data_3H60
# 
_entry.id   3H60 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H60         
RCSB  RCSB052735   
WWPDB D_1000052735 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3H61 . unspecified 
PDB 3H62 . unspecified 
PDB 3H63 . unspecified 
PDB 3H64 . unspecified 
PDB 3H66 . unspecified 
PDB 3H67 . unspecified 
PDB 3H68 . unspecified 
PDB 3H69 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3H60 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bertini, I.'   1 
'Calderone, V.' 2 
'Fragai, M.'    3 
'Luchinat, C.'  4 
'Talluri, E.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            52 
_citation.page_first                4838 
_citation.page_last                 4843 
_citation.year                      2009 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19601647 
_citation.pdbx_database_id_DOI      10.1021/jm900610k 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bertini, I.'   1 
primary 'Calderone, V.' 2 
primary 'Fragai, M.'    3 
primary 'Luchinat, C.'  4 
primary 'Talluri, E.'   5 
# 
_cell.entry_id           3H60 
_cell.length_a           154.414 
_cell.length_b           41.755 
_cell.length_c           105.432 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.07 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H60 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein phosphatase 5' 35950.797 2   3.1.3.16 ? 'Catalytic domain, residues 176-490' ? 
2 non-polymer syn 'MANGANESE (II) ION'                     54.938    4   ?        ? ?                                    ? 
3 water       nat water                                    18.015    432 ?        ? ?                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PP5c, PP5, Protein phosphatase T, PP-T, PPT' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF
EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL
EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF
EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL
EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   TYR n 
1 2   SER n 
1 3   GLY n 
1 4   PRO n 
1 5   LYS n 
1 6   LEU n 
1 7   GLU n 
1 8   ASP n 
1 9   GLY n 
1 10  LYS n 
1 11  VAL n 
1 12  THR n 
1 13  ILE n 
1 14  SER n 
1 15  PHE n 
1 16  MET n 
1 17  LYS n 
1 18  GLU n 
1 19  LEU n 
1 20  MET n 
1 21  GLN n 
1 22  TRP n 
1 23  TYR n 
1 24  LYS n 
1 25  ASP n 
1 26  GLN n 
1 27  LYS n 
1 28  LYS n 
1 29  LEU n 
1 30  HIS n 
1 31  ARG n 
1 32  LYS n 
1 33  CYS n 
1 34  ALA n 
1 35  TYR n 
1 36  GLN n 
1 37  ILE n 
1 38  LEU n 
1 39  VAL n 
1 40  GLN n 
1 41  VAL n 
1 42  LYS n 
1 43  GLU n 
1 44  VAL n 
1 45  LEU n 
1 46  SER n 
1 47  LYS n 
1 48  LEU n 
1 49  SER n 
1 50  THR n 
1 51  LEU n 
1 52  VAL n 
1 53  GLU n 
1 54  THR n 
1 55  THR n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  THR n 
1 60  GLU n 
1 61  LYS n 
1 62  ILE n 
1 63  THR n 
1 64  VAL n 
1 65  CYS n 
1 66  GLY n 
1 67  ASP n 
1 68  THR n 
1 69  HIS n 
1 70  GLY n 
1 71  GLN n 
1 72  PHE n 
1 73  TYR n 
1 74  ASP n 
1 75  LEU n 
1 76  LEU n 
1 77  ASN n 
1 78  ILE n 
1 79  PHE n 
1 80  GLU n 
1 81  LEU n 
1 82  ASN n 
1 83  GLY n 
1 84  LEU n 
1 85  PRO n 
1 86  SER n 
1 87  GLU n 
1 88  THR n 
1 89  ASN n 
1 90  PRO n 
1 91  TYR n 
1 92  ILE n 
1 93  PHE n 
1 94  ASN n 
1 95  GLY n 
1 96  ASP n 
1 97  PHE n 
1 98  VAL n 
1 99  ASP n 
1 100 ARG n 
1 101 GLY n 
1 102 SER n 
1 103 PHE n 
1 104 SER n 
1 105 VAL n 
1 106 GLU n 
1 107 VAL n 
1 108 ILE n 
1 109 LEU n 
1 110 THR n 
1 111 LEU n 
1 112 PHE n 
1 113 GLY n 
1 114 PHE n 
1 115 LYS n 
1 116 LEU n 
1 117 LEU n 
1 118 TYR n 
1 119 PRO n 
1 120 ASP n 
1 121 HIS n 
1 122 PHE n 
1 123 HIS n 
1 124 LEU n 
1 125 LEU n 
1 126 ARG n 
1 127 GLY n 
1 128 ASN n 
1 129 HIS n 
1 130 GLU n 
1 131 THR n 
1 132 ASP n 
1 133 ASN n 
1 134 MET n 
1 135 ASN n 
1 136 GLN n 
1 137 ILE n 
1 138 TYR n 
1 139 GLY n 
1 140 PHE n 
1 141 GLU n 
1 142 GLY n 
1 143 GLU n 
1 144 VAL n 
1 145 LYS n 
1 146 ALA n 
1 147 LYS n 
1 148 TYR n 
1 149 THR n 
1 150 ALA n 
1 151 GLN n 
1 152 MET n 
1 153 TYR n 
1 154 GLU n 
1 155 LEU n 
1 156 PHE n 
1 157 SER n 
1 158 GLU n 
1 159 VAL n 
1 160 PHE n 
1 161 GLU n 
1 162 TRP n 
1 163 LEU n 
1 164 PRO n 
1 165 LEU n 
1 166 ALA n 
1 167 GLN n 
1 168 CYS n 
1 169 ILE n 
1 170 ASN n 
1 171 GLY n 
1 172 LYS n 
1 173 VAL n 
1 174 LEU n 
1 175 ILE n 
1 176 MET n 
1 177 HIS n 
1 178 GLY n 
1 179 GLY n 
1 180 LEU n 
1 181 PHE n 
1 182 SER n 
1 183 GLU n 
1 184 ASP n 
1 185 GLY n 
1 186 VAL n 
1 187 THR n 
1 188 LEU n 
1 189 ASP n 
1 190 ASP n 
1 191 ILE n 
1 192 ARG n 
1 193 LYS n 
1 194 ILE n 
1 195 GLU n 
1 196 ARG n 
1 197 ASN n 
1 198 ARG n 
1 199 GLN n 
1 200 PRO n 
1 201 PRO n 
1 202 ASP n 
1 203 SER n 
1 204 GLY n 
1 205 PRO n 
1 206 MET n 
1 207 CYS n 
1 208 ASP n 
1 209 LEU n 
1 210 LEU n 
1 211 TRP n 
1 212 SER n 
1 213 ASP n 
1 214 PRO n 
1 215 GLN n 
1 216 PRO n 
1 217 GLN n 
1 218 ASN n 
1 219 GLY n 
1 220 ARG n 
1 221 SER n 
1 222 ILE n 
1 223 SER n 
1 224 LYS n 
1 225 ARG n 
1 226 GLY n 
1 227 VAL n 
1 228 SER n 
1 229 CYS n 
1 230 GLN n 
1 231 PHE n 
1 232 GLY n 
1 233 PRO n 
1 234 ASP n 
1 235 VAL n 
1 236 THR n 
1 237 LYS n 
1 238 ALA n 
1 239 PHE n 
1 240 LEU n 
1 241 GLU n 
1 242 GLU n 
1 243 ASN n 
1 244 ASN n 
1 245 LEU n 
1 246 ASP n 
1 247 TYR n 
1 248 ILE n 
1 249 ILE n 
1 250 ARG n 
1 251 SER n 
1 252 HIS n 
1 253 GLU n 
1 254 VAL n 
1 255 LYS n 
1 256 ALA n 
1 257 GLU n 
1 258 GLY n 
1 259 TYR n 
1 260 GLU n 
1 261 VAL n 
1 262 ALA n 
1 263 HIS n 
1 264 GLY n 
1 265 GLY n 
1 266 ARG n 
1 267 CYS n 
1 268 VAL n 
1 269 THR n 
1 270 VAL n 
1 271 PHE n 
1 272 SER n 
1 273 ALA n 
1 274 PRO n 
1 275 ASN n 
1 276 TYR n 
1 277 CYS n 
1 278 ASP n 
1 279 GLN n 
1 280 MET n 
1 281 GLY n 
1 282 ASN n 
1 283 LYS n 
1 284 ALA n 
1 285 SER n 
1 286 TYR n 
1 287 ILE n 
1 288 HIS n 
1 289 LEU n 
1 290 GLN n 
1 291 GLY n 
1 292 SER n 
1 293 ASP n 
1 294 LEU n 
1 295 ARG n 
1 296 PRO n 
1 297 GLN n 
1 298 PHE n 
1 299 HIS n 
1 300 GLN n 
1 301 PHE n 
1 302 THR n 
1 303 ALA n 
1 304 VAL n 
1 305 PRO n 
1 306 HIS n 
1 307 PRO n 
1 308 ASN n 
1 309 VAL n 
1 310 LYS n 
1 311 PRO n 
1 312 MET n 
1 313 ALA n 
1 314 TYR n 
1 315 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pDEST30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPP5_HUMAN 
_struct_ref.pdbx_db_accession          P53041 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF
EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL
EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
;
_struct_ref.pdbx_align_begin           176 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H60 A 1 ? 315 ? P53041 176 ? 490 ? 176 490 
2 1 3H60 B 1 ? 315 ? P53041 176 ? 490 ? 176 490 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3H60 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_percent_sol   47.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'10mM Tris-HCl, MPD 40%, PEG MME 5000 20%, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-10-25 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.89225 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.89225 
# 
_reflns.entry_id                     3H60 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             65.80 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   44744 
_reflns.number_all                   44744 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_Rsym_value              0.099 
_reflns.pdbx_netI_over_sigmaI        14.8 
_reflns.B_iso_Wilson_estimate        21.3 
_reflns.pdbx_redundancy              6.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.285 
_reflns_shell.pdbx_Rsym_value        0.285 
_reflns_shell.meanI_over_sigI_obs    5.7 
_reflns_shell.pdbx_redundancy        5.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5698 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3H60 
_refine.ls_number_reflns_obs                     40681 
_refine.ls_number_reflns_all                     40681 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             65.80 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.16653 
_refine.ls_R_factor_all                          0.16653 
_refine.ls_R_factor_R_work                       0.16129 
_refine.ls_R_factor_R_free                       0.21859 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.1 
_refine.ls_number_reflns_R_free                  4062 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.960 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               24.090 
_refine.aniso_B[1][1]                            0.12 
_refine.aniso_B[2][2]                            -0.61 
_refine.aniso_B[3][3]                            1.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.12 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1S95 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.180 
_refine.pdbx_overall_ESU_R_Free                  0.166 
_refine.overall_SU_ML                            0.103 
_refine.overall_SU_B                             3.610 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5056 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             432 
_refine_hist.number_atoms_total               5492 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        65.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.023  0.022  ? 5184 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.830  1.955  ? 7012 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.634  5.000  ? 628  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.922 24.688 ? 256  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.902 15.000 ? 894  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.606 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.129  0.200  ? 744  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.021  ? 3986 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.189  1.500  ? 3132 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.044  2.000  ? 5064 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.474  3.000  ? 2052 'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.660  4.500  ? 1948 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             2329 
_refine_ls_shell.R_factor_R_work                  0.229 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.303 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             236 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H60 
_struct.title                     'Catalytic domain of human Serine/Threonine Phosphatase 5 (PP5c)with two Mn2+ atoms' 
_struct.pdbx_descriptor           'Serine/threonine-protein phosphatase 5 (E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H60 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'metalloenzymes, phosphatase, Cytoplasm, Hydrolase, Iron, Manganese, Metal-binding, Nucleus, Protein phosphatase, TPR repeat' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 12  ? ASP A 25  ? THR A 187 ASP A 200 1 ? 14 
HELX_P HELX_P2  2  HIS A 30  ? LYS A 47  ? HIS A 205 LYS A 222 1 ? 18 
HELX_P HELX_P3  3  GLN A 71  ? GLY A 83  ? GLN A 246 GLY A 258 1 ? 13 
HELX_P HELX_P4  4  PHE A 103 ? TYR A 118 ? PHE A 278 TYR A 293 1 ? 16 
HELX_P HELX_P5  5  THR A 131 ? GLY A 139 ? THR A 306 GLY A 314 1 ? 9  
HELX_P HELX_P6  6  GLY A 139 ? TYR A 148 ? GLY A 314 TYR A 323 1 ? 10 
HELX_P HELX_P7  7  THR A 149 ? GLU A 161 ? THR A 324 GLU A 336 1 ? 13 
HELX_P HELX_P8  8  THR A 187 ? ILE A 194 ? THR A 362 ILE A 369 1 ? 8  
HELX_P HELX_P9  9  GLY A 204 ? SER A 212 ? GLY A 379 SER A 387 1 ? 9  
HELX_P HELX_P10 10 GLY A 232 ? ASN A 244 ? GLY A 407 ASN A 419 1 ? 13 
HELX_P HELX_P11 11 HIS A 263 ? GLY A 265 ? HIS A 438 GLY A 440 5 ? 3  
HELX_P HELX_P12 12 ASN A 275 ? GLN A 279 ? ASN A 450 GLN A 454 5 ? 5  
HELX_P HELX_P13 13 THR B 12  ? ASP B 25  ? THR B 187 ASP B 200 1 ? 14 
HELX_P HELX_P14 14 HIS B 30  ? LYS B 47  ? HIS B 205 LYS B 222 1 ? 18 
HELX_P HELX_P15 15 GLN B 71  ? GLY B 83  ? GLN B 246 GLY B 258 1 ? 13 
HELX_P HELX_P16 16 PHE B 103 ? TYR B 118 ? PHE B 278 TYR B 293 1 ? 16 
HELX_P HELX_P17 17 THR B 131 ? GLY B 139 ? THR B 306 GLY B 314 1 ? 9  
HELX_P HELX_P18 18 GLY B 139 ? TYR B 148 ? GLY B 314 TYR B 323 1 ? 10 
HELX_P HELX_P19 19 THR B 149 ? GLU B 161 ? THR B 324 GLU B 336 1 ? 13 
HELX_P HELX_P20 20 THR B 187 ? ILE B 194 ? THR B 362 ILE B 369 1 ? 8  
HELX_P HELX_P21 21 GLY B 204 ? SER B 212 ? GLY B 379 SER B 387 1 ? 9  
HELX_P HELX_P22 22 GLY B 232 ? ASN B 244 ? GLY B 407 ASN B 419 1 ? 13 
HELX_P HELX_P23 23 HIS B 263 ? GLY B 265 ? HIS B 438 GLY B 440 5 ? 3  
HELX_P HELX_P24 24 ASN B 275 ? GLN B 279 ? ASN B 450 GLN B 454 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 67  OD2 ? ? ? 1_555 D MN  . MN ? ? A ASP 242 A MN  501 1_555 ? ? ? ? ? ? ? 1.953 ? 
metalc2  metalc ? ? A ASP 96  OD2 ? ? ? 1_555 D MN  . MN ? ? A ASP 271 A MN  501 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc3  metalc ? ? A ASP 96  OD2 ? ? ? 1_555 C MN  . MN ? ? A ASP 271 A MN  500 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc4  metalc ? ? A ASN 128 OD1 ? ? ? 1_555 C MN  . MN ? ? A ASN 303 A MN  500 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc5  metalc ? ? B ASP 67  OD2 ? ? ? 1_555 F MN  . MN ? ? B ASP 242 B MN  501 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc6  metalc ? ? B ASP 96  OD2 ? ? ? 1_555 E MN  . MN ? ? B ASP 271 B MN  500 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc7  metalc ? ? B ASP 96  OD2 ? ? ? 1_555 F MN  . MN ? ? B ASP 271 B MN  501 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc8  metalc ? ? B ASN 128 OD1 ? ? ? 1_555 E MN  . MN ? ? B ASN 303 B MN  500 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc9  metalc ? ? D MN  .   MN  ? ? ? 1_555 G HOH . O  ? ? A MN  501 A HOH 21  1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc10 metalc ? ? F MN  .   MN  ? ? ? 1_555 H HOH . O  ? ? B MN  501 B HOH 89  1_555 ? ? ? ? ? ? ? 2.155 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 3 ? 
D ? 6 ? 
E ? 5 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 51  ? THR A 54  ? LEU A 226 THR A 229 
A 2 ALA A 166 ? ILE A 169 ? ALA A 341 ILE A 344 
A 3 VAL A 173 ? MET A 176 ? VAL A 348 MET A 351 
A 4 TYR A 247 ? ARG A 250 ? TYR A 422 ARG A 425 
A 5 CYS A 267 ? VAL A 270 ? CYS A 442 VAL A 445 
A 6 TYR A 259 ? ALA A 262 ? TYR A 434 ALA A 437 
B 1 PHE A 122 ? LEU A 125 ? PHE A 297 LEU A 300 
B 2 TYR A 91  ? ASN A 94  ? TYR A 266 ASN A 269 
B 3 LYS A 61  ? CYS A 65  ? LYS A 236 CYS A 240 
B 4 ALA A 284 ? GLN A 290 ? ALA A 459 GLN A 465 
B 5 ASP A 293 ? PHE A 301 ? ASP A 468 PHE A 476 
C 1 ASP A 213 ? PRO A 214 ? ASP A 388 PRO A 389 
C 2 CYS A 229 ? PHE A 231 ? CYS A 404 PHE A 406 
C 3 ARG A 220 ? ILE A 222 ? ARG A 395 ILE A 397 
D 1 LEU B 51  ? THR B 54  ? LEU B 226 THR B 229 
D 2 ALA B 166 ? ILE B 169 ? ALA B 341 ILE B 344 
D 3 VAL B 173 ? MET B 176 ? VAL B 348 MET B 351 
D 4 TYR B 247 ? ARG B 250 ? TYR B 422 ARG B 425 
D 5 CYS B 267 ? VAL B 270 ? CYS B 442 VAL B 445 
D 6 TYR B 259 ? ALA B 262 ? TYR B 434 ALA B 437 
E 1 PHE B 122 ? LEU B 125 ? PHE B 297 LEU B 300 
E 2 TYR B 91  ? ASN B 94  ? TYR B 266 ASN B 269 
E 3 LYS B 61  ? CYS B 65  ? LYS B 236 CYS B 240 
E 4 ALA B 284 ? GLN B 290 ? ALA B 459 GLN B 465 
E 5 ASP B 293 ? PHE B 301 ? ASP B 468 PHE B 476 
F 1 ASP B 213 ? PRO B 214 ? ASP B 388 PRO B 389 
F 2 CYS B 229 ? PHE B 231 ? CYS B 404 PHE B 406 
F 3 ARG B 220 ? ILE B 222 ? ARG B 395 ILE B 397 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 52  ? N VAL A 227 O CYS A 168 ? O CYS A 343 
A 2 3 N GLN A 167 ? N GLN A 342 O ILE A 175 ? O ILE A 350 
A 3 4 N LEU A 174 ? N LEU A 349 O ILE A 249 ? O ILE A 424 
A 4 5 N ARG A 250 ? N ARG A 425 O VAL A 268 ? O VAL A 443 
A 5 6 O CYS A 267 ? O CYS A 442 N ALA A 262 ? N ALA A 437 
B 1 2 O HIS A 123 ? O HIS A 298 N PHE A 93  ? N PHE A 268 
B 2 3 O ILE A 92  ? O ILE A 267 N CYS A 65  ? N CYS A 240 
B 3 4 N VAL A 64  ? N VAL A 239 O ILE A 287 ? O ILE A 462 
B 4 5 N TYR A 286 ? N TYR A 461 O HIS A 299 ? O HIS A 474 
C 1 2 N ASP A 213 ? N ASP A 388 O PHE A 231 ? O PHE A 406 
C 2 3 O GLN A 230 ? O GLN A 405 N SER A 221 ? N SER A 396 
D 1 2 N THR B 54  ? N THR B 229 O CYS B 168 ? O CYS B 343 
D 2 3 N GLN B 167 ? N GLN B 342 O ILE B 175 ? O ILE B 350 
D 3 4 N LEU B 174 ? N LEU B 349 O ILE B 249 ? O ILE B 424 
D 4 5 N ARG B 250 ? N ARG B 425 O VAL B 268 ? O VAL B 443 
D 5 6 O CYS B 267 ? O CYS B 442 N ALA B 262 ? N ALA B 437 
E 1 2 O HIS B 123 ? O HIS B 298 N PHE B 93  ? N PHE B 268 
E 2 3 O ILE B 92  ? O ILE B 267 N CYS B 65  ? N CYS B 240 
E 3 4 N VAL B 64  ? N VAL B 239 O ILE B 287 ? O ILE B 462 
E 4 5 N TYR B 286 ? N TYR B 461 O HIS B 299 ? O HIS B 474 
F 1 2 N ASP B 213 ? N ASP B 388 O PHE B 231 ? O PHE B 406 
F 2 3 O GLN B 230 ? O GLN B 405 N SER B 221 ? N SER B 396 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 500' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 501' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 500' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 96  ? ASP A 271 . ? 1_555 ? 
2  AC1 5 ASN A 128 ? ASN A 303 . ? 1_555 ? 
3  AC1 5 HIS A 177 ? HIS A 352 . ? 1_555 ? 
4  AC1 5 HIS A 252 ? HIS A 427 . ? 1_555 ? 
5  AC1 5 MN  D .   ? MN  A 501 . ? 1_555 ? 
6  AC2 5 HOH G .   ? HOH A 21  . ? 1_555 ? 
7  AC2 5 ASP A 67  ? ASP A 242 . ? 1_555 ? 
8  AC2 5 HIS A 69  ? HIS A 244 . ? 1_555 ? 
9  AC2 5 ASP A 96  ? ASP A 271 . ? 1_555 ? 
10 AC2 5 MN  C .   ? MN  A 500 . ? 1_555 ? 
11 AC3 5 ASP B 96  ? ASP B 271 . ? 1_555 ? 
12 AC3 5 ASN B 128 ? ASN B 303 . ? 1_555 ? 
13 AC3 5 HIS B 177 ? HIS B 352 . ? 1_555 ? 
14 AC3 5 HIS B 252 ? HIS B 427 . ? 1_555 ? 
15 AC3 5 MN  F .   ? MN  B 501 . ? 1_555 ? 
16 AC4 5 HOH H .   ? HOH B 89  . ? 1_555 ? 
17 AC4 5 ASP B 67  ? ASP B 242 . ? 1_555 ? 
18 AC4 5 HIS B 69  ? HIS B 244 . ? 1_555 ? 
19 AC4 5 ASP B 96  ? ASP B 271 . ? 1_555 ? 
20 AC4 5 MN  E .   ? MN  B 500 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3H60 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3H60 
_atom_sites.fract_transf_matrix[1][1]   0.006476 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000804 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023949 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009557 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 1   ? 6.999   0.972   -28.619 1.00 42.01 ? 176 TYR A N   1 
ATOM   2    C  CA  . TYR A 1 1   ? 6.001   1.400   -27.584 1.00 41.19 ? 176 TYR A CA  1 
ATOM   3    C  C   . TYR A 1 1   ? 6.483   2.586   -26.744 1.00 40.49 ? 176 TYR A C   1 
ATOM   4    O  O   . TYR A 1 1   ? 7.440   2.487   -25.972 1.00 39.95 ? 176 TYR A O   1 
ATOM   5    C  CB  . TYR A 1 1   ? 5.627   0.238   -26.664 1.00 41.69 ? 176 TYR A CB  1 
ATOM   6    C  CG  . TYR A 1 1   ? 4.613   0.617   -25.581 1.00 42.06 ? 176 TYR A CG  1 
ATOM   7    C  CD1 . TYR A 1 1   ? 3.284   0.890   -25.911 1.00 40.39 ? 176 TYR A CD1 1 
ATOM   8    C  CD2 . TYR A 1 1   ? 4.998   0.692   -24.226 1.00 42.41 ? 176 TYR A CD2 1 
ATOM   9    C  CE1 . TYR A 1 1   ? 2.356   1.238   -24.924 1.00 42.74 ? 176 TYR A CE1 1 
ATOM   10   C  CE2 . TYR A 1 1   ? 4.072   1.033   -23.215 1.00 42.86 ? 176 TYR A CE2 1 
ATOM   11   C  CZ  . TYR A 1 1   ? 2.746   1.302   -23.575 1.00 42.18 ? 176 TYR A CZ  1 
ATOM   12   O  OH  . TYR A 1 1   ? 1.810   1.621   -22.601 1.00 37.71 ? 176 TYR A OH  1 
ATOM   13   N  N   . SER A 1 2   ? 5.786   3.704   -26.879 1.00 39.29 ? 177 SER A N   1 
ATOM   14   C  CA  . SER A 1 2   ? 6.202   4.912   -26.217 1.00 38.32 ? 177 SER A CA  1 
ATOM   15   C  C   . SER A 1 2   ? 5.218   5.286   -25.080 1.00 36.81 ? 177 SER A C   1 
ATOM   16   O  O   . SER A 1 2   ? 5.288   6.378   -24.506 1.00 36.97 ? 177 SER A O   1 
ATOM   17   C  CB  . SER A 1 2   ? 6.326   6.015   -27.266 1.00 39.37 ? 177 SER A CB  1 
ATOM   18   O  OG  . SER A 1 2   ? 5.075   6.225   -27.935 1.00 42.07 ? 177 SER A OG  1 
ATOM   19   N  N   . GLY A 1 3   ? 4.331   4.362   -24.714 1.00 34.63 ? 178 GLY A N   1 
ATOM   20   C  CA  . GLY A 1 3   ? 3.286   4.691   -23.735 1.00 32.05 ? 178 GLY A CA  1 
ATOM   21   C  C   . GLY A 1 3   ? 3.626   4.494   -22.257 1.00 30.53 ? 178 GLY A C   1 
ATOM   22   O  O   . GLY A 1 3   ? 4.763   4.214   -21.896 1.00 30.21 ? 178 GLY A O   1 
ATOM   23   N  N   . PRO A 1 4   ? 2.607   4.622   -21.384 1.00 28.89 ? 179 PRO A N   1 
ATOM   24   C  CA  . PRO A 1 4   ? 2.743   4.493   -19.909 1.00 27.80 ? 179 PRO A CA  1 
ATOM   25   C  C   . PRO A 1 4   ? 3.451   3.180   -19.477 1.00 26.29 ? 179 PRO A C   1 
ATOM   26   O  O   . PRO A 1 4   ? 3.151   2.115   -19.991 1.00 24.98 ? 179 PRO A O   1 
ATOM   27   C  CB  . PRO A 1 4   ? 1.282   4.509   -19.402 1.00 27.16 ? 179 PRO A CB  1 
ATOM   28   C  CG  . PRO A 1 4   ? 0.445   5.054   -20.561 1.00 26.40 ? 179 PRO A CG  1 
ATOM   29   C  CD  . PRO A 1 4   ? 1.204   4.751   -21.827 1.00 27.53 ? 179 PRO A CD  1 
ATOM   30   N  N   . LYS A 1 5   ? 4.382   3.269   -18.542 1.00 26.12 ? 180 LYS A N   1 
ATOM   31   C  CA  . LYS A 1 5   ? 5.038   2.045   -18.031 1.00 27.49 ? 180 LYS A CA  1 
ATOM   32   C  C   . LYS A 1 5   ? 5.050   2.119   -16.519 1.00 25.88 ? 180 LYS A C   1 
ATOM   33   O  O   . LYS A 1 5   ? 5.245   3.204   -15.940 1.00 24.74 ? 180 LYS A O   1 
ATOM   34   C  CB  . LYS A 1 5   ? 6.520   1.902   -18.546 1.00 28.98 ? 180 LYS A CB  1 
ATOM   35   C  CG  . LYS A 1 5   ? 6.756   2.187   -20.050 1.00 34.74 ? 180 LYS A CG  1 
ATOM   36   C  CD  . LYS A 1 5   ? 7.231   0.945   -20.873 1.00 43.02 ? 180 LYS A CD  1 
ATOM   37   C  CE  . LYS A 1 5   ? 6.037   0.175   -21.578 1.00 50.31 ? 180 LYS A CE  1 
ATOM   38   N  NZ  . LYS A 1 5   ? 6.423   -1.191  -22.165 1.00 52.69 ? 180 LYS A NZ  1 
ATOM   39   N  N   . LEU A 1 6   ? 4.931   0.969   -15.865 1.00 24.85 ? 181 LEU A N   1 
ATOM   40   C  CA  . LEU A 1 6   ? 5.019   0.939   -14.400 1.00 25.85 ? 181 LEU A CA  1 
ATOM   41   C  C   . LEU A 1 6   ? 6.447   1.372   -13.910 1.00 26.65 ? 181 LEU A C   1 
ATOM   42   O  O   . LEU A 1 6   ? 7.414   1.168   -14.623 1.00 28.12 ? 181 LEU A O   1 
ATOM   43   C  CB  . LEU A 1 6   ? 4.633   -0.464  -13.912 1.00 25.22 ? 181 LEU A CB  1 
ATOM   44   C  CG  . LEU A 1 6   ? 3.192   -0.858  -14.315 1.00 26.74 ? 181 LEU A CG  1 
ATOM   45   C  CD1 . LEU A 1 6   ? 2.888   -2.285  -13.904 1.00 27.52 ? 181 LEU A CD1 1 
ATOM   46   C  CD2 . LEU A 1 6   ? 2.211   0.099   -13.673 1.00 21.38 ? 181 LEU A CD2 1 
ATOM   47   N  N   . GLU A 1 7   ? 6.566   2.001   -12.739 1.00 27.86 ? 182 GLU A N   1 
ATOM   48   C  CA  . GLU A 1 7   ? 7.876   2.317   -12.135 1.00 28.57 ? 182 GLU A CA  1 
ATOM   49   C  C   . GLU A 1 7   ? 8.275   1.252   -11.105 1.00 28.28 ? 182 GLU A C   1 
ATOM   50   O  O   . GLU A 1 7   ? 7.604   1.061   -10.060 1.00 27.85 ? 182 GLU A O   1 
ATOM   51   C  CB  . GLU A 1 7   ? 7.869   3.700   -11.471 1.00 28.79 ? 182 GLU A CB  1 
ATOM   52   C  CG  . GLU A 1 7   ? 7.416   4.792   -12.420 1.00 34.20 ? 182 GLU A CG  1 
ATOM   53   C  CD  . GLU A 1 7   ? 7.181   6.124   -11.726 1.00 37.13 ? 182 GLU A CD  1 
ATOM   54   O  OE1 . GLU A 1 7   ? 7.951   6.473   -10.782 1.00 43.39 ? 182 GLU A OE1 1 
ATOM   55   O  OE2 . GLU A 1 7   ? 6.240   6.830   -12.129 1.00 37.32 ? 182 GLU A OE2 1 
ATOM   56   N  N   . ASP A 1 8   ? 9.383   0.570   -11.398 1.00 26.98 ? 183 ASP A N   1 
ATOM   57   C  CA  . ASP A 1 8   ? 9.830   -0.534  -10.574 1.00 25.94 ? 183 ASP A CA  1 
ATOM   58   C  C   . ASP A 1 8   ? 8.656   -1.539  -10.426 1.00 25.30 ? 183 ASP A C   1 
ATOM   59   O  O   . ASP A 1 8   ? 8.436   -2.078  -9.351  1.00 24.74 ? 183 ASP A O   1 
ATOM   60   C  CB  . ASP A 1 8   ? 10.314  -0.041  -9.194  1.00 26.08 ? 183 ASP A CB  1 
ATOM   61   C  CG  . ASP A 1 8   ? 11.512  0.956   -9.281  1.00 26.58 ? 183 ASP A CG  1 
ATOM   62   O  OD1 . ASP A 1 8   ? 12.378  0.802   -10.189 1.00 25.35 ? 183 ASP A OD1 1 
ATOM   63   O  OD2 . ASP A 1 8   ? 11.576  1.889   -8.429  1.00 25.74 ? 183 ASP A OD2 1 
ATOM   64   N  N   . GLY A 1 9   ? 7.929   -1.753  -11.517 1.00 24.66 ? 184 GLY A N   1 
ATOM   65   C  CA  . GLY A 1 9   ? 6.841   -2.732  -11.592 1.00 25.86 ? 184 GLY A CA  1 
ATOM   66   C  C   . GLY A 1 9   ? 5.609   -2.357  -10.769 1.00 25.51 ? 184 GLY A C   1 
ATOM   67   O  O   . GLY A 1 9   ? 4.799   -3.201  -10.446 1.00 24.79 ? 184 GLY A O   1 
ATOM   68   N  N   . LYS A 1 10  ? 5.431   -1.083  -10.462 1.00 25.17 ? 185 LYS A N   1 
ATOM   69   C  CA  . LYS A 1 10  ? 4.363   -0.685  -9.550  1.00 25.27 ? 185 LYS A CA  1 
ATOM   70   C  C   . LYS A 1 10  ? 3.685   0.635   -9.993  1.00 24.43 ? 185 LYS A C   1 
ATOM   71   O  O   . LYS A 1 10  ? 4.324   1.479   -10.648 1.00 23.96 ? 185 LYS A O   1 
ATOM   72   C  CB  . LYS A 1 10  ? 4.944   -0.657  -8.134  1.00 28.05 ? 185 LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 10  ? 4.366   0.342   -7.184  1.00 33.56 ? 185 LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 10  ? 5.323   1.559   -7.041  1.00 41.37 ? 185 LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 10  ? 4.817   2.704   -6.082  1.00 39.88 ? 185 LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 10  ? 5.948   3.643   -5.727  1.00 43.45 ? 185 LYS A NZ  1 
ATOM   77   N  N   . VAL A 1 11  ? 2.376   0.762   -9.750  1.00 21.65 ? 186 VAL A N   1 
ATOM   78   C  CA  . VAL A 1 11  ? 1.622   1.959   -10.147 1.00 20.68 ? 186 VAL A CA  1 
ATOM   79   C  C   . VAL A 1 11  ? 2.091   3.136   -9.304  1.00 20.21 ? 186 VAL A C   1 
ATOM   80   O  O   . VAL A 1 11  ? 2.433   2.973   -8.147  1.00 22.20 ? 186 VAL A O   1 
ATOM   81   C  CB  . VAL A 1 11  ? 0.077   1.739   -9.963  1.00 20.43 ? 186 VAL A CB  1 
ATOM   82   C  CG1 . VAL A 1 11  ? -0.672  3.101   -10.177 1.00 17.87 ? 186 VAL A CG1 1 
ATOM   83   C  CG2 . VAL A 1 11  ? -0.417  0.622   -10.879 1.00 18.19 ? 186 VAL A CG2 1 
ATOM   84   N  N   . THR A 1 12  ? 2.144   4.320   -9.876  1.00 19.04 ? 187 THR A N   1 
ATOM   85   C  CA  . THR A 1 12  ? 2.516   5.492   -9.130  1.00 17.37 ? 187 THR A CA  1 
ATOM   86   C  C   . THR A 1 12  ? 1.582   6.568   -9.604  1.00 16.95 ? 187 THR A C   1 
ATOM   87   O  O   . THR A 1 12  ? 0.886   6.395   -10.576 1.00 15.72 ? 187 THR A O   1 
ATOM   88   C  CB  . THR A 1 12  ? 3.980   5.986   -9.501  1.00 18.52 ? 187 THR A CB  1 
ATOM   89   O  OG1 . THR A 1 12  ? 4.004   6.304   -10.919 1.00 16.72 ? 187 THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 12  ? 5.083   4.919   -9.069  1.00 17.26 ? 187 THR A CG2 1 
ATOM   91   N  N   . ILE A 1 13  ? 1.613   7.723   -8.968  1.00 17.42 ? 188 ILE A N   1 
ATOM   92   C  CA  . ILE A 1 13  ? 0.692   8.769   -9.425  1.00 18.50 ? 188 ILE A CA  1 
ATOM   93   C  C   . ILE A 1 13  ? 1.037   9.316   -10.834 1.00 18.65 ? 188 ILE A C   1 
ATOM   94   O  O   . ILE A 1 13  ? 0.147   9.683   -11.631 1.00 16.90 ? 188 ILE A O   1 
ATOM   95   C  CB  . ILE A 1 13  ? 0.582   9.885   -8.400  1.00 18.77 ? 188 ILE A CB  1 
ATOM   96   C  CG1 . ILE A 1 13  ? -0.600  10.773  -8.759  1.00 20.98 ? 188 ILE A CG1 1 
ATOM   97   C  CG2 . ILE A 1 13  ? 1.933   10.726  -8.305  1.00 21.42 ? 188 ILE A CG2 1 
ATOM   98   C  CD1 . ILE A 1 13  ? -0.120  11.990  -9.406  1.00 30.36 ? 188 ILE A CD1 1 
ATOM   99   N  N   . SER A 1 14  ? 2.329   9.398   -11.173 1.00 17.91 ? 189 SER A N   1 
ATOM   100  C  CA  . SER A 1 14  ? 2.615   9.871   -12.517 1.00 19.32 ? 189 SER A CA  1 
ATOM   101  C  C   . SER A 1 14  ? 2.246   8.877   -13.610 1.00 17.51 ? 189 SER A C   1 
ATOM   102  O  O   . SER A 1 14  ? 1.862   9.299   -14.685 1.00 17.67 ? 189 SER A O   1 
ATOM   103  C  CB  . SER A 1 14  ? 4.059   10.385  -12.651 1.00 20.10 ? 189 SER A CB  1 
ATOM   104  O  OG  . SER A 1 14  ? 4.926   9.339   -12.422 1.00 26.71 ? 189 SER A OG  1 
ATOM   105  N  N   . PHE A 1 15  ? 2.299   7.560   -13.329 1.00 16.75 ? 190 PHE A N   1 
ATOM   106  C  CA  . PHE A 1 15  ? 1.835   6.570   -14.278 1.00 17.05 ? 190 PHE A CA  1 
ATOM   107  C  C   . PHE A 1 15  ? 0.314   6.762   -14.504 1.00 15.78 ? 190 PHE A C   1 
ATOM   108  O  O   . PHE A 1 15  ? -0.177  6.707   -15.652 1.00 15.66 ? 190 PHE A O   1 
ATOM   109  C  CB  . PHE A 1 15  ? 2.061   5.163   -13.712 1.00 16.67 ? 190 PHE A CB  1 
ATOM   110  C  CG  . PHE A 1 15  ? 1.375   4.079   -14.499 1.00 18.10 ? 190 PHE A CG  1 
ATOM   111  C  CD1 . PHE A 1 15  ? 1.985   3.507   -15.624 1.00 18.36 ? 190 PHE A CD1 1 
ATOM   112  C  CD2 . PHE A 1 15  ? 0.130   3.600   -14.101 1.00 20.31 ? 190 PHE A CD2 1 
ATOM   113  C  CE1 . PHE A 1 15  ? 1.330   2.460   -16.313 1.00 19.47 ? 190 PHE A CE1 1 
ATOM   114  C  CE2 . PHE A 1 15  ? -0.539  2.591   -14.812 1.00 15.29 ? 190 PHE A CE2 1 
ATOM   115  C  CZ  . PHE A 1 15  ? 0.073   2.010   -15.923 1.00 15.38 ? 190 PHE A CZ  1 
ATOM   116  N  N   . MET A 1 16  ? -0.426  6.977   -13.405 1.00 15.33 ? 191 MET A N   1 
ATOM   117  C  CA  . MET A 1 16  ? -1.887  7.123   -13.532 1.00 15.76 ? 191 MET A CA  1 
ATOM   118  C  C   . MET A 1 16  ? -2.235  8.352   -14.413 1.00 16.66 ? 191 MET A C   1 
ATOM   119  O  O   . MET A 1 16  ? -3.137  8.324   -15.243 1.00 15.82 ? 191 MET A O   1 
ATOM   120  C  CB  . MET A 1 16  ? -2.571  7.258   -12.147 1.00 14.73 ? 191 MET A CB  1 
ATOM   121  C  CG  . MET A 1 16  ? -2.697  5.912   -11.355 1.00 17.54 ? 191 MET A CG  1 
ATOM   122  S  SD  . MET A 1 16  ? -3.147  4.494   -12.383 1.00 19.54 ? 191 MET A SD  1 
ATOM   123  C  CE  . MET A 1 16  ? -4.760  5.043   -12.921 1.00 20.18 ? 191 MET A CE  1 
ATOM   124  N  N   . LYS A 1 17  ? -1.520  9.445   -14.184 1.00 17.61 ? 192 LYS A N   1 
ATOM   125  C  CA  . LYS A 1 17  ? -1.756  10.641  -14.956 1.00 19.27 ? 192 LYS A CA  1 
ATOM   126  C  C   . LYS A 1 17  ? -1.406  10.389  -16.400 1.00 18.08 ? 192 LYS A C   1 
ATOM   127  O  O   . LYS A 1 17  ? -2.127  10.843  -17.291 1.00 16.25 ? 192 LYS A O   1 
ATOM   128  C  CB  . LYS A 1 17  ? -0.957  11.842  -14.380 1.00 19.85 ? 192 LYS A CB  1 
ATOM   129  C  CG  . LYS A 1 17  ? -1.598  12.378  -13.085 1.00 22.80 ? 192 LYS A CG  1 
ATOM   130  C  CD  . LYS A 1 17  ? -0.717  13.452  -12.463 1.00 26.33 ? 192 LYS A CD  1 
ATOM   131  C  CE  . LYS A 1 17  ? -1.552  14.479  -11.673 1.00 32.73 ? 192 LYS A CE  1 
ATOM   132  N  NZ  . LYS A 1 17  ? -0.781  14.920  -10.477 1.00 33.72 ? 192 LYS A NZ  1 
ATOM   133  N  N   . GLU A 1 18  ? -0.298  9.677   -16.668 1.00 18.88 ? 193 GLU A N   1 
ATOM   134  C  CA  . GLU A 1 18  ? 0.033   9.385   -18.063 1.00 18.42 ? 193 GLU A CA  1 
ATOM   135  C  C   . GLU A 1 18  ? -0.997  8.443   -18.684 1.00 17.43 ? 193 GLU A C   1 
ATOM   136  O  O   . GLU A 1 18  ? -1.397  8.623   -19.836 1.00 16.94 ? 193 GLU A O   1 
ATOM   137  C  CB  . GLU A 1 18  ? 1.432   8.737   -18.187 1.00 19.79 ? 193 GLU A CB  1 
ATOM   138  C  CG  . GLU A 1 18  ? 2.552   9.678   -17.827 1.00 25.47 ? 193 GLU A CG  1 
ATOM   139  C  CD  . GLU A 1 18  ? 3.936   9.044   -17.992 1.00 36.89 ? 193 GLU A CD  1 
ATOM   140  O  OE1 . GLU A 1 18  ? 4.053   8.050   -18.753 1.00 40.66 ? 193 GLU A OE1 1 
ATOM   141  O  OE2 . GLU A 1 18  ? 4.908   9.562   -17.374 1.00 41.96 ? 193 GLU A OE2 1 
ATOM   142  N  N   . LEU A 1 19  ? -1.393  7.414   -17.943 1.00 16.01 ? 194 LEU A N   1 
ATOM   143  C  CA  . LEU A 1 19  ? -2.426  6.497   -18.431 1.00 15.29 ? 194 LEU A CA  1 
ATOM   144  C  C   . LEU A 1 19  ? -3.734  7.223   -18.824 1.00 15.16 ? 194 LEU A C   1 
ATOM   145  O  O   . LEU A 1 19  ? -4.289  6.987   -19.882 1.00 13.78 ? 194 LEU A O   1 
ATOM   146  C  CB  . LEU A 1 19  ? -2.739  5.441   -17.360 1.00 14.71 ? 194 LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 19  ? -3.759  4.407   -17.838 1.00 14.96 ? 194 LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 19  ? -3.214  3.520   -18.966 1.00 11.89 ? 194 LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 19  ? -4.189  3.542   -16.618 1.00 14.97 ? 194 LEU A CD2 1 
ATOM   150  N  N   . MET A 1 20  ? -4.227  8.098   -17.949 1.00 16.51 ? 195 MET A N   1 
ATOM   151  C  CA  . MET A 1 20  ? -5.454  8.804   -18.249 1.00 17.04 ? 195 MET A CA  1 
ATOM   152  C  C   . MET A 1 20  ? -5.356  9.661   -19.530 1.00 16.84 ? 195 MET A C   1 
ATOM   153  O  O   . MET A 1 20  ? -6.273  9.644   -20.340 1.00 16.37 ? 195 MET A O   1 
ATOM   154  C  CB  . MET A 1 20  ? -5.926  9.618   -17.027 1.00 17.29 ? 195 MET A CB  1 
ATOM   155  C  CG  . MET A 1 20  ? -6.455  8.725   -15.843 1.00 17.77 ? 195 MET A CG  1 
ATOM   156  S  SD  . MET A 1 20  ? -7.109  9.795   -14.510 1.00 20.19 ? 195 MET A SD  1 
ATOM   157  C  CE  . MET A 1 20  ? -5.590  10.605  -13.974 1.00 18.72 ? 195 MET A CE  1 
ATOM   158  N  N   . GLN A 1 21  ? -4.260  10.408  -19.700 1.00 17.83 ? 196 GLN A N   1 
ATOM   159  C  CA  . GLN A 1 21  ? -3.987  11.112  -20.969 1.00 18.11 ? 196 GLN A CA  1 
ATOM   160  C  C   . GLN A 1 21  ? -3.857  10.162  -22.187 1.00 17.63 ? 196 GLN A C   1 
ATOM   161  O  O   . GLN A 1 21  ? -4.405  10.429  -23.240 1.00 16.37 ? 196 GLN A O   1 
ATOM   162  C  CB  . GLN A 1 21  ? -2.723  11.997  -20.833 1.00 19.34 ? 196 GLN A CB  1 
ATOM   163  C  CG  . GLN A 1 21  ? -2.466  12.832  -22.072 1.00 22.61 ? 196 GLN A CG  1 
ATOM   164  C  CD  . GLN A 1 21  ? -3.576  13.828  -22.285 1.00 27.08 ? 196 GLN A CD  1 
ATOM   165  O  OE1 . GLN A 1 21  ? -3.978  14.495  -21.343 1.00 30.12 ? 196 GLN A OE1 1 
ATOM   166  N  NE2 . GLN A 1 21  ? -4.137  13.874  -23.503 1.00 30.24 ? 196 GLN A NE2 1 
ATOM   167  N  N   . TRP A 1 22  ? -3.099  9.072   -22.086 1.00 17.52 ? 197 TRP A N   1 
ATOM   168  C  CA  . TRP A 1 22  ? -3.010  8.080   -23.197 1.00 18.00 ? 197 TRP A CA  1 
ATOM   169  C  C   . TRP A 1 22  ? -4.413  7.571   -23.642 1.00 18.36 ? 197 TRP A C   1 
ATOM   170  O  O   . TRP A 1 22  ? -4.737  7.456   -24.844 1.00 17.63 ? 197 TRP A O   1 
ATOM   171  C  CB  . TRP A 1 22  ? -2.153  6.912   -22.651 1.00 17.61 ? 197 TRP A CB  1 
ATOM   172  C  CG  . TRP A 1 22  ? -1.543  5.933   -23.619 1.00 22.69 ? 197 TRP A CG  1 
ATOM   173  C  CD1 . TRP A 1 22  ? -1.878  4.607   -23.797 1.00 21.90 ? 197 TRP A CD1 1 
ATOM   174  C  CD2 . TRP A 1 22  ? -0.429  6.191   -24.505 1.00 20.93 ? 197 TRP A CD2 1 
ATOM   175  N  NE1 . TRP A 1 22  ? -1.034  4.035   -24.746 1.00 22.43 ? 197 TRP A NE1 1 
ATOM   176  C  CE2 . TRP A 1 22  ? -0.146  4.991   -25.189 1.00 22.16 ? 197 TRP A CE2 1 
ATOM   177  C  CE3 . TRP A 1 22  ? 0.347   7.330   -24.780 1.00 23.39 ? 197 TRP A CE3 1 
ATOM   178  C  CZ2 . TRP A 1 22  ? 0.881   4.899   -26.153 1.00 22.78 ? 197 TRP A CZ2 1 
ATOM   179  C  CZ3 . TRP A 1 22  ? 1.382   7.239   -25.760 1.00 23.13 ? 197 TRP A CZ3 1 
ATOM   180  C  CH2 . TRP A 1 22  ? 1.626   6.028   -26.414 1.00 21.68 ? 197 TRP A CH2 1 
ATOM   181  N  N   . TYR A 1 23  ? -5.248  7.191   -22.657 1.00 18.54 ? 198 TYR A N   1 
ATOM   182  C  CA  . TYR A 1 23  ? -6.600  6.705   -22.942 1.00 18.36 ? 198 TYR A CA  1 
ATOM   183  C  C   . TYR A 1 23  ? -7.458  7.793   -23.478 1.00 17.82 ? 198 TYR A C   1 
ATOM   184  O  O   . TYR A 1 23  ? -8.247  7.550   -24.357 1.00 19.92 ? 198 TYR A O   1 
ATOM   185  C  CB  . TYR A 1 23  ? -7.290  6.166   -21.668 1.00 17.02 ? 198 TYR A CB  1 
ATOM   186  C  CG  . TYR A 1 23  ? -6.844  4.826   -21.266 1.00 16.24 ? 198 TYR A CG  1 
ATOM   187  C  CD1 . TYR A 1 23  ? -6.182  3.996   -22.163 1.00 19.29 ? 198 TYR A CD1 1 
ATOM   188  C  CD2 . TYR A 1 23  ? -7.093  4.353   -19.987 1.00 16.49 ? 198 TYR A CD2 1 
ATOM   189  C  CE1 . TYR A 1 23  ? -5.767  2.704   -21.781 1.00 18.81 ? 198 TYR A CE1 1 
ATOM   190  C  CE2 . TYR A 1 23  ? -6.734  3.032   -19.600 1.00 20.49 ? 198 TYR A CE2 1 
ATOM   191  C  CZ  . TYR A 1 23  ? -6.065  2.222   -20.514 1.00 21.38 ? 198 TYR A CZ  1 
ATOM   192  O  OH  . TYR A 1 23  ? -5.687  0.935   -20.132 1.00 19.80 ? 198 TYR A OH  1 
ATOM   193  N  N   . LYS A 1 24  ? -7.342  8.998   -22.938 1.00 19.67 ? 199 LYS A N   1 
ATOM   194  C  CA  . LYS A 1 24  ? -8.123  10.110  -23.490 1.00 20.74 ? 199 LYS A CA  1 
ATOM   195  C  C   . LYS A 1 24  ? -7.864  10.210  -24.993 1.00 20.88 ? 199 LYS A C   1 
ATOM   196  O  O   . LYS A 1 24  ? -8.797  10.352  -25.791 1.00 19.39 ? 199 LYS A O   1 
ATOM   197  C  CB  . LYS A 1 24  ? -7.764  11.411  -22.802 1.00 21.88 ? 199 LYS A CB  1 
ATOM   198  C  CG  . LYS A 1 24  ? -8.698  12.538  -23.176 1.00 26.25 ? 199 LYS A CG  1 
ATOM   199  C  CD  . LYS A 1 24  ? -8.484  13.734  -22.236 1.00 29.98 ? 199 LYS A CD  1 
ATOM   200  C  CE  . LYS A 1 24  ? -9.506  14.830  -22.589 1.00 31.93 ? 199 LYS A CE  1 
ATOM   201  N  NZ  . LYS A 1 24  ? -9.089  16.056  -21.877 1.00 34.90 ? 199 LYS A NZ  1 
ATOM   202  N  N   . ASP A 1 25  ? -6.590  10.085  -25.375 1.00 22.81 ? 200 ASP A N   1 
ATOM   203  C  CA  . ASP A 1 25  ? -6.226  10.140  -26.813 1.00 23.60 ? 200 ASP A CA  1 
ATOM   204  C  C   . ASP A 1 25  ? -6.381  8.792   -27.533 1.00 23.32 ? 200 ASP A C   1 
ATOM   205  O  O   . ASP A 1 25  ? -5.768  8.556   -28.585 1.00 22.38 ? 200 ASP A O   1 
ATOM   206  C  CB  . ASP A 1 25  ? -4.803  10.699  -26.983 1.00 23.45 ? 200 ASP A CB  1 
ATOM   207  C  CG  . ASP A 1 25  ? -4.639  12.126  -26.370 1.00 27.46 ? 200 ASP A CG  1 
ATOM   208  O  OD1 . ASP A 1 25  ? -5.607  12.937  -26.469 1.00 32.72 ? 200 ASP A OD1 1 
ATOM   209  O  OD2 . ASP A 1 25  ? -3.554  12.430  -25.768 1.00 29.61 ? 200 ASP A OD2 1 
ATOM   210  N  N   . GLN A 1 26  ? -7.179  7.898   -26.946 1.00 22.05 ? 201 GLN A N   1 
ATOM   211  C  CA  . GLN A 1 26  ? -7.564  6.635   -27.561 1.00 22.25 ? 201 GLN A CA  1 
ATOM   212  C  C   . GLN A 1 26  ? -6.417  5.685   -27.869 1.00 20.67 ? 201 GLN A C   1 
ATOM   213  O  O   . GLN A 1 26  ? -6.505  4.934   -28.795 1.00 20.44 ? 201 GLN A O   1 
ATOM   214  C  CB  . GLN A 1 26  ? -8.352  6.862   -28.859 1.00 22.80 ? 201 GLN A CB  1 
ATOM   215  C  CG  . GLN A 1 26  ? -9.650  7.647   -28.673 1.00 26.13 ? 201 GLN A CG  1 
ATOM   216  C  CD  . GLN A 1 26  ? -10.636 7.341   -29.777 1.00 27.54 ? 201 GLN A CD  1 
ATOM   217  O  OE1 . GLN A 1 26  ? -11.339 6.278   -29.802 1.00 26.54 ? 201 GLN A OE1 1 
ATOM   218  N  NE2 . GLN A 1 26  ? -10.687 8.250   -30.708 1.00 22.61 ? 201 GLN A NE2 1 
ATOM   219  N  N   . LYS A 1 27  ? -5.393  5.668   -27.045 1.00 21.51 ? 202 LYS A N   1 
ATOM   220  C  CA  . LYS A 1 27  ? -4.281  4.732   -27.241 1.00 22.21 ? 202 LYS A CA  1 
ATOM   221  C  C   . LYS A 1 27  ? -4.429  3.561   -26.290 1.00 21.95 ? 202 LYS A C   1 
