   2191 C  C     . ASP A 1 282 ? -1.957  34.678 31.839  1.00 70.27  ? 306 ASP A C     1 
ATOM   2192 O  O     . ASP A 1 282 ? -2.132  35.886 31.962  1.00 70.86  ? 306 ASP A O     1 
ATOM   2193 C  CB    . ASP A 1 282 ? -0.327  34.231 33.651  1.00 69.91  ? 306 ASP A CB    1 
ATOM   2194 C  CG    . ASP A 1 282 ? -1.459  33.735 34.542  1.00 71.80  ? 306 ASP A CG    1 
ATOM   2195 O  OD1   . ASP A 1 282 ? -2.199  32.820 34.105  1.00 71.26  ? 306 ASP A OD1   1 
ATOM   2196 O  OD2   . ASP A 1 282 ? -1.600  34.252 35.676  1.00 72.50  ? 306 ASP A OD2   1 
ATOM   2197 N  N     . SER A 1 283 ? -2.886  33.842 31.410  1.00 72.74  ? 307 SER A N     1 
ATOM   2198 C  CA    . SER A 1 283 ? -4.213  34.298 31.069  1.00 75.63  ? 307 SER A CA    1 
ATOM   2199 C  C     . SER A 1 283 ? -5.126  33.859 32.206  1.00 78.28  ? 307 SER A C     1 
ATOM   2200 O  O     . SER A 1 283 ? -4.928  32.800 32.803  1.00 78.60  ? 307 SER A O     1 
ATOM   2201 C  CB    . SER A 1 283 ? -4.656  33.662 29.745  1.00 74.53  ? 307 SER A CB    1 
ATOM   2202 O  OG    . SER A 1 283 ? -5.886  34.201 29.298  1.00 74.17  ? 307 SER A OG    1 
ATOM   2203 N  N     . PHE A 1 284 ? -6.102  34.693 32.537  1.00 81.11  ? 308 PHE A N     1 
ATOM   2204 C  CA    . PHE A 1 284 ? -7.045  34.347 33.585  1.00 83.79  ? 308 PHE A CA    1 
ATOM   2205 C  C     . PHE A 1 284 ? -8.359  35.090 33.442  1.00 85.66  ? 308 PHE A C     1 
ATOM   2206 O  O     . PHE A 1 284 ? -8.393  36.262 33.072  1.00 85.68  ? 308 PHE A O     1 
ATOM   2207 C  CB    . PHE A 1 284 ? -6.444  34.568 34.986  1.00 83.76  ? 308 PHE A CB    1 
ATOM   2208 C  CG    . PHE A 1 284 ? -5.602  35.805 35.117  1.00 83.52  ? 308 PHE A CG    1 
ATOM   2209 C  CD1   . PHE A 1 284 ? -6.127  37.061 34.842  1.00 83.49  ? 308 PHE A CD1   1 
ATOM   2210 C  CD2   . PHE A 1 284 ? -4.285  35.710 35.552  1.00 83.16  ? 308 PHE A CD2   1 
ATOM   2211 C  CE1   . PHE A 1 284 ? -5.350  38.206 34.998  1.00 84.03  ? 308 PHE A CE1   1 
ATOM   2212 C  CE2   . PHE A 1 284 ? -3.502  36.845 35.711  1.00 83.63  ? 308 PHE A CE2   1 
ATOM   2213 C  CZ    . PHE A 1 284 ? -4.036  38.098 35.435  1.00 83.65  ? 308 PHE A CZ    1 
ATOM   2214 N  N     . LYS A 1 285 ? -9.436  34.362 33.712  1.00 88.09  ? 309 LYS A N     1 
ATOM   2215 C  CA    . LYS A 1 285 ? -10.806 34.854 33.641  1.00 90.34  ? 309 LYS A CA    1 
ATOM   2216 C  C     . LYS A 1 285 ? -10.950 36.269 34.180  1.00 91.96  ? 309 LYS A C     1 
ATOM   2217 O  O     . LYS A 1 285 ? -11.341 36.452 35.330  1.00 92.44  ? 309 LYS A O     1 
ATOM   2218 C  CB    . LYS A 1 285 ? -11.718 33.904 34.425  1.00 90.10  ? 309 LYS A CB    1 
ATOM   2219 C  CG    . LYS A 1 285 ? -10.969 33.055 35.450  1.00 90.28  ? 309 LYS A CG    1 
ATOM   2220 C  CD    . LYS A 1 285 ? -10.169 31.939 34.771  1.00 90.74  ? 309 LYS A CD    1 
ATOM   2221 C  CE    . LYS A 1 285 ? -8.953  31.527 35.592  1.00 90.32  ? 309 LYS A CE    1 
ATOM   2222 N  NZ    . LYS A 1 285 ? -9.309  31.107 36.975  1.00 89.80  ? 309 LYS A NZ    1 
ATOM   2223 N  N     . LYS A 1 286 ? -10.639 37.256 33.339  1.00 94.37  ? 310 LYS A N     1 
ATOM   2224 C  CA    . LYS A 1 286 ? -10.716 38.678 33.694  1.00 96.42  ? 310 LYS A CA    1 
ATOM   2225 C  C     . LYS A 1 286 ? -10.635 38.856 35.208  1.00 97.36  ? 310 LYS A C     1 
ATOM   2226 O  O     . LYS A 1 286 ? -11.449 39.560 35.808  1.00 97.61  ? 310 LYS A O     1 
ATOM   2227 C  CB    . LYS A 1 286 ? -12.022 39.271 33.152  1.00 96.84  ? 310 LYS A CB    1 
ATOM   2228 C  CG    . LYS A 1 286 ? -12.202 39.047 31.655  1.00 97.35  ? 310 LYS A CG    1 
ATOM   2229 C  CD    . LYS A 1 286 ? -13.649 39.210 31.218  1.00 98.23  ? 310 LYS A CD    1 
ATOM   2230 C  CE    . LYS A 1 286 ? -13.843 38.740 29.779  1.00 98.42  ? 310 LYS A CE    1 
ATOM   2231 N  NZ    . LYS A 1 286 ? -15.274 38.761 29.359  1.00 98.80  ? 310 LYS A NZ    1 
ATOM   2232 N  N     . CYS A 1 287 ? -9.630  38.220 35.807  1.00 98.62  ? 311 CYS A N     1 
ATOM   2233 C  CA    . CYS A 1 287 ? -9.440  38.240 37.252  1.00 100.17 ? 311 CYS A CA    1 
ATOM   2234 C  C     . CYS A 1 287 ? -8.240  39.043 37.759  1.00 100.05 ? 311 CYS A C     1 
ATOM   2235 O  O     . CYS A 1 287 ? -7.267  38.476 38.259  1.00 99.89  ? 311 CYS A O     1 
ATOM   2236 C  CB    . CYS A 1 287 ? -9.347  36.792 37.762  1.00 101.73 ? 311 CYS A CB    1 
ATOM   2237 S  SG    . CYS A 1 287 ? -9.352  36.580 39.570  1.00 105.25 ? 311 CYS A SG    1 
ATOM   2238 N  N     . SER A 1 288 ? -8.314  40.362 37.630  1.00 100.37 ? 312 SER A N     1 
ATOM   2239 C  CA    . SER A 1 288 ? -7.257  41.242 38.116  1.00 101.10 ? 312 SER A CA    1 
ATOM   2240 C  C     . SER A 1 288 ? -7.897  42.591 38.448  1.00 101.77 ? 312 SER A C     1 
ATOM   2241 O  O     . SER A 1 288 ? -8.457  43.260 37.575  1.00 102.31 ? 312 SER A O     1 
ATOM   2242 C  CB    . SER A 1 288 ? -6.154  41.408 37.071  1.00 100.65 ? 312 SER A CB    1 
ATOM   2243 O  OG    . SER A 1 288 ? -4.966  41.882 37.683  1.00 100.03 ? 312 SER A OG    1 
ATOM   2244 N  N     . SER A 1 289 ? -7.813  42.971 39.722  1.00 102.22 ? 313 SER A N     1 
ATOM   2245 C  CA    . SER A 1 289 ? -8.404  44.208 40.238  1.00 102.10 ? 313 SER A CA    1 
ATOM   2246 C  C     . SER A 1 289 ? -7.702  45.501 39.839  1.00 101.80 ? 313 SER A C     1 
ATOM   2247 O  O     . SER A 1 289 ? -8.138  46.589 40.224  1.00 101.62 ? 313 SER A O     1 
ATOM   2248 C  CB    . SER A 1 289 ? -8.459  44.144 41.766  1.00 102.36 ? 313 SER A CB    1 
ATOM   2249 O  OG    . SER A 1 289 ? -7.151  44.095 42.311  1.00 102.41 ? 313 SER A OG    1 
ATOM   2250 N  N     . GLU A 1 290 ? -6.629  45.374 39.065  1.00 101.09 ? 314 GLU A N     1 
ATOM   2251 C  CA    . GLU A 1 290 ? -5.825  46.509 38.624  1.00 100.11 ? 314 GLU A CA    1 
ATOM   2252 C  C     . GLU A 1 290 ? -4.742  46.754 39.673  1.00 100.48 ? 314 GLU A C     1 
ATOM   2253 O  O     . GLU A 1 290 ? -3.900  47.636 39.514  1.00 100.90 ? 314 GLU A O     1 
ATOM   2254 C  CB    . GLU A 1 290 ? -6.672  47.781 38.450  1.00 98.84  ? 314 GLU A CB    1 
ATOM   2255 C  CG    . GLU A 1 290 ? -7.151  48.056 37.029  1.00 97.32  ? 314 GLU A CG    1 
ATOM   2256 C  CD    . GLU A 1 290 ? -8.416  47.303 36.655  1.00 97.09  ? 314 GLU A CD    1 
ATOM   2257 O  OE1   . GLU A 1 290 ? -8.854  47.431 35.493  1.00 97.28  ? 314 GLU A OE1   1 
ATOM   2258 O  OE2   . GLU A 1 290 ? -8.979  46.591 37.511  1.00 96.31  ? 314 GLU A OE2   1 
ATOM   2259 N  N     . VAL A 1 291 ? -4.772  45.967 40.745  1.00 100.17 ? 315 VAL A N     1 
ATOM   2260 C  CA    . VAL A 1 291 ? -3.789  46.092 41.817  1.00 100.02 ? 315 VAL A CA    1 
ATOM   2261 C  C     . VAL A 1 291 ? -3.836  44.864 42.710  1.00 99.81  ? 315 VAL A C     1 
ATOM   2262 O  O     . VAL A 1 291 ? -4.804  44.104 42.675  1.00 99.38  ? 315 VAL A O     1 
ATOM   2263 C  CB    . VAL A 1 291 ? -4.055  47.349 42.637  1.00 100.83 ? 315 VAL A CB    1 
ATOM   2264 N  N     . GLU A 1 292 ? -2.788  44.680 43.511  1.00 99.55  ? 316 GLU A N     1 
ATOM   2265 C  CA    . GLU A 1 292 ? -2.677  43.532 44.410  1.00 99.55  ? 316 GLU A CA    1 
ATOM   2266 C  C     . GLU A 1 292 ? -2.529  42.263 43.569  1.00 99.50  ? 316 GLU A C     1 
ATOM   2267 O  O     . GLU A 1 292 ? -1.867  41.299 43.972  1.00 99.08  ? 316 GLU A O     1 
ATOM   2268 C  CB    . GLU A 1 292 ? -3.911  43.438 45.306  1.00 99.59  ? 316 GLU A CB    1 
ATOM   2269 N  N     . ALA A 1 293 ? -3.149  42.289 42.390  1.00 99.59  ? 317 ALA A N     1 
ATOM   2270 C  CA    . ALA A 1 293 ? -3.114  41.186 41.439  1.00 99.04  ? 317 ALA A CA    1 
ATOM   2271 C  C     . ALA A 1 293 ? -1.757  41.175 40.747  1.00 98.63  ? 317 ALA A C     1 
ATOM   2272 O  O     . ALA A 1 293 ? -1.617  40.681 39.630  1.00 98.99  ? 317 ALA A O     1 
ATOM   2273 C  CB    . ALA A 1 293 ? -4.229  41.350 40.409  1.00 98.49  ? 317 ALA A CB    1 
ATOM   2274 N  N     . LYS A 1 294 ? -0.764  41.747 41.419  1.00 98.13  ? 318 LYS A N     1 
ATOM   2275 C  CA    . LYS A 1 294 ? 0.589   41.794 40.900  1.00 97.71  ? 318 LYS A CA    1 
ATOM   2276 C  C     . LYS A 1 294 ? 1.405   40.769 41.661  1.00 97.42  ? 318 LYS A C     1 
ATOM   2277 O  O     . LYS A 1 294 ? 2.631   40.727 41.576  1.00 97.15  ? 318 LYS A O     1 
ATOM   2278 C  CB    . LYS A 1 294 ? 1.187   43.189 41.071  1.00 98.90  ? 318 LYS A CB    1 
ATOM   2279 C  CG    . LYS A 1 294 ? 0.994   43.821 42.444  1.00 100.43 ? 318 LYS A CG    1 
ATOM   2280 C  CD    . LYS A 1 294 ? 0.191   45.121 42.309  1.00 101.71 ? 318 LYS A CD    1 
ATOM   2281 C  CE    . LYS A 1 294 ? 0.407   46.071 43.487  1.00 101.86 ? 318 LYS A CE    1 
ATOM   2282 N  NZ    . LYS A 1 294 ? -0.241  47.402 43.268  1.00 101.22 ? 318 LYS A NZ    1 
ATOM   2283 N  N     . ASN A 1 295 ? 0.705   39.951 42.433  1.00 97.07  ? 319 ASN A N     1 
ATOM   2284 C  CA    . ASN A 1 295 ? 1.359   38.892 43.170  1.00 96.33  ? 319 ASN A CA    1 
ATOM   2285 C  C     . ASN A 1 295 ? 1.599   37.861 42.067  1.00 95.43  ? 319 ASN A C     1 
ATOM   2286 O  O     . ASN A 1 295 ? 2.480   37.006 42.165  1.00 95.24  ? 319 ASN A O     1 
ATOM   2287 C  CB    . ASN A 1 295 ? 0.419   38.343 44.246  1.00 96.67  ? 319 ASN A CB    1 
ATOM   2288 C  CG    . ASN A 1 295 ? 1.125   37.420 45.219  1.00 97.53  ? 319 ASN A CG    1 
ATOM   2289 O  OD1   . ASN A 1 295 ? 2.124   37.797 45.832  1.00 97.84  ? 319 ASN A OD1   1 
ATOM   2290 N  ND2   . ASN A 1 295 ? 0.605   36.205 45.372  1.00 97.81  ? 319 ASN A ND2   1 
ATOM   2291 N  N     . LYS A 1 296 ? 0.797   37.980 41.008  1.00 94.00  ? 320 LYS A N     1 
ATOM   2292 C  CA    . LYS A 1 296 ? 0.878   37.110 39.837  1.00 92.57  ? 320 LYS A CA    1 
ATOM   2293 C  C     . LYS A 1 296 ? 2.190   37.428 39.134  1.00 91.81  ? 320 LYS A C     1 
ATOM   2294 O  O     . LYS A 1 296 ? 2.923   36.537 38.695  1.00 91.06  ? 320 LYS A O     1 
ATOM   2295 C  CB    . LYS A 1 296 ? -0.279  37.403 38.870  1.00 92.16  ? 320 LYS A CB    1 
ATOM   2296 C  CG    . LYS A 1 296 ? -1.676  37.158 39.416  1.00 91.23  ? 320 LYS A CG    1 
ATOM   2297 C  CD    . LYS A 1 296 ? -1.900  35.690 39.737  1.00 90.97  ? 320 LYS A CD    1 
ATOM   2298 C  CE    . LYS A 1 296 ? -3.370  35.402 39.993  1.00 90.34  ? 320 LYS A CE    1 
ATOM   2299 N  NZ    . LYS A 1 296 ? -4.188  35.667 38.775  1.00 90.48  ? 320 LYS A NZ    1 
ATOM   2300 N  N     . ILE A 1 297 ? 2.460   38.724 39.024  1.00 91.02  ? 321 ILE A N     1 
ATOM   2301 C  CA    . ILE A 1 297 ? 3.667   39.216 38.386  1.00 89.75  ? 321 ILE A CA    1 
ATOM   2302 C  C     . ILE A 1 297 ? 4.875   38.699 39.154  1.00 89.60  ? 321 ILE A C     1 
ATOM   2303 O  O     . ILE A 1 297 ? 5.898   38.357 38.567  1.00 89.67  ? 321 ILE A O     1 
ATOM   2304 C  CB    . ILE A 1 297 ? 3.658   40.768 38.335  1.00 88.61  ? 321 ILE A CB    1 
ATOM   2305 C  CG1   . ILE A 1 297 ? 2.558   41.232 37.368  1.00 87.15  ? 321 ILE A CG1   1 
ATOM   2306 C  CG2   . ILE A 1 297 ? 5.022   41.296 37.923  1.00 88.68  ? 321 ILE A CG2   1 
ATOM   2307 C  CD1   . ILE A 1 297 ? 2.541   42.711 37.096  1.00 86.35  ? 321 ILE A CD1   1 
ATOM   2308 N  N     . GLU A 1 298 ? 4.748   38.621 40.472  1.00 89.42  ? 322 GLU A N     1 
ATOM   2309 C  CA    . GLU A 1 298 ? 5.841   38.116 41.286  1.00 89.32  ? 322 GLU A CA    1 
ATOM   2310 C  C     . GLU A 1 298 ? 6.088   36.671 40.867  1.00 88.51  ? 322 GLU A C     1 
ATOM   2311 O  O     . GLU A 1 298 ? 7.226   36.201 40.848  1.00 88.24  ? 322 GLU A O     1 
ATOM   2312 C  CB    . GLU A 1 298 ? 5.474   38.177 42.769  1.00 90.64  ? 322 GLU A CB    1 
ATOM   2313 C  CG    . GLU A 1 298 ? 4.994   39.542 43.226  1.00 91.98  ? 322 GLU A CG    1 
ATOM   2314 C  CD    . GLU A 1 298 ? 5.095   39.723 44.726  1.00 93.28  ? 322 GLU A CD    1 
ATOM   2315 O  OE1   . GLU A 1 298 ? 4.693   40.802 45.215  1.00 94.34  ? 322 GLU A OE1   1 
ATOM   2316 O  OE2   . GLU A 1 298 ? 5.578   38.794 45.415  1.00 93.11  ? 322 GLU A OE2   1 
ATOM   2317 N  N     . GLU A 1 299 ? 5.005   35.978 40.525  1.00 87.63  ? 323 GLU A N     1 
ATOM   2318 C  CA    . GLU A 1 299 ? 5.070   34.586 40.092  1.00 86.59  ? 323 GLU A CA    1 
ATOM   2319 C  C     . GLU A 1 299 ? 5.918   34.449 38.841  1.00 84.85  ? 323 GLU A C     1 
ATOM   2320 O  O     . GLU A 1 299 ? 6.859   33.657 38.793  1.00 83.73  ? 323 GLU A O     1 
ATOM   2321 C  CB    . GLU A 1 299 ? 3.676   34.057 39.769  1.00 88.50  ? 323 GLU A CB    1 
ATOM   2322 C  CG    . GLU A 1 299 ? 3.062   33.154 40.808  1.00 90.55  ? 323 GLU A CG    1 
ATOM   2323 C  CD    . GLU A 1 299 ? 2.124   32.145 40.173  1.00 92.58  ? 323 GLU A CD    1 
ATOM   2324 O  OE1   . GLU A 1 299 ? 1.334   32.545 39.284  1.00 92.75  ? 323 GLU A OE1   1 
ATOM   2325 O  OE2   . GLU A 1 299 ? 2.180   30.955 40.560  1.00 93.66  ? 323 GLU A OE2   1 
ATOM   2326 N  N     . LEU A 1 300 ? 5.556   35.217 37.819  1.00 82.95  ? 324 LEU A N     1 
ATOM   2327 C  CA    . LEU A 1 300 ? 6.268   35.182 36.555  1.00 81.49  ? 324 LEU A CA    1 
ATOM   2328 C  C     . LEU A 1 300 ? 7.768   35.340 36.793  1.00 81.39  ? 324 LEU A C     1 
ATOM   2329 O  O     . LEU A 1 300 ? 8.563   34.495 36.377  1.00 80.73  ? 324 LEU A O     1 
ATOM   2330 C  CB    . LEU A 1 300 ? 5.738   36.286 35.634  1.00 79.98  ? 324 LEU A CB    1 
ATOM   2331 C  CG    . LEU A 1 300 ? 4.228   36.247 35.361  1.00 78.83  ? 324 LEU A CG    1 
ATOM   2332 C  CD1   . LEU A 1 300 ? 3.821   37.414 34.482  1.00 78.48  ? 324 LEU A CD1   1 
ATOM   2333 C  CD2   . LEU A 1 300 ? 3.863   34.945 34.686  1.00 78.05  ? 324 LEU A CD2   1 
ATOM   2334 N  N     . LEU A 1 301 ? 8.148   36.411 37.482  1.00 81.50  ? 325 LEU A N     1 
ATOM   2335 C  CA    . LEU A 1 301 ? 9.553   36.675 37.779  1.00 81.71  ? 325 LEU A CA    1 
ATOM   2336 C  C     . LEU A 1 301 ? 10.222  35.470 38.422  1.00 81.71  ? 325 LEU A C     1 
ATOM   2337 O  O     . LEU A 1 301 ? 11.371  35.153 38.122  1.00 81.32  ? 325 LEU A O     1 
ATOM   2338 C  CB    . LEU A 1 301 ? 9.682   37.888 38.701  1.00 82.63  ? 325 LEU A CB    1 
ATOM   2339 C  CG    . LEU A 1 301 ? 9.473   39.269 38.068  1.00 83.26  ? 325 LEU A CG    1 
ATOM   2340 C  CD1   . LEU A 1 301 ? 8.203   39.284 37.245  1.00 82.50  ? 325 LEU A CD1   1 
ATOM   2341 C  CD2   . LEU A 1 301 ? 9.420   40.325 39.159  1.00 82.80  ? 325 LEU A CD2   1 
ATOM   2342 N  N     . ALA A 1 302 ? 9.501   34.802 39.312  1.00 81.91  ? 326 ALA A N     1 
ATOM   2343 C  CA    . ALA A 1 302 ? 10.041  33.628 39.981  1.00 82.60  ? 326 ALA A CA    1 
ATOM   2344 C  C     . ALA A 1 302 ? 10.708  32.705 38.961  1.00 82.95  ? 326 ALA A C     1 
ATOM   2345 O  O     . ALA A 1 302 ? 11.927  32.512 38.986  1.00 83.05  ? 326 ALA A O     1 
ATOM   2346 C  CB    . ALA A 1 302 ? 8.927   32.888 40.702  1.00 83.42  ? 326 ALA A CB    1 
ATOM   2347 N  N     . SER A 1 303 ? 9.902   32.147 38.061  1.00 82.62  ? 327 SER A N     1 
ATOM   2348 C  CA    . SER A 1 303 ? 10.405  31.245 37.030  1.00 82.34  ? 327 SER A CA    1 
ATOM   2349 C  C     . SER A 1 303 ? 11.393  31.947 36.108  1.00 82.12  ? 327 SER A C     1 
ATOM   2350 O  O     . SER A 1 303 ? 12.519  31.483 35.925  1.00 82.01  ? 327 SER A O     1 
ATOM   2351 C  CB    . SER A 1 303 ? 9.250   30.688 36.192  1.00 82.13  ? 327 SER A CB    1 
ATOM   2352 O  OG    . SER A 1 303 ? 8.360   29.924 36.983  1.00 82.39  ? 327 SER A OG    1 
ATOM   2353 N  N     . LEU A 1 304 ? 10.963  33.062 35.524  1.00 81.15  ? 328 LEU A N     1 
ATOM   2354 C  CA    . LEU A 1 304 ? 11.817  33.812 34.618  1.00 80.99  ? 328 LEU A CA    1 
ATOM   2355 C  C     . LEU A 1 304 ? 13.222  33.974 35.177  1.00 81.81  ? 328 LEU A C     1 
ATOM   2356 O  O     . LEU A 1 304 ? 14.200  33.701 34.484  1.00 82.88  ? 328 LEU A O     1 
ATOM   2357 C  CB    . LEU A 1 304 ? 11.210  35.185 34.319  1.00 79.78  ? 328 LEU A CB    1 
ATOM   2358 C  CG    . LEU A 1 304 ? 10.061  35.199 33.304  1.00 78.96  ? 328 LEU A CG    1 
ATOM   2359 C  CD1   . LEU A 1 304 ? 9.480   36.594 33.200  1.00 78.09  ? 328 LEU A CD1   1 
ATOM   2360 C  CD2   . LEU A 1 304 ? 10.568  34.733 31.942  1.00 78.13  ? 328 LEU A CD2   1 
ATOM   2361 N  N     . LEU A 1 305 ? 13.329  34.406 36.430  1.00 82.30  ? 329 LEU A N     1 
ATOM   2362 C  CA    . LEU A 1 305 ? 14.637  34.585 37.049  1.00 82.19  ? 329 LEU A CA    1 
ATOM   2363 C  C     . LEU A 1 305 ? 15.439  33.292 37.035  1.00 81.65  ? 329 LEU A C     1 
ATOM   2364 O  O     . LEU A 1 305 ? 16.655  33.305 36.847  1.00 79.91  ? 329 LEU A O     1 
ATOM   2365 C  CB    . LEU A 1 305 ? 14.486  35.087 38.485  1.00 83.53  ? 329 LEU A CB    1 
ATOM   2366 C  CG    . LEU A 1 305 ? 14.448  36.611 38.646  1.00 84.85  ? 329 LEU A CG    1 
ATOM   2367 C  CD1   . LEU A 1 305 ? 13.252  37.203 37.910  1.00 85.89  ? 329 LEU A CD1   1 
ATOM   2368 C  CD2   . LEU A 1 305 ? 14.384  36.950 40.123  1.00 85.90  ? 329 LEU A CD2   1 
ATOM   2369 N  N     . ASN A 1 306 ? 14.748  32.175 37.231  1.00 82.30  ? 330 ASN A N     1 
ATOM   2370 C  CA    . ASN A 1 306 ? 15.395  30.868 37.233  1.00 82.97  ? 330 ASN A CA    1 
ATOM   2371 C  C     . ASN A 1 306 ? 15.841  30.505 35.813  1.00 82.29  ? 330 ASN A C     1 
ATOM   2372 O  O     . ASN A 1 306 ? 16.819  29.779 35.618  1.00 81.68  ? 330 ASN A O     1 
ATOM   2373 C  CB    . ASN A 1 306 ? 14.427  29.807 37.765  1.00 85.19  ? 330 ASN A CB    1 
ATOM   2374 C  CG    . ASN A 1 306 ? 15.115  28.488 38.076  1.00 87.10  ? 330 ASN A CG    1 
ATOM   2375 O  OD1   . ASN A 1 306 ? 15.746  27.879 37.210  1.00 88.86  ? 330 ASN A OD1   1 
ATOM   2376 N  ND2   . ASN A 1 306 ? 14.993  28.039 39.320  1.00 87.62  ? 330 ASN A ND2   1 
ATOM   2377 N  N     . ARG A 1 307 ? 15.115  31.018 34.824  1.00 81.60  ? 331 ARG A N     1 
ATOM   2378 C  CA    . ARG A 1 307 ? 15.432  30.758 33.425  1.00 81.01  ? 331 ARG A CA    1 
ATOM   2379 C  C     . ARG A 1 307 ? 16.557  31.671 32.940  1.00 81.54  ? 331 ARG A C     1 
ATOM   2380 O  O     . ARG A 1 307 ? 17.606  31.195 32.503  1.00 80.50  ? 331 ARG A O     1 
ATOM   2381 C  CB    . ARG A 1 307 ? 14.184  30.954 32.552  1.00 79.30  ? 331 ARG A CB    1 
ATOM   2382 C  CG    . ARG A 1 307 ? 13.035  30.016 32.902  1.00 76.49  ? 331 ARG A CG    1 
ATOM   2383 C  CD    . ARG A 1 307 ? 12.264  29.585 31.662  1.00 73.53  ? 331 ARG A CD    1 
ATOM   2384 N  NE    . ARG A 1 307 ? 11.330  30.594 31.177  1.00 69.88  ? 331 ARG A NE    1 
ATOM   2385 C  CZ    . ARG A 1 307 ? 11.218  30.940 29.901  1.00 68.29  ? 331 ARG A CZ    1 
ATOM   2386 N  NH1   . ARG A 1 307 ? 11.988  30.363 28.992  1.00 67.30  ? 331 ARG A NH1   1 
ATOM   2387 N  NH2   . ARG A 1 307 ? 10.330  31.853 29.531  1.00 68.63  ? 331 ARG A NH2   1 
ATOM   2388 N  N     . VAL A 1 308 ? 16.327  32.979 33.022  1.00 82.75  ? 332 VAL A N     1 
ATOM   2389 C  CA    . VAL A 1 308 ? 17.306  33.977 32.605  1.00 84.13  ? 332 VAL A CA    1 