ATOM   222  O  O   . LYS A 1 27  ? -5.243  3.616   -25.324 1.00 21.47 ? 202 LYS A O   1 
ATOM   223  C  CB  . LYS A 1 27  ? -2.954  5.474   -27.067 1.00 20.57 ? 202 LYS A CB  1 
ATOM   224  C  CG  . LYS A 1 27  ? -2.706  6.461   -28.223 1.00 25.79 ? 202 LYS A CG  1 
ATOM   225  C  CD  . LYS A 1 27  ? -1.528  7.408   -27.864 1.00 26.56 ? 202 LYS A CD  1 
ATOM   226  C  CE  . LYS A 1 27  ? -1.435  8.531   -28.889 1.00 31.95 ? 202 LYS A CE  1 
ATOM   227  N  NZ  . LYS A 1 27  ? -0.710  9.673   -28.224 1.00 34.39 ? 202 LYS A NZ  1 
ATOM   228  N  N   . LYS A 1 28  ? -3.663  2.510   -26.541 1.00 20.63 ? 203 LYS A N   1 
ATOM   229  C  CA  . LYS A 1 28  ? -3.806  1.265   -25.761 1.00 21.40 ? 203 LYS A CA  1 
ATOM   230  C  C   . LYS A 1 28  ? -2.642  1.021   -24.820 1.00 21.40 ? 203 LYS A C   1 
ATOM   231  O  O   . LYS A 1 28  ? -1.488  1.260   -25.189 1.00 21.48 ? 203 LYS A O   1 
ATOM   232  C  CB  . LYS A 1 28  ? -4.009  0.064   -26.714 1.00 21.51 ? 203 LYS A CB  1 
ATOM   233  C  CG  . LYS A 1 28  ? -4.187  -1.277  -26.010 1.00 23.42 ? 203 LYS A CG  1 
ATOM   234  C  CD  . LYS A 1 28  ? -4.134  -2.491  -26.952 1.00 26.14 ? 203 LYS A CD  1 
ATOM   235  C  CE  . LYS A 1 28  ? -4.715  -2.188  -28.347 1.00 31.57 ? 203 LYS A CE  1 
ATOM   236  N  NZ  . LYS A 1 28  ? -4.542  -3.370  -29.248 1.00 33.56 ? 203 LYS A NZ  1 
ATOM   237  N  N   . LEU A 1 29  ? -2.923  0.603   -23.578 1.00 19.76 ? 204 LEU A N   1 
ATOM   238  C  CA  . LEU A 1 29  ? -1.846  0.277   -22.649 1.00 19.47 ? 204 LEU A CA  1 
ATOM   239  C  C   . LEU A 1 29  ? -1.233  -1.068  -23.100 1.00 19.27 ? 204 LEU A C   1 
ATOM   240  O  O   . LEU A 1 29  ? -1.949  -2.030  -23.447 1.00 16.85 ? 204 LEU A O   1 
ATOM   241  C  CB  . LEU A 1 29  ? -2.353  0.200   -21.177 1.00 18.57 ? 204 LEU A CB  1 
ATOM   242  C  CG  . LEU A 1 29  ? -1.369  -0.224  -20.086 1.00 20.95 ? 204 LEU A CG  1 
ATOM   243  C  CD1 . LEU A 1 29  ? -0.252  0.853   -19.869 1.00 16.99 ? 204 LEU A CD1 1 
ATOM   244  C  CD2 . LEU A 1 29  ? -2.131  -0.536  -18.732 1.00 18.57 ? 204 LEU A CD2 1 
ATOM   245  N  N   . HIS A 1 30  ? 0.099   -1.123  -23.120 1.00 19.37 ? 205 HIS A N   1 
ATOM   246  C  CA  . HIS A 1 30  ? 0.752   -2.376  -23.549 1.00 20.73 ? 205 HIS A CA  1 
ATOM   247  C  C   . HIS A 1 30  ? 0.201   -3.560  -22.715 1.00 19.72 ? 205 HIS A C   1 
ATOM   248  O  O   . HIS A 1 30  ? 0.008   -3.447  -21.519 1.00 20.19 ? 205 HIS A O   1 
ATOM   249  C  CB  . HIS A 1 30  ? 2.275   -2.275  -23.411 1.00 20.63 ? 205 HIS A CB  1 
ATOM   250  C  CG  . HIS A 1 30  ? 3.002   -3.430  -24.031 1.00 25.65 ? 205 HIS A CG  1 
ATOM   251  N  ND1 . HIS A 1 30  ? 3.764   -3.308  -25.181 1.00 29.52 ? 205 HIS A ND1 1 
ATOM   252  C  CD2 . HIS A 1 30  ? 3.082   -4.734  -23.665 1.00 25.47 ? 205 HIS A CD2 1 
ATOM   253  C  CE1 . HIS A 1 30  ? 4.247   -4.497  -25.516 1.00 26.46 ? 205 HIS A CE1 1 
ATOM   254  N  NE2 . HIS A 1 30  ? 3.861   -5.378  -24.600 1.00 27.38 ? 205 HIS A NE2 1 
ATOM   255  N  N   . ARG A 1 31  ? -0.036  -4.678  -23.362 1.00 19.39 ? 206 ARG A N   1 
ATOM   256  C  CA  . ARG A 1 31  ? -0.535  -5.869  -22.701 1.00 20.26 ? 206 ARG A CA  1 
ATOM   257  C  C   . ARG A 1 31  ? 0.306   -6.340  -21.504 1.00 21.40 ? 206 ARG A C   1 
ATOM   258  O  O   . ARG A 1 31  ? -0.232  -6.876  -20.536 1.00 20.77 ? 206 ARG A O   1 
ATOM   259  C  CB  . ARG A 1 31  ? -0.764  -6.964  -23.742 1.00 20.77 ? 206 ARG A CB  1 
ATOM   260  C  CG  . ARG A 1 31  ? 0.599   -7.598  -24.285 1.00 24.21 ? 206 ARG A CG  1 
ATOM   261  C  CD  . ARG A 1 31  ? 0.392   -8.540  -25.517 1.00 31.22 ? 206 ARG A CD  1 
ATOM   262  N  NE  . ARG A 1 31  ? 1.691   -8.646  -26.192 1.00 40.08 ? 206 ARG A NE  1 
ATOM   263  C  CZ  . ARG A 1 31  ? 2.695   -9.415  -25.755 1.00 43.81 ? 206 ARG A CZ  1 
ATOM   264  N  NH1 . ARG A 1 31  ? 2.548   -10.233 -24.686 1.00 42.17 ? 206 ARG A NH1 1 
ATOM   265  N  NH2 . ARG A 1 31  ? 3.847   -9.396  -26.413 1.00 47.15 ? 206 ARG A NH2 1 
ATOM   266  N  N   . LYS A 1 32  ? 1.632   -6.123  -21.518 1.00 21.04 ? 207 LYS A N   1 
ATOM   267  C  CA  . LYS A 1 32  ? 2.398   -6.537  -20.356 1.00 20.32 ? 207 LYS A CA  1 
ATOM   268  C  C   . LYS A 1 32  ? 2.102   -5.699  -19.133 1.00 19.19 ? 207 LYS A C   1 
ATOM   269  O  O   . LYS A 1 32  ? 2.137   -6.204  -18.005 1.00 18.47 ? 207 LYS A O   1 
ATOM   270  C  CB  . LYS A 1 32  ? 3.902   -6.488  -20.630 1.00 21.84 ? 207 LYS A CB  1 
ATOM   271  C  CG  . LYS A 1 32  ? 4.293   -7.614  -21.566 1.00 26.33 ? 207 LYS A CG  1 
ATOM   272  C  CD  . LYS A 1 32  ? 5.809   -7.776  -21.702 1.00 28.44 ? 207 LYS A CD  1 
ATOM   273  C  CE  . LYS A 1 32  ? 6.068   -8.881  -22.765 1.00 34.79 ? 207 LYS A CE  1 
ATOM   274  N  NZ  . LYS A 1 32  ? 7.358   -8.635  -23.509 1.00 36.81 ? 207 LYS A NZ  1 
ATOM   275  N  N   . CYS A 1 33  ? 1.909   -4.400  -19.345 1.00 18.01 ? 208 CYS A N   1 
ATOM   276  C  CA  . CYS A 1 33  ? 1.476   -3.517  -18.248 1.00 20.00 ? 208 CYS A CA  1 
ATOM   277  C  C   . CYS A 1 33  ? 0.052   -3.852  -17.758 1.00 18.29 ? 208 CYS A C   1 
ATOM   278  O  O   . CYS A 1 33  ? -0.146  -3.847  -16.550 1.00 19.94 ? 208 CYS A O   1 
ATOM   279  C  CB  . CYS A 1 33  ? 1.484   -2.028  -18.637 0.50 17.93 ? 208 CYS A CB  1 
ATOM   280  S  SG  . CYS A 1 33  ? 3.091   -1.467  -19.155 0.50 23.94 ? 208 CYS A SG  1 
ATOM   281  N  N   . ALA A 1 34  ? -0.887  -4.027  -18.690 1.00 18.37 ? 209 ALA A N   1 
ATOM   282  C  CA  . ALA A 1 34  ? -2.279  -4.418  -18.347 1.00 19.78 ? 209 ALA A CA  1 
ATOM   283  C  C   . ALA A 1 34  ? -2.266  -5.720  -17.515 1.00 19.96 ? 209 ALA A C   1 
ATOM   284  O  O   . ALA A 1 34  ? -2.888  -5.821  -16.441 1.00 18.21 ? 209 ALA A O   1 
ATOM   285  C  CB  . ALA A 1 34  ? -3.130  -4.544  -19.550 1.00 18.36 ? 209 ALA A CB  1 
ATOM   286  N  N   . TYR A 1 35  ? -1.523  -6.706  -18.016 1.00 20.41 ? 210 TYR A N   1 
ATOM   287  C  CA  . TYR A 1 35  ? -1.269  -7.914  -17.258 1.00 21.25 ? 210 TYR A CA  1 
ATOM   288  C  C   . TYR A 1 35  ? -0.719  -7.670  -15.857 1.00 20.49 ? 210 TYR A C   1 
ATOM   289  O  O   . TYR A 1 35  ? -1.265  -8.188  -14.853 1.00 19.70 ? 210 TYR A O   1 
ATOM   290  C  CB  . TYR A 1 35  ? -0.375  -8.885  -18.081 1.00 21.58 ? 210 TYR A CB  1 
ATOM   291  C  CG  . TYR A 1 35  ? -0.050  -10.102 -17.305 1.00 24.54 ? 210 TYR A CG  1 
ATOM   292  C  CD1 . TYR A 1 35  ? -0.918  -11.213 -17.310 1.00 27.03 ? 210 TYR A CD1 1 
ATOM   293  C  CD2 . TYR A 1 35  ? 1.085   -10.150 -16.516 1.00 29.14 ? 210 TYR A CD2 1 
ATOM   294  C  CE1 . TYR A 1 35  ? -0.624  -12.341 -16.570 1.00 28.83 ? 210 TYR A CE1 1 
ATOM   295  C  CE2 . TYR A 1 35  ? 1.393   -11.286 -15.768 1.00 31.44 ? 210 TYR A CE2 1 
ATOM   296  C  CZ  . TYR A 1 35  ? 0.538   -12.368 -15.801 1.00 31.74 ? 210 TYR A CZ  1 
ATOM   297  O  OH  . TYR A 1 35  ? 0.833   -13.457 -15.019 1.00 35.86 ? 210 TYR A OH  1 
ATOM   298  N  N   . GLN A 1 36  ? 0.336   -6.857  -15.733 1.00 20.14 ? 211 GLN A N   1 
ATOM   299  C  CA  . GLN A 1 36  ? 0.844   -6.510  -14.394 1.00 20.75 ? 211 GLN A CA  1 
ATOM   300  C  C   . GLN A 1 36  ? -0.205  -5.922  -13.411 1.00 19.52 ? 211 GLN A C   1 
ATOM   301  O  O   . GLN A 1 36  ? -0.232  -6.296  -12.237 1.00 17.89 ? 211 GLN A O   1 
ATOM   302  C  CB  . GLN A 1 36  ? 2.070   -5.555  -14.444 1.00 21.38 ? 211 GLN A CB  1 
ATOM   303  C  CG  . GLN A 1 36  ? 3.380   -6.194  -14.946 1.00 28.27 ? 211 GLN A CG  1 
ATOM   304  C  CD  . GLN A 1 36  ? 4.536   -5.147  -15.139 1.00 37.97 ? 211 GLN A CD  1 
ATOM   305  O  OE1 . GLN A 1 36  ? 4.516   -4.332  -16.086 1.00 44.28 ? 211 GLN A OE1 1 
ATOM   306  N  NE2 . GLN A 1 36  ? 5.537   -5.177  -14.240 1.00 40.13 ? 211 GLN A NE2 1 
ATOM   307  N  N   . ILE A 1 37  ? -1.033  -5.001  -13.898 1.00 17.25 ? 212 ILE A N   1 
ATOM   308  C  CA  . ILE A 1 37  ? -2.084  -4.429  -13.040 1.00 17.16 ? 212 ILE A CA  1 
ATOM   309  C  C   . ILE A 1 37  ? -3.115  -5.486  -12.617 1.00 16.17 ? 212 ILE A C   1 
ATOM   310  O  O   . ILE A 1 37  ? -3.500  -5.545  -11.450 1.00 18.40 ? 212 ILE A O   1 
ATOM   311  C  CB  . ILE A 1 37  ? -2.753  -3.283  -13.772 1.00 16.13 ? 212 ILE A CB  1 
ATOM   312  C  CG1 . ILE A 1 37  ? -1.775  -2.074  -13.814 1.00 15.46 ? 212 ILE A CG1 1 
ATOM   313  C  CG2 . ILE A 1 37  ? -4.123  -2.821  -13.081 1.00 16.66 ? 212 ILE A CG2 1 
ATOM   314  C  CD1 . ILE A 1 37  ? -2.283  -1.081  -14.976 1.00 16.49 ? 212 ILE A CD1 1 
ATOM   315  N  N   . LEU A 1 38  ? -3.537  -6.313  -13.560 1.00 15.26 ? 213 LEU A N   1 
ATOM   316  C  CA  . LEU A 1 38  ? -4.528  -7.337  -13.286 1.00 17.43 ? 213 LEU A CA  1 
ATOM   317  C  C   . LEU A 1 38  ? -4.044  -8.349  -12.257 1.00 18.31 ? 213 LEU A C   1 
ATOM   318  O  O   . LEU A 1 38  ? -4.741  -8.579  -11.241 1.00 18.63 ? 213 LEU A O   1 
ATOM   319  C  CB  . LEU A 1 38  ? -5.059  -7.984  -14.563 1.00 17.07 ? 213 LEU A CB  1 
ATOM   320  C  CG  . LEU A 1 38  ? -5.963  -7.152  -15.491 1.00 21.52 ? 213 LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1 38  ? -6.251  -7.872  -16.764 1.00 20.45 ? 213 LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1 38  ? -7.259  -6.826  -14.814 1.00 23.87 ? 213 LEU A CD2 1 
ATOM   323  N  N   . VAL A 1 39  ? -2.849  -8.928  -12.443 1.00 18.03 ? 214 VAL A N   1 
ATOM   324  C  CA  . VAL A 1 39  ? -2.317  -9.834  -11.401 1.00 19.38 ? 214 VAL A CA  1 
ATOM   325  C  C   . VAL A 1 39  ? -2.069  -9.165  -9.998  1.00 16.75 ? 214 VAL A C   1 
ATOM   326  O  O   . VAL A 1 39  ? -2.365  -9.758  -8.947  1.00 15.44 ? 214 VAL A O   1 
ATOM   327  C  CB  . VAL A 1 39  ? -1.024  -10.669 -11.882 1.00 19.40 ? 214 VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 39  ? -1.269  -11.354 -13.244 1.00 20.80 ? 214 VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 39  ? 0.153   -9.796  -11.964 1.00 25.31 ? 214 VAL A CG2 1 
ATOM   330  N  N   . GLN A 1 40  ? -1.581  -7.919  -9.979  1.00 14.51 ? 215 GLN A N   1 
ATOM   331  C  CA  . GLN A 1 40  ? -1.407  -7.230  -8.718  1.00 15.31 ? 215 GLN A CA  1 
ATOM   332  C  C   . GLN A 1 40  ? -2.755  -6.906  -8.011  1.00 14.13 ? 215 GLN A C   1 
ATOM   333  O  O   . GLN A 1 40  ? -2.864  -6.988  -6.805  1.00 14.21 ? 215 GLN A O   1 
ATOM   334  C  CB  . GLN A 1 40  ? -0.605  -5.918  -8.905  1.00 16.10 ? 215 GLN A CB  1 
ATOM   335  C  CG  . GLN A 1 40  ? 0.887   -6.206  -9.127  1.00 20.82 ? 215 GLN A CG  1 
ATOM   336  C  CD  . GLN A 1 40  ? 1.680   -4.900  -9.310  1.00 23.52 ? 215 GLN A CD  1 
ATOM   337  O  OE1 . GLN A 1 40  ? 1.583   -4.033  -8.493  1.00 21.24 ? 215 GLN A OE1 1 
ATOM   338  N  NE2 . GLN A 1 40  ? 2.399   -4.768  -10.426 1.00 23.47 ? 215 GLN A NE2 1 
ATOM   339  N  N   . VAL A 1 41  ? -3.771  -6.577  -8.768  1.00 16.35 ? 216 VAL A N   1 
ATOM   340  C  CA  . VAL A 1 41  ? -5.027  -6.123  -8.150  1.00 16.18 ? 216 VAL A CA  1 
ATOM   341  C  C   . VAL A 1 41  ? -5.776  -7.374  -7.653  1.00 16.33 ? 216 VAL A C   1 
ATOM   342  O  O   . VAL A 1 41  ? -6.455  -7.360  -6.626  1.00 13.74 ? 216 VAL A O   1 
ATOM   343  C  CB  . VAL A 1 41  ? -5.814  -5.195  -9.072  1.00 16.43 ? 216 VAL A CB  1 
ATOM   344  C  CG1 . VAL A 1 41  ? -6.643  -5.962  -10.045 1.00 18.08 ? 216 VAL A CG1 1 
ATOM   345  C  CG2 . VAL A 1 41  ? -6.793  -4.249  -8.211  1.00 16.38 ? 216 VAL A CG2 1 
ATOM   346  N  N   . LYS A 1 42  ? -5.573  -8.477  -8.360  1.00 17.89 ? 217 LYS A N   1 
ATOM   347  C  CA  . LYS A 1 42  ? -6.190  -9.748  -7.954  1.00 19.32 ? 217 LYS A CA  1 
ATOM   348  C  C   . LYS A 1 42  ? -5.647  -10.061 -6.571  1.00 19.60 ? 217 LYS A C   1 
ATOM   349  O  O   . LYS A 1 42  ? -6.408  -10.412 -5.635  1.00 18.51 ? 217 LYS A O   1 
ATOM   350  C  CB  . LYS A 1 42  ? -5.918  -10.887 -8.966  1.00 18.95 ? 217 LYS A CB  1 
ATOM   351  C  CG  . LYS A 1 42  ? -6.542  -12.269 -8.487  1.00 23.52 ? 217 LYS A CG  1 
ATOM   352  C  CD  . LYS A 1 42  ? -6.208  -13.450 -9.448  1.00 30.20 ? 217 LYS A CD  1 
ATOM   353  C  CE  . LYS A 1 42  ? -7.371  -14.448 -9.481  1.00 37.92 ? 217 LYS A CE  1 
ATOM   354  N  NZ  . LYS A 1 42  ? -7.141  -15.793 -10.211 1.00 40.18 ? 217 LYS A NZ  1 
ATOM   355  N  N   . GLU A 1 43  ? -4.331  -9.874  -6.383  1.00 19.87 ? 218 GLU A N   1 
ATOM   356  C  CA  . GLU A 1 43  ? -3.743  -10.163 -5.082  1.00 20.78 ? 218 GLU A CA  1 
ATOM   357  C  C   . GLU A 1 43  ? -4.282  -9.209  -3.967  1.00 19.66 ? 218 GLU A C   1 
ATOM   358  O  O   . GLU A 1 43  ? -4.604  -9.632  -2.865  1.00 19.55 ? 218 GLU A O   1 
ATOM   359  C  CB  . GLU A 1 43  ? -2.236  -10.078 -5.178  1.00 22.10 ? 218 GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 43  ? -1.600  -10.243 -3.881  1.00 32.16 ? 218 GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 43  ? -1.038  -11.645 -3.735  1.00 43.15 ? 218 GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 43  ? 0.084   -11.776 -3.167  1.00 49.56 ? 218 GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 43  ? -1.703  -12.611 -4.225  1.00 46.92 ? 218 GLU A OE2 1 
ATOM   364  N  N   . VAL A 1 44  ? -4.376  -7.920  -4.255  1.00 18.48 ? 219 VAL A N   1 
ATOM   365  C  CA  . VAL A 1 44  ? -4.982  -6.960  -3.300  1.00 18.66 ? 219 VAL A CA  1 
ATOM   366  C  C   . VAL A 1 44  ? -6.486  -7.329  -2.986  1.00 16.61 ? 219 VAL A C   1 
ATOM   367  O  O   . VAL A 1 44  ? -6.897  -7.451  -1.824  1.00 16.65 ? 219 VAL A O   1 
ATOM   368  C  CB  . VAL A 1 44  ? -4.910  -5.489  -3.864  1.00 18.25 ? 219 VAL A CB  1 
ATOM   369  C  CG1 . VAL A 1 44  ? -5.770  -4.526  -3.008  1.00 18.47 ? 219 VAL A CG1 1 
ATOM   370  C  CG2 . VAL A 1 44  ? -3.412  -4.997  -3.976  1.00 19.81 ? 219 VAL A CG2 1 
ATOM   371  N  N   . LEU A 1 45  ? -7.272  -7.531  -4.014  1.00 15.82 ? 220 LEU A N   1 
ATOM   372  C  CA  . LEU A 1 45  ? -8.718  -7.858  -3.810  1.00 16.78 ? 220 LEU A CA  1 
ATOM   373  C  C   . LEU A 1 45  ? -8.939  -9.165  -3.057  1.00 16.56 ? 220 LEU A C   1 
ATOM   374  O  O   . LEU A 1 45  ? -9.818  -9.224  -2.210  1.00 15.62 ? 220 LEU A O   1 
ATOM   375  C  CB  . LEU A 1 45  ? -9.482  -7.940  -5.135  1.00 14.70 ? 220 LEU A CB  1 
ATOM   376  C  CG  . LEU A 1 45  ? -9.462  -6.620  -5.912  1.00 16.45 ? 220 LEU A CG  1 
ATOM   377  C  CD1 . LEU A 1 45  ? -10.047 -6.832  -7.331  1.00 16.21 ? 220 LEU A CD1 1 
ATOM   378  C  CD2 . LEU A 1 45  ? -10.238 -5.526  -5.103  1.00 14.68 ? 220 LEU A CD2 1 
ATOM   379  N  N   . SER A 1 46  ? -8.140  -10.191 -3.381  1.00 17.80 ? 221 SER A N   1 
ATOM   380  C  CA  . SER A 1 46  ? -8.324  -11.534 -2.847  1.00 19.55 ? 221 SER A CA  1 
ATOM   381  C  C   . SER A 1 46  ? -8.088  -11.509 -1.343  1.00 20.58 ? 221 SER A C   1 
ATOM   382  O  O   . SER A 1 46  ? -8.511  -12.420 -0.651  1.00 22.39 ? 221 SER A O   1 
ATOM   383  C  CB  . SER A 1 46  ? -7.337  -12.551 -3.477  1.00 17.90 ? 221 SER A CB  1 
ATOM   384  O  OG  . SER A 1 46  ? -6.064  -12.304 -2.882  1.00 19.62 ? 221 SER A OG  1 
ATOM   385  N  N   . LYS A 1 47  ? -7.417  -10.489 -0.823  1.00 20.43 ? 222 LYS A N   1 
ATOM   386  C  CA  . LYS A 1 47  ? -7.249  -10.390 0.607   1.00 21.56 ? 222 LYS A CA  1 
ATOM   387  C  C   . LYS A 1 47  ? -8.392  -9.750  1.362   1.00 21.25 ? 222 LYS A C   1 
ATOM   388  O  O   . LYS A 1 47  ? -8.353  -9.758  2.589   1.00 21.34 ? 222 LYS A O   1 
ATOM   389  C  CB  . LYS A 1 47  ? -5.998  -9.571  0.986   1.00 22.40 ? 222 LYS A CB  1 
ATOM   390  C  CG  . LYS A 1 47  ? -4.680  -10.279 0.725   1.00 29.44 ? 222 LYS A CG  1 
ATOM   391  C  CD  . LYS A 1 47  ? -4.842  -11.793 0.620   1.00 32.10 ? 222 LYS A CD  1 
ATOM   392  C  CE  . LYS A 1 47  ? -3.644  -12.470 1.319   1.00 38.11 ? 222 LYS A CE  1 
ATOM   393  N  NZ  . LYS A 1 47  ? -3.289  -13.775 0.674   1.00 43.22 ? 222 LYS A NZ  1 
ATOM   394  N  N   . LEU A 1 48  ? -9.357  -9.138  0.675   1.00 18.06 ? 223 LEU A N   1 
ATOM   395  C  CA  . LEU A 1 48  ? -10.370 -8.342  1.384   1.00 16.46 ? 223 LEU A CA  1 
ATOM   396  C  C   . LEU A 1 48  ? -11.545 -9.221  1.852   1.00 16.14 ? 223 LEU A C   1 
ATOM   397  O  O   . LEU A 1 48  ? -11.792 -10.249 1.282   1.00 13.44 ? 223 LEU A O   1 
ATOM   398  C  CB  . LEU A 1 48  ? -10.938 -7.241  0.487   1.00 15.65 ? 223 LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 48  ? -9.848  -6.287  -0.086  1.00 17.86 ? 223 LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 48  ? -10.525 -5.237  -1.021  1.00 17.68 ? 223 LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 48  ? -9.016  -5.619  1.044   1.00 21.58 ? 223 LEU A CD2 1 
ATOM   402  N  N   . SER A 1 49  ? -12.283 -8.741  2.860   1.00 16.16 ? 224 SER A N   1 
ATOM   403  C  CA  . SER A 1 49  ? -13.541 -9.391  3.268   1.00 18.34 ? 224 SER A CA  1 
ATOM   404  C  C   . SER A 1 49  ? -14.537 -9.125  2.179   1.00 17.54 ? 224 SER A C   1 
ATOM   405  O  O   . SER A 1 49  ? -14.486 -8.094  1.466   1.00 17.42 ? 224 SER A O   1 
ATOM   406  C  CB  . SER A 1 49  ? -14.041 -8.766  4.595   1.00 18.47 ? 224 SER A CB  1 
ATOM   407  O  OG  . SER A 1 49  ? -15.292 -9.321  5.008   1.00 20.76 ? 224 SER A OG  1 
ATOM   408  N  N   . THR A 1 50  ? -15.455 -10.049 2.017   1.00 16.14 ? 225 THR A N   1 
ATOM   409  C  CA  . THR A 1 50  ? -16.592 -9.770  1.207   1.00 14.83 ? 225 THR A CA  1 
ATOM   410  C  C   . THR A 1 50  ? -17.346 -8.466  1.569   1.00 14.23 ? 225 THR A C   1 
ATOM   411  O  O   . THR A 1 50  ? -17.934 -7.806  0.674   1.00 12.99 ? 225 THR A O   1 
ATOM   412  C  CB  . THR A 1 50  ? -17.523 -10.987 1.280   1.00 16.62 ? 225 THR A CB  1 
ATOM   413  O  OG1 . THR A 1 50  ? -16.828 -12.135 0.724   1.00 13.23 ? 225 THR A OG1 1 
ATOM   414  C  CG2 . THR A 1 50  ? -18.790 -10.675 0.527   1.00 12.33 ? 225 THR A CG2 1 
ATOM   415  N  N   . LEU A 1 51  ? -17.407 -8.174  2.866   1.00 13.93 ? 226 LEU A N   1 
ATOM   416  C  CA  . LEU A 1 51  ? -17.887 -6.914  3.393   1.00 15.05 ? 226 LEU A CA  1 
ATOM   417  C  C   . LEU A 1 51  ? -16.713 -6.013  3.842   1.00 14.49 ? 226 LEU A C   1 
ATOM   418  O  O   . LEU A 1 51  ? -16.118 -6.254  4.850   1.00 17.74 ? 226 LEU A O   1 
ATOM   419  C  CB  . LEU A 1 51  ? -18.839 -7.145  4.588   1.00 13.42 ? 226 LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 51  ? -19.317 -5.855  5.333   1.00 16.43 ? 226 LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 51  ? -20.261 -4.958  4.467   1.00 11.65 ? 226 LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 51  ? -19.917 -6.139  6.733   1.00 16.77 ? 226 LEU A CD2 1 
ATOM   423  N  N   . VAL A 1 52  ? -16.422 -4.965  3.106   1.00 15.13 ? 227 VAL A N   1 
ATOM   424  C  CA  . VAL A 1 52  ? -15.410 -3.976  3.484   1.00 15.75 ? 227 VAL A CA  1 
ATOM   425  C  C   . VAL A 1 52  ? -15.981 -3.047  4.572   1.00 16.36 ? 227 VAL A C   1 
ATOM   426  O  O   . VAL A 1 52  ? -17.052 -2.518  4.419   1.00 14.39 ? 227 VAL A O   1 
ATOM   427  C  CB  . VAL A 1 52  ? -15.063 -3.071  2.273   1.00 15.87 ? 227 VAL A CB  1 
ATOM   428  C  CG1 . VAL A 1 52  ? -14.058 -1.913  2.713   1.00 12.20 ? 227 VAL A CG1 1 
ATOM   429  C  CG2 . VAL A 1 52  ? -14.565 -3.940  1.092   1.00 16.37 ? 227 VAL A CG2 1 
ATOM   430  N  N   . GLU A 1 53  ? -15.285 -2.923  5.687   1.00 17.43 ? 228 GLU A N   1 
ATOM   431  C  CA  . GLU A 1 53  ? -15.739 -2.076  6.792   1.00 20.08 ? 228 GLU A CA  1 
ATOM   432  C  C   . GLU A 1 53  ? -14.773 -0.919  6.919   1.00 20.40 ? 228 GLU A C   1 
ATOM   433  O  O   . GLU A 1 53  ? -13.583 -1.098  7.109   1.00 21.86 ? 228 GLU A O   1 
ATOM   434  C  CB  . GLU A 1 53  ? -15.875 -2.908  8.076   1.00 21.06 ? 228 GLU A CB  1 
ATOM   435  C  CG  . GLU A 1 53  ? -16.954 -4.016  7.840   1.00 20.46 ? 228 GLU A CG  1 
ATOM   436  C  CD  . GLU A 1 53  ? -17.142 -4.908  9.006   1.00 26.46 ? 228 GLU A CD  1 
ATOM   437  O  OE1 . GLU A 1 53  ? -17.926 -4.501  9.910   1.00 27.13 ? 228 GLU A OE1 1 
ATOM   438  O  OE2 . GLU A 1 53  ? -16.519 -6.022  9.019   1.00 27.92 ? 228 GLU A OE2 1 
ATOM   439  N  N   . THR A 1 54  ? -15.301 0.271   6.811   1.00 20.11 ? 229 THR A N   1 
ATOM   440  C  CA  . THR A 1 54  ? -14.516 1.484   6.667   1.00 22.21 ? 229 THR A CA  1 
ATOM   441  C  C   . THR A 1 54  ? -14.969 2.493   7.743   1.00 22.78 ? 229 THR A C   1 
ATOM   442  O  O   . THR A 1 54  ? -16.183 2.698   7.947   1.00 20.85 ? 229 THR A O   1 
ATOM   443  C  CB  . THR A 1 54  ? -14.863 2.083   5.291   1.00 21.68 ? 229 THR A CB  1 
ATOM   444  O  OG1 . THR A 1 54  ? -14.250 1.283   4.262   1.00 25.51 ? 229 THR A OG1 1 
ATOM   445  C  CG2 . THR A 1 54  ? -14.431 3.499   5.174   1.00 23.61 ? 229 THR A CG2 1 
ATOM   446  N  N   . THR A 1 55  ? -14.012 3.160   8.384   1.00 22.98 ? 230 THR A N   1 
ATOM   447  C  CA  . THR A 1 55  ? -14.305 4.123   9.437   1.00 23.64 ? 230 THR A CA  1 
ATOM   448  C  C   . THR A 1 55  ? -13.966 5.481   8.894   1.00 23.82 ? 230 THR A C   1 
ATOM   449  O  O   . THR A 1 55  ? -12.880 5.671   8.340   1.00 25.27 ? 230 THR A O   1 
ATOM   450  C  CB  . THR A 1 55  ? -13.435 3.846   10.659  1.00 23.66 ? 230 THR A CB  1 
ATOM   451  O  OG1 . THR A 1 55  ? -13.846 2.587   11.159  1.00 25.85 ? 230 THR A OG1 1 
ATOM   452  C  CG2 . THR A 1 55  ? -13.660 4.944   11.741  1.00 26.71 ? 230 THR A CG2 1 
ATOM   453  N  N   . LEU A 1 56  ? -14.905 6.405   8.949   1.00 22.09 ? 231 LEU A N   1 
ATOM   454  C  CA  . LEU A 1 56  ? -14.653 7.744   8.472   1.00 23.48 ? 231 LEU A CA  1 
ATOM   455  C  C   . LEU A 1 56  ? -14.537 8.617   9.736   1.00 25.04 ? 231 LEU A C   1 
ATOM   456  O  O   . LEU A 1 56  ? -15.553 8.827   10.417  1.00 23.62 ? 231 LEU A O   1 
ATOM   457  C  CB  . LEU A 1 56  ? -15.847 8.199   7.634   0.50 22.25 ? 231 LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 56  ? -15.647 8.941   6.320   0.50 21.76 ? 231 LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 56  ? -14.685 8.149   5.446   0.50 19.72 ? 231 LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 56  ? -16.972 9.223   5.646   0.50 14.31 ? 231 LEU A CD2 1 
ATOM   461  N  N   . LYS A 1 57  ? -13.338 9.122   10.058  1.00 25.26 ? 232 LYS A N   1 
ATOM   462  C  CA  . LYS A 1 57  ? -13.200 10.060  11.179  1.00 27.42 ? 232 LYS A CA  1 
ATOM   463  C  C   . LYS A 1 57  ? -13.978 11.346  10.871  1.00 27.46 ? 232 LYS A C   1 
ATOM   464  O  O   . LYS A 1 57  ? -14.456 11.567  9.774   1.00 25.80 ? 232 LYS A O   1 
ATOM   465  C  CB  . LYS A 1 57  ? -11.738 10.468  11.430  1.00 28.03 ? 232 LYS A CB  1 
ATOM   466  C  CG  . LYS A 1 57  ? -10.764 9.414   11.865  1.00 31.35 ? 232 LYS A CG  1 
ATOM   467  C  CD  . LYS A 1 57  ? -9.449  9.752   11.171  1.00 36.86 ? 232 LYS A CD  1 
ATOM   468  C  CE  . LYS A 1 57  ? -8.266  9.336   11.985  1.00 40.84 ? 232 LYS A CE  1 
ATOM   469  N  NZ  . LYS A 1 57  ? -8.401  9.724   13.426  1.00 42.05 ? 232 LYS A NZ  1 
ATOM   470  N  N   . GLU A 1 58  ? -14.029 12.249  11.827  1.00 29.77 ? 233 GLU A N   1 
ATOM   471  C  CA  . GLU A 1 58  ? -14.958 13.365  11.685  1.00 31.68 ? 233 GLU A CA  1 
ATOM   472  C  C   . GLU A 1 58  ? -14.618 14.454  10.650  1.00 31.24 ? 233 GLU A C   1 
ATOM   473  O  O   . GLU A 1 58  ? -15.508 15.111  10.121  1.00 31.55 ? 233 GLU A O   1 
ATOM   474  C  CB  . GLU A 1 58  ? -15.241 13.985  13.050  1.00 33.68 ? 233 GLU A CB  1 
ATOM   475  C  CG  . GLU A 1 58  ? -14.115 14.852  13.603  1.00 39.66 ? 233 GLU A CG  1 
ATOM   476  C  CD  . GLU A 1 58  ? -14.455 15.392  14.994  1.00 50.01 ? 233 GLU A CD  1 
ATOM   477  O  OE1 . GLU A 1 58  ? -15.121 14.636  15.762  1.00 53.45 ? 233 GLU A OE1 1 
ATOM   478  O  OE2 . GLU A 1 58  ? -14.050 16.559  15.322  1.00 53.65 ? 233 GLU A OE2 1 
ATOM   479  N  N   . THR A 1 59  ? -13.344 14.690  10.378  1.00 31.16 ? 234 THR A N   1 
ATOM   480  C  CA  . THR A 1 59  ? -12.998 15.654  9.328   1.00 31.54 ? 234 THR A CA  1 
ATOM   481  C  C   . THR A 1 59  ? -12.789 14.955  7.932   1.00 29.78 ? 234 THR A C   1 
ATOM   482  O  O   . THR A 1 59  ? -12.388 15.596  6.951   1.00 29.46 ? 234 THR A O   1 
ATOM   483  C  CB  . THR A 1 59  ? -11.703 16.390  9.737   1.00 31.99 ? 234 THR A CB  1 
ATOM   484  O  OG1 . THR A 1 59  ? -10.686 15.400  9.980   1.00 34.68 ? 234 THR A OG1 1 
ATOM   485  C  CG2 . THR A 1 59  ? -11.923 17.154  11.070  1.00 35.29 ? 234 THR A CG2 1 
ATOM   486  N  N   . GLU A 1 60  ? -13.032 13.650  7.858   1.00 26.92 ? 235 GLU A N   1 
ATOM   487  C  CA  . GLU A 1 60  ? -12.844 12.919  6.602   1.00 26.40 ? 235 GLU A CA  1 
ATOM   488  C  C   . GLU A 1 60  ? -14.135 12.830  5.785   1.00 25.45 ? 235 GLU A C   1 
ATOM   489  O  O   . GLU A 1 60  ? -15.263 12.790  6.333   1.00 25.81 ? 235 GLU A O   1 
ATOM   490  C  CB  . GLU A 1 60  ? -12.287 11.502  6.894   1.00 25.81 ? 235 GLU A CB  1 
ATOM   491  C  CG  . GLU A 1 60  ? -10.811 11.510  7.352   1.00 29.97 ? 235 GLU A CG  1 
ATOM   492  C  CD  . GLU A 1 60  ? -10.319 10.156  7.917   1.00 36.47 ? 235 GLU A CD  1 
ATOM   493  O  OE1 . GLU A 1 60  ? -11.130 9.160   8.091   1.00 32.45 ? 235 GLU A OE1 1 
ATOM   494  O  OE2 . GLU A 1 60  ? -9.094  10.094  8.210   1.00 39.55 ? 235 GLU A OE2 1 
ATOM   495  N  N   . LYS A 1 61  ? -13.986 12.783  4.470   1.00 23.35 ? 236 LYS A N   1 
ATOM   496  C  CA  . LYS A 1 61  ? -15.136 12.659  3.562   1.00 23.93 ? 236 LYS A CA  1 
ATOM   497  C  C   . LYS A 1 61  ? -14.864 11.459  2.650   1.00 22.68 ? 236 LYS A C   1 
ATOM   498  O  O   . LYS A 1 61  ? -13.728 10.932  2.602   1.00 22.78 ? 236 LYS A O   1 
ATOM   499  C  CB  . LYS A 1 61  ? -15.217 13.903  2.680   1.00 23.11 ? 236 LYS A CB  1 
ATOM   500  C  CG  . LYS A 1 61  ? -13.894 14.018  1.864   1.00 26.20 ? 236 LYS A CG  1 
ATOM   501  C  CD  . LYS A 1 61  ? -13.977 15.183  0.911   1.00 33.78 ? 236 LYS A CD  1 
ATOM   502  C  CE  . LYS A 1 61  ? -15.356 15.164  0.259   1.00 40.84 ? 236 LYS A CE  1 
ATOM   503  N  NZ  . LYS A 1 61  ? -15.520 16.383  -0.588  1.00 47.09 ? 236 LYS A NZ  1 
ATOM   504  N  N   . ILE A 1 62  ? -15.881 11.084  1.881   1.00 20.64 ? 237 ILE A N   1 
ATOM   505  C  CA  . ILE A 1 62  ? -15.710 10.061  0.876   1.00 18.45 ? 237 ILE A CA  1 
ATOM   506  C  C   . ILE A 1 62  ? -16.745 10.324  -0.201  1.00 17.90 ? 237 ILE A C   1 
ATOM   507  O  O   . ILE A 1 62  ? -17.848 10.927  0.076   1.00 17.32 ? 237 ILE A O   1 
ATOM   508  C  CB  . ILE A 1 62  ? -15.859 8.650   1.525   1.00 18.79 ? 237 ILE A CB  1 
ATOM   509  C  CG1 . ILE A 1 62  ? -15.461 7.563   0.518   1.00 17.41 ? 237 ILE A CG1 1 
ATOM   510  C  CG2 . ILE A 1 62  ? -17.350 8.399   2.049   1.00 17.53 ? 237 ILE A CG2 1 
ATOM   511  C  CD1 . ILE A 1 62  ? -15.158 6.217   1.240   1.00 18.26 ? 237 ILE A CD1 1 
ATOM   512  N  N   . THR A 1 63  ? -16.411 9.925   -1.428  1.00 14.52 ? 238 THR A N   1 
ATOM   513  C  CA  . THR A 1 63  ? -17.262 10.108  -2.567  1.00 14.59 ? 238 THR A CA  1 
ATOM   514  C  C   . THR A 1 63  ? -17.789 8.715   -3.079  1.00 14.92 ? 238 THR A C   1 
ATOM   515  O  O   . THR A 1 63  ? -17.008 7.774   -3.316  1.00 15.37 ? 238 THR A O   1 
ATOM   516  C  CB  . THR A 1 63  ? -16.543 10.843  -3.696  1.00 14.86 ? 238 THR A CB  1 
ATOM   517  O  OG1 . THR A 1 63  ? -16.070 12.125  -3.209  1.00 14.33 ? 238 THR A OG1 1 
ATOM   518  C  CG2 . THR A 1 63  ? -17.490 10.990  -4.954  1.00 15.36 ? 238 THR A CG2 1 
ATOM   519  N  N   . VAL A 1 64  ? -19.094 8.598   -3.206  1.00 13.61 ? 239 VAL A N   1 
ATOM   520  C  CA  . VAL A 1 64  ? -19.679 7.340   -3.694  1.00 13.20 ? 239 VAL A CA  1 
ATOM   521  C  C   . VAL A 1 64  ? -20.221 7.611   -5.086  1.00 13.49 ? 239 VAL A C   1 
ATOM   522  O  O   . VAL A 1 64  ? -21.091 8.513   -5.278  1.00 15.96 ? 239 VAL A O   1 
ATOM   523  C  CB  . VAL A 1 64  ? -20.802 6.792   -2.780  1.00 12.75 ? 239 VAL A CB  1 
ATOM   524  C  CG1 . VAL A 1 64  ? -21.268 5.442   -3.333  1.00 12.34 ? 239 VAL A CG1 1 
ATOM   525  C  CG2 . VAL A 1 64  ? -20.353 6.682   -1.304  1.00 12.18 ? 239 VAL A CG2 1 
ATOM   526  N  N   . CYS A 1 65  ? -19.703 6.840   -6.057  1.00 11.62 ? 240 CYS A N   1 
ATOM   527  C  CA  . CYS A 1 65  ? -20.215 6.772   -7.408  1.00 11.96 ? 240 CYS A CA  1 
ATOM   528  C  C   . CYS A 1 65  ? -20.931 5.469   -7.701  1.00 12.29 ? 240 CYS A C   1 
ATOM   529  O  O   . CYS A 1 65  ? -20.560 4.425   -7.176  1.00 11.21 ? 240 CYS A O   1 
ATOM   530  C  CB  . CYS A 1 65  ? -19.082 6.903   -8.402  1.00 12.74 ? 240 CYS A CB  1 
ATOM   531  S  SG  . CYS A 1 65  ? -18.111 8.473   -8.146  1.00 18.80 ? 240 CYS A SG  1 
ATOM   532  N  N   . GLY A 1 66  ? -21.880 5.544   -8.623  1.00 13.83 ? 241 GLY A N   1 
ATOM   533  C  CA  . GLY A 1 66  ? -22.674 4.362   -9.081  1.00 14.57 ? 241 GLY A CA  1 
ATOM   534  C  C   . GLY A 1 66  ? -22.129 3.923   -10.407 1.00 14.63 ? 241 GLY A C   1 
ATOM   535  O  O   . GLY A 1 66  ? -20.937 4.153   -10.685 1.00 15.50 ? 241 GLY A O   1 
ATOM   536  N  N   . ASP A 1 67  ? -22.993 3.328   -11.216 1.00 15.06 ? 242 ASP A N   1 
ATOM   537  C  CA  . ASP A 1 67  ? -22.616 2.683   -12.483 1.00 14.07 ? 242 ASP A CA  1 
ATOM   538  C  C   . ASP A 1 67  ? -21.898 3.700   -13.363 1.00 15.05 ? 242 ASP A C   1 
ATOM   539  O  O   . ASP A 1 67  ? -22.285 4.890   -13.429 1.00 14.29 ? 242 ASP A O   1 
ATOM   540  C  CB  . ASP A 1 67  ? -23.809 2.169   -13.303 1.00 14.53 ? 242 ASP A CB  1 
ATOM   541  C  CG  . ASP A 1 67  ? -24.784 1.282   -12.523 1.00 13.71 ? 242 ASP A CG  1 
ATOM   542  O  OD1 . ASP A 1 67  ? -24.921 1.413   -11.316 1.00 13.01 ? 242 ASP A OD1 1 
ATOM   543  O  OD2 . ASP A 1 67  ? -25.456 0.460   -13.166 1.00 11.99 ? 242 ASP A OD2 1 
ATOM   544  N  N   . THR A 1 68  ? -20.863 3.220   -14.040 1.00 12.59 ? 243 THR A N   1 
ATOM   545  C  CA  . THR A 1 68  ? -20.101 4.018   -14.986 1.00 14.47 ? 243 THR A CA  1 
ATOM   546  C  C   . THR A 1 68  ? -20.157 3.396   -16.406 1.00 13.95 ? 243 THR A C   1 
ATOM   547  O  O   . THR A 1 68  ? -20.095 4.116   -17.385 1.00 13.62 ? 243 THR A O   1 
ATOM   548  C  CB  . THR A 1 68  ? -18.644 4.273   -14.536 1.00 15.32 ? 243 THR A CB  1 
ATOM   549  O  OG1 . THR A 1 68  ? -17.987 3.029   -14.182 1.00 16.09 ? 243 THR A OG1 1 
ATOM   550  C  CG2 . THR A 1 68  ? -18.622 5.279   -13.311 1.00 12.93 ? 243 THR A CG2 1 
ATOM   551  N  N   . HIS A 1 69  ? -20.320 2.072   -16.513 1.00 13.67 ? 244 HIS A N   1 
ATOM   552  C  CA  . HIS A 1 69  ? -20.588 1.451   -17.835 1.00 13.42 ? 244 HIS A CA  1 
ATOM   553  C  C   . HIS A 1 69  ? -19.711 1.950   -19.014 1.00 13.44 ? 244 HIS A C   1 
ATOM   554  O  O   . HIS A 1 69  ? -20.217 2.337   -20.076 1.00 12.04 ? 244 HIS A O   1 
ATOM   555  C  CB  . HIS A 1 69  ? -22.076 1.561   -18.193 1.00 14.26 ? 244 HIS A CB  1 
ATOM   556  C  CG  . HIS A 1 69  ? -22.916 0.575   -17.456 1.00 11.92 ? 244 HIS A CG  1 
ATOM   557  N  ND1 . HIS A 1 69  ? -22.738 -0.790  -17.588 1.00 16.36 ? 244 HIS A ND1 1 
ATOM   558  C  CD2 . HIS A 1 69  ? -23.897 0.743   -16.532 1.00 13.22 ? 244 HIS A CD2 1 
ATOM   559  C  CE1 . HIS A 1 69  ? -23.587 -1.422  -16.784 1.00 15.10 ? 244 HIS A CE1 1 
ATOM   560  N  NE2 . HIS A 1 69  ? -24.312 -0.509  -16.152 1.00 12.71 ? 244 HIS A NE2 1 
ATOM   561  N  N   . GLY A 1 70  ? -18.396 1.890   -18.819 1.00 14.83 ? 245 GLY A N   1 
ATOM   562  C  CA  . GLY A 1 70  ? -17.477 2.082   -19.961 1.00 13.29 ? 245 GLY A CA  1 
ATOM   563  C  C   . GLY A 1 70  ? -17.489 3.512   -20.490 1.00 14.01 ? 245 GLY A C   1 
ATOM   564  O  O   . GLY A 1 70  ? -16.910 3.739   -21.579 1.00 13.21 ? 245 GLY A O   1 
ATOM   565  N  N   . GLN A 1 71  ? -18.162 4.455   -19.769 1.00 12.52 ? 246 GLN A N   1 
ATOM   566  C  CA  . GLN A 1 71  ? -18.125 5.885   -20.134 1.00 12.69 ? 246 GLN A CA  1 
ATOM   567  C  C   . GLN A 1 71  ? -16.909 6.592   -19.599 1.00 12.70 ? 246 GLN A C   1 
ATOM   568  O  O   . GLN A 1 71  ? -16.975 7.437   -18.692 1.00 13.17 ? 246 GLN A O   1 
ATOM   569  C  CB  . GLN A 1 71  ? -19.426 6.664   -19.777 1.00 12.51 ? 246 GLN A CB  1 
ATOM   570  C  CG  . GLN A 1 71  ? -20.646 5.920   -20.356 1.00 14.98 ? 246 GLN A CG  1 
ATOM   571  C  CD  . GLN A 1 71  ? -21.963 6.623   -20.044 1.00 15.90 ? 246 GLN A CD  1 
ATOM   572  O  OE1 . GLN A 1 71  ? -21.991 7.835   -19.723 1.00 15.31 ? 246 GLN A OE1 1 
ATOM   573  N  NE2 . GLN A 1 71  ? -23.058 5.869   -20.174 1.00 15.05 ? 246 GLN A NE2 1 
ATOM   574  N  N   . PHE A 1 72  ? -15.761 6.255   -20.212 1.00 12.83 ? 247 PHE A N   1 
ATOM   575  C  CA  . PHE A 1 72  ? -14.512 6.749   -19.747 1.00 12.02 ? 247 PHE A CA  1 
ATOM   576  C  C   . PHE A 1 72  ? -14.415 8.267   -19.687 1.00 11.60 ? 247 PHE A C   1 
ATOM   577  O  O   . PHE A 1 72  ? -13.720 8.789   -18.838 1.00 12.98 ? 247 PHE A O   1 
ATOM   578  C  CB  . PHE A 1 72  ? -13.391 6.253   -20.703 1.00 12.59 ? 247 PHE A CB  1 
ATOM   579  C  CG  . PHE A 1 72  ? -12.020 6.719   -20.306 1.00 11.90 ? 247 PHE A CG  1 
ATOM   580  C  CD1 . PHE A 1 72  ? -11.456 6.278   -19.116 1.00 12.53 ? 247 PHE A CD1 1 
ATOM   581  C  CD2 . PHE A 1 72  ? -11.310 7.646   -21.078 1.00 17.59 ? 247 PHE A CD2 1 
ATOM   582  C  CE1 . PHE A 1 72  ? -10.195 6.713   -18.642 1.00 14.22 ? 247 PHE A CE1 1 
ATOM   583  C  CE2 . PHE A 1 72  ? -9.963  8.071   -20.609 1.00 15.78 ? 247 PHE A CE2 1 
ATOM   584  C  CZ  . PHE A 1 72  ? -9.460  7.590   -19.401 1.00 14.81 ? 247 PHE A CZ  1 
ATOM   585  N  N   . TYR A 1 73  ? -14.980 8.952   -20.678 1.00 12.05 ? 248 TYR A N   1 
ATOM   586  C  CA  . TYR A 1 73  ? -14.809 10.425  -20.740 1.00 14.20 ? 248 TYR A CA  1 
ATOM   587  C  C   . TYR A 1 73  ? -15.640 11.072  -19.646 1.00 12.76 ? 248 TYR A C   1 
ATOM   588  O  O   . TYR A 1 73  ? -15.270 12.079  -19.069 1.00 12.53 ? 248 TYR A O   1 
ATOM   589  C  CB  . TYR A 1 73  ? -15.101 10.924  -22.182 1.00 13.25 ? 248 TYR A CB  1 
ATOM   590  C  CG  . TYR A 1 73  ? -14.039 10.365  -23.120 1.00 12.74 ? 248 TYR A CG  1 
ATOM   591  C  CD1 . TYR A 1 73  ? -14.151 9.071   -23.671 1.00 15.15 ? 248 TYR A CD1 1 
ATOM   592  C  CD2 . TYR A 1 73  ? -12.868 11.116  -23.383 1.00 18.01 ? 248 TYR A CD2 1 
ATOM   593  C  CE1 . TYR A 1 73  ? -13.128 8.554   -24.528 1.00 16.50 ? 248 TYR A CE1 1 
ATOM   594  C  CE2 . TYR A 1 73  ? -11.856 10.621  -24.181 1.00 16.53 ? 248 TYR A CE2 1 
ATOM   595  C  CZ  . TYR A 1 73  ? -11.976 9.342   -24.753 1.00 18.42 ? 248 TYR A CZ  1 
ATOM   596  O  OH  . TYR A 1 73  ? -10.950 8.896   -25.554 1.00 20.34 ? 248 TYR A OH  1 
ATOM   597  N  N   . ASP A 1 74  ? -16.724 10.409  -19.256 1.00 13.07 ? 249 ASP A N   1 
ATOM   598  C  CA  . ASP A 1 74  ? -17.481 10.877  -18.070 1.00 14.07 ? 249 ASP A CA  1 
ATOM   599  C  C   . ASP A 1 74  ? -16.757 10.557  -16.765 1.00 13.77 ? 249 ASP A C   1 
ATOM   600  O  O   . ASP A 1 74  ? -16.828 11.342  -15.808 1.00 13.69 ? 249 ASP A O   1 
ATOM   601  C  CB  . ASP A 1 74  ? -18.905 10.274  -18.123 1.00 13.81 ? 249 ASP A CB  1 
ATOM   602  C  CG  . ASP A 1 74  ? -19.708 10.785  -19.365 1.00 18.70 ? 249 ASP A CG  1 
ATOM   603  O  OD1 . ASP A 1 74  ? -19.659 12.036  -19.659 1.00 20.54 ? 249 ASP A OD1 1 
ATOM   604  O  OD2 . ASP A 1 74  ? -20.365 9.942   -20.070 1.00 21.58 ? 249 ASP A OD2 1 
ATOM   605  N  N   . LEU A 1 75  ? -16.039 9.402   -16.714 1.00 14.23 ? 250 LEU A N   1 
ATOM   606  C  CA  . LEU A 1 75  ? -15.218 9.095   -15.542 1.00 14.22 ? 250 LEU A CA  1 
ATOM   607  C  C   . LEU A 1 75  ? -14.166 10.200  -15.337 1.00 15.00 ? 250 LEU A C   1 
ATOM   608  O  O   . LEU A 1 75  ? -13.871 10.632  -14.201 1.00 12.64 ? 250 LEU A O   1 
ATOM   609  C  CB  . LEU A 1 75  ? -14.522 7.712   -15.717 1.00 14.31 ? 250 LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 75  ? -13.502 7.375   -14.627 1.00 15.20 ? 250 LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 75  ? -14.213 7.177   -13.300 1.00 11.90 ? 250 LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 75  ? -12.647 6.022   -14.992 1.00 13.17 ? 250 LEU A CD2 1 
ATOM   613  N  N   . LEU A 1 76  ? -13.492 10.558  -16.434 1.00 14.63 ? 251 LEU A N   1 
ATOM   614  C  CA  . LEU A 1 76  ? -12.520 11.650  -16.369 1.00 15.63 ? 251 LEU A CA  1 
ATOM   615  C  C   . LEU A 1 76  ? -13.203 12.935  -15.863 1.00 13.86 ? 251 LEU A C   1 
ATOM   616  O  O   . LEU A 1 76  ? -12.632 13.640  -15.078 1.00 15.55 ? 251 LEU A O   1 
ATOM   617  C  CB  . LEU A 1 76  ? -11.847 11.943  -17.754 1.00 13.80 ? 251 LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 76  ? -10.899 10.817  -18.268 1.00 18.18 ? 251 LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 76  ? -10.043 11.283  -19.441 1.00 17.28 ? 251 LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 76  ? -10.026 10.272  -17.089 1.00 11.33 ? 251 LEU A CD2 1 
ATOM   621  N  N   . ASN A 1 77  ? -14.386 13.221  -16.355 1.00 14.31 ? 252 ASN A N   1 
ATOM   622  C  CA  . ASN A 1 77  ? -15.136 14.408  -15.877 1.00 14.52 ? 252 ASN A CA  1 
ATOM   623  C  C   . ASN A 1 77  ? -15.416 14.372  -14.352 1.00 13.62 ? 252 ASN A C   1 
ATOM   624  O  O   . ASN A 1 77  ? -15.262 15.389  -13.643 1.00 12.24 ? 252 ASN A O   1 
ATOM   625  C  CB  . ASN A 1 77  ? -16.370 14.637  -16.747 1.00 12.51 ? 252 ASN A CB  1 
ATOM   626  C  CG  . ASN A 1 77  ? -17.034 16.003  -16.484 1.00 15.33 ? 252 ASN A CG  1 
ATOM   627  O  OD1 . ASN A 1 77  ? -16.363 17.032  -16.463 1.00 17.07 ? 252 ASN A OD1 1 
ATOM   628  N  ND2 . ASN A 1 77  ? -18.316 15.999  -16.254 1.00 12.95 ? 252 ASN A ND2 1 
ATOM   629  N  N   . ILE A 1 78  ? -15.754 13.194  -13.805 1.00 13.31 ? 253 ILE A N   1 
ATOM   630  C  CA  . ILE A 1 78  ? -15.870 13.052  -12.308 1.00 12.14 ? 253 ILE A CA  1 
ATOM   631  C  C   . ILE A 1 78  ? -14.600 13.488  -11.606 1.00 13.51 ? 253 ILE A C   1 
ATOM   632  O  O   . ILE A 1 78  ? -14.650 14.282  -10.624 1.00 11.16 ? 253 ILE A O   1 
ATOM   633  C  CB  . ILE A 1 78  ? -16.222 11.613  -11.881 1.00 11.84 ? 253 ILE A CB  1 
ATOM   634  C  CG1 . ILE A 1 78  ? -17.596 11.186  -12.470 1.00 13.15 ? 253 ILE A CG1 1 
ATOM   635  C  CG2 . ILE A 1 78  ? -16.210 11.471  -10.367 1.00 13.28 ? 253 ILE A CG2 1 
ATOM   636  C  CD1 . ILE A 1 78  ? -18.069 9.681   -12.191 1.00 13.46 ? 253 ILE A CD1 1 
ATOM   637  N  N   . PHE A 1 79  ? -13.425 13.000  -12.091 1.00 11.58 ? 254 PHE A N   1 
ATOM   638  C  CA  . PHE A 1 79  ? -12.207 13.367  -11.392 1.00 13.05 ? 254 PHE A CA  1 
ATOM   639  C  C   . PHE A 1 79  ? -11.901 14.855  -11.604 1.00 14.56 ? 254 PHE A C   1 
ATOM   640  O  O   . PHE A 1 79  ? -11.236 15.456  -10.796 1.00 14.86 ? 254 PHE A O   1 
ATOM   641  C  CB  . PHE A 1 79  ? -11.022 12.544  -11.902 1.00 10.46 ? 254 PHE A CB  1 
ATOM   642  C  CG  . PHE A 1 79  ? -11.183 11.053  -11.638 1.00 14.22 ? 254 PHE A CG  1 
ATOM   643  C  CD1 . PHE A 1 79  ? -11.856 10.634  -10.482 1.00 16.34 ? 254 PHE A CD1 1 
ATOM   644  C  CD2 . PHE A 1 79  ? -10.580 10.093  -12.471 1.00 17.87 ? 254 PHE A CD2 1 
ATOM   645  C  CE1 . PHE A 1 79  ? -11.971 9.282   -10.173 1.00 16.31 ? 254 PHE A CE1 1 
ATOM   646  C  CE2 . PHE A 1 79  ? -10.658 8.710   -12.147 1.00 14.42 ? 254 PHE A CE2 1 
ATOM   647  C  CZ  . PHE A 1 79  ? -11.372 8.330   -10.998 1.00 16.29 ? 254 PHE A CZ  1 
ATOM   648  N  N   . GLU A 1 80  ? -12.319 15.406  -12.731 1.00 16.40 ? 255 GLU A N   1 
ATOM   649  C  CA  . GLU A 1 80  ? -12.147 16.872  -12.899 1.00 20.73 ? 255 GLU A CA  1 
ATOM   650  C  C   . GLU A 1 80  ? -13.021 17.668  -11.936 1.00 19.80 ? 255 GLU A C   1 
ATOM   651  O  O   . GLU A 1 80  ? -12.558 18.662  -11.349 1.00 19.87 ? 255 GLU A O   1 
ATOM   652  C  CB  . GLU A 1 80  ? -12.486 17.273  -14.337 1.00 21.04 ? 255 GLU A CB  1 
ATOM   653  C  CG  . GLU A 1 80  ? -11.433 16.647  -15.268 1.00 31.05 ? 255 GLU A CG  1 
ATOM   654  C  CD  . GLU A 1 80  ? -11.795 16.681  -16.790 1.00 42.15 ? 255 GLU A CD  1 
ATOM   655  O  OE1 . GLU A 1 80  ? -12.827 17.283  -17.210 1.00 47.71 ? 255 GLU A OE1 1 
ATOM   656  O  OE2 . GLU A 1 80  ? -11.028 16.077  -17.570 1.00 45.39 ? 255 GLU A OE2 1 
ATOM   657  N  N   . LEU A 1 81  ? -14.249 17.209  -11.718 1.00 18.81 ? 256 LEU A N   1 
ATOM   658  C  CA  . LEU A 1 81  ? -15.223 17.974  -10.898 1.00 18.83 ? 256 LEU A CA  1 
ATOM   659  C  C   . LEU A 1 81  ? -14.883 17.850  -9.446  1.00 18.31 ? 256 LEU A C   1 
ATOM   660  O  O   . LEU A 1 81  ? -15.034 18.782  -8.666  1.00 16.34 ? 256 LEU A O   1 
ATOM   661  C  CB  . LEU A 1 81  ? -16.642 17.420  -11.102 1.00 18.83 ? 256 LEU A CB  1 
ATOM   662  C  CG  . LEU A 1 81  ? -17.196 17.548  -12.506 1.00 21.60 ? 256 LEU A CG  1 
ATOM   663  C  CD1 . LEU A 1 81  ? -18.574 16.965  -12.508 1.00 24.55 ? 256 LEU A CD1 1 
ATOM   664  C  CD2 . LEU A 1 81  ? -17.274 19.046  -12.796 1.00 27.12 ? 256 LEU A CD2 1 
ATOM   665  N  N   . ASN A 1 82  ? -14.453 16.643  -9.073  1.00 17.37 ? 257 ASN A N   1 
ATOM   666  C  CA  . ASN A 1 82  ? -14.444 16.257  -7.715  1.00 17.81 ? 257 ASN A CA  1 
ATOM   667  C  C   . ASN A 1 82  ? -13.019 16.029  -7.239  1.00 17.54 ? 257 ASN A C   1 
ATOM   668  O  O   . ASN A 1 82  ? -12.854 15.749  -6.082  1.00 17.72 ? 257 ASN A O   1 
ATOM   669  C  CB  . ASN A 1 82  ? -15.283 14.928  -7.500  1.00 18.47 ? 257 ASN A CB  1 
ATOM   670  C  CG  . ASN A 1 82  ? -15.469 14.610  -6.042  1.00 17.46 ? 257 ASN A CG  1 
ATOM   671  O  OD1 . ASN A 1 82  ? -15.994 15.446  -5.316  1.00 19.07 ? 257 ASN A OD1 1 
ATOM   672  N  ND2 . ASN A 1 82  ? -15.008 13.438  -5.576  1.00 13.42 ? 257 ASN A ND2 1 
ATOM   673  N  N   . GLY A 1 83  ? -12.020 16.117  -8.122  1.00 17.16 ? 258 GLY A N   1 
ATOM   674  C  CA  . GLY A 1 83  ? -10.606 15.881  -7.714  1.00 15.87 ? 258 GLY A CA  1 
ATOM   675  C  C   . GLY A 1 83  ? -10.139 14.451  -7.974  1.00 17.51 ? 258 GLY A C   1 
ATOM   676  O  O   . GLY A 1 83  ? -10.938 13.487  -7.949  1.00 13.69 ? 258 GLY A O   1 
ATOM   677  N  N   . LEU A 1 84  ? -8.856  14.273  -8.274  1.00 17.28 ? 259 LEU A N   1 
ATOM   678  C  CA  . LEU A 1 84  ? -8.359  12.899  -8.308  1.00 16.96 ? 259 LEU A CA  1 
ATOM   679  C  C   . LEU A 1 84  ? -8.471  12.172  -6.969  1.00 15.57 ? 259 LEU A C   1 
ATOM   680  O  O   . LEU A 1 84  ? -8.424  12.792  -5.907  1.00 14.88 ? 259 LEU A O   1 
ATOM   681  C  CB  . LEU A 1 84  ? -6.891  12.856  -8.742  1.00 16.95 ? 259 LEU A CB  1 
ATOM   682  C  CG  . LEU A 1 84  ? -6.663  13.342  -10.177 1.00 20.65 ? 259 LEU A CG  1 
ATOM   683  C  CD1 . LEU A 1 84  ? -5.172  13.654  -10.356 1.00 24.34 ? 259 LEU A CD1 1 
ATOM   684  C  CD2 . LEU A 1 84  ? -7.106  12.194  -11.113 1.00 23.46 ? 259 LEU A CD2 1 
ATOM   685  N  N   . PRO A 1 85  ? -8.600  10.828  -7.020  1.00 14.61 ? 260 PRO A N   1 
ATOM   686  C  CA  . PRO A 1 85  ? -8.451  9.979   -5.822  1.00 16.89 ? 260 PRO A CA  1 
ATOM   687  C  C   . PRO A 1 85  ? -7.150  10.301  -5.088  1.00 17.23 ? 260 PRO A C   1 
ATOM   688  O  O   . PRO A 1 85  ? -6.126  10.586  -5.732  1.00 18.44 ? 260 PRO A O   1 
ATOM   689  C  CB  . PRO A 1 85  ? -8.357  8.534   -6.379  1.00 17.13 ? 260 PRO A CB  1 
ATOM   690  C  CG  . PRO A 1 85  ? -8.821  8.561   -7.802  1.00 15.54 ? 260 PRO A CG  1 
ATOM   691  C  CD  . PRO A 1 85  ? -8.743  10.071  -8.285  1.00 15.86 ? 260 PRO A CD  1 
ATOM   692  N  N   . SER A 1 86  ? -7.181  10.282  -3.775  1.00 18.28 ? 261 SER A N   1 
ATOM   693  C  CA  . SER A 1 86  ? -5.966  10.382  -2.998  1.00 21.15 ? 261 SER A CA  1 
ATOM   694  C  C   . SER A 1 86  ? -6.317  9.914   -1.578  1.00 22.00 ? 261 SER A C   1 
ATOM   695  O  O   . SER A 1 86  ? -7.497  9.625   -1.261  1.00 21.97 ? 261 SER A O   1 
ATOM   696  C  CB  . SER A 1 86  ? -5.460  11.846  -3.002  1.00 21.33 ? 261 SER A CB  1 
ATOM   697  O  OG  . SER A 1 86  ? -6.242  12.572  -2.076  1.00 21.55 ? 261 SER A OG  1 
ATOM   698  N  N   . GLU A 1 87  ? -5.332  9.844   -0.684  1.00 23.03 ? 262 GLU A N   1 
ATOM   699  C  CA  . GLU A 1 87  ? -5.649  9.523   0.722   1.00 24.38 ? 262 GLU A CA  1 
ATOM   700  C  C   . GLU A 1 87  ? -6.591  10.529  1.388   1.00 23.64 ? 262 GLU A C   1 
ATOM   701  O  O   . GLU A 1 87  ? -7.230  10.235  2.391   1.00 24.02 ? 262 GLU A O   1 
ATOM   702  C  CB  . GLU A 1 87  ? -4.362  9.427   1.554   1.00 26.69 ? 262 GLU A CB  1 
ATOM   703  C  CG  . GLU A 1 87  ? -3.315  8.502   0.962   1.00 33.64 ? 262 GLU A CG  1 
ATOM   704  C  CD  . GLU A 1 87  ? -2.402  9.166   -0.109  1.00 43.36 ? 262 GLU A CD  1 
ATOM   705  O  OE1 . GLU A 1 87  ? -2.720  10.274  -0.689  1.00 44.31 ? 262 GLU A OE1 1 
ATOM   706  O  OE2 . GLU A 1 87  ? -1.341  8.530   -0.365  1.00 48.25 ? 262 GLU A OE2 1 
ATOM   707  N  N   . THR A 1 88  ? -6.677  11.730  0.865   1.00 22.11 ? 263 THR A N   1 
ATOM   708  C  CA  . THR A 1 88  ? -7.605  12.647  1.464   1.00 22.56 ? 263 THR A CA  1 
ATOM   709  C  C   . THR A 1 88  ? -8.844  12.851  0.602   1.00 21.30 ? 263 THR A C   1 
ATOM   710  O  O   . THR A 1 88  ? -9.740  13.618  0.953   1.00 21.67 ? 263 THR A O   1 
ATOM   711  C  CB  . THR A 1 88  ? -6.913  14.006  1.789   1.00 24.18 ? 263 THR A CB  1 
ATOM   712  O  OG1 . THR A 1 88  ? -6.417  14.602  0.589   1.00 24.06 ? 263 THR A OG1 1 
ATOM   713  C  CG2 . THR A 1 88  ? -5.770  13.790  2.824   1.00 25.80 ? 263 THR A CG2 1 
ATOM   714  N  N   . ASN A 1 89  ? -8.918  12.147  -0.530  1.00 18.71 ? 264 ASN A N   1 
ATOM   715  C  CA  . ASN A 1 89  ? -10.109 12.247  -1.369  1.00 16.65 ? 264 ASN A CA  1 
ATOM   716  C  C   . ASN A 1 89  ? -10.547 10.828  -1.770  1.00 15.61 ? 264 ASN A C   1 
ATOM   717  O  O   . ASN A 1 89  ? -10.393 10.452  -2.860  1.00 15.43 ? 264 ASN A O   1 
ATOM   718  C  CB  . ASN A 1 89  ? -9.761  13.187  -2.557  1.00 16.76 ? 264 ASN A CB  1 
ATOM   719  C  CG  . ASN A 1 89  ? -10.967 13.620  -3.377  1.00 16.35 ? 264 ASN A CG  1 
ATOM   720  O  OD1 . ASN A 1 89  ? -10.865 13.757  -4.595  1.00 18.01 ? 264 ASN A OD1 1 
ATOM   721  N  ND2 . ASN A 1 89  ? -12.106 13.832  -2.731  1.00 14.00 ? 264 ASN A ND2 1 
ATOM   722  N  N   . PRO A 1 90  ? -10.959 9.976   -0.795  1.00 16.68 ? 265 PRO A N   1 
ATOM   723  C  CA  . PRO A 1 90  ? -11.338 8.567   -1.100  1.00 15.03 ? 265 PRO A CA  1 
ATOM   724  C  C   . PRO A 1 90  ? -12.560 8.435   -2.029  1.00 14.21 ? 265 PRO A C   1 
ATOM   725  O  O   . PRO A 1 90  ? -13.437 9.350   -2.102  1.00 13.82 ? 265 PRO A O   1 
ATOM   726  C  CB  . PRO A 1 90  ? -11.626 7.920   0.300   1.00 16.24 ? 265 PRO A CB  1 
ATOM   727  C  CG  . PRO A 1 90  ? -11.473 9.009   1.337   1.00 19.35 ? 265 PRO A CG  1 
ATOM   728  C  CD  . PRO A 1 90  ? -11.182 10.361  0.613   1.00 15.67 ? 265 PRO A CD  1 
ATOM   729  N  N   . TYR A 1 91  ? -12.612 7.339   -2.770  1.00 13.23 ? 266 TYR A N   1 
ATOM   730  C  CA  . TYR A 1 91  ? -13.766 7.022   -3.607  1.00 13.14 ? 266 TYR A CA  1 
ATOM   731  C  C   . TYR A 1 91  ? -14.275 5.595   -3.373  1.00 12.96 ? 266 TYR A C   1 
ATOM   732  O  O   . TYR A 1 91  ? -13.496 4.692   -3.088  1.00 13.52 ? 266 TYR A O   1 
ATOM   733  C  CB  . TYR A 1 91  ? -13.455 7.093   -5.118  1.00 12.56 ? 266 TYR A CB  1 
ATOM   734  C  CG  . TYR A 1 91  ? -13.426 8.422   -5.740  1.00 12.39 ? 266 TYR A CG  1 
ATOM   735  C  CD1 . TYR A 1 91  ? -12.323 9.257   -5.568  1.00 15.33 ? 266 TYR A CD1 1 
ATOM   736  C  CD2 . TYR A 1 91  ? -14.429 8.830   -6.582  1.00 14.68 ? 266 TYR A CD2 1 
ATOM   737  C  CE1 . TYR A 1 91  ? -12.270 10.521  -6.185  1.00 15.04 ? 266 TYR A CE1 1 
ATOM   738  C  CE2 . TYR A 1 91  ? -14.364 10.092  -7.221  1.00 14.95 ? 266 TYR A CE2 1 
ATOM   739  C  CZ  . TYR A 1 91  ? -13.284 10.927  -6.983  1.00 18.10 ? 266 TYR A CZ  1 
ATOM   740  O  OH  . TYR A 1 91  ? -13.203 12.157  -7.601  1.00 14.47 ? 266 TYR A OH  1 
ATOM   741  N  N   . ILE A 1 92  ? -15.555 5.425   -3.592  1.00 12.45 ? 267 ILE A N   1 
ATOM   742  C  CA  . ILE A 1 92  ? -16.184 4.116   -3.713  1.00 14.85 ? 267 ILE A CA  1 
ATOM   743  C  C   . ILE A 1 92  ? -16.883 4.067   -5.031  1.00 12.37 ? 267 ILE A C   1 
ATOM   744  O  O   . ILE A 1 92  ? -17.721 4.952   -5.372  1.00 15.47 ? 267 ILE A O   1 
ATOM   745  C  CB  . ILE A 1 92  ? -17.246 3.834   -2.605  1.00 14.37 ? 267 ILE A CB  1 
ATOM   746  C  CG1 . ILE A 1 92  ? -16.620 4.072   -1.236  1.00 18.54 ? 267 ILE A CG1 1 
ATOM   747  C  CG2 . ILE A 1 92  ? -17.925 2.411   -2.882  1.00 13.27 ? 267 ILE A CG2 1 
ATOM   748  C  CD1 . ILE A 1 92  ? -17.552 3.774   0.017   1.00 17.74 ? 267 ILE A CD1 1 
ATOM   749  N  N   . PHE A 1 93  ? -16.519 3.108   -5.852  1.00 11.32 ? 268 PHE A N   1 
ATOM   750  C  CA  . PHE A 1 93  ? -17.272 2.957   -7.109  1.00 10.31 ? 268 PHE A CA  1 
ATOM   751  C  C   . PHE A 1 93  ? -18.130 1.702   -6.955  1.00 12.42 ? 268 PHE A C   1 
ATOM   752  O  O   . PHE A 1 93  ? -17.559 0.597   -6.831  1.00 11.82 ? 268 PHE A O   1 
ATOM   753  C  CB  . PHE A 1 93  ? -16.368 2.870   -8.367  1.00 10.46 ? 268 PHE A CB  1 
ATOM   754  C  CG  . PHE A 1 93  ? -15.823 4.223   -8.809  1.00 11.80 ? 268 PHE A CG  1 
ATOM   755  C  CD1 . PHE A 1 93  ? -14.715 4.774   -8.177  1.00 11.86 ? 268 PHE A CD1 1 
ATOM   756  C  CD2 . PHE A 1 93  ? -16.452 4.925   -9.807  1.00 11.88 ? 268 PHE A CD2 1 
ATOM   757  C  CE1 . PHE A 1 93  ? -14.199 6.046   -8.589  1.00 13.25 ? 268 PHE A CE1 1 
ATOM   758  C  CE2 . PHE A 1 93  ? -15.960 6.176   -10.219 1.00 15.04 ? 268 PHE A CE2 1 
ATOM   759  C  CZ  . PHE A 1 93  ? -14.812 6.724   -9.598  1.00 12.62 ? 268 PHE A CZ  1 
ATOM   760  N  N   . ASN A 1 94  ? -19.452 1.878   -7.135  1.00 11.49 ? 269 ASN A N   1 
ATOM   761  C  CA  . ASN A 1 94  ? -20.435 0.875   -6.751  1.00 14.54 ? 269 ASN A CA  1 
ATOM   762  C  C   . ASN A 1 94  ? -20.910 -0.087  -7.882  1.00 12.61 ? 269 ASN A C   1 
ATOM   763  O  O   . ASN A 1 94  ? -22.093 -0.065  -8.256  1.00 15.28 ? 269 ASN A O   1 
ATOM   764  C  CB  . ASN A 1 94  ? -21.656 1.594   -6.055  1.00 13.91 ? 269 ASN A CB  1 
ATOM   765  C  CG  . ASN A 1 94  ? -22.565 0.609   -5.302  1.00 16.85 ? 269 ASN A CG  1 
ATOM   766  O  OD1 . ASN A 1 94  ? -22.119 -0.492  -4.814  1.00 14.92 ? 269 ASN A OD1 1 
ATOM   767  N  ND2 . ASN A 1 94  ? -23.855 0.989   -5.192  1.00 11.49 ? 269 ASN A ND2 1 
ATOM   768  N  N   . GLY A 1 95  ? -19.970 -0.812  -8.497  1.00 13.57 ? 270 GLY A N   1 
ATOM   769  C  CA  . GLY A 1 95  ? -20.249 -1.779  -9.593  1.00 12.47 ? 270 GLY A CA  1 
ATOM   770  C  C   . GLY A 1 95  ? -20.576 -1.235  -10.959 1.00 14.52 ? 270 GLY A C   1 
ATOM   771  O  O   . GLY A 1 95  ? -20.745 0.004   -11.145 1.00 15.92 ? 270 GLY A O   1 
ATOM   772  N  N   . ASP A 1 96  ? -20.727 -2.156  -11.922 1.00 12.72 ? 271 ASP A N   1 
ATOM   773  C  CA  . ASP A 1 96  ? -21.082 -1.857  -13.294 1.00 12.94 ? 271 ASP A CA  1 
ATOM   774  C  C   . ASP A 1 96  ? -20.115 -0.822  -13.916 1.00 12.57 ? 271 ASP A C   1 
ATOM   775  O  O   . ASP A 1 96  ? -20.507 0.274   -14.342 1.00 12.91 ? 271 ASP A O   1 
ATOM   776  C  CB  . ASP A 1 96  ? -22.521 -1.415  -13.386 1.00 12.09 ? 271 ASP A CB  1 
ATOM   777  C  CG  . ASP A 1 96  ? -23.497 -2.620  -13.325 1.00 13.37 ? 271 ASP A CG  1 
ATOM   778  O  OD1 . ASP A 1 96  ? -23.064 -3.702  -12.934 1.00 9.20  ? 271 ASP A OD1 1 
ATOM   779  O  OD2 . ASP A 1 96  ? -24.676 -2.431  -13.664 1.00 9.67  ? 271 ASP A OD2 1 
ATOM   780  N  N   . PHE A 1 97  ? -18.848 -1.157  -13.846 1.00 12.75 ? 272 PHE A N   1 
ATOM   781  C  CA  . PHE A 1 97  ? -17.783 -0.345  -14.477 1.00 13.91 ? 272 PHE A CA  1 
ATOM   782  C  C   . PHE A 1 97  ? -17.708 -0.578  -15.955 1.00 11.20 ? 272 PHE A C   1 
ATOM   783  O  O   . PHE A 1 97  ? -17.244 0.283   -16.718 1.00 11.03 ? 272 PHE A O   1 
ATOM   784  C  CB  . PHE A 1 97  ? -16.387 -0.715  -13.908 1.00 13.39 ? 272 PHE A CB  1 
ATOM   785  C  CG  . PHE A 1 97  ? -16.387 -1.046  -12.478 1.00 13.92 ? 272 PHE A CG  1 
ATOM   786  C  CD1 . PHE A 1 97  ? -16.702 -0.067  -11.529 1.00 14.28 ? 272 PHE A CD1 1 
ATOM   787  C  CD2 . PHE A 1 97  ? -16.057 -2.318  -12.054 1.00 13.06 ? 272 PHE A CD2 1 
ATOM   788  C  CE1 . PHE A 1 97  ? -16.696 -0.340  -10.166 1.00 15.70 ? 272 PHE A CE1 1 
ATOM   789  C  CE2 . PHE A 1 97  ? -16.083 -2.605  -10.679 1.00 18.30 ? 272 PHE A CE2 1 
ATOM   790  C  CZ  . PHE A 1 97  ? -16.400 -1.596  -9.721  1.00 15.29 ? 272 PHE A CZ  1 
ATOM   791  N  N   . VAL A 1 98  ? -18.102 -1.752  -16.399 1.00 13.45 ? 273 VAL A N   1 
ATOM   792  C  CA  . VAL A 1 98  ? -17.949 -2.118  -17.802 1.00 13.92 ? 273 VAL A CA  1 
ATOM   793  C  C   . VAL A 1 98  ? -19.302 -2.502  -18.439 1.00 15.59 ? 273 VAL A C   1 
ATOM   794  O  O   . VAL A 1 98  ? -20.340 -2.607  -17.709 1.00 15.31 ? 273 VAL A O   1 
ATOM   795  C  CB  . VAL A 1 98  ? -16.954 -3.338  -17.961 1.00 15.46 ? 273 VAL A CB  1 
ATOM   796  C  CG1 . VAL A 1 98  ? -15.566 -3.011  -17.392 1.00 17.04 ? 273 VAL A CG1 1 
ATOM   797  C  CG2 . VAL A 1 98  ? -17.495 -4.659  -17.311 1.00 15.70 ? 273 VAL A CG2 1 
ATOM   798  N  N   . ASP A 1 99  ? -19.267 -2.789  -19.750 1.00 14.89 ? 274 ASP A N   1 
ATOM   799  C  CA  . ASP A 1 99  ? -20.446 -3.167  -20.602 1.00 15.46 ? 274 ASP A CA  1 
ATOM   800  C  C   . ASP A 1 99  ? -21.229 -1.922  -21.057 1.00 15.24 ? 274 ASP A C   1 
ATOM   801  O  O   . ASP A 1 99  ? -21.277 -0.897  -20.310 1.00 14.52 ? 274 ASP A O   1 
ATOM   802  C  CB  . ASP A 1 99  ? -21.460 -4.128  -19.899 1.00 14.37 ? 274 ASP A CB  1 
ATOM   803  C  CG  . ASP A 1 99  ? -20.996 -5.623  -19.897 1.00 18.80 ? 274 ASP A CG  1 
ATOM   804  O  OD1 . ASP A 1 99  ? -20.133 -5.993  -20.705 1.00 16.95 ? 274 ASP A OD1 1 
ATOM   805  O  OD2 . ASP A 1 99  ? -21.517 -6.435  -19.074 1.00 20.12 ? 274 ASP A OD2 1 
ATOM   806  N  N   . ARG A 1 100 ? -21.885 -2.027  -22.223 1.00 17.06 ? 275 ARG A N   1 
ATOM   807  C  CA  . ARG A 1 100 ? -22.642 -0.929  -22.848 1.00 19.56 ? 275 ARG A CA  1 
ATOM   808  C  C   . ARG A 1 100 ? -21.748 0.195   -23.389 1.00 19.90 ? 275 ARG A C   1 
ATOM   809  O  O   . ARG A 1 100 ? -21.727 0.365   -24.593 1.00 21.14 ? 275 ARG A O   1 
ATOM   810  C  CB  . ARG A 1 100 ? -23.754 -0.377  -21.983 1.00 22.00 ? 275 ARG A CB  1 
ATOM   811  C  CG  . ARG A 1 100 ? -24.643 -1.500  -21.461 1.00 25.42 ? 275 ARG A CG  1 
ATOM   812  C  CD  . ARG A 1 100 ? -26.151 -1.183  -21.563 1.00 33.05 ? 275 ARG A CD  1 
ATOM   813  N  NE  . ARG A 1 100 ? -26.947 -2.314  -21.081 1.00 28.58 ? 275 ARG A NE  1 
ATOM   814  C  CZ  . ARG A 1 100 ? -27.025 -2.721  -19.803 1.00 32.97 ? 275 ARG A CZ  1 
ATOM   815  N  NH1 . ARG A 1 100 ? -26.312 -2.122  -18.816 1.00 29.70 ? 275 ARG A NH1 1 
ATOM   816  N  NH2 . ARG A 1 100 ? -27.809 -3.776  -19.494 1.00 32.44 ? 275 ARG A NH2 1 
ATOM   817  N  N   . GLY A 1 101 ? -20.970 0.874   -22.548 1.00 19.03 ? 276 GLY A N   1 
ATOM   818  C  CA  . GLY A 1 101 ? -20.088 1.945   -23.040 1.00 18.52 ? 276 GLY A CA  1 
ATOM   819  C  C   . GLY A 1 101 ? -18.918 1.326   -23.814 1.00 19.44 ? 276 GLY A C   1 
ATOM   820  O  O   . GLY A 1 101 ? -18.428 0.227   -23.500 1.00 17.80 ? 276 GLY A O   1 
ATOM   821  N  N   . SER A 1 102 ? -18.386 2.051   -24.775 1.00 19.67 ? 277 SER A N   1 
ATOM   822  C  CA  . SER A 1 102 ? -17.356 1.415   -25.601 1.00 20.79 ? 277 SER A CA  1 
ATOM   823  C  C   . SER A 1 102 ? -15.933 1.759   -25.199 1.00 20.02 ? 277 SER A C   1 
ATOM   824  O  O   . SER A 1 102 ? -14.986 1.502   -25.951 1.00 20.45 ? 277 SER A O   1 
ATOM   825  C  CB  . SER A 1 102 ? -17.646 1.750   -27.070 1.00 21.46 ? 277 SER A CB  1 
ATOM   826  O  OG  . SER A 1 102 ? -18.759 0.974   -27.473 1.00 24.67 ? 277 SER A OG  1 
ATOM   827  N  N   . PHE A 1 103 ? -15.788 2.296   -23.992 1.00 17.04 ? 278 PHE A N   1 
ATOM   828  C  CA  . PHE A 1 103 ? -14.473 2.548   -23.397 1.00 15.52 ? 278 PHE A CA  1 
ATOM   829  C  C   . PHE A 1 103 ? -14.357 1.791   -22.064 1.00 14.01 ? 278 PHE A C   1 
ATOM   830  O  O   . PHE A 1 103 ? -13.791 2.255   -21.111 1.00 12.78 ? 278 PHE A O   1 
ATOM   831  C  CB  . PHE A 1 103 ? -14.225 4.059   -23.281 1.00 14.67 ? 278 PHE A CB  1 
ATOM   832  C  CG  . PHE A 1 103 ? -14.602 4.828   -24.528 1.00 17.74 ? 278 PHE A CG  1 
ATOM   833  C  CD1 . PHE A 1 103 ? -13.723 4.905   -25.622 1.00 20.43 ? 278 PHE A CD1 1 
ATOM   834  C  CD2 . PHE A 1 103 ? -15.836 5.503   -24.598 1.00 18.54 ? 278 PHE A CD2 1 
ATOM   835  C  CE1 . PHE A 1 103 ? -14.068 5.669   -26.758 1.00 21.97 ? 278 PHE A CE1 1 
ATOM   836  C  CE2 . PHE A 1 103 ? -16.208 6.225   -25.702 1.00 19.71 ? 278 PHE A CE2 1 
ATOM   837  C  CZ  . PHE A 1 103 ? -15.329 6.323   -26.819 1.00 19.66 ? 278 PHE A CZ  1 
ATOM   838  N  N   . SER A 1 104 ? -14.902 0.581   -22.022 1.00 13.91 ? 279 SER A N   1 
ATOM   839  C  CA  . SER A 1 104 ? -14.890 -0.233  -20.799 1.00 13.64 ? 279 SER A CA  1 
ATOM   840  C  C   . SER A 1 104 ? -13.476 -0.602  -20.359 1.00 12.99 ? 279 SER A C   1 
ATOM   841  O  O   . SER A 1 104 ? -13.138 -0.563  -19.186 1.00 14.41 ? 279 SER A O   1 
ATOM   842  C  CB  . SER A 1 104 ? -15.699 -1.519  -20.983 1.00 13.02 ? 279 SER A CB  1 
ATOM   843  O  OG  . SER A 1 104 ? -17.080 -1.242  -21.119 1.00 16.31 ? 279 SER A OG  1 
ATOM   844  N  N   . VAL A 1 105 ? -12.633 -0.973  -21.322 1.00 12.89 ? 280 VAL A N   1 
ATOM   845  C  CA  . VAL A 1 105 ? -11.249 -1.303  -20.982 1.00 13.52 ? 280 VAL A CA  1 
ATOM   846  C  C   . VAL A 1 105 ? -10.533 -0.137  -20.359 1.00 12.77 ? 280 VAL A C   1 
ATOM   847  O  O   . VAL A 1 105 ? -9.798  -0.307  -19.388 1.00 14.30 ? 280 VAL A O   1 
ATOM   848  C  CB  . VAL A 1 105 ? -10.473 -1.776  -22.265 1.00 13.65 ? 280 VAL A CB  1 
ATOM   849  C  CG1 . VAL A 1 105 ? -8.969  -1.745  -21.953 1.00 16.94 ? 280 VAL A CG1 1 
ATOM   850  C  CG2 . VAL A 1 105 ? -11.028 -3.251  -22.687 1.00 14.93 ? 280 VAL A CG2 1 
ATOM   851  N  N   . GLU A 1 106 ? -10.713 1.050   -20.934 1.00 13.58 ? 281 GLU A N   1 
ATOM   852  C  CA  . GLU A 1 106 ? -10.152 2.303   -20.337 1.00 13.81 ? 281 GLU A CA  1 
ATOM   853  C  C   . GLU A 1 106 ? -10.695 2.556   -18.932 1.00 13.44 ? 281 GLU A C   1 
ATOM   854  O  O   . GLU A 1 106 ? -9.929  2.838   -18.006 1.00 11.67 ? 281 GLU A O   1 
ATOM   855  C  CB  . GLU A 1 106 ? -10.404 3.540   -21.248 1.00 14.07 ? 281 GLU A CB  1 
ATOM   856  C  CG  . GLU A 1 106 ? -9.668  3.445   -22.657 1.00 19.13 ? 281 GLU A CG  1 
ATOM   857  C  CD  . GLU A 1 106 ? -10.270 2.344   -23.608 1.00 23.85 ? 281 GLU A CD  1 
ATOM   858  O  OE1 . GLU A 1 106 ? -11.433 1.856   -23.399 1.00 21.24 ? 281 GLU A OE1 1 
ATOM   859  O  OE2 . GLU A 1 106 ? -9.573  1.988   -24.597 1.00 23.86 ? 281 GLU A OE2 1 
ATOM   860  N  N   . VAL A 1 107 ? -12.023 2.456   -18.766 1.00 12.25 ? 282 VAL A N   1 
ATOM   861  C  CA  . VAL A 1 107 ? -12.574 2.640   -17.389 1.00 11.22 ? 282 VAL A CA  1 
ATOM   862  C  C   . VAL A 1 107 ? -11.946 1.632   -16.415 1.00 10.50 ? 282 VAL A C   1 
ATOM   863  O  O   . VAL A 1 107 ? -11.448 1.994   -15.409 1.00 8.88  ? 282 VAL A O   1 
ATOM   864  C  CB  . VAL A 1 107 ? -14.127 2.497   -17.337 1.00 10.73 ? 282 VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 107 ? -14.573 2.318   -15.873 1.00 11.01 ? 282 VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 107 ? -14.835 3.720   -18.007 1.00 11.09 ? 282 VAL A CG2 1 
ATOM   867  N  N   . ILE A 1 108 ? -11.994 0.326   -16.724 1.00 12.74 ? 283 ILE A N   1 
ATOM   868  C  CA  . ILE A 1 108 ? -11.602 -0.664  -15.722 1.00 11.35 ? 283 ILE A CA  1 
ATOM   869  C  C   . ILE A 1 108 ? -10.077 -0.622  -15.358 1.00 12.12 ? 283 ILE A C   1 
ATOM   870  O  O   . ILE A 1 108 ? -9.699  -0.772  -14.227 1.00 9.93  ? 283 ILE A O   1 
ATOM   871  C  CB  . ILE A 1 108 ? -12.152 -2.151  -16.104 1.00 11.65 ? 283 ILE A CB  1 
ATOM   872  C  CG1 . ILE A 1 108 ? -12.042 -3.112  -14.915 1.00 13.10 ? 283 ILE A CG1 1 
ATOM   873  C  CG2 . ILE A 1 108 ? -11.448 -2.706  -17.380 1.00 10.31 ? 283 ILE A CG2 1 
ATOM   874  C  CD1 . ILE A 1 108 ? -12.929 -2.610  -13.686 1.00 15.07 ? 283 ILE A CD1 1 
ATOM   875  N  N   . LEU A 1 109 ? -9.205  -0.410  -16.324 1.00 13.45 ? 284 LEU A N   1 
ATOM   876  C  CA  . LEU A 1 109 ? -7.776  -0.386  -15.999 1.00 13.90 ? 284 LEU A CA  1 
ATOM   877  C  C   . LEU A 1 109 ? -7.437  0.946   -15.298 1.00 13.59 ? 284 LEU A C   1 
ATOM   878  O  O   . LEU A 1 109 ? -6.576  0.964   -14.494 1.00 11.77 ? 284 LEU A O   1 
ATOM   879  C  CB  . LEU A 1 109 ? -6.916  -0.562  -17.270 1.00 12.98 ? 284 LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 109 ? -7.004  -2.032  -17.813 1.00 13.05 ? 284 LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 109 ? -6.304  -2.212  -19.233 1.00 12.49 ? 284 LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 109 ? -6.448  -3.086  -16.773 1.00 16.04 ? 284 LEU A CD2 1 
ATOM   883  N  N   . THR A 1 110 ? -8.179  2.030   -15.548 1.00 11.84 ? 285 THR A N   1 
ATOM   884  C  CA  . THR A 1 110 ? -7.928  3.253   -14.707 1.00 11.51 ? 285 THR A CA  1 
ATOM   885  C  C   . THR A 1 110 ? -8.385  3.010   -13.253 1.00 11.17 ? 285 THR A C   1 
ATOM   886  O  O   . THR A 1 110 ? -7.695  3.332   -12.289 1.00 12.69 ? 285 THR A O   1 
ATOM   887  C  CB  . THR A 1 110 ? -8.699  4.431   -15.279 1.00 12.52 ? 285 THR A CB  1 
ATOM   888  O  OG1 . THR A 1 110 ? -8.193  4.686   -16.601 1.00 15.62 ? 285 THR A OG1 1 
ATOM   889  C  CG2 . THR A 1 110 ? -8.637  5.694   -14.338 1.00 11.67 ? 285 THR A CG2 1 
ATOM   890  N  N   . LEU A 1 111 ? -9.554  2.404   -13.078 1.00 12.03 ? 286 LEU A N   1 
ATOM   891  C  CA  . LEU A 1 111 ? -9.994  2.073   -11.701 1.00 12.34 ? 286 LEU A CA  1 
ATOM   892  C  C   . LEU A 1 111 ? -9.074  1.106   -10.993 1.00 10.65 ? 286 LEU A C   1 
ATOM   893  O  O   . LEU A 1 111 ? -8.819  1.299   -9.832  1.00 11.35 ? 286 LEU A O   1 
ATOM   894  C  CB  . LEU A 1 111 ? -11.434 1.513   -11.680 1.00 10.80 ? 286 LEU A CB  1 
ATOM   895  C  CG  . LEU A 1 111 ? -12.536 2.466   -12.185 1.00 15.99 ? 286 LEU A CG  1 
ATOM   896  C  CD1 . LEU A 1 111 ? -13.917 1.726   -12.188 1.00 16.35 ? 286 LEU A CD1 1 
ATOM   897  C  CD2 . LEU A 1 111 ? -12.584 3.767   -11.334 1.00 14.62 ? 286 LEU A CD2 1 
ATOM   898  N  N   . PHE A 1 112 ? -8.620  0.037   -11.670 1.00 11.45 ? 287 PHE A N   1 
ATOM   899  C  CA  . PHE A 1 112 ? -7.772  -0.912  -11.035 1.00 12.06 ? 287 PHE A CA  1 
ATOM   900  C  C   . PHE A 1 112 ? -6.426  -0.227  -10.704 1.00 13.36 ? 287 PHE A C   1 
ATOM   901  O  O   . PHE A 1 112 ? -5.869  -0.485  -9.626  1.00 14.27 ? 287 PHE A O   1 
ATOM   902  C  CB  . PHE A 1 112 ? -7.521  -2.119  -11.986 1.00 12.57 ? 287 PHE A CB  1 
ATOM   903  C  CG  . PHE A 1 112 ? -8.668  -3.145  -12.025 1.00 14.80 ? 287 PHE A CG  1 
ATOM   904  C  CD1 . PHE A 1 112 ? -9.700  -3.108  -11.066 1.00 16.98 ? 287 PHE A CD1 1 
ATOM   905  C  CD2 . PHE A 1 112 ? -8.624  -4.206  -12.942 1.00 14.97 ? 287 PHE A CD2 1 
ATOM   906  C  CE1 . PHE A 1 112 ? -10.703 -4.093  -11.035 1.00 14.45 ? 287 PHE A CE1 1 
ATOM   907  C  CE2 . PHE A 1 112 ? -9.669  -5.185  -12.970 1.00 13.05 ? 287 PHE A CE2 1 
ATOM   908  C  CZ  . PHE A 1 112 ? -10.686 -5.132  -12.037 1.00 15.25 ? 287 PHE A CZ  1 
ATOM   909  N  N   . GLY A 1 113 ? -5.915  0.573   -11.652 1.00 12.09 ? 288 GLY A N   1 
ATOM   910  C  CA  . GLY A 1 113 ? -4.774  1.490   -11.367 1.00 14.12 ? 288 GLY A CA  1 
ATOM   911  C  C   . GLY A 1 113 ? -4.847  2.248   -10.043 1.00 13.12 ? 288 GLY A C   1 
ATOM   912  O  O   . GLY A 1 113 ? -3.959  2.158   -9.187  1.00 14.43 ? 288 GLY A O   1 
ATOM   913  N  N   . PHE A 1 114 ? -5.914  2.996   -9.867  1.00 13.80 ? 289 PHE A N   1 
ATOM   914  C  CA  . PHE A 1 114 ? -6.135  3.718   -8.622  1.00 13.38 ? 289 PHE A CA  1 
ATOM   915  C  C   . PHE A 1 114 ? -6.307  2.804   -7.389  1.00 13.18 ? 289 PHE A C   1 
ATOM   916  O  O   . PHE A 1 114 ? -5.872  3.152   -6.304  1.00 11.77 ? 289 PHE A O   1 
ATOM   917  C  CB  . PHE A 1 114 ? -7.306  4.718   -8.807  1.00 13.32 ? 289 PHE A CB  1 
ATOM   918  C  CG  . PHE A 1 114 ? -6.911  6.000   -9.502  1.00 12.85 ? 289 PHE A CG  1 
ATOM   919  C  CD1 . PHE A 1 114 ? -5.895  6.785   -8.953  1.00 16.35 ? 289 PHE A CD1 1 
ATOM   920  C  CD2 . PHE A 1 114 ? -7.560  6.430   -10.689 1.00 12.83 ? 289 PHE A CD2 1 
ATOM   921  C  CE1 . PHE A 1 114 ? -5.524  8.029   -9.535  1.00 14.94 ? 289 PHE A CE1 1 
ATOM   922  C  CE2 . PHE A 1 114 ? -7.173  7.661   -11.318 1.00 17.55 ? 289 PHE A CE2 1 
ATOM   923  C  CZ  . PHE A 1 114 ? -6.145  8.456   -10.709 1.00 13.07 ? 289 PHE A CZ  1 
ATOM   924  N  N   . LYS A 1 115 ? -6.960  1.652   -7.549  1.00 13.83 ? 290 LYS A N   1 
ATOM   925  C  CA  . LYS A 1 115 ? -7.112  0.709   -6.437  1.00 14.94 ? 290 LYS A CA  1 
ATOM   926  C  C   . LYS A 1 115 ? -5.696  0.290   -5.968  1.00 15.44 ? 290 LYS A C   1 
ATOM   927  O  O   . LYS A 1 115 ? -5.431  0.243   -4.761  1.00 13.25 ? 290 LYS A O   1 
ATOM   928  C  CB  . LYS A 1 115 ? -7.925  -0.495  -6.888  1.00 16.14 ? 290 LYS A CB  1 
ATOM   929  C  CG  . LYS A 1 115 ? -8.212  -1.638  -5.825  1.00 20.50 ? 290 LYS A CG  1 
ATOM   930  C  CD  . LYS A 1 115 ? -8.193  -1.158  -4.408  1.00 22.50 ? 290 LYS A CD  1 
ATOM   931  C  CE  . LYS A 1 115 ? -9.119  -1.960  -3.494  1.00 26.86 ? 290 LYS A CE  1 
ATOM   932  N  NZ  . LYS A 1 115 ? -9.490  -1.200  -2.259  1.00 22.00 ? 290 LYS A NZ  1 
ATOM   933  N  N   . LEU A 1 116 ? -4.810  -0.027  -6.925  1.00 14.64 ? 291 LEU A N   1 
ATOM   934  C  CA  . LEU A 1 116 ? -3.379  -0.319  -6.571  1.00 16.13 ? 291 LEU A CA  1 
ATOM   935  C  C   . LEU A 1 116 ? -2.632  0.864   -5.912  1.00 16.34 ? 291 LEU A C   1 
ATOM   936  O  O   . LEU A 1 116 ? -1.835  0.687   -4.975  1.00 16.23 ? 291 LEU A O   1 
ATOM   937  C  CB  . LEU A 1 116 ? -2.589  -0.785  -7.833  1.00 15.86 ? 291 LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 116 ? -3.002  -2.189  -8.368  1.00 18.03 ? 291 LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 116 ? -2.286  -2.506  -9.682  1.00 15.96 ? 291 LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 116 ? -2.730  -3.252  -7.311  1.00 16.89 ? 291 LEU A CD2 1 
ATOM   941  N  N   . LEU A 1 117 ? -2.895  2.084   -6.386  1.00 15.86 ? 292 LEU A N   1 
ATOM   942  C  CA  . LEU A 1 117 ? -2.197  3.225   -5.884  1.00 15.14 ? 292 LEU A CA  1 
ATOM   943  C  C   . LEU A 1 117 ? -2.679  3.616   -4.472  1.00 16.25 ? 292 LEU A C   1 
ATOM   944  O  O   . LEU A 1 117 ? -1.841  3.974   -3.578  1.00 13.20 ? 292 LEU A O   1 
ATOM   945  C  CB  . LEU A 1 117 ? -2.357  4.381   -6.879  1.00 14.69 ? 292 LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 117 ? -1.606  5.671   -6.579  1.00 15.35 ? 292 LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 117 ? 0.003   5.413   -6.383  1.00 15.50 ? 292 LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 117 ? -1.911  6.755   -7.616  1.00 13.09 ? 292 LEU A CD2 1 
ATOM   949  N  N   . TYR A 1 118 ? -4.004  3.516   -4.252  1.00 14.60 ? 293 TYR A N   1 
ATOM   950  C  CA  . TYR A 1 118 ? -4.598  3.909   -2.959  1.00 15.90 ? 293 TYR A CA  1 
ATOM   951  C  C   . TYR A 1 118 ? -5.507  2.797   -2.343  1.00 16.07 ? 293 TYR A C   1 
ATOM   952  O  O   . TYR A 1 118 ? -6.688  3.010   -2.223  1.00 16.81 ? 293 TYR A O   1 
ATOM   953  C  CB  . TYR A 1 118 ? -5.429  5.223   -3.115  1.00 14.14 ? 293 TYR A CB  1 
ATOM   954  C  CG  . TYR A 1 118 ? -4.642  6.381   -3.723  1.00 15.96 ? 293 TYR A CG  1 
ATOM   955  C  CD1 . TYR A 1 118 ? -3.584  6.957   -3.032  1.00 18.18 ? 293 TYR A CD1 1 
ATOM   956  C  CD2 . TYR A 1 118 ? -4.953  6.873   -4.982  1.00 17.36 ? 293 TYR A CD2 1 
ATOM   957  C  CE1 . TYR A 1 118 ? -2.870  8.025   -3.571  1.00 24.19 ? 293 TYR A CE1 1 
ATOM   958  C  CE2 . TYR A 1 118 ? -4.257  7.928   -5.551  1.00 21.87 ? 293 TYR A CE2 1 
ATOM   959  C  CZ  . TYR A 1 118 ? -3.197  8.497   -4.833  1.00 25.52 ? 293 TYR A CZ  1 
ATOM   960  O  OH  . TYR A 1 118 ? -2.467  9.508   -5.382  1.00 23.86 ? 293 TYR A OH  1 
ATOM   961  N  N   . PRO A 1 119 ? -4.938  1.659   -1.937  1.00 16.87 ? 294 PRO A N   1 
ATOM   962  C  CA  . PRO A 1 119 ? -5.747  0.474   -1.568  1.00 19.16 ? 294 PRO A CA  1 
ATOM   963  C  C   . PRO A 1 119 ? -6.680  0.723   -0.386  1.00 19.79 ? 294 PRO A C   1 
ATOM   964  O  O   . PRO A 1 119 ? -7.805  0.188   -0.350  1.00 21.25 ? 294 PRO A O   1 
ATOM   965  C  CB  . PRO A 1 119 ? -4.724  -0.666  -1.373  1.00 18.62 ? 294 PRO A CB  1 
ATOM   966  C  CG  . PRO A 1 119 ? -3.417  0.025   -1.257  1.00 17.50 ? 294 PRO A CG  1 
ATOM   967  C  CD  . PRO A 1 119 ? -3.487  1.416   -1.847  1.00 17.55 ? 294 PRO A CD  1 
ATOM   968  N  N   . ASP A 1 120 ? -6.304  1.617   0.500   1.00 20.30 ? 295 ASP A N   1 
ATOM   969  C  CA  . ASP A 1 120 ? -7.215  1.882   1.643   1.00 22.38 ? 295 ASP A CA  1 
ATOM   970  C  C   . ASP A 1 120 ? -8.137  3.041   1.414   1.00 22.17 ? 295 ASP A C   1 
ATOM   971  O  O   . ASP A 1 120 ? -8.942  3.343   2.274   1.00 22.70 ? 295 ASP A O   1 
ATOM   972  C  CB  . ASP A 1 120 ? -6.403  2.121   2.915   1.00 23.62 ? 295 ASP A CB  1 
ATOM   973  C  CG  . ASP A 1 120 ? -5.424  0.964   3.195   1.00 28.00 ? 295 ASP A CG  1 
ATOM   974  O  OD1 . ASP A 1 120 ? -5.829  -0.201  3.007   1.00 33.07 ? 295 ASP A OD1 1 
ATOM   975  O  OD2 . ASP A 1 120 ? -4.261  1.223   3.540   1.00 32.05 ? 295 ASP A OD2 1 
ATOM   976  N  N   . HIS A 1 121 ? -8.010  3.712   0.264   1.00 21.22 ? 296 HIS A N   1 
ATOM   977  C  CA  . HIS A 1 121 ? -8.814  4.932   0.016   1.00 20.71 ? 296 HIS A CA  1 
ATOM   978  C  C   . HIS A 1 121 ? -9.602  4.906   -1.306  1.00 19.73 ? 296 HIS A C   1 
ATOM   979  O  O   . HIS A 1 121 ? -10.276 5.870   -1.654  1.00 18.38 ? 296 HIS A O   1 
ATOM   980  C  CB  . HIS A 1 121 ? -7.911  6.196   0.145   1.00 21.39 ? 296 HIS A CB  1 
ATOM   981  C  CG  . HIS A 1 121 ? -7.434  6.416   1.539   1.00 25.17 ? 296 HIS A CG  1 
ATOM   982  N  ND1 . HIS A 1 121 ? -6.237  5.915   2.003   1.00 26.17 ? 296 HIS A ND1 1 
ATOM   983  C  CD2 . HIS A 1 121 ? -8.062  6.957   2.611   1.00 24.40 ? 296 HIS A CD2 1 
ATOM   984  C  CE1 . HIS A 1 121 ? -6.127  6.184   3.287   1.00 26.34 ? 296 HIS A CE1 1 
ATOM   985  N  NE2 . HIS A 1 121 ? -7.228  6.798   3.683   1.00 25.78 ? 296 HIS A NE2 1 
ATOM   986  N  N   . PHE A 1 122 ? -9.495  3.807   -2.050  1.00 18.38 ? 297 PHE A N   1 
ATOM   987  C  CA  . PHE A 1 122 ? -10.136 3.690   -3.312  1.00 16.23 ? 297 PHE A CA  1 
ATOM   988  C  C   . PHE A 1 122 ? -10.728 2.281   -3.350  1.00 18.10 ? 297 PHE A C   1 
ATOM   989  O  O   . PHE A 1 122 ? -9.979  1.249   -3.346  1.00 18.95 ? 297 PHE A O   1 
ATOM   990  C  CB  . PHE A 1 122 ? -9.120  3.886   -4.436  1.00 17.55 ? 297 PHE A CB  1 
ATOM   991  C  CG  . PHE A 1 122 ? -9.742  4.138   -5.736  1.00 14.97 ? 297 PHE A CG  1 
ATOM   992  C  CD1 . PHE A 1 122 ? -10.112 5.448   -6.117  1.00 16.07 ? 297 PHE A CD1 1 
ATOM   993  C  CD2 . PHE A 1 122 ? -10.014 3.066   -6.617  1.00 16.51 ? 297 PHE A CD2 1 
ATOM   994  C  CE1 . PHE A 1 122 ? -10.730 5.650   -7.345  1.00 14.83 ? 297 PHE A CE1 1 
ATOM   995  C  CE2 . PHE A 1 122 ? -10.614 3.280   -7.807  1.00 14.81 ? 297 PHE A CE2 1 
ATOM   996  C  CZ  . PHE A 1 122 ? -11.002 4.555   -8.178  1.00 15.76 ? 297 PHE A CZ  1 
ATOM   997  N  N   . HIS A 1 123 ? -12.052 2.248   -3.355  1.00 16.32 ? 298 HIS A N   1 
ATOM   998  C  CA  . HIS A 1 123 ? -12.860 1.041   -3.149  1.00 15.74 ? 298 HIS A CA  1 
ATOM   999  C  C   . HIS A 1 123 ? -13.711 0.730   -4.373  1.00 14.63 ? 298 HIS A C   1 
ATOM   1000 O  O   . HIS A 1 123 ? -14.364 1.631   -4.965  1.00 13.86 ? 298 HIS A O   1 
ATOM   1001 C  CB  . HIS A 1 123 ? -13.743 1.159   -1.884  1.00 14.23 ? 298 HIS A CB  1 
ATOM   1002 C  CG  . HIS A 1 123 ? -12.968 1.539   -0.666  1.00 18.54 ? 298 HIS A CG  1 
ATOM   1003 N  ND1 . HIS A 1 123 ? -12.836 2.857   -0.265  1.00 21.00 ? 298 HIS A ND1 1 
ATOM   1004 C  CD2 . HIS A 1 123 ? -12.188 0.812   0.169   1.00 17.03 ? 298 HIS A CD2 1 
ATOM   1005 C  CE1 . HIS A 1 123 ? -12.091 2.911   0.812   1.00 12.33 ? 298 HIS A CE1 1 
ATOM   1006 N  NE2 . HIS A 1 123 ? -11.694 1.683   1.106   1.00 22.58 ? 298 HIS A NE2 1 
ATOM   1007 N  N   . LEU A 1 124 ? -13.669 -0.546  -4.778  1.00 11.36 ? 299 LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 124 ? -14.479 -1.018  -5.883  1.00 10.18 ? 299 LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 124 ? -15.398 -2.158  -5.354  1.00 11.63 ? 299 LEU A C   1 
ATOM   1010 O  O   . LEU A 1 124 ? -14.911 -3.091  -4.749  1.00 11.82 ? 299 LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 124 ? -13.603 -1.542  -7.052  1.00 8.32  ? 299 LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 124 ? -12.498 -0.579  -7.562  1.00 12.16 ? 299 LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 124 ? -11.621 -1.335  -8.662  1.00 7.96  ? 299 LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 124 ? -13.203 0.588   -8.215  1.00 10.77 ? 299 LEU A CD2 1 
ATOM   1015 N  N   . LEU A 1 125 ? -16.693 -2.092  -5.651  1.00 11.09 ? 300 LEU A N   1 
ATOM   1016 C  CA  . LEU A 1 125 ? -17.620 -3.154  -5.300  1.00 11.02 ? 300 LEU A CA  1 
ATOM   1017 C  C   . LEU A 1 125 ? -18.062 -3.772  -6.622  1.00 12.47 ? 300 LEU A C   1 
ATOM   1018 O  O   . LEU A 1 125 ? -18.162 -3.108  -7.691  1.00 14.18 ? 300 LEU A O   1 
ATOM   1019 C  CB  . LEU A 1 125 ? -18.878 -2.574  -4.547  1.00 9.91  ? 300 LEU A CB  1 
ATOM   1020 C  CG  . LEU A 1 125 ? -18.476 -1.760  -3.334  1.00 11.62 ? 300 LEU A CG  1 
ATOM   1021 C  CD1 . LEU A 1 125 ? -19.744 -1.270  -2.565  1.00 13.50 ? 300 LEU A CD1 1 
ATOM   1022 C  CD2 . LEU A 1 125 ? -17.569 -2.543  -2.294  1.00 12.38 ? 300 LEU A CD2 1 
ATOM   1023 N  N   . ARG A 1 126 ? -18.359 -5.064  -6.549  1.00 13.08 ? 301 ARG A N   1 
ATOM   1024 C  CA  . ARG A 1 126 ? -18.860 -5.789  -7.676  1.00 12.17 ? 301 ARG A CA  1 
ATOM   1025 C  C   . ARG A 1 126 ? -20.311 -5.397  -8.005  1.00 12.99 ? 301 ARG A C   1 
ATOM   1026 O  O   . ARG A 1 126 ? -21.136 -5.262  -7.122  1.00 14.44 ? 301 ARG A O   1 
ATOM   1027 C  CB  . ARG A 1 126 ? -18.794 -7.279  -7.337  1.00 11.78 ? 301 ARG A CB  1 
ATOM   1028 C  CG  . ARG A 1 126 ? -18.792 -8.104  -8.575  1.00 11.61 ? 301 ARG A CG  1 
ATOM   1029 C  CD  . ARG A 1 126 ? -18.462 -9.569  -8.255  1.00 10.36 ? 301 ARG A CD  1 
ATOM   1030 N  NE  . ARG A 1 126 ? -18.377 -10.334 -9.515  1.00 12.30 ? 301 ARG A NE  1 
ATOM   1031 C  CZ  . ARG A 1 126 ? -18.255 -11.685 -9.536  1.00 10.99 ? 301 ARG A CZ  1 
ATOM   1032 N  NH1 . ARG A 1 126 ? -18.284 -12.337 -8.390  1.00 12.12 ? 301 ARG A NH1 1 
ATOM   1033 N  NH2 . ARG A 1 126 ? -18.245 -12.359 -10.701 1.00 13.58 ? 301 ARG A NH2 1 
ATOM   1034 N  N   . GLY A 1 127 ? -20.590 -5.243  -9.281  1.00 12.96 ? 302 GLY A N   1 
ATOM   1035 C  CA  . GLY A 1 127 ? -21.912 -5.089  -9.815  1.00 14.46 ? 302 GLY A CA  1 
ATOM   1036 C  C   . GLY A 1 127 ? -22.313 -6.373  -10.604 1.00 13.78 ? 302 GLY A C   1 
ATOM   1037 O  O   . GLY A 1 127 ? -21.502 -7.241  -10.831 1.00 14.35 ? 302 GLY A O   1 
ATOM   1038 N  N   . ASN A 1 128 ? -23.544 -6.436  -11.067 1.00 13.19 ? 303 ASN A N   1 
ATOM   1039 C  CA  . ASN A 1 128 ? -23.989 -7.549  -11.872 1.00 13.00 ? 303 ASN A CA  1 
ATOM   1040 C  C   . ASN A 1 128 ? -23.328 -7.627  -13.279 1.00 13.29 ? 303 ASN A C   1 
ATOM   1041 O  O   . ASN A 1 128 ? -23.285 -8.683  -13.889 1.00 12.81 ? 303 ASN A O   1 
ATOM   1042 C  CB  . ASN A 1 128 ? -25.548 -7.573  -11.957 1.00 12.42 ? 303 ASN A CB  1 
ATOM   1043 C  CG  . ASN A 1 128 ? -26.085 -6.418  -12.750 1.00 11.61 ? 303 ASN A CG  1 
ATOM   1044 O  OD1 . ASN A 1 128 ? -25.807 -5.267  -12.400 1.00 14.39 ? 303 ASN A OD1 1 
ATOM   1045 N  ND2 . ASN A 1 128 ? -26.912 -6.678  -13.731 1.00 14.92 ? 303 ASN A ND2 1 
ATOM   1046 N  N   . HIS A 1 129 ? -22.753 -6.524  -13.768 1.00 13.89 ? 304 HIS A N   1 
ATOM   1047 C  CA  . HIS A 1 129 ? -22.024 -6.563  -15.030 1.00 14.71 ? 304 HIS A CA  1 
ATOM   1048 C  C   . HIS A 1 129 ? -20.533 -6.909  -14.868 1.00 16.21 ? 304 HIS A C   1 
ATOM   1049 O  O   . HIS A 1 129 ? -19.785 -6.853  -15.846 1.00 20.38 ? 304 HIS A O   1 
ATOM   1050 C  CB  . HIS A 1 129 ? -22.189 -5.223  -15.807 1.00 14.75 ? 304 HIS A CB  1 
ATOM   1051 C  CG  . HIS A 1 129 ? -23.479 -5.140  -16.535 1.00 15.46 ? 304 HIS A CG  1 
ATOM   1052 N  ND1 . HIS A 1 129 ? -23.609 -5.517  -17.858 1.00 17.17 ? 304 HIS A ND1 1 
ATOM   1053 C  CD2 . HIS A 1 129 ? -24.724 -4.804  -16.106 1.00 14.47 ? 304 HIS A CD2 1 
ATOM   1054 C  CE1 . HIS A 1 129 ? -24.875 -5.375  -18.220 1.00 16.51 ? 304 HIS A CE1 1 
ATOM   1055 N  NE2 . HIS A 1 129 ? -25.569 -4.952  -17.172 1.00 16.32 ? 304 HIS A NE2 1 
ATOM   1056 N  N   . GLU A 1 130 ? -20.067 -7.203  -13.670 1.00 14.77 ? 305 GLU A N   1 
ATOM   1057 C  CA  . GLU A 1 130 ? -18.705 -7.770  -13.524 1.00 16.11 ? 305 GLU A CA  1 
ATOM   1058 C  C   . GLU A 1 130 ? -18.843 -9.290  -13.382 1.00 15.30 ? 305 GLU A C   1 
ATOM   1059 O  O   . GLU A 1 130 ? -18.402 -9.867  -12.410 1.00 14.70 ? 305 GLU A O   1 
ATOM   1060 C  CB  . GLU A 1 130 ? -17.943 -7.171  -12.322 1.00 14.24 ? 305 GLU A CB  1 
ATOM   1061 C  CG  . GLU A 1 130 ? -17.348 -5.736  -12.627 1.00 17.86 ? 305 GLU A CG  1 
ATOM   1062 C  CD  . GLU A 1 130 ? -18.441 -4.669  -12.653 1.00 19.97 ? 305 GLU A CD  1 
ATOM   1063 O  OE1 . GLU A 1 130 ? -19.230 -4.612  -11.650 1.00 22.19 ? 305 GLU A OE1 1 
ATOM   1064 O  OE2 . GLU A 1 130 ? -18.504 -3.909  -13.681 1.00 21.00 ? 305 GLU A OE2 1 