ATOM   2390 C  C     . VAL A 1 308 ? 18.665  33.676 33.223  1.00 85.44  ? 332 VAL A C     1 
ATOM   2391 O  O     . VAL A 1 308 ? 19.709  33.962 32.633  1.00 86.22  ? 332 VAL A O     1 
ATOM   2392 C  CB    . VAL A 1 308 ? 16.869  35.385 33.037  1.00 84.28  ? 332 VAL A CB    1 
ATOM   2393 C  CG1   . VAL A 1 308 ? 17.996  36.362 32.811  1.00 85.19  ? 332 VAL A CG1   1 
ATOM   2394 C  CG2   . VAL A 1 308 ? 15.633  35.815 32.253  1.00 84.67  ? 332 VAL A CG2   1 
ATOM   2395 N  N     . CYS A 1 309 ? 18.635  33.107 34.425  1.00 86.83  ? 333 CYS A N     1 
ATOM   2396 C  CA    . CYS A 1 309 ? 19.842  32.722 35.152  1.00 87.44  ? 333 CYS A CA    1 
ATOM   2397 C  C     . CYS A 1 309 ? 20.504  31.578 34.385  1.00 87.31  ? 333 CYS A C     1 
ATOM   2398 O  O     . CYS A 1 309 ? 21.428  31.799 33.601  1.00 86.33  ? 333 CYS A O     1 
ATOM   2399 C  CB    . CYS A 1 309 ? 19.463  32.262 36.570  1.00 88.17  ? 333 CYS A CB    1 
ATOM   2400 S  SG    . CYS A 1 309 ? 20.770  31.437 37.531  1.00 90.18  ? 333 CYS A SG    1 
ATOM   2401 N  N     . GLN A 1 310 ? 20.002  30.366 34.622  1.00 88.04  ? 334 GLN A N     1 
ATOM   2402 C  CA    . GLN A 1 310 ? 20.479  29.139 33.981  1.00 88.35  ? 334 GLN A CA    1 
ATOM   2403 C  C     . GLN A 1 310 ? 21.243  29.404 32.686  1.00 88.17  ? 334 GLN A C     1 
ATOM   2404 O  O     . GLN A 1 310 ? 22.376  28.946 32.512  1.00 87.90  ? 334 GLN A O     1 
ATOM   2405 C  CB    . GLN A 1 310 ? 19.285  28.221 33.682  1.00 89.14  ? 334 GLN A CB    1 
ATOM   2406 C  CG    . GLN A 1 310 ? 18.658  27.566 34.902  1.00 89.29  ? 334 GLN A CG    1 
ATOM   2407 C  CD    . GLN A 1 310 ? 19.354  26.273 35.284  1.00 90.02  ? 334 GLN A CD    1 
ATOM   2408 O  OE1   . GLN A 1 310 ? 19.084  25.694 36.339  1.00 90.38  ? 334 GLN A OE1   1 
ATOM   2409 N  NE2   . GLN A 1 310 ? 20.250  25.806 34.418  1.00 89.02  ? 334 GLN A NE2   1 
ATOM   2410 N  N     . ASP A 1 311 ? 20.602  30.144 31.785  1.00 87.88  ? 335 ASP A N     1 
ATOM   2411 C  CA    . ASP A 1 311 ? 21.176  30.490 30.489  1.00 87.57  ? 335 ASP A CA    1 
ATOM   2412 C  C     . ASP A 1 311 ? 22.644  30.881 30.598  1.00 87.23  ? 335 ASP A C     1 
ATOM   2413 O  O     . ASP A 1 311 ? 23.504  30.333 29.898  1.00 87.12  ? 335 ASP A O     1 
ATOM   2414 C  CB    . ASP A 1 311 ? 20.375  31.638 29.857  1.00 87.14  ? 335 ASP A CB    1 
ATOM   2415 C  CG    . ASP A 1 311 ? 20.994  32.149 28.566  1.00 86.91  ? 335 ASP A CG    1 
ATOM   2416 O  OD1   . ASP A 1 311 ? 21.198  31.354 27.623  1.00 86.97  ? 335 ASP A OD1   1 
ATOM   2417 O  OD2   . ASP A 1 311 ? 21.274  33.360 28.495  1.00 87.16  ? 335 ASP A OD2   1 
ATOM   2418 N  N     . GLY A 1 312 ? 22.921  31.827 31.489  1.00 86.34  ? 336 GLY A N     1 
ATOM   2419 C  CA    . GLY A 1 312 ? 24.279  32.299 31.675  1.00 83.94  ? 336 GLY A CA    1 
ATOM   2420 C  C     . GLY A 1 312 ? 24.318  33.796 31.451  1.00 81.75  ? 336 GLY A C     1 
ATOM   2421 O  O     . GLY A 1 312 ? 24.671  34.548 32.352  1.00 82.73  ? 336 GLY A O     1 
ATOM   2422 N  N     . ARG A 1 313 ? 23.948  34.224 30.246  1.00 79.61  ? 337 ARG A N     1 
ATOM   2423 C  CA    . ARG A 1 313 ? 23.925  35.641 29.894  1.00 76.11  ? 337 ARG A CA    1 
ATOM   2424 C  C     . ARG A 1 313 ? 22.950  36.392 30.811  1.00 74.37  ? 337 ARG A C     1 
ATOM   2425 O  O     . ARG A 1 313 ? 22.134  35.783 31.513  1.00 73.47  ? 337 ARG A O     1 
ATOM   2426 C  CB    . ARG A 1 313 ? 23.483  35.812 28.434  1.00 74.79  ? 337 ARG A CB    1 
ATOM   2427 C  CG    . ARG A 1 313 ? 24.219  34.928 27.435  1.00 74.18  ? 337 ARG A CG    1 
ATOM   2428 C  CD    . ARG A 1 313 ? 23.236  34.089 26.617  1.00 74.44  ? 337 ARG A CD    1 
ATOM   2429 N  NE    . ARG A 1 313 ? 22.284  34.915 25.872  1.00 74.63  ? 337 ARG A NE    1 
ATOM   2430 C  CZ    . ARG A 1 313 ? 21.129  34.482 25.364  1.00 74.08  ? 337 ARG A CZ    1 
ATOM   2431 N  NH1   . ARG A 1 313 ? 20.750  33.218 25.507  1.00 72.77  ? 337 ARG A NH1   1 
ATOM   2432 N  NH2   . ARG A 1 313 ? 20.340  35.323 24.715  1.00 74.28  ? 337 ARG A NH2   1 
ATOM   2433 N  N     . LYS A 1 314 ? 23.042  37.716 30.802  1.00 72.05  ? 338 LYS A N     1 
ATOM   2434 C  CA    . LYS A 1 314 ? 22.166  38.546 31.612  1.00 69.89  ? 338 LYS A CA    1 
ATOM   2435 C  C     . LYS A 1 314 ? 21.433  39.522 30.704  1.00 68.15  ? 338 LYS A C     1 
ATOM   2436 O  O     . LYS A 1 314 ? 22.014  40.081 29.780  1.00 68.39  ? 338 LYS A O     1 
ATOM   2437 C  CB    . LYS A 1 314 ? 22.973  39.298 32.649  1.00 70.87  ? 338 LYS A CB    1 
ATOM   2438 N  N     . PRO A 1 315 ? 20.140  39.735 30.956  1.00 66.78  ? 339 PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 315 ? 19.326  40.645 30.155  1.00 66.55  ? 339 PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 315 ? 19.504  42.064 30.648  1.00 66.65  ? 339 PRO A C     1 
ATOM   2441 O  O     . PRO A 1 315 ? 19.721  42.287 31.836  1.00 66.24  ? 339 PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 315 ? 17.921  40.138 30.410  1.00 66.78  ? 339 PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 315 ? 17.986  39.833 31.879  1.00 66.41  ? 339 PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 315 ? 19.334  39.125 32.027  1.00 66.47  ? 339 PRO A CD    1 
ATOM   2445 N  N     . HIS A 1 316 ? 19.401  43.022 29.738  1.00 67.35  ? 340 HIS A N     1 
ATOM   2446 C  CA    . HIS A 1 316 ? 19.546  44.421 30.101  1.00 68.55  ? 340 HIS A CA    1 
ATOM   2447 C  C     . HIS A 1 316 ? 18.279  45.226 29.824  1.00 68.41  ? 340 HIS A C     1 
ATOM   2448 O  O     . HIS A 1 316 ? 18.329  46.427 29.561  1.00 69.01  ? 340 HIS A O     1 
ATOM   2449 C  CB    . HIS A 1 316 ? 20.748  45.026 29.369  1.00 70.06  ? 340 HIS A CB    1 
ATOM   2450 C  CG    . HIS A 1 316 ? 22.066  44.466 29.814  1.00 72.46  ? 340 HIS A CG    1 
ATOM   2451 N  ND1   . HIS A 1 316 ? 23.275  45.004 29.427  1.00 73.53  ? 340 HIS A ND1   1 
ATOM   2452 C  CD2   . HIS A 1 316 ? 22.363  43.415 30.617  1.00 72.99  ? 340 HIS A CD2   1 
ATOM   2453 C  CE1   . HIS A 1 316 ? 24.259  44.310 29.973  1.00 73.76  ? 340 HIS A CE1   1 
ATOM   2454 N  NE2   . HIS A 1 316 ? 23.732  43.340 30.700  1.00 72.88  ? 340 HIS A NE2   1 
ATOM   2455 N  N     . THR A 1 317 ? 17.138  44.551 29.896  1.00 67.89  ? 341 THR A N     1 
ATOM   2456 C  CA    . THR A 1 317 ? 15.848  45.191 29.676  1.00 67.00  ? 341 THR A CA    1 
ATOM   2457 C  C     . THR A 1 317 ? 14.720  44.294 30.160  1.00 67.43  ? 341 THR A C     1 
ATOM   2458 O  O     . THR A 1 317 ? 14.790  43.072 30.035  1.00 68.22  ? 341 THR A O     1 
ATOM   2459 C  CB    . THR A 1 317 ? 15.617  45.502 28.195  1.00 64.99  ? 341 THR A CB    1 
ATOM   2460 O  OG1   . THR A 1 317 ? 16.607  46.431 27.751  1.00 64.04  ? 341 THR A OG1   1 
ATOM   2461 C  CG2   . THR A 1 317 ? 14.232  46.102 27.982  1.00 64.42  ? 341 THR A CG2   1 
ATOM   2462 N  N     . VAL A 1 318 ? 13.687  44.905 30.727  1.00 67.38  ? 342 VAL A N     1 
ATOM   2463 C  CA    . VAL A 1 318 ? 12.537  44.159 31.211  1.00 67.01  ? 342 VAL A CA    1 
ATOM   2464 C  C     . VAL A 1 318 ? 11.300  44.791 30.595  1.00 67.04  ? 342 VAL A C     1 
ATOM   2465 O  O     . VAL A 1 318 ? 11.349  45.915 30.090  1.00 65.81  ? 342 VAL A O     1 
ATOM   2466 C  CB    . VAL A 1 318 ? 12.434  44.196 32.752  1.00 67.24  ? 342 VAL A CB    1 
ATOM   2467 C  CG1   . VAL A 1 318 ? 11.616  45.394 33.198  1.00 67.60  ? 342 VAL A CG1   1 
ATOM   2468 C  CG2   . VAL A 1 318 ? 11.829  42.907 33.260  1.00 66.75  ? 342 VAL A CG2   1 
ATOM   2469 N  N     . ARG A 1 319 ? 10.190  44.071 30.642  1.00 68.13  ? 343 ARG A N     1 
ATOM   2470 C  CA    . ARG A 1 319 ? 8.962   44.570 30.048  1.00 70.33  ? 343 ARG A CA    1 
ATOM   2471 C  C     . ARG A 1 319 ? 7.728   43.954 30.681  1.00 72.10  ? 343 ARG A C     1 
ATOM   2472 O  O     . ARG A 1 319 ? 7.812   42.925 31.349  1.00 72.99  ? 343 ARG A O     1 
ATOM   2473 C  CB    . ARG A 1 319 ? 8.968   44.265 28.549  1.00 68.59  ? 343 ARG A CB    1 
ATOM   2474 C  CG    . ARG A 1 319 ? 7.699   44.641 27.828  1.00 69.13  ? 343 ARG A CG    1 
ATOM   2475 C  CD    . ARG A 1 319 ? 7.758   44.174 26.402  1.00 70.16  ? 343 ARG A CD    1 
ATOM   2476 N  NE    . ARG A 1 319 ? 9.042   44.511 25.802  1.00 72.67  ? 343 ARG A NE    1 
ATOM   2477 C  CZ    . ARG A 1 319 ? 9.320   44.373 24.510  1.00 73.94  ? 343 ARG A CZ    1 
ATOM   2478 N  NH1   . ARG A 1 319 ? 8.395   43.903 23.680  1.00 74.56  ? 343 ARG A NH1   1 
ATOM   2479 N  NH2   . ARG A 1 319 ? 10.518  44.708 24.049  1.00 73.22  ? 343 ARG A NH2   1 
ATOM   2480 N  N     . LEU A 1 320 ? 6.586   44.602 30.479  1.00 74.21  ? 344 LEU A N     1 
ATOM   2481 C  CA    . LEU A 1 320 ? 5.318   44.107 30.989  1.00 77.33  ? 344 LEU A CA    1 
ATOM   2482 C  C     . LEU A 1 320 ? 4.280   44.307 29.904  1.00 78.71  ? 344 LEU A C     1 
ATOM   2483 O  O     . LEU A 1 320 ? 4.268   45.331 29.227  1.00 78.23  ? 344 LEU A O     1 
ATOM   2484 C  CB    . LEU A 1 320 ? 4.892   44.847 32.262  1.00 78.78  ? 344 LEU A CB    1 
ATOM   2485 C  CG    . LEU A 1 320 ? 5.693   44.545 33.532  1.00 79.88  ? 344 LEU A CG    1 
ATOM   2486 C  CD1   . LEU A 1 320 ? 7.017   45.284 33.481  1.00 79.58  ? 344 LEU A CD1   1 
ATOM   2487 C  CD2   . LEU A 1 320 ? 4.903   44.967 34.764  1.00 80.91  ? 344 LEU A CD2   1 
ATOM   2488 N  N     . ILE A 1 321 ? 3.420   43.314 29.734  1.00 80.82  ? 345 ILE A N     1 
ATOM   2489 C  CA    . ILE A 1 321 ? 2.382   43.375 28.719  1.00 83.33  ? 345 ILE A CA    1 
ATOM   2490 C  C     . ILE A 1 321 ? 1.044   43.069 29.379  1.00 85.77  ? 345 ILE A C     1 
ATOM   2491 O  O     . ILE A 1 321 ? 0.993   42.337 30.369  1.00 86.17  ? 345 ILE A O     1 
ATOM   2492 C  CB    . ILE A 1 321 ? 2.664   42.348 27.607  1.00 82.76  ? 345 ILE A CB    1 
ATOM   2493 C  CG1   . ILE A 1 321 ? 4.118   42.492 27.146  1.00 82.35  ? 345 ILE A CG1   1 
ATOM   2494 C  CG2   . ILE A 1 321 ? 1.696   42.547 26.445  1.00 81.61  ? 345 ILE A CG2   1 
ATOM   2495 C  CD1   . ILE A 1 321 ? 4.540   41.502 26.080  1.00 83.84  ? 345 ILE A CD1   1 
ATOM   2496 N  N     . ILE A 1 322 ? -0.035  43.637 28.845  1.00 88.13  ? 346 ILE A N     1 
ATOM   2497 C  CA    . ILE A 1 322 ? -1.361  43.405 29.411  1.00 90.95  ? 346 ILE A CA    1 
ATOM   2498 C  C     . ILE A 1 322 ? -2.477  43.368 28.372  1.00 93.29  ? 346 ILE A C     1 
ATOM   2499 O  O     . ILE A 1 322 ? -2.261  43.609 27.182  1.00 93.03  ? 346 ILE A O     1 
ATOM   2500 C  CB    . ILE A 1 322 ? -1.735  44.481 30.461  1.00 90.70  ? 346 ILE A CB    1 
ATOM   2501 C  CG1   . ILE A 1 322 ? -1.897  45.841 29.778  1.00 90.71  ? 346 ILE A CG1   1 
ATOM   2502 C  CG2   . ILE A 1 322 ? -0.676  44.541 31.553  1.00 89.84  ? 346 ILE A CG2   1 
ATOM   2503 C  CD1   . ILE A 1 322 ? -2.417  46.927 30.695  1.00 90.59  ? 346 ILE A CD1   1 
ATOM   2504 N  N     . ARG A 1 323 ? -3.679  43.070 28.854  1.00 96.33  ? 347 ARG A N     1 
ATOM   2505 C  CA    . ARG A 1 323 ? -4.866  42.986 28.016  1.00 99.68  ? 347 ARG A CA    1 
ATOM   2506 C  C     . ARG A 1 323 ? -6.062  43.624 28.737  1.00 102.21 ? 347 ARG A C     1 
ATOM   2507 O  O     . ARG A 1 323 ? -6.014  43.874 29.946  1.00 101.84 ? 347 ARG A O     1 
ATOM   2508 C  CB    . ARG A 1 323 ? -5.156  41.518 27.703  1.00 99.53  ? 347 ARG A CB    1 
ATOM   2509 C  CG    . ARG A 1 323 ? -6.368  41.274 26.831  1.00 99.75  ? 347 ARG A CG    1 
ATOM   2510 C  CD    . ARG A 1 323 ? -6.678  39.793 26.792  1.00 99.65  ? 347 ARG A CD    1 
ATOM   2511 N  NE    . ARG A 1 323 ? -5.579  39.025 26.212  1.00 99.49  ? 347 ARG A NE    1 
ATOM   2512 C  CZ    . ARG A 1 323 ? -5.416  37.715 26.366  1.00 99.23  ? 347 ARG A CZ    1 
ATOM   2513 N  NH1   . ARG A 1 323 ? -6.279  37.016 27.091  1.00 99.23  ? 347 ARG A NH1   1 
ATOM   2514 N  NH2   . ARG A 1 323 ? -4.396  37.102 25.783  1.00 98.60  ? 347 ARG A NH2   1 
ATOM   2515 N  N     . ARG A 1 324 ? -7.132  43.888 27.990  1.00 105.26 ? 348 ARG A N     1 
ATOM   2516 C  CA    . ARG A 1 324 ? -8.336  44.500 28.549  1.00 107.75 ? 348 ARG A CA    1 
ATOM   2517 C  C     . ARG A 1 324 ? -9.610  43.966 27.887  1.00 109.15 ? 348 ARG A C     1 
ATOM   2518 O  O     . ARG A 1 324 ? -9.778  44.059 26.666  1.00 109.27 ? 348 ARG A O     1 
ATOM   2519 C  CB    . ARG A 1 324 ? -8.261  46.022 28.391  1.00 108.32 ? 348 ARG A CB    1 
ATOM   2520 C  CG    . ARG A 1 324 ? -7.117  46.664 29.169  1.00 108.46 ? 348 ARG A CG    1 
ATOM   2521 C  CD    . ARG A 1 324 ? -6.943  48.140 28.817  1.00 109.22 ? 348 ARG A CD    1 
ATOM   2522 N  NE    . ARG A 1 324 ? -5.905  48.767 29.634  1.00 109.72 ? 348 ARG A NE    1 
ATOM   2523 C  CZ    . ARG A 1 324 ? -5.430  49.994 29.440  1.00 109.82 ? 348 ARG A CZ    1 
ATOM   2524 N  NH1   . ARG A 1 324 ? -5.899  50.740 28.447  1.00 109.74 ? 348 ARG A NH1   1 
ATOM   2525 N  NH2   . ARG A 1 324 ? -4.487  50.477 30.243  1.00 109.97 ? 348 ARG A NH2   1 
ATOM   2526 N  N     . TYR A 1 325 ? -10.504 43.413 28.703  1.00 110.79 ? 349 TYR A N     1 
ATOM   2527 C  CA    . TYR A 1 325 ? -11.759 42.845 28.212  1.00 112.51 ? 349 TYR A CA    1 
ATOM   2528 C  C     . TYR A 1 325 ? -12.795 43.911 27.874  1.00 113.45 ? 349 TYR A C     1 
ATOM   2529 O  O     . TYR A 1 325 ? -12.821 44.983 28.480  1.00 113.62 ? 349 TYR A O     1 
ATOM   2530 C  CB    . TYR A 1 325 ? -12.330 41.876 29.247  1.00 112.22 ? 349 TYR A CB    1 
ATOM   2531 N  N     . SER A 1 326 ? -13.649 43.601 26.902  1.00 114.41 ? 350 SER A N     1 
ATOM   2532 C  CA    . SER A 1 326 ? -14.705 44.512 26.467  1.00 115.91 ? 350 SER A CA    1 
ATOM   2533 C  C     . SER A 1 326 ? -15.417 43.927 25.250  1.00 116.70 ? 350 SER A C     1 
ATOM   2534 O  O     . SER A 1 326 ? -16.240 43.021 25.378  1.00 117.30 ? 350 SER A O     1 
ATOM   2535 C  CB    . SER A 1 326 ? -14.119 45.886 26.127  1.00 115.91 ? 350 SER A CB    1 
ATOM   2536 N  N     . SER A 1 327 ? -15.096 44.450 24.070  1.00 117.20 ? 351 SER A N     1 
ATOM   2537 C  CA    . SER A 1 327 ? -15.698 43.969 22.833  1.00 117.37 ? 351 SER A CA    1 
ATOM   2538 C  C     . SER A 1 327 ? -14.824 42.862 22.254  1.00 117.53 ? 351 SER A C     1 
ATOM   2539 O  O     . SER A 1 327 ? -14.196 42.104 22.996  1.00 116.94 ? 351 SER A O     1 
ATOM   2540 C  CB    . SER A 1 327 ? -15.832 45.118 21.830  1.00 117.07 ? 351 SER A CB    1 
ATOM   2541 N  N     . GLU A 1 328 ? -14.785 42.775 20.929  1.00 117.98 ? 352 GLU A N     1 
ATOM   2542 C  CA    . GLU A 1 328 ? -13.986 41.764 20.255  1.00 118.54 ? 352 GLU A CA    1 
ATOM   2543 C  C     . GLU A 1 328 ? -12.707 42.381 19.687  1.00 119.18 ? 352 GLU A C     1 
ATOM   2544 O  O     . GLU A 1 328 ? -12.504 42.399 18.470  1.00 119.68 ? 352 GLU A O     1 
ATOM   2545 C  CB    . GLU A 1 328 ? -14.800 41.115 19.141  1.00 117.85 ? 352 GLU A CB    1 
ATOM   2546 N  N     . LYS A 1 329 ? -11.850 42.889 20.573  1.00 119.53 ? 353 LYS A N     1 
ATOM   2547 C  CA    . LYS A 1 329 ? -10.586 43.498 20.160  1.00 119.61 ? 353 LYS A CA    1 
ATOM   2548 C  C     . LYS A 1 329 ? -9.680  42.426 19.554  1.00 119.79 ? 353 LYS A C     1 
ATOM   2549 O  O     . LYS A 1 329 ? -8.892  41.792 20.260  1.00 119.98 ? 353 LYS A O     1 
ATOM   2550 C  CB    . LYS A 1 329 ? -9.901  44.156 21.359  1.00 119.23 ? 353 LYS A CB    1 
ATOM   2551 N  N     . HIS A 1 330 ? -9.804  42.235 18.241  1.00 119.54 ? 354 HIS A N     1 
ATOM   2552 C  CA    . HIS A 1 330 ? -9.026  41.237 17.504  1.00 119.07 ? 354 HIS A CA    1 
ATOM   2553 C  C     . HIS A 1 330 ? -7.507  41.427 17.589  1.00 118.62 ? 354 HIS A C     1 
ATOM   2554 O  O     . HIS A 1 330 ? -6.746  40.643 17.011  1.00 118.70 ? 354 HIS A O     1 
ATOM   2555 C  CB    . HIS A 1 330 ? -9.469  41.221 16.038  1.00 118.85 ? 354 HIS A CB    1 
ATOM   2556 N  N     . TYR A 1 331 ? -7.072  42.462 18.308  1.00 117.53 ? 355 TYR A N     1 
ATOM   2557 C  CA    . TYR A 1 331 ? -5.648  42.755 18.478  1.00 115.96 ? 355 TYR A CA    1 
ATOM   2558 C  C     . TYR A 1 331 ? -5.456  43.882 19.489  1.00 114.66 ? 355 TYR A C     1 
ATOM   2559 O  O     . TYR A 1 331 ? -5.593  45.056 19.144  1.00 114.86 ? 355 TYR A O     1 
ATOM   2560 C  CB    . TYR A 1 331 ? -5.028  43.145 17.137  1.00 116.04 ? 355 TYR A CB    1 
ATOM   2561 N  N     . GLY A 1 332 ? -5.133  43.532 20.733  1.00 112.78 ? 356 GLY A N     1 
ATOM   2562 C  CA    . GLY A 1 332 ? -4.949  44.559 21.744  1.00 110.47 ? 356 GLY A CA    1 
ATOM   2563 C  C     . GLY A 1 332 ? -4.031  44.244 22.914  1.00 108.69 ? 356 GLY A C     1 
ATOM   2564 O  O     . GLY A 1 332 ? -4.427  43.580 23.873  1.00 108.71 ? 356 GLY A O     1 
ATOM   2565 N  N     . ARG A 1 333 ? -2.800  44.738 22.838  1.00 106.75 ? 357 ARG A N     1 
ATOM   2566 C  CA    . ARG A 1 333 ? -1.821  44.534 23.897  1.00 104.76 ? 357 ARG A CA    1 
ATOM   2567 C  C     . ARG A 1 333 ? -1.123  45.858 24.218  1.00 102.85 ? 357 ARG A C     1 
ATOM   2568 O  O     . ARG A 1 333 ? -1.091  46.764 23.386  1.00 101.88 ? 357 ARG A O     1 
ATOM   2569 C  CB    . ARG A 1 333 ? -0.789  43.482 23.472  1.00 106.02 ? 357 ARG A CB    1 
ATOM   2570 C  CG    . ARG A 1 333 ? -1.284  42.037 23.525  1.00 106.69 ? 357 ARG A CG    1 
ATOM   2571 C  CD    . ARG A 1 333 ? -0.157  41.062 23.184  1.00 107.90 ? 357 ARG A CD    1 
ATOM   2572 N  NE    . ARG A 1 333 ? -0.428  39.695 23.631  1.00 108.95 ? 357 ARG A NE    1 
ATOM   2573 C  CZ    . ARG A 1 333 ? -1.372  38.904 23.127  1.00 109.44 ? 357 ARG A CZ    1 
ATOM   2574 N  NH1   . ARG A 1 333 ? -2.151  39.335 22.143  1.00 109.76 ? 357 ARG A NH1   1 
ATOM   2575 N  NH2   . ARG A 1 333 ? -1.541  37.681 23.613  1.00 109.10 ? 357 ARG A NH2   1 
ATOM   2576 N  N     . GLU A 1 334 ? -0.575  45.965 25.426  1.00 101.05 ? 358 GLU A N     1 
ATOM   2577 C  CA    . GLU A 1 334 ? 0.121   47.177 25.867  1.00 99.89  ? 358 GLU A CA    1 
ATOM   2578 C  C     . GLU A 1 334 ? 1.343   46.823 26.717  1.00 98.84  ? 358 GLU A C     1 
ATOM   2579 O  O     . GLU A 1 334 ? 1.258   45.982 27.612  1.00 99.09  ? 358 GLU A O     1 
ATOM   2580 C  CB    . GLU A 1 334 ? -0.819  48.051 26.695  1.00 99.94  ? 358 GLU A CB    1 
ATOM   2581 C  CG    . GLU A 1 334 ? -2.119  48.411 26.004  1.00 100.54 ? 358 GLU A CG    1 
ATOM   2582 C  CD    . GLU A 1 334 ? -3.053  49.194 26.909  1.00 100.67 ? 358 GLU A CD    1 
ATOM   2583 O  OE1   . GLU A 1 334 ? -4.153  49.577 26.454  1.00 100.60 ? 358 GLU A OE1   1 
ATOM   2584 O  OE2   . GLU A 1 334 ? -2.683  49.425 28.080  1.00 100.86 ? 358 GLU A OE2   1 
ATOM   2585 N  N     . SER A 1 335 ? 2.475   47.473 26.458  1.00 97.19  ? 359 SER A N     1 
ATOM   2586 C  CA    . SER A 1 335 ? 3.684   47.176 27.220  1.00 94.89  ? 359 SER A CA    1 
ATOM   2587 C  C     . SER A 1 335 ? 4.568   48.375 27.544  1.00 94.20  ? 359 SER A C     1 