ATOM   1065 N  N   . THR A 1 131 ? -19.540 -9.879  -14.343 1.00 15.68 ? 306 THR A N   1 
ATOM   1066 C  CA  . THR A 1 131 ? -19.828 -11.321 -14.420 1.00 16.10 ? 306 THR A CA  1 
ATOM   1067 C  C   . THR A 1 131 ? -19.702 -11.787 -15.873 1.00 16.13 ? 306 THR A C   1 
ATOM   1068 O  O   . THR A 1 131 ? -19.847 -11.006 -16.810 1.00 15.34 ? 306 THR A O   1 
ATOM   1069 C  CB  . THR A 1 131 ? -21.237 -11.693 -13.832 1.00 16.81 ? 306 THR A CB  1 
ATOM   1070 O  OG1 . THR A 1 131 ? -22.261 -11.007 -14.579 1.00 15.65 ? 306 THR A OG1 1 
ATOM   1071 C  CG2 . THR A 1 131 ? -21.316 -11.226 -12.414 1.00 15.40 ? 306 THR A CG2 1 
ATOM   1072 N  N   . ASP A 1 132 ? -19.370 -13.059 -16.057 1.00 18.07 ? 307 ASP A N   1 
ATOM   1073 C  CA  . ASP A 1 132 ? -19.206 -13.585 -17.441 1.00 19.84 ? 307 ASP A CA  1 
ATOM   1074 C  C   . ASP A 1 132 ? -20.445 -13.499 -18.334 1.00 19.54 ? 307 ASP A C   1 
ATOM   1075 O  O   . ASP A 1 132 ? -20.337 -13.089 -19.481 1.00 17.19 ? 307 ASP A O   1 
ATOM   1076 C  CB  . ASP A 1 132 ? -18.754 -15.064 -17.413 1.00 21.10 ? 307 ASP A CB  1 
ATOM   1077 C  CG  . ASP A 1 132 ? -17.403 -15.230 -16.777 1.00 24.05 ? 307 ASP A CG  1 
ATOM   1078 O  OD1 . ASP A 1 132 ? -16.720 -14.164 -16.532 1.00 23.41 ? 307 ASP A OD1 1 
ATOM   1079 O  OD2 . ASP A 1 132 ? -17.037 -16.416 -16.491 1.00 25.01 ? 307 ASP A OD2 1 
ATOM   1080 N  N   . ASN A 1 133 ? -21.582 -13.988 -17.837 1.00 19.31 ? 308 ASN A N   1 
ATOM   1081 C  CA  . ASN A 1 133 ? -22.835 -13.926 -18.554 1.00 20.00 ? 308 ASN A CA  1 
ATOM   1082 C  C   . ASN A 1 133 ? -23.126 -12.553 -19.170 1.00 19.90 ? 308 ASN A C   1 
ATOM   1083 O  O   . ASN A 1 133 ? -23.498 -12.428 -20.348 1.00 18.50 ? 308 ASN A O   1 
ATOM   1084 C  CB  . ASN A 1 133 ? -23.982 -14.164 -17.550 1.00 22.64 ? 308 ASN A CB  1 
ATOM   1085 C  CG  . ASN A 1 133 ? -24.243 -15.617 -17.317 1.00 27.98 ? 308 ASN A CG  1 
ATOM   1086 O  OD1 . ASN A 1 133 ? -23.614 -16.487 -17.934 1.00 30.01 ? 308 ASN A OD1 1 
ATOM   1087 N  ND2 . ASN A 1 133 ? -25.151 -15.905 -16.397 1.00 35.81 ? 308 ASN A ND2 1 
ATOM   1088 N  N   . MET A 1 134 ? -23.076 -11.536 -18.331 1.00 17.17 ? 309 MET A N   1 
ATOM   1089 C  CA  . MET A 1 134 ? -23.295 -10.206 -18.797 1.00 18.24 ? 309 MET A CA  1 
ATOM   1090 C  C   . MET A 1 134 ? -22.206 -9.772  -19.765 1.00 17.63 ? 309 MET A C   1 
ATOM   1091 O  O   . MET A 1 134 ? -22.518 -9.197  -20.803 1.00 19.12 ? 309 MET A O   1 
ATOM   1092 C  CB  . MET A 1 134 ? -23.351 -9.261  -17.617 1.00 17.29 ? 309 MET A CB  1 
ATOM   1093 C  CG  . MET A 1 134 ? -24.537 -9.588  -16.720 1.00 21.86 ? 309 MET A CG  1 
ATOM   1094 S  SD  . MET A 1 134 ? -26.123 -9.119  -17.428 1.00 26.85 ? 309 MET A SD  1 
ATOM   1095 C  CE  . MET A 1 134 ? -26.706 -10.698 -17.852 1.00 25.05 ? 309 MET A CE  1 
ATOM   1096 N  N   . ASN A 1 135 ? -20.930 -10.044 -19.450 1.00 18.93 ? 310 ASN A N   1 
ATOM   1097 C  CA  . ASN A 1 135 ? -19.830 -9.539  -20.307 1.00 19.11 ? 310 ASN A CA  1 
ATOM   1098 C  C   . ASN A 1 135 ? -19.895 -10.091 -21.721 1.00 21.03 ? 310 ASN A C   1 
ATOM   1099 O  O   . ASN A 1 135 ? -19.509 -9.422  -22.663 1.00 19.27 ? 310 ASN A O   1 
ATOM   1100 C  CB  . ASN A 1 135 ? -18.445 -9.844  -19.711 1.00 19.43 ? 310 ASN A CB  1 
ATOM   1101 C  CG  . ASN A 1 135 ? -18.152 -9.038  -18.499 1.00 17.84 ? 310 ASN A CG  1 
ATOM   1102 O  OD1 . ASN A 1 135 ? -17.201 -9.340  -17.776 1.00 19.44 ? 310 ASN A OD1 1 
ATOM   1103 N  ND2 . ASN A 1 135 ? -18.921 -7.992  -18.270 1.00 17.05 ? 310 ASN A ND2 1 
ATOM   1104 N  N   . GLN A 1 136 ? -20.413 -11.318 -21.850 1.00 22.88 ? 311 GLN A N   1 
ATOM   1105 C  CA  . GLN A 1 136 ? -20.408 -12.006 -23.120 1.00 25.20 ? 311 GLN A CA  1 
ATOM   1106 C  C   . GLN A 1 136 ? -21.428 -11.356 -24.052 1.00 24.52 ? 311 GLN A C   1 
ATOM   1107 O  O   . GLN A 1 136 ? -21.172 -11.262 -25.238 1.00 24.89 ? 311 GLN A O   1 
ATOM   1108 C  CB  . GLN A 1 136 ? -20.637 -13.513 -22.926 1.00 25.92 ? 311 GLN A CB  1 
ATOM   1109 C  CG  . GLN A 1 136 ? -20.011 -14.116 -21.624 1.00 34.25 ? 311 GLN A CG  1 
ATOM   1110 C  CD  . GLN A 1 136 ? -18.457 -14.273 -21.609 1.00 44.07 ? 311 GLN A CD  1 
ATOM   1111 O  OE1 . GLN A 1 136 ? -17.801 -14.121 -22.651 1.00 49.32 ? 311 GLN A OE1 1 
ATOM   1112 N  NE2 . GLN A 1 136 ? -17.876 -14.586 -20.429 1.00 43.56 ? 311 GLN A NE2 1 
ATOM   1113 N  N   . ILE A 1 137 ? -22.534 -10.843 -23.492 1.00 23.10 ? 312 ILE A N   1 
ATOM   1114 C  CA  . ILE A 1 137 ? -23.613 -10.206 -24.240 1.00 22.76 ? 312 ILE A CA  1 
ATOM   1115 C  C   . ILE A 1 137 ? -23.437 -8.694  -24.416 1.00 22.02 ? 312 ILE A C   1 
ATOM   1116 O  O   . ILE A 1 137 ? -23.762 -8.169  -25.472 1.00 21.66 ? 312 ILE A O   1 
ATOM   1117 C  CB  . ILE A 1 137 ? -24.978 -10.333 -23.459 1.00 23.18 ? 312 ILE A CB  1 
ATOM   1118 C  CG1 . ILE A 1 137 ? -25.572 -11.715 -23.501 1.00 29.57 ? 312 ILE A CG1 1 
ATOM   1119 C  CG2 . ILE A 1 137 ? -26.025 -9.390  -23.974 1.00 23.89 ? 312 ILE A CG2 1 
ATOM   1120 C  CD1 . ILE A 1 137 ? -26.602 -11.892 -22.351 1.00 31.33 ? 312 ILE A CD1 1 
ATOM   1121 N  N   . TYR A 1 138 ? -22.949 -7.983  -23.387 1.00 20.58 ? 313 TYR A N   1 
ATOM   1122 C  CA  . TYR A 1 138 ? -23.151 -6.517  -23.378 1.00 20.01 ? 313 TYR A CA  1 
ATOM   1123 C  C   . TYR A 1 138 ? -21.934 -5.701  -23.768 1.00 19.34 ? 313 TYR A C   1 
ATOM   1124 O  O   . TYR A 1 138 ? -21.891 -4.505  -23.547 1.00 20.49 ? 313 TYR A O   1 
ATOM   1125 C  CB  . TYR A 1 138 ? -23.709 -6.070  -22.003 1.00 19.48 ? 313 TYR A CB  1 
ATOM   1126 C  CG  . TYR A 1 138 ? -25.148 -6.445  -21.847 1.00 21.77 ? 313 TYR A CG  1 
ATOM   1127 C  CD1 . TYR A 1 138 ? -26.128 -5.689  -22.470 1.00 26.31 ? 313 TYR A CD1 1 
ATOM   1128 C  CD2 . TYR A 1 138 ? -25.540 -7.542  -21.071 1.00 23.13 ? 313 TYR A CD2 1 
ATOM   1129 C  CE1 . TYR A 1 138 ? -27.474 -5.996  -22.302 1.00 27.44 ? 313 TYR A CE1 1 
ATOM   1130 C  CE2 . TYR A 1 138 ? -26.869 -7.850  -20.892 1.00 23.10 ? 313 TYR A CE2 1 
ATOM   1131 C  CZ  . TYR A 1 138 ? -27.823 -7.079  -21.521 1.00 29.17 ? 313 TYR A CZ  1 
ATOM   1132 O  OH  . TYR A 1 138 ? -29.165 -7.351  -21.401 1.00 31.91 ? 313 TYR A OH  1 
ATOM   1133 N  N   . GLY A 1 139 ? -20.923 -6.337  -24.344 1.00 19.22 ? 314 GLY A N   1 
ATOM   1134 C  CA  . GLY A 1 139 ? -19.810 -5.579  -24.883 1.00 18.19 ? 314 GLY A CA  1 
ATOM   1135 C  C   . GLY A 1 139 ? -18.420 -5.769  -24.314 1.00 18.30 ? 314 GLY A C   1 
ATOM   1136 O  O   . GLY A 1 139 ? -17.458 -5.658  -25.082 1.00 16.94 ? 314 GLY A O   1 
ATOM   1137 N  N   . PHE A 1 140 ? -18.275 -6.059  -23.010 1.00 16.86 ? 315 PHE A N   1 
ATOM   1138 C  CA  . PHE A 1 140 ? -16.928 -6.045  -22.389 1.00 16.97 ? 315 PHE A CA  1 
ATOM   1139 C  C   . PHE A 1 140 ? -16.009 -7.175  -22.920 1.00 18.37 ? 315 PHE A C   1 
ATOM   1140 O  O   . PHE A 1 140 ? -14.812 -6.940  -23.207 1.00 16.14 ? 315 PHE A O   1 
ATOM   1141 C  CB  . PHE A 1 140 ? -16.956 -6.106  -20.841 1.00 18.15 ? 315 PHE A CB  1 
ATOM   1142 C  CG  . PHE A 1 140 ? -15.565 -6.038  -20.207 1.00 16.31 ? 315 PHE A CG  1 
ATOM   1143 C  CD1 . PHE A 1 140 ? -14.698 -4.967  -20.528 1.00 15.09 ? 315 PHE A CD1 1 
ATOM   1144 C  CD2 . PHE A 1 140 ? -15.119 -7.048  -19.365 1.00 15.31 ? 315 PHE A CD2 1 
ATOM   1145 C  CE1 . PHE A 1 140 ? -13.448 -4.869  -19.968 1.00 14.39 ? 315 PHE A CE1 1 
ATOM   1146 C  CE2 . PHE A 1 140 ? -13.859 -6.971  -18.796 1.00 18.11 ? 315 PHE A CE2 1 
ATOM   1147 C  CZ  . PHE A 1 140 ? -13.012 -5.854  -19.099 1.00 13.75 ? 315 PHE A CZ  1 
ATOM   1148 N  N   . GLU A 1 141 ? -16.553 -8.391  -22.993 1.00 17.35 ? 316 GLU A N   1 
ATOM   1149 C  CA  . GLU A 1 141 ? -15.754 -9.504  -23.563 1.00 19.45 ? 316 GLU A CA  1 
ATOM   1150 C  C   . GLU A 1 141 ? -15.322 -9.219  -24.996 1.00 18.89 ? 316 GLU A C   1 
ATOM   1151 O  O   . GLU A 1 141 ? -14.122 -9.450  -25.358 1.00 19.98 ? 316 GLU A O   1 
ATOM   1152 C  CB  . GLU A 1 141 ? -16.496 -10.832 -23.560 1.00 19.87 ? 316 GLU A CB  1 
ATOM   1153 C  CG  . GLU A 1 141 ? -15.564 -11.964 -24.043 1.00 25.06 ? 316 GLU A CG  1 
ATOM   1154 C  CD  . GLU A 1 141 ? -16.293 -13.315 -24.227 1.00 33.10 ? 316 GLU A CD  1 
ATOM   1155 O  OE1 . GLU A 1 141 ? -17.510 -13.300 -24.495 1.00 36.51 ? 316 GLU A OE1 1 
ATOM   1156 O  OE2 . GLU A 1 141 ? -15.635 -14.393 -24.145 1.00 34.80 ? 316 GLU A OE2 1 
ATOM   1157 N  N   . GLY A 1 142 ? -16.287 -8.748  -25.803 1.00 18.14 ? 317 GLY A N   1 
ATOM   1158 C  CA  . GLY A 1 142 ? -16.035 -8.273  -27.180 1.00 18.09 ? 317 GLY A CA  1 
ATOM   1159 C  C   . GLY A 1 142 ? -14.942 -7.241  -27.251 1.00 19.56 ? 317 GLY A C   1 
ATOM   1160 O  O   . GLY A 1 142 ? -13.992 -7.294  -28.102 1.00 17.08 ? 317 GLY A O   1 
ATOM   1161 N  N   . GLU A 1 143 ? -15.040 -6.269  -26.354 1.00 18.39 ? 318 GLU A N   1 
ATOM   1162 C  CA  . GLU A 1 143 ? -14.043 -5.220  -26.334 1.00 18.32 ? 318 GLU A CA  1 
ATOM   1163 C  C   . GLU A 1 143 ? -12.606 -5.693  -25.972 1.00 19.36 ? 318 GLU A C   1 
ATOM   1164 O  O   . GLU A 1 143 ? -11.628 -5.283  -26.637 1.00 18.32 ? 318 GLU A O   1 
ATOM   1165 C  CB  . GLU A 1 143 ? -14.522 -4.035  -25.447 1.00 18.99 ? 318 GLU A CB  1 
ATOM   1166 C  CG  . GLU A 1 143 ? -13.488 -2.926  -25.299 1.00 22.73 ? 318 GLU A CG  1 
ATOM   1167 C  CD  . GLU A 1 143 ? -14.003 -1.671  -24.545 1.00 25.61 ? 318 GLU A CD  1 
ATOM   1168 O  OE1 . GLU A 1 143 ? -15.228 -1.621  -24.195 1.00 26.07 ? 318 GLU A OE1 1 
ATOM   1169 O  OE2 . GLU A 1 143 ? -13.179 -0.727  -24.323 1.00 23.47 ? 318 GLU A OE2 1 
ATOM   1170 N  N   . VAL A 1 144 ? -12.480 -6.534  -24.932 1.00 17.45 ? 319 VAL A N   1 
ATOM   1171 C  CA  . VAL A 1 144 ? -11.217 -7.107  -24.522 1.00 18.65 ? 319 VAL A CA  1 
ATOM   1172 C  C   . VAL A 1 144 ? -10.621 -7.999  -25.624 1.00 20.36 ? 319 VAL A C   1 
ATOM   1173 O  O   . VAL A 1 144 ? -9.393  -7.944  -25.844 1.00 19.98 ? 319 VAL A O   1 
ATOM   1174 C  CB  . VAL A 1 144 ? -11.333 -7.910  -23.173 1.00 17.29 ? 319 VAL A CB  1 
ATOM   1175 C  CG1 . VAL A 1 144 ? -9.964  -8.554  -22.710 1.00 16.08 ? 319 VAL A CG1 1 
ATOM   1176 C  CG2 . VAL A 1 144 ? -11.785 -6.929  -22.040 1.00 17.61 ? 319 VAL A CG2 1 
ATOM   1177 N  N   . LYS A 1 145 ? -11.451 -8.818  -26.263 1.00 21.44 ? 320 LYS A N   1 
ATOM   1178 C  CA  . LYS A 1 145 ? -10.964 -9.729  -27.314 1.00 23.67 ? 320 LYS A CA  1 
ATOM   1179 C  C   . LYS A 1 145 ? -10.449 -8.870  -28.483 1.00 23.80 ? 320 LYS A C   1 
ATOM   1180 O  O   . LYS A 1 145 ? -9.434  -9.199  -29.080 1.00 24.66 ? 320 LYS A O   1 
ATOM   1181 C  CB  . LYS A 1 145 ? -12.070 -10.647 -27.822 1.00 22.29 ? 320 LYS A CB  1 
ATOM   1182 C  CG  . LYS A 1 145 ? -12.347 -11.812 -26.918 1.00 26.90 ? 320 LYS A CG  1 
ATOM   1183 C  CD  . LYS A 1 145 ? -13.432 -12.675 -27.547 1.00 33.24 ? 320 LYS A CD  1 
ATOM   1184 C  CE  . LYS A 1 145 ? -13.623 -13.951 -26.762 1.00 38.55 ? 320 LYS A CE  1 
ATOM   1185 N  NZ  . LYS A 1 145 ? -14.264 -14.988 -27.657 1.00 44.42 ? 320 LYS A NZ  1 
ATOM   1186 N  N   . ALA A 1 146 ? -11.140 -7.775  -28.790 1.00 22.86 ? 321 ALA A N   1 
ATOM   1187 C  CA  . ALA A 1 146 ? -10.682 -6.843  -29.811 1.00 24.18 ? 321 ALA A CA  1 
ATOM   1188 C  C   . ALA A 1 146 ? -9.372  -6.101  -29.485 1.00 25.22 ? 321 ALA A C   1 
ATOM   1189 O  O   . ALA A 1 146 ? -8.549  -5.834  -30.383 1.00 25.55 ? 321 ALA A O   1 
ATOM   1190 C  CB  . ALA A 1 146 ? -11.786 -5.836  -30.130 1.00 23.55 ? 321 ALA A CB  1 
ATOM   1191 N  N   . LYS A 1 147 ? -9.203  -5.661  -28.249 1.00 24.41 ? 322 LYS A N   1 
ATOM   1192 C  CA  . LYS A 1 147 ? -8.024  -4.886  -27.917 1.00 24.65 ? 322 LYS A CA  1 
ATOM   1193 C  C   . LYS A 1 147 ? -6.888  -5.755  -27.447 1.00 24.47 ? 322 LYS A C   1 
ATOM   1194 O  O   . LYS A 1 147 ? -5.726  -5.306  -27.494 1.00 26.25 ? 322 LYS A O   1 
ATOM   1195 C  CB  . LYS A 1 147 ? -8.319  -3.803  -26.843 1.00 24.48 ? 322 LYS A CB  1 
ATOM   1196 C  CG  . LYS A 1 147 ? -9.403  -2.815  -27.335 1.00 24.04 ? 322 LYS A CG  1 
ATOM   1197 C  CD  . LYS A 1 147 ? -9.806  -1.741  -26.295 1.00 21.27 ? 322 LYS A CD  1 
ATOM   1198 C  CE  . LYS A 1 147 ? -10.689 -0.733  -27.035 1.00 24.73 ? 322 LYS A CE  1 
ATOM   1199 N  NZ  . LYS A 1 147 ? -11.389 0.279   -26.196 1.00 25.05 ? 322 LYS A NZ  1 
ATOM   1200 N  N   . TYR A 1 148 ? -7.198  -6.947  -26.932 1.00 23.06 ? 323 TYR A N   1 
ATOM   1201 C  CA  . TYR A 1 148 ? -6.158  -7.822  -26.350 1.00 23.37 ? 323 TYR A CA  1 
ATOM   1202 C  C   . TYR A 1 148 ? -6.352  -9.240  -26.849 1.00 24.12 ? 323 TYR A C   1 
ATOM   1203 O  O   . TYR A 1 148 ? -6.134  -9.495  -28.030 1.00 25.59 ? 323 TYR A O   1 
ATOM   1204 C  CB  . TYR A 1 148 ? -6.179  -7.795  -24.824 1.00 22.42 ? 323 TYR A CB  1 
ATOM   1205 C  CG  . TYR A 1 148 ? -5.698  -6.495  -24.276 1.00 23.01 ? 323 TYR A CG  1 
ATOM   1206 C  CD1 . TYR A 1 148 ? -4.403  -6.115  -24.448 1.00 18.01 ? 323 TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A 1 148 ? -6.571  -5.610  -23.623 1.00 22.10 ? 323 TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A 1 148 ? -3.939  -4.934  -23.924 1.00 21.08 ? 323 TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A 1 148 ? -6.115  -4.415  -23.110 1.00 22.03 ? 323 TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A 1 148 ? -4.795  -4.076  -23.279 1.00 21.81 ? 323 TYR A CZ  1 
ATOM   1211 O  OH  . TYR A 1 148 ? -4.306  -2.890  -22.775 1.00 19.26 ? 323 TYR A OH  1 
ATOM   1212 N  N   . THR A 1 149 ? -6.752  -10.157 -25.981 1.00 22.61 ? 324 THR A N   1 
ATOM   1213 C  CA  . THR A 1 149 ? -7.044  -11.508 -26.451 1.00 23.59 ? 324 THR A CA  1 
ATOM   1214 C  C   . THR A 1 149 ? -8.064  -12.158 -25.534 1.00 23.21 ? 324 THR A C   1 
ATOM   1215 O  O   . THR A 1 149 ? -8.460  -11.579 -24.512 1.00 22.21 ? 324 THR A O   1 
ATOM   1216 C  CB  . THR A 1 149 ? -5.788  -12.424 -26.386 1.00 23.07 ? 324 THR A CB  1 
ATOM   1217 O  OG1 . THR A 1 149 ? -5.338  -12.509 -25.031 1.00 22.99 ? 324 THR A OG1 1 
ATOM   1218 C  CG2 . THR A 1 149 ? -4.630  -11.880 -27.383 1.00 24.93 ? 324 THR A CG2 1 
ATOM   1219 N  N   . ALA A 1 150 ? -8.477  -13.364 -25.888 1.00 23.21 ? 325 ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 150 ? -9.406  -14.108 -25.031 1.00 24.28 ? 325 ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 150 ? -8.724  -14.391 -23.701 1.00 24.63 ? 325 ALA A C   1 
ATOM   1222 O  O   . ALA A 1 150 ? -9.363  -14.341 -22.645 1.00 24.11 ? 325 ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 150 ? -9.936  -15.428 -25.743 1.00 23.37 ? 325 ALA A CB  1 
ATOM   1224 N  N   . GLN A 1 151 ? -7.409  -14.640 -23.733 1.00 24.33 ? 326 GLN A N   1 
ATOM   1225 C  CA  . GLN A 1 151 ? -6.648  -14.843 -22.494 1.00 24.24 ? 326 GLN A CA  1 
ATOM   1226 C  C   . GLN A 1 151 ? -6.755  -13.672 -21.473 1.00 22.39 ? 326 GLN A C   1 
ATOM   1227 O  O   . GLN A 1 151 ? -6.962  -13.895 -20.272 1.00 19.05 ? 326 GLN A O   1 
ATOM   1228 C  CB  . GLN A 1 151 ? -5.156  -15.066 -22.784 1.00 26.56 ? 326 GLN A CB  1 
ATOM   1229 C  CG  . GLN A 1 151 ? -4.557  -16.061 -21.843 1.00 32.89 ? 326 GLN A CG  1 
ATOM   1230 C  CD  . GLN A 1 151 ? -3.035  -16.200 -21.938 1.00 43.95 ? 326 GLN A CD  1 
ATOM   1231 O  OE1 . GLN A 1 151 ? -2.378  -15.689 -22.870 1.00 47.95 ? 326 GLN A OE1 1 
ATOM   1232 N  NE2 . GLN A 1 151 ? -2.463  -16.898 -20.954 1.00 45.91 ? 326 GLN A NE2 1 
ATOM   1233 N  N   . MET A 1 152 ? -6.563  -12.455 -21.986 1.00 20.16 ? 327 MET A N   1 
ATOM   1234 C  CA  . MET A 1 152 ? -6.648  -11.234 -21.188 1.00 19.92 ? 327 MET A CA  1 
ATOM   1235 C  C   . MET A 1 152 ? -8.074  -11.198 -20.572 1.00 19.08 ? 327 MET A C   1 
ATOM   1236 O  O   . MET A 1 152 ? -8.231  -10.875 -19.401 1.00 17.35 ? 327 MET A O   1 
ATOM   1237 C  CB  . MET A 1 152 ? -6.447  -10.011 -22.077 1.00 19.23 ? 327 MET A CB  1 
ATOM   1238 C  CG  . MET A 1 152 ? -6.332  -8.671  -21.237 1.00 22.55 ? 327 MET A CG  1 
ATOM   1239 S  SD  . MET A 1 152 ? -4.867  -8.675  -20.189 1.00 25.59 ? 327 MET A SD  1 
ATOM   1240 C  CE  . MET A 1 152 ? -3.592  -8.083  -21.385 1.00 20.69 ? 327 MET A CE  1 
ATOM   1241 N  N   . TYR A 1 153 ? -9.080  -11.556 -21.385 1.00 19.47 ? 328 TYR A N   1 
ATOM   1242 C  CA  . TYR A 1 153 ? -10.491 -11.567 -20.920 1.00 20.54 ? 328 TYR A CA  1 
ATOM   1243 C  C   . TYR A 1 153 ? -10.711 -12.521 -19.756 1.00 19.85 ? 328 TYR A C   1 
ATOM   1244 O  O   . TYR A 1 153 ? -11.351 -12.162 -18.747 1.00 17.75 ? 328 TYR A O   1 
ATOM   1245 C  CB  . TYR A 1 153 ? -11.526 -11.833 -22.026 1.00 21.76 ? 328 TYR A CB  1 
ATOM   1246 C  CG  . TYR A 1 153 ? -12.904 -11.898 -21.375 1.00 22.64 ? 328 TYR A CG  1 
ATOM   1247 C  CD1 . TYR A 1 153 ? -13.496 -10.754 -20.850 1.00 21.45 ? 328 TYR A CD1 1 
ATOM   1248 C  CD2 . TYR A 1 153 ? -13.536 -13.128 -21.177 1.00 26.03 ? 328 TYR A CD2 1 
ATOM   1249 C  CE1 . TYR A 1 153 ? -14.690 -10.820 -20.173 1.00 24.25 ? 328 TYR A CE1 1 
ATOM   1250 C  CE2 . TYR A 1 153 ? -14.752 -13.200 -20.501 1.00 27.26 ? 328 TYR A CE2 1 
ATOM   1251 C  CZ  . TYR A 1 153 ? -15.322 -12.056 -20.013 1.00 25.57 ? 328 TYR A CZ  1 
ATOM   1252 O  OH  . TYR A 1 153 ? -16.514 -12.161 -19.324 1.00 32.97 ? 328 TYR A OH  1 
ATOM   1253 N  N   . GLU A 1 154 ? -10.135 -13.726 -19.851 1.00 19.69 ? 329 GLU A N   1 
ATOM   1254 C  CA  . GLU A 1 154 ? -10.251 -14.681 -18.775 1.00 20.68 ? 329 GLU A CA  1 
ATOM   1255 C  C   . GLU A 1 154 ? -9.554  -14.137 -17.513 1.00 19.25 ? 329 GLU A C   1 
ATOM   1256 O  O   . GLU A 1 154 ? -10.041 -14.354 -16.411 1.00 16.44 ? 329 GLU A O   1 
ATOM   1257 C  CB  . GLU A 1 154 ? -9.653  -16.079 -19.132 1.00 23.53 ? 329 GLU A CB  1 
ATOM   1258 C  CG  . GLU A 1 154 ? -9.891  -16.557 -20.560 1.00 30.76 ? 329 GLU A CG  1 
ATOM   1259 C  CD  . GLU A 1 154 ? -11.398 -16.634 -20.932 1.00 42.89 ? 329 GLU A CD  1 
ATOM   1260 O  OE1 . GLU A 1 154 ? -12.228 -16.831 -19.977 1.00 44.30 ? 329 GLU A OE1 1 
ATOM   1261 O  OE2 . GLU A 1 154 ? -11.723 -16.474 -22.176 1.00 44.78 ? 329 GLU A OE2 1 
ATOM   1262 N  N   . LEU A 1 155 ? -8.413  -13.455 -17.659 1.00 16.66 ? 330 LEU A N   1 
ATOM   1263 C  CA  . LEU A 1 155 ? -7.843  -12.843 -16.481 1.00 18.41 ? 330 LEU A CA  1 
ATOM   1264 C  C   . LEU A 1 155 ? -8.784  -11.760 -15.799 1.00 15.79 ? 330 LEU A C   1 
ATOM   1265 O  O   . LEU A 1 155 ? -8.940  -11.766 -14.570 1.00 17.66 ? 330 LEU A O   1 
ATOM   1266 C  CB  . LEU A 1 155 ? -6.413  -12.297 -16.766 1.00 17.87 ? 330 LEU A CB  1 
ATOM   1267 C  CG  . LEU A 1 155 ? -5.657  -11.690 -15.612 1.00 21.52 ? 330 LEU A CG  1 
ATOM   1268 C  CD1 . LEU A 1 155 ? -5.567  -12.657 -14.365 1.00 26.68 ? 330 LEU A CD1 1 
ATOM   1269 C  CD2 . LEU A 1 155 ? -4.215  -11.226 -16.115 1.00 27.46 ? 330 LEU A CD2 1 
ATOM   1270 N  N   . PHE A 1 156 ? -9.370  -10.846 -16.586 1.00 16.08 ? 331 PHE A N   1 
ATOM   1271 C  CA  . PHE A 1 156 ? -10.387 -9.899  -16.053 1.00 14.50 ? 331 PHE A CA  1 
ATOM   1272 C  C   . PHE A 1 156 ? -11.527 -10.627 -15.364 1.00 14.57 ? 331 PHE A C   1 
ATOM   1273 O  O   . PHE A 1 156 ? -11.977 -10.179 -14.340 1.00 15.80 ? 331 PHE A O   1 
ATOM   1274 C  CB  . PHE A 1 156 ? -11.034 -9.091  -17.157 1.00 13.50 ? 331 PHE A CB  1 
ATOM   1275 C  CG  . PHE A 1 156 ? -10.266 -7.859  -17.580 1.00 17.03 ? 331 PHE A CG  1 
ATOM   1276 C  CD1 . PHE A 1 156 ? -10.249 -6.725  -16.784 1.00 18.97 ? 331 PHE A CD1 1 
ATOM   1277 C  CD2 . PHE A 1 156 ? -9.663  -7.803  -18.832 1.00 17.43 ? 331 PHE A CD2 1 
ATOM   1278 C  CE1 . PHE A 1 156 ? -9.592  -5.565  -17.227 1.00 15.48 ? 331 PHE A CE1 1 
ATOM   1279 C  CE2 . PHE A 1 156 ? -9.000  -6.670  -19.263 1.00 19.94 ? 331 PHE A CE2 1 
ATOM   1280 C  CZ  . PHE A 1 156 ? -8.963  -5.564  -18.460 1.00 19.99 ? 331 PHE A CZ  1 
ATOM   1281 N  N   . SER A 1 157 ? -12.038 -11.728 -15.936 1.00 14.74 ? 332 SER A N   1 
ATOM   1282 C  CA  . SER A 1 157 ? -13.109 -12.496 -15.266 1.00 17.24 ? 332 SER A CA  1 
ATOM   1283 C  C   . SER A 1 157 ? -12.708 -12.943 -13.843 1.00 16.40 ? 332 SER A C   1 
ATOM   1284 O  O   . SER A 1 157 ? -13.453 -12.782 -12.834 1.00 15.75 ? 332 SER A O   1 
ATOM   1285 C  CB  . SER A 1 157 ? -13.545 -13.723 -16.138 1.00 18.35 ? 332 SER A CB  1 
ATOM   1286 O  OG  . SER A 1 157 ? -14.326 -14.552 -15.267 1.00 23.60 ? 332 SER A OG  1 
ATOM   1287 N  N   . GLU A 1 158 ? -11.514 -13.546 -13.729 1.00 15.23 ? 333 GLU A N   1 
ATOM   1288 C  CA  . GLU A 1 158 ? -11.007 -14.000 -12.458 1.00 15.21 ? 333 GLU A CA  1 
ATOM   1289 C  C   . GLU A 1 158 ? -10.737 -12.868 -11.450 1.00 13.90 ? 333 GLU A C   1 
ATOM   1290 O  O   . GLU A 1 158 ? -10.861 -13.065 -10.249 1.00 12.80 ? 333 GLU A O   1 
ATOM   1291 C  CB  . GLU A 1 158 ? -9.669  -14.784 -12.629 1.00 14.85 ? 333 GLU A CB  1 
ATOM   1292 C  CG  . GLU A 1 158 ? -9.869  -15.974 -13.552 1.00 24.30 ? 333 GLU A CG  1 
ATOM   1293 C  CD  . GLU A 1 158 ? -8.638  -16.905 -13.634 1.00 32.78 ? 333 GLU A CD  1 
ATOM   1294 O  OE1 . GLU A 1 158 ? -7.537  -16.491 -13.169 1.00 35.83 ? 333 GLU A OE1 1 
ATOM   1295 O  OE2 . GLU A 1 158 ? -8.809  -18.033 -14.175 1.00 37.19 ? 333 GLU A OE2 1 
ATOM   1296 N  N   . VAL A 1 159 ? -10.261 -11.728 -11.921 1.00 13.91 ? 334 VAL A N   1 
ATOM   1297 C  CA  . VAL A 1 159 ? -10.080 -10.593 -11.007 1.00 14.07 ? 334 VAL A CA  1 
ATOM   1298 C  C   . VAL A 1 159 ? -11.478 -10.071 -10.485 1.00 12.84 ? 334 VAL A C   1 
ATOM   1299 O  O   . VAL A 1 159 ? -11.590 -9.789  -9.313  1.00 14.43 ? 334 VAL A O   1 
ATOM   1300 C  CB  . VAL A 1 159 ? -9.317  -9.397  -11.675 1.00 14.47 ? 334 VAL A CB  1 
ATOM   1301 C  CG1 . VAL A 1 159 ? -9.257  -8.176  -10.693 1.00 15.12 ? 334 VAL A CG1 1 
ATOM   1302 C  CG2 . VAL A 1 159 ? -7.849  -9.822  -12.072 1.00 18.26 ? 334 VAL A CG2 1 
ATOM   1303 N  N   . PHE A 1 160 ? -12.478 -9.961  -11.363 1.00 12.88 ? 335 PHE A N   1 
ATOM   1304 C  CA  . PHE A 1 160 ? -13.880 -9.547  -10.984 1.00 14.71 ? 335 PHE A CA  1 
ATOM   1305 C  C   . PHE A 1 160 ? -14.473 -10.416 -9.868  1.00 15.20 ? 335 PHE A C   1 
ATOM   1306 O  O   . PHE A 1 160 ? -15.200 -9.941  -8.960  1.00 13.54 ? 335 PHE A O   1 
ATOM   1307 C  CB  . PHE A 1 160 ? -14.817 -9.599  -12.205 1.00 13.55 ? 335 PHE A CB  1 
ATOM   1308 C  CG  . PHE A 1 160 ? -14.615 -8.510  -13.214 1.00 16.42 ? 335 PHE A CG  1 
ATOM   1309 C  CD1 . PHE A 1 160 ? -13.828 -7.378  -12.932 1.00 18.91 ? 335 PHE A CD1 1 
ATOM   1310 C  CD2 . PHE A 1 160 ? -15.181 -8.642  -14.489 1.00 16.50 ? 335 PHE A CD2 1 
ATOM   1311 C  CE1 . PHE A 1 160 ? -13.662 -6.391  -13.904 1.00 13.87 ? 335 PHE A CE1 1 
ATOM   1312 C  CE2 . PHE A 1 160 ? -15.026 -7.668  -15.475 1.00 16.99 ? 335 PHE A CE2 1 
ATOM   1313 C  CZ  . PHE A 1 160 ? -14.274 -6.523  -15.184 1.00 13.95 ? 335 PHE A CZ  1 
ATOM   1314 N  N   . GLU A 1 161 ? -14.125 -11.730 -9.910  1.00 14.96 ? 336 GLU A N   1 
ATOM   1315 C  CA  . GLU A 1 161 ? -14.554 -12.702 -8.848  1.00 14.95 ? 336 GLU A CA  1 
ATOM   1316 C  C   . GLU A 1 161 ? -14.104 -12.332 -7.440  1.00 13.71 ? 336 GLU A C   1 
ATOM   1317 O  O   . GLU A 1 161 ? -14.777 -12.698 -6.438  1.00 14.28 ? 336 GLU A O   1 
ATOM   1318 C  CB  . GLU A 1 161 ? -14.095 -14.161 -9.204  1.00 12.93 ? 336 GLU A CB  1 
ATOM   1319 C  CG  . GLU A 1 161 ? -14.899 -14.697 -10.307 1.00 16.13 ? 336 GLU A CG  1 
ATOM   1320 C  CD  . GLU A 1 161 ? -14.439 -16.117 -10.702 1.00 22.07 ? 336 GLU A CD  1 
ATOM   1321 O  OE1 . GLU A 1 161 ? -13.375 -16.541 -10.210 1.00 23.82 ? 336 GLU A OE1 1 
ATOM   1322 O  OE2 . GLU A 1 161 ? -15.126 -16.768 -11.508 1.00 22.53 ? 336 GLU A OE2 1 
ATOM   1323 N  N   . TRP A 1 162 ? -12.974 -11.619 -7.333  1.00 12.16 ? 337 TRP A N   1 
ATOM   1324 C  CA  . TRP A 1 162 ? -12.535 -11.158 -6.043  1.00 12.44 ? 337 TRP A CA  1 
ATOM   1325 C  C   . TRP A 1 162 ? -13.055 -9.792  -5.525  1.00 11.57 ? 337 TRP A C   1 
ATOM   1326 O  O   . TRP A 1 162 ? -12.715 -9.423  -4.410  1.00 11.18 ? 337 TRP A O   1 
ATOM   1327 C  CB  . TRP A 1 162 ? -11.003 -11.204 -5.875  1.00 12.44 ? 337 TRP A CB  1 
ATOM   1328 C  CG  . TRP A 1 162 ? -10.512 -12.685 -5.783  1.00 14.95 ? 337 TRP A CG  1 
ATOM   1329 C  CD1 . TRP A 1 162 ? -9.887  -13.403 -6.750  1.00 18.56 ? 337 TRP A CD1 1 
ATOM   1330 C  CD2 . TRP A 1 162 ? -10.628 -13.528 -4.657  1.00 17.86 ? 337 TRP A CD2 1 
ATOM   1331 N  NE1 . TRP A 1 162 ? -9.676  -14.697 -6.324  1.00 16.97 ? 337 TRP A NE1 1 
ATOM   1332 C  CE2 . TRP A 1 162 ? -10.068 -14.783 -5.015  1.00 21.19 ? 337 TRP A CE2 1 
ATOM   1333 C  CE3 . TRP A 1 162 ? -11.170 -13.362 -3.364  1.00 18.21 ? 337 TRP A CE3 1 
ATOM   1334 C  CZ2 . TRP A 1 162 ? -9.974  -15.835 -4.131  1.00 18.28 ? 337 TRP A CZ2 1 
ATOM   1335 C  CZ3 . TRP A 1 162 ? -11.089 -14.453 -2.465  1.00 21.55 ? 337 TRP A CZ3 1 
ATOM   1336 C  CH2 . TRP A 1 162 ? -10.497 -15.671 -2.870  1.00 19.63 ? 337 TRP A CH2 1 
ATOM   1337 N  N   . LEU A 1 163 ? -13.802 -9.060  -6.332  1.00 11.05 ? 338 LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 163 ? -14.341 -7.740  -5.897  1.00 11.72 ? 338 LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 163 ? -15.269 -7.979  -4.691  1.00 12.00 ? 338 LEU A C   1 
ATOM   1340 O  O   . LEU A 1 163 ? -16.123 -8.903  -4.700  1.00 13.54 ? 338 LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 163 ? -15.139 -7.072  -7.029  1.00 10.91 ? 338 LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 163 ? -14.245 -6.478  -8.147  1.00 11.89 ? 338 LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 163 ? -15.139 -6.280  -9.352  1.00 11.47 ? 338 LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 163 ? -13.558 -5.171  -7.736  1.00 11.16 ? 338 LEU A CD2 1 
ATOM   1345 N  N   . PRO A 1 164 ? -15.069 -7.209  -3.636  1.00 13.87 ? 339 PRO A N   1 
ATOM   1346 C  CA  . PRO A 1 164 ? -15.987 -7.283  -2.455  1.00 12.69 ? 339 PRO A CA  1 
ATOM   1347 C  C   . PRO A 1 164 ? -17.464 -7.024  -2.926  1.00 10.18 ? 339 PRO A C   1 
ATOM   1348 O  O   . PRO A 1 164 ? -17.693 -6.459  -3.993  1.00 8.94  ? 339 PRO A O   1 
ATOM   1349 C  CB  . PRO A 1 164 ? -15.444 -6.217  -1.500  1.00 10.87 ? 339 PRO A CB  1 
ATOM   1350 C  CG  . PRO A 1 164 ? -14.374 -5.470  -2.230  1.00 17.25 ? 339 PRO A CG  1 
ATOM   1351 C  CD  . PRO A 1 164 ? -14.066 -6.123  -3.544  1.00 13.82 ? 339 PRO A CD  1 
ATOM   1352 N  N   . LEU A 1 165 ? -18.448 -7.489  -2.165  1.00 11.03 ? 340 LEU A N   1 
ATOM   1353 C  CA  . LEU A 1 165 ? -19.855 -7.318  -2.563  1.00 12.11 ? 340 LEU A CA  1 
ATOM   1354 C  C   . LEU A 1 165 ? -20.572 -6.138  -1.880  1.00 11.15 ? 340 LEU A C   1 
ATOM   1355 O  O   . LEU A 1 165 ? -21.610 -5.701  -2.380  1.00 12.63 ? 340 LEU A O   1 
ATOM   1356 C  CB  . LEU A 1 165 ? -20.653 -8.626  -2.320  1.00 11.78 ? 340 LEU A CB  1 
ATOM   1357 C  CG  . LEU A 1 165 ? -20.092 -9.882  -2.984  1.00 9.28  ? 340 LEU A CG  1 
ATOM   1358 C  CD1 . LEU A 1 165 ? -20.959 -11.132 -2.557  1.00 10.01 ? 340 LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A 1 165 ? -20.010 -9.684  -4.476  1.00 7.99  ? 340 LEU A CD2 1 
ATOM   1360 N  N   . ALA A 1 166 ? -20.032 -5.671  -0.748  1.00 12.35 ? 341 ALA A N   1 
ATOM   1361 C  CA  . ALA A 1 166 ? -20.674 -4.524  -0.011  1.00 13.40 ? 341 ALA A CA  1 
ATOM   1362 C  C   . ALA A 1 166 ? -19.695 -3.763  0.823   1.00 12.70 ? 341 ALA A C   1 
ATOM   1363 O  O   . ALA A 1 166 ? -18.603 -4.271  1.142   1.00 13.30 ? 341 ALA A O   1 
ATOM   1364 C  CB  . ALA A 1 166 ? -21.873 -5.031  0.885   1.00 11.52 ? 341 ALA A CB  1 
ATOM   1365 N  N   . GLN A 1 167 ? -20.079 -2.562  1.244   1.00 12.89 ? 342 GLN A N   1 
ATOM   1366 C  CA  . GLN A 1 167 ? -19.201 -1.776  2.055   1.00 12.06 ? 342 GLN A CA  1 
ATOM   1367 C  C   . GLN A 1 167 ? -19.987 -1.060  3.145   1.00 13.31 ? 342 GLN A C   1 
ATOM   1368 O  O   . GLN A 1 167 ? -21.052 -0.465  2.892   1.00 12.53 ? 342 GLN A O   1 
ATOM   1369 C  CB  . GLN A 1 167 ? -18.428 -0.736  1.182   1.00 12.51 ? 342 GLN A CB  1 
ATOM   1370 C  CG  . GLN A 1 167 ? -17.375 0.084   2.014   1.00 12.49 ? 342 GLN A CG  1 
ATOM   1371 C  CD  . GLN A 1 167 ? -16.365 0.739   1.096   1.00 20.89 ? 342 GLN A CD  1 
ATOM   1372 O  OE1 . GLN A 1 167 ? -16.376 0.493   -0.144  1.00 19.36 ? 342 GLN A OE1 1 
ATOM   1373 N  NE2 . GLN A 1 167 ? -15.468 1.558   1.672   1.00 18.77 ? 342 GLN A NE2 1 
ATOM   1374 N  N   . CYS A 1 168 ? -19.467 -1.119  4.366   1.00 11.70 ? 343 CYS A N   1 
ATOM   1375 C  CA  . CYS A 1 168 ? -20.161 -0.448  5.456   1.00 14.97 ? 343 CYS A CA  1 
ATOM   1376 C  C   . CYS A 1 168 ? -19.329 0.661   6.077   1.00 13.72 ? 343 CYS A C   1 
ATOM   1377 O  O   . CYS A 1 168 ? -18.211 0.406   6.585   1.00 17.44 ? 343 CYS A O   1 
ATOM   1378 C  CB  . CYS A 1 168 ? -20.583 -1.465  6.519   1.00 13.36 ? 343 CYS A CB  1 
ATOM   1379 S  SG  . CYS A 1 168 ? -21.736 -0.797  7.806   1.00 18.58 ? 343 CYS A SG  1 
ATOM   1380 N  N   . ILE A 1 169 ? -19.856 1.862   6.072   1.00 13.62 ? 344 ILE A N   1 
ATOM   1381 C  CA  . ILE A 1 169 ? -19.166 3.058   6.644   1.00 15.69 ? 344 ILE A CA  1 
ATOM   1382 C  C   . ILE A 1 169 ? -19.676 3.340   8.043   1.00 15.45 ? 344 ILE A C   1 
ATOM   1383 O  O   . ILE A 1 169 ? -20.926 3.577   8.202   1.00 14.70 ? 344 ILE A O   1 
ATOM   1384 C  CB  . ILE A 1 169 ? -19.493 4.378   5.841   1.00 15.30 ? 344 ILE A CB  1 
ATOM   1385 C  CG1 . ILE A 1 169 ? -19.514 4.171   4.310   1.00 19.58 ? 344 ILE A CG1 1 
ATOM   1386 C  CG2 . ILE A 1 169 ? -18.658 5.616   6.406   1.00 13.57 ? 344 ILE A CG2 1 
ATOM   1387 C  CD1 . ILE A 1 169 ? -18.235 3.752   3.728   1.00 25.73 ? 344 ILE A CD1 1 
ATOM   1388 N  N   . ASN A 1 170 ? -18.785 3.292   9.035   1.00 15.35 ? 345 ASN A N   1 
ATOM   1389 C  CA  . ASN A 1 170 ? -19.085 3.626   10.436  1.00 15.92 ? 345 ASN A CA  1 
ATOM   1390 C  C   . ASN A 1 170 ? -20.229 2.814   11.090  1.00 17.08 ? 345 ASN A C   1 
ATOM   1391 O  O   . ASN A 1 170 ? -20.928 3.377   11.946  1.00 15.81 ? 345 ASN A O   1 
ATOM   1392 C  CB  . ASN A 1 170 ? -19.395 5.142   10.589  1.00 16.36 ? 345 ASN A CB  1 
ATOM   1393 C  CG  . ASN A 1 170 ? -18.162 6.014   10.349  1.00 20.53 ? 345 ASN A CG  1 
ATOM   1394 O  OD1 . ASN A 1 170 ? -17.129 5.500   9.938   1.00 19.97 ? 345 ASN A OD1 1 
ATOM   1395 N  ND2 . ASN A 1 170 ? -18.276 7.318   10.563  1.00 17.95 ? 345 ASN A ND2 1 
ATOM   1396 N  N   . GLY A 1 171 ? -20.408 1.553   10.662  1.00 14.55 ? 346 GLY A N   1 
ATOM   1397 C  CA  . GLY A 1 171 ? -21.526 0.701   11.064  1.00 15.53 ? 346 GLY A CA  1 
ATOM   1398 C  C   . GLY A 1 171 ? -22.890 1.325   10.826  1.00 14.63 ? 346 GLY A C   1 
ATOM   1399 O  O   . GLY A 1 171 ? -23.853 0.935   11.444  1.00 15.84 ? 346 GLY A O   1 
ATOM   1400 N  N   . LYS A 1 172 ? -22.984 2.283   9.918   1.00 15.98 ? 347 LYS A N   1 
ATOM   1401 C  CA  . LYS A 1 172 ? -24.221 3.099   9.697   1.00 16.84 ? 347 LYS A CA  1 
ATOM   1402 C  C   . LYS A 1 172 ? -24.788 3.107   8.275   1.00 15.01 ? 347 LYS A C   1 
ATOM   1403 O  O   . LYS A 1 172 ? -26.005 3.118   8.102   1.00 15.36 ? 347 LYS A O   1 
ATOM   1404 C  CB  . LYS A 1 172 ? -24.002 4.577   10.152  1.00 17.40 ? 347 LYS A CB  1 
ATOM   1405 C  CG  . LYS A 1 172 ? -23.890 4.738   11.679  1.00 20.34 ? 347 LYS A CG  1 
ATOM   1406 C  CD  . LYS A 1 172 ? -25.054 3.898   12.334  1.00 31.28 ? 347 LYS A CD  1 
ATOM   1407 C  CE  . LYS A 1 172 ? -25.214 4.246   13.865  1.00 36.37 ? 347 LYS A CE  1 
ATOM   1408 N  NZ  . LYS A 1 172 ? -25.865 3.126   14.592  1.00 38.27 ? 347 LYS A NZ  1 
ATOM   1409 N  N   . VAL A 1 173 ? -23.920 3.188   7.262   1.00 13.31 ? 348 VAL A N   1 
ATOM   1410 C  CA  . VAL A 1 173 ? -24.348 3.156   5.875   1.00 13.54 ? 348 VAL A CA  1 
ATOM   1411 C  C   . VAL A 1 173 ? -23.827 1.898   5.182   1.00 12.78 ? 348 VAL A C   1 
ATOM   1412 O  O   . VAL A 1 173 ? -22.621 1.596   5.181   1.00 14.01 ? 348 VAL A O   1 
ATOM   1413 C  CB  . VAL A 1 173 ? -23.923 4.426   5.117   1.00 13.87 ? 348 VAL A CB  1 
ATOM   1414 C  CG1 . VAL A 1 173 ? -24.444 4.411   3.649   1.00 10.06 ? 348 VAL A CG1 1 
ATOM   1415 C  CG2 . VAL A 1 173 ? -24.400 5.720   5.936   1.00 17.58 ? 348 VAL A CG2 1 
ATOM   1416 N  N   . LEU A 1 174 ? -24.741 1.165   4.596   1.00 13.30 ? 349 LEU A N   1 
ATOM   1417 C  CA  . LEU A 1 174 ? -24.370 -0.027  3.798   1.00 11.20 ? 349 LEU A CA  1 
ATOM   1418 C  C   . LEU A 1 174 ? -24.517 0.294   2.330   1.00 9.55  ? 349 LEU A C   1 
ATOM   1419 O  O   . LEU A 1 174 ? -25.540 0.765   1.882   1.00 9.82  ? 349 LEU A O   1 
ATOM   1420 C  CB  . LEU A 1 174 ? -25.271 -1.219  4.207   1.00 9.97  ? 349 LEU A CB  1 
ATOM   1421 C  CG  . LEU A 1 174 ? -24.858 -2.594  3.564   1.00 11.95 ? 349 LEU A CG  1 
ATOM   1422 C  CD1 . LEU A 1 174 ? -23.489 -2.930  4.155   1.00 14.65 ? 349 LEU A CD1 1 
ATOM   1423 C  CD2 . LEU A 1 174 ? -25.923 -3.636  3.948   1.00 14.37 ? 349 LEU A CD2 1 
ATOM   1424 N  N   . ILE A 1 175 ? -23.481 0.008   1.555   1.00 9.52  ? 350 ILE A N   1 
ATOM   1425 C  CA  . ILE A 1 175 ? -23.457 0.257   0.142   1.00 9.97  ? 350 ILE A CA  1 
ATOM   1426 C  C   . ILE A 1 175 ? -23.296 -1.087  -0.582  1.00 10.96 ? 350 ILE A C   1 
ATOM   1427 O  O   . ILE A 1 175 ? -22.406 -1.865  -0.181  1.00 11.34 ? 350 ILE A O   1 
ATOM   1428 C  CB  . ILE A 1 175 ? -22.223 1.137   -0.203  1.00 9.37  ? 350 ILE A CB  1 
ATOM   1429 C  CG1 . ILE A 1 175 ? -22.327 2.372   0.690   1.00 12.49 ? 350 ILE A CG1 1 
ATOM   1430 C  CG2 . ILE A 1 175 ? -22.143 1.489   -1.794  1.00 12.71 ? 350 ILE A CG2 1 
ATOM   1431 C  CD1 . ILE A 1 175 ? -21.000 3.213   0.817   1.00 16.50 ? 350 ILE A CD1 1 
ATOM   1432 N  N   . MET A 1 176 ? -24.033 -1.278  -1.669  1.00 8.85  ? 351 MET A N   1 
ATOM   1433 C  CA  . MET A 1 176 ? -23.972 -2.531  -2.475  1.00 11.07 ? 351 MET A CA  1 
ATOM   1434 C  C   . MET A 1 176 ? -24.522 -2.140  -3.810  1.00 9.75  ? 351 MET A C   1 
ATOM   1435 O  O   . MET A 1 176 ? -25.255 -1.113  -3.876  1.00 9.50  ? 351 MET A O   1 
ATOM   1436 C  CB  . MET A 1 176 ? -24.809 -3.702  -1.852  1.00 8.97  ? 351 MET A CB  1 
ATOM   1437 C  CG  . MET A 1 176 ? -26.326 -3.622  -2.209  1.00 12.83 ? 351 MET A CG  1 
ATOM   1438 S  SD  . MET A 1 176 ? -27.062 -2.437  -1.043  1.00 21.76 ? 351 MET A SD  1 
ATOM   1439 C  CE  . MET A 1 176 ? -26.872 -3.355  0.393   1.00 15.04 ? 351 MET A CE  1 
ATOM   1440 N  N   . HIS A 1 177 ? -24.224 -2.901  -4.895  1.00 8.32  ? 352 HIS A N   1 
ATOM   1441 C  CA  . HIS A 1 177 ? -24.674 -2.468  -6.219  1.00 8.32  ? 352 HIS A CA  1 
ATOM   1442 C  C   . HIS A 1 177 ? -26.180 -2.519  -6.411  1.00 9.89  ? 352 HIS A C   1 
ATOM   1443 O  O   . HIS A 1 177 ? -26.815 -1.555  -6.859  1.00 7.62  ? 352 HIS A O   1 
ATOM   1444 C  CB  . HIS A 1 177 ? -23.977 -3.284  -7.363  1.00 8.11  ? 352 HIS A CB  1 
ATOM   1445 C  CG  . HIS A 1 177 ? -24.526 -2.995  -8.741  1.00 9.51  ? 352 HIS A CG  1 
ATOM   1446 N  ND1 . HIS A 1 177 ? -24.162 -1.893  -9.462  1.00 9.48  ? 352 HIS A ND1 1 
ATOM   1447 C  CD2 . HIS A 1 177 ? -25.375 -3.676  -9.517  1.00 7.04  ? 352 HIS A CD2 1 
ATOM   1448 C  CE1 . HIS A 1 177 ? -24.803 -1.860  -10.599 1.00 9.51  ? 352 HIS A CE1 1 
ATOM   1449 N  NE2 . HIS A 1 177 ? -25.530 -2.958  -10.695 1.00 7.87  ? 352 HIS A NE2 1 
ATOM   1450 N  N   . GLY A 1 178 ? -26.757 -3.651  -6.067  1.00 9.94  ? 353 GLY A N   1 
ATOM   1451 C  CA  . GLY A 1 178 ? -28.160 -3.959  -6.453  1.00 12.38 ? 353 GLY A CA  1 
ATOM   1452 C  C   . GLY A 1 178 ? -28.999 -3.595  -5.193  1.00 13.76 ? 353 GLY A C   1 
ATOM   1453 O  O   . GLY A 1 178 ? -29.669 -2.565  -5.143  1.00 15.89 ? 353 GLY A O   1 
ATOM   1454 N  N   . GLY A 1 179 ? -29.011 -4.427  -4.178  1.00 13.45 ? 354 GLY A N   1 
ATOM   1455 C  CA  . GLY A 1 179 ? -29.859 -4.076  -3.011  1.00 14.52 ? 354 GLY A CA  1 
ATOM   1456 C  C   . GLY A 1 179 ? -29.980 -5.135  -1.919  1.00 13.96 ? 354 GLY A C   1 
ATOM   1457 O  O   . GLY A 1 179 ? -29.016 -5.843  -1.599  1.00 13.53 ? 354 GLY A O   1 
ATOM   1458 N  N   . LEU A 1 180 ? -31.180 -5.256  -1.353  1.00 12.51 ? 355 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 180 ? -31.359 -6.097  -0.177  1.00 13.63 ? 355 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 180 ? -31.881 -7.455  -0.636  1.00 12.28 ? 355 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 180 ? -31.787 -7.814  -1.797  1.00 13.77 ? 355 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 180 ? -32.331 -5.426  0.841   1.00 11.11 ? 355 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 180 ? -31.737 -4.141  1.400   1.00 14.33 ? 355 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 180 ? -32.705 -3.580  2.467   1.00 11.18 ? 355 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 180 ? -30.364 -4.355  2.053   1.00 13.05 ? 355 LEU A CD2 1 
ATOM   1466 N  N   . PHE A 1 181 ? -32.501 -8.191  0.263   1.00 13.78 ? 356 PHE A N   1 
ATOM   1467 C  CA  . PHE A 1 181 ? -32.531 -9.644  0.081   1.00 14.29 ? 356 PHE A CA  1 
ATOM   1468 C  C   . PHE A 1 181 ? -33.938 -10.242 -0.200  1.00 15.77 ? 356 PHE A C   1 
ATOM   1469 O  O   . PHE A 1 181 ? -34.953 -9.658  0.092   1.00 14.73 ? 356 PHE A O   1 
ATOM   1470 C  CB  . PHE A 1 181 ? -31.834 -10.291 1.298   1.00 15.48 ? 356 PHE A CB  1 
ATOM   1471 C  CG  . PHE A 1 181 ? -30.400 -9.865  1.430   1.00 14.57 ? 356 PHE A CG  1 
ATOM   1472 C  CD1 . PHE A 1 181 ? -29.404 -10.511 0.647   1.00 14.30 ? 356 PHE A CD1 1 
ATOM   1473 C  CD2 . PHE A 1 181 ? -30.028 -8.789  2.279   1.00 11.90 ? 356 PHE A CD2 1 
ATOM   1474 C  CE1 . PHE A 1 181 ? -28.107 -10.110 0.699   1.00 14.69 ? 356 PHE A CE1 1 
ATOM   1475 C  CE2 . PHE A 1 181 ? -28.683 -8.378  2.387   1.00 15.31 ? 356 PHE A CE2 1 
ATOM   1476 C  CZ  . PHE A 1 181 ? -27.711 -9.011  1.587   1.00 13.64 ? 356 PHE A CZ  1 
ATOM   1477 N  N   . SER A 1 182 ? -33.957 -11.438 -0.762  1.00 16.51 ? 357 SER A N   1 
ATOM   1478 C  CA  . SER A 1 182 ? -35.215 -12.044 -1.086  1.00 16.99 ? 357 SER A CA  1 
ATOM   1479 C  C   . SER A 1 182 ? -35.816 -12.830 0.135   1.00 16.64 ? 357 SER A C   1 
ATOM   1480 O  O   . SER A 1 182 ? -36.918 -13.346 0.055   1.00 17.07 ? 357 SER A O   1 
ATOM   1481 C  CB  . SER A 1 182 ? -34.994 -12.887 -2.360  0.50 14.59 ? 357 SER A CB  1 
ATOM   1482 O  OG  . SER A 1 182 ? -34.322 -14.032 -1.915  0.50 16.57 ? 357 SER A OG  1 
ATOM   1483 N  N   . GLU A 1 183 ? -35.078 -12.908 1.248   1.00 16.44 ? 358 GLU A N   1 
ATOM   1484 C  CA  . GLU A 1 183 ? -35.489 -13.539 2.509   1.00 17.14 ? 358 GLU A CA  1 
ATOM   1485 C  C   . GLU A 1 183 ? -35.122 -12.539 3.610   1.00 17.81 ? 358 GLU A C   1 
ATOM   1486 O  O   . GLU A 1 183 ? -34.079 -11.873 3.530   1.00 15.12 ? 358 GLU A O   1 
ATOM   1487 C  CB  . GLU A 1 183 ? -34.702 -14.881 2.771   1.00 16.71 ? 358 GLU A CB  1 
ATOM   1488 C  CG  . GLU A 1 183 ? -34.047 -15.639 1.454   1.00 22.84 ? 358 GLU A CG  1 
ATOM   1489 C  CD  . GLU A 1 183 ? -32.400 -15.443 1.179   1.00 42.38 ? 358 GLU A CD  1 
ATOM   1490 O  OE1 . GLU A 1 183 ? -31.973 -14.735 0.162   1.00 44.17 ? 358 GLU A OE1 1 
ATOM   1491 O  OE2 . GLU A 1 183 ? -31.533 -16.050 1.945   1.00 41.89 ? 358 GLU A OE2 1 
ATOM   1492 N  N   . ASP A 1 184 ? -35.941 -12.522 4.674   1.00 16.92 ? 359 ASP A N   1 
ATOM   1493 C  CA  . ASP A 1 184 ? -35.674 -11.791 5.883   1.00 18.62 ? 359 ASP A CA  1 
ATOM   1494 C  C   . ASP A 1 184 ? -34.558 -12.421 6.753   1.00 18.11 ? 359 ASP A C   1 
ATOM   1495 O  O   . ASP A 1 184 ? -34.236 -13.646 6.626   1.00 16.28 ? 359 ASP A O   1 
ATOM   1496 C  CB  . ASP A 1 184 ? -36.952 -11.698 6.719   1.00 19.98 ? 359 ASP A CB  1 
ATOM   1497 C  CG  . ASP A 1 184 ? -37.997 -10.761 6.094   1.00 24.20 ? 359 ASP A CG  1 
ATOM   1498 O  OD1 . ASP A 1 184 ? -37.685 -9.892  5.260   1.00 22.11 ? 359 ASP A OD1 1 
ATOM   1499 O  OD2 . ASP A 1 184 ? -39.168 -10.932 6.447   1.00 30.82 ? 359 ASP A OD2 1 
ATOM   1500 N  N   . GLY A 1 185 ? -33.984 -11.551 7.598   1.00 17.07 ? 360 GLY A N   1 
ATOM   1501 C  CA  . GLY A 1 185 ? -33.039 -11.951 8.642   1.00 18.68 ? 360 GLY A CA  1 
ATOM   1502 C  C   . GLY A 1 185 ? -31.570 -12.048 8.206   1.00 17.93 ? 360 GLY A C   1 
ATOM   1503 O  O   . GLY A 1 185 ? -30.753 -12.637 8.912   1.00 18.44 ? 360 GLY A O   1 
ATOM   1504 N  N   . VAL A 1 186 ? -31.231 -11.542 7.021   1.00 16.68 ? 361 VAL A N   1 
ATOM   1505 C  CA  . VAL A 1 186 ? -29.821 -11.548 6.609   1.00 15.79 ? 361 VAL A CA  1 
ATOM   1506 C  C   . VAL A 1 186 ? -29.090 -10.502 7.481   1.00 15.84 ? 361 VAL A C   1 
ATOM   1507 O  O   . VAL A 1 186 ? -29.622 -9.382  7.686   1.00 15.42 ? 361 VAL A O   1 
ATOM   1508 C  CB  . VAL A 1 186 ? -29.654 -11.210 5.091   1.00 16.35 ? 361 VAL A CB  1 
ATOM   1509 C  CG1 . VAL A 1 186 ? -28.144 -11.052 4.646   1.00 13.99 ? 361 VAL A CG1 1 
ATOM   1510 C  CG2 . VAL A 1 186 ? -30.400 -12.219 4.202   1.00 15.77 ? 361 VAL A CG2 1 
ATOM   1511 N  N   . THR A 1 187 ? -27.914 -10.865 7.995   1.00 13.95 ? 362 THR A N   1 
ATOM   1512 C  CA  . THR A 1 187 ? -27.114 -9.952  8.785   1.00 15.29 ? 362 THR A CA  1 
ATOM   1513 C  C   . THR A 1 187 ? -25.763 -9.519  8.092   1.00 15.53 ? 362 THR A C   1 
ATOM   1514 O  O   . THR A 1 187 ? -25.355 -10.098 7.083   1.00 14.26 ? 362 THR A O   1 
ATOM   1515 C  CB  . THR A 1 187 ? -26.766 -10.532 10.154  1.00 15.25 ? 362 THR A CB  1 
ATOM   1516 O  OG1 . THR A 1 187 ? -25.870 -11.607 9.953   1.00 17.39 ? 362 THR A OG1 1 
ATOM   1517 C  CG2 . THR A 1 187 ? -27.999 -10.998 10.954  1.00 19.05 ? 362 THR A CG2 1 
ATOM   1518 N  N   . LEU A 1 188 ? -25.102 -8.500  8.657   1.00 16.41 ? 363 LEU A N   1 
ATOM   1519 C  CA  . LEU A 1 188 ? -23.815 -8.081  8.137   1.00 17.41 ? 363 LEU A CA  1 
ATOM   1520 C  C   . LEU A 1 188 ? -22.846 -9.272  8.272   1.00 18.99 ? 363 LEU A C   1 
ATOM   1521 O  O   . LEU A 1 188 ? -22.005 -9.469  7.408   1.00 17.76 ? 363 LEU A O   1 
ATOM   1522 C  CB  . LEU A 1 188 ? -23.306 -6.923  8.934   1.00 18.27 ? 363 LEU A CB  1 
ATOM   1523 C  CG  . LEU A 1 188 ? -24.066 -5.615  8.689   1.00 19.78 ? 363 LEU A CG  1 
ATOM   1524 C  CD1 . LEU A 1 188 ? -23.480 -4.597  9.692   1.00 20.41 ? 363 LEU A CD1 1 
ATOM   1525 C  CD2 . LEU A 1 188 ? -24.047 -5.152  7.180   1.00 18.57 ? 363 LEU A CD2 1 
ATOM   1526 N  N   . ASP A 1 189 ? -22.972 -10.074 9.341   1.00 20.76 ? 364 ASP A N   1 
ATOM   1527 C  CA  . ASP A 1 189 ? -22.149 -11.271 9.431   1.00 22.00 ? 364 ASP A CA  1 
ATOM   1528 C  C   . ASP A 1 189 ? -22.321 -12.299 8.319   1.00 22.06 ? 364 ASP A C   1 
ATOM   1529 O  O   . ASP A 1 189 ? -21.316 -12.859 7.808   1.00 21.90 ? 364 ASP A O   1 
ATOM   1530 C  CB  . ASP A 1 189 ? -22.140 -11.912 10.810  1.00 24.36 ? 364 ASP A CB  1 
ATOM   1531 C  CG  . ASP A 1 189 ? -20.847 -12.802 11.012  1.00 30.28 ? 364 ASP A CG  1 
ATOM   1532 O  OD1 . ASP A 1 189 ? -19.682 -12.296 10.847  1.00 34.02 ? 364 ASP A OD1 1 
ATOM   1533 O  OD2 . ASP A 1 189 ? -21.015 -14.019 11.228  1.00 35.24 ? 364 ASP A OD2 1 
ATOM   1534 N  N   . ASP A 1 190 ? -23.569 -12.525 7.902   1.00 20.44 ? 365 ASP A N   1 
ATOM   1535 C  CA  . ASP A 1 190 ? -23.879 -13.364 6.764   1.00 19.82 ? 365 ASP A CA  1 
ATOM   1536 C  C   . ASP A 1 190 ? -23.172 -12.849 5.489   1.00 19.69 ? 365 ASP A C   1 
ATOM   1537 O  O   . ASP A 1 190 ? -22.644 -13.659 4.747   1.00 16.90 ? 365 ASP A O   1 
ATOM   1538 C  CB  . ASP A 1 190 ? -25.384 -13.321 6.453   1.00 21.41 ? 365 ASP A CB  1 
ATOM   1539 C  CG  . ASP A 1 190 ? -26.210 -14.006 7.524   1.00 26.00 ? 365 ASP A CG  1 
ATOM   1540 O  OD1 . ASP A 1 190 ? -25.641 -14.948 8.157   1.00 29.00 ? 365 ASP A OD1 1 
ATOM   1541 O  OD2 . ASP A 1 190 ? -27.383 -13.579 7.763   1.00 27.23 ? 365 ASP A OD2 1 
ATOM   1542 N  N   . ILE A 1 191 ? -23.191 -11.523 5.241   1.00 16.34 ? 366 ILE A N   1 
ATOM   1543 C  CA  . ILE A 1 191 ? -22.530 -10.955 4.059   1.00 15.75 ? 366 ILE A CA  1 
ATOM   1544 C  C   . ILE A 1 191 ? -21.027 -11.188 4.118   1.00 15.20 ? 366 ILE A C   1 
ATOM   1545 O  O   . ILE A 1 191 ? -20.439 -11.626 3.136   1.00 16.22 ? 366 ILE A O   1 
ATOM   1546 C  CB  . ILE A 1 191 ? -22.852 -9.437  3.895   1.00 15.61 ? 366 ILE A CB  1 
ATOM   1547 C  CG1 . ILE A 1 191 ? -24.388 -9.246  3.998   1.00 17.23 ? 366 ILE A CG1 1 
ATOM   1548 C  CG2 . ILE A 1 191 ? -22.241 -8.930  2.545   1.00 15.03 ? 366 ILE A CG2 1 
ATOM   1549 C  CD1 . ILE A 1 191 ? -24.888 -7.813  3.733   1.00 18.96 ? 366 ILE A CD1 1 
ATOM   1550 N  N   . ARG A 1 192 ? -20.424 -10.898 5.270   1.00 16.31 ? 367 ARG A N   1 
ATOM   1551 C  CA  . ARG A 1 192 ? -19.006 -11.132 5.543   1.00 20.56 ? 367 ARG A CA  1 
ATOM   1552 C  C   . ARG A 1 192 ? -18.593 -12.616 5.213   1.00 20.92 ? 367 ARG A C   1 
ATOM   1553 O  O   . ARG A 1 192 ? -17.487 -12.861 4.737   1.00 20.39 ? 367 ARG A O   1 
ATOM   1554 C  CB  . ARG A 1 192 ? -18.747 -10.759 7.025   1.00 21.88 ? 367 ARG A CB  1 
ATOM   1555 C  CG  . ARG A 1 192 ? -17.336 -10.523 7.434   1.00 29.43 ? 367 ARG A CG  1 
ATOM   1556 C  CD  . ARG A 1 192 ? -17.232 -9.487  8.572   1.00 32.64 ? 367 ARG A CD  1 
ATOM   1557 N  NE  . ARG A 1 192 ? -18.349 -9.591  9.446   1.00 34.68 ? 367 ARG A NE  1 
ATOM   1558 C  CZ  . ARG A 1 192 ? -18.894 -8.589  10.109  1.00 34.26 ? 367 ARG A CZ  1 
ATOM   1559 N  NH1 . ARG A 1 192 ? -18.426 -7.389  9.955   1.00 32.64 ? 367 ARG A NH1 1 
ATOM   1560 N  NH2 . ARG A 1 192 ? -19.942 -8.815  10.905  1.00 34.77 ? 367 ARG A NH2 1 
ATOM   1561 N  N   . LYS A 1 193 ? -19.511 -13.566 5.399   1.00 19.93 ? 368 LYS A N   1 
ATOM   1562 C  CA  . LYS A 1 193 ? -19.236 -15.002 5.195   1.00 21.01 ? 368 LYS A CA  1 
ATOM   1563 C  C   . LYS A 1 193 ? -19.471 -15.541 3.814   1.00 19.95 ? 368 LYS A C   1 
ATOM   1564 O  O   . LYS A 1 193 ? -19.111 -16.663 3.562   1.00 19.71 ? 368 LYS A O   1 
ATOM   1565 C  CB  . LYS A 1 193 ? -20.043 -15.862 6.177   1.00 21.24 ? 368 LYS A CB  1 
ATOM   1566 C  CG  . LYS A 1 193 ? -19.467 -15.641 7.531   1.00 26.20 ? 368 LYS A CG  1 
ATOM   1567 C  CD  . LYS A 1 193 ? -20.348 -16.109 8.649   1.00 35.29 ? 368 LYS A CD  1 
ATOM   1568 C  CE  . LYS A 1 193 ? -19.415 -16.204 9.842   1.00 40.43 ? 368 LYS A CE  1 
ATOM   1569 N  NZ  . LYS A 1 193 ? -19.984 -15.950 11.185  1.00 42.31 ? 368 LYS A NZ  1 
ATOM   1570 N  N   . ILE A 1 194 ? -20.141 -14.783 2.948   1.00 17.57 ? 369 ILE A N   1 
ATOM   1571 C  CA  . ILE A 1 194 ? -20.287 -15.183 1.551   1.00 17.60 ? 369 ILE A CA  1 
ATOM   1572 C  C   . ILE A 1 194 ? -18.924 -15.484 0.907   1.00 18.06 ? 369 ILE A C   1 
ATOM   1573 O  O   . ILE A 1 194 ? -17.982 -14.668 1.031   1.00 16.52 ? 369 ILE A O   1 
ATOM   1574 C  CB  . ILE A 1 194 ? -21.022 -14.106 0.730   1.00 14.57 ? 369 ILE A CB  1 
ATOM   1575 C  CG1 . ILE A 1 194 ? -22.397 -13.865 1.358   1.00 16.17 ? 369 ILE A CG1 1 
ATOM   1576 C  CG2 . ILE A 1 194 ? -21.082 -14.468 -0.792  1.00 16.16 ? 369 ILE A CG2 1 
ATOM   1577 C  CD1 . ILE A 1 194 ? -23.149 -12.736 0.653   1.00 18.20 ? 369 ILE A CD1 1 
ATOM   1578 N  N   . GLU A 1 195 ? -18.838 -16.653 0.259   1.00 17.91 ? 370 GLU A N   1 
ATOM   1579 C  CA  . GLU A 1 195 ? -17.630 -17.095 -0.473  1.00 19.47 ? 370 GLU A CA  1 
ATOM   1580 C  C   . GLU A 1 195 ? -17.871 -16.527 -1.823  1.00 18.37 ? 370 GLU A C   1 
ATOM   1581 O  O   . GLU A 1 195 ? -18.711 -17.032 -2.597  1.00 17.62 ? 370 GLU A O   1 
ATOM   1582 C  CB  . GLU A 1 195 ? -17.602 -18.658 -0.628  1.00 21.92 ? 370 GLU A CB  1 
ATOM   1583 C  CG  . GLU A 1 195 ? -16.863 -19.092 -2.016  1.00 33.41 ? 370 GLU A CG  1 
ATOM   1584 C  CD  . GLU A 1 195 ? -17.314 -20.401 -2.844  1.00 46.23 ? 370 GLU A CD  1 
ATOM   1585 O  OE1 . GLU A 1 195 ? -18.369 -21.115 -2.606  1.00 49.19 ? 370 GLU A OE1 1 
ATOM   1586 O  OE2 . GLU A 1 195 ? -16.533 -20.698 -3.802  1.00 50.06 ? 370 GLU A OE2 1 
ATOM   1587 N  N   . ARG A 1 196 ? -17.230 -15.402 -2.119  1.00 16.79 ? 371 ARG A N   1 
ATOM   1588 C  CA  . ARG A 1 196 ? -17.705 -14.626 -3.242  1.00 15.24 ? 371 ARG A CA  1 
ATOM   1589 C  C   . ARG A 1 196 ? -16.899 -14.896 -4.557  1.00 16.24 ? 371 ARG A C   1 
ATOM   1590 O  O   . ARG A 1 196 ? -17.237 -14.383 -5.659  1.00 14.72 ? 371 ARG A O   1 
ATOM   1591 C  CB  . ARG A 1 196 ? -17.585 -13.123 -2.884  1.00 15.58 ? 371 ARG A CB  1 
ATOM   1592 C  CG  . ARG A 1 196 ? -16.152 -12.654 -2.783  1.00 10.36 ? 371 ARG A CG  1 
ATOM   1593 C  CD  . ARG A 1 196 ? -16.078 -11.150 -2.443  1.00 11.92 ? 371 ARG A CD  1 
ATOM   1594 N  NE  . ARG A 1 196 ? -14.698 -10.689 -2.439  1.00 14.16 ? 371 ARG A NE  1 
ATOM   1595 C  CZ  . ARG A 1 196 ? -13.774 -10.837 -1.499  1.00 16.01 ? 371 ARG A CZ  1 
ATOM   1596 N  NH1 . ARG A 1 196 ? -14.010 -11.436 -0.309  1.00 14.13 ? 371 ARG A NH1 1 
ATOM   1597 N  NH2 . ARG A 1 196 ? -12.551 -10.351 -1.757  1.00 17.94 ? 371 ARG A NH2 1 
ATOM   1598 N  N   . ASN A 1 197 ? -15.820 -15.646 -4.445  1.00 15.35 ? 372 ASN A N   1 
ATOM   1599 C  CA  . ASN A 1 197 ? -14.959 -15.840 -5.637  1.00 18.00 ? 372 ASN A CA  1 
ATOM   1600 C  C   . ASN A 1 197 ? -15.497 -16.855 -6.640  1.00 17.78 ? 372 ASN A C   1 
ATOM   1601 O  O   . ASN A 1 197 ? -15.019 -17.993 -6.705  1.00 20.23 ? 372 ASN A O   1 
ATOM   1602 C  CB  . ASN A 1 197 ? -13.493 -16.155 -5.196  1.00 18.08 ? 372 ASN A CB  1 
ATOM   1603 C  CG  . ASN A 1 197 ? -13.383 -17.414 -4.306  1.00 19.49 ? 372 ASN A CG  1 
ATOM   1604 O  OD1 . ASN A 1 197 ? -14.066 -17.564 -3.276  1.00 21.49 ? 372 ASN A OD1 1 
ATOM   1605 N  ND2 . ASN A 1 197 ? -12.522 -18.329 -4.726  1.00 20.59 ? 372 ASN A ND2 1 
ATOM   1606 N  N   . ARG A 1 198 ? -16.482 -16.433 -7.418  1.00 17.16 ? 373 ARG A N   1 
ATOM   1607 C  CA  . ARG A 1 198 ? -17.300 -17.263 -8.250  1.00 18.01 ? 373 ARG A CA  1 
ATOM   1608 C  C   . ARG A 1 198 ? -18.144 -16.386 -9.163  1.00 17.62 ? 373 ARG A C   1 
ATOM   1609 O  O   . ARG A 1 198 ? -18.237 -15.146 -8.984  1.00 16.66 ? 373 ARG A O   1 
ATOM   1610 C  CB  . ARG A 1 198 ? -18.249 -18.119 -7.369  1.00 18.54 ? 373 ARG A CB  1 
ATOM   1611 C  CG  . ARG A 1 198 ? -18.999 -17.324 -6.286  1.00 18.19 ? 373 ARG A CG  1 
ATOM   1612 C  CD  . ARG A 1 198 ? -20.004 -18.276 -5.586  1.00 20.04 ? 373 ARG A CD  1 
ATOM   1613 N  NE  . ARG A 1 198 ? -20.881 -18.958 -6.542  1.00 25.26 ? 373 ARG A NE  1 
ATOM   1614 C  CZ  . ARG A 1 198 ? -21.822 -19.864 -6.204  1.00 26.70 ? 373 ARG A CZ  1 
ATOM   1615 N  NH1 . ARG A 1 198 ? -21.986 -20.201 -4.937  1.00 25.77 ? 373 ARG A NH1 1 
ATOM   1616 N  NH2 . ARG A 1 198 ? -22.612 -20.405 -7.122  1.00 26.59 ? 373 ARG A NH2 1 
ATOM   1617 N  N   . GLN A 1 199 ? -18.767 -17.023 -10.147 1.00 18.03 ? 374 GLN A N   1 
ATOM   1618 C  CA  . GLN A 1 199 ? -19.867 -16.399 -10.821 1.00 18.05 ? 374 GLN A CA  1 
ATOM   1619 C  C   . GLN A 1 199 ? -21.053 -16.502 -9.861  1.00 19.21 ? 374 GLN A C   1 
ATOM   1620 O  O   . GLN A 1 199 ? -21.219 -17.518 -9.187  1.00 19.43 ? 374 GLN A O   1 
ATOM   1621 C  CB  . GLN A 1 199 ? -20.147 -17.036 -12.185 1.00 17.51 ? 374 GLN A CB  1 
ATOM   1622 C  CG  . GLN A 1 199 ? -18.990 -16.954 -13.169 1.00 17.76 ? 374 GLN A CG  1 
ATOM   1623 C  CD  . GLN A 1 199 ? -18.564 -15.484 -13.404 1.00 18.63 ? 374 GLN A CD  1 
ATOM   1624 O  OE1 . GLN A 1 199 ? -19.325 -14.682 -13.898 1.00 21.24 ? 374 GLN A OE1 1 
ATOM   1625 N  NE2 . GLN A 1 199 ? -17.353 -15.155 -13.019 1.00 12.85 ? 374 GLN A NE2 1 
ATOM   1626 N  N   . PRO A 1 200 ? -21.882 -15.426 -9.763  1.00 19.70 ? 375 PRO A N   1 
ATOM   1627 C  CA  . PRO A 1 200 ? -22.959 -15.530 -8.731  1.00 18.87 ? 375 PRO A CA  1 
ATOM   1628 C  C   . PRO A 1 200 ? -23.951 -16.666 -9.034  1.00 18.73 ? 375 PRO A C   1 
ATOM   1629 O  O   . PRO A 1 200 ? -24.187 -16.995 -10.168 1.00 17.90 ? 375 PRO A O   1 
ATOM   1630 C  CB  . PRO A 1 200 ? -23.688 -14.185 -8.813  1.00 18.73 ? 375 PRO A CB  1 
ATOM   1631 C  CG  . PRO A 1 200 ? -23.232 -13.503 -10.102 1.00 19.13 ? 375 PRO A CG  1 
ATOM   1632 C  CD  . PRO A 1 200 ? -21.933 -14.192 -10.580 1.00 18.78 ? 375 PRO A CD  1 
ATOM   1633 N  N   . PRO A 1 201 ? -24.528 -17.254 -8.006  1.00 19.78 ? 376 PRO A N   1 
ATOM   1634 C  CA  . PRO A 1 201 ? -25.634 -18.208 -8.251  1.00 21.70 ? 376 PRO A CA  1 
ATOM   1635 C  C   . PRO A 1 201 ? -26.912 -17.502 -8.763  1.00 22.87 ? 376 PRO A C   1 
ATOM   1636 O  O   . PRO A 1 201 ? -27.008 -16.244 -8.741  1.00 23.31 ? 376 PRO A O   1 
ATOM   1637 C  CB  . PRO A 1 201 ? -25.857 -18.848 -6.863  1.00 21.51 ? 376 PRO A CB  1 
ATOM   1638 C  CG  . PRO A 1 201 ? -25.439 -17.712 -5.886  1.00 21.61 ? 376 PRO A CG  1 
ATOM   1639 C  CD  . PRO A 1 201 ? -24.246 -17.019 -6.582  1.00 19.56 ? 376 PRO A CD  1 
ATOM   1640 N  N   . ASP A 1 202 ? -27.869 -18.317 -9.201  1.00 24.03 ? 377 ASP A N   1 
ATOM   1641 C  CA  . ASP A 1 202 ? -29.209 -17.913 -9.648  1.00 26.66 ? 377 ASP A CA  1 
ATOM   1642 C  C   . ASP A 1 202 ? -30.054 -17.279 -8.595  1.00 24.77 ? 377 ASP A C   1 
ATOM   1643 O  O   . ASP A 1 202 ? -31.052 -16.668 -8.946  1.00 26.27 ? 377 ASP A O   1 
ATOM   1644 C  CB  . ASP A 1 202 ? -30.046 -19.156 -10.049 1.00 29.25 ? 377 ASP A CB  1 
ATOM   1645 C  CG  . ASP A 1 202 ? -30.209 -19.241 -11.502 1.00 38.11 ? 377 ASP A CG  1 
ATOM   1646 O  OD1 . ASP A 1 202 ? -29.245 -18.748 -12.169 1.00 48.25 ? 377 ASP A OD1 1 
ATOM   1647 O  OD2 . ASP A 1 202 ? -31.262 -19.755 -11.979 1.00 46.93 ? 377 ASP A OD2 1 
ATOM   1648 N  N   . SER A 1 203 ? -29.724 -17.508 -7.336  1.00 23.78 ? 378 SER A N   1 
ATOM   1649 C  CA  . SER A 1 203 ? -30.564 -17.136 -6.205  1.00 24.56 ? 378 SER A CA  1 
ATOM   1650 C  C   . SER A 1 203 ? -29.737 -17.072 -4.953  1.00 23.86 ? 378 SER A C   1 
ATOM   1651 O  O   . SER A 1 203 ? -28.618 -17.595 -4.918  1.00 25.23 ? 378 SER A O   1 
ATOM   1652 C  CB  . SER A 1 203 ? -31.711 -18.176 -5.987  1.00 25.30 ? 378 SER A CB  1 
ATOM   1653 O  OG  . SER A 1 203 ? -31.252 -19.200 -5.119  1.00 27.79 ? 378 SER A OG  1 
ATOM   1654 N  N   . GLY A 1 204 ? -30.256 -16.447 -3.898  1.00 22.14 ? 379 GLY A N   1 
ATOM   1655 C  CA  . GLY A 1 204 ? -29.474 -16.297 -2.684  1.00 20.48 ? 379 GLY A CA  1 
ATOM   1656 C  C   . GLY A 1 204 ? -28.889 -14.880 -2.541  1.00 19.40 ? 379 GLY A C   1 
ATOM   1657 O  O   . GLY A 1 204 ? -28.994 -14.038 -3.444  1.00 16.83 ? 379 GLY A O   1 
ATOM   1658 N  N   . PRO A 1 205 ? -28.244 -14.654 -1.419  1.00 20.44 ? 380 PRO A N   1 
ATOM   1659 C  CA  . PRO A 1 205 ? -27.752 -13.364 -0.885  1.00 19.48 ? 380 PRO A CA  1 
ATOM   1660 C  C   . PRO A 1 205 ? -26.743 -12.778 -1.895  1.00 18.79 ? 380 PRO A C   1 
ATOM   1661 O  O   . PRO A 1 205 ? -26.831 -11.601 -2.252  1.00 16.49 ? 380 PRO A O   1 
ATOM   1662 C  CB  . PRO A 1 205 ? -27.093 -13.730 0.415   1.00 19.55 ? 380 PRO A CB  1 
ATOM   1663 C  CG  . PRO A 1 205 ? -27.769 -15.103 0.815   1.00 22.07 ? 380 PRO A CG  1 
ATOM   1664 C  CD  . PRO A 1 205 ? -28.012 -15.789 -0.512  1.00 22.34 ? 380 PRO A CD  1 
ATOM   1665 N  N   . MET A 1 206 ? -25.837 -13.604 -2.409  1.00 16.82 ? 381 MET A N   1 
ATOM   1666 C  CA  . MET A 1 206 ? -24.887 -13.050 -3.375  1.00 17.55 ? 381 MET A CA  1 
ATOM   1667 C  C   . MET A 1 206 ? -25.577 -12.526 -4.634  1.00 16.13 ? 381 MET A C   1 
ATOM   1668 O  O   . MET A 1 206 ? -25.244 -11.423 -5.150  1.00 15.89 ? 381 MET A O   1 
ATOM   1669 C  CB  . MET A 1 206 ? -23.735 -14.021 -3.713  1.00 16.69 ? 381 MET A CB  1 
ATOM   1670 C  CG  . MET A 1 206 ? -22.901 -13.536 -4.869  1.00 17.41 ? 381 MET A CG  1 
ATOM   1671 S  SD  . MET A 1 206 ? -21.427 -14.644 -5.074  1.00 20.56 ? 381 MET A SD  1 
ATOM   1672 C  CE  . MET A 1 206 ? -20.556 -13.717 -6.364  1.00 13.47 ? 381 MET A CE  1 
ATOM   1673 N  N   . CYS A 1 207 ? -26.566 -13.286 -5.121  1.00 15.15 ? 382 CYS A N   1 
ATOM   1674 C  CA  . CYS A 1 207 ? -27.363 -12.894 -6.246  1.00 14.73 ? 382 CYS A CA  1 
ATOM   1675 C  C   . CYS A 1 207 ? -28.149 -11.618 -5.919  1.00 13.92 ? 382 CYS A C   1 
ATOM   1676 O  O   . CYS A 1 207 ? -28.186 -10.693 -6.723  1.00 13.81 ? 382 CYS A O   1 
ATOM   1677 C  CB  . CYS A 1 207 ? -28.340 -14.000 -6.647  1.00 16.91 ? 382 CYS A CB  1 
ATOM   1678 S  SG  . CYS A 1 207 ? -29.519 -13.581 -7.901  1.00 20.52 ? 382 CYS A SG  1 
ATOM   1679 N  N   . ASP A 1 208 ? -28.792 -11.582 -4.758  1.00 12.59 ? 383 ASP A N   1 
ATOM   1680 C  CA  . ASP A 1 208 ? -29.601 -10.386 -4.397  1.00 13.38 ? 383 ASP A CA  1 
ATOM   1681 C  C   . ASP A 1 208 ? -28.757 -9.076  -4.299  1.00 11.15 ? 383 ASP A C   1 
ATOM   1682 O  O   . ASP A 1 208 ? -29.197 -8.032  -4.682  1.00 11.70 ? 383 ASP A O   1 
ATOM   1683 C  CB  . ASP A 1 208 ? -30.228 -10.630 -3.017  1.00 11.44 ? 383 ASP A CB  1 
ATOM   1684 C  CG  . ASP A 1 208 ? -31.324 -11.749 -3.060  1.00 13.31 ? 383 ASP A CG  1 
ATOM   1685 O  OD1 . ASP A 1 208 ? -31.972 -11.982 -4.097  1.00 13.43 ? 383 ASP A OD1 1 
ATOM   1686 O  OD2 . ASP A 1 208 ? -31.536 -12.341 -2.032  1.00 16.01 ? 383 ASP A OD2 1 
ATOM   1687 N  N   . LEU A 1 209 ? -27.580 -9.151  -3.690  1.00 13.23 ? 384 LEU A N   1 
ATOM   1688 C  CA  . LEU A 1 209 ? -26.699 -7.973  -3.561  1.00 12.89 ? 384 LEU A CA  1 
ATOM   1689 C  C   . LEU A 1 209 ? -26.407 -7.349  -4.887  1.00 14.04 ? 384 LEU A C   1 
ATOM   1690 O  O   . LEU A 1 209 ? -26.363 -6.111  -4.967  1.00 13.79 ? 384 LEU A O   1 
ATOM   1691 C  CB  . LEU A 1 209 ? -25.329 -8.328  -2.880  1.00 14.60 ? 384 LEU A CB  1 
ATOM   1692 C  CG  . LEU A 1 209 ? -25.414 -8.522  -1.378  1.00 15.51 ? 384 LEU A CG  1 
ATOM   1693 C  CD1 . LEU A 1 209 ? -24.209 -9.277  -0.777  1.00 16.46 ? 384 LEU A CD1 1 
ATOM   1694 C  CD2 . LEU A 1 209 ? -25.578 -7.152  -0.724  1.00 18.56 ? 384 LEU A CD2 1 
ATOM   1695 N  N   . LEU A 1 210 ? -26.174 -8.177  -5.916  1.00 12.40 ? 385 LEU A N   1 
ATOM   1696 C  CA  . LEU A 1 210 ? -25.899 -7.690  -7.309  1.00 15.53 ? 385 LEU A CA  1 
ATOM   1697 C  C   . LEU A 1 210 ? -27.083 -7.268  -8.149  1.00 13.53 ? 385 LEU A C   1 
ATOM   1698 O  O   . LEU A 1 210 ? -26.956 -6.456  -9.086  1.00 14.33 ? 385 LEU A O   1 
ATOM   1699 C  CB  . LEU A 1 210 ? -25.056 -8.722  -8.107  1.00 14.49 ? 385 LEU A CB  1 
ATOM   1700 C  CG  . LEU A 1 210 ? -23.770 -9.076  -7.323  1.00 19.26 ? 385 LEU A CG  1 
ATOM   1701 C  CD1 . LEU A 1 210 ? -23.021 -10.292 -7.871  1.00 17.02 ? 385 LEU A CD1 1 
ATOM   1702 C  CD2 . LEU A 1 210 ? -22.817 -7.826  -7.256  1.00 20.47 ? 385 LEU A CD2 1 
ATOM   1703 N  N   . TRP A 1 211 ? -28.238 -7.877  -7.856  1.00 11.60 ? 386 TRP A N   1 
ATOM   1704 C  CA  . TRP A 1 211 ? -29.334 -7.822  -8.789  1.00 12.17 ? 386 TRP A CA  1 
ATOM   1705 C  C   . TRP A 1 211 ? -30.670 -7.211  -8.317  1.00 11.07 ? 386 TRP A C   1 
ATOM   1706 O  O   . TRP A 1 211 ? -31.469 -6.856  -9.170  1.00 9.32  ? 386 TRP A O   1 
ATOM   1707 C  CB  . TRP A 1 211 ? -29.663 -9.244  -9.305  1.00 11.08 ? 386 TRP A CB  1 
ATOM   1708 C  CG  . TRP A 1 211 ? -28.747 -9.724  -10.377 1.00 11.83 ? 386 TRP A CG  1 
ATOM   1709 C  CD1 . TRP A 1 211 ? -27.667 -10.563 -10.240 1.00 14.36 ? 386 TRP A CD1 1 
ATOM   1710 C  CD2 . TRP A 1 211 ? -28.877 -9.460  -11.789 1.00 12.45 ? 386 TRP A CD2 1 
ATOM   1711 N  NE1 . TRP A 1 211 ? -27.106 -10.816 -11.492 1.00 13.82 ? 386 TRP A NE1 1 
ATOM   1712 C  CE2 . TRP A 1 211 ? -27.834 -10.161 -12.452 1.00 12.92 ? 386 TRP A CE2 1 
ATOM   1713 C  CE3 . TRP A 1 211 ? -29.798 -8.741  -12.561 1.00 15.26 ? 386 TRP A CE3 1 
ATOM   1714 C  CZ2 . TRP A 1 211 ? -27.659 -10.078 -13.834 1.00 13.50 ? 386 TRP A CZ2 1 
ATOM   1715 C  CZ3 . TRP A 1 211 ? -29.636 -8.704  -13.918 1.00 16.11 ? 386 TRP A CZ3 1 
ATOM   1716 C  CH2 . TRP A 1 211 ? -28.591 -9.368  -14.541 1.00 12.37 ? 386 TRP A CH2 1 
ATOM   1717 N  N   . SER A 1 212 ? -30.895 -7.059  -7.004  1.00 10.06 ? 387 SER A N   1 
ATOM   1718 C  CA  . SER A 1 212 ? -32.259 -6.690  -6.569  1.00 13.19 ? 387 SER A CA  1 
ATOM   1719 C  C   . SER A 1 212 ? -32.587 -5.163  -6.715  1.00 13.08 ? 387 SER A C   1 
ATOM   1720 O  O   . SER A 1 212 ? -31.656 -4.343  -6.852  1.00 9.20  ? 387 SER A O   1 
ATOM   1721 C  CB  . SER A 1 212 ? -32.484 -7.176  -5.170  1.00 12.62 ? 387 SER A CB  1 
ATOM   1722 O  OG  . SER A 1 212 ? -31.866 -6.289  -4.323  1.00 16.96 ? 387 SER A OG  1 
ATOM   1723 N  N   . ASP A 1 213 ? -33.886 -4.808  -6.738  1.00 12.72 ? 388 ASP A N   1 
ATOM   1724 C  CA  . ASP A 1 213 ? -34.346 -3.368  -6.862  1.00 12.09 ? 388 ASP A CA  1 
ATOM   1725 C  C   . ASP A 1 213 ? -35.403 -3.037  -5.763  1.00 12.73 ? 388 ASP A C   1 
ATOM   1726 O  O   . ASP A 1 213 ? -36.181 -3.921  -5.405  1.00 11.48 ? 388 ASP A O   1 
ATOM   1727 C  CB  . ASP A 1 213 ? -35.012 -3.139  -8.228  1.00 12.70 ? 388 ASP A CB  1 
ATOM   1728 C  CG  . ASP A 1 213 ? -34.054 -3.334  -9.446  1.00 18.11 ? 388 ASP A CG  1 
ATOM   1729 O  OD1 . ASP A 1 213 ? -33.121 -2.518  -9.610  1.00 18.92 ? 388 ASP A OD1 1 
ATOM   1730 O  OD2 . ASP A 1 213 ? -34.302 -4.227  -10.301 1.00 22.20 ? 388 ASP A OD2 1 
ATOM   1731 N  N   . PRO A 1 214 ? -35.389 -1.800  -5.186  1.00 12.40 ? 389 PRO A N   1 
ATOM   1732 C  CA  . PRO A 1 214 ? -36.457 -1.388  -4.276  1.00 12.94 ? 389 PRO A CA  1 
ATOM   1733 C  C   . PRO A 1 214 ? -37.774 -1.196  -5.074  1.00 13.30 ? 389 PRO A C   1 
ATOM   1734 O  O   . PRO A 1 214 ? -37.730 -0.993  -6.245  1.00 14.08 ? 389 PRO A O   1 
ATOM   1735 C  CB  . PRO A 1 214 ? -35.936 -0.046  -3.700  1.00 11.39 ? 389 PRO A CB  1 
ATOM   1736 C  CG  . PRO A 1 214 ? -35.228 0.597   -4.872  1.00 11.78 ? 389 PRO A CG  1 
ATOM   1737 C  CD  . PRO A 1 214 ? -34.491 -0.668  -5.521  1.00 12.25 ? 389 PRO A CD  1 
ATOM   1738 N  N   . GLN A 1 215 ? -38.935 -1.341  -4.423  1.00 13.64 ? 390 GLN A N   1 
ATOM   1739 C  CA  . GLN A 1 215 ? -40.202 -1.006  -5.007  1.00 12.92 ? 390 GLN A CA  1 
ATOM   1740 C  C   . GLN A 1 215 ? -40.892 -0.143  -3.953  1.00 12.23 ? 390 GLN A C   1 
ATOM   1741 O  O   . GLN A 1 215 ? -40.548 -0.204  -2.772  1.00 10.38 ? 390 GLN A O   1 
ATOM   1742 C  CB  . GLN A 1 215 ? -41.053 -2.256  -5.327  1.00 13.88 ? 390 GLN A CB  1 
ATOM   1743 C  CG  . GLN A 1 215 ? -41.171 -3.200  -4.084  1.00 10.02 ? 390 GLN A CG  1 
ATOM   1744 C  CD  . GLN A 1 215 ? -42.194 -4.319  -4.208  1.00 12.82 ? 390 GLN A CD  1 
ATOM   1745 O  OE1 . GLN A 1 215 ? -42.386 -4.841  -5.280  1.00 14.26 ? 390 GLN A OE1 1 
ATOM   1746 N  NE2 . GLN A 1 215 ? -42.891 -4.659  -3.087  1.00 10.69 ? 390 GLN A NE2 1 
ATOM   1747 N  N   . PRO A 1 216 ? -41.864 0.669   -4.393  1.00 13.45 ? 391 PRO A N   1 
ATOM   1748 C  CA  . PRO A 1 216 ? -42.492 1.594   -3.456  1.00 15.13 ? 391 PRO A CA  1 
ATOM   1749 C  C   . PRO A 1 216 ? -43.431 0.920   -2.464  1.00 15.82 ? 391 PRO A C   1 
ATOM   1750 O  O   . PRO A 1 216 ? -43.530 1.362   -1.321  1.00 17.44 ? 391 PRO A O   1 
ATOM   1751 C  CB  . PRO A 1 216 ? -43.262 2.589   -4.364  1.00 14.28 ? 391 PRO A CB  1 
ATOM   1752 C  CG  . PRO A 1 216 ? -43.409 1.949   -5.659  1.00 15.57 ? 391 PRO A CG  1 
ATOM   1753 C  CD  . PRO A 1 216 ? -42.319 0.857   -5.781  1.00 12.94 ? 391 PRO A CD  1 
ATOM   1754 N  N   . GLN A 1 217 ? -44.068 -0.154  -2.888  1.00 16.64 ? 392 GLN A N   1 
ATOM   1755 C  CA  . GLN A 1 217 ? -45.070 -0.826  -2.051  1.00 17.72 ? 392 GLN A CA  1 
ATOM   1756 C  C   . GLN A 1 217 ? -44.510 -1.894  -1.105  1.00 16.84 ? 392 GLN A C   1 
ATOM   1757 O  O   . GLN A 1 217 ? -43.480 -2.540  -1.385  1.00 14.99 ? 392 GLN A O   1 
ATOM   1758 C  CB  . GLN A 1 217 ? -46.185 -1.375  -2.942  1.00 18.46 ? 392 GLN A CB  1 
ATOM   1759 C  CG  . GLN A 1 217 ? -45.905 -2.662  -3.605  1.00 19.41 ? 392 GLN A CG  1 
ATOM   1760 C  CD  . GLN A 1 217 ? -45.253 -2.524  -4.983  1.00 19.78 ? 392 GLN A CD  1 
ATOM   1761 O  OE1 . GLN A 1 217 ? -44.467 -1.607  -5.243  1.00 17.70 ? 392 GLN A OE1 1 
ATOM   1762 N  NE2 . GLN A 1 217 ? -45.523 -3.499  -5.837  1.00 24.13 ? 392 GLN A NE2 1 
ATOM   1763 N  N   . ASN A 1 218 ? -45.170 -2.099  0.030   1.00 15.11 ? 393 ASN A N   1 
ATOM   1764 C  CA  . ASN A 1 218 ? -44.661 -3.056  0.994   1.00 16.41 ? 393 ASN A CA  1 
ATOM   1765 C  C   . ASN A 1 218 ? -44.641 -4.471  0.408   1.00 14.88 ? 393 ASN A C   1 
ATOM   1766 O  O   . ASN A 1 218 ? -45.485 -4.765  -0.378  1.00 17.00 ? 393 ASN A O   1 
ATOM   1767 C  CB  . ASN A 1 218 ? -45.492 -3.058  2.267   1.00 16.55 ? 393 ASN A CB  1 
ATOM   1768 C  CG  . ASN A 1 218 ? -45.167 -1.893  3.197   1.00 21.04 ? 393 ASN A CG  1 
ATOM   1769 O  OD1 . ASN A 1 218 ? -44.035 -1.416  3.272   1.00 22.32 ? 393 ASN A OD1 1 
ATOM   1770 N  ND2 . ASN A 1 218 ? -46.192 -1.418  3.903   1.00 22.72 ? 393 ASN A ND2 1 
ATOM   1771 N  N   . GLY A 1 219 ? -43.688 -5.314  0.807   1.00 15.03 ? 394 GLY A N   1 
ATOM   1772 C  CA  . GLY A 1 219 ? -43.669 -6.758  0.483   1.00 14.24 ? 394 GLY A CA  1 
ATOM   1773 C  C   . GLY A 1 219 ? -42.407 -7.032  -0.363  1.00 14.85 ? 394 GLY A C   1 
ATOM   1774 O  O   . GLY A 1 219 ? -41.415 -6.310  -0.261  1.00 16.14 ? 394 GLY A O   1 
ATOM   1775 N  N   . ARG A 1 220 ? -42.506 -8.022  -1.232  1.00 13.82 ? 395 ARG A N   1 
ATOM   1776 C  CA  . ARG A 1 220 ? -41.470 -8.408  -2.200  1.00 15.10 ? 395 ARG A CA  1 
ATOM   1777 C  C   . ARG A 1 220 ? -42.180 -8.884  -3.426  1.00 14.78 ? 395 ARG A C   1 
ATOM   1778 O  O   . ARG A 1 220 ? -43.273 -9.490  -3.326  1.00 14.34 ? 395 ARG A O   1 
ATOM   1779 C  CB  . ARG A 1 220 ? -40.558 -9.526  -1.669  1.00 13.02 ? 395 ARG A CB  1 
ATOM   1780 C  CG  . ARG A 1 220 ? -39.595 -9.122  -0.531  1.00 13.68 ? 395 ARG A CG  1 
ATOM   1781 C  CD  . ARG A 1 220 ? -38.657 -10.363 -0.186  1.00 13.50 ? 395 ARG A CD  1 
ATOM   1782 N  NE  . ARG A 1 220 ? -37.559 -10.052 0.747   1.00 11.55 ? 395 ARG A NE  1 
ATOM   1783 C  CZ  . ARG A 1 220 ? -37.646 -10.013 2.074   1.00 11.51 ? 395 ARG A CZ  1 
ATOM   1784 N  NH1 . ARG A 1 220 ? -38.828 -10.209 2.689   1.00 10.33 ? 395 ARG A NH1 1 
ATOM   1785 N  NH2 . ARG A 1 220 ? -36.572 -9.653  2.798   1.00 9.79  ? 395 ARG A NH2 1 
ATOM   1786 N  N   . SER A 1 221 ? -41.614 -8.580  -4.592  1.00 14.15 ? 396 SER A N   1 
ATOM   1787 C  CA  . SER A 1 221 ? -42.165 -9.012  -5.849  1.00 14.85 ? 396 SER A CA  1 
ATOM   1788 C  C   . SER A 1 221 ? -41.117 -9.698  -6.643  1.00 16.54 ? 396 SER A C   1 
ATOM   1789 O  O   . SER A 1 221 ? -39.924 -9.379  -6.536  1.00 14.64 ? 396 SER A O   1 
ATOM   1790 C  CB  . SER A 1 221 ? -42.655 -7.859  -6.701  1.00 17.69 ? 396 SER A CB  1 
ATOM   1791 O  OG  . SER A 1 221 ? -43.624 -7.095  -6.051  1.00 18.33 ? 396 SER A OG  1 
ATOM   1792 N  N   . ILE A 1 222 ? -41.568 -10.619 -7.478  1.00 16.75 ? 397 ILE A N   1 
ATOM   1793 C  CA  . ILE A 1 222 ? -40.677 -11.228 -8.451  1.00 19.48 ? 397 ILE A CA  1 
ATOM   1794 C  C   . ILE A 1 222 ? -40.035 -10.128 -9.359  1.00 19.87 ? 397 ILE A C   1 
ATOM   1795 O  O   . ILE A 1 222 ? -40.738 -9.249  -9.852  1.00 20.14 ? 397 ILE A O   1 
ATOM   1796 C  CB  . ILE A 1 222 ? -41.417 -12.324 -9.213  1.00 18.66 ? 397 ILE A CB  1 
ATOM   1797 C  CG1 . ILE A 1 222 ? -41.615 -13.495 -8.232  1.00 21.73 ? 397 ILE A CG1 1 
ATOM   1798 C  CG2 . ILE A 1 222 ? -40.625 -12.829 -10.368 1.00 20.45 ? 397 ILE A CG2 1 
ATOM   1799 C  CD1 . ILE A 1 222 ? -42.745 -14.358 -8.658  1.00 29.19 ? 397 ILE A CD1 1 
ATOM   1800 N  N   . SER A 1 223 ? -38.720 -10.156 -9.515  1.00 19.27 ? 398 SER A N   1 
ATOM   1801 C  CA  . SER A 1 223 ? -38.048 -9.126  -10.311 1.00 21.30 ? 398 SER A CA  1 
ATOM   1802 C  C   . SER A 1 223 ? -38.460 -9.117  -11.795 1.00 22.30 ? 398 SER A C   1 
ATOM   1803 O  O   . SER A 1 223 ? -38.541 -10.162 -12.434 1.00 22.57 ? 398 SER A O   1 
ATOM   1804 C  CB  . SER A 1 223 ? -36.499 -9.232  -10.169 1.00 20.97 ? 398 SER A CB  1 
ATOM   1805 O  OG  . SER A 1 223 ? -35.876 -8.473  -11.199 1.00 22.71 ? 398 SER A OG  1 
ATOM   1806 N  N   . LYS A 1 224 ? -38.652 -7.945  -12.386 1.00 24.39 ? 399 LYS A N   1 
ATOM   1807 C  CA  . LYS A 1 224 ? -38.789 -7.880  -13.860 1.00 26.98 ? 399 LYS A CA  1 
ATOM   1808 C  C   . LYS A 1 224 ? -37.487 -8.244  -14.569 1.00 26.68 ? 399 LYS A C   1 
ATOM   1809 O  O   . LYS A 1 224 ? -37.484 -8.439  -15.827 1.00 27.55 ? 399 LYS A O   1 
ATOM   1810 C  CB  . LYS A 1 224 ? -39.214 -6.468  -14.355 1.00 29.04 ? 399 LYS A CB  1 
ATOM   1811 C  CG  . LYS A 1 224 ? -40.159 -5.680  -13.410 1.00 35.25 ? 399 LYS A CG  1 
ATOM   1812 C  CD  . LYS A 1 224 ? -40.396 -4.200  -13.888 1.00 41.96 ? 399 LYS A CD  1 
ATOM   1813 C  CE  . LYS A 1 224 ? -39.094 -3.321  -13.851 1.00 45.35 ? 399 LYS A CE  1 
ATOM   1814 N  NZ  . LYS A 1 224 ? -39.079 -2.198  -14.899 1.00 48.32 ? 399 LYS A NZ  1 
ATOM   1815 N  N   . ARG A 1 225 ? -36.375 -8.316  -13.829 1.00 24.40 ? 400 ARG A N   1 
ATOM   1816 C  CA  . ARG A 1 225 ? -35.118 -8.691  -14.503 1.00 23.42 ? 400 ARG A CA  1 
ATOM   1817 C  C   . ARG A 1 225 ? -34.989 -10.220 -14.665 1.00 24.14 ? 400 ARG A C   1 
ATOM   1818 O  O   . ARG A 1 225 ? -34.058 -10.696 -15.304 1.00 22.06 ? 400 ARG A O   1 
ATOM   1819 C  CB  . ARG A 1 225 ? -33.888 -8.168  -13.768 1.00 21.71 ? 400 ARG A CB  1 
ATOM   1820 C  CG  . ARG A 1 225 ? -33.986 -6.676  -13.540 1.00 22.95 ? 400 ARG A CG  1 
ATOM   1821 C  CD  . ARG A 1 225 ? -32.773 -6.257  -12.863 1.00 17.28 ? 400 ARG A CD  1 
ATOM   1822 N  NE  . ARG A 1 225 ? -32.739 -4.890  -12.396 1.00 15.91 ? 400 ARG A NE  1 
ATOM   1823 C  CZ  . ARG A 1 225 ? -32.002 -3.949  -12.976 1.00 19.78 ? 400 ARG A CZ  1 
ATOM   1824 N  NH1 . ARG A 1 225 ? -31.346 -4.225  -14.109 1.00 17.78 ? 400 ARG A NH1 1 
ATOM   1825 N  NH2 . ARG A 1 225 ? -31.964 -2.738  -12.460 1.00 12.80 ? 400 ARG A NH2 1 
ATOM   1826 N  N   . GLY A 1 226 ? -35.894 -10.972 -14.016 1.00 24.06 ? 401 GLY A N   1 
ATOM   1827 C  CA  . GLY A 1 226 ? -35.821 -12.434 -14.060 1.00 23.95 ? 401 GLY A CA  1 
ATOM   1828 C  C   . GLY A 1 226 ? -34.899 -13.111 -13.069 1.00 23.87 ? 401 GLY A C   1 
ATOM   1829 O  O   . GLY A 1 226 ? -34.726 -14.316 -13.128 1.00 25.79 ? 401 GLY A O   1 
ATOM   1830 N  N   . VAL A 1 227 ? -34.285 -12.347 -12.175 1.00 22.50 ? 402 VAL A N   1 
ATOM   1831 C  CA  . VAL A 1 227 ? -33.423 -12.876 -11.133 1.00 20.88 ? 402 VAL A CA  1 
ATOM   1832 C  C   . VAL A 1 227 ? -33.634 -11.995 -9.890  1.00 18.05 ? 402 VAL A C   1 
ATOM   1833 O  O   . VAL A 1 227 ? -33.874 -10.843 -10.042 1.00 17.98 ? 402 VAL A O   1 
ATOM   1834 C  CB  . VAL A 1 227 ? -31.937 -12.790 -11.642 1.00 23.33 ? 402 VAL A CB  1 
ATOM   1835 C  CG1 . VAL A 1 227 ? -31.791 -11.609 -12.498 1.00 24.75 ? 402 VAL A CG1 1 
ATOM   1836 C  CG2 . VAL A 1 227 ? -30.997 -12.595 -10.628 1.00 19.01 ? 402 VAL A CG2 1 
ATOM   1837 N  N   . SER A 1 228 ? -33.501 -12.545 -8.683  1.00 17.34 ? 403 SER A N   1 
ATOM   1838 C  CA  . SER A 1 228 ? -33.656 -11.835 -7.443  1.00 16.15 ? 403 SER A CA  1 
ATOM   1839 C  C   . SER A 1 228 ? -35.079 -11.258 -7.327  1.00 15.46 ? 403 SER A C   1 
ATOM   1840 O  O   . SER A 1 228 ? -36.011 -11.785 -7.954  1.00 14.63 ? 403 SER A O   1 
ATOM   1841 C  CB  . SER A 1 228 ? -32.601 -10.709 -7.374  1.00 16.13 ? 403 SER A CB  1 
ATOM   1842 O  OG  . SER A 1 228 ? -32.558 -10.145 -6.107  1.00 15.76 ? 403 SER A OG  1 
ATOM   1843 N  N   . CYS A 1 229 ? -35.238 -10.151 -6.597  1.00 14.85 ? 404 CYS A N   1 
ATOM   1844 C  CA  . CYS A 1 229 ? -36.617 -9.628  -6.373  1.00 15.09 ? 404 CYS A CA  1 
ATOM   1845 C  C   . CYS A 1 229 ? -36.629 -8.098  -6.306  1.00 14.60 ? 404 CYS A C   1 
ATOM   1846 O  O   . CYS A 1 229 ? -35.570 -7.447  -6.287  1.00 13.50 ? 404 CYS A O   1 
ATOM   1847 C  CB  . CYS A 1 229 ? -37.158 -10.220 -5.025  1.00 14.07 ? 404 CYS A CB  1 
ATOM   1848 S  SG  . CYS A 1 229 ? -36.351 -9.548  -3.503  1.00 19.29 ? 404 CYS A SG  1 
ATOM   1849 N  N   . GLN A 1 230 ? -37.827 -7.523  -6.234  1.00 12.62 ? 405 GLN A N   1 
ATOM   1850 C  CA  . GLN A 1 230 ? -38.008 -6.156  -5.750  1.00 12.13 ? 405 GLN A CA  1 
ATOM   1851 C  C   . GLN A 1 230 ? -38.429 -6.181  -4.251  1.00 11.88 ? 405 GLN A C   1 
ATOM   1852 O  O   . GLN A 1 230 ? -39.205 -7.029  -3.835  1.00 10.51 ? 405 GLN A O   1 
ATOM   1853 C  CB  . GLN A 1 230 ? -39.105 -5.469  -6.568  1.00 12.50 ? 405 GLN A CB  1 
ATOM   1854 C  CG  . GLN A 1 230 ? -38.831 -5.554  -8.015  1.00 15.43 ? 405 GLN A CG  1 
ATOM   1855 C  CD  . GLN A 1 230 ? -39.979 -5.197  -8.914  1.00 24.21 ? 405 GLN A CD  1 
ATOM   1856 O  OE1 . GLN A 1 230 ? -40.107 -5.814  -9.961  1.00 36.24 ? 405 GLN A OE1 1 
ATOM   1857 N  NE2 . GLN A 1 230 ? -40.811 -4.211  -8.547  1.00 23.29 ? 405 GLN A NE2 1 
ATOM   1858 N  N   . PHE A 1 231 ? -37.928 -5.236  -3.465  1.00 9.51  ? 406 PHE A N   1 
ATOM   1859 C  CA  . PHE A 1 231 ? -38.117 -5.217  -2.001  1.00 10.96 ? 406 PHE A CA  1 
ATOM   1860 C  C   . PHE A 1 231 ? -38.751 -3.867  -1.585  1.00 10.55 ? 406 PHE A C   1 
ATOM   1861 O  O   . PHE A 1 231 ? -38.359 -2.788  -2.095  1.00 10.40 ? 406 PHE A O   1 
ATOM   1862 C  CB  . PHE A 1 231 ? -36.803 -5.511  -1.240  1.00 8.89  ? 406 PHE A CB  1 
ATOM   1863 C  CG  . PHE A 1 231 ? -35.650 -4.471  -1.523  1.00 11.03 ? 406 PHE A CG  1 
ATOM   1864 C  CD1 . PHE A 1 231 ? -34.751 -4.670  -2.600  1.00 12.57 ? 406 PHE A CD1 1 
ATOM   1865 C  CD2 . PHE A 1 231 ? -35.452 -3.367  -0.698  1.00 11.13 ? 406 PHE A CD2 1 
ATOM   1866 C  CE1 . PHE A 1 231 ? -33.716 -3.756  -2.927  1.00 9.14  ? 406 PHE A CE1 1 
ATOM   1867 C  CE2 . PHE A 1 231 ? -34.417 -2.430  -0.971  1.00 11.91 ? 406 PHE A CE2 1 
ATOM   1868 C  CZ  . PHE A 1 231 ? -33.537 -2.598  -2.109  1.00 10.07 ? 406 PHE A CZ  1 
ATOM   1869 N  N   . GLY A 1 232 ? -39.728 -3.934  -0.693  1.00 12.79 ? 407 GLY A N   1 
ATOM   1870 C  CA  . GLY A 1 232 ? -40.492 -2.720  -0.336  1.00 11.35 ? 407 GLY A CA  1 
ATOM   1871 C  C   . GLY A 1 232 ? -39.891 -2.067  0.892   1.00 10.29 ? 407 GLY A C   1 
ATOM   1872 O  O   . GLY A 1 232 ? -38.951 -2.583  1.488   1.00 9.63  ? 407 GLY A O   1 
ATOM   1873 N  N   . PRO A 1 233 ? -40.472 -0.935  1.307   1.00 11.82 ? 408 PRO A N   1 
ATOM   1874 C  CA  . PRO A 1 233 ? -39.889 -0.179  2.432   1.00 11.42 ? 408 PRO A CA  1 
ATOM   1875 C  C   . PRO A 1 233 ? -39.868 -0.970  3.725   1.00 11.33 ? 408 PRO A C   1 
ATOM   1876 O  O   . PRO A 1 233 ? -39.024 -0.690  4.595   1.00 10.52 ? 408 PRO A O   1 
ATOM   1877 C  CB  . PRO A 1 233 ? -40.833 1.056   2.590   1.00 12.80 ? 408 PRO A CB  1 
ATOM   1878 C  CG  . PRO A 1 233 ? -41.636 1.097   1.379   1.00 14.33 ? 408 PRO A CG  1 
ATOM   1879 C  CD  . PRO A 1 233 ? -41.697 -0.301  0.758   1.00 10.13 ? 408 PRO A CD  1 
ATOM   1880 N  N   . ASP A 1 234 ? -40.820 -1.905  3.886   1.00 10.46 ? 409 ASP A N   1 
ATOM   1881 C  CA  . ASP A 1 234 ? -40.864 -2.700  5.102   1.00 11.35 ? 409 ASP A CA  1 
ATOM   1882 C  C   . ASP A 1 234 ? -39.639 -3.638  5.179   1.00 11.35 ? 409 ASP A C   1 
ATOM   1883 O  O   . ASP A 1 234 ? -39.085 -3.868  6.271   1.00 12.07 ? 409 ASP A O   1 
ATOM   1884 C  CB  . ASP A 1 234 ? -42.182 -3.526  5.232   1.00 10.56 ? 409 ASP A CB  1 
ATOM   1885 C  CG  . ASP A 1 234 ? -42.556 -4.293  3.961   1.00 10.84 ? 409 ASP A CG  1 
ATOM   1886 O  OD1 . ASP A 1 234 ? -41.957 -4.100  2.835   1.00 14.64 ? 409 ASP A OD1 1 
ATOM   1887 O  OD2 . ASP A 1 234 ? -43.510 -5.150  4.036   1.00 15.80 ? 409 ASP A OD2 1 
ATOM   1888 N  N   . VAL A 1 235 ? -39.179 -4.104  4.021   1.00 11.10 ? 410 VAL A N   1 
ATOM   1889 C  CA  . VAL A 1 235 ? -37.996 -5.001  4.012   1.00 10.82 ? 410 VAL A CA  1 
ATOM   1890 C  C   . VAL A 1 235 ? -36.786 -4.142  4.465   1.00 11.80 ? 410 VAL A C   1 
ATOM   1891 O  O   . VAL A 1 235 ? -35.951 -4.539  5.303   1.00 10.67 ? 410 VAL A O   1 
ATOM   1892 C  CB  . VAL A 1 235 ? -37.741 -5.545  2.552   1.00 10.96 ? 410 VAL A CB  1 
ATOM   1893 C  CG1 . VAL A 1 235 ? -36.284 -6.109  2.391   1.00 8.83  ? 410 VAL A CG1 1 
ATOM   1894 C  CG2 . VAL A 1 235 ? -38.854 -6.602  2.067   1.00 8.24  ? 410 VAL A CG2 1 
ATOM   1895 N  N   . THR A 1 236 ? -36.697 -2.923  3.898   1.00 11.22 ? 411 THR A N   1 
ATOM   1896 C  CA  . THR A 1 236 ? -35.538 -2.089  4.207   1.00 11.49 ? 411 THR A CA  1 
ATOM   1897 C  C   . THR A 1 236 ? -35.507 -1.744  5.680   1.00 10.84 ? 411 THR A C   1 
ATOM   1898 O  O   . THR A 1 236 ? -34.487 -1.864  6.347   1.00 10.06 ? 411 THR A O   1 
ATOM   1899 C  CB  . THR A 1 236 ? -35.513 -0.841  3.263   1.00 10.97 ? 411 THR A CB  1 
ATOM   1900 O  OG1 . THR A 1 236 ? -35.510 -1.297  1.920   1.00 11.68 ? 411 THR A OG1 1 
ATOM   1901 C  CG2 . THR A 1 236 ? -34.221 -0.004  3.511   1.00 10.20 ? 411 THR A CG2 1 
ATOM   1902 N  N   . LYS A 1 237 ? -36.658 -1.316  6.220   1.00 10.09 ? 412 LYS A N   1 
ATOM   1903 C  CA  . LYS A 1 237 ? -36.733 -0.998  7.600   1.00 12.89 ? 412 LYS A CA  1 
ATOM   1904 C  C   . LYS A 1 237 ? -36.329 -2.153  8.524   1.00 13.20 ? 412 LYS A C   1 
ATOM   1905 O  O   . LYS A 1 237 ? -35.627 -1.950  9.498   1.00 13.04 ? 412 LYS A O   1 
ATOM   1906 C  CB  . LYS A 1 237 ? -38.183 -0.534  7.931   1.00 13.42 ? 412 LYS A CB  1 
ATOM   1907 C  CG  . LYS A 1 237 ? -38.364 0.012   9.300   1.00 20.90 ? 412 LYS A CG  1 
ATOM   1908 C  CD  . LYS A 1 237 ? -39.738 0.725   9.406   1.00 29.69 ? 412 LYS A CD  1 
ATOM   1909 C  CE  . LYS A 1 237 ? -39.919 1.439   10.767  1.00 36.42 ? 412 LYS A CE  1 
ATOM   1910 N  NZ  . LYS A 1 237 ? -39.370 0.536   11.815  1.00 42.61 ? 412 LYS A NZ  1 
ATOM   1911 N  N   . ALA A 1 238 ? -36.842 -3.348  8.278   1.00 12.12 ? 413 ALA A N   1 