ATOM   2588 O  O     . SER A 1 335 ? 4.709   49.310 26.748  1.00 93.23  ? 359 SER A O     1 
ATOM   2589 C  CB    . SER A 1 335 ? 4.527   46.143 26.481  1.00 94.20  ? 359 SER A CB    1 
ATOM   2590 O  OG    . SER A 1 335 ? 5.063   46.700 25.297  1.00 94.24  ? 359 SER A OG    1 
ATOM   2591 N  N     . ARG A 1 336 ? 5.169   48.322 28.729  1.00 93.65  ? 360 ARG A N     1 
ATOM   2592 C  CA    . ARG A 1 336 ? 6.065   49.369 29.203  1.00 93.28  ? 360 ARG A CA    1 
ATOM   2593 C  C     . ARG A 1 336 ? 7.483   48.812 29.300  1.00 92.37  ? 360 ARG A C     1 
ATOM   2594 O  O     . ARG A 1 336 ? 7.813   48.080 30.237  1.00 91.68  ? 360 ARG A O     1 
ATOM   2595 C  CB    . ARG A 1 336 ? 5.621   49.899 30.582  1.00 93.41  ? 360 ARG A CB    1 
ATOM   2596 C  CG    . ARG A 1 336 ? 4.247   50.578 30.606  1.00 93.51  ? 360 ARG A CG    1 
ATOM   2597 C  CD    . ARG A 1 336 ? 4.044   51.493 29.397  1.00 93.50  ? 360 ARG A CD    1 
ATOM   2598 N  NE    . ARG A 1 336 ? 2.714   52.095 29.367  1.00 93.86  ? 360 ARG A NE    1 
ATOM   2599 C  CZ    . ARG A 1 336 ? 2.170   52.651 28.288  1.00 94.27  ? 360 ARG A CZ    1 
ATOM   2600 N  NH1   . ARG A 1 336 ? 2.841   52.681 27.143  1.00 94.89  ? 360 ARG A NH1   1 
ATOM   2601 N  NH2   . ARG A 1 336 ? 0.956   53.179 28.353  1.00 94.15  ? 360 ARG A NH2   1 
ATOM   2602 N  N     . GLN A 1 337 ? 8.312   49.164 28.322  1.00 91.33  ? 361 GLN A N     1 
ATOM   2603 C  CA    . GLN A 1 337 ? 9.695   48.709 28.279  1.00 90.31  ? 361 GLN A CA    1 
ATOM   2604 C  C     . GLN A 1 337 ? 10.556  49.607 29.170  1.00 89.12  ? 361 GLN A C     1 
ATOM   2605 O  O     . GLN A 1 337 ? 10.235  50.779 29.371  1.00 88.71  ? 361 GLN A O     1 
ATOM   2606 C  CB    . GLN A 1 337 ? 10.197  48.753 26.835  1.00 91.19  ? 361 GLN A CB    1 
ATOM   2607 C  CG    . GLN A 1 337 ? 11.391  47.862 26.550  1.00 91.78  ? 361 GLN A CG    1 
ATOM   2608 C  CD    . GLN A 1 337 ? 11.813  47.929 25.096  1.00 92.37  ? 361 GLN A CD    1 
ATOM   2609 O  OE1   . GLN A 1 337 ? 11.005  47.704 24.190  1.00 91.90  ? 361 GLN A OE1   1 
ATOM   2610 N  NE2   . GLN A 1 337 ? 13.082  48.243 24.863  1.00 92.36  ? 361 GLN A NE2   1 
ATOM   2611 N  N     . CYS A 1 338 ? 11.645  49.057 29.702  1.00 87.83  ? 362 CYS A N     1 
ATOM   2612 C  CA    . CYS A 1 338 ? 12.531  49.819 30.584  1.00 86.41  ? 362 CYS A CA    1 
ATOM   2613 C  C     . CYS A 1 338 ? 13.872  49.115 30.867  1.00 85.36  ? 362 CYS A C     1 
ATOM   2614 O  O     . CYS A 1 338 ? 13.923  47.895 31.009  1.00 85.55  ? 362 CYS A O     1 
ATOM   2615 C  CB    . CYS A 1 338 ? 11.804  50.102 31.902  1.00 85.47  ? 362 CYS A CB    1 
ATOM   2616 S  SG    . CYS A 1 338 ? 12.858  50.013 33.373  1.00 84.71  ? 362 CYS A SG    1 
ATOM   2617 N  N     . PRO A 1 339 ? 14.977  49.880 30.939  1.00 83.83  ? 363 PRO A N     1 
ATOM   2618 C  CA    . PRO A 1 339 ? 16.300  49.309 31.207  1.00 83.15  ? 363 PRO A CA    1 
ATOM   2619 C  C     . PRO A 1 339 ? 16.414  48.723 32.604  1.00 83.09  ? 363 PRO A C     1 
ATOM   2620 O  O     . PRO A 1 339 ? 15.778  49.202 33.533  1.00 82.54  ? 363 PRO A O     1 
ATOM   2621 C  CB    . PRO A 1 339 ? 17.233  50.498 31.007  1.00 82.76  ? 363 PRO A CB    1 
ATOM   2622 C  CG    . PRO A 1 339 ? 16.526  51.301 29.968  1.00 82.58  ? 363 PRO A CG    1 
ATOM   2623 C  CD    . PRO A 1 339 ? 15.108  51.272 30.477  1.00 83.45  ? 363 PRO A CD    1 
ATOM   2624 N  N     . ILE A 1 340 ? 17.235  47.689 32.743  1.00 84.87  ? 364 ILE A N     1 
ATOM   2625 C  CA    . ILE A 1 340 ? 17.443  47.015 34.023  1.00 87.22  ? 364 ILE A CA    1 
ATOM   2626 C  C     . ILE A 1 340 ? 18.681  47.535 34.753  1.00 89.08  ? 364 ILE A C     1 
ATOM   2627 O  O     . ILE A 1 340 ? 19.795  47.419 34.245  1.00 89.81  ? 364 ILE A O     1 
ATOM   2628 C  CB    . ILE A 1 340 ? 17.604  45.484 33.821  1.00 87.24  ? 364 ILE A CB    1 
ATOM   2629 C  CG1   . ILE A 1 340 ? 16.256  44.861 33.453  1.00 87.35  ? 364 ILE A CG1   1 
ATOM   2630 C  CG2   . ILE A 1 340 ? 18.182  44.840 35.074  1.00 86.78  ? 364 ILE A CG2   1 
ATOM   2631 C  CD1   . ILE A 1 340 ? 16.312  43.366 33.217  1.00 87.59  ? 364 ILE A CD1   1 
ATOM   2632 N  N     . PRO A 1 341 ? 18.502  48.099 35.962  1.00 90.70  ? 365 PRO A N     1 
ATOM   2633 C  CA    . PRO A 1 341 ? 19.610  48.634 36.760  1.00 91.41  ? 365 PRO A CA    1 
ATOM   2634 C  C     . PRO A 1 341 ? 20.846  47.739 36.763  1.00 92.57  ? 365 PRO A C     1 
ATOM   2635 O  O     . PRO A 1 341 ? 20.797  46.592 37.205  1.00 92.29  ? 365 PRO A O     1 
ATOM   2636 C  CB    . PRO A 1 341 ? 18.991  48.777 38.143  1.00 91.14  ? 365 PRO A CB    1 
ATOM   2637 C  CG    . PRO A 1 341 ? 17.600  49.193 37.816  1.00 91.29  ? 365 PRO A CG    1 
ATOM   2638 C  CD    . PRO A 1 341 ? 17.228  48.240 36.693  1.00 91.35  ? 365 PRO A CD    1 
ATOM   2639 N  N     . SER A 1 342 ? 21.954  48.280 36.264  1.00 93.87  ? 366 SER A N     1 
ATOM   2640 C  CA    . SER A 1 342 ? 23.217  47.550 36.192  1.00 94.80  ? 366 SER A CA    1 
ATOM   2641 C  C     . SER A 1 342 ? 23.545  46.809 37.490  1.00 94.97  ? 366 SER A C     1 
ATOM   2642 O  O     . SER A 1 342 ? 23.995  45.662 37.462  1.00 95.11  ? 366 SER A O     1 
ATOM   2643 C  CB    . SER A 1 342 ? 24.357  48.515 35.828  1.00 94.99  ? 366 SER A CB    1 
ATOM   2644 O  OG    . SER A 1 342 ? 24.364  49.655 36.673  1.00 95.43  ? 366 SER A OG    1 
ATOM   2645 N  N     . HIS A 1 343 ? 23.313  47.464 38.623  1.00 95.12  ? 367 HIS A N     1 
ATOM   2646 C  CA    . HIS A 1 343 ? 23.588  46.855 39.919  1.00 95.08  ? 367 HIS A CA    1 
ATOM   2647 C  C     . HIS A 1 343 ? 22.711  45.622 40.125  1.00 94.98  ? 367 HIS A C     1 
ATOM   2648 O  O     . HIS A 1 343 ? 23.211  44.539 40.449  1.00 94.33  ? 367 HIS A O     1 
ATOM   2649 C  CB    . HIS A 1 343 ? 23.340  47.869 41.038  1.00 95.24  ? 367 HIS A CB    1 
ATOM   2650 N  N     . VAL A 1 344 ? 21.405  45.794 39.921  1.00 94.75  ? 368 VAL A N     1 
ATOM   2651 C  CA    . VAL A 1 344 ? 20.438  44.712 40.096  1.00 94.04  ? 368 VAL A CA    1 
ATOM   2652 C  C     . VAL A 1 344 ? 20.720  43.514 39.197  1.00 93.49  ? 368 VAL A C     1 
ATOM   2653 O  O     . VAL A 1 344 ? 20.351  42.389 39.527  1.00 93.19  ? 368 VAL A O     1 
ATOM   2654 C  CB    . VAL A 1 344 ? 18.980  45.194 39.834  1.00 93.94  ? 368 VAL A CB    1 
ATOM   2655 C  CG1   . VAL A 1 344 ? 18.736  46.512 40.541  1.00 94.89  ? 368 VAL A CG1   1 
ATOM   2656 C  CG2   . VAL A 1 344 ? 18.713  45.326 38.349  1.00 93.43  ? 368 VAL A CG2   1 
ATOM   2657 N  N     . ILE A 1 345 ? 21.373  43.755 38.063  1.00 92.74  ? 369 ILE A N     1 
ATOM   2658 C  CA    . ILE A 1 345 ? 21.688  42.678 37.132  1.00 91.38  ? 369 ILE A CA    1 
ATOM   2659 C  C     . ILE A 1 345 ? 22.409  41.534 37.833  1.00 90.92  ? 369 ILE A C     1 
ATOM   2660 O  O     . ILE A 1 345 ? 22.012  40.373 37.727  1.00 91.09  ? 369 ILE A O     1 
ATOM   2661 C  CB    . ILE A 1 345 ? 22.556  43.191 35.957  1.00 90.62  ? 369 ILE A CB    1 
ATOM   2662 C  CG1   . ILE A 1 345 ? 21.716  44.122 35.076  1.00 90.32  ? 369 ILE A CG1   1 
ATOM   2663 C  CG2   . ILE A 1 345 ? 23.104  42.021 35.148  1.00 89.39  ? 369 ILE A CG2   1 
ATOM   2664 C  CD1   . ILE A 1 345 ? 22.416  44.593 33.822  1.00 89.91  ? 369 ILE A CD1   1 
ATOM   2665 N  N     . GLN A 1 346 ? 23.456  41.867 38.570  1.00 90.40  ? 370 GLN A N     1 
ATOM   2666 C  CA    . GLN A 1 346 ? 24.223  40.856 39.268  1.00 90.28  ? 370 GLN A CA    1 
ATOM   2667 C  C     . GLN A 1 346 ? 23.506  40.311 40.500  1.00 90.07  ? 370 GLN A C     1 
ATOM   2668 O  O     . GLN A 1 346 ? 22.930  39.219 40.462  1.00 89.42  ? 370 GLN A O     1 
ATOM   2669 C  CB    . GLN A 1 346 ? 25.574  41.443 39.643  1.00 90.42  ? 370 GLN A CB    1 
ATOM   2670 C  CG    . GLN A 1 346 ? 26.306  41.986 38.437  1.00 90.82  ? 370 GLN A CG    1 
ATOM   2671 C  CD    . GLN A 1 346 ? 27.612  42.636 38.803  1.00 92.02  ? 370 GLN A CD    1 
ATOM   2672 O  OE1   . GLN A 1 346 ? 28.471  42.012 39.425  1.00 92.31  ? 370 GLN A OE1   1 
ATOM   2673 N  NE2   . GLN A 1 346 ? 27.776  43.899 38.418  1.00 91.90  ? 370 GLN A NE2   1 
ATOM   2674 N  N     . VAL A 1 355 ? 17.131  39.050 45.215  1.00 92.69  ? 379 VAL A N     1 
ATOM   2675 C  CA    . VAL A 1 355 ? 17.280  39.612 43.877  1.00 93.19  ? 379 VAL A CA    1 
ATOM   2676 C  C     . VAL A 1 355 ? 15.928  40.031 43.317  1.00 93.50  ? 379 VAL A C     1 
ATOM   2677 O  O     . VAL A 1 355 ? 15.832  40.968 42.520  1.00 93.18  ? 379 VAL A O     1 
ATOM   2678 C  CB    . VAL A 1 355 ? 17.933  38.591 42.949  1.00 92.61  ? 379 VAL A CB    1 
ATOM   2679 N  N     . MET A 1 356 ? 14.882  39.327 43.734  1.00 93.74  ? 380 MET A N     1 
ATOM   2680 C  CA    . MET A 1 356 ? 13.537  39.628 43.267  1.00 93.94  ? 380 MET A CA    1 
ATOM   2681 C  C     . MET A 1 356 ? 13.094  41.006 43.714  1.00 93.80  ? 380 MET A C     1 
ATOM   2682 O  O     . MET A 1 356 ? 12.812  41.876 42.887  1.00 92.75  ? 380 MET A O     1 
ATOM   2683 C  CB    . MET A 1 356 ? 12.531  38.592 43.785  1.00 94.65  ? 380 MET A CB    1 
ATOM   2684 C  CG    . MET A 1 356 ? 12.144  37.525 42.769  1.00 94.93  ? 380 MET A CG    1 
ATOM   2685 S  SD    . MET A 1 356 ? 10.467  36.910 43.032  1.00 95.33  ? 380 MET A SD    1 
ATOM   2686 C  CE    . MET A 1 356 ? 9.491   38.304 42.404  1.00 94.62  ? 380 MET A CE    1 
ATOM   2687 N  N     . THR A 1 357 ? 13.035  41.179 45.034  1.00 94.33  ? 381 THR A N     1 
ATOM   2688 C  CA    . THR A 1 357 ? 12.616  42.426 45.662  1.00 94.28  ? 381 THR A CA    1 
ATOM   2689 C  C     . THR A 1 357 ? 12.757  43.650 44.749  1.00 93.87  ? 381 THR A C     1 
ATOM   2690 O  O     . THR A 1 357 ? 11.754  44.177 44.260  1.00 94.62  ? 381 THR A O     1 
ATOM   2691 C  CB    . THR A 1 357 ? 13.375  42.640 46.999  1.00 94.42  ? 381 THR A CB    1 
ATOM   2692 O  OG1   . THR A 1 357 ? 14.618  41.925 46.966  1.00 95.00  ? 381 THR A OG1   1 
ATOM   2693 C  CG2   . THR A 1 357 ? 12.544  42.132 48.169  1.00 94.36  ? 381 THR A CG2   1 
ATOM   2694 N  N     . PRO A 1 358 ? 13.995  44.095 44.472  1.00 92.60  ? 382 PRO A N     1 
ATOM   2695 C  CA    . PRO A 1 358 ? 14.136  45.267 43.598  1.00 91.63  ? 382 PRO A CA    1 
ATOM   2696 C  C     . PRO A 1 358 ? 13.204  45.172 42.386  1.00 91.18  ? 382 PRO A C     1 
ATOM   2697 O  O     . PRO A 1 358 ? 12.247  45.947 42.245  1.00 90.47  ? 382 PRO A O     1 
ATOM   2698 C  CB    . PRO A 1 358 ? 15.607  45.212 43.192  1.00 91.54  ? 382 PRO A CB    1 
ATOM   2699 C  CG    . PRO A 1 358 ? 16.264  44.552 44.370  1.00 91.43  ? 382 PRO A CG    1 
ATOM   2700 C  CD    . PRO A 1 358 ? 15.301  43.445 44.689  1.00 91.92  ? 382 PRO A CD    1 
ATOM   2701 N  N     . MET A 1 359 ? 13.504  44.197 41.529  1.00 90.60  ? 383 MET A N     1 
ATOM   2702 C  CA    . MET A 1 359 ? 12.751  43.921 40.310  1.00 89.33  ? 383 MET A CA    1 
ATOM   2703 C  C     . MET A 1 359 ? 11.257  44.056 40.509  1.00 88.24  ? 383 MET A C     1 
ATOM   2704 O  O     . MET A 1 359 ? 10.568  44.716 39.728  1.00 87.25  ? 383 MET A O     1 
ATOM   2705 C  CB    . MET A 1 359 ? 13.060  42.504 39.821  1.00 89.73  ? 383 MET A CB    1 
ATOM   2706 C  CG    . MET A 1 359 ? 14.261  42.391 38.900  1.00 89.64  ? 383 MET A CG    1 
ATOM   2707 S  SD    . MET A 1 359 ? 13.962  43.220 37.323  1.00 89.73  ? 383 MET A SD    1 
ATOM   2708 C  CE    . MET A 1 359 ? 15.058  44.614 37.463  1.00 89.71  ? 383 MET A CE    1 
ATOM   2709 N  N     . VAL A 1 360 ? 10.762  43.414 41.558  1.00 87.94  ? 384 VAL A N     1 
ATOM   2710 C  CA    . VAL A 1 360 ? 9.346   43.444 41.866  1.00 88.41  ? 384 VAL A CA    1 
ATOM   2711 C  C     . VAL A 1 360 ? 8.780   44.849 41.698  1.00 88.83  ? 384 VAL A C     1 
ATOM   2712 O  O     . VAL A 1 360 ? 7.884   45.073 40.880  1.00 87.86  ? 384 VAL A O     1 
ATOM   2713 C  CB    . VAL A 1 360 ? 9.088   42.952 43.303  1.00 88.36  ? 384 VAL A CB    1 
ATOM   2714 C  CG1   . VAL A 1 360 ? 7.592   42.910 43.578  1.00 88.17  ? 384 VAL A CG1   1 
ATOM   2715 C  CG2   . VAL A 1 360 ? 9.708   41.571 43.496  1.00 87.42  ? 384 VAL A CG2   1 
ATOM   2716 N  N     . ASP A 1 361 ? 9.317   45.802 42.454  1.00 89.66  ? 385 ASP A N     1 
ATOM   2717 C  CA    . ASP A 1 361 ? 8.822   47.164 42.360  1.00 90.61  ? 385 ASP A CA    1 
ATOM   2718 C  C     . ASP A 1 361 ? 9.146   47.782 41.010  1.00 90.77  ? 385 ASP A C     1 
ATOM   2719 O  O     . ASP A 1 361 ? 8.391   48.614 40.504  1.00 91.49  ? 385 ASP A O     1 
ATOM   2720 C  CB    . ASP A 1 361 ? 9.398   48.039 43.467  1.00 91.08  ? 385 ASP A CB    1 
ATOM   2721 C  CG    . ASP A 1 361 ? 8.538   49.265 43.733  1.00 91.90  ? 385 ASP A CG    1 
ATOM   2722 O  OD1   . ASP A 1 361 ? 8.193   49.973 42.762  1.00 91.94  ? 385 ASP A OD1   1 
ATOM   2723 O  OD2   . ASP A 1 361 ? 8.202   49.520 44.909  1.00 92.32  ? 385 ASP A OD2   1 
ATOM   2724 N  N     . ILE A 1 362 ? 10.270  47.381 40.426  1.00 90.21  ? 386 ILE A N     1 
ATOM   2725 C  CA    . ILE A 1 362 ? 10.652  47.908 39.125  1.00 89.63  ? 386 ILE A CA    1 
ATOM   2726 C  C     . ILE A 1 362 ? 9.472   47.744 38.171  1.00 89.41  ? 386 ILE A C     1 
ATOM   2727 O  O     . ILE A 1 362 ? 9.081   48.693 37.487  1.00 88.67  ? 386 ILE A O     1 
ATOM   2728 C  CB    . ILE A 1 362 ? 11.870  47.169 38.595  1.00 89.33  ? 386 ILE A CB    1 
ATOM   2729 N  N     . LEU A 1 363 ? 8.898   46.541 38.149  1.00 89.41  ? 387 LEU A N     1 
ATOM   2730 C  CA    . LEU A 1 363 ? 7.759   46.245 37.281  1.00 89.68  ? 387 LEU A CA    1 
ATOM   2731 C  C     . LEU A 1 363 ? 6.500   46.941 37.781  1.00 89.55  ? 387 LEU A C     1 
ATOM   2732 O  O     . LEU A 1 363 ? 5.609   47.284 37.001  1.00 88.94  ? 387 LEU A O     1 
ATOM   2733 C  CB    . LEU A 1 363 ? 7.500   44.737 37.220  1.00 89.83  ? 387 LEU A CB    1 
ATOM   2734 C  CG    . LEU A 1 363 ? 8.650   43.801 36.840  1.00 90.64  ? 387 LEU A CG    1 
ATOM   2735 C  CD1   . LEU A 1 363 ? 8.094   42.417 36.583  1.00 90.54  ? 387 LEU A CD1   1 
ATOM   2736 C  CD2   . LEU A 1 363 ? 9.358   44.304 35.599  1.00 91.42  ? 387 LEU A CD2   1 
ATOM   2737 N  N     . MET A 1 364 ? 6.437   47.142 39.092  1.00 89.46  ? 388 MET A N     1 
ATOM   2738 C  CA    . MET A 1 364 ? 5.291   47.786 39.711  1.00 89.74  ? 388 MET A CA    1 
ATOM   2739 C  C     . MET A 1 364 ? 5.048   49.203 39.192  1.00 89.75  ? 388 MET A C     1 
ATOM   2740 O  O     . MET A 1 364 ? 3.914   49.561 38.863  1.00 89.22  ? 388 MET A O     1 
ATOM   2741 C  CB    . MET A 1 364 ? 5.466   47.805 41.230  1.00 90.73  ? 388 MET A CB    1 
ATOM   2742 C  CG    . MET A 1 364 ? 5.606   46.422 41.855  1.00 91.00  ? 388 MET A CG    1 
ATOM   2743 S  SD    . MET A 1 364 ? 4.378   45.235 41.255  1.00 92.10  ? 388 MET A SD    1 
ATOM   2744 C  CE    . MET A 1 364 ? 2.914   46.235 41.242  1.00 91.92  ? 388 MET A CE    1 
ATOM   2745 N  N     . LYS A 1 365 ? 6.106   50.010 39.130  1.00 89.42  ? 389 LYS A N     1 
ATOM   2746 C  CA    . LYS A 1 365 ? 5.993   51.382 38.636  1.00 88.55  ? 389 LYS A CA    1 
ATOM   2747 C  C     . LYS A 1 365 ? 5.652   51.340 37.146  1.00 88.56  ? 389 LYS A C     1 
ATOM   2748 O  O     . LYS A 1 365 ? 4.921   52.194 36.632  1.00 87.45  ? 389 LYS A O     1 
ATOM   2749 C  CB    . LYS A 1 365 ? 7.300   52.131 38.864  1.00 88.45  ? 389 LYS A CB    1 
ATOM   2750 N  N     . LEU A 1 366 ? 6.194   50.331 36.465  1.00 88.81  ? 390 LEU A N     1 
ATOM   2751 C  CA    . LEU A 1 366 ? 5.950   50.120 35.042  1.00 88.52  ? 390 LEU A CA    1 
ATOM   2752 C  C     . LEU A 1 366 ? 4.492   49.697 34.933  1.00 88.46  ? 390 LEU A C     1 
ATOM   2753 O  O     . LEU A 1 366 ? 3.836   49.892 33.907  1.00 88.34  ? 390 LEU A O     1 
ATOM   2754 C  CB    . LEU A 1 366 ? 6.858   49.006 34.512  1.00 88.49  ? 390 LEU A CB    1 
ATOM   2755 C  CG    . LEU A 1 366 ? 8.374   49.189 34.660  1.00 88.05  ? 390 LEU A CG    1 
ATOM   2756 C  CD1   . LEU A 1 366 ? 9.085   47.900 34.307  1.00 87.35  ? 390 LEU A CD1   1 
ATOM   2757 C  CD2   . LEU A 1 366 ? 8.852   50.315 33.761  1.00 88.78  ? 390 LEU A CD2   1 
ATOM   2758 N  N     . PHE A 1 367 ? 4.004   49.117 36.025  1.00 88.19  ? 391 PHE A N     1 
ATOM   2759 C  CA    . PHE A 1 367 ? 2.630   48.654 36.132  1.00 88.60  ? 391 PHE A CA    1 
ATOM   2760 C  C     . PHE A 1 367 ? 1.692   49.858 36.122  1.00 88.41  ? 391 PHE A C     1 
ATOM   2761 O  O     . PHE A 1 367 ? 0.851   50.004 35.232  1.00 88.06  ? 391 PHE A O     1 
ATOM   2762 C  CB    . PHE A 1 367 ? 2.458   47.867 37.438  1.00 88.84  ? 391 PHE A CB    1 
ATOM   2763 C  CG    . PHE A 1 367 ? 1.081   47.292 37.641  1.00 90.18  ? 391 PHE A CG    1 
ATOM   2764 C  CD1   . PHE A 1 367 ? 0.769   46.629 38.823  1.00 90.27  ? 391 PHE A CD1   1 
ATOM   2765 C  CD2   . PHE A 1 367 ? 0.099   47.393 36.652  1.00 91.17  ? 391 PHE A CD2   1 
ATOM   2766 C  CE1   . PHE A 1 367 ? -0.496  46.072 39.020  1.00 91.47  ? 391 PHE A CE1   1 
ATOM   2767 C  CE2   . PHE A 1 367 ? -1.171  46.841 36.836  1.00 91.61  ? 391 PHE A CE2   1 
ATOM   2768 C  CZ    . PHE A 1 367 ? -1.469  46.179 38.023  1.00 91.70  ? 391 PHE A CZ    1 
ATOM   2769 N  N     . ARG A 1 368 ? 1.853   50.722 37.118  1.00 88.44  ? 392 ARG A N     1 
ATOM   2770 C  CA    . ARG A 1 368 ? 1.019   51.910 37.252  1.00 88.35  ? 392 ARG A CA    1 
ATOM   2771 C  C     . ARG A 1 368 ? 0.971   52.781 36.001  1.00 88.05  ? 392 ARG A C     1 
ATOM   2772 O  O     . ARG A 1 368 ? -0.104  53.215 35.592  1.00 88.41  ? 392 ARG A O     1 
ATOM   2773 C  CB    . ARG A 1 368 ? 1.477   52.736 38.464  1.00 87.52  ? 392 ARG A CB    1 
ATOM   2774 C  CG    . ARG A 1 368 ? 1.181   52.055 39.802  1.00 86.41  ? 392 ARG A CG    1 
ATOM   2775 C  CD    . ARG A 1 368 ? 2.430   51.880 40.668  1.00 85.20  ? 392 ARG A CD    1 
ATOM   2776 N  NE    . ARG A 1 368 ? 2.212   50.905 41.738  1.00 84.14  ? 392 ARG A NE    1 
ATOM   2777 C  CZ    . ARG A 1 368 ? 3.129   50.544 42.632  1.00 83.61  ? 392 ARG A CZ    1 
ATOM   2778 N  NH1   . ARG A 1 368 ? 4.343   51.077 42.603  1.00 83.08  ? 392 ARG A NH1   1 
ATOM   2779 N  NH2   . ARG A 1 368 ? 2.835   49.636 43.553  1.00 83.38  ? 392 ARG A NH2   1 
ATOM   2780 N  N     . ASN A 1 369 ? 2.125   53.027 35.388  1.00 87.72  ? 393 ASN A N     1 
ATOM   2781 C  CA    . ASN A 1 369 ? 2.176   53.854 34.186  1.00 87.78  ? 393 ASN A CA    1 
ATOM   2782 C  C     . ASN A 1 369 ? 1.137   53.387 33.160  1.00 87.55  ? 393 ASN A C     1 
ATOM   2783 O  O     . ASN A 1 369 ? 0.783   54.119 32.233  1.00 87.38  ? 393 ASN A O     1 
ATOM   2784 C  CB    . ASN A 1 369 ? 3.582   53.803 33.577  1.00 88.07  ? 393 ASN A CB    1 
ATOM   2785 C  CG    . ASN A 1 369 ? 3.774   54.815 32.458  1.00 88.68  ? 393 ASN A CG    1 