ATOM   1912 C  CA  . ALA A 1 238 ? -36.485 -4.497  9.127   1.00 12.29 ? 413 ALA A CA  1 
ATOM   1913 C  C   . ALA A 1 238 ? -34.966 -4.774  9.056   1.00 11.52 ? 413 ALA A C   1 
ATOM   1914 O  O   . ALA A 1 238 ? -34.361 -5.093  10.034  1.00 12.69 ? 413 ALA A O   1 
ATOM   1915 C  CB  . ALA A 1 238 ? -37.259 -5.792  8.669   1.00 9.04  ? 413 ALA A CB  1 
ATOM   1916 N  N   . PHE A 1 239 ? -34.399 -4.704  7.857   1.00 12.80 ? 414 PHE A N   1 
ATOM   1917 C  CA  . PHE A 1 239 ? -32.957 -4.982  7.671   1.00 12.40 ? 414 PHE A CA  1 
ATOM   1918 C  C   . PHE A 1 239 ? -32.086 -3.943  8.447   1.00 12.71 ? 414 PHE A C   1 
ATOM   1919 O  O   . PHE A 1 239 ? -31.194 -4.317  9.212   1.00 11.40 ? 414 PHE A O   1 
ATOM   1920 C  CB  . PHE A 1 239 ? -32.641 -5.029  6.166   1.00 11.30 ? 414 PHE A CB  1 
ATOM   1921 C  CG  . PHE A 1 239 ? -31.174 -5.255  5.873   1.00 10.74 ? 414 PHE A CG  1 
ATOM   1922 C  CD1 . PHE A 1 239 ? -30.664 -6.553  5.762   1.00 11.17 ? 414 PHE A CD1 1 
ATOM   1923 C  CD2 . PHE A 1 239 ? -30.328 -4.170  5.743   1.00 9.72  ? 414 PHE A CD2 1 
ATOM   1924 C  CE1 . PHE A 1 239 ? -29.292 -6.795  5.535   1.00 12.65 ? 414 PHE A CE1 1 
ATOM   1925 C  CE2 . PHE A 1 239 ? -28.998 -4.364  5.500   1.00 13.17 ? 414 PHE A CE2 1 
ATOM   1926 C  CZ  . PHE A 1 239 ? -28.446 -5.683  5.394   1.00 13.30 ? 414 PHE A CZ  1 
ATOM   1927 N  N   . LEU A 1 240 ? -32.390 -2.652  8.245   1.00 11.45 ? 415 LEU A N   1 
ATOM   1928 C  CA  . LEU A 1 240 ? -31.693 -1.585  8.936   1.00 11.72 ? 415 LEU A CA  1 
ATOM   1929 C  C   . LEU A 1 240 ? -31.814 -1.750  10.463  1.00 12.36 ? 415 LEU A C   1 
ATOM   1930 O  O   . LEU A 1 240 ? -30.838 -1.604  11.188  1.00 12.97 ? 415 LEU A O   1 
ATOM   1931 C  CB  . LEU A 1 240 ? -32.197 -0.208  8.459   1.00 11.45 ? 415 LEU A CB  1 
ATOM   1932 C  CG  . LEU A 1 240 ? -31.973 0.086   6.972   1.00 11.29 ? 415 LEU A CG  1 
ATOM   1933 C  CD1 . LEU A 1 240 ? -32.731 1.372   6.597   1.00 13.95 ? 415 LEU A CD1 1 
ATOM   1934 C  CD2 . LEU A 1 240 ? -30.443 0.199   6.640   1.00 16.00 ? 415 LEU A CD2 1 
ATOM   1935 N  N   . GLU A 1 241 ? -33.007 -2.115  10.950  1.00 12.48 ? 416 GLU A N   1 
ATOM   1936 C  CA  . GLU A 1 241 ? -33.209 -2.265  12.407  1.00 13.92 ? 416 GLU A CA  1 
ATOM   1937 C  C   . GLU A 1 241 ? -32.381 -3.419  12.939  1.00 14.78 ? 416 GLU A C   1 
ATOM   1938 O  O   . GLU A 1 241 ? -31.674 -3.263  13.927  1.00 13.81 ? 416 GLU A O   1 
ATOM   1939 C  CB  . GLU A 1 241 ? -34.699 -2.476  12.722  0.50 12.90 ? 416 GLU A CB  1 
ATOM   1940 C  CG  . GLU A 1 241 ? -35.419 -1.145  12.586  0.50 17.76 ? 416 GLU A CG  1 
ATOM   1941 C  CD  . GLU A 1 241 ? -36.950 -1.155  12.579  0.50 24.52 ? 416 GLU A CD  1 
ATOM   1942 O  OE1 . GLU A 1 241 ? -37.606 -2.019  11.930  0.50 28.32 ? 416 GLU A OE1 1 
ATOM   1943 O  OE2 . GLU A 1 241 ? -37.490 -0.197  13.180  0.50 24.99 ? 416 GLU A OE2 1 
ATOM   1944 N  N   . GLU A 1 242 ? -32.436 -4.563  12.284  1.00 14.38 ? 417 GLU A N   1 
ATOM   1945 C  CA  . GLU A 1 242 ? -31.673 -5.724  12.810  1.00 16.78 ? 417 GLU A CA  1 
ATOM   1946 C  C   . GLU A 1 242 ? -30.166 -5.458  12.818  1.00 16.04 ? 417 GLU A C   1 
ATOM   1947 O  O   . GLU A 1 242 ? -29.421 -5.977  13.670  1.00 16.38 ? 417 GLU A O   1 
ATOM   1948 C  CB  . GLU A 1 242 ? -31.918 -6.993  11.935  1.00 14.41 ? 417 GLU A CB  1 
ATOM   1949 C  CG  . GLU A 1 242 ? -31.311 -8.268  12.537  1.00 22.42 ? 417 GLU A CG  1 
ATOM   1950 C  CD  . GLU A 1 242 ? -31.708 -9.573  11.852  1.00 24.73 ? 417 GLU A CD  1 
ATOM   1951 O  OE1 . GLU A 1 242 ? -31.256 -10.614 12.372  1.00 27.74 ? 417 GLU A OE1 1 
ATOM   1952 O  OE2 . GLU A 1 242 ? -32.501 -9.580  10.854  1.00 30.00 ? 417 GLU A OE2 1 
ATOM   1953 N  N   . ASN A 1 243 ? -29.696 -4.751  11.797  1.00 15.38 ? 418 ASN A N   1 
ATOM   1954 C  CA  . ASN A 1 243 ? -28.259 -4.556  11.624  1.00 14.99 ? 418 ASN A CA  1 
ATOM   1955 C  C   . ASN A 1 243 ? -27.742 -3.250  12.238  1.00 16.42 ? 418 ASN A C   1 
ATOM   1956 O  O   . ASN A 1 243 ? -26.587 -2.907  12.067  1.00 17.48 ? 418 ASN A O   1 
ATOM   1957 C  CB  . ASN A 1 243 ? -27.920 -4.675  10.119  1.00 13.87 ? 418 ASN A CB  1 
ATOM   1958 C  CG  . ASN A 1 243 ? -28.076 -6.111  9.658   1.00 14.51 ? 418 ASN A CG  1 
ATOM   1959 O  OD1 . ASN A 1 243 ? -27.308 -6.937  10.089  1.00 18.20 ? 418 ASN A OD1 1 
ATOM   1960 N  ND2 . ASN A 1 243 ? -29.123 -6.425  8.895   1.00 12.05 ? 418 ASN A ND2 1 
ATOM   1961 N  N   . ASN A 1 244 ? -28.640 -2.513  12.899  1.00 17.56 ? 419 ASN A N   1 
ATOM   1962 C  CA  . ASN A 1 244 ? -28.314 -1.201  13.466  1.00 17.97 ? 419 ASN A CA  1 
ATOM   1963 C  C   . ASN A 1 244 ? -27.730 -0.196  12.472  1.00 16.92 ? 419 ASN A C   1 
ATOM   1964 O  O   . ASN A 1 244 ? -26.750 0.541   12.757  1.00 15.73 ? 419 ASN A O   1 
ATOM   1965 C  CB  . ASN A 1 244 ? -27.402 -1.373  14.669  1.00 20.13 ? 419 ASN A CB  1 
ATOM   1966 C  CG  . ASN A 1 244 ? -27.961 -0.691  15.859  1.00 30.01 ? 419 ASN A CG  1 
ATOM   1967 O  OD1 . ASN A 1 244 ? -27.601 0.459   16.153  1.00 36.20 ? 419 ASN A OD1 1 
ATOM   1968 N  ND2 . ASN A 1 244 ? -28.969 -1.360  16.519  1.00 35.24 ? 419 ASN A ND2 1 
ATOM   1969 N  N   . LEU A 1 245 ? -28.336 -0.143  11.297  1.00 17.07 ? 420 LEU A N   1 
ATOM   1970 C  CA  . LEU A 1 245 ? -27.842 0.748   10.239  1.00 15.63 ? 420 LEU A CA  1 
ATOM   1971 C  C   . LEU A 1 245 ? -28.800 1.927   10.097  1.00 17.10 ? 420 LEU A C   1 
ATOM   1972 O  O   . LEU A 1 245 ? -30.004 1.803   10.447  1.00 15.07 ? 420 LEU A O   1 
ATOM   1973 C  CB  . LEU A 1 245 ? -27.847 -0.031  8.920   1.00 15.96 ? 420 LEU A CB  1 
ATOM   1974 C  CG  . LEU A 1 245 ? -26.843 -1.204  8.870   1.00 14.17 ? 420 LEU A CG  1 
ATOM   1975 C  CD1 . LEU A 1 245 ? -27.145 -2.061  7.679   1.00 10.77 ? 420 LEU A CD1 1 
ATOM   1976 C  CD2 . LEU A 1 245 ? -25.442 -0.620  8.749   1.00 15.09 ? 420 LEU A CD2 1 
ATOM   1977 N  N   . ASP A 1 246 ? -28.289 3.032   9.555   1.00 15.19 ? 421 ASP A N   1 
ATOM   1978 C  CA  . ASP A 1 246 ? -29.125 4.201   9.151   1.00 15.92 ? 421 ASP A CA  1 
ATOM   1979 C  C   . ASP A 1 246 ? -29.807 4.085   7.799   1.00 13.40 ? 421 ASP A C   1 
ATOM   1980 O  O   . ASP A 1 246 ? -31.009 4.318   7.701   1.00 11.75 ? 421 ASP A O   1 
ATOM   1981 C  CB  . ASP A 1 246 ? -28.280 5.494   9.219   1.00 16.32 ? 421 ASP A CB  1 
ATOM   1982 C  CG  . ASP A 1 246 ? -27.883 5.845   10.691  1.00 21.63 ? 421 ASP A CG  1 
ATOM   1983 O  OD1 . ASP A 1 246 ? -28.537 5.359   11.644  1.00 25.64 ? 421 ASP A OD1 1 
ATOM   1984 O  OD2 . ASP A 1 246 ? -26.890 6.556   10.906  1.00 26.53 ? 421 ASP A OD2 1 
ATOM   1985 N  N   . TYR A 1 247 ? -29.060 3.796   6.725   1.00 10.09 ? 422 TYR A N   1 
ATOM   1986 C  CA  . TYR A 1 247 ? -29.709 3.693   5.406   1.00 9.73  ? 422 TYR A CA  1 
ATOM   1987 C  C   . TYR A 1 247 ? -28.790 2.956   4.482   1.00 9.78  ? 422 TYR A C   1 
ATOM   1988 O  O   . TYR A 1 247 ? -27.602 2.707   4.840   1.00 10.27 ? 422 TYR A O   1 
ATOM   1989 C  CB  . TYR A 1 247 ? -30.043 5.023   4.760   1.00 7.43  ? 422 TYR A CB  1 
ATOM   1990 C  CG  . TYR A 1 247 ? -28.887 5.943   4.421   1.00 11.25 ? 422 TYR A CG  1 
ATOM   1991 C  CD1 . TYR A 1 247 ? -28.275 6.724   5.432   1.00 11.67 ? 422 TYR A CD1 1 
ATOM   1992 C  CD2 . TYR A 1 247 ? -28.407 6.031   3.123   1.00 10.23 ? 422 TYR A CD2 1 
ATOM   1993 C  CE1 . TYR A 1 247 ? -27.251 7.619   5.125   1.00 14.56 ? 422 TYR A CE1 1 
ATOM   1994 C  CE2 . TYR A 1 247 ? -27.388 6.910   2.816   1.00 10.28 ? 422 TYR A CE2 1 
ATOM   1995 C  CZ  . TYR A 1 247 ? -26.799 7.648   3.814   1.00 13.51 ? 422 TYR A CZ  1 
ATOM   1996 O  OH  . TYR A 1 247 ? -25.758 8.483   3.513   1.00 17.93 ? 422 TYR A OH  1 
ATOM   1997 N  N   . ILE A 1 248 ? -29.287 2.672   3.285   1.00 10.12 ? 423 ILE A N   1 
ATOM   1998 C  CA  . ILE A 1 248 ? -28.395 1.998   2.295   1.00 11.55 ? 423 ILE A CA  1 
ATOM   1999 C  C   . ILE A 1 248 ? -28.185 2.893   1.082   1.00 11.35 ? 423 ILE A C   1 
ATOM   2000 O  O   . ILE A 1 248 ? -29.031 3.723   0.731   1.00 11.58 ? 423 ILE A O   1 
ATOM   2001 C  CB  . ILE A 1 248 ? -28.963 0.626   1.837   1.00 12.12 ? 423 ILE A CB  1 
ATOM   2002 C  CG1 . ILE A 1 248 ? -30.125 0.810   0.846   1.00 16.44 ? 423 ILE A CG1 1 
ATOM   2003 C  CG2 . ILE A 1 248 ? -29.200 -0.345  3.099   1.00 17.34 ? 423 ILE A CG2 1 
ATOM   2004 C  CD1 . ILE A 1 248 ? -30.790 -0.575  0.364   1.00 21.10 ? 423 ILE A CD1 1 
ATOM   2005 N  N   . ILE A 1 249 ? -27.094 2.693   0.403   1.00 11.47 ? 424 ILE A N   1 
ATOM   2006 C  CA  . ILE A 1 249 ? -26.868 3.313   -0.885  1.00 10.00 ? 424 ILE A CA  1 
ATOM   2007 C  C   . ILE A 1 249 ? -26.637 2.196   -1.877  1.00 11.35 ? 424 ILE A C   1 
ATOM   2008 O  O   . ILE A 1 249 ? -25.830 1.304   -1.614  1.00 11.45 ? 424 ILE A O   1 
ATOM   2009 C  CB  . ILE A 1 249 ? -25.537 4.181   -0.872  1.00 11.55 ? 424 ILE A CB  1 
ATOM   2010 C  CG1 . ILE A 1 249 ? -25.656 5.345   0.179   1.00 13.21 ? 424 ILE A CG1 1 
ATOM   2011 C  CG2 . ILE A 1 249 ? -25.258 4.692   -2.301  1.00 7.47  ? 424 ILE A CG2 1 
ATOM   2012 C  CD1 . ILE A 1 249 ? -24.340 6.198   0.424   1.00 9.57  ? 424 ILE A CD1 1 
ATOM   2013 N  N   . ARG A 1 250 ? -27.308 2.261   -3.023  1.00 10.94 ? 425 ARG A N   1 
ATOM   2014 C  CA  . ARG A 1 250 ? -27.164 1.224   -4.046  1.00 11.88 ? 425 ARG A CA  1 
ATOM   2015 C  C   . ARG A 1 250 ? -27.191 1.934   -5.401  1.00 9.08  ? 425 ARG A C   1 
ATOM   2016 O  O   . ARG A 1 250 ? -27.401 3.164   -5.498  1.00 10.07 ? 425 ARG A O   1 
ATOM   2017 C  CB  . ARG A 1 250 ? -28.237 0.108   -3.945  1.00 10.59 ? 425 ARG A CB  1 
ATOM   2018 C  CG  . ARG A 1 250 ? -29.670 0.636   -3.663  1.00 13.31 ? 425 ARG A CG  1 
ATOM   2019 C  CD  . ARG A 1 250 ? -30.351 1.032   -4.950  1.00 11.43 ? 425 ARG A CD  1 
ATOM   2020 N  NE  . ARG A 1 250 ? -30.633 -0.129  -5.828  1.00 8.54  ? 425 ARG A NE  1 
ATOM   2021 C  CZ  . ARG A 1 250 ? -31.429 -0.125  -6.902  1.00 7.45  ? 425 ARG A CZ  1 
ATOM   2022 N  NH1 . ARG A 1 250 ? -32.036 0.968   -7.330  1.00 8.52  ? 425 ARG A NH1 1 
ATOM   2023 N  NH2 . ARG A 1 250 ? -31.636 -1.250  -7.595  1.00 6.58  ? 425 ARG A NH2 1 
ATOM   2024 N  N   . SER A 1 251 ? -26.939 1.206   -6.457  1.00 10.51 ? 426 SER A N   1 
ATOM   2025 C  CA  . SER A 1 251 ? -26.893 1.835   -7.769  1.00 9.62  ? 426 SER A CA  1 
ATOM   2026 C  C   . SER A 1 251 ? -27.832 1.086   -8.720  1.00 12.02 ? 426 SER A C   1 
ATOM   2027 O  O   . SER A 1 251 ? -29.050 0.992   -8.385  1.00 12.26 ? 426 SER A O   1 
ATOM   2028 C  CB  . SER A 1 251 ? -25.457 1.931   -8.259  1.00 10.52 ? 426 SER A CB  1 
ATOM   2029 O  OG  . SER A 1 251 ? -24.757 2.715   -7.305  1.00 10.28 ? 426 SER A OG  1 
ATOM   2030 N  N   . HIS A 1 252 ? -27.327 0.600   -9.871  1.00 12.28 ? 427 HIS A N   1 
ATOM   2031 C  CA  . HIS A 1 252 ? -28.002 -0.509  -10.639 1.00 12.75 ? 427 HIS A CA  1 
ATOM   2032 C  C   . HIS A 1 252 ? -29.202 -0.058  -11.557 1.00 14.52 ? 427 HIS A C   1 
ATOM   2033 O  O   . HIS A 1 252 ? -29.506 -0.694  -12.591 1.00 17.11 ? 427 HIS A O   1 
ATOM   2034 C  CB  . HIS A 1 252 ? -28.322 -1.674  -9.609  1.00 11.09 ? 427 HIS A CB  1 
ATOM   2035 C  CG  . HIS A 1 252 ? -28.930 -2.924  -10.185 1.00 10.93 ? 427 HIS A CG  1 
ATOM   2036 N  ND1 . HIS A 1 252 ? -28.390 -3.640  -11.241 1.00 9.97  ? 427 HIS A ND1 1 
ATOM   2037 C  CD2 . HIS A 1 252 ? -29.960 -3.685  -9.712  1.00 10.59 ? 427 HIS A CD2 1 
ATOM   2038 C  CE1 . HIS A 1 252 ? -29.098 -4.741  -11.447 1.00 13.22 ? 427 HIS A CE1 1 
ATOM   2039 N  NE2 . HIS A 1 252 ? -30.068 -4.785  -10.526 1.00 8.62  ? 427 HIS A NE2 1 
ATOM   2040 N  N   . GLU A 1 253 ? -29.816 1.093   -11.268 1.00 15.20 ? 428 GLU A N   1 
ATOM   2041 C  CA  . GLU A 1 253 ? -30.919 1.580   -12.076 1.00 15.85 ? 428 GLU A CA  1 
ATOM   2042 C  C   . GLU A 1 253 ? -30.646 3.010   -12.522 1.00 15.64 ? 428 GLU A C   1 
ATOM   2043 O  O   . GLU A 1 253 ? -30.319 3.866   -11.679 1.00 15.43 ? 428 GLU A O   1 
ATOM   2044 C  CB  . GLU A 1 253 ? -32.222 1.613   -11.256 1.00 15.13 ? 428 GLU A CB  1 
ATOM   2045 C  CG  . GLU A 1 253 ? -32.823 0.257   -11.028 1.00 18.33 ? 428 GLU A CG  1 
ATOM   2046 C  CD  . GLU A 1 253 ? -34.163 0.339   -10.264 1.00 19.37 ? 428 GLU A CD  1 
ATOM   2047 O  OE1 . GLU A 1 253 ? -34.186 0.694   -9.073  1.00 18.40 ? 428 GLU A OE1 1 
ATOM   2048 O  OE2 . GLU A 1 253 ? -35.153 -0.017  -10.886 1.00 21.79 ? 428 GLU A OE2 1 
ATOM   2049 N  N   . VAL A 1 254 ? -30.777 3.236   -13.826 1.00 16.16 ? 429 VAL A N   1 
ATOM   2050 C  CA  . VAL A 1 254 ? -30.613 4.594   -14.414 1.00 17.54 ? 429 VAL A CA  1 
ATOM   2051 C  C   . VAL A 1 254 ? -31.674 5.514   -13.813 1.00 16.55 ? 429 VAL A C   1 
ATOM   2052 O  O   . VAL A 1 254 ? -32.846 5.107   -13.675 1.00 16.18 ? 429 VAL A O   1 
ATOM   2053 C  CB  . VAL A 1 254 ? -30.646 4.582   -15.987 1.00 17.06 ? 429 VAL A CB  1 
ATOM   2054 C  CG1 . VAL A 1 254 ? -31.886 3.977   -16.531 1.00 20.03 ? 429 VAL A CG1 1 
ATOM   2055 C  CG2 . VAL A 1 254 ? -30.398 5.986   -16.622 1.00 19.24 ? 429 VAL A CG2 1 
ATOM   2056 N  N   . LYS A 1 255 ? -31.269 6.716   -13.444 1.00 14.26 ? 430 LYS A N   1 
ATOM   2057 C  CA  . LYS A 1 255 ? -32.198 7.686   -12.839 1.00 16.14 ? 430 LYS A CA  1 
ATOM   2058 C  C   . LYS A 1 255 ? -32.108 9.015   -13.631 1.00 16.40 ? 430 LYS A C   1 
ATOM   2059 O  O   . LYS A 1 255 ? -30.970 9.496   -13.884 1.00 16.32 ? 430 LYS A O   1 
ATOM   2060 C  CB  . LYS A 1 255 ? -31.809 7.913   -11.324 1.00 15.66 ? 430 LYS A CB  1 
ATOM   2061 C  CG  . LYS A 1 255 ? -32.105 6.672   -10.361 1.00 14.19 ? 430 LYS A CG  1 
ATOM   2062 C  CD  . LYS A 1 255 ? -33.611 6.308   -10.381 1.00 18.52 ? 430 LYS A CD  1 
ATOM   2063 C  CE  . LYS A 1 255 ? -33.974 4.979   -9.617  1.00 17.91 ? 430 LYS A CE  1 
ATOM   2064 N  NZ  . LYS A 1 255 ? -35.392 4.531   -9.970  1.00 18.98 ? 430 LYS A NZ  1 
ATOM   2065 N  N   . ALA A 1 256 ? -33.243 9.579   -14.069 1.00 17.45 ? 431 ALA A N   1 
ATOM   2066 C  CA  . ALA A 1 256 ? -33.253 10.883  -14.834 1.00 18.31 ? 431 ALA A CA  1 
ATOM   2067 C  C   . ALA A 1 256 ? -32.420 11.992  -14.242 1.00 18.04 ? 431 ALA A C   1 
ATOM   2068 O  O   . ALA A 1 256 ? -31.690 12.691  -14.974 1.00 16.55 ? 431 ALA A O   1 
ATOM   2069 C  CB  . ALA A 1 256 ? -34.741 11.399  -15.090 1.00 20.70 ? 431 ALA A CB  1 
ATOM   2070 N  N   . GLU A 1 257 ? -32.461 12.112  -12.902 1.00 17.54 ? 432 GLU A N   1 
ATOM   2071 C  CA  . GLU A 1 257 ? -31.725 13.150  -12.174 1.00 16.99 ? 432 GLU A CA  1 
ATOM   2072 C  C   . GLU A 1 257 ? -30.363 12.646  -11.673 1.00 15.39 ? 432 GLU A C   1 
ATOM   2073 O  O   . GLU A 1 257 ? -29.654 13.422  -10.966 1.00 13.81 ? 432 GLU A O   1 
ATOM   2074 C  CB  . GLU A 1 257 ? -32.515 13.619  -10.928 1.00 18.89 ? 432 GLU A CB  1 
ATOM   2075 C  CG  . GLU A 1 257 ? -33.762 14.454  -11.262 1.00 24.83 ? 432 GLU A CG  1 
ATOM   2076 C  CD  . GLU A 1 257 ? -33.417 15.684  -12.093 1.00 28.53 ? 432 GLU A CD  1 
ATOM   2077 O  OE1 . GLU A 1 257 ? -32.679 16.597  -11.620 1.00 32.58 ? 432 GLU A OE1 1 
ATOM   2078 O  OE2 . GLU A 1 257 ? -33.892 15.742  -13.214 1.00 34.38 ? 432 GLU A OE2 1 
ATOM   2079 N  N   . GLY A 1 258 ? -30.018 11.363  -11.944 1.00 12.76 ? 433 GLY A N   1 
ATOM   2080 C  CA  . GLY A 1 258 ? -28.739 10.810  -11.362 1.00 14.00 ? 433 GLY A CA  1 
ATOM   2081 C  C   . GLY A 1 258 ? -28.810 10.164  -9.971  1.00 13.60 ? 433 GLY A C   1 
ATOM   2082 O  O   . GLY A 1 258 ? -27.830 9.525   -9.487  1.00 14.04 ? 433 GLY A O   1 
ATOM   2083 N  N   . TYR A 1 259 ? -29.944 10.372  -9.279  1.00 12.38 ? 434 TYR A N   1 
ATOM   2084 C  CA  . TYR A 1 259 ? -30.133 9.795   -7.953  1.00 12.30 ? 434 TYR A CA  1 
ATOM   2085 C  C   . TYR A 1 259 ? -31.648 9.669   -7.681  1.00 12.09 ? 434 TYR A C   1 
ATOM   2086 O  O   . TYR A 1 259 ? -32.479 10.293  -8.388  1.00 13.45 ? 434 TYR A O   1 
ATOM   2087 C  CB  . TYR A 1 259 ? -29.419 10.609  -6.850  1.00 11.92 ? 434 TYR A CB  1 
ATOM   2088 C  CG  . TYR A 1 259 ? -30.043 11.963  -6.552  1.00 13.09 ? 434 TYR A CG  1 
ATOM   2089 C  CD1 . TYR A 1 259 ? -29.901 13.042  -7.467  1.00 16.12 ? 434 TYR A CD1 1 
ATOM   2090 C  CD2 . TYR A 1 259 ? -30.870 12.132  -5.444  1.00 13.50 ? 434 TYR A CD2 1 
ATOM   2091 C  CE1 . TYR A 1 259 ? -30.497 14.293  -7.229  1.00 18.62 ? 434 TYR A CE1 1 
ATOM   2092 C  CE2 . TYR A 1 259 ? -31.505 13.385  -5.210  1.00 16.42 ? 434 TYR A CE2 1 
ATOM   2093 C  CZ  . TYR A 1 259 ? -31.289 14.465  -6.102  1.00 19.65 ? 434 TYR A CZ  1 
ATOM   2094 O  OH  . TYR A 1 259 ? -31.929 15.700  -5.911  1.00 17.10 ? 434 TYR A OH  1 
ATOM   2095 N  N   . GLU A 1 260 ? -31.960 8.947   -6.614  1.00 13.84 ? 435 GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 260 ? -33.308 8.801   -6.097  1.00 14.13 ? 435 GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 260 ? -33.190 8.477   -4.617  1.00 14.84 ? 435 GLU A C   1 
ATOM   2098 O  O   . GLU A 1 260 ? -32.257 7.806   -4.173  1.00 14.70 ? 435 GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 260 ? -34.123 7.762   -6.882  1.00 15.93 ? 435 GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 260 ? -35.571 7.527   -6.246  1.00 20.30 ? 435 GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 260 ? -36.519 6.739   -7.152  1.00 27.67 ? 435 GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 260 ? -37.342 5.916   -6.609  1.00 27.54 ? 435 GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 260 ? -36.438 6.926   -8.411  1.00 27.06 ? 435 GLU A OE2 1 
ATOM   2104 N  N   . VAL A 1 261 ? -34.105 8.971   -3.802  1.00 13.75 ? 436 VAL A N   1 
ATOM   2105 C  CA  . VAL A 1 261 ? -34.084 8.573   -2.397  1.00 12.94 ? 436 VAL A CA  1 
ATOM   2106 C  C   . VAL A 1 261 ? -35.444 7.892   -2.159  1.00 14.51 ? 436 VAL A C   1 
ATOM   2107 O  O   . VAL A 1 261 ? -36.470 8.565   -2.232  1.00 15.75 ? 436 VAL A O   1 
ATOM   2108 C  CB  . VAL A 1 261 ? -33.862 9.737   -1.460  1.00 13.47 ? 436 VAL A CB  1 
ATOM   2109 C  CG1 . VAL A 1 261 ? -33.879 9.289   0.067   1.00 11.10 ? 436 VAL A CG1 1 
ATOM   2110 C  CG2 . VAL A 1 261 ? -32.530 10.498  -1.864  1.00 11.99 ? 436 VAL A CG2 1 
ATOM   2111 N  N   . ALA A 1 262 ? -35.461 6.576   -1.974  1.00 12.89 ? 437 ALA A N   1 
ATOM   2112 C  CA  . ALA A 1 262 ? -36.743 5.855   -1.807  1.00 12.42 ? 437 ALA A CA  1 
ATOM   2113 C  C   . ALA A 1 262 ? -36.939 5.475   -0.350  1.00 11.64 ? 437 ALA A C   1 
ATOM   2114 O  O   . ALA A 1 262 ? -36.042 5.759   0.498   1.00 12.14 ? 437 ALA A O   1 
ATOM   2115 C  CB  . ALA A 1 262 ? -36.822 4.561   -2.710  1.00 11.38 ? 437 ALA A CB  1 
ATOM   2116 N  N   . HIS A 1 263 ? -38.096 4.831   -0.053  1.00 11.59 ? 438 HIS A N   1 
ATOM   2117 C  CA  . HIS A 1 263 ? -38.322 4.184   1.275   1.00 10.47 ? 438 HIS A CA  1 
ATOM   2118 C  C   . HIS A 1 263 ? -38.129 5.240   2.382   1.00 11.58 ? 438 HIS A C   1 
ATOM   2119 O  O   . HIS A 1 263 ? -37.528 4.982   3.488   1.00 10.51 ? 438 HIS A O   1 
ATOM   2120 C  CB  . HIS A 1 263 ? -37.369 2.961   1.472   1.00 11.20 ? 438 HIS A CB  1 
ATOM   2121 C  CG  . HIS A 1 263 ? -37.629 1.872   0.496   1.00 9.75  ? 438 HIS A CG  1 
ATOM   2122 N  ND1 . HIS A 1 263 ? -36.957 0.659   0.504   1.00 11.64 ? 438 HIS A ND1 1 
ATOM   2123 C  CD2 . HIS A 1 263 ? -38.505 1.812   -0.533  1.00 11.21 ? 438 HIS A CD2 1 
ATOM   2124 C  CE1 . HIS A 1 263 ? -37.410 -0.089  -0.494  1.00 10.84 ? 438 HIS A CE1 1 
ATOM   2125 N  NE2 . HIS A 1 263 ? -38.371 0.565   -1.113  1.00 12.66 ? 438 HIS A NE2 1 
ATOM   2126 N  N   . GLY A 1 264 ? -38.642 6.445   2.078   1.00 12.43 ? 439 GLY A N   1 
ATOM   2127 C  CA  . GLY A 1 264 ? -38.655 7.543   3.081   1.00 11.60 ? 439 GLY A CA  1 
ATOM   2128 C  C   . GLY A 1 264 ? -37.298 8.002   3.602   1.00 13.27 ? 439 GLY A C   1 
ATOM   2129 O  O   . GLY A 1 264 ? -37.218 8.502   4.696   1.00 11.42 ? 439 GLY A O   1 
ATOM   2130 N  N   . GLY A 1 265 ? -36.247 7.879   2.782   1.00 12.51 ? 440 GLY A N   1 
ATOM   2131 C  CA  . GLY A 1 265 ? -34.921 8.164   3.195   1.00 12.91 ? 440 GLY A CA  1 
ATOM   2132 C  C   . GLY A 1 265 ? -33.969 6.953   3.266   1.00 14.18 ? 440 GLY A C   1 
ATOM   2133 O  O   . GLY A 1 265 ? -32.736 7.126   3.244   1.00 15.23 ? 440 GLY A O   1 
ATOM   2134 N  N   . ARG A 1 266 ? -34.515 5.758   3.369   1.00 11.88 ? 441 ARG A N   1 
ATOM   2135 C  CA  . ARG A 1 266 ? -33.732 4.586   3.709   1.00 13.89 ? 441 ARG A CA  1 
ATOM   2136 C  C   . ARG A 1 266 ? -32.935 3.937   2.560   1.00 13.37 ? 441 ARG A C   1 
ATOM   2137 O  O   . ARG A 1 266 ? -32.017 3.164   2.809   1.00 14.73 ? 441 ARG A O   1 
ATOM   2138 C  CB  . ARG A 1 266 ? -34.651 3.473   4.254   1.00 14.09 ? 441 ARG A CB  1 
ATOM   2139 C  CG  . ARG A 1 266 ? -35.399 3.841   5.557   1.00 15.31 ? 441 ARG A CG  1 
ATOM   2140 C  CD  . ARG A 1 266 ? -34.446 4.212   6.715   1.00 31.05 ? 441 ARG A CD  1 
ATOM   2141 N  NE  . ARG A 1 266 ? -34.956 3.505   7.929   1.00 43.67 ? 441 ARG A NE  1 
ATOM   2142 C  CZ  . ARG A 1 266 ? -34.349 3.231   9.108   1.00 42.55 ? 441 ARG A CZ  1 
ATOM   2143 N  NH1 . ARG A 1 266 ? -33.052 3.599   9.482   1.00 38.41 ? 441 ARG A NH1 1 
ATOM   2144 N  NH2 . ARG A 1 266 ? -35.116 2.552   9.934   1.00 34.01 ? 441 ARG A NH2 1 
ATOM   2145 N  N   . CYS A 1 267 ? -33.399 4.131   1.341   1.00 13.63 ? 442 CYS A N   1 
ATOM   2146 C  CA  . CYS A 1 267 ? -32.863 3.440   0.200   1.00 14.01 ? 442 CYS A CA  1 
ATOM   2147 C  C   . CYS A 1 267 ? -32.540 4.465   -0.863  1.00 13.11 ? 442 CYS A C   1 
ATOM   2148 O  O   . CYS A 1 267 ? -33.428 4.935   -1.599  1.00 14.46 ? 442 CYS A O   1 
ATOM   2149 C  CB  . CYS A 1 267 ? -33.825 2.399   -0.341  1.00 12.53 ? 442 CYS A CB  1 
ATOM   2150 S  SG  . CYS A 1 267 ? -33.046 1.474   -1.737  1.00 16.40 ? 442 CYS A SG  1 
ATOM   2151 N  N   . VAL A 1 268 ? -31.264 4.842   -0.903  1.00 11.86 ? 443 VAL A N   1 
ATOM   2152 C  CA  . VAL A 1 268 ? -30.770 5.858   -1.877  1.00 11.02 ? 443 VAL A CA  1 
ATOM   2153 C  C   . VAL A 1 268 ? -30.188 5.155   -3.130  1.00 11.21 ? 443 VAL A C   1 
ATOM   2154 O  O   . VAL A 1 268 ? -29.466 4.153   -2.999  1.00 10.74 ? 443 VAL A O   1 
ATOM   2155 C  CB  . VAL A 1 268 ? -29.643 6.679   -1.226  1.00 12.92 ? 443 VAL A CB  1 
ATOM   2156 C  CG1 . VAL A 1 268 ? -28.856 7.558   -2.305  1.00 10.75 ? 443 VAL A CG1 1 
ATOM   2157 C  CG2 . VAL A 1 268 ? -30.118 7.433   -0.021  1.00 11.90 ? 443 VAL A CG2 1 
ATOM   2158 N  N   . THR A 1 269 ? -30.488 5.664   -4.323  1.00 9.47  ? 444 THR A N   1 
ATOM   2159 C  CA  . THR A 1 269 ? -29.880 5.195   -5.587  1.00 10.83 ? 444 THR A CA  1 
ATOM   2160 C  C   . THR A 1 269 ? -28.976 6.349   -6.067  1.00 12.20 ? 444 THR A C   1 
ATOM   2161 O  O   . THR A 1 269 ? -29.397 7.502   -6.096  1.00 11.71 ? 444 THR A O   1 
ATOM   2162 C  CB  . THR A 1 269 ? -30.968 4.883   -6.692  1.00 10.11 ? 444 THR A CB  1 
ATOM   2163 O  OG1 . THR A 1 269 ? -31.877 3.873   -6.212  1.00 10.40 ? 444 THR A OG1 1 
ATOM   2164 C  CG2 . THR A 1 269 ? -30.455 4.462   -8.131  1.00 10.52 ? 444 THR A CG2 1 
ATOM   2165 N  N   . VAL A 1 270 ? -27.765 5.983   -6.487  1.00 11.49 ? 445 VAL A N   1 
ATOM   2166 C  CA  . VAL A 1 270 ? -26.813 6.861   -7.129  1.00 13.26 ? 445 VAL A CA  1 
ATOM   2167 C  C   . VAL A 1 270 ? -26.377 6.209   -8.461  1.00 14.46 ? 445 VAL A C   1 
ATOM   2168 O  O   . VAL A 1 270 ? -26.154 4.981   -8.560  1.00 15.24 ? 445 VAL A O   1 
ATOM   2169 C  CB  . VAL A 1 270 ? -25.644 7.209   -6.172  1.00 12.06 ? 445 VAL A CB  1 
ATOM   2170 C  CG1 . VAL A 1 270 ? -24.822 5.938   -5.773  1.00 9.37  ? 445 VAL A CG1 1 
ATOM   2171 C  CG2 . VAL A 1 270 ? -24.657 8.241   -6.857  1.00 11.39 ? 445 VAL A CG2 1 
ATOM   2172 N  N   . PHE A 1 271 ? -26.329 7.002   -9.518  1.00 12.55 ? 446 PHE A N   1 
ATOM   2173 C  CA  . PHE A 1 271 ? -26.066 6.459   -10.812 1.00 13.56 ? 446 PHE A CA  1 
ATOM   2174 C  C   . PHE A 1 271 ? -25.074 7.408   -11.505 1.00 13.27 ? 446 PHE A C   1 
ATOM   2175 O  O   . PHE A 1 271 ? -25.403 8.600   -11.677 1.00 10.88 ? 446 PHE A O   1 
ATOM   2176 C  CB  . PHE A 1 271 ? -27.382 6.400   -11.620 1.00 11.57 ? 446 PHE A CB  1 
ATOM   2177 C  CG  . PHE A 1 271 ? -27.257 5.625   -12.894 1.00 14.91 ? 446 PHE A CG  1 
ATOM   2178 C  CD1 . PHE A 1 271 ? -27.185 4.230   -12.864 1.00 16.29 ? 446 PHE A CD1 1 
ATOM   2179 C  CD2 . PHE A 1 271 ? -27.149 6.285   -14.149 1.00 15.25 ? 446 PHE A CD2 1 
ATOM   2180 C  CE1 . PHE A 1 271 ? -27.053 3.506   -14.074 1.00 15.85 ? 446 PHE A CE1 1 
ATOM   2181 C  CE2 . PHE A 1 271 ? -27.020 5.563   -15.324 1.00 17.25 ? 446 PHE A CE2 1 
ATOM   2182 C  CZ  . PHE A 1 271 ? -26.941 4.172   -15.285 1.00 13.58 ? 446 PHE A CZ  1 
ATOM   2183 N  N   . SER A 1 272 ? -23.895 6.914   -11.898 1.00 13.40 ? 447 SER A N   1 
ATOM   2184 C  CA  . SER A 1 272 ? -22.844 7.886   -12.319 1.00 13.39 ? 447 SER A CA  1 
ATOM   2185 C  C   . SER A 1 272 ? -22.536 7.906   -13.874 1.00 13.31 ? 447 SER A C   1 
ATOM   2186 O  O   . SER A 1 272 ? -21.450 8.260   -14.310 1.00 16.43 ? 447 SER A O   1 
ATOM   2187 C  CB  . SER A 1 272 ? -21.595 7.764   -11.433 1.00 11.85 ? 447 SER A CB  1 
ATOM   2188 O  OG  . SER A 1 272 ? -21.863 7.951   -10.066 1.00 13.86 ? 447 SER A OG  1 
ATOM   2189 N  N   . ALA A 1 273 ? -23.489 7.501   -14.695 1.00 13.43 ? 448 ALA A N   1 
ATOM   2190 C  CA  . ALA A 1 273 ? -23.269 7.431   -16.146 1.00 12.84 ? 448 ALA A CA  1 
ATOM   2191 C  C   . ALA A 1 273 ? -24.221 8.402   -16.847 1.00 13.62 ? 448 ALA A C   1 
ATOM   2192 O  O   . ALA A 1 273 ? -25.391 8.053   -17.172 1.00 13.88 ? 448 ALA A O   1 
ATOM   2193 C  CB  . ALA A 1 273 ? -23.372 5.951   -16.674 1.00 12.53 ? 448 ALA A CB  1 
ATOM   2194 N  N   . PRO A 1 274 ? -23.776 9.673   -17.016 1.00 13.93 ? 449 PRO A N   1 
ATOM   2195 C  CA  . PRO A 1 274 ? -24.730 10.665  -17.618 1.00 15.55 ? 449 PRO A CA  1 
ATOM   2196 C  C   . PRO A 1 274 ? -25.035 10.344  -19.124 1.00 16.38 ? 449 PRO A C   1 
ATOM   2197 O  O   . PRO A 1 274 ? -24.194 9.698   -19.802 1.00 15.42 ? 449 PRO A O   1 
ATOM   2198 C  CB  . PRO A 1 274 ? -23.978 12.031  -17.504 1.00 14.51 ? 449 PRO A CB  1 
ATOM   2199 C  CG  . PRO A 1 274 ? -22.492 11.606  -17.598 1.00 13.48 ? 449 PRO A CG  1 
ATOM   2200 C  CD  . PRO A 1 274 ? -22.393 10.188  -16.913 1.00 13.77 ? 449 PRO A CD  1 
ATOM   2201 N  N   . ASN A 1 275 ? -26.230 10.732  -19.614 1.00 18.74 ? 450 ASN A N   1 
ATOM   2202 C  CA  . ASN A 1 275 ? -26.675 10.444  -21.001 1.00 19.45 ? 450 ASN A CA  1 
ATOM   2203 C  C   . ASN A 1 275 ? -26.313 9.014   -21.378 1.00 19.82 ? 450 ASN A C   1 
ATOM   2204 O  O   . ASN A 1 275 ? -25.627 8.741   -22.364 1.00 18.38 ? 450 ASN A O   1 
ATOM   2205 C  CB  . ASN A 1 275 ? -26.038 11.416  -22.026 1.00 20.85 ? 450 ASN A CB  1 
ATOM   2206 C  CG  . ASN A 1 275 ? -26.756 11.388  -23.387 1.00 22.88 ? 450 ASN A CG  1 
ATOM   2207 O  OD1 . ASN A 1 275 ? -27.947 11.095  -23.466 1.00 22.84 ? 450 ASN A OD1 1 
ATOM   2208 N  ND2 . ASN A 1 275 ? -26.022 11.700  -24.458 1.00 22.12 ? 450 ASN A ND2 1 
ATOM   2209 N  N   . TYR A 1 276 ? -26.794 8.116   -20.547 1.00 19.03 ? 451 TYR A N   1 
ATOM   2210 C  CA  . TYR A 1 276 ? -26.470 6.728   -20.594 1.00 19.52 ? 451 TYR A CA  1 
ATOM   2211 C  C   . TYR A 1 276 ? -26.706 6.084   -21.989 1.00 20.24 ? 451 TYR A C   1 
ATOM   2212 O  O   . TYR A 1 276 ? -27.759 6.272   -22.641 1.00 20.11 ? 451 TYR A O   1 
ATOM   2213 C  CB  . TYR A 1 276 ? -27.304 6.097   -19.489 1.00 18.04 ? 451 TYR A CB  1 
ATOM   2214 C  CG  . TYR A 1 276 ? -27.147 4.623   -19.302 1.00 18.73 ? 451 TYR A CG  1 
ATOM   2215 C  CD1 . TYR A 1 276 ? -25.870 4.022   -19.258 1.00 21.62 ? 451 TYR A CD1 1 
ATOM   2216 C  CD2 . TYR A 1 276 ? -28.276 3.810   -19.139 1.00 22.21 ? 451 TYR A CD2 1 
ATOM   2217 C  CE1 . TYR A 1 276 ? -25.718 2.611   -19.056 1.00 22.16 ? 451 TYR A CE1 1 
ATOM   2218 C  CE2 . TYR A 1 276 ? -28.131 2.400   -18.899 1.00 23.94 ? 451 TYR A CE2 1 
ATOM   2219 C  CZ  . TYR A 1 276 ? -26.860 1.826   -18.873 1.00 23.43 ? 451 TYR A CZ  1 
ATOM   2220 O  OH  . TYR A 1 276 ? -26.727 0.472   -18.654 1.00 26.12 ? 451 TYR A OH  1 
ATOM   2221 N  N   . CYS A 1 277 ? -25.674 5.406   -22.485 1.00 21.77 ? 452 CYS A N   1 
ATOM   2222 C  CA  . CYS A 1 277 ? -25.679 4.817   -23.818 1.00 23.73 ? 452 CYS A CA  1 
ATOM   2223 C  C   . CYS A 1 277 ? -25.930 5.849   -24.928 1.00 23.77 ? 452 CYS A C   1 
ATOM   2224 O  O   . CYS A 1 277 ? -26.485 5.519   -25.946 1.00 23.49 ? 452 CYS A O   1 
ATOM   2225 C  CB  . CYS A 1 277 ? -26.736 3.702   -23.923 1.00 24.04 ? 452 CYS A CB  1 
ATOM   2226 S  SG  . CYS A 1 277 ? -26.332 2.247   -22.883 1.00 29.30 ? 452 CYS A SG  1 
ATOM   2227 N  N   . ASP A 1 278 ? -25.536 7.091   -24.700 1.00 24.63 ? 453 ASP A N   1 
ATOM   2228 C  CA  . ASP A 1 278 ? -25.703 8.177   -25.655 1.00 26.42 ? 453 ASP A CA  1 
ATOM   2229 C  C   . ASP A 1 278 ? -27.164 8.469   -26.030 1.00 27.71 ? 453 ASP A C   1 
ATOM   2230 O  O   . ASP A 1 278 ? -27.405 9.269   -26.916 1.00 27.80 ? 453 ASP A O   1 
ATOM   2231 C  CB  . ASP A 1 278 ? -24.832 7.994   -26.920 1.00 26.09 ? 453 ASP A CB  1 
ATOM   2232 C  CG  . ASP A 1 278 ? -23.329 8.082   -26.640 1.00 26.44 ? 453 ASP A CG  1 
ATOM   2233 O  OD1 . ASP A 1 278 ? -22.894 8.752   -25.656 1.00 23.55 ? 453 ASP A OD1 1 
ATOM   2234 O  OD2 . ASP A 1 278 ? -22.566 7.470   -27.423 1.00 29.33 ? 453 ASP A OD2 1 
ATOM   2235 N  N   . GLN A 1 279 ? -28.128 7.890   -25.310 1.00 27.95 ? 454 GLN A N   1 
ATOM   2236 C  CA  . GLN A 1 279 ? -29.539 8.115   -25.623 1.00 29.43 ? 454 GLN A CA  1 
ATOM   2237 C  C   . GLN A 1 279 ? -30.415 8.557   -24.481 1.00 29.09 ? 454 GLN A C   1 
ATOM   2238 O  O   . GLN A 1 279 ? -31.499 9.065   -24.765 1.00 29.59 ? 454 GLN A O   1 
ATOM   2239 C  CB  . GLN A 1 279 ? -30.256 6.845   -26.056 1.00 30.00 ? 454 GLN A CB  1 
ATOM   2240 C  CG  . GLN A 1 279 ? -29.479 5.838   -26.766 1.00 35.74 ? 454 GLN A CG  1 
ATOM   2241 C  CD  . GLN A 1 279 ? -30.391 4.843   -27.436 1.00 42.66 ? 454 GLN A CD  1 
ATOM   2242 O  OE1 . GLN A 1 279 ? -30.447 4.786   -28.670 1.00 46.29 ? 454 GLN A OE1 1 
ATOM   2243 N  NE2 . GLN A 1 279 ? -31.146 4.075   -26.637 1.00 42.19 ? 454 GLN A NE2 1 
ATOM   2244 N  N   . MET A 1 280 ? -30.028 8.329   -23.218 1.00 29.10 ? 455 MET A N   1 
ATOM   2245 C  CA  . MET A 1 280 ? -31.035 8.476   -22.155 1.00 29.26 ? 455 MET A CA  1 
ATOM   2246 C  C   . MET A 1 280 ? -31.316 9.873   -21.753 1.00 27.21 ? 455 MET A C   1 
ATOM   2247 O  O   . MET A 1 280 ? -32.315 10.118  -21.089 1.00 27.86 ? 455 MET A O   1 
ATOM   2248 C  CB  . MET A 1 280 ? -30.646 7.732   -20.891 1.00 30.39 ? 455 MET A CB  1 
ATOM   2249 C  CG  . MET A 1 280 ? -30.440 6.313   -21.077 1.00 36.14 ? 455 MET A CG  1 
ATOM   2250 S  SD  . MET A 1 280 ? -31.989 5.511   -21.445 1.00 50.42 ? 455 MET A SD  1 
ATOM   2251 C  CE  . MET A 1 280 ? -31.827 4.355   -20.069 1.00 41.25 ? 455 MET A CE  1 
ATOM   2252 N  N   . GLY A 1 281 ? -30.391 10.771  -22.051 1.00 25.47 ? 456 GLY A N   1 
ATOM   2253 C  CA  . GLY A 1 281 ? -30.524 12.161  -21.651 1.00 23.96 ? 456 GLY A CA  1 
ATOM   2254 C  C   . GLY A 1 281 ? -30.448 12.400  -20.152 1.00 22.94 ? 456 GLY A C   1 
ATOM   2255 O  O   . GLY A 1 281 ? -30.651 13.519  -19.701 1.00 22.32 ? 456 GLY A O   1 
ATOM   2256 N  N   . ASN A 1 282 ? -30.142 11.379  -19.353 1.00 21.35 ? 457 ASN A N   1 
ATOM   2257 C  CA  . ASN A 1 282 ? -30.173 11.600  -17.901 1.00 20.13 ? 457 ASN A CA  1 
ATOM   2258 C  C   . ASN A 1 282 ? -28.955 12.406  -17.404 1.00 19.54 ? 457 ASN A C   1 
ATOM   2259 O  O   . ASN A 1 282 ? -27.838 12.353  -17.994 1.00 19.11 ? 457 ASN A O   1 
ATOM   2260 C  CB  . ASN A 1 282 ? -30.203 10.250  -17.181 1.00 19.44 ? 457 ASN A CB  1 
ATOM   2261 C  CG  . ASN A 1 282 ? -28.988 9.376   -17.572 1.00 21.95 ? 457 ASN A CG  1 
ATOM   2262 O  OD1 . ASN A 1 282 ? -28.883 8.950   -18.724 1.00 23.59 ? 457 ASN A OD1 1 
ATOM   2263 N  ND2 . ASN A 1 282 ? -28.071 9.170   -16.645 1.00 20.45 ? 457 ASN A ND2 1 
ATOM   2264 N  N   . LYS A 1 283 ? -29.144 13.062  -16.271 1.00 17.50 ? 458 LYS A N   1 
ATOM   2265 C  CA  . LYS A 1 283 ? -28.040 13.515  -15.453 1.00 18.21 ? 458 LYS A CA  1 
ATOM   2266 C  C   . LYS A 1 283 ? -27.466 12.325  -14.647 1.00 15.98 ? 458 LYS A C   1 
ATOM   2267 O  O   . LYS A 1 283 ? -28.101 11.319  -14.491 1.00 15.34 ? 458 LYS A O   1 
ATOM   2268 C  CB  . LYS A 1 283 ? -28.473 14.611  -14.481 1.00 18.11 ? 458 LYS A CB  1 
ATOM   2269 C  CG  . LYS A 1 283 ? -29.287 15.737  -15.122 1.00 22.05 ? 458 LYS A CG  1 
ATOM   2270 C  CD  . LYS A 1 283 ? -29.425 16.846  -14.093 1.00 26.79 ? 458 LYS A CD  1 
ATOM   2271 C  CE  . LYS A 1 283 ? -30.121 18.078  -14.669 1.00 34.75 ? 458 LYS A CE  1 
ATOM   2272 N  NZ  . LYS A 1 283 ? -31.564 18.054  -14.302 1.00 38.15 ? 458 LYS A NZ  1 
ATOM   2273 N  N   . ALA A 1 284 ? -26.232 12.471  -14.194 1.00 15.20 ? 459 ALA A N   1 
ATOM   2274 C  CA  . ALA A 1 284 ? -25.589 11.556  -13.283 1.00 15.07 ? 459 ALA A CA  1 
ATOM   2275 C  C   . ALA A 1 284 ? -25.312 12.307  -11.966 1.00 13.09 ? 459 ALA A C   1 
ATOM   2276 O  O   . ALA A 1 284 ? -25.416 13.559  -11.916 1.00 14.55 ? 459 ALA A O   1 
ATOM   2277 C  CB  . ALA A 1 284 ? -24.241 11.106  -13.908 1.00 15.56 ? 459 ALA A CB  1 
ATOM   2278 N  N   . SER A 1 285 ? -25.005 11.573  -10.900 1.00 9.87  ? 460 SER A N   1 
ATOM   2279 C  CA  . SER A 1 285 ? -24.499 12.159  -9.678  1.00 12.15 ? 460 SER A CA  1 
ATOM   2280 C  C   . SER A 1 285 ? -23.518 11.276  -9.026  1.00 12.03 ? 460 SER A C   1 
ATOM   2281 O  O   . SER A 1 285 ? -23.287 10.117  -9.462  1.00 13.77 ? 460 SER A O   1 
ATOM   2282 C  CB  . SER A 1 285 ? -25.651 12.470  -8.686  1.00 12.75 ? 460 SER A CB  1 
ATOM   2283 O  OG  . SER A 1 285 ? -26.069 11.262  -8.087  1.00 16.55 ? 460 SER A OG  1 
ATOM   2284 N  N   . TYR A 1 286 ? -22.884 11.852  -8.025  1.00 11.70 ? 461 TYR A N   1 
ATOM   2285 C  CA  . TYR A 1 286 ? -22.139 11.168  -7.035  1.00 11.75 ? 461 TYR A CA  1 
ATOM   2286 C  C   . TYR A 1 286 ? -22.564 11.747  -5.696  1.00 13.22 ? 461 TYR A C   1 
ATOM   2287 O  O   . TYR A 1 286 ? -23.156 12.852  -5.592  1.00 13.76 ? 461 TYR A O   1 
ATOM   2288 C  CB  . TYR A 1 286 ? -20.598 11.301  -7.246  1.00 10.86 ? 461 TYR A CB  1 
ATOM   2289 C  CG  . TYR A 1 286 ? -20.054 12.723  -7.521  1.00 15.78 ? 461 TYR A CG  1 
ATOM   2290 C  CD1 . TYR A 1 286 ? -19.589 13.535  -6.486  1.00 14.35 ? 461 TYR A CD1 1 
ATOM   2291 C  CD2 . TYR A 1 286 ? -19.978 13.210  -8.826  1.00 15.99 ? 461 TYR A CD2 1 
ATOM   2292 C  CE1 . TYR A 1 286 ? -19.079 14.832  -6.749  1.00 14.20 ? 461 TYR A CE1 1 
ATOM   2293 C  CE2 . TYR A 1 286 ? -19.488 14.532  -9.110  1.00 19.21 ? 461 TYR A CE2 1 
ATOM   2294 C  CZ  . TYR A 1 286 ? -19.048 15.313  -8.053  1.00 17.53 ? 461 TYR A CZ  1 
ATOM   2295 O  OH  . TYR A 1 286 ? -18.541 16.568  -8.303  1.00 22.90 ? 461 TYR A OH  1 
ATOM   2296 N  N   . ILE A 1 287 ? -22.230 11.027  -4.647  1.00 13.85 ? 462 ILE A N   1 
ATOM   2297 C  CA  . ILE A 1 287 ? -22.566 11.410  -3.289  1.00 13.60 ? 462 ILE A CA  1 
ATOM   2298 C  C   . ILE A 1 287 ? -21.302 11.750  -2.467  1.00 14.59 ? 462 ILE A C   1 
ATOM   2299 O  O   . ILE A 1 287 ? -20.248 11.058  -2.548  1.00 13.17 ? 462 ILE A O   1 
ATOM   2300 C  CB  . ILE A 1 287 ? -23.303 10.222  -2.595  1.00 12.72 ? 462 ILE A CB  1 
ATOM   2301 C  CG1 . ILE A 1 287 ? -24.705 9.983   -3.203  1.00 12.41 ? 462 ILE A CG1 1 
ATOM   2302 C  CG2 . ILE A 1 287 ? -23.501 10.490  -1.136  1.00 12.75 ? 462 ILE A CG2 1 
ATOM   2303 C  CD1 . ILE A 1 287 ? -25.356 8.627   -2.707  1.00 11.06 ? 462 ILE A CD1 1 
ATOM   2304 N  N   . HIS A 1 288 ? -21.404 12.803  -1.659  1.00 14.98 ? 463 HIS A N   1 
ATOM   2305 C  CA  . HIS A 1 288 ? -20.438 13.085  -0.615  1.00 15.79 ? 463 HIS A CA  1 
ATOM   2306 C  C   . HIS A 1 288 ? -21.008 12.727  0.718   1.00 16.44 ? 463 HIS A C   1 
ATOM   2307 O  O   . HIS A 1 288 ? -22.161 13.111  1.018   1.00 13.82 ? 463 HIS A O   1 
ATOM   2308 C  CB  . HIS A 1 288 ? -20.091 14.593  -0.580  1.00 18.42 ? 463 HIS A CB  1 
ATOM   2309 C  CG  . HIS A 1 288 ? -19.067 14.981  -1.581  1.00 23.75 ? 463 HIS A CG  1 
ATOM   2310 N  ND1 . HIS A 1 288 ? -18.704 16.289  -1.815  1.00 28.63 ? 463 HIS A ND1 1 
ATOM   2311 C  CD2 . HIS A 1 288 ? -18.359 14.222  -2.461  1.00 26.60 ? 463 HIS A CD2 1 
ATOM   2312 C  CE1 . HIS A 1 288 ? -17.811 16.320  -2.793  1.00 29.25 ? 463 HIS A CE1 1 
ATOM   2313 N  NE2 . HIS A 1 288 ? -17.581 15.079  -3.194  1.00 26.70 ? 463 HIS A NE2 1 
ATOM   2314 N  N   . LEU A 1 289 ? -20.249 11.934  1.487   1.00 16.48 ? 464 LEU A N   1 
ATOM   2315 C  CA  . LEU A 1 289 ? -20.538 11.647  2.878   1.00 19.40 ? 464 LEU A CA  1 
ATOM   2316 C  C   . LEU A 1 289 ? -19.384 12.146  3.733   1.00 20.63 ? 464 LEU A C   1 
ATOM   2317 O  O   . LEU A 1 289 ? -18.208 12.060  3.298   1.00 21.09 ? 464 LEU A O   1 
ATOM   2318 C  CB  . LEU A 1 289 ? -20.617 10.127  3.092   1.00 18.33 ? 464 LEU A CB  1 
ATOM   2319 C  CG  . LEU A 1 289 ? -21.522 9.316   2.198   1.00 20.51 ? 464 LEU A CG  1 
ATOM   2320 C  CD1 . LEU A 1 289 ? -21.280 7.839   2.578   1.00 23.46 ? 464 LEU A CD1 1 
ATOM   2321 C  CD2 . LEU A 1 289 ? -22.980 9.785   2.395   1.00 18.55 ? 464 LEU A CD2 1 
ATOM   2322 N  N   . GLN A 1 290 ? -19.645 12.609  4.957   1.00 21.57 ? 465 GLN A N   1 
ATOM   2323 C  CA  . GLN A 1 290 ? -18.531 12.980  5.842   1.00 23.67 ? 465 GLN A CA  1 
ATOM   2324 C  C   . GLN A 1 290 ? -18.668 12.394  7.223   1.00 23.59 ? 465 GLN A C   1 
ATOM   2325 O  O   . GLN A 1 290 ? -19.774 12.045  7.662   1.00 21.73 ? 465 GLN A O   1 
ATOM   2326 C  CB  . GLN A 1 290 ? -18.339 14.480  5.935   1.00 26.02 ? 465 GLN A CB  1 
ATOM   2327 C  CG  . GLN A 1 290 ? -19.614 15.222  6.107   1.00 33.13 ? 465 GLN A CG  1 
ATOM   2328 C  CD  . GLN A 1 290 ? -19.608 16.477  5.259   1.00 44.10 ? 465 GLN A CD  1 
ATOM   2329 O  OE1 . GLN A 1 290 ? -18.711 16.653  4.409   1.00 47.60 ? 465 GLN A OE1 1 
ATOM   2330 N  NE2 . GLN A 1 290 ? -20.611 17.357  5.464   1.00 46.60 ? 465 GLN A NE2 1 
ATOM   2331 N  N   . GLY A 1 291 ? -17.537 12.211  7.882   1.00 23.07 ? 466 GLY A N   1 
ATOM   2332 C  CA  . GLY A 1 291 ? -17.509 11.454  9.102   1.00 24.84 ? 466 GLY A CA  1 
ATOM   2333 C  C   . GLY A 1 291 ? -18.394 12.094  10.161  1.00 26.73 ? 466 GLY A C   1 
ATOM   2334 O  O   . GLY A 1 291 ? -18.978 11.379  10.962  1.00 28.22 ? 466 GLY A O   1 
ATOM   2335 N  N   . SER A 1 292 ? -18.509 13.424  10.172  1.00 26.55 ? 467 SER A N   1 
ATOM   2336 C  CA  . SER A 1 292 ? -19.270 14.093  11.238  1.00 28.62 ? 467 SER A CA  1 
ATOM   2337 C  C   . SER A 1 292 ? -20.758 14.166  10.871  1.00 28.17 ? 467 SER A C   1 
ATOM   2338 O  O   . SER A 1 292 ? -21.598 14.638  11.648  1.00 28.87 ? 467 SER A O   1 
ATOM   2339 C  CB  . SER A 1 292 ? -18.726 15.501  11.477  1.00 28.49 ? 467 SER A CB  1 
ATOM   2340 O  OG  . SER A 1 292 ? -18.899 16.294  10.309  1.00 31.20 ? 467 SER A OG  1 
ATOM   2341 N  N   . ASP A 1 293 ? -21.090 13.695  9.678   1.00 27.65 ? 468 ASP A N   1 
ATOM   2342 C  CA  . ASP A 1 293 ? -22.462 13.811  9.204   1.00 27.15 ? 468 ASP A CA  1 
ATOM   2343 C  C   . ASP A 1 293 ? -22.649 12.942  8.009   1.00 25.46 ? 468 ASP A C   1 
ATOM   2344 O  O   . ASP A 1 293 ? -22.361 13.360  6.885   1.00 25.11 ? 468 ASP A O   1 
ATOM   2345 C  CB  . ASP A 1 293 ? -22.762 15.250  8.798   1.00 28.43 ? 468 ASP A CB  1 
ATOM   2346 C  CG  . ASP A 1 293 ? -24.211 15.438  8.292   1.00 32.20 ? 468 ASP A CG  1 
ATOM   2347 O  OD1 . ASP A 1 293 ? -24.958 14.416  8.220   1.00 32.86 ? 468 ASP A OD1 1 
ATOM   2348 O  OD2 . ASP A 1 293 ? -24.608 16.607  7.976   1.00 32.37 ? 468 ASP A OD2 1 
ATOM   2349 N  N   . LEU A 1 294 ? -23.163 11.744  8.243   1.00 23.83 ? 469 LEU A N   1 
ATOM   2350 C  CA  . LEU A 1 294 ? -23.248 10.753  7.183   1.00 23.27 ? 469 LEU A CA  1 
ATOM   2351 C  C   . LEU A 1 294 ? -24.450 10.881  6.282   1.00 21.19 ? 469 LEU A C   1 
ATOM   2352 O  O   . LEU A 1 294 ? -24.664 10.028  5.460   1.00 21.10 ? 469 LEU A O   1 
ATOM   2353 C  CB  . LEU A 1 294 ? -23.157 9.343   7.764   1.00 23.24 ? 469 LEU A CB  1 
ATOM   2354 C  CG  . LEU A 1 294 ? -21.798 9.061   8.389   1.00 26.03 ? 469 LEU A CG  1 
ATOM   2355 C  CD1 . LEU A 1 294 ? -21.906 7.773   9.166   1.00 31.65 ? 469 LEU A CD1 1 
ATOM   2356 C  CD2 . LEU A 1 294 ? -20.690 8.946   7.304   1.00 28.75 ? 469 LEU A CD2 1 
ATOM   2357 N  N   . ARG A 1 295 ? -25.240 11.944  6.403   1.00 19.67 ? 470 ARG A N   1 
ATOM   2358 C  CA  . ARG A 1 295 ? -26.341 12.127  5.463   1.00 20.18 ? 470 ARG A CA  1 
ATOM   2359 C  C   . ARG A 1 295 ? -25.817 12.453  4.029   1.00 19.06 ? 470 ARG A C   1 
ATOM   2360 O  O   . ARG A 1 295 ? -24.821 13.199  3.905   1.00 18.97 ? 470 ARG A O   1 
ATOM   2361 C  CB  . ARG A 1 295 ? -27.259 13.218  5.981   1.00 21.33 ? 470 ARG A CB  1 
ATOM   2362 C  CG  . ARG A 1 295 ? -27.984 12.730  7.258   1.00 26.50 ? 470 ARG A CG  1 
ATOM   2363 C  CD  . ARG A 1 295 ? -28.765 13.863  7.909   1.00 30.80 ? 470 ARG A CD  1 
ATOM   2364 N  NE  . ARG A 1 295 ? -27.866 14.997  8.107   1.00 32.16 ? 470 ARG A NE  1 
ATOM   2365 C  CZ  . ARG A 1 295 ? -28.270 16.227  8.399   1.00 35.22 ? 470 ARG A CZ  1 
ATOM   2366 N  NH1 . ARG A 1 295 ? -29.563 16.475  8.505   1.00 35.13 ? 470 ARG A NH1 1 
ATOM   2367 N  NH2 . ARG A 1 295 ? -27.383 17.195  8.594   1.00 34.03 ? 470 ARG A NH2 1 
ATOM   2368 N  N   . PRO A 1 296 ? -26.443 11.872  2.972   1.00 17.48 ? 471 PRO A N   1 
ATOM   2369 C  CA  . PRO A 1 296 ? -25.885 11.973  1.587   1.00 17.13 ? 471 PRO A CA  1 
ATOM   2370 C  C   . PRO A 1 296 ? -26.051 13.392  1.037   1.00 17.86 ? 471 PRO A C   1 
ATOM   2371 O  O   . PRO A 1 296 ? -27.125 14.022  1.215   1.00 17.07 ? 471 PRO A O   1 
ATOM   2372 C  CB  . PRO A 1 296 ? -26.736 10.986  0.751   1.00 16.91 ? 471 PRO A CB  1 
ATOM   2373 C  CG  . PRO A 1 296 ? -28.033 10.837  1.553   1.00 18.51 ? 471 PRO A CG  1 
ATOM   2374 C  CD  . PRO A 1 296 ? -27.710 11.098  3.028   1.00 17.15 ? 471 PRO A CD  1 
ATOM   2375 N  N   . GLN A 1 297 ? -24.990 13.913  0.428   1.00 17.07 ? 472 GLN A N   1 
ATOM   2376 C  CA  . GLN A 1 297 ? -25.066 15.174  -0.305  1.00 18.27 ? 472 GLN A CA  1 
ATOM   2377 C  C   . GLN A 1 297 ? -24.866 14.872  -1.772  1.00 17.12 ? 472 GLN A C   1 
ATOM   2378 O  O   . GLN A 1 297 ? -23.843 14.246  -2.143  1.00 16.73 ? 472 GLN A O   1 
ATOM   2379 C  CB  . GLN A 1 297 ? -24.001 16.161  0.221   1.00 18.76 ? 472 GLN A CB  1 
ATOM   2380 C  CG  . GLN A 1 297 ? -24.027 16.273  1.757   1.00 26.76 ? 472 GLN A CG  1 
ATOM   2381 C  CD  . GLN A 1 297 ? -22.782 17.000  2.257   1.00 37.37 ? 472 GLN A CD  1 
ATOM   2382 O  OE1 . GLN A 1 297 ? -22.648 18.203  2.011   1.00 37.85 ? 472 GLN A OE1 1 
ATOM   2383 N  NE2 . GLN A 1 297 ? -21.842 16.260  2.916   1.00 38.94 ? 472 GLN A NE2 1 
ATOM   2384 N  N   . PHE A 1 298 ? -25.829 15.275  -2.612  1.00 16.26 ? 473 PHE A N   1 
ATOM   2385 C  CA  . PHE A 1 298 ? -25.819 14.836  -4.006  1.00 17.56 ? 473 PHE A CA  1 
ATOM   2386 C  C   . PHE A 1 298 ? -25.152 15.896  -4.882  1.00 18.34 ? 473 PHE A C   1 
ATOM   2387 O  O   . PHE A 1 298 ? -25.434 17.089  -4.753  1.00 18.42 ? 473 PHE A O   1 
ATOM   2388 C  CB  . PHE A 1 298 ? -27.247 14.517  -4.507  1.00 17.52 ? 473 PHE A CB  1 
ATOM   2389 C  CG  . PHE A 1 298 ? -27.912 13.355  -3.738  1.00 17.89 ? 473 PHE A CG  1 
ATOM   2390 C  CD1 . PHE A 1 298 ? -27.677 12.047  -4.113  1.00 14.15 ? 473 PHE A CD1 1 
ATOM   2391 C  CD2 . PHE A 1 298 ? -28.727 13.595  -2.649  1.00 22.11 ? 473 PHE A CD2 1 
ATOM   2392 C  CE1 . PHE A 1 298 ? -28.228 10.987  -3.396  1.00 15.91 ? 473 PHE A CE1 1 
ATOM   2393 C  CE2 . PHE A 1 298 ? -29.322 12.498  -1.929  1.00 18.46 ? 473 PHE A CE2 1 
ATOM   2394 C  CZ  . PHE A 1 298 ? -29.060 11.242  -2.307  1.00 15.88 ? 473 PHE A CZ  1 
ATOM   2395 N  N   . HIS A 1 299 ? -24.279 15.464  -5.757  1.00 16.49 ? 474 HIS A N   1 
ATOM   2396 C  CA  . HIS A 1 299 ? -23.680 16.332  -6.761  1.00 19.04 ? 474 HIS A CA  1 
ATOM   2397 C  C   . HIS A 1 299 ? -24.010 15.880  -8.170  1.00 17.83 ? 474 HIS A C   1 
ATOM   2398 O  O   . HIS A 1 299 ? -23.556 14.813  -8.600  1.00 17.66 ? 474 HIS A O   1 
ATOM   2399 C  CB  . HIS A 1 299 ? -22.153 16.408  -6.533  1.00 19.79 ? 474 HIS A CB  1 
ATOM   2400 C  CG  . HIS A 1 299 ? -21.810 17.053  -5.236  1.00 25.96 ? 474 HIS A CG  1 
ATOM   2401 N  ND1 . HIS A 1 299 ? -21.632 16.341  -4.062  1.00 31.36 ? 474 HIS A ND1 1 
ATOM   2402 C  CD2 . HIS A 1 299 ? -21.709 18.359  -4.899  1.00 32.05 ? 474 HIS A CD2 1 
ATOM   2403 C  CE1 . HIS A 1 299 ? -21.395 17.179  -3.070  1.00 31.64 ? 474 HIS A CE1 1 
ATOM   2404 N  NE2 . HIS A 1 299 ? -21.421 18.407  -3.552  1.00 36.05 ? 474 HIS A NE2 1 
ATOM   2405 N  N   . GLN A 1 300 ? -24.718 16.707  -8.934  1.00 16.12 ? 475 GLN A N   1 
ATOM   2406 C  CA  . GLN A 1 300 ? -25.137 16.292  -10.237 1.00 16.94 ? 475 GLN A CA  1 
ATOM   2407 C  C   . GLN A 1 300 ? -24.153 16.768  -11.320 1.00 17.61 ? 475 GLN A C   1 
ATOM   2408 O  O   . GLN A 1 300 ? -23.528 17.809  -11.165 1.00 17.34 ? 475 GLN A O   1 
ATOM   2409 C  CB  . GLN A 1 300 ? -26.538 16.826  -10.569 1.00 18.75 ? 475 GLN A CB  1 
ATOM   2410 C  CG  . GLN A 1 300 ? -27.662 16.178  -9.822  1.00 21.09 ? 475 GLN A CG  1 
ATOM   2411 C  CD  . GLN A 1 300 ? -28.982 16.932  -10.044 1.00 24.30 ? 475 GLN A CD  1 
ATOM   2412 O  OE1 . GLN A 1 300 ? -29.042 18.128  -9.814  1.00 24.66 ? 475 GLN A OE1 1 
ATOM   2413 N  NE2 . GLN A 1 300 ? -30.011 16.243  -10.542 1.00 18.87 ? 475 GLN A NE2 1 
ATOM   2414 N  N   . PHE A 1 301 ? -24.049 16.006  -12.408 1.00 15.32 ? 476 PHE A N   1 
ATOM   2415 C  CA  . PHE A 1 301 ? -23.274 16.424  -13.577 1.00 16.63 ? 476 PHE A CA  1 
ATOM   2416 C  C   . PHE A 1 301 ? -23.845 15.811  -14.869 1.00 17.18 ? 476 PHE A C   1 
ATOM   2417 O  O   . PHE A 1 301 ? -24.656 14.859  -14.872 1.00 17.50 ? 476 PHE A O   1 
ATOM   2418 C  CB  . PHE A 1 301 ? -21.783 16.054  -13.333 1.00 15.88 ? 476 PHE A CB  1 
ATOM   2419 C  CG  . PHE A 1 301 ? -21.518 14.529  -13.294 1.00 14.14 ? 476 PHE A CG  1 
ATOM   2420 C  CD1 . PHE A 1 301 ? -21.767 13.779  -12.131 1.00 13.47 ? 476 PHE A CD1 1 
ATOM   2421 C  CD2 . PHE A 1 301 ? -21.068 13.877  -14.432 1.00 16.30 ? 476 PHE A CD2 1 
ATOM   2422 C  CE1 . PHE A 1 301 ? -21.500 12.370  -12.058 1.00 16.75 ? 476 PHE A CE1 1 
ATOM   2423 C  CE2 . PHE A 1 301 ? -20.817 12.461  -14.405 1.00 13.71 ? 476 PHE A CE2 1 
ATOM   2424 C  CZ  . PHE A 1 301 ? -21.035 11.703  -13.223 1.00 13.20 ? 476 PHE A CZ  1 
ATOM   2425 N  N   . THR A 1 302 ? -23.473 16.378  -16.012 1.00 16.79 ? 477 THR A N   1 
ATOM   2426 C  CA  . THR A 1 302 ? -24.022 15.929  -17.273 1.00 17.29 ? 477 THR A CA  1 
ATOM   2427 C  C   . THR A 1 302 ? -22.869 15.451  -18.179 1.00 16.15 ? 477 THR A C   1 
ATOM   2428 O  O   . THR A 1 302 ? -21.679 15.574  -17.827 1.00 14.30 ? 477 THR A O   1 
ATOM   2429 C  CB  . THR A 1 302 ? -24.742 17.096  -18.034 1.00 19.62 ? 477 THR A CB  1 
ATOM   2430 O  OG1 . THR A 1 302 ? -23.857 18.214  -18.076 1.00 19.98 ? 477 THR A OG1 1 
ATOM   2431 C  CG2 . THR A 1 302 ? -26.066 17.519  -17.294 1.00 20.84 ? 477 THR A CG2 1 
ATOM   2432 N  N   . ALA A 1 303 ? -23.249 14.908  -19.311 1.00 16.40 ? 478 ALA A N   1 
ATOM   2433 C  CA  . ALA A 1 303 ? -22.316 14.172  -20.189 1.00 18.07 ? 478 ALA A CA  1 
ATOM   2434 C  C   . ALA A 1 303 ? -21.299 15.135  -20.860 1.00 18.79 ? 478 ALA A C   1 
ATOM   2435 O  O   . ALA A 1 303 ? -21.634 16.292  -21.112 1.00 19.72 ? 478 ALA A O   1 
ATOM   2436 C  CB  . ALA A 1 303 ? -23.102 13.338  -21.241 1.00 16.20 ? 478 ALA A CB  1 
ATOM   2437 N  N   . VAL A 1 304 ? -20.069 14.665  -21.105 1.00 18.61 ? 479 VAL A N   1 
ATOM   2438 C  CA  . VAL A 1 304 ? -19.067 15.397  -21.920 1.00 18.76 ? 479 VAL A CA  1 
ATOM   2439 C  C   . VAL A 1 304 ? -18.862 14.692  -23.249 1.00 19.03 ? 479 VAL A C   1 
ATOM   2440 O  O   . VAL A 1 304 ? -19.234 13.539  -23.396 1.00 19.19 ? 479 VAL A O   1 
ATOM   2441 C  CB  . VAL A 1 304 ? -17.693 15.516  -21.176 1.00 17.62 ? 479 VAL A CB  1 
ATOM   2442 C  CG1 . VAL A 1 304 ? -17.884 16.324  -19.912 1.00 21.00 ? 479 VAL A CG1 1 
ATOM   2443 C  CG2 . VAL A 1 304 ? -17.073 14.072  -20.964 1.00 16.07 ? 479 VAL A CG2 1 
ATOM   2444 N  N   . PRO A 1 305 ? -18.284 15.387  -24.247 1.00 20.72 ? 480 PRO A N   1 
ATOM   2445 C  CA  . PRO A 1 305 ? -18.008 14.776  -25.546 1.00 21.29 ? 480 PRO A CA  1 
ATOM   2446 C  C   . PRO A 1 305 ? -17.030 13.585  -25.398 1.00 20.70 ? 480 PRO A C   1 
ATOM   2447 O  O   . PRO A 1 305 ? -16.206 13.534  -24.462 1.00 22.31 ? 480 PRO A O   1 
ATOM   2448 C  CB  . PRO A 1 305 ? -17.309 15.907  -26.307 1.00 21.23 ? 480 PRO A CB  1 
ATOM   2449 C  CG  . PRO A 1 305 ? -17.736 17.103  -25.628 1.00 21.55 ? 480 PRO A CG  1 
ATOM   2450 C  CD  . PRO A 1 305 ? -17.775 16.762  -24.198 1.00 20.63 ? 480 PRO A CD  1 
ATOM   2451 N  N   . HIS A 1 306 ? -17.170 12.620  -26.273 1.00 21.61 ? 481 HIS A N   1 
ATOM   2452 C  CA  . HIS A 1 306 ? -16.223 11.492  -26.343 1.00 22.49 ? 481 HIS A CA  1 
ATOM   2453 C  C   . HIS A 1 306 ? -16.069 11.217  -27.826 1.00 22.40 ? 481 HIS A C   1 
ATOM   2454 O  O   . HIS A 1 306 ? -16.889 11.695  -28.620 1.00 22.08 ? 481 HIS A O   1 
ATOM   2455 C  CB  . HIS A 1 306 ? -16.755 10.245  -25.615 1.00 20.38 ? 481 HIS A CB  1 
ATOM   2456 C  CG  . HIS A 1 306 ? -18.128 9.827   -26.026 1.00 21.93 ? 481 HIS A CG  1 
ATOM   2457 N  ND1 . HIS A 1 306 ? -18.413 9.262   -27.255 1.00 21.37 ? 481 HIS A ND1 1 
ATOM   2458 C  CD2 . HIS A 1 306 ? -19.299 9.811   -25.333 1.00 24.53 ? 481 HIS A CD2 1 
ATOM   2459 C  CE1 . HIS A 1 306 ? -19.702 8.966   -27.320 1.00 20.17 ? 481 HIS A CE1 1 
ATOM   2460 N  NE2 . HIS A 1 306 ? -20.257 9.280   -26.161 1.00 22.07 ? 481 HIS A NE2 1 
ATOM   2461 N  N   . PRO A 1 307 ? -15.037 10.434  -28.196 1.00 24.22 ? 482 PRO A N   1 
ATOM   2462 C  CA  . PRO A 1 307 ? -14.832 10.064  -29.595 1.00 25.48 ? 482 PRO A CA  1 
ATOM   2463 C  C   . PRO A 1 307 ? -16.045 9.335   -30.155 1.00 26.63 ? 482 PRO A C   1 
ATOM   2464 O  O   . PRO A 1 307 ? -16.839 8.751   -29.408 1.00 25.42 ? 482 PRO A O   1 
ATOM   2465 C  CB  . PRO A 1 307 ? -13.599 9.134   -29.565 1.00 25.08 ? 482 PRO A CB  1 
ATOM   2466 C  CG  . PRO A 1 307 ? -12.911 9.425   -28.250 1.00 23.86 ? 482 PRO A CG  1 
ATOM   2467 C  CD  . PRO A 1 307 ? -13.974 9.936   -27.307 1.00 22.63 ? 482 PRO A CD  1 
ATOM   2468 N  N   . ASN A 1 308 ? -16.179 9.404   -31.471 1.00 28.76 ? 483 ASN A N   1 
ATOM   2469 C  CA  . ASN A 1 308 ? -17.309 8.810   -32.167 1.00 30.75 ? 483 ASN A CA  1 
ATOM   2470 C  C   . ASN A 1 308 ? -17.153 7.296   -32.300 1.00 31.66 ? 483 ASN A C   1 
ATOM   2471 O  O   . ASN A 1 308 ? -16.795 6.734   -33.383 1.00 32.92 ? 483 ASN A O   1 
ATOM   2472 C  CB  . ASN A 1 308 ? -17.509 9.458   -33.547 1.00 32.41 ? 483 ASN A CB  1 
ATOM   2473 C  CG  . ASN A 1 308 ? -18.681 8.815   -34.321 1.00 34.75 ? 483 ASN A CG  1 
ATOM   2474 O  OD1 . ASN A 1 308 ? -19.648 8.299   -33.718 1.00 37.53 ? 483 ASN A OD1 1 
ATOM   2475 N  ND2 . ASN A 1 308 ? -18.582 8.815   -35.648 1.00 35.74 ? 483 ASN A ND2 1 
ATOM   2476 N  N   . VAL A 1 309 ? -17.330 6.626   -31.173 1.00 30.94 ? 484 VAL A N   1 
ATOM   2477 C  CA  . VAL A 1 309 ? -17.448 5.185   -31.153 1.00 30.19 ? 484 VAL A CA  1 
ATOM   2478 C  C   . VAL A 1 309 ? -18.820 4.957   -30.526 1.00 30.20 ? 484 VAL A C   1 
ATOM   2479 O  O   . VAL A 1 309 ? -19.148 5.591   -29.531 1.00 29.17 ? 484 VAL A O   1 
ATOM   2480 C  CB  . VAL A 1 309 ? -16.360 4.539   -30.273 1.00 29.91 ? 484 VAL A CB  1 
ATOM   2481 C  CG1 . VAL A 1 309 ? -16.508 3.013   -30.295 1.00 30.59 ? 484 VAL A CG1 1 
ATOM   2482 C  CG2 . VAL A 1 309 ? -14.932 5.000   -30.733 1.00 30.43 ? 484 VAL A CG2 1 
ATOM   2483 N  N   . LYS A 1 310 ? -19.645 4.107   -31.120 1.00 29.14 ? 485 LYS A N   1 
ATOM   2484 C  CA  . LYS A 1 310 ? -20.968 3.894   -30.551 1.00 29.90 ? 485 LYS A CA  1 
ATOM   2485 C  C   . LYS A 1 310 ? -21.067 2.894   -29.391 1.00 28.22 ? 485 LYS A C   1 
ATOM   2486 O  O   . LYS A 1 310 ? -20.245 2.001   -29.259 1.00 25.67 ? 485 LYS A O   1 
ATOM   2487 C  CB  . LYS A 1 310 ? -22.005 3.548   -31.637 1.00 30.20 ? 485 LYS A CB  1 
ATOM   2488 C  CG  . LYS A 1 310 ? -22.465 4.801   -32.447 1.00 35.92 ? 485 LYS A CG  1 
ATOM   2489 C  CD  . LYS A 1 310 ? -21.790 4.794   -33.815 1.00 42.98 ? 485 LYS A CD  1 
ATOM   2490 C  CE  . LYS A 1 310 ? -22.607 4.015   -34.875 1.00 47.82 ? 485 LYS A CE  1 
ATOM   2491 N  NZ  . LYS A 1 310 ? -23.744 4.875   -35.365 1.00 52.18 ? 485 LYS A NZ  1 
ATOM   2492 N  N   . PRO A 1 311 ? -22.107 3.068   -28.545 1.00 28.97 ? 486 PRO A N   1 
ATOM   2493 C  CA  . PRO A 1 311 ? -22.323 2.131   -27.435 1.00 29.96 ? 486 PRO A CA  1 
ATOM   2494 C  C   . PRO A 1 311 ? -22.528 0.758   -28.008 1.00 30.18 ? 486 PRO A C   1 
ATOM   2495 O  O   . PRO A 1 311 ? -23.127 0.622   -29.052 1.00 30.58 ? 486 PRO A O   1 
ATOM   2496 C  CB  . PRO A 1 311 ? -23.620 2.633   -26.771 1.00 29.67 ? 486 PRO A CB  1 
ATOM   2497 C  CG  . PRO A 1 311 ? -23.650 4.100   -27.102 1.00 30.42 ? 486 PRO A CG  1 
ATOM   2498 C  CD  . PRO A 1 311 ? -23.058 4.198   -28.511 1.00 28.95 ? 486 PRO A CD  1 
ATOM   2499 N  N   . MET A 1 312 ? -21.981 -0.232  -27.336 1.00 31.30 ? 487 MET A N   1 
ATOM   2500 C  CA  . MET A 1 312 ? -22.018 -1.599  -27.789 1.00 33.19 ? 487 MET A CA  1 
ATOM   2501 C  C   . MET A 1 312 ? -21.441 -1.949  -29.151 1.00 33.40 ? 487 MET A C   1 
ATOM   2502 O  O   . MET A 1 312 ? -21.780 -2.981  -29.738 1.00 32.82 ? 487 MET A O   1 
ATOM   2503 C  CB  . MET A 1 312 ? -23.386 -2.194  -27.633 1.00 35.02 ? 487 MET A CB  1 
ATOM   2504 C  CG  . MET A 1 312 ? -23.298 -3.173  -26.449 1.00 37.95 ? 487 MET A CG  1 
ATOM   2505 S  SD  . MET A 1 312 ? -24.812 -3.111  -25.612 1.00 46.53 ? 487 MET A SD  1 
ATOM   2506 C  CE  . MET A 1 312 ? -25.327 -1.450  -26.100 1.00 42.97 ? 487 MET A CE  1 
ATOM   2507 N  N   . ALA A 1 313 ? -20.529 -1.118  -29.614 1.00 33.43 ? 488 ALA A N   1 
ATOM   2508 C  CA  . ALA A 1 313 ? -19.864 -1.388  -30.865 1.00 33.96 ? 488 ALA A CA  1 
ATOM   2509 C  C   . ALA A 1 313 ? -19.216 -2.768  -30.751 1.00 35.28 ? 488 ALA A C   1 
ATOM   2510 O  O   . ALA A 1 313 ? -18.977 -3.414  -31.775 1.00 35.54 ? 488 ALA A O   1 
ATOM   2511 C  CB  . ALA A 1 313 ? -18.817 -0.316  -31.147 1.00 33.37 ? 488 ALA A CB  1 
ATOM   2512 N  N   . TYR A 1 314 ? -18.936 -3.226  -29.517 1.00 35.62 ? 489 TYR A N   1 
ATOM   2513 C  CA  . TYR A 1 314 ? -18.202 -4.469  -29.333 1.00 36.34 ? 489 TYR A CA  1 
ATOM   2514 C  C   . TYR A 1 314 ? -19.068 -5.648  -28.933 1.00 37.83 ? 489 TYR A C   1 
ATOM   2515 O  O   . TYR A 1 314 ? -18.554 -6.751  -28.736 1.00 38.61 ? 489 TYR A O   1 
ATOM   2516 C  CB  . TYR A 1 314 ? -17.022 -4.315  -28.335 1.00 35.63 ? 489 TYR A CB  1 
ATOM   2517 C  CG  . TYR A 1 314 ? -15.967 -3.303  -28.743 1.00 31.28 ? 489 TYR A CG  1 
ATOM   2518 C  CD1 . TYR A 1 314 ? -15.038 -3.577  -29.738 1.00 30.48 ? 489 TYR A CD1 1 
ATOM   2519 C  CD2 . TYR A 1 314 ? -15.898 -2.071  -28.098 1.00 28.17 ? 489 TYR A CD2 1 
ATOM   2520 C  CE1 . TYR A 1 314 ? -14.047 -2.596  -30.113 1.00 31.34 ? 489 TYR A CE1 1 
ATOM   2521 C  CE2 . TYR A 1 314 ? -14.934 -1.118  -28.442 1.00 29.38 ? 489 TYR A CE2 1 
ATOM   2522 C  CZ  . TYR A 1 314 ? -14.017 -1.385  -29.458 1.00 29.84 ? 489 TYR A CZ  1 
ATOM   2523 O  OH  . TYR A 1 314 ? -13.092 -0.401  -29.729 1.00 33.23 ? 489 TYR A OH  1 
ATOM   2524 N  N   . ALA A 1 315 ? -20.368 -5.431  -28.788 1.00 39.80 ? 490 ALA A N   1 
ATOM   2525 C  CA  . ALA A 1 315 ? -21.263 -6.536  -28.385 1.00 40.61 ? 490 ALA A CA  1 
ATOM   2526 C  C   . ALA A 1 315 ? -21.548 -7.401  -29.595 1.00 41.92 ? 490 ALA A C   1 
ATOM   2527 O  O   . ALA A 1 315 ? -22.188 -6.930  -30.535 1.00 43.31 ? 490 ALA A O   1 
ATOM   2528 C  CB  . ALA A 1 315 ? -22.546 -6.007  -27.835 1.00 40.20 ? 490 ALA A CB  1 
ATOM   2529 N  N   . TYR B 1 1   ? -69.414 0.173   -13.786 1.00 60.71 ? 176 TYR B N   1 
ATOM   2530 C  CA  . TYR B 1 1   ? -68.788 0.585   -15.080 1.00 60.81 ? 176 TYR B CA  1 
ATOM   2531 C  C   . TYR B 1 1   ? -69.466 1.789   -15.746 1.00 60.73 ? 176 TYR B C   1 
ATOM   2532 O  O   . TYR B 1 1   ? -70.597 1.680   -16.229 1.00 60.80 ? 176 TYR B O   1 
ATOM   2533 C  CB  . TYR B 1 1   ? -68.773 -0.579  -16.057 1.00 60.51 ? 176 TYR B CB  1 
ATOM   2534 C  CG  . TYR B 1 1   ? -68.123 -0.246  -17.383 1.00 61.34 ? 176 TYR B CG  1 
ATOM   2535 C  CD1 . TYR B 1 1   ? -66.754 0.065   -17.459 1.00 61.35 ? 176 TYR B CD1 1 
ATOM   2536 C  CD2 . TYR B 1 1   ? -68.867 -0.252  -18.566 1.00 61.25 ? 176 TYR B CD2 1 
ATOM   2537 C  CE1 . TYR B 1 1   ? -66.151 0.360   -18.671 1.00 60.00 ? 176 TYR B CE1 1 
ATOM   2538 C  CE2 . TYR B 1 1   ? -68.274 0.047   -19.794 1.00 60.88 ? 176 TYR B CE2 1 
ATOM   2539 C  CZ  . TYR B 1 1   ? -66.909 0.341   -19.842 1.00 59.07 ? 176 TYR B CZ  1 
ATOM   2540 O  OH  . TYR B 1 1   ? -66.305 0.641   -21.046 1.00 55.09 ? 176 TYR B OH  1 
ATOM   2541 N  N   . SER B 1 2   ? -68.765 2.927   -15.783 1.00 60.45 ? 177 SER B N   1 
ATOM   2542 C  CA  . SER B 1 2   ? -69.279 4.136   -16.444 1.00 60.24 ? 177 SER B CA  1 
ATOM   2543 C  C   . SER B 1 2   ? -68.557 4.451   -17.771 1.00 59.66 ? 177 SER B C   1 
ATOM   2544 O  O   . SER B 1 2   ? -68.793 5.514   -18.368 1.00 59.65 ? 177 SER B O   1 
ATOM   2545 C  CB  . SER B 1 2   ? -69.234 5.354   -15.498 1.00 60.42 ? 177 SER B CB  1 
ATOM   2546 O  OG  . SER B 1 2   ? -67.925 5.576   -14.982 1.00 61.17 ? 177 SER B OG  1 
ATOM   2547 N  N   . GLY B 1 3   ? -67.687 3.533   -18.219 1.00 58.71 ? 178 GLY B N   1 
ATOM   2548 C  CA  . GLY B 1 3   ? -66.948 3.672   -19.480 1.00 57.10 ? 178 GLY B CA  1 
ATOM   2549 C  C   . GLY B 1 3   ? -67.798 3.504   -20.735 1.00 56.50 ? 178 GLY B C   1 
ATOM   2550 O  O   . GLY B 1 3   ? -69.010 3.338   -20.645 1.00 56.62 ? 178 GLY B O   1 
ATOM   2551 N  N   . PRO B 1 4   ? -67.162 3.559   -21.927 1.00 55.73 ? 179 PRO B N   1 
ATOM   2552 C  CA  . PRO B 1 4   ? -67.863 3.577   -23.213 1.00 55.48 ? 179 PRO B CA  1 
ATOM   2553 C  C   . PRO B 1 4   ? -68.589 2.261   -23.538 1.00 55.57 ? 179 PRO B C   1 
ATOM   2554 O  O   . PRO B 1 4   ? -68.171 1.203   -23.072 1.00 55.17 ? 179 PRO B O   1 
ATOM   2555 C  CB  . PRO B 1 4   ? -66.730 3.851   -24.214 1.00 55.42 ? 179 PRO B CB  1 
ATOM   2556 C  CG  . PRO B 1 4   ? -65.634 4.474   -23.380 1.00 55.29 ? 179 PRO B CG  1 
ATOM   2557 C  CD  . PRO B 1 4   ? -65.713 3.757   -22.094 1.00 55.21 ? 179 PRO B CD  1 
ATOM   2558 N  N   . LYS B 1 5   ? -69.677 2.345   -24.309 1.00 56.04 ? 180 LYS B N   1 
ATOM   2559 C  CA  . LYS B 1 5   ? -70.509 1.176   -24.676 1.00 56.52 ? 180 LYS B CA  1 
ATOM   2560 C  C   . LYS B 1 5   ? -70.971 1.260   -26.124 1.00 56.26 ? 180 LYS B C   1 
ATOM   2561 O  O   . LYS B 1 5   ? -71.323 2.340   -26.607 1.00 55.59 ? 180 LYS B O   1 
ATOM   2562 C  CB  . LYS B 1 5   ? -71.758 1.036   -23.767 1.00 56.97 ? 180 LYS B CB  1 
ATOM   2563 C  CG  . LYS B 1 5   ? -71.626 1.621   -22.368 1.00 59.23 ? 180 LYS B CG  1 
ATOM   2564 C  CD  . LYS B 1 5   ? -72.237 0.734   -21.293 1.00 63.91 ? 180 LYS B CD  1 
ATOM   2565 C  CE  . LYS B 1 5   ? -71.249 0.612   -20.103 1.00 67.39 ? 180 LYS B CE  1 
ATOM   2566 N  NZ  . LYS B 1 5   ? -71.739 -0.307  -19.020 1.00 69.73 ? 180 LYS B NZ  1 
ATOM   2567 N  N   . LEU B 1 6   ? -70.999 0.111   -26.799 1.00 56.80 ? 181 LEU B N   1 
ATOM   2568 C  CA  . LEU B 1 6   ? -71.385 0.028   -28.217 1.00 57.83 ? 181 LEU B CA  1 
ATOM   2569 C  C   . LEU B 1 6   ? -72.870 0.356   -28.431 1.00 58.57 ? 181 LEU B C   1 
ATOM   2570 O  O   . LEU B 1 6   ? -73.705 -0.012  -27.610 1.00 58.80 ? 181 LEU B O   1 
ATOM   2571 C  CB  . LEU B 1 6   ? -71.084 -1.377  -28.760 1.00 57.43 ? 181 LEU B CB  1 
ATOM   2572 C  CG  . LEU B 1 6   ? -69.597 -1.730  -28.873 1.00 58.58 ? 181 LEU B CG  1 
ATOM   2573 C  CD1 . LEU B 1 6   ? -69.373 -3.125  -29.491 1.00 59.47 ? 181 LEU B CD1 1 
ATOM   2574 C  CD2 . LEU B 1 6   ? -68.860 -0.660  -29.676 1.00 57.88 ? 181 LEU B CD2 1 
ATOM   2575 N  N   . GLU B 1 7   ? -73.215 1.022   -29.528 1.00 59.05 ? 182 GLU B N   1 
ATOM   2576 C  CA  . GLU B 1 7   ? -74.614 1.402   -29.733 1.00 59.88 ? 182 GLU B CA  1 
ATOM   2577 C  C   . GLU B 1 7   ? -75.377 0.400   -30.595 1.00 59.71 ? 182 GLU B C   1 
ATOM   2578 O  O   . GLU B 1 7   ? -75.357 0.493   -31.817 1.00 59.92 ? 182 GLU B O   1 
ATOM   2579 C  CB  . GLU B 1 7   ? -74.696 2.789   -30.345 1.00 60.26 ? 182 GLU B CB  1 
ATOM   2580 C  CG  . GLU B 1 7   ? -73.601 3.719   -29.837 1.00 62.14 ? 182 GLU B CG  1 
ATOM   2581 C  CD  . GLU B 1 7   ? -73.799 5.140   -30.331 1.00 63.58 ? 182 GLU B CD  1 
ATOM   2582 O  OE1 . GLU B 1 7   ? -74.883 5.430   -30.878 1.00 65.17 ? 182 GLU B OE1 1 
ATOM   2583 O  OE2 . GLU B 1 7   ? -72.876 5.956   -30.187 1.00 63.47 ? 182 GLU B OE2 1 
ATOM   2584 N  N   . ASP B 1 8   ? -76.064 -0.540  -29.947 1.00 59.61 ? 183 ASP B N   1 
ATOM   2585 C  CA  . ASP B 1 8   ? -76.724 -1.643  -30.641 1.00 59.23 ? 183 ASP B CA  1 
ATOM   2586 C  C   . ASP B 1 8   ? -75.665 -2.621  -31.124 1.00 57.90 ? 183 ASP B C   1 
ATOM   2587 O  O   . ASP B 1 8   ? -75.699 -3.080  -32.266 1.00 57.31 ? 183 ASP B O   1 
ATOM   2588 C  CB  . ASP B 1 8   ? -77.546 -1.142  -31.840 1.00 59.82 ? 183 ASP B CB  1 
ATOM   2589 C  CG  . ASP B 1 8   ? -78.796 -0.357  -31.425 1.00 62.78 ? 183 ASP B CG  1 
ATOM   2590 O  OD1 . ASP B 1 8   ? -79.661 -0.913  -30.689 1.00 64.55 ? 183 ASP B OD1 1 
ATOM   2591 O  OD2 . ASP B 1 8   ? -78.920 0.820   -31.865 1.00 64.60 ? 183 ASP B OD2 1 
ATOM   2592 N  N   . GLY B 1 9   ? -74.711 -2.925  -30.254 1.00 56.52 ? 184 GLY B N   1 
ATOM   2593 C  CA  . GLY B 1 9   ? -73.586 -3.784  -30.630 1.00 54.90 ? 184 GLY B CA  1 
ATOM   2594 C  C   . GLY B 1 9   ? -72.795 -3.297  -31.846 1.00 53.48 ? 184 GLY B C   1 
ATOM   2595 O  O   . GLY B 1 9   ? -72.260 -4.104  -32.619 1.00 53.73 ? 184 GLY B O   1 
ATOM   2596 N  N   . LYS B 1 10  ? -72.714 -1.981  -32.029 1.00 51.29 ? 185 LYS B N   1 
ATOM   2597 C  CA  . LYS B 1 10  ? -72.076 -1.462  -33.216 1.00 49.26 ? 185 LYS B CA  1 
ATOM   2598 C  C   . LYS B 1 10  ? -71.310 -0.162  -32.938 1.00 46.52 ? 185 LYS B C   1 
ATOM   2599 O  O   . LYS B 1 10  ? -71.757 0.694   -32.162 1.00 46.07 ? 185 LYS B O   1 
ATOM   2600 C  CB  . LYS B 1 10  ? -73.080 -1.398  -34.377 1.00 49.89 ? 185 LYS B CB  1 
ATOM   2601 C  CG  . LYS B 1 10  ? -73.051 -0.152  -35.247 1.00 53.76 ? 185 LYS B CG  1 
ATOM   2602 C  CD  . LYS B 1 10  ? -74.101 0.882   -34.739 1.00 59.14 ? 185 LYS B CD  1 
ATOM   2603 C  CE  . LYS B 1 10  ? -74.502 1.963   -35.769 1.00 61.21 ? 185 LYS B CE  1 
ATOM   2604 N  NZ  . LYS B 1 10  ? -75.133 1.442   -37.020 1.00 63.34 ? 185 LYS B NZ  1 
ATOM   2605 N  N   . VAL B 1 11  ? -70.125 -0.065  -33.547 1.00 42.60 ? 186 VAL B N   1 
ATOM   2606 C  CA  . VAL B 1 11  ? -69.224 1.040   -33.333 1.00 38.44 ? 186 VAL B CA  1 
ATOM   2607 C  C   . VAL B 1 11  ? -69.790 2.260   -34.025 1.00 36.50 ? 186 VAL B C   1 
ATOM   2608 O  O   . VAL B 1 11  ? -70.250 2.180   -35.148 1.00 36.11 ? 186 VAL B O   1 
ATOM   2609 C  CB  . VAL B 1 11  ? -67.808 0.738   -33.891 1.00 38.69 ? 186 VAL B CB  1 
ATOM   2610 C  CG1 . VAL B 1 11  ? -66.949 2.019   -33.902 1.00 36.87 ? 186 VAL B CG1 1 
ATOM   2611 C  CG2 . VAL B 1 11  ? -67.159 -0.334  -33.087 1.00 36.06 ? 186 VAL B CG2 1 
ATOM   2612 N  N   . THR B 1 12  ? -69.784 3.387   -33.327 1.00 34.53 ? 187 THR B N   1 
ATOM   2613 C  CA  . THR B 1 12  ? -70.177 4.646   -33.943 1.00 34.00 ? 187 THR B CA  1 
ATOM   2614 C  C   . THR B 1 12  ? -69.103 5.677   -33.737 1.00 33.41 ? 187 THR B C   1 
ATOM   2615 O  O   . THR B 1 12  ? -68.147 5.441   -33.002 1.00 33.40 ? 187 THR B O   1 
ATOM   2616 C  CB  . THR B 1 12  ? -71.463 5.181   -33.324 1.00 33.88 ? 187 THR B CB  1 
ATOM   2617 O  OG1 . THR B 1 12  ? -71.225 5.454   -31.941 1.00 31.69 ? 187 THR B OG1 1 
ATOM   2618 C  CG2 . THR B 1 12  ? -72.572 4.115   -33.492 1.00 33.87 ? 187 THR B CG2 1 
ATOM   2619 N  N   . ILE B 1 13  ? -69.255 6.819   -34.390 1.00 33.94 ? 188 ILE B N   1 
ATOM   2620 C  CA  . ILE B 1 13  ? -68.308 7.891   -34.196 1.00 34.06 ? 188 ILE B CA  1 
ATOM   2621 C  C   . ILE B 1 13  ? -68.339 8.435   -32.756 1.00 34.38 ? 188 ILE B C   1 
ATOM   2622 O  O   . ILE B 1 13  ? -67.281 8.770   -32.150 1.00 33.06 ? 188 ILE B O   1 
ATOM   2623 C  CB  . ILE B 1 13  ? -68.436 8.961   -35.330 1.00 35.08 ? 188 ILE B CB  1 
ATOM   2624 C  CG1 . ILE B 1 13  ? -67.262 9.938   -35.287 1.00 36.53 ? 188 ILE B CG1 1 
ATOM   2625 C  CG2 . ILE B 1 13  ? -69.784 9.663   -35.304 1.00 36.79 ? 188 ILE B CG2 1 
ATOM   2626 C  CD1 . ILE B 1 13  ? -67.561 11.198  -34.517 1.00 38.48 ? 188 ILE B CD1 1 
ATOM   2627 N  N   . SER B 1 14  ? -69.528 8.488   -32.144 1.00 33.34 ? 189 SER B N   1 
ATOM   2628 C  CA  . SER B 1 14  ? -69.520 8.949   -30.749 1.00 33.17 ? 189 SER B CA  1 
ATOM   2629 C  C   . SER B 1 14  ? -68.885 7.965   -29.766 1.00 30.40 ? 189 SER B C   1 
ATOM   2630 O  O   . SER B 1 14  ? -68.195 8.380   -28.849 1.00 30.40 ? 189 SER B O   1 
ATOM   2631 C  CB  . SER B 1 14  ? -70.887 9.522   -30.276 1.00 33.95 ? 189 SER B CB  1 
ATOM   2632 O  OG  . SER B 1 14  ? -71.935 8.600   -30.530 1.00 39.34 ? 189 SER B OG  1 
ATOM   2633 N  N   . PHE B 1 15  ? -69.063 6.662   -29.972 1.00 30.07 ? 190 PHE B N   1 
ATOM   2634 C  CA  . PHE B 1 15  ? -68.279 5.654   -29.189 1.00 28.70 ? 190 PHE B CA  1 
ATOM   2635 C  C   . PHE B 1 15  ? -66.736 5.862   -29.336 1.00 26.51 ? 190 PHE B C   1 
ATOM   2636 O  O   . PHE B 1 15  ? -65.982 5.837   -28.354 1.00 25.89 ? 190 PHE B O   1 
ATOM   2637 C  CB  . PHE B 1 15  ? -68.636 4.228   -29.619 1.00 29.34 ? 190 PHE B CB  1 
ATOM   2638 C  CG  . PHE B 1 15  ? -67.785 3.157   -28.970 1.00 30.94 ? 190 PHE B CG  1 
ATOM   2639 C  CD1 . PHE B 1 15  ? -68.106 2.656   -27.705 1.00 34.19 ? 190 PHE B CD1 1 
ATOM   2640 C  CD2 . PHE B 1 15  ? -66.668 2.632   -29.636 1.00 34.66 ? 190 PHE B CD2 1 
ATOM   2641 C  CE1 . PHE B 1 15  ? -67.317 1.650   -27.092 1.00 34.32 ? 190 PHE B CE1 1 
ATOM   2642 C  CE2 . PHE B 1 15  ? -65.868 1.653   -29.044 1.00 32.61 ? 190 PHE B CE2 1 
ATOM   2643 C  CZ  . PHE B 1 15  ? -66.194 1.143   -27.776 1.00 34.46 ? 190 PHE B CZ  1 
ATOM   2644 N  N   . MET B 1 16  ? -66.279 6.049   -30.570 1.00 26.81 ? 191 MET B N   1 
ATOM   2645 C  CA  . MET B 1 16  ? -64.824 6.225   -30.809 1.00 26.64 ? 191 MET B CA  1 
ATOM   2646 C  C   . MET B 1 16  ? -64.321 7.452   -30.086 1.00 26.77 ? 191 MET B C   1 
ATOM   2647 O  O   . MET B 1 16  ? -63.230 7.449   -29.524 1.00 27.46 ? 191 MET B O   1 
ATOM   2648 C  CB  . MET B 1 16  ? -64.506 6.297   -32.314 1.00 26.22 ? 191 MET B CB  1 
ATOM   2649 C  CG  . MET B 1 16  ? -64.618 4.915   -33.059 1.00 25.97 ? 191 MET B CG  1 
ATOM   2650 S  SD  . MET B 1 16  ? -63.871 3.544   -32.145 1.00 31.46 ? 191 MET B SD  1 
ATOM   2651 C  CE  . MET B 1 16  ? -62.145 4.125   -32.081 1.00 27.81 ? 191 MET B CE  1 
ATOM   2652 N  N   . LYS B 1 17  ? -65.119 8.516   -30.087 1.00 28.04 ? 192 LYS B N   1 
ATOM   2653 C  CA  . LYS B 1 17  ? -64.739 9.728   -29.381 1.00 28.94 ? 192 LYS B CA  1 
ATOM   2654 C  C   . LYS B 1 17  ? -64.691 9.469   -27.884 1.00 28.85 ? 192 LYS B C   1 
ATOM   2655 O  O   . LYS B 1 17  ? -63.737 9.836   -27.195 1.00 27.57 ? 192 LYS B O   1 
ATOM   2656 C  CB  . LYS B 1 17  ? -65.672 10.858  -29.769 1.00 29.97 ? 192 LYS B CB  1 
ATOM   2657 C  CG  . LYS B 1 17  ? -65.254 11.479  -31.090 1.00 33.22 ? 192 LYS B CG  1 
ATOM   2658 C  CD  . LYS B 1 17  ? -66.170 12.646  -31.429 1.00 42.30 ? 192 LYS B CD  1 
ATOM   2659 C  CE  . LYS B 1 17  ? -65.680 13.457  -32.606 1.00 43.57 ? 192 LYS B CE  1 
ATOM   2660 N  NZ  . LYS B 1 17  ? -66.853 14.187  -33.187 1.00 47.53 ? 192 LYS B NZ  1 
ATOM   2661 N  N   . GLU B 1 18  ? -65.658 8.712   -27.380 1.00 29.45 ? 193 GLU B N   1 
ATOM   2662 C  CA  . GLU B 1 18  ? -65.616 8.386   -25.965 1.00 29.96 ? 193 GLU B CA  1 
ATOM   2663 C  C   . GLU B 1 18  ? -64.554 7.369   -25.611 1.00 28.08 ? 193 GLU B C   1 
ATOM   2664 O  O   . GLU B 1 18  ? -63.983 7.410   -24.530 1.00 28.11 ? 193 GLU B O   1 
ATOM   2665 C  CB  . GLU B 1 18  ? -66.995 7.934   -25.451 1.00 31.56 ? 193 GLU B CB  1 
ATOM   2666 C  CG  . GLU B 1 18  ? -67.860 9.125   -25.048 1.00 39.18 ? 193 GLU B CG  1 
ATOM   2667 C  CD  . GLU B 1 18  ? -69.136 8.709   -24.337 1.00 49.76 ? 193 GLU B CD  1 
ATOM   2668 O  OE1 . GLU B 1 18  ? -69.068 7.778   -23.467 1.00 51.26 ? 193 GLU B OE1 1 
ATOM   2669 O  OE2 . GLU B 1 18  ? -70.202 9.337   -24.633 1.00 53.69 ? 193 GLU B OE2 1 
ATOM   2670 N  N   . LEU B 1 19  ? -64.280 6.447   -26.525 1.00 27.90 ? 194 LEU B N   1 
ATOM   2671 C  CA  . LEU B 1 19  ? -63.173 5.519   -26.300 1.00 26.18 ? 194 LEU B CA  1 
ATOM   2672 C  C   . LEU B 1 19  ? -61.824 6.277   -26.129 1.00 25.84 ? 194 LEU B C   1 
ATOM   2673 O  O   . LEU B 1 19  ? -61.086 6.055   -25.151 1.00 24.03 ? 194 LEU B O   1 
ATOM   2674 C  CB  . LEU B 1 19  ? -63.147 4.456   -27.406 1.00 25.37 ? 194 LEU B CB  1 
ATOM   2675 C  CG  . LEU B 1 19  ? -62.115 3.360   -27.209 1.00 26.07 ? 194 LEU B CG  1 
ATOM   2676 C  CD1 . LEU B 1 19  ? -62.443 2.602   -25.927 1.00 27.71 ? 194 LEU B CD1 1 
ATOM   2677 C  CD2 . LEU B 1 19  ? -62.097 2.480   -28.428 1.00 24.98 ? 194 LEU B CD2 1 
ATOM   2678 N  N   . MET B 1 20  ? -61.552 7.238   -27.025 1.00 25.92 ? 195 MET B N   1 
ATOM   2679 C  CA  . MET B 1 20  ? -60.252 7.894   -27.011 1.00 25.30 ? 195 MET B CA  1 
ATOM   2680 C  C   . MET B 1 20  ? -60.049 8.726   -25.742 1.00 25.54 ? 195 MET B C   1 
ATOM   2681 O  O   . MET B 1 20  ? -58.958 8.721   -25.169 1.00 24.84 ? 195 MET B O   1 
ATOM   2682 C  CB  . MET B 1 20  ? -60.062 8.730   -28.261 1.00 24.17 ? 195 MET B CB  1 
ATOM   2683 C  CG  . MET B 1 20  ? -59.884 7.897   -29.555 1.00 29.08 ? 195 MET B CG  1 
ATOM   2684 S  SD  . MET B 1 20  ? -59.635 8.894   -31.067 1.00 31.25 ? 195 MET B SD  1 
ATOM   2685 C  CE  . MET B 1 20  ? -61.291 9.608   -31.239 1.00 32.15 ? 195 MET B CE  1 
ATOM   2686 N  N   . GLN B 1 21  ? -61.106 9.441   -25.294 1.00 25.58 ? 196 GLN B N   1 
ATOM   2687 C  CA  . GLN B 1 21  ? -61.063 10.166  -24.005 1.00 25.85 ? 196 GLN B CA  1 
ATOM   2688 C  C   . GLN B 1 21  ? -60.844 9.240   -22.796 1.00 25.17 ? 196 GLN B C   1 
ATOM   2689 O  O   . GLN B 1 21  ? -60.032 9.520   -21.919 1.00 24.71 ? 196 GLN B O   1 
ATOM   2690 C  CB  . GLN B 1 21  ? -62.354 11.022  -23.783 1.00 26.88 ? 196 GLN B CB  1 
ATOM   2691 C  CG  . GLN B 1 21  ? -62.252 11.909  -22.545 1.00 26.28 ? 196 GLN B CG  1 
ATOM   2692 C  CD  . GLN B 1 21  ? -61.242 12.983  -22.751 1.00 26.38 ? 196 GLN B CD  1 
ATOM   2693 O  OE1 . GLN B 1 21  ? -61.171 13.565  -23.828 1.00 30.89 ? 196 GLN B OE1 1 
ATOM   2694 N  NE2 . GLN B 1 21  ? -60.427 13.231  -21.759 1.00 30.18 ? 196 GLN B NE2 1 
ATOM   2695 N  N   . TRP B 1 22  ? -61.588 8.142   -22.765 1.00 25.51 ? 197 TRP B N   1 
ATOM   2696 C  CA  . TRP B 1 22  ? -61.488 7.143   -21.693 1.00 25.16 ? 197 TRP B CA  1 
ATOM   2697 C  C   . TRP B 1 22  ? -60.058 6.628   -21.541 1.00 24.70 ? 197 TRP B C   1 
ATOM   2698 O  O   . TRP B 1 22  ? -59.505 6.579   -20.430 1.00 23.00 ? 197 TRP B O   1 
ATOM   2699 C  CB  . TRP B 1 22  ? -62.445 6.004   -22.011 1.00 25.33 ? 197 TRP B CB  1 
ATOM   2700 C  CG  . TRP B 1 22  ? -62.708 5.038   -20.848 1.00 29.03 ? 197 TRP B CG  1 
ATOM   2701 C  CD1 . TRP B 1 22  ? -62.255 3.751   -20.720 1.00 30.51 ? 197 TRP B CD1 1 
ATOM   2702 C  CD2 . TRP B 1 22  ? -63.533 5.285   -19.697 1.00 34.32 ? 197 TRP B CD2 1 
ATOM   2703 N  NE1 . TRP B 1 22  ? -62.716 3.186   -19.542 1.00 31.85 ? 197 TRP B NE1 1 
ATOM   2704 C  CE2 . TRP B 1 22  ? -63.504 4.103   -18.895 1.00 35.34 ? 197 TRP B CE2 1 
ATOM   2705 C  CE3 . TRP B 1 22  ? -64.287 6.391   -19.259 1.00 35.65 ? 197 TRP B CE3 1 
ATOM   2706 C  CZ2 . TRP B 1 22  ? -64.203 4.000   -17.670 1.00 37.28 ? 197 TRP B CZ2 1 
ATOM   2707 C  CZ3 . TRP B 1 22  ? -64.982 6.289   -18.034 1.00 37.33 ? 197 TRP B CZ3 1 
ATOM   2708 C  CH2 . TRP B 1 22  ? -64.937 5.101   -17.262 1.00 36.68 ? 197 TRP B CH2 1 
ATOM   2709 N  N   . TYR B 1 23  ? -59.452 6.273   -22.693 1.00 25.72 ? 198 TYR B N   1 
ATOM   2710 C  CA  . TYR B 1 23  ? -58.061 5.801   -22.758 1.00 24.65 ? 198 TYR B CA  1 
ATOM   2711 C  C   . TYR B 1 23  ? -57.107 6.898   -22.412 1.00 25.22 ? 198 TYR B C   1 
ATOM   2712 O  O   . TYR B 1 23  ? -56.089 6.696   -21.731 1.00 25.63 ? 198 TYR B O   1 
ATOM   2713 C  CB  . TYR B 1 23  ? -57.764 5.341   -24.185 1.00 24.58 ? 198 TYR B CB  1 
ATOM   2714 C  CG  . TYR B 1 23  ? -58.325 3.998   -24.470 1.00 26.88 ? 198 TYR B CG  1 
ATOM   2715 C  CD1 . TYR B 1 23  ? -58.744 3.170   -23.422 1.00 28.76 ? 198 TYR B CD1 1 
ATOM   2716 C  CD2 . TYR B 1 23  ? -58.391 3.508   -25.771 1.00 26.64 ? 198 TYR B CD2 1 
ATOM   2717 C  CE1 . TYR B 1 23  ? -59.226 1.860   -23.690 1.00 29.71 ? 198 TYR B CE1 1 
ATOM   2718 C  CE2 . TYR B 1 23  ? -58.850 2.216   -26.047 1.00 26.85 ? 198 TYR B CE2 1 
ATOM   2719 C  CZ  . TYR B 1 23  ? -59.271 1.397   -25.007 1.00 28.24 ? 198 TYR B CZ  1 
ATOM   2720 O  OH  . TYR B 1 23  ? -59.734 0.123   -25.299 1.00 28.00 ? 198 TYR B OH  1 
ATOM   2721 N  N   . LYS B 1 24  ? -57.397 8.090   -22.921 1.00 27.41 ? 199 LYS B N   1 
ATOM   2722 C  CA  . LYS B 1 24  ? -56.552 9.211   -22.588 1.00 28.67 ? 199 LYS B CA  1 
ATOM   2723 C  C   . LYS B 1 24  ? -56.463 9.307   -21.052 1.00 29.87 ? 199 LYS B C   1 
ATOM   2724 O  O   . LYS B 1 24  ? -55.392 9.555   -20.470 1.00 29.08 ? 199 LYS B O   1 
ATOM   2725 C  CB  . LYS B 1 24  ? -57.112 10.492  -23.189 1.00 29.57 ? 199 LYS B CB  1 
ATOM   2726 C  CG  . LYS B 1 24  ? -56.141 11.648  -23.092 1.00 30.95 ? 199 LYS B CG  1 
ATOM   2727 C  CD  . LYS B 1 24  ? -56.669 12.810  -23.900 1.00 37.83 ? 199 LYS B CD  1 
ATOM   2728 C  CE  . LYS B 1 24  ? -56.433 14.090  -23.137 1.00 42.26 ? 199 LYS B CE  1 
ATOM   2729 N  NZ  . LYS B 1 24  ? -56.543 15.250  -24.067 1.00 45.73 ? 199 LYS B NZ  1 
ATOM   2730 N  N   . ASP B 1 25  ? -57.597 9.087   -20.401 1.00 30.83 ? 200 ASP B N   1 
ATOM   2731 C  CA  . ASP B 1 25  ? -57.653 9.162   -18.953 1.00 32.06 ? 200 ASP B CA  1 
ATOM   2732 C  C   . ASP B 1 25  ? -57.159 7.899   -18.225 1.00 32.29 ? 200 ASP B C   1 
ATOM   2733 O  O   . ASP B 1 25  ? -57.353 7.762   -17.020 1.00 30.97 ? 200 ASP B O   1 
ATOM   2734 C  CB  . ASP B 1 25  ? -59.094 9.543   -18.534 1.00 31.97 ? 200 ASP B CB  1 
ATOM   2735 C  CG  . ASP B 1 25  ? -59.455 10.989  -18.935 1.00 34.93 ? 200 ASP B CG  1 
ATOM   2736 O  OD1 . ASP B 1 25  ? -58.539 11.862  -18.875 1.00 33.69 ? 200 ASP B OD1 1 
ATOM   2737 O  OD2 . ASP B 1 25  ? -60.629 11.251  -19.347 1.00 35.09 ? 200 ASP B OD2 1 
ATOM   2738 N  N   . GLN B 1 26  ? -56.508 6.989   -18.969 1.00 32.75 ? 201 GLN B N   1 
ATOM   2739 C  CA  . GLN B 1 26  ? -55.926 5.742   -18.433 1.00 32.31 ? 201 GLN B CA  1 
ATOM   2740 C  C   . GLN B 1 26  ? -56.927 4.761   -17.860 1.00 32.50 ? 201 GLN B C   1 
ATOM   2741 O  O   . GLN B 1 26  ? -56.644 4.069   -16.872 1.00 31.26 ? 201 GLN B O   1 
ATOM   2742 C  CB  . GLN B 1 26  ? -54.859 6.011   -17.371 1.00 33.85 ? 201 GLN B CB  1 
ATOM   2743 C  CG  . GLN B 1 26  ? -53.625 6.662   -17.902 1.00 33.65 ? 201 GLN B CG  1 
ATOM   2744 C  CD  . GLN B 1 26  ? -52.442 6.418   -17.015 1.00 36.24 ? 201 GLN B CD  1 
ATOM   2745 O  OE1 . GLN B 1 26  ? -51.814 5.321   -17.037 1.00 35.32 ? 201 GLN B OE1 1 
ATOM   2746 N  NE2 . GLN B 1 26  ? -52.107 7.434   -16.212 1.00 32.20 ? 201 GLN B NE2 1 
ATOM   2747 N  N   . LYS B 1 27  ? -58.072 4.661   -18.502 1.00 31.96 ? 202 LYS B N   1 
ATOM   2748 C  CA  . LYS B 1 27  ? -59.088 3.773   -18.037 1.00 32.41 ? 202 LYS B CA  1 
ATOM   2749 C  C   . LYS B 1 27  ? -59.232 2.582   -18.964 1.00 33.10 ? 202 LYS B C   1 
ATOM   2750 O  O   . LYS B 1 27  ? -58.818 2.617   -20.140 1.00 32.35 ? 202 LYS B O   1 
ATOM   2751 C  CB  . LYS B 1 27  ? -60.385 4.550   -17.947 1.00 32.27 ? 202 LYS B CB  1 
ATOM   2752 C  CG  . LYS B 1 27  ? -60.354 5.536   -16.814 1.00 35.15 ? 202 LYS B CG  1 
ATOM   2753 C  CD  . LYS B 1 27  ? -61.624 6.360   -16.772 1.00 39.41 ? 202 LYS B CD  1 
ATOM   2754 C  CE  . LYS B 1 27  ? -61.601 7.392   -15.659 1.00 42.34 ? 202 LYS B CE  1 
ATOM   2755 N  NZ  . LYS B 1 27  ? -62.369 8.566   -16.156 1.00 43.23 ? 202 LYS B NZ  1 
ATOM   2756 N  N   . LYS B 1 28  ? -59.826 1.520   -18.443 1.00 33.31 ? 203 LYS B N   1 
ATOM   2757 C  CA  . LYS B 1 28  ? -59.997 0.285   -19.227 1.00 33.61 ? 203 LYS B CA  1 
ATOM   2758 C  C   . LYS B 1 28  ? -61.367 0.120   -19.907 1.00 32.80 ? 203 LYS B C   1 
ATOM   2759 O  O   . LYS B 1 28  ? -62.407 0.295   -19.278 1.00 33.28 ? 203 LYS B O   1 