ATOM   2786 O  OD1   . ASN A 1 369 ? 3.115   54.750 31.417  1.00 89.39  ? 393 ASN A OD1   1 
ATOM   2787 N  ND2   . ASN A 1 369 ? 4.680   55.760 32.670  1.00 88.70  ? 393 ASN A ND2   1 
ATOM   2788 N  N     . MET A 1 370 ? 0.641   52.167 33.345  1.00 87.32  ? 394 MET A N     1 
ATOM   2789 C  CA    . MET A 1 370 ? -0.347  51.586 32.443  1.00 86.34  ? 394 MET A CA    1 
ATOM   2790 C  C     . MET A 1 370 ? -1.774  51.848 32.926  1.00 85.36  ? 394 MET A C     1 
ATOM   2791 O  O     . MET A 1 370 ? -2.715  51.154 32.538  1.00 84.21  ? 394 MET A O     1 
ATOM   2792 C  CB    . MET A 1 370 ? -0.099  50.079 32.319  1.00 86.91  ? 394 MET A CB    1 
ATOM   2793 C  CG    . MET A 1 370 ? 1.359   49.714 32.018  1.00 86.13  ? 394 MET A CG    1 
ATOM   2794 S  SD    . MET A 1 370 ? 1.544   48.393 30.781  1.00 86.82  ? 394 MET A SD    1 
ATOM   2795 C  CE    . MET A 1 370 ? 2.064   46.989 31.799  1.00 85.59  ? 394 MET A CE    1 
ATOM   2796 N  N     . THR A 1 380 ? -6.769  40.941 31.071  1.00 76.70  ? 404 THR A N     1 
ATOM   2797 C  CA    . THR A 1 380 ? -7.039  39.538 31.367  1.00 75.84  ? 404 THR A CA    1 
ATOM   2798 C  C     . THR A 1 380 ? -5.734  38.727 31.449  1.00 75.61  ? 404 THR A C     1 
ATOM   2799 O  O     . THR A 1 380 ? -5.645  37.750 32.195  1.00 75.28  ? 404 THR A O     1 
ATOM   2800 C  CB    . THR A 1 380 ? -7.946  38.909 30.283  1.00 75.81  ? 404 THR A CB    1 
ATOM   2801 O  OG1   . THR A 1 380 ? -7.137  38.417 29.206  1.00 75.59  ? 404 THR A OG1   1 
ATOM   2802 C  CG2   . THR A 1 380 ? -8.919  39.951 29.733  1.00 74.33  ? 404 THR A CG2   1 
ATOM   2803 N  N     . LEU A 1 381 ? -4.725  39.138 30.680  1.00 74.33  ? 405 LEU A N     1 
ATOM   2804 C  CA    . LEU A 1 381 ? -3.436  38.450 30.661  1.00 72.19  ? 405 LEU A CA    1 
ATOM   2805 C  C     . LEU A 1 381 ? -2.281  39.333 31.130  1.00 70.87  ? 405 LEU A C     1 
ATOM   2806 O  O     . LEU A 1 381 ? -2.277  40.541 30.917  1.00 70.23  ? 405 LEU A O     1 
ATOM   2807 C  CB    . LEU A 1 381 ? -3.149  37.930 29.258  1.00 71.56  ? 405 LEU A CB    1 
ATOM   2808 N  N     . LEU A 1 382 ? -1.301  38.708 31.769  1.00 70.16  ? 406 LEU A N     1 
ATOM   2809 C  CA    . LEU A 1 382 ? -0.123  39.406 32.268  1.00 70.29  ? 406 LEU A CA    1 
ATOM   2810 C  C     . LEU A 1 382 ? 1.139   38.616 31.944  1.00 70.04  ? 406 LEU A C     1 
ATOM   2811 O  O     . LEU A 1 382 ? 1.197   37.406 32.172  1.00 69.72  ? 406 LEU A O     1 
ATOM   2812 C  CB    . LEU A 1 382 ? -0.200  39.597 33.783  1.00 70.64  ? 406 LEU A CB    1 
ATOM   2813 C  CG    . LEU A 1 382 ? -1.254  40.555 34.326  1.00 71.57  ? 406 LEU A CG    1 
ATOM   2814 C  CD1   . LEU A 1 382 ? -1.053  40.741 35.832  1.00 71.37  ? 406 LEU A CD1   1 
ATOM   2815 C  CD2   . LEU A 1 382 ? -1.137  41.883 33.602  1.00 71.03  ? 406 LEU A CD2   1 
ATOM   2816 N  N     . SER A 1 383 ? 2.153   39.305 31.422  1.00 69.44  ? 407 SER A N     1 
ATOM   2817 C  CA    . SER A 1 383 ? 3.409   38.648 31.078  1.00 67.48  ? 407 SER A CA    1 
ATOM   2818 C  C     . SER A 1 383 ? 4.629   39.543 31.215  1.00 65.88  ? 407 SER A C     1 
ATOM   2819 O  O     . SER A 1 383 ? 4.612   40.723 30.862  1.00 65.25  ? 407 SER A O     1 
ATOM   2820 C  CB    . SER A 1 383 ? 3.354   38.102 29.649  1.00 66.68  ? 407 SER A CB    1 
ATOM   2821 O  OG    . SER A 1 383 ? 3.302   39.157 28.708  1.00 65.73  ? 407 SER A OG    1 
ATOM   2822 N  N     . VAL A 1 384 ? 5.692   38.952 31.735  1.00 64.90  ? 408 VAL A N     1 
ATOM   2823 C  CA    . VAL A 1 384 ? 6.952   39.645 31.908  1.00 64.42  ? 408 VAL A CA    1 
ATOM   2824 C  C     . VAL A 1 384 ? 7.904   39.123 30.842  1.00 63.36  ? 408 VAL A C     1 
ATOM   2825 O  O     . VAL A 1 384 ? 7.832   37.958 30.442  1.00 62.75  ? 408 VAL A O     1 
ATOM   2826 C  CB    . VAL A 1 384 ? 7.547   39.366 33.296  1.00 65.10  ? 408 VAL A CB    1 
ATOM   2827 C  CG1   . VAL A 1 384 ? 8.918   40.004 33.422  1.00 65.93  ? 408 VAL A CG1   1 
ATOM   2828 C  CG2   . VAL A 1 384 ? 6.617   39.903 34.362  1.00 67.39  ? 408 VAL A CG2   1 
ATOM   2829 N  N     . CYS A 1 385 ? 8.794   39.986 30.376  1.00 61.96  ? 409 CYS A N     1 
ATOM   2830 C  CA    . CYS A 1 385 ? 9.740   39.585 29.360  1.00 60.33  ? 409 CYS A CA    1 
ATOM   2831 C  C     . CYS A 1 385 ? 11.130  40.153 29.577  1.00 60.64  ? 409 CYS A C     1 
ATOM   2832 O  O     . CYS A 1 385 ? 11.314  41.364 29.647  1.00 60.66  ? 409 CYS A O     1 
ATOM   2833 C  CB    . CYS A 1 385 ? 9.237   40.006 27.979  1.00 57.98  ? 409 CYS A CB    1 
ATOM   2834 S  SG    . CYS A 1 385 ? 10.355  39.549 26.636  1.00 56.24  ? 409 CYS A SG    1 
ATOM   2835 N  N     . PHE A 1 386 ? 12.111  39.271 29.697  1.00 61.04  ? 410 PHE A N     1 
ATOM   2836 C  CA    . PHE A 1 386 ? 13.486  39.709 29.841  1.00 61.59  ? 410 PHE A CA    1 
ATOM   2837 C  C     . PHE A 1 386 ? 14.087  39.657 28.447  1.00 61.37  ? 410 PHE A C     1 
ATOM   2838 O  O     . PHE A 1 386 ? 14.296  38.579 27.896  1.00 61.48  ? 410 PHE A O     1 
ATOM   2839 C  CB    . PHE A 1 386 ? 14.256  38.781 30.770  1.00 63.34  ? 410 PHE A CB    1 
ATOM   2840 C  CG    . PHE A 1 386 ? 13.908  38.957 32.205  1.00 64.91  ? 410 PHE A CG    1 
ATOM   2841 C  CD1   . PHE A 1 386 ? 12.638  38.641 32.665  1.00 66.33  ? 410 PHE A CD1   1 
ATOM   2842 C  CD2   . PHE A 1 386 ? 14.836  39.475 33.094  1.00 65.88  ? 410 PHE A CD2   1 
ATOM   2843 C  CE1   . PHE A 1 386 ? 12.295  38.841 33.995  1.00 67.25  ? 410 PHE A CE1   1 
ATOM   2844 C  CE2   . PHE A 1 386 ? 14.506  39.682 34.427  1.00 66.96  ? 410 PHE A CE2   1 
ATOM   2845 C  CZ    . PHE A 1 386 ? 13.234  39.365 34.880  1.00 67.63  ? 410 PHE A CZ    1 
ATOM   2846 N  N     . CYS A 1 387 ? 14.340  40.820 27.864  1.00 61.09  ? 411 CYS A N     1 
ATOM   2847 C  CA    . CYS A 1 387 ? 14.919  40.866 26.534  1.00 61.99  ? 411 CYS A CA    1 
ATOM   2848 C  C     . CYS A 1 387 ? 16.225  41.633 26.566  1.00 62.46  ? 411 CYS A C     1 
ATOM   2849 O  O     . CYS A 1 387 ? 16.672  42.045 27.631  1.00 62.47  ? 411 CYS A O     1 
ATOM   2850 C  CB    . CYS A 1 387 ? 13.946  41.519 25.562  1.00 62.11  ? 411 CYS A CB    1 
ATOM   2851 S  SG    . CYS A 1 387 ? 13.458  43.170 26.036  1.00 64.61  ? 411 CYS A SG    1 
ATOM   2852 N  N     . ASN A 1 388 ? 16.836  41.817 25.398  1.00 63.84  ? 412 ASN A N     1 
ATOM   2853 C  CA    . ASN A 1 388 ? 18.111  42.526 25.287  1.00 64.15  ? 412 ASN A CA    1 
ATOM   2854 C  C     . ASN A 1 388 ? 19.188  41.802 26.099  1.00 64.23  ? 412 ASN A C     1 
ATOM   2855 O  O     . ASN A 1 388 ? 19.708  42.330 27.082  1.00 63.81  ? 412 ASN A O     1 
ATOM   2856 C  CB    . ASN A 1 388 ? 17.952  43.965 25.778  1.00 65.46  ? 412 ASN A CB    1 
ATOM   2857 C  CG    . ASN A 1 388 ? 19.147  44.831 25.444  1.00 66.85  ? 412 ASN A CG    1 
ATOM   2858 O  OD1   . ASN A 1 388 ? 20.215  44.704 26.046  1.00 67.05  ? 412 ASN A OD1   1 
ATOM   2859 N  ND2   . ASN A 1 388 ? 18.973  45.717 24.468  1.00 67.78  ? 412 ASN A ND2   1 
ATOM   2860 N  N     . LEU A 1 389 ? 19.513  40.584 25.672  1.00 64.86  ? 413 LEU A N     1 
ATOM   2861 C  CA    . LEU A 1 389 ? 20.512  39.754 26.339  1.00 65.49  ? 413 LEU A CA    1 
ATOM   2862 C  C     . LEU A 1 389 ? 21.939  40.095 25.909  1.00 67.38  ? 413 LEU A C     1 
ATOM   2863 O  O     . LEU A 1 389 ? 22.164  40.583 24.795  1.00 67.47  ? 413 LEU A O     1 
ATOM   2864 C  CB    . LEU A 1 389 ? 20.243  38.277 26.041  1.00 63.56  ? 413 LEU A CB    1 
ATOM   2865 C  CG    . LEU A 1 389 ? 19.009  37.621 26.652  1.00 62.11  ? 413 LEU A CG    1 
ATOM   2866 C  CD1   . LEU A 1 389 ? 19.236  37.456 28.138  1.00 63.71  ? 413 LEU A CD1   1 
ATOM   2867 C  CD2   . LEU A 1 389 ? 17.766  38.448 26.368  1.00 61.05  ? 413 LEU A CD2   1 
ATOM   2868 N  N     . LYS A 1 390 ? 22.897  39.828 26.800  1.00 68.92  ? 414 LYS A N     1 
ATOM   2869 C  CA    . LYS A 1 390 ? 24.314  40.082 26.535  1.00 70.10  ? 414 LYS A CA    1 
ATOM   2870 C  C     . LYS A 1 390 ? 25.181  39.163 27.392  1.00 70.78  ? 414 LYS A C     1 
ATOM   2871 O  O     . LYS A 1 390 ? 24.654  38.634 28.392  1.00 71.73  ? 414 LYS A O     1 
ATOM   2872 C  CB    . LYS A 1 390 ? 24.655  41.548 26.833  1.00 69.43  ? 414 LYS A CB    1 
ATOM   2873 C  CG    . LYS A 1 390 ? 23.872  42.532 25.984  1.00 69.41  ? 414 LYS A CG    1 
ATOM   2874 C  CD    . LYS A 1 390 ? 24.170  43.967 26.344  1.00 71.07  ? 414 LYS A CD    1 
ATOM   2875 C  CE    . LYS A 1 390 ? 23.281  44.910 25.552  1.00 71.91  ? 414 LYS A CE    1 
ATOM   2876 N  NZ    . LYS A 1 390 ? 23.555  46.331 25.885  1.00 73.30  ? 414 LYS A NZ    1 
ATOM   2877 O  OXT   . LYS A 1 390 ? 26.374  38.987 27.067  1.00 71.70  ? 414 LYS A OXT   1 
ATOM   2878 O  "O5'" . DA  B 2 1   ? 6.384   52.288 25.549  1.00 44.01  ? 867 DA  P "O5'" 1 
ATOM   2879 C  "C5'" . DA  B 2 1   ? 6.680   51.992 24.201  1.00 51.77  ? 867 DA  P "C5'" 1 
ATOM   2880 C  "C4'" . DA  B 2 1   ? 5.469   52.077 23.305  1.00 56.97  ? 867 DA  P "C4'" 1 
ATOM   2881 O  "O4'" . DA  B 2 1   ? 5.926   52.024 21.932  1.00 58.76  ? 867 DA  P "O4'" 1 
ATOM   2882 C  "C3'" . DA  B 2 1   ? 4.494   50.913 23.449  1.00 59.87  ? 867 DA  P "C3'" 1 
ATOM   2883 O  "O3'" . DA  B 2 1   ? 3.151   51.331 23.153  1.00 62.94  ? 867 DA  P "O3'" 1 
ATOM   2884 C  "C2'" . DA  B 2 1   ? 5.040   49.894 22.465  1.00 58.79  ? 867 DA  P "C2'" 1 
ATOM   2885 C  "C1'" . DA  B 2 1   ? 5.627   50.756 21.349  1.00 56.50  ? 867 DA  P "C1'" 1 
ATOM   2886 N  N9    . DA  B 2 1   ? 6.884   50.202 20.839  1.00 52.48  ? 867 DA  P N9    1 
ATOM   2887 C  C8    . DA  B 2 1   ? 7.867   49.610 21.592  1.00 51.26  ? 867 DA  P C8    1 
ATOM   2888 N  N7    . DA  B 2 1   ? 8.874   49.161 20.886  1.00 50.54  ? 867 DA  P N7    1 
ATOM   2889 C  C5    . DA  B 2 1   ? 8.539   49.489 19.582  1.00 47.69  ? 867 DA  P C5    1 
ATOM   2890 C  C6    . DA  B 2 1   ? 9.197   49.277 18.368  1.00 47.37  ? 867 DA  P C6    1 
ATOM   2891 N  N6    . DA  B 2 1   ? 10.375  48.660 18.281  1.00 46.69  ? 867 DA  P N6    1 
ATOM   2892 N  N1    . DA  B 2 1   ? 8.600   49.722 17.237  1.00 46.14  ? 867 DA  P N1    1 
ATOM   2893 C  C2    . DA  B 2 1   ? 7.418   50.338 17.342  1.00 46.69  ? 867 DA  P C2    1 
ATOM   2894 N  N3    . DA  B 2 1   ? 6.698   50.598 18.436  1.00 47.84  ? 867 DA  P N3    1 
ATOM   2895 C  C4    . DA  B 2 1   ? 7.320   50.140 19.535  1.00 48.24  ? 867 DA  P C4    1 
ATOM   2896 P  P     . DG  B 2 2   ? 1.989   50.231 22.954  1.00 65.65  ? 868 DG  P P     1 
ATOM   2897 O  OP1   . DG  B 2 2   ? 0.700   50.965 23.017  1.00 65.42  ? 868 DG  P OP1   1 
ATOM   2898 O  OP2   . DG  B 2 2   ? 2.229   49.095 23.889  1.00 63.68  ? 868 DG  P OP2   1 
ATOM   2899 O  "O5'" . DG  B 2 2   ? 2.202   49.766 21.440  1.00 62.57  ? 868 DG  P "O5'" 1 
ATOM   2900 C  "C5'" . DG  B 2 2   ? 2.340   50.750 20.420  1.00 62.53  ? 868 DG  P "C5'" 1 
ATOM   2901 C  "C4'" . DG  B 2 2   ? 2.079   50.168 19.049  1.00 64.18  ? 868 DG  P "C4'" 1 
ATOM   2902 O  "O4'" . DG  B 2 2   ? 3.316   49.672 18.460  1.00 62.44  ? 868 DG  P "O4'" 1 
ATOM   2903 C  "C3'" . DG  B 2 2   ? 1.137   48.962 19.080  1.00 64.57  ? 868 DG  P "C3'" 1 
ATOM   2904 O  "O3'" . DG  B 2 2   ? 0.390   48.906 17.852  1.00 68.76  ? 868 DG  P "O3'" 1 
ATOM   2905 C  "C2'" . DG  B 2 2   ? 2.099   47.797 19.233  1.00 62.38  ? 868 DG  P "C2'" 1 
ATOM   2906 C  "C1'" . DG  B 2 2   ? 3.267   48.255 18.368  1.00 57.73  ? 868 DG  P "C1'" 1 
ATOM   2907 N  N9    . DG  B 2 2   ? 4.584   47.689 18.665  1.00 51.33  ? 868 DG  P N9    1 
ATOM   2908 C  C8    . DG  B 2 2   ? 5.086   47.314 19.893  1.00 48.56  ? 868 DG  P C8    1 
ATOM   2909 N  N7    . DG  B 2 2   ? 6.260   46.740 19.814  1.00 45.55  ? 868 DG  P N7    1 
ATOM   2910 C  C5    . DG  B 2 2   ? 6.563   46.759 18.455  1.00 44.49  ? 868 DG  P C5    1 
ATOM   2911 C  C6    . DG  B 2 2   ? 7.702   46.270 17.753  1.00 43.10  ? 868 DG  P C6    1 
ATOM   2912 O  O6    . DG  B 2 2   ? 8.704   45.701 18.201  1.00 43.96  ? 868 DG  P O6    1 
ATOM   2913 N  N1    . DG  B 2 2   ? 7.597   46.499 16.388  1.00 40.16  ? 868 DG  P N1    1 
ATOM   2914 C  C2    . DG  B 2 2   ? 6.543   47.113 15.768  1.00 39.31  ? 868 DG  P C2    1 
ATOM   2915 N  N2    . DG  B 2 2   ? 6.644   47.233 14.432  1.00 37.22  ? 868 DG  P N2    1 
ATOM   2916 N  N3    . DG  B 2 2   ? 5.477   47.571 16.402  1.00 40.40  ? 868 DG  P N3    1 
ATOM   2917 C  C4    . DG  B 2 2   ? 5.551   47.360 17.735  1.00 45.62  ? 868 DG  P C4    1 
ATOM   2918 P  P     . DG  B 2 3   ? -0.320  47.533 17.390  1.00 70.52  ? 869 DG  P P     1 
ATOM   2919 O  OP1   . DG  B 2 3   ? -1.632  47.898 16.779  1.00 68.91  ? 869 DG  P OP1   1 
ATOM   2920 O  OP2   . DG  B 2 3   ? -0.278  46.571 18.525  1.00 69.57  ? 869 DG  P OP2   1 
ATOM   2921 O  "O5'" . DG  B 2 3   ? 0.630   47.021 16.213  1.00 68.75  ? 869 DG  P "O5'" 1 
ATOM   2922 C  "C5'" . DG  B 2 3   ? 1.174   47.961 15.283  1.00 67.64  ? 869 DG  P "C5'" 1 
ATOM   2923 C  "C4'" . DG  B 2 3   ? 1.559   47.290 13.983  1.00 66.53  ? 869 DG  P "C4'" 1 
ATOM   2924 O  "O4'" . DG  B 2 3   ? 2.872   46.682 14.099  1.00 65.01  ? 869 DG  P "O4'" 1 
ATOM   2925 C  "C3'" . DG  B 2 3   ? 0.627   46.150 13.591  1.00 66.70  ? 869 DG  P "C3'" 1 
ATOM   2926 O  "O3'" . DG  B 2 3   ? 0.554   46.042 12.169  1.00 68.97  ? 869 DG  P "O3'" 1 
ATOM   2927 C  "C2'" . DG  B 2 3   ? 1.280   44.941 14.243  1.00 64.14  ? 869 DG  P "C2'" 1 
ATOM   2928 C  "C1'" . DG  B 2 3   ? 2.767   45.260 14.107  1.00 59.58  ? 869 DG  P "C1'" 1 
ATOM   2929 N  N9    . DG  B 2 3   ? 3.633   44.748 15.169  1.00 52.95  ? 869 DG  P N9    1 
ATOM   2930 C  C8    . DG  B 2 3   ? 3.359   44.714 16.518  1.00 50.90  ? 869 DG  P C8    1 
ATOM   2931 N  N7    . DG  B 2 3   ? 4.325   44.191 17.228  1.00 47.51  ? 869 DG  P N7    1 
ATOM   2932 C  C5    . DG  B 2 3   ? 5.301   43.857 16.295  1.00 45.68  ? 869 DG  P C5    1 
ATOM   2933 C  C6    . DG  B 2 3   ? 6.583   43.249 16.474  1.00 43.00  ? 869 DG  P C6    1 
ATOM   2934 O  O6    . DG  B 2 3   ? 7.123   42.874 17.524  1.00 40.29  ? 869 DG  P O6    1 
ATOM   2935 N  N1    . DG  B 2 3   ? 7.247   43.091 15.261  1.00 41.79  ? 869 DG  P N1    1 
ATOM   2936 C  C2    . DG  B 2 3   ? 6.751   43.466 14.030  1.00 42.74  ? 869 DG  P C2    1 
ATOM   2937 N  N2    . DG  B 2 3   ? 7.553   43.227 12.973  1.00 40.43  ? 869 DG  P N2    1 
ATOM   2938 N  N3    . DG  B 2 3   ? 5.561   44.032 13.849  1.00 44.56  ? 869 DG  P N3    1 
ATOM   2939 C  C4    . DG  B 2 3   ? 4.894   44.195 15.017  1.00 48.18  ? 869 DG  P C4    1 
ATOM   2940 P  P     . DA  B 2 4   ? -0.550  45.080 11.502  1.00 73.84  ? 870 DA  P P     1 
ATOM   2941 O  OP1   . DA  B 2 4   ? -1.448  45.922 10.655  1.00 73.53  ? 870 DA  P OP1   1 
ATOM   2942 O  OP2   . DA  B 2 4   ? -1.129  44.211 12.564  1.00 71.78  ? 870 DA  P OP2   1 
ATOM   2943 O  "O5'" . DA  B 2 4   ? 0.316   44.147 10.553  1.00 70.31  ? 870 DA  P "O5'" 1 
ATOM   2944 C  "C5'" . DA  B 2 4   ? 1.599   43.724 10.982  1.00 66.06  ? 870 DA  P "C5'" 1 
ATOM   2945 C  "C4'" . DA  B 2 4   ? 2.115   42.611 10.105  1.00 61.67  ? 870 DA  P "C4'" 1 
ATOM   2946 O  "O4'" . DA  B 2 4   ? 3.287   42.109 10.794  1.00 58.23  ? 870 DA  P "O4'" 1 
ATOM   2947 C  "C3'" . DA  B 2 4   ? 1.166   41.420 9.977   1.00 59.15  ? 870 DA  P "C3'" 1 
ATOM   2948 O  "O3'" . DA  B 2 4   ? 1.297   40.749 8.710   1.00 59.34  ? 870 DA  P "O3'" 1 
ATOM   2949 C  "C2'" . DA  B 2 4   ? 1.529   40.574 11.181  1.00 57.64  ? 870 DA  P "C2'" 1 
ATOM   2950 C  "C1'" . DA  B 2 4   ? 3.015   40.853 11.396  1.00 53.82  ? 870 DA  P "C1'" 1 
ATOM   2951 N  N9    . DA  B 2 4   ? 3.350   40.957 12.818  1.00 47.65  ? 870 DA  P N9    1 
ATOM   2952 C  C8    . DA  B 2 4   ? 2.566   41.474 13.824  1.00 45.36  ? 870 DA  P C8    1 
ATOM   2953 N  N7    . DA  B 2 4   ? 3.082   41.336 15.022  1.00 42.73  ? 870 DA  P N7    1 
ATOM   2954 C  C5    . DA  B 2 4   ? 4.301   40.713 14.788  1.00 41.76  ? 870 DA  P C5    1 
ATOM   2955 C  C6    . DA  B 2 4   ? 5.324   40.282 15.649  1.00 41.47  ? 870 DA  P C6    1 
ATOM   2956 N  N6    . DA  B 2 4   ? 5.282   40.417 16.976  1.00 38.84  ? 870 DA  P N6    1 
ATOM   2957 N  N1    . DA  B 2 4   ? 6.407   39.698 15.092  1.00 41.14  ? 870 DA  P N1    1 
ATOM   2958 C  C2    . DA  B 2 4   ? 6.449   39.567 13.758  1.00 40.78  ? 870 DA  P C2    1 
ATOM   2959 N  N3    . DA  B 2 4   ? 5.555   39.926 12.849  1.00 39.20  ? 870 DA  P N3    1 
ATOM   2960 C  C4    . DA  B 2 4   ? 4.490   40.497 13.433  1.00 43.17  ? 870 DA  P C4    1 
ATOM   2961 P  P     . DC  B 2 5   ? 0.639   39.285 8.500   1.00 62.85  ? 871 DC  P P     1 
ATOM   2962 O  OP1   . DC  B 2 5   ? 0.545   38.990 7.043   1.00 61.18  ? 871 DC  P OP1   1 
ATOM   2963 O  OP2   . DC  B 2 5   ? -0.574  39.167 9.347   1.00 62.11  ? 871 DC  P OP2   1 
ATOM   2964 O  "O5'" . DC  B 2 5   ? 1.748   38.320 9.108   1.00 60.13  ? 871 DC  P "O5'" 1 
ATOM   2965 C  "C5'" . DC  B 2 5   ? 3.128   38.573 8.856   1.00 55.66  ? 871 DC  P "C5'" 1 
ATOM   2966 C  "C4'" . DC  B 2 5   ? 3.933   37.312 9.049   1.00 52.62  ? 871 DC  P "C4'" 1 
ATOM   2967 O  "O4'" . DC  B 2 5   ? 4.537   37.358 10.371  1.00 50.58  ? 871 DC  P "O4'" 1 
ATOM   2968 C  "C3'" . DC  B 2 5   ? 3.008   36.095 9.059   1.00 50.58  ? 871 DC  P "C3'" 1 
ATOM   2969 O  "O3'" . DC  B 2 5   ? 3.605   34.916 8.528   1.00 49.22  ? 871 DC  P "O3'" 1 
ATOM   2970 C  "C2'" . DC  B 2 5   ? 2.654   35.951 10.524  1.00 49.47  ? 871 DC  P "C2'" 1 
ATOM   2971 C  "C1'" . DC  B 2 5   ? 3.934   36.392 11.212  1.00 46.12  ? 871 DC  P "C1'" 1 
ATOM   2972 N  N1    . DC  B 2 5   ? 3.718   36.971 12.548  1.00 41.16  ? 871 DC  P N1    1 
ATOM   2973 C  C2    . DC  B 2 5   ? 4.696   36.784 13.539  1.00 38.59  ? 871 DC  P C2    1 
ATOM   2974 O  O2    . DC  B 2 5   ? 5.787   36.288 13.225  1.00 37.28  ? 871 DC  P O2    1 
ATOM   2975 N  N3    . DC  B 2 5   ? 4.422   37.151 14.814  1.00 34.66  ? 871 DC  P N3    1 
ATOM   2976 C  C4    . DC  B 2 5   ? 3.250   37.705 15.110  1.00 32.32  ? 871 DC  P C4    1 
ATOM   2977 N  N4    . DC  B 2 5   ? 3.012   38.003 16.380  1.00 29.25  ? 871 DC  P N4    1 
ATOM   2978 C  C5    . DC  B 2 5   ? 2.268   37.973 14.113  1.00 34.33  ? 871 DC  P C5    1 
ATOM   2979 C  C6    . DC  B 2 5   ? 2.547   37.606 12.852  1.00 38.01  ? 871 DC  P C6    1 
ATOM   2980 P  P     . DC  B 2 6   ? 2.820   33.511 8.649   1.00 49.89  ? 872 DC  P P     1 
ATOM   2981 O  OP1   . DC  B 2 6   ? 3.079   32.742 7.403   1.00 48.32  ? 872 DC  P OP1   1 
ATOM   2982 O  OP2   . DC  B 2 6   ? 1.416   33.735 9.084   1.00 47.73  ? 872 DC  P OP2   1 
ATOM   2983 O  "O5'" . DC  B 2 6   ? 3.581   32.811 9.859   1.00 48.18  ? 872 DC  P "O5'" 1 
ATOM   2984 C  "C5'" . DC  B 2 6   ? 5.010   32.830 9.929   1.00 44.37  ? 872 DC  P "C5'" 1 
ATOM   2985 C  "C4'" . DC  B 2 6   ? 5.510   31.596 10.645  1.00 41.66  ? 872 DC  P "C4'" 1 
ATOM   2986 O  "O4'" . DC  B 2 6   ? 5.793   31.947 12.033  1.00 40.07  ? 872 DC  P "O4'" 1 
ATOM   2987 C  "C3'" . DC  B 2 6   ? 4.398   30.552 10.704  1.00 40.47  ? 872 DC  P "C3'" 1 
ATOM   2988 O  "O3'" . DC  B 2 6   ? 4.807   29.200 10.631  1.00 39.75  ? 872 DC  P "O3'" 1 
ATOM   2989 C  "C2'" . DC  B 2 6   ? 3.701   30.853 12.011  1.00 41.17  ? 872 DC  P "C2'" 1 
ATOM   2990 C  "C1'" . DC  B 2 6   ? 4.830   31.359 12.903  1.00 38.18  ? 872 DC  P "C1'" 1 
ATOM   2991 N  N1    . DC  B 2 6   ? 4.306   32.384 13.831  1.00 34.63  ? 872 DC  P N1    1 
ATOM   2992 C  C2    . DC  B 2 6   ? 4.727   32.386 15.163  1.00 31.18  ? 872 DC  P C2    1 
ATOM   2993 O  O2    . DC  B 2 6   ? 5.662   31.655 15.496  1.00 31.44  ? 872 DC  P O2    1 
ATOM   2994 N  N3    . DC  B 2 6   ? 4.094   33.185 16.050  1.00 27.10  ? 872 DC  P N3    1 
ATOM   2995 C  C4    . DC  B 2 6   ? 3.100   33.976 15.645  1.00 26.96  ? 872 DC  P C4    1 
ATOM   2996 N  N4    . DC  B 2 6   ? 2.466   34.705 16.558  1.00 23.57  ? 872 DC  P N4    1 
ATOM   2997 C  C5    . DC  B 2 6   ? 2.704   34.049 14.282  1.00 28.78  ? 872 DC  P C5    1 
ATOM   2998 C  C6    . DC  B 2 6   ? 3.338   33.259 13.414  1.00 32.03  ? 872 DC  P C6    1 
HETATM 2999 N  N1    . DOC B 2 7   ? 3.305   28.435 16.072  1.00 38.96  ? 873 DOC P N1    1 
HETATM 3000 C  C2    . DOC B 2 7   ? 3.221   28.754 17.433  1.00 37.78  ? 873 DOC P C2    1 
HETATM 3001 N  N3    . DOC B 2 7   ? 2.510   29.836 17.818  1.00 36.83  ? 873 DOC P N3    1 
HETATM 3002 C  C4    . DOC B 2 7   ? 1.908   30.593 16.904  1.00 36.64  ? 873 DOC P C4    1 
HETATM 3003 C  C5    . DOC B 2 7   ? 1.999   30.310 15.508  1.00 36.17  ? 873 DOC P C5    1 
HETATM 3004 C  C6    . DOC B 2 7   ? 2.707   29.235 15.139  1.00 36.86  ? 873 DOC P C6    1 
HETATM 3005 O  O2    . DOC B 2 7   ? 3.801   28.034 18.250  1.00 35.57  ? 873 DOC P O2    1 
HETATM 3006 N  N4    . DOC B 2 7   ? 1.205   31.637 17.336  1.00 36.34  ? 873 DOC P N4    1 
HETATM 3007 C  "C1'" . DOC B 2 7   ? 4.020   27.207 15.689  1.00 40.15  ? 873 DOC P "C1'" 1 
HETATM 3008 C  "C2'" . DOC B 2 7   ? 3.295   26.259 14.747  1.00 40.19  ? 873 DOC P "C2'" 1 
HETATM 3009 C  "C3'" . DOC B 2 7   ? 4.457   25.545 14.090  1.00 41.64  ? 873 DOC P "C3'" 1 
HETATM 3010 C  "C4'" . DOC B 2 7   ? 5.492   26.659 13.952  1.00 43.15  ? 873 DOC P "C4'" 1 
HETATM 3011 O  "O4'" . DOC B 2 7   ? 5.238   27.560 15.059  1.00 43.08  ? 873 DOC P "O4'" 1 
HETATM 3012 C  "C5'" . DOC B 2 7   ? 5.365   27.401 12.642  1.00 43.01  ? 873 DOC P "C5'" 1 
HETATM 3013 O  "O5'" . DOC B 2 7   ? 4.009   27.435 12.186  1.00 41.40  ? 873 DOC P "O5'" 1 
HETATM 3014 P  P     . DOC B 2 7   ? 3.693   28.052 10.750  1.00 39.00  ? 873 DOC P P     1 
HETATM 3015 O  OP1   . DOC B 2 7   ? 3.985   27.021 9.728   1.00 37.68  ? 873 DOC P OP1   1 
HETATM 3016 O  OP2   . DOC B 2 7   ? 2.365   28.720 10.763  1.00 35.81  ? 873 DOC P OP2   1 
ATOM   3017 O  "O5'" . DT  C 3 1   ? -8.291  34.771 20.811  1.00 75.55  ? 839 DT  T "O5'" 1 
ATOM   3018 C  "C5'" . DT  C 3 1   ? -8.524  35.266 22.131  1.00 75.04  ? 839 DT  T "C5'" 1 
ATOM   3019 C  "C4'" . DT  C 3 1   ? -8.310  34.210 23.185  1.00 74.37  ? 839 DT  T "C4'" 1 
ATOM   3020 O  "O4'" . DT  C 3 1   ? -8.825  32.958 22.664  1.00 76.85  ? 839 DT  T "O4'" 1 
ATOM   3021 C  "C3'" . DT  C 3 1   ? -6.843  33.964 23.529  1.00 72.13  ? 839 DT  T "C3'" 1 
ATOM   3022 O  "O3'" . DT  C 3 1   ? -6.635  34.002 24.950  1.00 67.05  ? 839 DT  T "O3'" 1 
ATOM   3023 C  "C2'" . DT  C 3 1   ? -6.492  32.645 22.870  1.00 74.45  ? 839 DT  T "C2'" 1 
ATOM   3024 C  "C1'" . DT  C 3 1   ? -7.821  31.953 22.612  1.00 76.41  ? 839 DT  T "C1'" 1 
ATOM   3025 N  N1    . DT  C 3 1   ? -7.914  31.253 21.286  1.00 77.82  ? 839 DT  T N1    1 
ATOM   3026 C  C2    . DT  C 3 1   ? -8.857  30.250 21.128  1.00 78.98  ? 839 DT  T C2    1 
ATOM   3027 O  O2    . DT  C 3 1   ? -9.644  29.921 22.006  1.00 80.20  ? 839 DT  T O2    1 
ATOM   3028 N  N3    . DT  C 3 1   ? -8.845  29.641 19.897  1.00 78.81  ? 839 DT  T N3    1 
ATOM   3029 C  C4    . DT  C 3 1   ? -8.009  29.921 18.833  1.00 78.94  ? 839 DT  T C4    1 
ATOM   3030 O  O4    . DT  C 3 1   ? -8.103  29.274 17.784  1.00 77.76  ? 839 DT  T O4    1 
ATOM   3031 C  C5    . DT  C 3 1   ? -7.059  30.983 19.062  1.00 79.13  ? 839 DT  T C5    1 
ATOM   3032 C  C7    . DT  C 3 1   ? -6.110  31.349 17.970  1.00 79.71  ? 839 DT  T C7    1 
ATOM   3033 C  C6    . DT  C 3 1   ? -7.063  31.592 20.253  1.00 78.51  ? 839 DT  T C6    1 
HETATM 3034 N  N1    A BRU C 3 2   ? -2.922  30.380 22.963  0.90 45.69  ? 840 BRU T N1    1 
HETATM 3035 N  N1    B BRU C 3 2   ? -2.476  29.195 23.253  0.10 54.89  ? 840 BRU T N1    1 
HETATM 3036 C  C2    A BRU C 3 2   ? -2.333  29.606 21.978  0.90 44.31  ? 840 BRU T C2    1 
HETATM 3037 C  C2    B BRU C 3 2   ? -3.064  30.038 22.331  0.10 54.94  ? 840 BRU T C2    1 
HETATM 3038 N  N3    A BRU C 3 2   ? -2.276  30.189 20.740  0.90 42.90  ? 840 BRU T N3    1 
HETATM 3039 N  N3    B BRU C 3 2   ? -2.579  29.920 21.052  0.10 54.95  ? 840 BRU T N3    1 
HETATM 3040 C  C4    A BRU C 3 2   ? -2.726  31.444 20.397  0.90 43.31  ? 840 BRU T C4    1 
HETATM 3041 C  C4    B BRU C 3 2   ? -1.591  29.062 20.612  0.10 55.01  ? 840 BRU T C4    1 
HETATM 3042 C  C5    A BRU C 3 2   ? -3.327  32.184 21.464  0.90 43.81  ? 840 BRU T C5    1 
HETATM 3043 C  C5    B BRU C 3 2   ? -1.026  28.223 21.632  0.10 55.10  ? 840 BRU T C5    1 
HETATM 3044 C  C6    A BRU C 3 2   ? -3.408  31.640 22.679  0.90 45.93  ? 840 BRU T C6    1 
HETATM 3045 C  C6    B BRU C 3 2   ? -1.473  28.321 22.885  0.10 55.05  ? 840 BRU T C6    1 
HETATM 3046 O  O2    A BRU C 3 2   ? -1.891  28.498 22.191  0.90 44.73  ? 840 BRU T O2    1 
HETATM 3047 O  O2    B BRU C 3 2   ? -3.949  30.822 22.623  0.10 54.95  ? 840 BRU T O2    1 
HETATM 3048 O  O4    A BRU C 3 2   ? -2.558  31.849 19.252  0.90 43.17  ? 840 BRU T O4    1 
HETATM 3049 O  O4    B BRU C 3 2   ? -1.274  29.070 19.419  0.10 54.91  ? 840 BRU T O4    1 
HETATM 3050 BR BR    A BRU C 3 2   ? -3.993  33.920 21.135  0.90 127.77 ? 840 BRU T BR    1 
HETATM 3051 BR BR    B BRU C 3 2   ? 0.337   26.985 21.186  0.10 72.06  ? 840 BRU T BR    1 
HETATM 3052 C  "C1'" A BRU C 3 2   ? -3.001  29.819 24.322  0.90 47.16  ? 840 BRU T "C1'" 1 
HETATM 3053 C  "C1'" B BRU C 3 2   ? -2.950  29.235 24.643  0.10 54.74  ? 840 BRU T "C1'" 1 
HETATM 3054 C  "C2'" A BRU C 3 2   ? -2.880  30.851 25.445  0.90 48.74  ? 840 BRU T "C2'" 1 
HETATM 3055 C  "C2'" B BRU C 3 2   ? -2.794  30.527 25.407  0.10 54.03  ? 840 BRU T "C2'" 1 
HETATM 3056 C  "C3'" A BRU C 3 2   ? -3.777  30.308 26.544  0.90 49.59  ? 840 BRU T "C3'" 1 
HETATM 3057 C  "C3'" B BRU C 3 2   ? -3.729  30.250 26.563  0.10 53.54  ? 840 BRU T "C3'" 1 
HETATM 3058 C  "C4'" A BRU C 3 2   ? -4.807  29.481 25.783  0.90 52.36  ? 840 BRU T "C4'" 1 
HETATM 3059 C  "C4'" B BRU C 3 2   ? -4.868  29.473 25.904  0.10 55.71  ? 840 BRU T "C4'" 1 
HETATM 3060 O  "O3'" A BRU C 3 2   ? -3.084  29.475 27.480  0.90 47.74  ? 840 BRU T "O3'" 1 
HETATM 3061 O  "O3'" B BRU C 3 2   ? -3.016  29.440 27.478  0.10 50.06  ? 840 BRU T "O3'" 1 
HETATM 3062 O  "O4'" A BRU C 3 2   ? -4.275  29.237 24.462  0.90 49.88  ? 840 BRU T "O4'" 1 
HETATM 3063 O  "O4'" B BRU C 3 2   ? -4.338  28.969 24.655  0.10 55.33  ? 840 BRU T "O4'" 1 
HETATM 3064 C  "C5'" A BRU C 3 2   ? -6.149  30.149 25.633  0.90 57.16  ? 840 BRU T "C5'" 1 
HETATM 3065 C  "C5'" B BRU C 3 2   ? -6.137  30.263 25.687  0.10 58.79  ? 840 BRU T "C5'" 1 
HETATM 3066 O  "O5'" A BRU C 3 2   ? -5.994  31.484 25.150  0.90 63.56  ? 840 BRU T "O5'" 1 
HETATM 3067 O  "O5'" B BRU C 3 2   ? -5.863  31.634 25.445  0.10 63.01  ? 840 BRU T "O5'" 1 
HETATM 3068 P  P     A BRU C 3 2   ? -6.779  32.674 25.863  0.90 67.70  ? 840 BRU T P     1 
HETATM 3069 P  P     B BRU C 3 2   ? -6.966  32.711 25.837  0.10 65.61  ? 840 BRU T P     1 
HETATM 3070 O  OP1   A BRU C 3 2   ? -8.207  32.330 25.884  0.90 68.87  ? 840 BRU T OP1   1 
HETATM 3071 O  OP1   B BRU C 3 2   ? -8.297  32.224 25.391  0.10 65.63  ? 840 BRU T OP1   1 
HETATM 3072 O  OP2   A BRU C 3 2   ? -6.065  32.938 27.164  0.90 67.33  ? 840 BRU T OP2   1 
HETATM 3073 O  OP2   B BRU C 3 2   ? -6.765  33.106 27.254  0.10 65.56  ? 840 BRU T OP2   1 
ATOM   3074 P  P     . DG  C 3 3   ? -2.137  30.146 28.602  1.00 46.55  ? 841 DG  T P     1 
ATOM   3075 O  OP1   . DG  C 3 3   ? -2.194  29.299 29.816  1.00 47.06  ? 841 DG  T OP1   1 
ATOM   3076 O  OP2   . DG  C 3 3   ? -2.526  31.577 28.698  1.00 46.81  ? 841 DG  T OP2   1 
ATOM   3077 O  "O5'" . DG  C 3 3   ? -0.670  30.040 27.988  1.00 46.53  ? 841 DG  T "O5'" 1 
ATOM   3078 C  "C5'" . DG  C 3 3   ? 0.046   28.825 28.092  1.00 41.14  ? 841 DG  T "C5'" 1 
ATOM   3079 C  "C4'" . DG  C 3 3   ? 1.443   28.954 27.528  1.00 39.83  ? 841 DG  T "C4'" 1 
ATOM   3080 O  "O4'" . DG  C 3 3   ? 1.403   29.097 26.085  1.00 37.53  ? 841 DG  T "O4'" 1 
ATOM   3081 C  "C3'" . DG  C 3 3   ? 2.180   30.204 28.027  1.00 39.84  ? 841 DG  T "C3'" 1 
ATOM   3082 O  "O3'" . DG  C 3 3   ? 3.596   29.953 27.976  1.00 40.70  ? 841 DG  T "O3'" 1 
ATOM   3083 C  "C2'" . DG  C 3 3   ? 1.808   31.243 26.988  1.00 37.24  ? 841 DG  T "C2'" 1 
ATOM   3084 C  "C1'" . DG  C 3 3   ? 1.879   30.386 25.743  1.00 35.34  ? 841 DG  T "C1'" 1 
ATOM   3085 N  N9    . DG  C 3 3   ? 1.254   30.856 24.509  1.00 32.47  ? 841 DG  T N9    1 
ATOM   3086 C  C8    . DG  C 3 3   ? 0.296   31.827 24.376  1.00 30.58  ? 841 DG  T C8    1 
ATOM   3087 N  N7    . DG  C 3 3   ? 0.023   32.106 23.128  1.00 28.45  ? 841 DG  T N7    1 
ATOM   3088 C  C5    . DG  C 3 3   ? 0.835   31.254 22.396  1.00 27.54  ? 841 DG  T C5    1 
ATOM   3089 C  C6    . DG  C 3 3   ? 0.984   31.108 20.993  1.00 28.45  ? 841 DG  T C6    1 
ATOM   3090 O  O6    . DG  C 3 3   ? 0.414   31.728 20.088  1.00 30.15  ? 841 DG  T O6    1 
ATOM   3091 N  N1    . DG  C 3 3   ? 1.906   30.121 20.676  1.00 26.92  ? 841 DG  T N1    1 
ATOM   3092 C  C2    . DG  C 3 3   ? 2.590   29.367 21.585  1.00 27.44  ? 841 DG  T C2    1 
ATOM   3093 N  N2    . DG  C 3 3   ? 3.417   28.460 21.078  1.00 25.75  ? 841 DG  T N2    1 
ATOM   3094 N  N3    . DG  C 3 3   ? 2.467   29.493 22.896  1.00 28.83  ? 841 DG  T N3    1 
ATOM   3095 C  C4    . DG  C 3 3   ? 1.580   30.454 23.228  1.00 29.43  ? 841 DG  T C4    1 
ATOM   3096 P  P     . DG  C 3 4   ? 4.615   30.852 28.843  1.00 40.74  ? 842 DG  T P     1 
ATOM   3097 O  OP1   . DG  C 3 4   ? 5.800   30.003 29.118  1.00 38.67  ? 842 DG  T OP1   1 
ATOM   3098 O  OP2   . DG  C 3 4   ? 3.873   31.462 29.970  1.00 40.18  ? 842 DG  T OP2   1 
ATOM   3099 O  "O5'" . DG  C 3 4   ? 5.072   32.020 27.859  1.00 39.28  ? 842 DG  T "O5'" 1 
ATOM   3100 C  "C5'" . DG  C 3 4   ? 4.796   31.928 26.477  1.00 38.41  ? 842 DG  T "C5'" 1 
ATOM   3101 C  "C4'" . DG  C 3 4   ? 5.871   31.125 25.789  1.00 38.57  ? 842 DG  T "C4'" 1 
ATOM   3102 O  "O4'" . DG  C 3 4   ? 5.315   30.704 24.520  1.00 35.94  ? 842 DG  T "O4'" 1 
ATOM   3103 C  "C3'" . DG  C 3 4   ? 7.083   31.987 25.448  1.00 38.28  ? 842 DG  T "C3'" 1 
ATOM   3104 O  "O3'" . DG  C 3 4   ? 8.329   31.295 25.398  1.00 37.59  ? 842 DG  T "O3'" 1 
ATOM   3105 C  "C2'" . DG  C 3 4   ? 6.729   32.529 24.086  1.00 39.10  ? 842 DG  T "C2'" 1 
ATOM   3106 C  "C1'" . DG  C 3 4   ? 5.919   31.409 23.456  1.00 32.16  ? 842 DG  T "C1'" 1 
ATOM   3107 N  N9    . DG  C 3 4   ? 4.868   32.030 22.676  1.00 29.93  ? 842 DG  T N9    1 
ATOM   3108 C  C8    . DG  C 3 4   ? 3.845   32.812 23.150  1.00 27.42  ? 842 DG  T C8    1 
ATOM   3109 N  N7    . DG  C 3 4   ? 3.183   33.414 22.202  1.00 26.71  ? 842 DG  T N7    1 
ATOM   3110 C  C5    . DG  C 3 4   ? 3.774   32.960 21.034  1.00 28.49  ? 842 DG  T C5    1 
ATOM   3111 C  C6    . DG  C 3 4   ? 3.498   33.275 19.695  1.00 28.10  ? 842 DG  T C6    1 
ATOM   3112 O  O6    . DG  C 3 4   ? 2.654   34.053 19.255  1.00 30.53  ? 842 DG  T O6    1 
ATOM   3113 N  N1    . DG  C 3 4   ? 4.331   32.581 18.823  1.00 27.27  ? 842 DG  T N1    1 
ATOM   3114 C  C2    . DG  C 3 4   ? 5.312   31.699 19.200  1.00 28.12  ? 842 DG  T C2    1 
ATOM   3115 N  N2    . DG  C 3 4   ? 6.013   31.129 18.212  1.00 30.30  ? 842 DG  T N2    1 
ATOM   3116 N  N3    . DG  C 3 4   ? 5.586   31.400 20.455  1.00 27.75  ? 842 DG  T N3    1 
ATOM   3117 C  C4    . DG  C 3 4   ? 4.785   32.065 21.313  1.00 29.77  ? 842 DG  T C4    1 
ATOM   3118 P  P     . DG  C 3 5   ? 9.697   32.139 25.514  1.00 34.93  ? 843 DG  T P     1 
ATOM   3119 O  OP1   . DG  C 3 5   ? 10.656  31.367 26.334  1.00 35.89  ? 843 DG  T OP1   1 
ATOM   3120 O  OP2   . DG  C 3 5   ? 9.334   33.509 25.909  1.00 36.60  ? 843 DG  T OP2   1 
ATOM   3121 O  "O5'" . DG  C 3 5   ? 10.284  32.226 24.034  1.00 35.16  ? 843 DG  T "O5'" 1 
ATOM   3122 C  "C5'" . DG  C 3 5   ? 9.479   32.622 22.938  1.00 30.34  ? 843 DG  T "C5'" 1 
ATOM   3123 C  "C4'" . DG  C 3 5   ? 10.240  32.456 21.646  1.00 30.99  ? 843 DG  T "C4'" 1 
ATOM   3124 O  "O4'" . DG  C 3 5   ? 9.238   32.427 20.597  1.00 29.94  ? 843 DG  T "O4'" 1 
ATOM   3125 C  "C3'" . DG  C 3 5   ? 11.145  33.650 21.325  1.00 32.11  ? 843 DG  T "C3'" 1 
ATOM   3126 O  "O3'" . DG  C 3 5   ? 12.317  33.370 20.547  1.00 36.32  ? 843 DG  T "O3'" 1 
ATOM   3127 C  "C2'" . DG  C 3 5   ? 10.235  34.560 20.547  1.00 32.99  ? 843 DG  T "C2'" 1 
ATOM   3128 C  "C1'" . DG  C 3 5   ? 9.295   33.609 19.824  1.00 29.15  ? 843 DG  T "C1'" 1 
ATOM   3129 N  N9    . DG  C 3 5   ? 7.981   34.235 19.825  1.00 29.51  ? 843 DG  T N9    1 
ATOM   3130 C  C8    . DG  C 3 5   ? 7.230   34.595 20.922  1.00 27.45  ? 843 DG  T C8    1 
ATOM   3131 N  N7    . DG  C 3 5   ? 6.207   35.347 20.613  1.00 28.67  ? 843 DG  T N7    1 
ATOM   3132 C  C5    . DG  C 3 5   ? 6.257   35.440 19.226  1.00 27.29  ? 843 DG  T C5    1 
ATOM   3133 C  C6    . DG  C 3 5   ? 5.419   36.129 18.323  1.00 26.46  ? 843 DG  T C6    1 
ATOM   3134 O  O6    . DG  C 3 5   ? 4.434   36.838 18.574  1.00 26.21  ? 843 DG  T O6    1 
ATOM   3135 N  N1    . DG  C 3 5   ? 5.826   35.940 17.000  1.00 27.34  ? 843 DG  T N1    1 
ATOM   3136 C  C2    . DG  C 3 5   ? 6.908   35.186 16.603  1.00 27.61  ? 843 DG  T C2    1 
ATOM   3137 N  N2    . DG  C 3 5   ? 7.149   35.110 15.282  1.00 24.46  ? 843 DG  T N2    1 
ATOM   3138 N  N3    . DG  C 3 5   ? 7.700   34.550 17.441  1.00 28.12  ? 843 DG  T N3    1 
ATOM   3139 C  C4    . DG  C 3 5   ? 7.320   34.719 18.725  1.00 28.55  ? 843 DG  T C4    1 
ATOM   3140 P  P     . DT  C 3 6   ? 13.337  34.577 20.176  1.00 36.14  ? 844 DT  T P     1 
ATOM   3141 O  OP1   . DT  C 3 6   ? 14.693  33.997 20.037  1.00 35.46  ? 844 DT  T OP1   1 
ATOM   3142 O  OP2   . DT  C 3 6   ? 13.120  35.705 21.114  1.00 33.81  ? 844 DT  T OP2   1 
ATOM   3143 O  "O5'" . DT  C 3 6   ? 12.854  35.026 18.729  1.00 36.20  ? 844 DT  T "O5'" 1 
ATOM   3144 C  "C5'" . DT  C 3 6   ? 12.672  34.044 17.707  1.00 39.28  ? 844 DT  T "C5'" 1 
ATOM   3145 C  "C4'" . DT  C 3 6   ? 12.870  34.655 16.341  1.00 38.22  ? 844 DT  T "C4'" 1 
ATOM   3146 O  "O4'" . DT  C 3 6   ? 11.605  35.183 15.858  1.00 36.45  ? 844 DT  T "O4'" 1 
ATOM   3147 C  "C3'" . DT  C 3 6   ? 13.807  35.851 16.411  1.00 40.11  ? 844 DT  T "C3'" 1 
ATOM   3148 O  "O3'" . DT  C 3 6   ? 14.550  36.025 15.214  1.00 44.71  ? 844 DT  T "O3'" 1 
ATOM   3149 C  "C2'" . DT  C 3 6   ? 12.861  37.008 16.653  1.00 38.56  ? 844 DT  T "C2'" 1 
ATOM   3150 C  "C1'" . DT  C 3 6   ? 11.619  36.604 15.867  1.00 33.62  ? 844 DT  T "C1'" 1 
ATOM   3151 N  N1    . DT  C 3 6   ? 10.383  37.096 16.521  1.00 29.14  ? 844 DT  T N1    1 
ATOM   3152 C  C2    . DT  C 3 6   ? 9.418   37.734 15.769  1.00 26.71  ? 844 DT  T C2    1 
ATOM   3153 O  O2    . DT  C 3 6   ? 9.463   37.816 14.564  1.00 26.44  ? 844 DT  T O2    1 
ATOM   3154 N  N3    . DT  C 3 6   ? 8.395   38.282 16.497  1.00 23.80  ? 844 DT  T N3    1 
ATOM   3155 C  C4    . DT  C 3 6   ? 8.243   38.244 17.866  1.00 26.16  ? 844 DT  T C4    1 
ATOM   3156 O  O4    . DT  C 3 6   ? 7.296   38.811 18.394  1.00 29.30  ? 844 DT  T O4    1 
ATOM   3157 C  C5    . DT  C 3 6   ? 9.257   37.516 18.580  1.00 24.93  ? 844 DT  T C5    1 
ATOM   3158 C  C7    . DT  C 3 6   ? 9.162   37.410 20.065  1.00 24.64  ? 844 DT  T C7    1 
ATOM   3159 C  C6    . DT  C 3 6   ? 10.251  36.972 17.882  1.00 26.60  ? 844 DT  T C6    1 
ATOM   3160 P  P     . DC  C 3 7   ? 15.560  37.268 15.087  1.00 47.41  ? 845 DC  T P     1 
ATOM   3161 O  OP1   . DC  C 3 7   ? 16.792  36.752 14.438  1.00 50.01  ? 845 DC  T OP1   1 
ATOM   3162 O  OP2   . DC  C 3 7   ? 15.664  37.982 16.391  1.00 44.76  ? 845 DC  T OP2   1 
ATOM   3163 O  "O5'" . DC  C 3 7   ? 14.799  38.210 14.057  1.00 46.12  ? 845 DC  T "O5'" 1 
ATOM   3164 C  "C5'" . DC  C 3 7   ? 14.317  37.679 12.833  1.00 42.00  ? 845 DC  T "C5'" 1 
ATOM   3165 C  "C4'" . DC  C 3 7   ? 13.683  38.762 11.992  1.00 40.83  ? 845 DC  T "C4'" 1 
ATOM   3166 O  "O4'" . DC  C 3 7   ? 12.430  39.175 12.593  1.00 41.27  ? 845 DC  T "O4'" 1 
ATOM   3167 C  "C3'" . DC  C 3 7   ? 14.531  40.034 11.937  1.00 41.43  ? 845 DC  T "C3'" 1 
ATOM   3168 O  "O3'" . DC  C 3 7   ? 14.277  40.711 10.700  1.00 46.22  ? 845 DC  T "O3'" 1 
ATOM   3169 C  "C2'" . DC  C 3 7   ? 14.026  40.835 13.122  1.00 39.29  ? 845 DC  T "C2'" 1 
ATOM   3170 C  "C1'" . DC  C 3 7   ? 12.546  40.509 13.072  1.00 37.51  ? 845 DC  T "C1'" 1 
ATOM   3171 N  N1    . DC  C 3 7   ? 11.772  40.657 14.317  1.00 32.25  ? 845 DC  T N1    1 
ATOM   3172 C  C2    . DC  C 3 7   ? 10.495  41.221 14.238  1.00 29.83  ? 845 DC  T C2    1 
ATOM   3173 O  O2    . DC  C 3 7   ? 10.039  41.513 13.118  1.00 30.22  ? 845 DC  T O2    1 
ATOM   3174 N  N3    . DC  C 3 7   ? 9.792   41.431 15.374  1.00 26.28  ? 845 DC  T N3    1 
ATOM   3175 C  C4    . DC  C 3 7   ? 10.317  41.083 16.551  1.00 26.86  ? 845 DC  T C4    1 
ATOM   3176 N  N4    . DC  C 3 7   ? 9.598   41.307 17.652  1.00 25.33  ? 845 DC  T N4    1 
ATOM   3177 C  C5    . DC  C 3 7   ? 11.607  40.487 16.655  1.00 27.74  ? 845 DC  T C5    1 
ATOM   3178 C  C6    . DC  C 3 7   ? 12.291  40.289 15.524  1.00 29.78  ? 845 DC  T C6    1 
ATOM   3179 P  P     . DC  C 3 8   ? 14.798  42.217 10.474  1.00 48.36  ? 846 DC  T P     1 
ATOM   3180 O  OP1   . DC  C 3 8   ? 15.478  42.182 9.149   1.00 46.43  ? 846 DC  T OP1   1 
ATOM   3181 O  OP2   . DC  C 3 8   ? 15.544  42.679 11.674  1.00 48.06  ? 846 DC  T OP2   1 
ATOM   3182 O  "O5'" . DC  C 3 8   ? 13.444  43.058 10.353  1.00 47.15  ? 846 DC  T "O5'" 1 
ATOM   3183 C  "C5'" . DC  C 3 8   ? 12.353  42.532 9.598   1.00 47.31  ? 846 DC  T "C5'" 1 
ATOM   3184 C  "C4'" . DC  C 3 8   ? 11.282  43.572 9.338   1.00 46.91  ? 846 DC  T "C4'" 1 
ATOM   3185 O  "O4'" . DC  C 3 8   ? 10.469  43.804 10.517  1.00 45.26  ? 846 DC  T "O4'" 1 
ATOM   3186 C  "C3'" . DC  C 3 8   ? 11.801  44.952 8.950   1.00 47.31  ? 846 DC  T "C3'" 1 
ATOM   3187 O  "O3'" . DC  C 3 8   ? 10.848  45.550 8.064   1.00 50.15  ? 846 DC  T "O3'" 1 
ATOM   3188 C  "C2'" . DC  C 3 8   ? 11.912  45.659 10.294  1.00 43.93  ? 846 DC  T "C2'" 1 
ATOM   3189 C  "C1'" . DC  C 3 8   ? 10.709  45.102 11.044  1.00 40.49  ? 846 DC  T "C1'" 1 
ATOM   3190 N  N1    . DC  C 3 8   ? 10.821  44.979 12.505  1.00 37.19  ? 846 DC  T N1    1 
ATOM   3191 C  C2    . DC  C 3 8   ? 9.777   45.477 13.305  1.00 36.91  ? 846 DC  T C2    1 
ATOM   3192 O  O2    . DC  C 3 8   ? 8.802   46.019 12.757  1.00 36.53  ? 846 DC  T O2    1 
ATOM   3193 N  N3    . DC  C 3 8   ? 9.858   45.353 14.654  1.00 35.39  ? 846 DC  T N3    1 
ATOM   3194 C  C4    . DC  C 3 8   ? 10.924  44.764 15.206  1.00 34.98  ? 846 DC  T C4    1 
ATOM   3195 N  N4    . DC  C 3 8   ? 10.960  44.659 16.543  1.00 34.56  ? 846 DC  T N4    1 
ATOM   3196 C  C5    . DC  C 3 8   ? 11.999  44.256 14.416  1.00 33.04  ? 846 DC  T C5    1 
ATOM   3197 C  C6    . DC  C 3 8   ? 11.906  44.384 13.083  1.00 34.69  ? 846 DC  T C6    1 
ATOM   3198 P  P     . DT  C 3 9   ? 11.267  46.806 7.153   1.00 50.57  ? 847 DT  T P     1 
ATOM   3199 O  OP1   . DT  C 3 9   ? 10.740  46.582 5.778   1.00 48.21  ? 847 DT  T OP1   1 
ATOM   3200 O  OP2   . DT  C 3 9   ? 12.716  47.085 7.352   1.00 50.18  ? 847 DT  T OP2   1 
ATOM   3201 O  "O5'" . DT  C 3 9   ? 10.424  47.977 7.811   1.00 47.24  ? 847 DT  T "O5'" 1 
ATOM   3202 C  "C5'" . DT  C 3 9   ? 9.932   47.839 9.130   1.00 44.83  ? 847 DT  T "C5'" 1 
ATOM   3203 C  "C4'" . DT  C 3 9   ? 8.683   48.664 9.301   1.00 44.60  ? 847 DT  T "C4'" 1 
ATOM   3204 O  "O4'" . DT  C 3 9   ? 8.305   48.571 10.691  1.00 41.03  ? 847 DT  T "O4'" 1 
ATOM   3205 C  "C3'" . DT  C 3 9   ? 8.892   50.153 9.030   1.00 45.62  ? 847 DT  T "C3'" 1 
ATOM   3206 O  "O3'" . DT  C 3 9   ? 7.666   50.812 8.667   1.00 45.48  ? 847 DT  T "O3'" 1 
ATOM   3207 C  "C2'" . DT  C 3 9   ? 9.373   50.662 10.377  1.00 43.78  ? 847 DT  T "C2'" 1 
ATOM   3208 C  "C1'" . DT  C 3 9   ? 8.609   49.786 11.369  1.00 39.85  ? 847 DT  T "C1'" 1 
ATOM   3209 N  N1    . DT  C 3 9   ? 9.409   49.426 12.552  1.00 37.67  ? 847 DT  T N1    1 
ATOM   3210 C  C2    . DT  C 3 9   ? 8.942   49.767 13.811  1.00 37.73  ? 847 DT  T C2    1 
ATOM   3211 O  O2    . DT  C 3 9   ? 7.892   50.375 13.996  1.00 40.56  ? 847 DT  T O2    1 
ATOM   3212 N  N3    . DT  C 3 9   ? 9.756   49.366 14.849  1.00 32.20  ? 847 DT  T N3    1 
ATOM   3213 C  C4    . DT  C 3 9   ? 10.952  48.683 14.752  1.00 30.63  ? 847 DT  T C4    1 
ATOM   3214 O  O4    . DT  C 3 9   ? 11.565  48.386 15.769  1.00 29.89  ? 847 DT  T O4    1 
ATOM   3215 C  C5    . DT  C 3 9   ? 11.382  48.369 13.402  1.00 29.50  ? 847 DT  T C5    1 
ATOM   3216 C  C7    . DT  C 3 9   ? 12.669  47.637 13.195  1.00 27.94  ? 847 DT  T C7    1 
ATOM   3217 C  C6    . DT  C 3 9   ? 10.600  48.751 12.388  1.00 33.00  ? 847 DT  T C6    1 
HETATM 3218 P  PG    . DTP D 4 .   ? 0.902   18.879 14.606  0.90 90.83  ? 875 DTP A PG    1 
HETATM 3219 O  O1G   . DTP D 4 .   ? 0.897   17.412 14.436  0.90 87.84  ? 875 DTP A O1G   1 
HETATM 3220 O  O2G   . DTP D 4 .   ? 0.736   19.136 16.099  0.90 89.75  ? 875 DTP A O2G   1 
HETATM 3221 O  O3G   . DTP D 4 .   ? 2.100   19.544 13.942  0.90 90.01  ? 875 DTP A O3G   1 
HETATM 3222 P  PB    . DTP D 4 .   ? -0.755  19.515 12.348  0.90 91.47  ? 875 DTP A PB    1 
HETATM 3223 O  O1B   . DTP D 4 .   ? 0.455   19.055 11.619  0.90 92.03  ? 875 DTP A O1B   1 
HETATM 3224 O  O2B   . DTP D 4 .   ? -1.928  18.491 11.991  0.90 91.09  ? 875 DTP A O2B   1 
HETATM 3225 O  O3B   . DTP D 4 .   ? -0.426  19.535 13.919  0.90 90.60  ? 875 DTP A O3B   1 
HETATM 3226 P  PA    . DTP D 4 .   ? -0.461  22.409 12.569  0.90 87.75  ? 875 DTP A PA    1 
HETATM 3227 O  O1A   . DTP D 4 .   ? -1.013  22.507 13.889  0.90 88.75  ? 875 DTP A O1A   1 
HETATM 3228 O  O2A   . DTP D 4 .   ? 1.051   22.226 12.601  0.90 87.74  ? 875 DTP A O2A   1 
HETATM 3229 O  O3A   . DTP D 4 .   ? -0.913  21.037 11.844  0.90 90.12  ? 875 DTP A O3A   1 
HETATM 3230 O  "O5'" . DTP D 4 .   ? -0.811  23.650 11.638  0.90 84.01  ? 875 DTP A "O5'" 1 
HETATM 3231 C  "C5'" . DTP D 4 .   ? -1.562  24.415 12.543  0.90 78.72  ? 875 DTP A "C5'" 1 
HETATM 3232 C  "C4'" . DTP D 4 .   ? -2.009  25.746 11.977  0.90 74.78  ? 875 DTP A "C4'" 1 
HETATM 3233 O  "O4'" . DTP D 4 .   ? -2.332  26.472 13.191  0.90 72.99  ? 875 DTP A "O4'" 1 
HETATM 3234 C  "C3'" . DTP D 4 .   ? -1.096  26.905 11.221  0.90 73.75  ? 875 DTP A "C3'" 1 
HETATM 3235 O  "O3'" . DTP D 4 .   ? -1.882  27.999 10.660  0.90 73.62  ? 875 DTP A "O3'" 1 
HETATM 3236 C  "C2'" . DTP D 4 .   ? -0.279  27.333 12.418  0.90 72.18  ? 875 DTP A "C2'" 1 
HETATM 3237 C  "C1'" . DTP D 4 .   ? -1.329  27.429 13.517  0.90 70.62  ? 875 DTP A "C1'" 1 
HETATM 3238 N  N9    . DTP D 4 .   ? -0.824  27.160 14.901  0.90 67.69  ? 875 DTP A N9    1 
HETATM 3239 C  C8    . DTP D 4 .   ? -0.007  26.130 15.325  0.90 66.52  ? 875 DTP A C8    1 
HETATM 3240 N  N7    . DTP D 4 .   ? 0.262   26.143 16.612  0.90 65.67  ? 875 DTP A N7    1 
HETATM 3241 C  C5    . DTP D 4 .   ? -0.418  27.251 17.081  0.90 64.75  ? 875 DTP A C5    1 
HETATM 3242 C  C6    . DTP D 4 .   ? -0.556  27.829 18.379  0.90 63.37  ? 875 DTP A C6    1 
HETATM 3243 N  N6    . DTP D 4 .   ? 0.028   27.328 19.465  0.90 62.39  ? 875 DTP A N6    1 
HETATM 3244 N  N1    . DTP D 4 .   ? -1.321  28.954 18.513  0.90 63.29  ? 875 DTP A N1    1 
HETATM 3245 C  C2    . DTP D 4 .   ? -1.924  29.475 17.406  0.90 64.41  ? 875 DTP A C2    1 
HETATM 3246 N  N3    . DTP D 4 .   ? -1.872  29.022 16.130  0.90 64.33  ? 875 DTP A N3    1 
HETATM 3247 C  C4    . DTP D 4 .   ? -1.098  27.894 16.037  0.90 65.77  ? 875 DTP A C4    1 
HETATM 3248 MG MG    . MG  E 5 .   ? 2.346   21.755 14.178  1.00 58.57  ? 871 MG  A MG    1 
HETATM 3249 O  O     . HOH F 6 .   ? -0.948  20.262 -7.933  1.00 12.33  ? 1   HOH A O     1 
HETATM 3250 O  O     . HOH F 6 .   ? 9.328   15.050 -6.985  1.00 50.59  ? 2   HOH A O     1 
HETATM 3251 O  O     . HOH F 6 .   ? 12.385  24.591 17.210  1.00 28.75  ? 4   HOH A O     1 
HETATM 3252 O  O     . HOH F 6 .   ? 20.532  27.147 16.158  1.00 17.25  ? 5   HOH A O     1 
HETATM 3253 O  O     . HOH F 6 .   ? 19.071  27.123 18.311  1.00 9.93   ? 6   HOH A O     1 
HETATM 3254 O  O     . HOH F 6 .   ? 13.332  30.234 17.888  1.00 51.37  ? 7   HOH A O     1 
HETATM 3255 O  O     . HOH F 6 .   ? 4.805   19.955 7.886   1.00 29.00  ? 9   HOH A O     1 
HETATM 3256 O  O     . HOH F 6 .   ? 6.622   14.212 4.603   1.00 32.26  ? 10  HOH A O     1 
HETATM 3257 O  O     . HOH F 6 .   ? 25.540  25.778 15.392  1.00 32.56  ? 11  HOH A O     1 
HETATM 3258 O  O     . HOH F 6 .   ? 12.932  11.215 1.585   1.00 36.31  ? 12  HOH A O     1 
HETATM 3259 O  O     . HOH F 6 .   ? 12.170  29.127 20.425  1.00 32.83  ? 13  HOH A O     1 
HETATM 3260 O  O     . HOH F 6 .   ? 12.958  21.417 17.621  1.00 38.67  ? 14  HOH A O     1 
HETATM 3261 O  O     . HOH F 6 .   ? 20.627  17.994 24.080  1.00 27.56  ? 15  HOH A O     1 
HETATM 3262 O  O     . HOH F 6 .   ? 20.639  16.247 21.936  1.00 52.87  ? 16  HOH A O     1 
HETATM 3263 O  O     . HOH F 6 .   ? 14.324  33.644 8.692   1.00 31.33  ? 17  HOH A O     1 
HETATM 3264 O  O     . HOH F 6 .   ? 17.265  21.528 26.853  1.00 28.71  ? 18  HOH A O     1 
HETATM 3265 O  O     . HOH F 6 .   ? 25.252  20.467 19.194  1.00 16.81  ? 19  HOH A O     1 
HETATM 3266 O  O     . HOH F 6 .   ? 8.425   22.944 -11.476 1.00 22.68  ? 20  HOH A O     1 
HETATM 3267 O  O     . HOH F 6 .   ? 6.455   7.686  -2.514  1.00 31.43  ? 21  HOH A O     1 
HETATM 3268 O  O     . HOH F 6 .   ? 9.437   7.812  5.217   1.00 27.41  ? 22  HOH A O     1 
HETATM 3269 O  O     . HOH F 6 .   ? 13.323  20.401 -4.529  1.00 41.82  ? 23  HOH A O     1 
HETATM 3270 O  O     . HOH F 6 .   ? 3.365   13.085 -3.529  1.00 25.88  ? 24  HOH A O     1 
HETATM 3271 O  O     . HOH F 6 .   ? 21.407  8.189  12.858  1.00 27.93  ? 415 HOH A O     1 
HETATM 3272 O  O     . HOH F 6 .   ? 15.124  27.072 -5.330  1.00 47.87  ? 416 HOH A O     1 
HETATM 3273 O  O     . HOH F 6 .   ? -5.563  37.555 -10.714 1.00 36.91  ? 417 HOH A O     1 
HETATM 3274 O  O     . HOH F 6 .   ? 20.511  29.018 3.446   1.00 35.48  ? 418 HOH A O     1 
HETATM 3275 O  O     . HOH F 6 .   ? 17.487  33.639 17.715  1.00 39.78  ? 419 HOH A O     1 
HETATM 3276 O  O     . HOH F 6 .   ? 17.772  29.657 -3.742  1.00 31.07  ? 420 HOH A O     1 
HETATM 3277 O  O     . HOH F 6 .   ? 12.979  29.943 23.581  1.00 29.26  ? 421 HOH A O     1 
HETATM 3278 O  O     . HOH F 6 .   ? 11.275  8.829  13.192  1.00 39.89  ? 422 HOH A O     1 
HETATM 3279 O  O     . HOH F 6 .   ? 9.803   7.712  -7.096  1.00 38.86  ? 423 HOH A O     1 
HETATM 3280 O  O     . HOH F 6 .   ? -7.005  27.569 -5.231  1.00 28.68  ? 424 HOH A O     1 
HETATM 3281 O  O     . HOH F 6 .   ? 16.259  15.789 -14.595 1.00 45.23  ? 425 HOH A O     1 
HETATM 3282 O  O     . HOH F 6 .   ? 9.093   28.770 4.997   1.00 47.04  ? 426 HOH A O     1 
HETATM 3283 O  O     . HOH F 6 .   ? 10.487  28.344 -9.333  1.00 23.42  ? 427 HOH A O     1 
HETATM 3284 O  O     . HOH F 6 .   ? 26.133  21.003 5.714   1.00 39.87  ? 428 HOH A O     1 
HETATM 3285 O  O     . HOH F 6 .   ? 8.753   32.343 3.572   1.00 51.26  ? 429 HOH A O     1 
HETATM 3286 O  O     . HOH F 6 .   ? 2.084   20.761 2.099   1.00 31.22  ? 430 HOH A O     1 
HETATM 3287 O  O     . HOH F 6 .   ? 1.093   31.368 5.388   1.00 32.81  ? 431 HOH A O     1 
HETATM 3288 O  O     . HOH F 6 .   ? 19.720  21.379 26.381  1.00 42.66  ? 432 HOH A O     1 
HETATM 3289 O  O     . HOH F 6 .   ? -6.924  22.489 2.045   1.00 36.79  ? 433 HOH A O     1 
HETATM 3290 O  O     . HOH F 6 .   ? -2.851  27.360 -8.255  1.00 28.08  ? 434 HOH A O     1 
HETATM 3291 O  O     . HOH F 6 .   ? -5.191  32.777 -12.486 1.00 33.68  ? 435 HOH A O     1 
HETATM 3292 O  O     . HOH F 6 .   ? 11.918  20.011 15.190  1.00 44.16  ? 436 HOH A O     1 
HETATM 3293 O  O     . HOH F 6 .   ? 11.447  34.434 0.726   1.00 22.70  ? 437 HOH A O     1 
HETATM 3294 O  O     . HOH F 6 .   ? 14.591  4.102  -1.591  1.00 56.92  ? 438 HOH A O     1 
HETATM 3295 O  O     . HOH F 6 .   ? 25.858  24.050 4.058   1.00 31.09  ? 439 HOH A O     1 
HETATM 3296 O  O     . HOH F 6 .   ? 12.453  6.664  -10.132 1.00 45.67  ? 440 HOH A O     1 
HETATM 3297 O  O     . HOH F 6 .   ? 3.025   21.181 32.014  1.00 61.85  ? 441 HOH A O     1 
HETATM 3298 O  O     . HOH F 6 .   ? 16.263  32.453 15.002  1.00 36.11  ? 442 HOH A O     1 
HETATM 3299 O  O     . HOH F 6 .   ? -1.708  17.311 34.016  1.00 49.69  ? 443 HOH A O     1 
HETATM 3300 O  O     . HOH F 6 .   ? 17.960  7.120  -13.424 1.00 23.00  ? 444 HOH A O     1 
HETATM 3301 O  O     . HOH F 6 .   ? 12.888  4.411  1.823   1.00 30.18  ? 445 HOH A O     1 
HETATM 3302 O  O     . HOH F 6 .   ? 7.664   10.805 -13.307 1.00 42.60  ? 446 HOH A O     1 
HETATM 3303 O  O     . HOH F 6 .   ? 14.155  5.104  21.517  1.00 20.47  ? 447 HOH A O     1 
HETATM 3304 O  O     . HOH F 6 .   ? -4.245  20.226 -2.346  1.00 40.71  ? 448 HOH A O     1 
HETATM 3305 O  O     . HOH F 6 .   ? -5.426  35.938 -13.326 1.00 38.74  ? 449 HOH A O     1 
HETATM 3306 O  O     . HOH F 6 .   ? 8.587   29.014 28.046  1.00 14.78  ? 450 HOH A O     1 
HETATM 3307 O  O     . HOH F 6 .   ? 16.510  23.411 -7.877  1.00 41.63  ? 451 HOH A O     1 
HETATM 3308 O  O     . HOH F 6 .   ? 10.273  30.384 3.911   1.00 52.89  ? 452 HOH A O     1 
HETATM 3309 O  O     . HOH F 6 .   ? 13.641  13.680 2.202   1.00 36.17  ? 453 HOH A O     1 
HETATM 3310 O  O     . HOH F 6 .   ? 3.771   17.314 9.271   1.00 60.56  ? 454 HOH A O     1 
HETATM 3311 O  O     . HOH F 6 .   ? 12.547  24.171 -7.994  1.00 45.86  ? 455 HOH A O     1 
HETATM 3312 O  O     . HOH F 6 .   ? -2.226  16.809 -4.526  1.00 33.95  ? 456 HOH A O     1 
HETATM 3313 O  O     . HOH F 6 .   ? 15.572  4.738  -5.649  1.00 34.65  ? 457 HOH A O     1 
HETATM 3314 O  O     . HOH F 6 .   ? 13.239  6.959  11.728  1.00 44.05  ? 458 HOH A O     1 
HETATM 3315 O  O     . HOH F 6 .   ? 3.100   28.196 -13.302 1.00 39.53  ? 459 HOH A O     1 
HETATM 3316 O  O     . HOH F 6 .   ? 26.824  23.732 16.440  1.00 32.51  ? 460 HOH A O     1 
HETATM 3317 O  O     . HOH F 6 .   ? -2.449  18.784 -6.936  1.00 54.30  ? 461 HOH A O     1 
HETATM 3318 O  O     . HOH F 6 .   ? 17.073  17.797 -16.844 1.00 36.37  ? 462 HOH A O     1 
HETATM 3319 O  O     . HOH F 6 .   ? 27.353  24.893 6.979   1.00 31.97  ? 463 HOH A O     1 
HETATM 3320 O  O     . HOH F 6 .   ? 0.876   29.355 6.260   1.00 40.39  ? 464 HOH A O     1 
HETATM 3321 O  O     . HOH F 6 .   ? 9.596   34.627 2.926   1.00 35.21  ? 465 HOH A O     1 
HETATM 3322 O  O     . HOH F 6 .   ? 20.599  6.063  11.259  1.00 57.61  ? 466 HOH A O     1 
HETATM 3323 O  O     . HOH F 6 .   ? 12.388  24.301 -10.495 1.00 40.59  ? 467 HOH A O     1 
HETATM 3324 O  O     . HOH F 6 .   ? 29.183  20.555 13.599  1.00 38.76  ? 468 HOH A O     1 
HETATM 3325 O  O     . HOH F 6 .   ? -9.947  35.902 -8.372  1.00 62.95  ? 469 HOH A O     1 
HETATM 3326 O  O     . HOH F 6 .   ? 0.364   9.478  18.947  1.00 51.29  ? 470 HOH A O     1 
HETATM 3327 O  O     . HOH F 6 .   ? 17.933  6.511  -6.479  1.00 28.03  ? 471 HOH A O     1 
HETATM 3328 O  O     . HOH F 6 .   ? -6.154  19.574 32.514  1.00 63.57  ? 472 HOH A O     1 
HETATM 3329 O  O     . HOH F 6 .   ? 16.396  26.530 -7.882  1.00 33.70  ? 473 HOH A O     1 
HETATM 3330 O  O     . HOH F 6 .   ? 4.382   6.382  -2.216  1.00 49.71  ? 474 HOH A O     1 
HETATM 3331 O  O     . HOH F 6 .   ? 27.566  20.642 17.745  1.00 36.45  ? 475 HOH A O     1 
HETATM 3332 O  O     . HOH F 6 .   ? 24.951  23.812 8.623   1.00 14.85  ? 476 HOH A O     1 
HETATM 3333 O  O     . HOH F 6 .   ? 29.283  18.729 16.169  1.00 41.26  ? 477 HOH A O     1 
HETATM 3334 O  O     . HOH F 6 .   ? 28.958  13.256 7.587   1.00 66.17  ? 478 HOH A O     1 
HETATM 3335 O  O     . HOH F 6 .   ? -13.875 30.847 27.352  1.00 28.88  ? 479 HOH A O     1 
HETATM 3336 O  O     . HOH F 6 .   ? 29.980  16.174 7.585   1.00 43.22  ? 480 HOH A O     1 
HETATM 3337 O  O     . HOH F 6 .   ? 7.967   7.251  -5.677  1.00 50.23  ? 481 HOH A O     1 
HETATM 3338 O  O     . HOH F 6 .   ? 15.090  38.445 -3.385  1.00 26.34  ? 482 HOH A O     1 
HETATM 3339 O  O     . HOH F 6 .   ? 21.493  7.199  15.550  1.00 23.97  ? 483 HOH A O     1 
HETATM 3340 O  O     . HOH F 6 .   ? -8.236  35.291 30.465  1.00 39.61  ? 484 HOH A O     1 
HETATM 3341 O  O     . HOH F 6 .   ? 12.132  26.889 -7.369  1.00 36.28  ? 485 HOH A O     1 
HETATM 3342 O  O     . HOH F 6 .   ? 10.544  6.131  7.045   1.00 37.84  ? 486 HOH A O     1 
HETATM 3343 O  O     . HOH F 6 .   ? 9.750   27.077 33.857  1.00 45.10  ? 487 HOH A O     1 
HETATM 3344 O  O     . HOH F 6 .   ? 3.536   46.638 23.305  1.00 58.89  ? 488 HOH A O     1 
HETATM 3345 O  O     . HOH F 6 .   ? 18.911  18.891 -15.988 1.00 52.43  ? 489 HOH A O     1 
HETATM 3346 O  O     . HOH F 6 .   ? -14.719 24.135 26.220  1.00 45.69  ? 490 HOH A O     1 
HETATM 3347 O  O     . HOH F 6 .   ? 20.728  34.148 19.418  1.00 58.91  ? 491 HOH A O     1 
HETATM 3348 O  O     . HOH F 6 .   ? -14.604 28.208 27.417  1.00 42.84  ? 492 HOH A O     1 
HETATM 3349 O  O     . HOH F 6 .   ? 23.808  27.242 19.243  1.00 29.22  ? 493 HOH A O     1 
HETATM 3350 O  O     . HOH F 6 .   ? -11.994 32.698 28.463  1.00 49.97  ? 494 HOH A O     1 
HETATM 3351 O  O     . HOH F 6 .   ? 11.271  4.907  10.644  1.00 49.88  ? 495 HOH A O     1 
HETATM 3352 O  O     . HOH F 6 .   ? 18.473  39.956 18.331  1.00 30.38  ? 496 HOH A O     1 
HETATM 3353 O  O     . HOH F 6 .   ? 6.151   8.862  35.054  1.00 70.91  ? 497 HOH A O     1 
HETATM 3354 O  O     . HOH F 6 .   ? 19.299  24.676 -6.389  1.00 48.69  ? 498 HOH A O     1 
HETATM 3355 O  O     . HOH F 6 .   ? -9.635  25.635 0.834   1.00 68.24  ? 499 HOH A O     1 
HETATM 3356 O  O     . HOH F 6 .   ? 8.227   7.589  -15.551 1.00 55.80  ? 500 HOH A O     1 
HETATM 3357 O  O     . HOH F 6 .   ? 14.177  33.775 -6.831  1.00 75.77  ? 501 HOH A O     1 
HETATM 3358 O  O     . HOH F 6 .   ? 14.746  30.480 41.077  1.00 50.93  ? 502 HOH A O     1 
HETATM 3359 O  O     . HOH F 6 .   ? 22.153  33.973 17.407  1.00 64.55  ? 503 HOH A O     1 
HETATM 3360 O  O     . HOH F 6 .   ? 10.528  30.165 -11.047 1.00 42.78  ? 504 HOH A O     1 
HETATM 3361 O  O     . HOH F 6 .   ? -7.908  27.019 1.886   1.00 40.84  ? 505 HOH A O     1 
HETATM 3362 O  O     . HOH F 6 .   ? 1.999   20.729 19.909  1.00 39.36  ? 506 HOH A O     1 
HETATM 3363 O  O     . HOH F 6 .   ? -12.002 36.291 30.913  1.00 49.18  ? 507 HOH A O     1 
HETATM 3364 O  O     . HOH F 6 .   ? -8.315  24.991 -4.363  1.00 24.06  ? 508 HOH A O     1 
HETATM 3365 O  O     . HOH F 6 .   ? 13.522  18.043 30.324  1.00 35.27  ? 509 HOH A O     1 
HETATM 3366 O  O     . HOH F 6 .   ? 14.202  18.539 -16.357 1.00 27.96  ? 510 HOH A O     1 
HETATM 3367 O  O     . HOH F 6 .   ? 24.919  9.969  10.828  1.00 29.79  ? 511 HOH A O     1 
HETATM 3368 O  O     . HOH F 6 .   ? 8.477   7.326  -3.602  1.00 43.64  ? 512 HOH A O     1 
HETATM 3369 O  O     . HOH F 6 .   ? 14.449  46.961 23.075  1.00 37.40  ? 513 HOH A O     1 
HETATM 3370 O  O     . HOH F 6 .   ? 11.876  30.789 7.576   1.00 29.31  ? 514 HOH A O     1 
HETATM 3371 O  O     . HOH F 6 .   ? -14.028 29.216 23.118  1.00 64.73  ? 515 HOH A O     1 
HETATM 3372 O  O     . HOH F 6 .   ? 28.276  23.288 -3.170  1.00 39.91  ? 516 HOH A O     1 
HETATM 3373 O  O     . HOH F 6 .   ? 10.865  45.714 45.485  1.00 48.19  ? 517 HOH A O     1 
HETATM 3374 O  O     . HOH F 6 .   ? 12.491  10.555 14.147  1.00 37.09  ? 518 HOH A O     1 
HETATM 3375 O  O     . HOH F 6 .   ? 20.665  24.917 20.168  1.00 52.45  ? 519 HOH A O     1 
HETATM 3376 O  O     . HOH F 6 .   ? 20.908  24.043 23.253  1.00 28.43  ? 520 HOH A O     1 
HETATM 3377 O  O     . HOH F 6 .   ? 5.190   22.492 19.028  1.00 43.26  ? 521 HOH A O     1 
HETATM 3378 O  O     . HOH F 6 .   ? -14.619 30.270 20.318  1.00 47.28  ? 522 HOH A O     1 
HETATM 3379 O  O     . HOH F 6 .   ? 14.582  29.868 -4.937  1.00 40.07  ? 523 HOH A O     1 
HETATM 3380 O  O     . HOH F 6 .   ? 5.407   12.378 -11.912 1.00 31.49  ? 524 HOH A O     1 
HETATM 3381 O  O     . HOH F 6 .   ? 9.441   25.316 -11.306 1.00 37.16  ? 525 HOH A O     1 
HETATM 3382 O  O     . HOH F 6 .   ? 1.553   15.597 13.548  1.00 49.56  ? 526 HOH A O     1 
HETATM 3383 O  O     . HOH F 6 .   ? -8.956  31.100 -7.855  1.00 32.42  ? 527 HOH A O     1 
HETATM 3384 O  O     . HOH F 6 .   ? 5.715   15.798 -10.025 1.00 34.58  ? 528 HOH A O     1 
HETATM 3385 O  O     . HOH F 6 .   ? 2.404   23.086 16.646  1.00 25.61  ? 529 HOH A O     1 
HETATM 3386 O  O     . HOH F 6 .   ? 1.916   24.798 19.655  1.00 58.59  ? 530 HOH A O     1 
HETATM 3387 O  O     . HOH F 6 .   ? -12.100 37.725 -4.143  1.00 34.09  ? 531 HOH A O     1 
HETATM 3388 O  O     . HOH F 6 .   ? 27.537  18.016 -6.469  1.00 47.60  ? 532 HOH A O     1 
HETATM 3389 O  O     . HOH F 6 .   ? 2.334   20.708 10.784  1.00 44.87  ? 533 HOH A O     1 
HETATM 3390 O  O     . HOH G 6 .   ? 5.773   27.173 18.876  1.00 50.61  ? 8   HOH P O     1 
HETATM 3391 O  O     . HOH G 6 .   ? 6.647   39.979 10.804  1.00 61.36  ? 80  HOH P O     1 
HETATM 3392 O  O     . HOH G 6 .   ? 0.378   34.556 11.578  1.00 39.02  ? 86  HOH P O     1 
HETATM 3393 O  O     . HOH G 6 .   ? 9.439   44.870 20.256  1.00 34.93  ? 103 HOH P O     1 
HETATM 3394 O  O     . HOH G 6 .   ? 0.693   31.039 12.221  1.00 57.18  ? 139 HOH P O     1 
HETATM 3395 O  O     . HOH G 6 .   ? 7.826   51.275 26.873  1.00 44.56  ? 147 HOH P O     1 
HETATM 3396 O  O     . HOH G 6 .   ? -1.042  32.225 14.510  1.00 41.18  ? 168 HOH P O     1 
HETATM 3397 O  O     . HOH H 6 .   ? 16.298  31.360 19.707  1.00 45.83  ? 3   HOH T O     1 
HETATM 3398 O  O     . HOH H 6 .   ? 6.144   28.437 30.821  1.00 52.75  ? 46  HOH T O     1 
HETATM 3399 O  O     . HOH H 6 .   ? 13.768  47.129 16.070  1.00 22.26  ? 53  HOH T O     1 
HETATM 3400 O  O     . HOH H 6 .   ? 17.921  33.985 15.239  1.00 47.10  ? 88  HOH T O     1 
HETATM 3401 O  O     . HOH H 6 .   ? 9.522   37.587 12.366  1.00 45.39  ? 91  HOH T O     1 
HETATM 3402 O  O     . HOH H 6 .   ? 5.797   27.683 21.303  1.00 59.22  ? 135 HOH T O     1 
HETATM 3403 O  O     . HOH H 6 .   ? -7.332  35.526 18.924  1.00 54.93  ? 169 HOH T O     1 
HETATM 3404 O  O     . HOH H 6 .   ? -6.625  36.610 20.858  1.00 32.58  ? 170 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   25  25  ALA ALA A . n 
A 1 2   SER 2   26  26  SER SER A . n 
A 1 3   SER 3   27  27  SER SER A . n 
A 1 4   ARG 4   28  28  ARG ARG A . n 
A 1 5   VAL 5   29  29  VAL VAL A . n 
A 1 6   ILE 6   30  30  ILE ILE A . n 
A 1 7   VAL 7   31  31  VAL VAL A . n 
A 1 8   HIS 8   32  32  HIS HIS A . n 
A 1 9   VAL 9   33  33  VAL VAL A . n 
A 1 10  ASP 10  34  34  ASP ASP A . n 
A 1 11  LEU 11  35  35  LEU LEU A . n 
A 1 12  ASP 12  36  36  ASP ASP A . n 
A 1 13  CYS 13  37  37  CYS CYS A . n 
A 1 14  PHE 14  38  38  PHE PHE A . n 
A 1 15  TYR 15  39  39  TYR TYR A . n 
A 1 16  ALA 16  40  40  ALA ALA A . n 
A 1 17  GLN 17  41  41  GLN GLN A . n 
A 1 18  VAL 18  42  42  VAL VAL A . n 
A 1 19  GLU 19  43  43  GLU GLU A . n 
A 1 20  MET 20  44  44  MET MET A . n 
A 1 21  ILE 21  45  45  ILE ILE A . n 
A 1 22  SER 22  46  46  SER SER A . n 
A 1 23  ASN 23  47  47  ASN ASN A . n 
A 1 24  PRO 24  48  48  PRO PRO A . n 
A 1 25  GLU 25  49  49  GLU GLU A . n 
A 1 26  LEU 26  50  50  LEU LEU A . n 
A 1 27  LYS 27  51  51  LYS LYS A . n 
A 1 28  ASP 28  52  52  ASP ASP A . n 
A 1 29  LYS 29  53  53  LYS LYS A . n 
A 1 30  PRO 30  54  54  PRO PRO A . n 
A 1 31  LEU 31  55  55  LEU LEU A . n 
A 1 32  GLY 32  56  56  GLY GLY A . n 
A 1 33  VAL 33  57  57  VAL VAL A . n 
A 1 34  GLN 34  58  58  GLN GLN A . n 
A 1 35  GLN 35  59  59  GLN GLN A . n 
A 1 36  LYS 36  60  60  LYS LYS A . n 
A 1 37  TYR 37  61  61  TYR TYR A . n 
A 1 38  LEU 38  62  62  LEU LEU A . n 
A 1 39  VAL 39  63  63  VAL VAL A . n 
A 1 40  VAL 40  64  64  VAL VAL A . n 
A 1 41  THR 41  65  65  THR THR A . n 
A 1 42  CYS 42  66  66  CYS CYS A . n 
A 1 43  ASN 43  67  67  ASN ASN A . n 
A 1 44  TYR 44  68  68  TYR TYR A . n 
A 1 45  GLU 45  69  69  GLU GLU A . n 
A 1 46  ALA 46  70  70  ALA ALA A . n 
A 1 47  ARG 47  71  71  ARG ARG A . n 
A 1 48  LYS 48  72  72  LYS LYS A . n 
A 1 49  LEU 49  73  73  LEU LEU A . n 
A 1 50  GLY 50  74  74  GLY GLY A . n 
A 1 51  VAL 51  75  75  VAL VAL A . n 
A 1 52  LYS 52  76  76  LYS LYS A . n 
A 1 53  LYS 53  77  77  LYS LYS A . n 
A 1 54  LEU 54  78  78  LEU LEU A . n 
A 1 55  MET 55  79  79  MET MET A . n 
A 1 56  ASN 56  80  80  ASN ASN A . n 
A 1 57  VAL 57  81  81  VAL VAL A . n 
A 1 58  ARG 58  82  82  ARG ARG A . n 
A 1 59  ASP 59  83  83  ASP ASP A . n 
A 1 60  ALA 60  84  84  ALA ALA A . n 
A 1 61  LYS 61  85  85  LYS LYS A . n 
A 1 62  GLU 62  86  86  GLU GLU A . n 
A 1 63  LYS 63  87  87  LYS LYS A . n 
A 1 64  CYS 64  88  88  CYS CYS A . n 
A 1 65  PRO 65  89  89  PRO PRO A . n 
A 1 66  GLN 66  90  90  GLN GLN A . n 
A 1 67  LEU 67  91  91  LEU LEU A . n 
A 1 68  VAL 68  92  92  VAL VAL A . n 
A 1 69  LEU 69  93  93  LEU LEU A . n 
A 1 70  VAL 70  94  94  VAL VAL A . n 
A 1 71  ASN 71  95  95  ASN ASN A . n 
A 1 72  GLY 72  96  96  GLY GLY A . n 
A 1 73  GLU 73  97  97  GLU GLU A . n 
A 1 74  ASP 74  98  98  ASP ASP A . n 
A 1 75  LEU 75  99  99  LEU LEU A . n 
A 1 76  THR 76  100 100 THR THR A . n 
A 1 77  ARG 77  101 101 ARG ARG A . n 
A 1 78  TYR 78  102 102 TYR TYR A . n 
A 1 79  ARG 79  103 103 ARG ARG A . n 
A 1 80  GLU 80  104 104 GLU GLU A . n 
A 1 81  MET 81  105 105 MET MET A . n 
A 1 82  SER 82  106 106 SER SER A . n 
A 1 83  TYR 83  107 107 TYR TYR A . n 
A 1 84  LYS 84  108 108 LYS LYS A . n 
A 1 85  VAL 85  109 109 VAL VAL A . n 
A 1 86  THR 86  110 110 THR THR A . n 
A 1 87  GLU 87  111 111 GLU GLU A . n 
A 1 88  LEU 88  112 112 LEU LEU A . n 
A 1 89  LEU 89  113 113 LEU LEU A . n 
A 1 90  GLU 90  114 114 GLU GLU A . n 
A 1 91  GLU 91  115 115 GLU GLU A . n 
A 1 92  PHE 92  116 116 PHE PHE A . n 
A 1 93  SER 93  117 117 SER SER A . n 
A 1 94  PRO 94  118 118 PRO PRO A . n 
A 1 95  VAL 95  119 119 VAL VAL A . n 
A 1 96  VAL 96  120 120 VAL VAL A . n 
A 1 97  GLU 97  121 121 GLU GLU A . n 
A 1 98  ARG 98  122 122 ARG ARG A . n 
A 1 99  LEU 99  123 123 LEU LEU A . n 
A 1 100 GLY 100 124 124 GLY GLY A . n 
A 1 101 PHE 101 125 125 PHE PHE A . n 
A 1 102 ASP 102 126 126 ASP ASP A . n 
A 1 103 GLU 103 127 127 GLU GLU A . n 
A 1 104 ASN 104 128 128 ASN ASN A . n 
A 1 105 PHE 105 129 129 PHE PHE A . n 
A 1 106 VAL 106 130 130 VAL VAL A . n 
A 1 107 ASP 107 131 131 ASP ASP A . n 
A 1 108 LEU 108 132 132 LEU LEU A . n 
A 1 109 THR 109 133 133 THR THR A . n 
A 1 110 GLU 110 134 134 GLU GLU A . n 
A 1 111 MET 111 135 135 MET MET A . n 
A 1 112 VAL 112 136 136 VAL VAL A . n 
A 1 113 GLU 113 137 137 GLU GLU A . n 
A 1 114 LYS 114 138 138 LYS LYS A . n 
A 1 115 ARG 115 139 139 ARG ARG A . n 
A 1 116 LEU 116 140 140 LEU LEU A . n 
A 1 117 GLN 117 141 141 GLN GLN A . n 
A 1 118 GLN 118 142 142 GLN GLN A . n 
A 1 119 LEU 119 143 143 LEU LEU A . n 
A 1 120 GLN 120 144 144 GLN GLN A . n 
A 1 121 SER 121 145 145 SER SER A . n 
A 1 122 ASP 122 146 146 ASP ALA A . n 
A 1 123 GLU 123 147 147 GLU GLU A . n 
A 1 124 LEU 124 148 148 LEU LEU A . n 
A 1 125 SER 125 149 149 SER SER A . n 
A 1 126 ALA 126 150 150 ALA ALA A . n 
A 1 127 VAL 127 151 151 VAL VAL A . n 
A 1 128 THR 128 152 152 THR THR A . n 
A 1 129 VAL 129 153 153 VAL VAL A . n 
A 1 130 SER 130 154 154 SER SER A . n 
A 1 131 GLY 131 155 155 GLY GLY A . n 
A 1 132 HIS 132 156 156 HIS HIS A . n 
A 1 133 VAL 133 157 157 VAL VAL A . n 
A 1 134 TYR 134 158 158 TYR TYR A . n 
A 1 135 ASN 135 159 159 ASN ASN A . n 
A 1 136 ASN 136 160 160 ASN ASN A . n 
A 1 137 GLN 137 161 161 GLN GLN A . n 
A 1 138 SER 138 162 162 SER SER A . n 
A 1 139 ILE 139 163 163 ILE ILE A . n 
A 1 140 ASN 140 164 164 ASN ASN A . n 
A 1 141 LEU 141 165 165 LEU LEU A . n 
A 1 142 LEU 142 166 166 LEU LEU A . n 
A 1 143 ASP 143 167 167 ASP ASP A . n 
A 1 144 VAL 144 168 168 VAL VAL A . n 
A 1 145 LEU 145 169 169 LEU LEU A . n 
A 1 146 HIS 146 170 170 HIS HIS A . n 
A 1 147 ILE 147 171 171 ILE ILE A . n 
A 1 148 ARG 148 172 172 ARG ARG A . n 
A 1 149 LEU 149 173 173 LEU LEU A . n 
A 1 150 LEU 150 174 174 LEU LEU A . n 
A 1 151 VAL 151 175 175 VAL VAL A . n 
A 1 152 GLY 152 176 176 GLY GLY A . n 
A 1 153 SER 153 177 177 SER SER A . n 
A 1 154 GLN 154 178 178 GLN GLN A . n 
A 1 155 ILE 155 179 179 ILE ILE A . n 
A 1 156 ALA 156 180 180 ALA ALA A . n 
A 1 157 ALA 157 181 181 ALA ALA A . n 
A 1 158 GLU 158 182 182 GLU GLU A . n 
A 1 159 MET 159 183 183 MET MET A . n 
A 1 160 ARG 160 184 184 ARG ARG A . n 
A 1 161 GLU 161 185 185 GLU GLU A . n 
A 1 162 ALA 162 186 186 ALA ALA A . n 
A 1 163 MET 163 187 187 MET MET A . n 
A 1 164 TYR 164 188 188 TYR TYR A . n 
A 1 165 ASN 165 189 189 ASN ASN A . n 
A 1 166 GLN 166 190 190 GLN GLN A . n 
A 1 167 LEU 167 191 191 LEU LEU A . n 
A 1 168 GLY 168 192 192 GLY GLY A . n 
A 1 169 LEU 169 193 193 LEU LEU A . n 
A 1 170 THR 170 194 194 THR THR A . n 
A 1 171 GLY 171 195 195 GLY GLY A . n 
A 1 172 CYS 172 196 196 CYS CYS A . n 
A 1 173 ALA 173 197 197 ALA ALA A . n 
A 1 174 GLY 174 198 198 GLY GLY A . n 
A 1 175 VAL 175 199 199 VAL VAL A . n 
A 1 176 ALA 176 200 200 ALA ALA A . n 
A 1 177 SER 177 201 201 SER SER A . n 
A 1 178 ASN 178 202 202 ASN ASN A . n 
A 1 179 LYS 179 203 203 LYS LYS A . n 
A 1 180 LEU 180 204 204 LEU LEU A . n 
A 1 181 LEU 181 205 205 LEU LEU A . n 
A 1 182 ALA 182 206 206 ALA ALA A . n 
A 1 183 LYS 183 207 207 LYS LYS A . n 
A 1 184 LEU 184 208 208 LEU LEU A . n 
A 1 185 VAL 185 209 209 VAL VAL A . n 
A 1 186 SER 186 210 210 SER SER A . n 
A 1 187 GLY 187 211 211 GLY GLY A . n 
A 1 188 VAL 188 212 212 VAL VAL A . n 
A 1 189 PHE 189 213 213 PHE PHE A . n 
A 1 190 LYS 190 214 214 LYS LYS A . n 
A 1 191 PRO 191 215 215 PRO PRO A . n 
A 1 192 ASN 192 216 216 ASN ASN A . n 
A 1 193 GLN 193 217 217 GLN GLN A . n 
A 1 194 GLN 194 218 218 GLN GLN A . n 
A 1 195 THR 195 219 219 THR THR A . n 
A 1 196 VAL 196 220 220 VAL VAL A . n 
A 1 197 LEU 197 221 221 LEU LEU A . n 
A 1 198 LEU 198 222 222 LEU LEU A . n 
A 1 199 PRO 199 223 223 PRO PRO A . n 
A 1 200 GLU 200 224 224 GLU GLU A . n 
A 1 201 SER 201 225 225 SER SER A . n 
A 1 202 CYS 202 226 226 CYS CYS A . n 
A 1 203 GLN 203 227 227 GLN GLN A . n 
A 1 204 HIS 204 228 228 HIS HIS A . n 
A 1 205 LEU 205 229 229 LEU LEU A . n 
A 1 206 ILE 206 230 230 ILE ILE A . n 
A 1 207 HIS 207 231 231 HIS HIS A . n 
A 1 208 SER 208 232 232 SER SER A . n 
A 1 209 LEU 209 233 233 LEU LEU A . n 
A 1 210 ASN 210 234 234 ASN ASN A . n 
A 1 211 HIS 211 235 235 HIS HIS A . n 
A 1 212 ILE 212 236 236 ILE ILE A . n 
A 1 213 LYS 213 237 237 LYS LYS A . n 
A 1 214 GLU 214 238 238 GLU GLU A . n 
A 1 215 ILE 215 239 239 ILE ILE A . n 
A 1 216 PRO 216 240 240 PRO PRO A . n 
A 1 217 GLY 217 241 241 GLY GLY A . n 
A 1 218 ILE 218 242 242 ILE ILE A . n 
A 1 219 GLY 219 243 243 GLY GLY A . n 
A 1 220 TYR 220 244 244 TYR TYR A . n 
A 1 221 LYS 221 245 245 LYS ALA A . n 
A 1 222 THR 222 246 246 THR THR A . n 
A 1 223 ALA 223 247 247 ALA ALA A . n 
A 1 224 LYS 224 248 248 LYS LYS A . n 
A 1 225 CYS 225 249 249 CYS CYS A . n 
A 1 226 LEU 226 250 250 LEU LEU A . n 
A 1 227 GLU 227 251 251 GLU GLU A . n 
A 1 228 ALA 228 252 252 ALA ALA A . n 
A 1 229 LEU 229 253 253 LEU LEU A . n 
A 1 230 GLY 230 254 254 GLY GLY A . n 
A 1 231 ILE 231 255 255 ILE ILE A . n 
A 1 232 ASN 232 256 256 ASN ASN A . n 
A 1 233 SER 233 257 257 SER SER A . n 
A 1 234 VAL 234 258 258 VAL VAL A . n 
A 1 235 ARG 235 259 259 ARG ARG A . n 
A 1 236 ASP 236 260 260 ASP ASP A . n 
A 1 237 LEU 237 261 261 LEU LEU A . n 
A 1 238 GLN 238 262 262 GLN GLN A . n 
A 1 239 THR 239 263 263 THR THR A . n 
A 1 240 PHE 240 264 264 PHE PHE A . n 
A 1 241 SER 241 265 265 SER SER A . n 
A 1 242 PRO 242 266 266 PRO PRO A . n 
A 1 243 LYS 243 267 267 LYS LYS A . n 
A 1 244 ILE 244 268 268 ILE ILE A . n 
A 1 245 LEU 245 269 269 LEU LEU A . n 
A 1 246 GLU 246 270 270 GLU GLU A . n 
A 1 247 LYS 247 271 271 LYS ALA A . n 
A 1 248 GLU 248 272 272 GLU GLU A . n 
A 1 249 LEU 249 273 273 LEU LEU A . n 
A 1 250 GLY 250 274 274 GLY GLY A . n 
A 1 251 ILE 251 275 275 ILE ILE A . n 
A 1 252 SER 252 276 276 SER SER A . n 
A 1 253 VAL 253 277 277 VAL VAL A . n 
A 1 254 ALA 254 278 278 ALA ALA A . n 
A 1 255 GLN 255 279 279 GLN GLN A . n 
A 1 256 ARG 256 280 280 ARG ARG A . n 
A 1 257 ILE 257 281 281 ILE ILE A . n 
A 1 258 GLN 258 282 282 GLN GLN A . n 
A 1 259 LYS 259 283 283 LYS LYS A . n 
A 1 260 LEU 260 284 284 LEU LEU A . n 
A 1 261 SER 261 285 285 SER SER A . n 
A 1 262 PHE 262 286 286 PHE PHE A . n 
A 1 263 GLY 263 287 287 GLY GLY A . n 
A 1 264 GLU 264 288 288 GLU GLU A . n 
A 1 265 ASP 265 289 289 ASP ASP A . n 
A 1 266 ASN 266 290 290 ASN ASN A . n 
A 1 267 SER 267 291 291 SER SER A . n 
A 1 268 PRO 268 292 292 PRO PRO A . n 
A 1 269 VAL 269 293 293 VAL VAL A . n 
A 1 270 ILE 270 294 294 ILE ILE A . n 
A 1 271 LEU 271 295 295 LEU LEU A . n 
A 1 272 SER 272 296 296 SER SER A . n 
A 1 273 GLY 273 297 297 GLY GLY A . n 
A 1 274 PRO 274 298 298 PRO PRO A . n 
A 1 275 PRO 275 299 299 PRO PRO A . n 
A 1 276 GLN 276 300 300 GLN GLN A . n 
A 1 277 SER 277 301 301 SER SER A . n 
A 1 278 PHE 278 302 302 PHE PHE A . n 
A 1 279 SER 279 303 303 SER SER A . n 
A 1 280 GLU 280 304 304 GLU GLU A . n 
A 1 281 GLU 281 305 305 GLU GLU A . n 
A 1 282 ASP 282 306 306 ASP ASP A . n 
A 1 283 SER 283 307 307 SER SER A . n 
A 1 284 PHE 284 308 308 PHE PHE A . n 
A 1 285 LYS 285 309 309 LYS LYS A . n 
A 1 286 LYS 286 310 310 LYS LYS A . n 
A 1 287 CYS 287 311 311 CYS CYS A . n 
A 1 288 SER 288 312 312 SER SER A . n 
A 1 289 SER 289 313 313 SER SER A . n 
A 1 290 GLU 290 314 314 GLU GLU A . n 
A 1 291 VAL 291 315 315 VAL ALA A . n 
A 1 292 GLU 292 316 316 GLU ALA A . n 
A 1 293 ALA 293 317 317 ALA ALA A . n 
A 1 294 LYS 294 318 318 LYS LYS A . n 
A 1 295 ASN 295 319 319 ASN ASN A . n 
A 1 296 LYS 296 320 320 LYS LYS A . n 
A 1 297 ILE 297 321 321 ILE ILE A . n 
A 1 298 GLU 298 322 322 GLU GLU A . n 
A 1 299 GLU 299 323 323 GLU GLU A . n 
A 1 300 LEU 300 324 324 LEU LEU A . n 
A 1 301 LEU 301 325 325 LEU LEU A . n 
A 1 302 ALA 302 326 326 ALA ALA A . n 
A 1 303 SER 303 327 327 SER SER A . n 
A 1 304 LEU 304 328 328 LEU LEU A . n 
A 1 305 LEU 305 329 329 LEU LEU A . n 
A 1 306 ASN 306 330 330 ASN ASN A . n 
A 1 307 ARG 307 331 331 ARG ARG A . n 
A 1 308 VAL 308 332 332 VAL VAL A . n 
A 1 309 CYS 309 333 333 CYS CYS A . n 
A 1 310 GLN 310 334 334 GLN GLN A . n 
A 1 311 ASP 311 335 335 ASP ASP A . n 
A 1 312 GLY 312 336 336 GLY GLY A . n 
A 1 313 ARG 313 337 337 ARG ARG A . n 
A 1 314 LYS 314 338 338 LYS ALA A . n 
A 1 315 PRO 315 339 339 PRO PRO A . n 
A 1 316 HIS 316 340 340 HIS HIS A . n 
A 1 317 THR 317 341 341 THR THR A . n 
A 1 318 VAL 318 342 342 VAL VAL A . n 
A 1 319 ARG 319 343 343 ARG ARG A . n 
A 1 320 LEU 320 344 344 LEU LEU A . n 
A 1 321 ILE 321 345 345 ILE ILE A . n 
A 1 322 ILE 322 346 346 ILE ILE A . n 
A 1 323 ARG 323 347 347 ARG ARG A . n 
A 1 324 ARG 324 348 348 ARG ARG A . n 
A 1 325 TYR 325 349 349 TYR ALA A . n 
A 1 326 SER 326 350 350 SER ALA A . n 
A 1 327 SER 327 351 351 SER ALA A . n 
A 1 328 GLU 328 352 352 GLU ALA A . n 
A 1 329 LYS 329 353 353 LYS ALA A . n 
A 1 330 HIS 330 354 354 HIS ALA A . n 
A 1 331 TYR 331 355 355 TYR ALA A . n 
A 1 332 GLY 332 356 356 GLY GLY A . n 
A 1 333 ARG 333 357 357 ARG ARG A . n 
A 1 334 GLU 334 358 358 GLU GLU A . n 
A 1 335 SER 335 359 359 SER SER A . n 
A 1 336 ARG 336 360 360 ARG ARG A . n 
A 1 337 GLN 337 361 361 GLN GLN A . n 
A 1 338 CYS 338 362 362 CYS CYS A . n 
A 1 339 PRO 339 363 363 PRO PRO A . n 
A 1 340 ILE 340 364 364 ILE ILE A . n 
A 1 341 PRO 341 365 365 PRO PRO A . n 
A 1 342 SER 342 366 366 SER SER A . n 
A 1 343 HIS 343 367 367 HIS ALA A . n 
A 1 344 VAL 344 368 368 VAL VAL A . n 
A 1 345 ILE 345 369 369 ILE ILE A . n 
A 1 346 GLN 346 370 370 GLN GLN A . n 
A 1 347 LYS 347 371 ?   ?   ?   A . n 
A 1 348 LEU 348 372 ?   ?   ?   A . n 
A 1 349 GLY 349 373 ?   ?   ?   A . n 
A 1 350 THR 350 374 ?   ?   ?   A . n 
A 1 351 GLY 351 375 ?   ?   ?   A . n 
A 1 352 ASN 352 376 ?   ?   ?   A . n 
A 1 353 TYR 353 377 ?   ?   ?   A . n 
A 1 354 ASP 354 378 ?   ?   ?   A . n 
A 1 355 VAL 355 379 379 VAL ALA A . n 
A 1 356 MET 356 380 380 MET MET A . n 
A 1 357 THR 357 381 381 THR THR A . n 
A 1 358 PRO 358 382 382 PRO PRO A . n 
A 1 359 MET 359 383 383 MET MET A . n 
A 1 360 VAL 360 384 384 VAL VAL A . n 
A 1 361 ASP 361 385 385 ASP ASP A . n 
A 1 362 ILE 362 386 386 ILE ALA A . n 
A 1 363 LEU 363 387 387 LEU LEU A . n 
A 1 364 MET 364 388 388 MET MET A . n 
A 1 365 LYS 365 389 389 LYS ALA A . n 
A 1 366 LEU 366 390 390 LEU LEU A . n 
A 1 367 PHE 367 391 391 PHE PHE A . n 
A 1 368 ARG 368 392 392 ARG ARG A . n 
A 1 369 ASN 369 393 393 ASN ASN A . n 
A 1 370 MET 370 394 394 MET MET A . n 
A 1 371 VAL 371 395 ?   ?   ?   A . n 
A 1 372 ASN 372 396 ?   ?   ?   A . n 
A 1 373 VAL 373 397 ?   ?   ?   A . n 
A 1 374 LYS 374 398 ?   ?   ?   A . n 
A 1 375 MET 375 399 ?   ?   ?   A . n 
A 1 376 PRO 376 400 ?   ?   ?   A . n 
A 1 377 PHE 377 401 ?   ?   ?   A . n 
A 1 378 HIS 378 402 ?   ?   ?   A . n 
A 1 379 LEU 379 403 ?   ?   ?   A . n 
A 1 380 THR 380 404 404 THR THR A . n 
A 1 381 LEU 381 405 405 LEU ALA A . n 
A 1 382 LEU 382 406 406 LEU LEU A . n 
A 1 383 SER 383 407 407 SER SER A . n 
A 1 384 VAL 384 408 408 VAL VAL A . n 
A 1 385 CYS 385 409 409 CYS CYS A . n 
A 1 386 PHE 386 410 410 PHE PHE A . n 
A 1 387 CYS 387 411 411 CYS CYS A . n 
A 1 388 ASN 388 412 412 ASN ASN A . n 
A 1 389 LEU 389 413 413 LEU LEU A . n 
A 1 390 LYS 390 414 414 LYS LYS A . n 
B 2 1   DA  1   867 867 DA  DA  P . n 
B 2 2   DG  2   868 868 DG  DG  P . n 
B 2 3   DG  3   869 869 DG  DG  P . n 
B 2 4   DA  4   870 870 DA  DA  P . n 
B 2 5   DC  5   871 871 DC  DC  P . n 
B 2 6   DC  6   872 872 DC  DC  P . n 
B 2 7   DOC 7   873 873 DOC DOC P . n 
C 3 1   DT  1   839 839 DT  DT  T . n 
C 3 2   BRU 2   840 840 BRU BRU T . n 
C 3 3   DG  3   841 841 DG  DG  T . n 
C 3 4   DG  4   842 842 DG  DG  T . n 
C 3 5   DG  5   843 843 DG  DG  T . n 
C 3 6   DT  6   844 844 DT  DT  T . n 
C 3 7   DC  7   845 845 DC  DC  T . n 
C 3 8   DC  8   846 846 DC  DC  T . n 
C 3 9   DT  9   847 847 DT  DT  T . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B DOC 7 P DOC 873 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
2 C BRU 2 T BRU 840 ? DU ?                                        
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4950  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  19890 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O3G ? D DTP . ? A DTP 875 ? 1_555 MG ? E MG . ? A MG 871 ? 1_555 O2A ? D DTP . ? A DTP 875 ? 1_555 94.3  ? 
2 O3G ? D DTP . ? A DTP 875 ? 1_555 MG ? E MG . ? A MG 871 ? 1_555 O   ? F HOH . ? A HOH 529 ? 1_555 124.3 ? 
3 O2A ? D DTP . ? A DTP 875 ? 1_555 MG ? E MG . ? A MG 871 ? 1_555 O   ? F HOH . ? A HOH 529 ? 1_555 124.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-21 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum ? 1 
AMoRE    phasing           .       ? 2 
CNS      refinement        1.1     ? 3 
HKL-2000 'data reduction'  .       ? 4 
HKL-2000 'data scaling'    .       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A GLY 254 ? ? O A HOH 469 ? ? 2.12 
2 1 O1G A DTP 875 ? ? O A HOH 526 ? ? 2.12 
3 1 O   A HOH 481 ? ? O A HOH 512 ? ? 2.14 
4 1 O   A THR 381 ? ? O A HOH 517 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N     A LYS 214 ? ? CA    A LYS 214 ? ? C  A LYS 214 ? ? 127.86 111.00 16.86 2.70 N 
2 1 "O4'" T DG  841 ? ? "C1'" T DG  841 ? ? N9 T DG  841 ? ? 110.67 108.30 2.37  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 26  ? ? -177.96 -57.01  
2  1 CYS A 37  ? ? 19.64   53.99   
3  1 SER A 46  ? ? -61.25  -72.91  
4  1 GLU A 49  ? ? -49.17  -17.86  
5  1 ASP A 52  ? ? 46.30   -11.29  
6  1 LYS A 60  ? ? 60.38   -123.91 
7  1 CYS A 88  ? ? -155.95 74.88   
8  1 PRO A 89  ? ? -64.06  43.85   
9  1 GLN A 90  ? ? -153.47 -14.25  
10 1 SER A 145 ? ? -60.64  57.10   
11 1 ASP A 146 ? ? -167.14 -65.53  
12 1 ASN A 216 ? ? 37.51   65.86   
13 1 LYS A 245 ? ? -61.12  -76.17  
14 1 THR A 246 ? ? -37.67  -34.04  
15 1 GLU A 272 ? ? -142.40 -4.78   
16 1 SER A 276 ? ? -72.89  -85.03  
17 1 ASP A 306 ? ? -166.24 118.80  
18 1 LYS A 309 ? ? -40.20  82.39   
19 1 LYS A 310 ? ? 22.74   49.93   
20 1 CYS A 311 ? ? -109.64 69.26   
21 1 GLU A 314 ? ? 89.20   -2.40   
22 1 GLU A 316 ? ? 66.97   -31.49  
23 1 ALA A 317 ? ? -75.98  24.15   
24 1 CYS A 333 ? ? -67.23  -82.40  
25 1 GLN A 334 ? ? -20.24  -53.59  
26 1 SER A 350 ? ? 174.27  -102.72 
27 1 SER A 351 ? ? -91.39  -147.13 
28 1 GLU A 352 ? ? -103.38 63.38   
29 1 LYS A 353 ? ? -66.13  89.55   
30 1 HIS A 354 ? ? -59.31  -0.16   
31 1 TYR A 355 ? ? -172.76 99.22   
32 1 THR A 381 ? ? -21.82  -71.32  
33 1 ASN A 393 ? ? -49.69  -17.06  
34 1 ASN A 412 ? ? 60.48   65.14   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC P 871 ? ? 0.071 'SIDE CHAIN' 
2 1 DC P 872 ? ? 0.079 'SIDE CHAIN' 
3 1 DG T 842 ? ? 0.069 'SIDE CHAIN' 
4 1 DG T 843 ? ? 0.071 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 146 ? CG  ? A ASP 122 CG  
2  1 Y 1 A ASP 146 ? OD1 ? A ASP 122 OD1 
3  1 Y 1 A ASP 146 ? OD2 ? A ASP 122 OD2 
4  1 Y 1 A LYS 245 ? CG  ? A LYS 221 CG  
5  1 Y 1 A LYS 245 ? CD  ? A LYS 221 CD  
6  1 Y 1 A LYS 245 ? CE  ? A LYS 221 CE  
7  1 Y 1 A LYS 245 ? NZ  ? A LYS 221 NZ  
8  1 Y 1 A LYS 271 ? CG  ? A LYS 247 CG  
9  1 Y 1 A LYS 271 ? CD  ? A LYS 247 CD  
10 1 Y 1 A LYS 271 ? CE  ? A LYS 247 CE  
11 1 Y 1 A LYS 271 ? NZ  ? A LYS 247 NZ  
12 1 Y 1 A VAL 315 ? CG1 ? A VAL 291 CG1 
13 1 Y 1 A VAL 315 ? CG2 ? A VAL 291 CG2 
14 1 Y 1 A GLU 316 ? CG  ? A GLU 292 CG  
15 1 Y 1 A GLU 316 ? CD  ? A GLU 292 CD  
16 1 Y 1 A GLU 316 ? OE1 ? A GLU 292 OE1 
17 1 Y 1 A GLU 316 ? OE2 ? A GLU 292 OE2 
18 1 Y 1 A LYS 338 ? CG  ? A LYS 314 CG  
19 1 Y 1 A LYS 338 ? CD  ? A LYS 314 CD  
20 1 Y 1 A LYS 338 ? CE  ? A LYS 314 CE  
21 1 Y 1 A LYS 338 ? NZ  ? A LYS 314 NZ  
22 1 Y 1 A TYR 349 ? CG  ? A TYR 325 CG  
23 1 Y 1 A TYR 349 ? CD1 ? A TYR 325 CD1 
24 1 Y 1 A TYR 349 ? CD2 ? A TYR 325 CD2 
25 1 Y 1 A TYR 349 ? CE1 ? A TYR 325 CE1 
26 1 Y 1 A TYR 349 ? CE2 ? A TYR 325 CE2 
27 1 Y 1 A TYR 349 ? CZ  ? A TYR 325 CZ  
28 1 Y 1 A TYR 349 ? OH  ? A TYR 325 OH  
29 1 Y 1 A SER 350 ? OG  ? A SER 326 OG  
30 1 Y 1 A SER 351 ? OG  ? A SER 327 OG  
31 1 Y 1 A GLU 352 ? CG  ? A GLU 328 CG  
32 1 Y 1 A GLU 352 ? CD  ? A GLU 328 CD  
33 1 Y 1 A GLU 352 ? OE1 ? A GLU 328 OE1 
34 1 Y 1 A GLU 352 ? OE2 ? A GLU 328 OE2 
35 1 Y 1 A LYS 353 ? CG  ? A LYS 329 CG  
36 1 Y 1 A LYS 353 ? CD  ? A LYS 329 CD  
37 1 Y 1 A LYS 353 ? CE  ? A LYS 329 CE  
38 1 Y 1 A LYS 353 ? NZ  ? A LYS 329 NZ  
39 1 Y 1 A HIS 354 ? CG  ? A HIS 330 CG  
40 1 Y 1 A HIS 354 ? ND1 ? A HIS 330 ND1 
41 1 Y 1 A HIS 354 ? CD2 ? A HIS 330 CD2 
42 1 Y 1 A HIS 354 ? CE1 ? A HIS 330 CE1 
43 1 Y 1 A HIS 354 ? NE2 ? A HIS 330 NE2 
44 1 Y 1 A TYR 355 ? CG  ? A TYR 331 CG  
45 1 Y 1 A TYR 355 ? CD1 ? A TYR 331 CD1 
46 1 Y 1 A TYR 355 ? CD2 ? A TYR 331 CD2 
47 1 Y 1 A TYR 355 ? CE1 ? A TYR 331 CE1 
48 1 Y 1 A TYR 355 ? CE2 ? A TYR 331 CE2 
49 1 Y 1 A TYR 355 ? CZ  ? A TYR 331 CZ  
50 1 Y 1 A TYR 355 ? OH  ? A TYR 331 OH  
51 1 Y 1 A HIS 367 ? CG  ? A HIS 343 CG  
52 1 Y 1 A HIS 367 ? ND1 ? A HIS 343 ND1 
53 1 Y 1 A HIS 367 ? CD2 ? A HIS 343 CD2 
54 1 Y 1 A HIS 367 ? CE1 ? A HIS 343 CE1 
55 1 Y 1 A HIS 367 ? NE2 ? A HIS 343 NE2 
56 1 Y 1 A VAL 379 ? CG1 ? A VAL 355 CG1 
57 1 Y 1 A VAL 379 ? CG2 ? A VAL 355 CG2 
58 1 Y 1 A ILE 386 ? CG1 ? A ILE 362 CG1 
59 1 Y 1 A ILE 386 ? CG2 ? A ILE 362 CG2 
60 1 Y 1 A ILE 386 ? CD1 ? A ILE 362 CD1 
61 1 Y 1 A LYS 389 ? CG  ? A LYS 365 CG  
62 1 Y 1 A LYS 389 ? CD  ? A LYS 365 CD  
63 1 Y 1 A LYS 389 ? CE  ? A LYS 365 CE  
64 1 Y 1 A LYS 389 ? NZ  ? A LYS 365 NZ  
65 1 Y 1 A LEU 405 ? CG  ? A LEU 381 CG  
66 1 Y 1 A LEU 405 ? CD1 ? A LEU 381 CD1 
67 1 Y 1 A LEU 405 ? CD2 ? A LEU 381 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 371 ? A LYS 347 
2  1 Y 1 A LEU 372 ? A LEU 348 
3  1 Y 1 A GLY 373 ? A GLY 349 
4  1 Y 1 A THR 374 ? A THR 350 
5  1 Y 1 A GLY 375 ? A GLY 351 
6  1 Y 1 A ASN 376 ? A ASN 352 
7  1 Y 1 A TYR 377 ? A TYR 353 
8  1 Y 1 A ASP 378 ? A ASP 354 
9  1 Y 1 A VAL 395 ? A VAL 371 
10 1 Y 1 A ASN 396 ? A ASN 372 
11 1 Y 1 A VAL 397 ? A VAL 373 
12 1 Y 1 A LYS 398 ? A LYS 374 
13 1 Y 1 A MET 399 ? A MET 375 
14 1 Y 1 A PRO 400 ? A PRO 376 
15 1 Y 1 A PHE 401 ? A PHE 377 
16 1 Y 1 A HIS 402 ? A HIS 378 
17 1 Y 1 A LEU 403 ? A LEU 379 
# 
_ndb_struct_conf_na.entry_id   3H4B 
_ndb_struct_conf_na.feature    'double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA  1 1_555 C DT 9 1_555 -0.068 -0.291 0.325  8.780  -1.038 -0.191 1 P_DA867:DT847_T  P 867 ? T 847 ? 20 1 
1 B DG  2 1_555 C DC 8 1_555 -0.137 0.037  -0.084 3.101  -1.909 -1.606 2 P_DG868:DC846_T  P 868 ? T 846 ? 19 1 
1 B DG  3 1_555 C DC 7 1_555 -0.121 -0.028 -0.445 -0.221 -1.071 -2.658 3 P_DG869:DC845_T  P 869 ? T 845 ? 19 1 
1 B DA  4 1_555 C DT 6 1_555 0.150  -0.132 -0.179 9.530  7.066  0.037  4 P_DA870:DT844_T  P 870 ? T 844 ? 20 1 
1 B DC  5 1_555 C DG 5 1_555 -0.083 -0.136 -0.743 17.995 -0.764 0.211  5 P_DC871:DG843_T  P 871 ? T 843 ? 19 1 
1 B DC  6 1_555 C DG 4 1_555 0.046  -0.234 -0.700 11.551 3.143  -2.424 6 P_DC872:DG842_T  P 872 ? T 842 ? 19 1 
1 B DOC 7 1_555 C DG 3 1_555 0.132  -0.140 -0.559 6.725  6.807  -2.746 7 P_DOC873:DG841_T P 873 ? T 841 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 1 1_555 C DT 9 1_555 B DG  2 1_555 C DC 8 1_555 0.507  -0.781 3.564 3.664  -0.338 29.894 -1.427 -0.152 3.607 -0.651 -7.068 
30.115 1 PP_DA867DG868:DC846DT847_TT  P 867 ? T 847 ? P 868 ? T 846 ? 
1 B DG 2 1_555 C DC 8 1_555 B DG  3 1_555 C DC 7 1_555 0.125  -0.894 3.479 2.751  0.269  37.056 -1.441 0.194  3.472 0.423  -4.321 
37.156 2 PP_DG868DG869:DC845DC846_TT  P 868 ? T 846 ? P 869 ? T 845 ? 
1 B DG 3 1_555 C DC 7 1_555 B DA  4 1_555 C DT 6 1_555 0.046  -0.219 3.149 -3.468 5.993  31.936 -1.384 -0.658 3.038 10.734 6.212  
32.659 3 PP_DG869DA870:DT844DC845_TT  P 869 ? T 845 ? P 870 ? T 844 ? 
1 B DA 4 1_555 C DT 6 1_555 B DC  5 1_555 C DG 5 1_555 0.562  -0.871 3.122 1.707  3.398  28.722 -2.449 -0.767 3.028 6.811  -3.423 
28.967 4 PP_DA870DC871:DG843DT844_TT  P 870 ? T 844 ? P 871 ? T 843 ? 
1 B DC 5 1_555 C DG 5 1_555 B DC  6 1_555 C DG 4 1_555 -0.517 -1.418 3.626 -3.152 11.862 30.772 -4.577 0.354  2.932 21.320 5.665  
33.074 5 PP_DC871DC872:DG842DG843_TT  P 871 ? T 843 ? P 872 ? T 842 ? 
1 B DC 6 1_555 C DG 4 1_555 B DOC 7 1_555 C DG 3 1_555 -0.638 -1.271 3.541 -0.876 9.620  24.906 -5.304 1.149  2.878 21.309 1.941  
26.686 6 PP_DC872DOC873:DG841DG842_TT P 872 ? T 842 ? P 873 ? T 841 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
5 'MAGNESIUM ION'                     MG  
6 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DTP 1   875 875 DTP DTP A . 
E 5 MG  1   871 871 MG  MG2 A . 
F 6 HOH 1   1   1   HOH TIP A . 
F 6 HOH 2   2   2   HOH TIP A . 
F 6 HOH 3   4   4   HOH TIP A . 
F 6 HOH 4   5   5   HOH TIP A . 
F 6 HOH 5   6   6   HOH TIP A . 
F 6 HOH 6   7   7   HOH TIP A . 
F 6 HOH 7   9   9   HOH TIP A . 
F 6 HOH 8   10  10  HOH TIP A . 
F 6 HOH 9   11  11  HOH TIP A . 
F 6 HOH 10  12  12  HOH TIP A . 
F 6 HOH 11  13  13  HOH TIP A . 
F 6 HOH 12  14  14  HOH TIP A . 
F 6 HOH 13  15  15  HOH TIP A . 
F 6 HOH 14  16  16  HOH TIP A . 
F 6 HOH 15  17  17  HOH TIP A . 
F 6 HOH 16  18  18  HOH TIP A . 
F 6 HOH 17  19  19  HOH TIP A . 
F 6 HOH 18  20  20  HOH TIP A . 
F 6 HOH 19  21  21  HOH TIP A . 
F 6 HOH 20  22  22  HOH TIP A . 
F 6 HOH 21  23  23  HOH TIP A . 
F 6 HOH 22  24  24  HOH TIP A . 
F 6 HOH 23  415 25  HOH TIP A . 
F 6 HOH 24  416 26  HOH TIP A . 
F 6 HOH 25  417 27  HOH TIP A . 
F 6 HOH 26  418 28  HOH TIP A . 
F 6 HOH 27  419 29  HOH TIP A . 
F 6 HOH 28  420 30  HOH TIP A . 
F 6 HOH 29  421 31  HOH TIP A . 
F 6 HOH 30  422 32  HOH TIP A . 
F 6 HOH 31  423 33  HOH TIP A . 
F 6 HOH 32  424 34  HOH TIP A . 
F 6 HOH 33  425 35  HOH TIP A . 
F 6 HOH 34  426 36  HOH TIP A . 
F 6 HOH 35  427 37  HOH TIP A . 
F 6 HOH 36  428 38  HOH TIP A . 
F 6 HOH 37  429 39  HOH TIP A . 
F 6 HOH 38  430 40  HOH TIP A . 
F 6 HOH 39  431 41  HOH TIP A . 
F 6 HOH 40  432 42  HOH TIP A . 
F 6 HOH 41  433 43  HOH TIP A . 
F 6 HOH 42  434 44  HOH TIP A . 
F 6 HOH 43  435 45  HOH TIP A . 
F 6 HOH 44  436 47  HOH TIP A . 
F 6 HOH 45  437 49  HOH TIP A . 
F 6 HOH 46  438 50  HOH TIP A . 
F 6 HOH 47  439 51  HOH TIP A . 
F 6 HOH 48  440 54  HOH TIP A . 
F 6 HOH 49  441 56  HOH TIP A . 
F 6 HOH 50  442 57  HOH TIP A . 
F 6 HOH 51  443 58  HOH TIP A . 
F 6 HOH 52  444 59  HOH TIP A . 
F 6 HOH 53  445 60  HOH TIP A . 
F 6 HOH 54  446 61  HOH TIP A . 
F 6 HOH 55  447 62  HOH TIP A . 
F 6 HOH 56  448 63  HOH TIP A . 
F 6 HOH 57  449 64  HOH TIP A . 
F 6 HOH 58  450 65  HOH TIP A . 
F 6 HOH 59  451 66  HOH TIP A . 
F 6 HOH 60  452 67  HOH TIP A . 
F 6 HOH 61  453 68  HOH TIP A . 
F 6 HOH 62  454 69  HOH TIP A . 
F 6 HOH 63  455 70  HOH TIP A . 
F 6 HOH 64  456 71  HOH TIP A . 
F 6 HOH 65  457 72  HOH TIP A . 
F 6 HOH 66  458 73  HOH TIP A . 
F 6 HOH 67  459 74  HOH TIP A . 
F 6 HOH 68  460 75  HOH TIP A . 
F 6 HOH 69  461 76  HOH TIP A . 
F 6 HOH 70  462 77  HOH TIP A . 
F 6 HOH 71  463 78  HOH TIP A . 
F 6 HOH 72  464 79  HOH TIP A . 
F 6 HOH 73  465 81  HOH TIP A . 
F 6 HOH 74  466 82  HOH TIP A . 
F 6 HOH 75  467 83  HOH TIP A . 
F 6 HOH 76  468 84  HOH TIP A . 
F 6 HOH 77  469 85  HOH TIP A . 
F 6 HOH 78  470 87  HOH TIP A . 
F 6 HOH 79  471 90  HOH TIP A . 
F 6 HOH 80  472 92  HOH TIP A . 
F 6 HOH 81  473 93  HOH TIP A . 
F 6 HOH 82  474 95  HOH TIP A . 
F 6 HOH 83  475 96  HOH TIP A . 
F 6 HOH 84  476 97  HOH TIP A . 
F 6 HOH 85  477 98  HOH TIP A . 
F 6 HOH 86  478 99  HOH TIP A . 
F 6 HOH 87  479 100 HOH TIP A . 
F 6 HOH 88  480 101 HOH TIP A . 
F 6 HOH 89  481 102 HOH TIP A . 
F 6 HOH 90  482 104 HOH TIP A . 
F 6 HOH 91  483 105 HOH TIP A . 
F 6 HOH 92  484 106 HOH TIP A . 
F 6 HOH 93  485 107 HOH TIP A . 
F 6 HOH 94  486 108 HOH TIP A . 
F 6 HOH 95  487 109 HOH TIP A . 
F 6 HOH 96  488 110 HOH TIP A . 
F 6 HOH 97  489 112 HOH TIP A . 
F 6 HOH 98  490 113 HOH TIP A . 
F 6 HOH 99  491 114 HOH TIP A . 
F 6 HOH 100 492 116 HOH TIP A . 
F 6 HOH 101 493 117 HOH TIP A . 
F 6 HOH 102 494 118 HOH TIP A . 
F 6 HOH 103 495 119 HOH TIP A . 
F 6 HOH 104 496 120 HOH TIP A . 
F 6 HOH 105 497 123 HOH TIP A . 
F 6 HOH 106 498 124 HOH TIP A . 
F 6 HOH 107 499 125 HOH TIP A . 
F 6 HOH 108 500 126 HOH TIP A . 
F 6 HOH 109 501 127 HOH TIP A . 
F 6 HOH 110 502 128 HOH TIP A . 
F 6 HOH 111 503 129 HOH TIP A . 
F 6 HOH 112 504 131 HOH TIP A . 
F 6 HOH 113 505 132 HOH TIP A . 
F 6 HOH 114 506 133 HOH TIP A . 
F 6 HOH 115 507 134 HOH TIP A . 
F 6 HOH 116 508 136 HOH TIP A . 
F 6 HOH 117 509 137 HOH TIP A . 
F 6 HOH 118 510 138 HOH TIP A . 
F 6 HOH 119 511 140 HOH TIP A . 
F 6 HOH 120 512 141 HOH TIP A . 
F 6 HOH 121 513 142 HOH TIP A . 
F 6 HOH 122 514 143 HOH TIP A . 
F 6 HOH 123 515 145 HOH TIP A . 
F 6 HOH 124 516 146 HOH TIP A . 
F 6 HOH 125 517 148 HOH TIP A . 
F 6 HOH 126 518 149 HOH TIP A . 
F 6 HOH 127 519 150 HOH TIP A . 
F 6 HOH 128 520 151 HOH TIP A . 
F 6 HOH 129 521 152 HOH TIP A . 
F 6 HOH 130 522 153 HOH TIP A . 
F 6 HOH 131 523 154 HOH TIP A . 
F 6 HOH 132 524 156 HOH TIP A . 
F 6 HOH 133 525 157 HOH TIP A . 
F 6 HOH 134 526 159 HOH TIP A . 
F 6 HOH 135 527 162 HOH TIP A . 
F 6 HOH 136 528 164 HOH TIP A . 
F 6 HOH 137 529 166 HOH TIP A . 
F 6 HOH 138 530 167 HOH TIP A . 
F 6 HOH 139 531 171 HOH TIP A . 
F 6 HOH 140 532 172 HOH TIP A . 
F 6 HOH 141 533 173 HOH TIP A . 
G 6 HOH 1   8   8   HOH TIP P . 
G 6 HOH 2   80  80  HOH TIP P . 
G 6 HOH 3   86  86  HOH TIP P . 
G 6 HOH 4   103 103 HOH TIP P . 
G 6 HOH 5   139 139 HOH TIP P . 
G 6 HOH 6   147 147 HOH TIP P . 
G 6 HOH 7   168 168 HOH TIP P . 
H 6 HOH 1   3   3   HOH TIP T . 
H 6 HOH 2   46  46  HOH TIP T . 
H 6 HOH 3   53  53  HOH TIP T . 
H 6 HOH 4   88  88  HOH TIP T . 
H 6 HOH 5   91  91  HOH TIP T . 
H 6 HOH 6   135 135 HOH TIP T . 
H 6 HOH 7   169 169 HOH TIP T . 
H 6 HOH 8   170 170 HOH TIP T . 
#