ATOM   2760 C  CB  . LYS B 1 28  ? -59.618 -0.916  -18.345 1.00 33.86 ? 203 LYS B CB  1 
ATOM   2761 C  CG  . LYS B 1 28  ? -59.854 -2.284  -18.971 1.00 36.43 ? 203 LYS B CG  1 
ATOM   2762 C  CD  . LYS B 1 28  ? -58.692 -3.183  -18.619 1.00 39.84 ? 203 LYS B CD  1 
ATOM   2763 C  CE  . LYS B 1 28  ? -58.517 -3.357  -17.121 1.00 42.80 ? 203 LYS B CE  1 
ATOM   2764 N  NZ  . LYS B 1 28  ? -59.751 -3.982  -16.586 1.00 44.68 ? 203 LYS B NZ  1 
ATOM   2765 N  N   . LEU B 1 29  ? -61.381 -0.205  -21.198 1.00 31.91 ? 204 LEU B N   1 
ATOM   2766 C  CA  . LEU B 1 29  ? -62.628 -0.583  -21.880 1.00 31.82 ? 204 LEU B CA  1 
ATOM   2767 C  C   . LEU B 1 29  ? -63.087 -1.938  -21.321 1.00 32.84 ? 204 LEU B C   1 
ATOM   2768 O  O   . LEU B 1 29  ? -62.265 -2.846  -21.112 1.00 31.66 ? 204 LEU B O   1 
ATOM   2769 C  CB  . LEU B 1 29  ? -62.453 -0.680  -23.417 1.00 31.74 ? 204 LEU B CB  1 
ATOM   2770 C  CG  . LEU B 1 29  ? -63.645 -1.033  -24.328 1.00 29.97 ? 204 LEU B CG  1 
ATOM   2771 C  CD1 . LEU B 1 29  ? -64.761 0.064   -24.306 1.00 27.30 ? 204 LEU B CD1 1 
ATOM   2772 C  CD2 . LEU B 1 29  ? -63.264 -1.369  -25.802 1.00 26.81 ? 204 LEU B CD2 1 
ATOM   2773 N  N   . HIS B 1 30  ? -64.381 -2.056  -21.028 1.00 33.63 ? 205 HIS B N   1 
ATOM   2774 C  CA  . HIS B 1 30  ? -64.928 -3.297  -20.436 1.00 35.43 ? 205 HIS B CA  1 
ATOM   2775 C  C   . HIS B 1 30  ? -64.642 -4.536  -21.345 1.00 35.37 ? 205 HIS B C   1 
ATOM   2776 O  O   . HIS B 1 30  ? -64.751 -4.455  -22.568 1.00 34.80 ? 205 HIS B O   1 
ATOM   2777 C  CB  . HIS B 1 30  ? -66.440 -3.133  -20.252 1.00 36.09 ? 205 HIS B CB  1 
ATOM   2778 C  CG  . HIS B 1 30  ? -67.098 -4.271  -19.538 1.00 38.61 ? 205 HIS B CG  1 
ATOM   2779 N  ND1 . HIS B 1 30  ? -67.427 -4.217  -18.200 1.00 43.21 ? 205 HIS B ND1 1 
ATOM   2780 C  CD2 . HIS B 1 30  ? -67.496 -5.486  -19.976 1.00 38.98 ? 205 HIS B CD2 1 
ATOM   2781 C  CE1 . HIS B 1 30  ? -67.995 -5.354  -17.841 1.00 43.16 ? 205 HIS B CE1 1 
ATOM   2782 N  NE2 . HIS B 1 30  ? -68.049 -6.142  -18.900 1.00 43.41 ? 205 HIS B NE2 1 
ATOM   2783 N  N   . ARG B 1 31  ? -64.304 -5.670  -20.736 1.00 36.38 ? 206 ARG B N   1 
ATOM   2784 C  CA  . ARG B 1 31  ? -64.028 -6.902  -21.496 1.00 37.10 ? 206 ARG B CA  1 
ATOM   2785 C  C   . ARG B 1 31  ? -65.106 -7.284  -22.519 1.00 37.13 ? 206 ARG B C   1 
ATOM   2786 O  O   . ARG B 1 31  ? -64.790 -7.825  -23.582 1.00 37.26 ? 206 ARG B O   1 
ATOM   2787 C  CB  . ARG B 1 31  ? -63.709 -8.060  -20.555 1.00 38.04 ? 206 ARG B CB  1 
ATOM   2788 C  CG  . ARG B 1 31  ? -64.898 -8.439  -19.648 1.00 40.66 ? 206 ARG B CG  1 
ATOM   2789 C  CD  . ARG B 1 31  ? -64.554 -9.464  -18.578 1.00 47.62 ? 206 ARG B CD  1 
ATOM   2790 N  NE  . ARG B 1 31  ? -65.504 -9.426  -17.445 1.00 51.72 ? 206 ARG B NE  1 
ATOM   2791 C  CZ  . ARG B 1 31  ? -66.741 -9.939  -17.467 1.00 54.00 ? 206 ARG B CZ  1 
ATOM   2792 N  NH1 . ARG B 1 31  ? -67.222 -10.535 -18.565 1.00 52.76 ? 206 ARG B NH1 1 
ATOM   2793 N  NH2 . ARG B 1 31  ? -67.506 -9.856  -16.383 1.00 53.13 ? 206 ARG B NH2 1 
ATOM   2794 N  N   . LYS B 1 32  ? -66.378 -6.982  -22.272 1.00 36.85 ? 207 LYS B N   1 
ATOM   2795 C  CA  . LYS B 1 32  ? -67.370 -7.397  -23.269 1.00 36.65 ? 207 LYS B CA  1 
ATOM   2796 C  C   . LYS B 1 32  ? -67.398 -6.465  -24.459 1.00 35.48 ? 207 LYS B C   1 
ATOM   2797 O  O   . LYS B 1 32  ? -67.795 -6.857  -25.551 1.00 34.28 ? 207 LYS B O   1 
ATOM   2798 C  CB  . LYS B 1 32  ? -68.785 -7.504  -22.691 1.00 37.94 ? 207 LYS B CB  1 
ATOM   2799 C  CG  . LYS B 1 32  ? -68.905 -8.445  -21.507 1.00 41.79 ? 207 LYS B CG  1 
ATOM   2800 C  CD  . LYS B 1 32  ? -70.273 -8.209  -20.858 1.00 48.21 ? 207 LYS B CD  1 
ATOM   2801 C  CE  . LYS B 1 32  ? -70.695 -9.414  -20.013 1.00 51.38 ? 207 LYS B CE  1 
ATOM   2802 N  NZ  . LYS B 1 32  ? -72.093 -9.202  -19.514 1.00 53.94 ? 207 LYS B NZ  1 
ATOM   2803 N  N   . CYS B 1 33  ? -67.022 -5.209  -24.245 1.00 34.38 ? 208 CYS B N   1 
ATOM   2804 C  CA  . CYS B 1 33  ? -66.915 -4.276  -25.390 1.00 33.29 ? 208 CYS B CA  1 
ATOM   2805 C  C   . CYS B 1 33  ? -65.682 -4.661  -26.231 1.00 31.71 ? 208 CYS B C   1 
ATOM   2806 O  O   . CYS B 1 33  ? -65.765 -4.726  -27.429 1.00 30.52 ? 208 CYS B O   1 
ATOM   2807 C  CB  . CYS B 1 33  ? -66.819 -2.813  -24.917 0.50 32.85 ? 208 CYS B CB  1 
ATOM   2808 S  SG  . CYS B 1 33  ? -68.284 -2.188  -23.976 0.50 32.73 ? 208 CYS B SG  1 
ATOM   2809 N  N   . ALA B 1 34  ? -64.558 -4.933  -25.566 1.00 32.13 ? 209 ALA B N   1 
ATOM   2810 C  CA  . ALA B 1 34  ? -63.308 -5.299  -26.238 1.00 31.67 ? 209 ALA B CA  1 
ATOM   2811 C  C   . ALA B 1 34  ? -63.530 -6.578  -27.026 1.00 32.39 ? 209 ALA B C   1 
ATOM   2812 O  O   . ALA B 1 34  ? -63.156 -6.687  -28.216 1.00 32.25 ? 209 ALA B O   1 
ATOM   2813 C  CB  . ALA B 1 34  ? -62.199 -5.481  -25.213 1.00 32.05 ? 209 ALA B CB  1 
ATOM   2814 N  N   . TYR B 1 35  ? -64.182 -7.546  -26.376 1.00 32.38 ? 210 TYR B N   1 
ATOM   2815 C  CA  . TYR B 1 35  ? -64.602 -8.774  -27.060 1.00 32.11 ? 210 TYR B CA  1 
ATOM   2816 C  C   . TYR B 1 35  ? -65.478 -8.579  -28.296 1.00 32.50 ? 210 TYR B C   1 
ATOM   2817 O  O   . TYR B 1 35  ? -65.231 -9.221  -29.319 1.00 31.90 ? 210 TYR B O   1 
ATOM   2818 C  CB  . TYR B 1 35  ? -65.272 -9.763  -26.106 1.00 32.26 ? 210 TYR B CB  1 
ATOM   2819 C  CG  . TYR B 1 35  ? -65.911 -10.919 -26.865 1.00 33.16 ? 210 TYR B CG  1 
ATOM   2820 C  CD1 . TYR B 1 35  ? -65.182 -12.078 -27.146 1.00 32.78 ? 210 TYR B CD1 1 
ATOM   2821 C  CD2 . TYR B 1 35  ? -67.224 -10.836 -27.321 1.00 33.05 ? 210 TYR B CD2 1 
ATOM   2822 C  CE1 . TYR B 1 35  ? -65.747 -13.119 -27.830 1.00 35.86 ? 210 TYR B CE1 1 
ATOM   2823 C  CE2 . TYR B 1 35  ? -67.808 -11.886 -28.013 1.00 36.97 ? 210 TYR B CE2 1 
ATOM   2824 C  CZ  . TYR B 1 35  ? -67.058 -13.031 -28.266 1.00 37.57 ? 210 TYR B CZ  1 
ATOM   2825 O  OH  . TYR B 1 35  ? -67.602 -14.106 -28.972 1.00 40.92 ? 210 TYR B OH  1 
ATOM   2826 N  N   . GLN B 1 36  ? -66.493 -7.720  -28.228 1.00 33.08 ? 211 GLN B N   1 
ATOM   2827 C  CA  . GLN B 1 36  ? -67.303 -7.467  -29.413 1.00 35.25 ? 211 GLN B CA  1 
ATOM   2828 C  C   . GLN B 1 36  ? -66.523 -6.841  -30.579 1.00 34.08 ? 211 GLN B C   1 
ATOM   2829 O  O   . GLN B 1 36  ? -66.806 -7.108  -31.749 1.00 35.80 ? 211 GLN B O   1 
ATOM   2830 C  CB  . GLN B 1 36  ? -68.495 -6.561  -29.083 1.00 37.20 ? 211 GLN B CB  1 
ATOM   2831 C  CG  . GLN B 1 36  ? -69.780 -7.304  -28.733 1.00 44.51 ? 211 GLN B CG  1 
ATOM   2832 C  CD  . GLN B 1 36  ? -70.974 -6.330  -28.618 1.00 54.35 ? 211 GLN B CD  1 
ATOM   2833 O  OE1 . GLN B 1 36  ? -70.938 -5.379  -27.818 1.00 58.79 ? 211 GLN B OE1 1 
ATOM   2834 N  NE2 . GLN B 1 36  ? -72.028 -6.561  -29.424 1.00 56.71 ? 211 GLN B NE2 1 
ATOM   2835 N  N   . ILE B 1 37  ? -65.576 -5.965  -30.282 1.00 33.08 ? 212 ILE B N   1 
ATOM   2836 C  CA  . ILE B 1 37  ? -64.780 -5.334  -31.353 1.00 31.21 ? 212 ILE B CA  1 
ATOM   2837 C  C   . ILE B 1 37  ? -63.899 -6.372  -32.075 1.00 29.79 ? 212 ILE B C   1 
ATOM   2838 O  O   . ILE B 1 37  ? -63.926 -6.465  -33.314 1.00 29.35 ? 212 ILE B O   1 
ATOM   2839 C  CB  . ILE B 1 37  ? -63.933 -4.167  -30.788 1.00 31.11 ? 212 ILE B CB  1 
ATOM   2840 C  CG1 . ILE B 1 37  ? -64.825 -2.968  -30.485 1.00 30.70 ? 212 ILE B CG1 1 
ATOM   2841 C  CG2 . ILE B 1 37  ? -62.777 -3.768  -31.726 1.00 29.37 ? 212 ILE B CG2 1 
ATOM   2842 C  CD1 . ILE B 1 37  ? -64.162 -1.994  -29.479 1.00 31.28 ? 212 ILE B CD1 1 
ATOM   2843 N  N   . LEU B 1 38  ? -63.152 -7.143  -31.278 1.00 29.97 ? 213 LEU B N   1 
ATOM   2844 C  CA  . LEU B 1 38  ? -62.320 -8.239  -31.760 1.00 30.47 ? 213 LEU B CA  1 
ATOM   2845 C  C   . LEU B 1 38  ? -63.093 -9.166  -32.710 1.00 31.28 ? 213 LEU B C   1 
ATOM   2846 O  O   . LEU B 1 38  ? -62.756 -9.280  -33.911 1.00 30.20 ? 213 LEU B O   1 
ATOM   2847 C  CB  . LEU B 1 38  ? -61.632 -8.968  -30.576 1.00 30.44 ? 213 LEU B CB  1 
ATOM   2848 C  CG  . LEU B 1 38  ? -60.483 -8.153  -29.914 1.00 32.09 ? 213 LEU B CG  1 
ATOM   2849 C  CD1 . LEU B 1 38  ? -59.839 -8.782  -28.708 1.00 30.57 ? 213 LEU B CD1 1 
ATOM   2850 C  CD2 . LEU B 1 38  ? -59.420 -7.828  -30.952 1.00 34.89 ? 213 LEU B CD2 1 
ATOM   2851 N  N   . VAL B 1 39  ? -64.175 -9.802  -32.232 1.00 31.75 ? 214 VAL B N   1 
ATOM   2852 C  CA  . VAL B 1 39  ? -64.935 -10.702 -33.114 1.00 30.63 ? 214 VAL B CA  1 
ATOM   2853 C  C   . VAL B 1 39  ? -65.554 -10.026 -34.336 1.00 30.72 ? 214 VAL B C   1 
ATOM   2854 O  O   . VAL B 1 39  ? -65.598 -10.602 -35.444 1.00 31.82 ? 214 VAL B O   1 
ATOM   2855 C  CB  . VAL B 1 39  ? -65.973 -11.584 -32.332 1.00 32.57 ? 214 VAL B CB  1 
ATOM   2856 C  CG1 . VAL B 1 39  ? -65.273 -12.279 -31.179 1.00 30.47 ? 214 VAL B CG1 1 
ATOM   2857 C  CG2 . VAL B 1 39  ? -67.118 -10.720 -31.821 1.00 33.00 ? 214 VAL B CG2 1 
ATOM   2858 N  N   . GLN B 1 40  ? -66.011 -8.792  -34.223 1.00 29.37 ? 215 GLN B N   1 
ATOM   2859 C  CA  . GLN B 1 40  ? -66.460 -8.167  -35.453 1.00 28.86 ? 215 GLN B CA  1 
ATOM   2860 C  C   . GLN B 1 40  ? -65.305 -7.820  -36.447 1.00 28.28 ? 215 GLN B C   1 
ATOM   2861 O  O   . GLN B 1 40  ? -65.439 -7.967  -37.649 1.00 26.85 ? 215 GLN B O   1 
ATOM   2862 C  CB  . GLN B 1 40  ? -67.264 -6.907  -35.160 1.00 29.26 ? 215 GLN B CB  1 
ATOM   2863 C  CG  . GLN B 1 40  ? -68.574 -7.129  -34.463 1.00 31.89 ? 215 GLN B CG  1 
ATOM   2864 C  CD  . GLN B 1 40  ? -69.232 -5.813  -34.140 1.00 33.18 ? 215 GLN B CD  1 
ATOM   2865 O  OE1 . GLN B 1 40  ? -69.317 -4.941  -34.987 1.00 33.67 ? 215 GLN B OE1 1 
ATOM   2866 N  NE2 . GLN B 1 40  ? -69.651 -5.645  -32.896 1.00 36.45 ? 215 GLN B NE2 1 
ATOM   2867 N  N   . VAL B 1 41  ? -64.191 -7.303  -35.946 1.00 29.21 ? 216 VAL B N   1 
ATOM   2868 C  CA  . VAL B 1 41  ? -63.122 -6.902  -36.885 1.00 28.87 ? 216 VAL B CA  1 
ATOM   2869 C  C   . VAL B 1 41  ? -62.483 -8.168  -37.486 1.00 28.85 ? 216 VAL B C   1 
ATOM   2870 O  O   . VAL B 1 41  ? -62.124 -8.206  -38.667 1.00 27.80 ? 216 VAL B O   1 
ATOM   2871 C  CB  . VAL B 1 41  ? -62.110 -5.960  -36.232 1.00 28.54 ? 216 VAL B CB  1 
ATOM   2872 C  CG1 . VAL B 1 41  ? -60.902 -6.716  -35.724 1.00 29.14 ? 216 VAL B CG1 1 
ATOM   2873 C  CG2 . VAL B 1 41  ? -61.685 -4.892  -37.261 1.00 31.15 ? 216 VAL B CG2 1 
ATOM   2874 N  N   . LYS B 1 42  ? -62.396 -9.229  -36.688 1.00 29.70 ? 217 LYS B N   1 
ATOM   2875 C  CA  . LYS B 1 42  ? -61.965 -10.505 -37.244 1.00 31.18 ? 217 LYS B CA  1 
ATOM   2876 C  C   . LYS B 1 42  ? -62.779 -10.882 -38.474 1.00 30.87 ? 217 LYS B C   1 
ATOM   2877 O  O   . LYS B 1 42  ? -62.232 -11.384 -39.452 1.00 30.49 ? 217 LYS B O   1 
ATOM   2878 C  CB  . LYS B 1 42  ? -62.008 -11.619 -36.216 1.00 31.93 ? 217 LYS B CB  1 
ATOM   2879 C  CG  . LYS B 1 42  ? -61.329 -12.901 -36.703 1.00 35.82 ? 217 LYS B CG  1 
ATOM   2880 C  CD  . LYS B 1 42  ? -61.676 -14.106 -35.799 1.00 41.01 ? 217 LYS B CD  1 
ATOM   2881 C  CE  . LYS B 1 42  ? -60.453 -15.031 -35.664 1.00 48.14 ? 217 LYS B CE  1 
ATOM   2882 N  NZ  . LYS B 1 42  ? -60.788 -16.529 -35.633 1.00 52.00 ? 217 LYS B NZ  1 
ATOM   2883 N  N   . GLU B 1 43  ? -64.080 -10.594 -38.458 1.00 30.58 ? 218 GLU B N   1 
ATOM   2884 C  CA  . GLU B 1 43  ? -64.958 -10.968 -39.563 1.00 30.91 ? 218 GLU B CA  1 
ATOM   2885 C  C   . GLU B 1 43  ? -64.744 -10.079 -40.805 1.00 30.41 ? 218 GLU B C   1 
ATOM   2886 O  O   . GLU B 1 43  ? -64.721 -10.547 -41.962 1.00 29.41 ? 218 GLU B O   1 
ATOM   2887 C  CB  . GLU B 1 43  ? -66.394 -10.875 -39.094 1.00 32.69 ? 218 GLU B CB  1 
ATOM   2888 C  CG  . GLU B 1 43  ? -67.349 -10.527 -40.193 1.00 37.63 ? 218 GLU B CG  1 
ATOM   2889 C  CD  . GLU B 1 43  ? -68.039 -11.755 -40.757 1.00 45.44 ? 218 GLU B CD  1 
ATOM   2890 O  OE1 . GLU B 1 43  ? -69.013 -11.552 -41.532 1.00 48.23 ? 218 GLU B OE1 1 
ATOM   2891 O  OE2 . GLU B 1 43  ? -67.611 -12.906 -40.413 1.00 48.42 ? 218 GLU B OE2 1 
ATOM   2892 N  N   . VAL B 1 44  ? -64.602 -8.780  -40.558 1.00 28.76 ? 219 VAL B N   1 
ATOM   2893 C  CA  . VAL B 1 44  ? -64.185 -7.824  -41.580 1.00 27.71 ? 219 VAL B CA  1 
ATOM   2894 C  C   . VAL B 1 44  ? -62.826 -8.218  -42.256 1.00 27.07 ? 219 VAL B C   1 
ATOM   2895 O  O   . VAL B 1 44  ? -62.735 -8.308  -43.484 1.00 27.02 ? 219 VAL B O   1 
ATOM   2896 C  CB  . VAL B 1 44  ? -64.093 -6.399  -40.923 1.00 27.66 ? 219 VAL B CB  1 
ATOM   2897 C  CG1 . VAL B 1 44  ? -63.498 -5.365  -41.891 1.00 25.83 ? 219 VAL B CG1 1 
ATOM   2898 C  CG2 . VAL B 1 44  ? -65.481 -5.984  -40.370 1.00 27.99 ? 219 VAL B CG2 1 
ATOM   2899 N  N   . LEU B 1 45  ? -61.802 -8.489  -41.443 1.00 26.62 ? 220 LEU B N   1 
ATOM   2900 C  CA  . LEU B 1 45  ? -60.442 -8.741  -41.930 1.00 26.95 ? 220 LEU B CA  1 
ATOM   2901 C  C   . LEU B 1 45  ? -60.405 -10.067 -42.700 1.00 28.03 ? 220 LEU B C   1 
ATOM   2902 O  O   . LEU B 1 45  ? -59.778 -10.172 -43.768 1.00 27.60 ? 220 LEU B O   1 
ATOM   2903 C  CB  . LEU B 1 45  ? -59.466 -8.797  -40.734 1.00 26.78 ? 220 LEU B CB  1 
ATOM   2904 C  CG  . LEU B 1 45  ? -59.250 -7.479  -39.956 1.00 24.58 ? 220 LEU B CG  1 
ATOM   2905 C  CD1 . LEU B 1 45  ? -58.181 -7.654  -38.802 1.00 21.15 ? 220 LEU B CD1 1 
ATOM   2906 C  CD2 . LEU B 1 45  ? -58.843 -6.380  -40.970 1.00 25.94 ? 220 LEU B CD2 1 
ATOM   2907 N  N   . SER B 1 46  ? -61.092 -11.082 -42.171 1.00 28.37 ? 221 SER B N   1 
ATOM   2908 C  CA  . SER B 1 46  ? -61.131 -12.403 -42.858 1.00 31.19 ? 221 SER B CA  1 
ATOM   2909 C  C   . SER B 1 46  ? -61.692 -12.394 -44.308 1.00 32.08 ? 221 SER B C   1 
ATOM   2910 O  O   . SER B 1 46  ? -61.408 -13.313 -45.074 1.00 33.28 ? 221 SER B O   1 
ATOM   2911 C  CB  . SER B 1 46  ? -61.887 -13.437 -42.013 1.00 30.92 ? 221 SER B CB  1 
ATOM   2912 O  OG  . SER B 1 46  ? -63.281 -13.108 -42.054 1.00 32.62 ? 221 SER B OG  1 
ATOM   2913 N  N   . LYS B 1 47  ? -62.465 -11.379 -44.707 1.00 32.81 ? 222 LYS B N   1 
ATOM   2914 C  CA  . LYS B 1 47  ? -62.905 -11.311 -46.102 1.00 33.22 ? 222 LYS B CA  1 
ATOM   2915 C  C   . LYS B 1 47  ? -61.928 -10.612 -47.043 1.00 32.91 ? 222 LYS B C   1 
ATOM   2916 O  O   . LYS B 1 47  ? -62.082 -10.718 -48.263 1.00 32.69 ? 222 LYS B O   1 
ATOM   2917 C  CB  . LYS B 1 47  ? -64.207 -10.545 -46.240 1.00 35.25 ? 222 LYS B CB  1 
ATOM   2918 C  CG  . LYS B 1 47  ? -65.028 -10.533 -44.991 1.00 38.05 ? 222 LYS B CG  1 
ATOM   2919 C  CD  . LYS B 1 47  ? -65.849 -11.777 -44.886 1.00 43.39 ? 222 LYS B CD  1 
ATOM   2920 C  CE  . LYS B 1 47  ? -67.321 -11.353 -44.636 1.00 44.29 ? 222 LYS B CE  1 
ATOM   2921 N  NZ  . LYS B 1 47  ? -68.144 -12.422 -44.049 1.00 45.72 ? 222 LYS B NZ  1 
ATOM   2922 N  N   . LEU B 1 48  ? -60.932 -9.896  -46.499 1.00 31.33 ? 223 LEU B N   1 
ATOM   2923 C  CA  . LEU B 1 48  ? -59.993 -9.150  -47.343 1.00 29.63 ? 223 LEU B CA  1 
ATOM   2924 C  C   . LEU B 1 48  ? -58.971 -10.037 -48.098 1.00 27.63 ? 223 LEU B C   1 
ATOM   2925 O  O   . LEU B 1 48  ? -58.544 -11.050 -47.589 1.00 26.53 ? 223 LEU B O   1 
ATOM   2926 C  CB  . LEU B 1 48  ? -59.235 -8.150  -46.496 1.00 29.31 ? 223 LEU B CB  1 
ATOM   2927 C  CG  . LEU B 1 48  ? -60.093 -7.079  -45.849 1.00 31.74 ? 223 LEU B CG  1 
ATOM   2928 C  CD1 . LEU B 1 48  ? -59.196 -6.141  -45.039 1.00 32.55 ? 223 LEU B CD1 1 
ATOM   2929 C  CD2 . LEU B 1 48  ? -60.869 -6.345  -46.955 1.00 34.19 ? 223 LEU B CD2 1 
ATOM   2930 N  N   . SER B 1 49  ? -58.520 -9.582  -49.271 1.00 27.65 ? 224 SER B N   1 
ATOM   2931 C  CA  . SER B 1 49  ? -57.421 -10.255 -49.973 1.00 26.95 ? 224 SER B CA  1 
ATOM   2932 C  C   . SER B 1 49  ? -56.170 -10.017 -49.130 1.00 25.74 ? 224 SER B C   1 
ATOM   2933 O  O   . SER B 1 49  ? -56.102 -9.044  -48.362 1.00 25.06 ? 224 SER B O   1 
ATOM   2934 C  CB  . SER B 1 49  ? -57.275 -9.692  -51.400 1.00 27.47 ? 224 SER B CB  1 
ATOM   2935 O  OG  . SER B 1 49  ? -56.055 -10.135 -52.075 1.00 30.96 ? 224 SER B OG  1 
ATOM   2936 N  N   . THR B 1 50  ? -55.182 -10.909 -49.249 1.00 23.69 ? 225 THR B N   1 
ATOM   2937 C  CA  . THR B 1 50  ? -53.878 -10.687 -48.669 1.00 21.60 ? 225 THR B CA  1 
ATOM   2938 C  C   . THR B 1 50  ? -53.232 -9.361  -49.179 1.00 20.84 ? 225 THR B C   1 
ATOM   2939 O  O   . THR B 1 50  ? -52.437 -8.724  -48.454 1.00 19.86 ? 225 THR B O   1 
ATOM   2940 C  CB  . THR B 1 50  ? -52.975 -11.926 -48.933 1.00 22.46 ? 225 THR B CB  1 
ATOM   2941 O  OG1 . THR B 1 50  ? -53.539 -13.078 -48.235 1.00 23.82 ? 225 THR B OG1 1 
ATOM   2942 C  CG2 . THR B 1 50  ? -51.564 -11.684 -48.451 1.00 17.55 ? 225 THR B CG2 1 
ATOM   2943 N  N   . LEU B 1 51  ? -53.532 -9.019  -50.434 1.00 20.85 ? 226 LEU B N   1 
ATOM   2944 C  CA  . LEU B 1 51  ? -53.131 -7.771  -51.097 1.00 22.37 ? 226 LEU B CA  1 
ATOM   2945 C  C   . LEU B 1 51  ? -54.322 -6.866  -51.271 1.00 22.39 ? 226 LEU B C   1 
ATOM   2946 O  O   . LEU B 1 51  ? -55.197 -7.140  -52.078 1.00 24.34 ? 226 LEU B O   1 
ATOM   2947 C  CB  . LEU B 1 51  ? -52.510 -8.027  -52.476 1.00 21.75 ? 226 LEU B CB  1 
ATOM   2948 C  CG  . LEU B 1 51  ? -52.121 -6.715  -53.231 1.00 21.98 ? 226 LEU B CG  1 
ATOM   2949 C  CD1 . LEU B 1 51  ? -50.902 -5.977  -52.671 1.00 18.92 ? 226 LEU B CD1 1 
ATOM   2950 C  CD2 . LEU B 1 51  ? -51.923 -6.981  -54.701 1.00 21.84 ? 226 LEU B CD2 1 
ATOM   2951 N  N   . VAL B 1 52  ? -54.376 -5.797  -50.506 1.00 23.54 ? 227 VAL B N   1 
ATOM   2952 C  CA  . VAL B 1 52  ? -55.451 -4.833  -50.625 1.00 24.58 ? 227 VAL B CA  1 
ATOM   2953 C  C   . VAL B 1 52  ? -55.165 -3.951  -51.834 1.00 25.74 ? 227 VAL B C   1 
ATOM   2954 O  O   . VAL B 1 52  ? -54.042 -3.504  -52.000 1.00 24.01 ? 227 VAL B O   1 
ATOM   2955 C  CB  . VAL B 1 52  ? -55.610 -4.035  -49.320 1.00 25.63 ? 227 VAL B CB  1 
ATOM   2956 C  CG1 . VAL B 1 52  ? -56.635 -2.878  -49.492 1.00 24.94 ? 227 VAL B CG1 1 
ATOM   2957 C  CG2 . VAL B 1 52  ? -56.046 -4.998  -48.224 1.00 25.49 ? 227 VAL B CG2 1 
ATOM   2958 N  N   . GLU B 1 53  ? -56.144 -3.778  -52.732 1.00 26.89 ? 228 GLU B N   1 
ATOM   2959 C  CA  . GLU B 1 53  ? -55.911 -2.947  -53.915 1.00 29.57 ? 228 GLU B CA  1 
ATOM   2960 C  C   . GLU B 1 53  ? -56.843 -1.743  -53.866 1.00 30.55 ? 228 GLU B C   1 
ATOM   2961 O  O   . GLU B 1 53  ? -58.072 -1.909  -53.839 1.00 30.20 ? 228 GLU B O   1 
ATOM   2962 C  CB  . GLU B 1 53  ? -56.053 -3.778  -55.223 1.00 29.13 ? 228 GLU B CB  1 
ATOM   2963 C  CG  . GLU B 1 53  ? -55.097 -4.944  -55.193 1.00 31.47 ? 228 GLU B CG  1 
ATOM   2964 C  CD  . GLU B 1 53  ? -55.128 -5.833  -56.414 1.00 36.45 ? 228 GLU B CD  1 
ATOM   2965 O  OE1 . GLU B 1 53  ? -54.590 -5.407  -57.462 1.00 32.90 ? 228 GLU B OE1 1 
ATOM   2966 O  OE2 . GLU B 1 53  ? -55.649 -6.982  -56.312 1.00 38.84 ? 228 GLU B OE2 1 
ATOM   2967 N  N   . THR B 1 54  ? -56.261 -0.545  -53.810 1.00 31.14 ? 229 THR B N   1 
ATOM   2968 C  CA  . THR B 1 54  ? -57.028 0.676   -53.585 1.00 32.74 ? 229 THR B CA  1 
ATOM   2969 C  C   . THR B 1 54  ? -56.920 1.576   -54.829 1.00 33.98 ? 229 THR B C   1 
ATOM   2970 O  O   . THR B 1 54  ? -55.848 1.691   -55.430 1.00 33.89 ? 229 THR B O   1 
ATOM   2971 C  CB  . THR B 1 54  ? -56.521 1.444   -52.293 1.00 32.51 ? 229 THR B CB  1 
ATOM   2972 O  OG1 . THR B 1 54  ? -56.623 0.605   -51.141 1.00 32.75 ? 229 THR B OG1 1 
ATOM   2973 C  CG2 . THR B 1 54  ? -57.300 2.755   -52.026 1.00 32.82 ? 229 THR B CG2 1 
ATOM   2974 N  N   . THR B 1 55  ? -58.040 2.179   -55.245 1.00 35.26 ? 230 THR B N   1 
ATOM   2975 C  CA  . THR B 1 55  ? -57.995 3.237   -56.254 1.00 37.20 ? 230 THR B CA  1 
ATOM   2976 C  C   . THR B 1 55  ? -58.188 4.596   -55.605 1.00 37.36 ? 230 THR B C   1 
ATOM   2977 O  O   . THR B 1 55  ? -59.138 4.771   -54.850 1.00 38.60 ? 230 THR B O   1 
ATOM   2978 C  CB  . THR B 1 55  ? -59.060 3.058   -57.356 1.00 37.77 ? 230 THR B CB  1 
ATOM   2979 O  OG1 . THR B 1 55  ? -58.573 2.117   -58.315 1.00 37.60 ? 230 THR B OG1 1 
ATOM   2980 C  CG2 . THR B 1 55  ? -59.325 4.417   -58.082 1.00 39.91 ? 230 THR B CG2 1 
ATOM   2981 N  N   . LEU B 1 56  ? -57.272 5.532   -55.862 1.00 37.16 ? 231 LEU B N   1 
ATOM   2982 C  CA  . LEU B 1 56  ? -57.421 6.911   -55.411 1.00 38.01 ? 231 LEU B CA  1 
ATOM   2983 C  C   . LEU B 1 56  ? -57.806 7.694   -56.630 1.00 39.11 ? 231 LEU B C   1 
ATOM   2984 O  O   . LEU B 1 56  ? -57.005 7.768   -57.582 1.00 38.22 ? 231 LEU B O   1 
ATOM   2985 C  CB  . LEU B 1 56  ? -56.106 7.495   -54.885 0.50 37.59 ? 231 LEU B CB  1 
ATOM   2986 C  CG  . LEU B 1 56  ? -55.898 7.773   -53.401 0.50 36.38 ? 231 LEU B CG  1 
ATOM   2987 C  CD1 . LEU B 1 56  ? -56.060 6.502   -52.630 0.50 37.21 ? 231 LEU B CD1 1 
ATOM   2988 C  CD2 . LEU B 1 56  ? -54.518 8.366   -53.171 0.50 31.91 ? 231 LEU B CD2 1 
ATOM   2989 N  N   . LYS B 1 57  ? -59.021 8.265   -56.607 1.00 41.02 ? 232 LYS B N   1 
ATOM   2990 C  CA  . LYS B 1 57  ? -59.468 9.185   -57.660 1.00 43.51 ? 232 LYS B CA  1 
ATOM   2991 C  C   . LYS B 1 57  ? -58.611 10.428  -57.604 1.00 43.97 ? 232 LYS B C   1 
ATOM   2992 O  O   . LYS B 1 57  ? -57.900 10.681  -56.623 1.00 42.44 ? 232 LYS B O   1 
ATOM   2993 C  CB  . LYS B 1 57  ? -60.920 9.622   -57.480 1.00 44.10 ? 232 LYS B CB  1 
ATOM   2994 C  CG  . LYS B 1 57  ? -61.952 8.542   -57.627 1.00 47.08 ? 232 LYS B CG  1 
ATOM   2995 C  CD  . LYS B 1 57  ? -63.231 8.963   -56.901 1.00 51.91 ? 232 LYS B CD  1 
ATOM   2996 C  CE  . LYS B 1 57  ? -64.277 7.858   -56.972 1.00 55.61 ? 232 LYS B CE  1 
ATOM   2997 N  NZ  . LYS B 1 57  ? -64.544 7.604   -58.424 1.00 58.53 ? 232 LYS B NZ  1 
ATOM   2998 N  N   . GLU B 1 58  ? -58.724 11.221  -58.662 1.00 45.46 ? 233 GLU B N   1 
ATOM   2999 C  CA  . GLU B 1 58  ? -57.839 12.354  -58.894 1.00 46.82 ? 233 GLU B CA  1 
ATOM   3000 C  C   . GLU B 1 58  ? -57.882 13.343  -57.715 1.00 46.68 ? 233 GLU B C   1 
ATOM   3001 O  O   . GLU B 1 58  ? -56.847 13.892  -57.328 1.00 47.30 ? 233 GLU B O   1 
ATOM   3002 C  CB  . GLU B 1 58  ? -58.182 12.968  -60.284 1.00 47.97 ? 233 GLU B CB  1 
ATOM   3003 C  CG  . GLU B 1 58  ? -57.922 14.464  -60.501 1.00 51.73 ? 233 GLU B CG  1 
ATOM   3004 C  CD  . GLU B 1 58  ? -59.140 15.196  -61.113 1.00 57.35 ? 233 GLU B CD  1 
ATOM   3005 O  OE1 . GLU B 1 58  ? -59.662 14.776  -62.183 1.00 60.00 ? 233 GLU B OE1 1 
ATOM   3006 O  OE2 . GLU B 1 58  ? -59.590 16.203  -60.512 1.00 59.77 ? 233 GLU B OE2 1 
ATOM   3007 N  N   . THR B 1 59  ? -59.055 13.520  -57.101 1.00 45.75 ? 234 THR B N   1 
ATOM   3008 C  CA  . THR B 1 59  ? -59.187 14.460  -55.988 1.00 45.78 ? 234 THR B CA  1 
ATOM   3009 C  C   . THR B 1 59  ? -59.119 13.820  -54.581 1.00 44.82 ? 234 THR B C   1 
ATOM   3010 O  O   . THR B 1 59  ? -59.420 14.489  -53.590 1.00 45.05 ? 234 THR B O   1 
ATOM   3011 C  CB  . THR B 1 59  ? -60.536 15.183  -56.026 1.00 45.99 ? 234 THR B CB  1 
ATOM   3012 O  OG1 . THR B 1 59  ? -61.589 14.210  -56.012 1.00 46.72 ? 234 THR B OG1 1 
ATOM   3013 C  CG2 . THR B 1 59  ? -60.656 16.065  -57.292 1.00 47.45 ? 234 THR B CG2 1 
ATOM   3014 N  N   . GLU B 1 60  ? -58.769 12.538  -54.502 1.00 43.01 ? 235 GLU B N   1 
ATOM   3015 C  CA  . GLU B 1 60  ? -58.812 11.803  -53.247 1.00 41.39 ? 235 GLU B CA  1 
ATOM   3016 C  C   . GLU B 1 60  ? -57.412 11.762  -52.624 1.00 39.39 ? 235 GLU B C   1 
ATOM   3017 O  O   . GLU B 1 60  ? -56.437 11.626  -53.346 1.00 38.76 ? 235 GLU B O   1 
ATOM   3018 C  CB  . GLU B 1 60  ? -59.366 10.381  -53.502 1.00 42.01 ? 235 GLU B CB  1 
ATOM   3019 C  CG  . GLU B 1 60  ? -60.886 10.347  -53.526 1.00 45.18 ? 235 GLU B CG  1 
ATOM   3020 C  CD  . GLU B 1 60  ? -61.490 9.042   -54.048 1.00 50.81 ? 235 GLU B CD  1 
ATOM   3021 O  OE1 . GLU B 1 60  ? -60.739 8.102   -54.417 1.00 49.82 ? 235 GLU B OE1 1 
ATOM   3022 O  OE2 . GLU B 1 60  ? -62.755 8.965   -54.089 1.00 54.27 ? 235 GLU B OE2 1 
ATOM   3023 N  N   . LYS B 1 61  ? -57.312 11.869  -51.293 1.00 37.06 ? 236 LYS B N   1 
ATOM   3024 C  CA  . LYS B 1 61  ? -56.017 11.806  -50.610 1.00 35.28 ? 236 LYS B CA  1 
ATOM   3025 C  C   . LYS B 1 61  ? -56.021 10.583  -49.667 1.00 32.35 ? 236 LYS B C   1 
ATOM   3026 O  O   . LYS B 1 61  ? -57.072 10.026  -49.348 1.00 32.70 ? 236 LYS B O   1 
ATOM   3027 C  CB  . LYS B 1 61  ? -55.740 13.088  -49.789 1.00 35.75 ? 236 LYS B CB  1 
ATOM   3028 C  CG  . LYS B 1 61  ? -56.634 13.113  -48.516 1.00 39.58 ? 236 LYS B CG  1 
ATOM   3029 C  CD  . LYS B 1 61  ? -56.361 14.270  -47.574 1.00 43.25 ? 236 LYS B CD  1 
ATOM   3030 C  CE  . LYS B 1 61  ? -54.874 14.628  -47.568 1.00 47.40 ? 236 LYS B CE  1 
ATOM   3031 N  NZ  . LYS B 1 61  ? -54.588 15.760  -46.578 1.00 49.85 ? 236 LYS B NZ  1 
ATOM   3032 N  N   . ILE B 1 62  ? -54.832 10.167  -49.247 1.00 28.72 ? 237 ILE B N   1 
ATOM   3033 C  CA  . ILE B 1 62  ? -54.707 9.131   -48.251 1.00 25.14 ? 237 ILE B CA  1 
ATOM   3034 C  C   . ILE B 1 62  ? -53.450 9.400   -47.429 1.00 23.33 ? 237 ILE B C   1 
ATOM   3035 O  O   . ILE B 1 62  ? -52.446 10.032  -47.903 1.00 22.05 ? 237 ILE B O   1 
ATOM   3036 C  CB  . ILE B 1 62  ? -54.761 7.697   -48.859 1.00 25.74 ? 237 ILE B CB  1 
ATOM   3037 C  CG1 . ILE B 1 62  ? -55.012 6.661   -47.754 1.00 25.74 ? 237 ILE B CG1 1 
ATOM   3038 C  CG2 . ILE B 1 62  ? -53.456 7.359   -49.640 1.00 23.55 ? 237 ILE B CG2 1 
ATOM   3039 C  CD1 . ILE B 1 62  ? -55.565 5.290   -48.299 1.00 29.61 ? 237 ILE B CD1 1 
ATOM   3040 N  N   . THR B 1 63  ? -53.560 9.023   -46.171 1.00 20.72 ? 238 THR B N   1 
ATOM   3041 C  CA  . THR B 1 63  ? -52.498 9.172   -45.188 1.00 21.14 ? 238 THR B CA  1 
ATOM   3042 C  C   . THR B 1 63  ? -51.910 7.798   -44.873 1.00 20.26 ? 238 THR B C   1 
ATOM   3043 O  O   . THR B 1 63  ? -52.634 6.884   -44.521 1.00 17.88 ? 238 THR B O   1 
ATOM   3044 C  CB  . THR B 1 63  ? -52.988 9.814   -43.906 1.00 20.89 ? 238 THR B CB  1 
ATOM   3045 O  OG1 . THR B 1 63  ? -53.504 11.100  -44.261 1.00 23.76 ? 238 THR B OG1 1 
ATOM   3046 C  CG2 . THR B 1 63  ? -51.810 10.008  -42.900 1.00 23.55 ? 238 THR B CG2 1 
ATOM   3047 N  N   . VAL B 1 64  ? -50.599 7.691   -45.002 1.00 19.64 ? 239 VAL B N   1 
ATOM   3048 C  CA  . VAL B 1 64  ? -49.906 6.460   -44.664 1.00 19.18 ? 239 VAL B CA  1 
ATOM   3049 C  C   . VAL B 1 64  ? -49.053 6.665   -43.413 1.00 18.82 ? 239 VAL B C   1 
ATOM   3050 O  O   . VAL B 1 64  ? -48.164 7.510   -43.427 1.00 19.06 ? 239 VAL B O   1 
ATOM   3051 C  CB  . VAL B 1 64  ? -49.018 5.966   -45.847 1.00 18.58 ? 239 VAL B CB  1 
ATOM   3052 C  CG1 . VAL B 1 64  ? -48.370 4.621   -45.426 1.00 18.72 ? 239 VAL B CG1 1 
ATOM   3053 C  CG2 . VAL B 1 64  ? -49.828 5.874   -47.205 1.00 18.64 ? 239 VAL B CG2 1 
ATOM   3054 N  N   . CYS B 1 65  ? -49.326 5.887   -42.351 1.00 16.88 ? 240 CYS B N   1 
ATOM   3055 C  CA  . CYS B 1 65  ? -48.529 5.868   -41.133 1.00 18.16 ? 240 CYS B CA  1 
ATOM   3056 C  C   . CYS B 1 65  ? -47.695 4.600   -41.016 1.00 16.82 ? 240 CYS B C   1 
ATOM   3057 O  O   . CYS B 1 65  ? -48.105 3.553   -41.518 1.00 16.06 ? 240 CYS B O   1 
ATOM   3058 C  CB  . CYS B 1 65  ? -49.395 6.015   -39.859 1.00 18.74 ? 240 CYS B CB  1 
ATOM   3059 S  SG  . CYS B 1 65  ? -50.380 7.548   -39.924 1.00 20.78 ? 240 CYS B SG  1 
ATOM   3060 N  N   . GLY B 1 66  ? -46.532 4.749   -40.380 1.00 17.53 ? 241 GLY B N   1 
ATOM   3061 C  CA  . GLY B 1 66  ? -45.620 3.640   -40.076 1.00 19.64 ? 241 GLY B CA  1 
ATOM   3062 C  C   . GLY B 1 66  ? -45.861 3.124   -38.642 1.00 19.60 ? 241 GLY B C   1 
ATOM   3063 O  O   . GLY B 1 66  ? -46.995 3.318   -38.097 1.00 21.34 ? 241 GLY B O   1 
ATOM   3064 N  N   . ASP B 1 67  ? -44.856 2.470   -38.055 1.00 18.70 ? 242 ASP B N   1 
ATOM   3065 C  CA  . ASP B 1 67  ? -44.978 1.837   -36.712 1.00 18.08 ? 242 ASP B CA  1 
ATOM   3066 C  C   . ASP B 1 67  ? -45.494 2.856   -35.690 1.00 18.87 ? 242 ASP B C   1 
ATOM   3067 O  O   . ASP B 1 67  ? -45.094 4.044   -35.681 1.00 16.20 ? 242 ASP B O   1 
ATOM   3068 C  CB  . ASP B 1 67  ? -43.642 1.290   -36.145 1.00 17.60 ? 242 ASP B CB  1 
ATOM   3069 C  CG  . ASP B 1 67  ? -42.884 0.389   -37.135 1.00 20.15 ? 242 ASP B CG  1 
ATOM   3070 O  OD1 . ASP B 1 67  ? -43.041 0.536   -38.338 1.00 17.41 ? 242 ASP B OD1 1 
ATOM   3071 O  OD2 . ASP B 1 67  ? -42.143 -0.487  -36.724 1.00 18.25 ? 242 ASP B OD2 1 
ATOM   3072 N  N   . THR B 1 68  ? -46.366 2.365   -34.809 1.00 17.82 ? 243 THR B N   1 
ATOM   3073 C  CA  . THR B 1 68  ? -46.830 3.188   -33.681 1.00 18.37 ? 243 THR B CA  1 
ATOM   3074 C  C   . THR B 1 68  ? -46.429 2.578   -32.292 1.00 17.92 ? 243 THR B C   1 
ATOM   3075 O  O   . THR B 1 68  ? -46.192 3.338   -31.335 1.00 19.06 ? 243 THR B O   1 
ATOM   3076 C  CB  . THR B 1 68  ? -48.346 3.465   -33.772 1.00 18.32 ? 243 THR B CB  1 
ATOM   3077 O  OG1 . THR B 1 68  ? -49.025 2.228   -33.984 1.00 21.75 ? 243 THR B OG1 1 
ATOM   3078 C  CG2 . THR B 1 68  ? -48.654 4.405   -34.961 1.00 18.08 ? 243 THR B CG2 1 
ATOM   3079 N  N   . HIS B 1 69  ? -46.311 1.231   -32.206 1.00 16.33 ? 244 HIS B N   1 
ATOM   3080 C  CA  . HIS B 1 69  ? -45.722 0.574   -30.987 1.00 16.73 ? 244 HIS B CA  1 
ATOM   3081 C  C   . HIS B 1 69  ? -46.288 1.103   -29.635 1.00 15.89 ? 244 HIS B C   1 
ATOM   3082 O  O   . HIS B 1 69  ? -45.549 1.515   -28.728 1.00 16.11 ? 244 HIS B O   1 
ATOM   3083 C  CB  . HIS B 1 69  ? -44.175 0.610   -30.936 1.00 16.35 ? 244 HIS B CB  1 
ATOM   3084 C  CG  . HIS B 1 69  ? -43.525 -0.384  -31.847 1.00 16.86 ? 244 HIS B CG  1 
ATOM   3085 N  ND1 . HIS B 1 69  ? -43.801 -1.736  -31.792 1.00 18.52 ? 244 HIS B ND1 1 
ATOM   3086 C  CD2 . HIS B 1 69  ? -42.739 -0.197  -32.948 1.00 16.67 ? 244 HIS B CD2 1 
ATOM   3087 C  CE1 . HIS B 1 69  ? -43.135 -2.352  -32.767 1.00 18.13 ? 244 HIS B CE1 1 
ATOM   3088 N  NE2 . HIS B 1 69  ? -42.472 -1.438  -33.461 1.00 16.89 ? 244 HIS B NE2 1 
ATOM   3089 N  N   . GLY B 1 70  ? -47.588 0.978   -29.505 1.00 17.94 ? 245 GLY B N   1 
ATOM   3090 C  CA  . GLY B 1 70  ? -48.282 1.248   -28.234 1.00 17.69 ? 245 GLY B CA  1 
ATOM   3091 C  C   . GLY B 1 70  ? -48.114 2.666   -27.724 1.00 19.29 ? 245 GLY B C   1 
ATOM   3092 O  O   . GLY B 1 70  ? -48.343 2.886   -26.518 1.00 19.97 ? 245 GLY B O   1 
ATOM   3093 N  N   . GLN B 1 71  ? -47.670 3.604   -28.599 1.00 17.96 ? 246 GLN B N   1 
ATOM   3094 C  CA  . GLN B 1 71  ? -47.562 5.011   -28.237 1.00 18.40 ? 246 GLN B CA  1 
ATOM   3095 C  C   . GLN B 1 71  ? -48.908 5.713   -28.483 1.00 18.63 ? 246 GLN B C   1 
ATOM   3096 O  O   . GLN B 1 71  ? -49.072 6.539   -29.375 1.00 18.98 ? 246 GLN B O   1 
ATOM   3097 C  CB  . GLN B 1 71  ? -46.376 5.730   -28.882 1.00 18.74 ? 246 GLN B CB  1 
ATOM   3098 C  CG  . GLN B 1 71  ? -45.074 4.995   -28.625 1.00 19.29 ? 246 GLN B CG  1 
ATOM   3099 C  CD  . GLN B 1 71  ? -43.831 5.670   -29.174 1.00 20.92 ? 246 GLN B CD  1 
ATOM   3100 O  OE1 . GLN B 1 71  ? -43.846 6.845   -29.616 1.00 23.22 ? 246 GLN B OE1 1 
ATOM   3101 N  NE2 . GLN B 1 71  ? -42.751 4.933   -29.155 1.00 18.46 ? 246 GLN B NE2 1 
ATOM   3102 N  N   . PHE B 1 72  ? -49.863 5.353   -27.645 1.00 17.43 ? 247 PHE B N   1 
ATOM   3103 C  CA  . PHE B 1 72  ? -51.195 5.856   -27.770 1.00 18.61 ? 247 PHE B CA  1 
ATOM   3104 C  C   . PHE B 1 72  ? -51.343 7.399   -27.765 1.00 16.34 ? 247 PHE B C   1 
ATOM   3105 O  O   . PHE B 1 72  ? -52.165 7.937   -28.472 1.00 17.07 ? 247 PHE B O   1 
ATOM   3106 C  CB  . PHE B 1 72  ? -52.064 5.321   -26.633 1.00 18.98 ? 247 PHE B CB  1 
ATOM   3107 C  CG  . PHE B 1 72  ? -53.499 5.854   -26.698 1.00 19.19 ? 247 PHE B CG  1 
ATOM   3108 C  CD1 . PHE B 1 72  ? -54.367 5.380   -27.645 1.00 17.24 ? 247 PHE B CD1 1 
ATOM   3109 C  CD2 . PHE B 1 72  ? -53.942 6.828   -25.819 1.00 21.15 ? 247 PHE B CD2 1 
ATOM   3110 C  CE1 . PHE B 1 72  ? -55.683 5.862   -27.712 1.00 23.05 ? 247 PHE B CE1 1 
ATOM   3111 C  CE2 . PHE B 1 72  ? -55.277 7.278   -25.863 1.00 21.56 ? 247 PHE B CE2 1 
ATOM   3112 C  CZ  . PHE B 1 72  ? -56.127 6.799   -26.806 1.00 18.06 ? 247 PHE B CZ  1 
ATOM   3113 N  N   . TYR B 1 73  ? -50.595 8.070   -26.934 1.00 18.76 ? 248 TYR B N   1 
ATOM   3114 C  CA  . TYR B 1 73  ? -50.702 9.556   -26.859 1.00 20.62 ? 248 TYR B CA  1 
ATOM   3115 C  C   . TYR B 1 73  ? -50.159 10.210  -28.168 1.00 20.29 ? 248 TYR B C   1 
ATOM   3116 O  O   . TYR B 1 73  ? -50.623 11.273  -28.632 1.00 17.47 ? 248 TYR B O   1 
ATOM   3117 C  CB  . TYR B 1 73  ? -50.029 10.057  -25.587 1.00 20.41 ? 248 TYR B CB  1 
ATOM   3118 C  CG  . TYR B 1 73  ? -50.831 9.521   -24.405 1.00 25.34 ? 248 TYR B CG  1 
ATOM   3119 C  CD1 . TYR B 1 73  ? -50.545 8.269   -23.836 1.00 24.53 ? 248 TYR B CD1 1 
ATOM   3120 C  CD2 . TYR B 1 73  ? -51.946 10.221  -23.938 1.00 28.59 ? 248 TYR B CD2 1 
ATOM   3121 C  CE1 . TYR B 1 73  ? -51.329 7.765   -22.801 1.00 26.48 ? 248 TYR B CE1 1 
ATOM   3122 C  CE2 . TYR B 1 73  ? -52.735 9.727   -22.887 1.00 27.95 ? 248 TYR B CE2 1 
ATOM   3123 C  CZ  . TYR B 1 73  ? -52.410 8.510   -22.320 1.00 28.69 ? 248 TYR B CZ  1 
ATOM   3124 O  OH  . TYR B 1 73  ? -53.202 8.037   -21.308 1.00 29.62 ? 248 TYR B OH  1 
ATOM   3125 N  N   . ASP B 1 74  ? -49.212 9.513   -28.789 1.00 19.71 ? 249 ASP B N   1 
ATOM   3126 C  CA  . ASP B 1 74  ? -48.682 9.946   -30.096 1.00 20.80 ? 249 ASP B CA  1 
ATOM   3127 C  C   . ASP B 1 74  ? -49.651 9.682   -31.233 1.00 20.23 ? 249 ASP B C   1 
ATOM   3128 O  O   . ASP B 1 74  ? -49.738 10.460  -32.197 1.00 20.78 ? 249 ASP B O   1 
ATOM   3129 C  CB  . ASP B 1 74  ? -47.312 9.307   -30.324 1.00 19.15 ? 249 ASP B CB  1 
ATOM   3130 C  CG  . ASP B 1 74  ? -46.305 9.837   -29.348 1.00 22.51 ? 249 ASP B CG  1 
ATOM   3131 O  OD1 . ASP B 1 74  ? -46.351 11.070  -29.087 1.00 25.43 ? 249 ASP B OD1 1 
ATOM   3132 O  OD2 . ASP B 1 74  ? -45.496 9.050   -28.788 1.00 23.37 ? 249 ASP B OD2 1 
ATOM   3133 N  N   . LEU B 1 75  ? -50.401 8.589   -31.127 1.00 21.36 ? 250 LEU B N   1 
ATOM   3134 C  CA  . LEU B 1 75  ? -51.462 8.311   -32.078 1.00 20.66 ? 250 LEU B CA  1 
ATOM   3135 C  C   . LEU B 1 75  ? -52.600 9.342   -32.007 1.00 21.15 ? 250 LEU B C   1 
ATOM   3136 O  O   . LEU B 1 75  ? -53.190 9.717   -33.036 1.00 20.10 ? 250 LEU B O   1 
ATOM   3137 C  CB  . LEU B 1 75  ? -52.064 6.936   -31.750 1.00 21.16 ? 250 LEU B CB  1 
ATOM   3138 C  CG  . LEU B 1 75  ? -53.250 6.453   -32.570 1.00 20.51 ? 250 LEU B CG  1 
ATOM   3139 C  CD1 . LEU B 1 75  ? -52.820 6.336   -34.031 1.00 20.77 ? 250 LEU B CD1 1 
ATOM   3140 C  CD2 . LEU B 1 75  ? -53.768 5.078   -32.140 1.00 20.94 ? 250 LEU B CD2 1 
ATOM   3141 N  N   . LEU B 1 76  ? -53.004 9.725   -30.787 1.00 20.86 ? 251 LEU B N   1 
ATOM   3142 C  CA  . LEU B 1 76  ? -54.023 10.812  -30.692 1.00 22.04 ? 251 LEU B CA  1 
ATOM   3143 C  C   . LEU B 1 76  ? -53.450 12.066  -31.328 1.00 19.97 ? 251 LEU B C   1 
ATOM   3144 O  O   . LEU B 1 76  ? -54.164 12.824  -31.916 1.00 22.19 ? 251 LEU B O   1 
ATOM   3145 C  CB  . LEU B 1 76  ? -54.354 11.149  -29.226 1.00 20.13 ? 251 LEU B CB  1 
ATOM   3146 C  CG  . LEU B 1 76  ? -54.970 10.036  -28.400 1.00 23.29 ? 251 LEU B CG  1 
ATOM   3147 C  CD1 . LEU B 1 76  ? -55.378 10.569  -26.989 1.00 23.89 ? 251 LEU B CD1 1 
ATOM   3148 C  CD2 . LEU B 1 76  ? -56.154 9.443   -29.178 1.00 23.24 ? 251 LEU B CD2 1 
ATOM   3149 N  N   . ASN B 1 77  ? -52.162 12.292  -31.161 1.00 20.41 ? 252 ASN B N   1 
ATOM   3150 C  CA  . ASN B 1 77  ? -51.542 13.463  -31.743 1.00 20.46 ? 252 ASN B CA  1 
ATOM   3151 C  C   . ASN B 1 77  ? -51.582 13.428  -33.270 1.00 20.23 ? 252 ASN B C   1 
ATOM   3152 O  O   . ASN B 1 77  ? -51.917 14.448  -33.923 1.00 18.85 ? 252 ASN B O   1 
ATOM   3153 C  CB  . ASN B 1 77  ? -50.138 13.716  -31.189 1.00 19.33 ? 252 ASN B CB  1 
ATOM   3154 C  CG  . ASN B 1 77  ? -49.604 15.108  -31.583 1.00 24.28 ? 252 ASN B CG  1 
ATOM   3155 O  OD1 . ASN B 1 77  ? -50.315 16.112  -31.416 1.00 23.63 ? 252 ASN B OD1 1 
ATOM   3156 N  ND2 . ASN B 1 77  ? -48.371 15.164  -32.125 1.00 16.81 ? 252 ASN B ND2 1 
ATOM   3157 N  N   . ILE B 1 78  ? -51.345 12.256  -33.859 1.00 19.59 ? 253 ILE B N   1 
ATOM   3158 C  CA  . ILE B 1 78  ? -51.558 12.123  -35.303 1.00 19.69 ? 253 ILE B CA  1 
ATOM   3159 C  C   . ILE B 1 78  ? -52.980 12.556  -35.696 1.00 20.07 ? 253 ILE B C   1 
ATOM   3160 O  O   . ILE B 1 78  ? -53.184 13.325  -36.672 1.00 18.12 ? 253 ILE B O   1 
ATOM   3161 C  CB  . ILE B 1 78  ? -51.289 10.694  -35.841 1.00 20.22 ? 253 ILE B CB  1 
ATOM   3162 C  CG1 . ILE B 1 78  ? -49.838 10.259  -35.618 1.00 20.34 ? 253 ILE B CG1 1 
ATOM   3163 C  CG2 . ILE B 1 78  ? -51.502 10.635  -37.344 1.00 20.73 ? 253 ILE B CG2 1 
ATOM   3164 C  CD1 . ILE B 1 78  ? -49.647 8.726   -35.991 1.00 22.24 ? 253 ILE B CD1 1 
ATOM   3165 N  N   . PHE B 1 79  ? -53.996 12.035  -34.997 1.00 20.13 ? 254 PHE B N   1 
ATOM   3166 C  CA  . PHE B 1 79  ? -55.368 12.441  -35.416 1.00 22.04 ? 254 PHE B CA  1 
ATOM   3167 C  C   . PHE B 1 79  ? -55.655 13.950  -35.183 1.00 22.50 ? 254 PHE B C   1 
ATOM   3168 O  O   . PHE B 1 79  ? -56.499 14.535  -35.857 1.00 23.91 ? 254 PHE B O   1 
ATOM   3169 C  CB  . PHE B 1 79  ? -56.455 11.598  -34.746 1.00 21.65 ? 254 PHE B CB  1 
ATOM   3170 C  CG  . PHE B 1 79  ? -56.342 10.116  -35.009 1.00 21.88 ? 254 PHE B CG  1 
ATOM   3171 C  CD1 . PHE B 1 79  ? -55.982 9.640   -36.242 1.00 21.21 ? 254 PHE B CD1 1 
ATOM   3172 C  CD2 . PHE B 1 79  ? -56.625 9.210   -34.007 1.00 22.50 ? 254 PHE B CD2 1 
ATOM   3173 C  CE1 . PHE B 1 79  ? -55.908 8.287   -36.501 1.00 22.39 ? 254 PHE B CE1 1 
ATOM   3174 C  CE2 . PHE B 1 79  ? -56.568 7.829   -34.263 1.00 24.03 ? 254 PHE B CE2 1 
ATOM   3175 C  CZ  . PHE B 1 79  ? -56.224 7.375   -35.513 1.00 23.03 ? 254 PHE B CZ  1 
ATOM   3176 N  N   . GLU B 1 80  ? -54.988 14.558  -34.205 1.00 24.51 ? 255 GLU B N   1 
ATOM   3177 C  CA  . GLU B 1 80  ? -55.097 16.018  -33.986 1.00 26.19 ? 255 GLU B CA  1 
ATOM   3178 C  C   . GLU B 1 80  ? -54.494 16.795  -35.111 1.00 25.33 ? 255 GLU B C   1 
ATOM   3179 O  O   . GLU B 1 80  ? -55.153 17.676  -35.678 1.00 24.82 ? 255 GLU B O   1 
ATOM   3180 C  CB  . GLU B 1 80  ? -54.512 16.424  -32.635 1.00 26.67 ? 255 GLU B CB  1 
ATOM   3181 C  CG  . GLU B 1 80  ? -55.409 15.733  -31.599 1.00 35.31 ? 255 GLU B CG  1 
ATOM   3182 C  CD  . GLU B 1 80  ? -55.044 15.905  -30.119 1.00 42.32 ? 255 GLU B CD  1 
ATOM   3183 O  OE1 . GLU B 1 80  ? -53.870 16.165  -29.788 1.00 47.41 ? 255 GLU B OE1 1 
ATOM   3184 O  OE2 . GLU B 1 80  ? -55.966 15.696  -29.269 1.00 45.44 ? 255 GLU B OE2 1 
ATOM   3185 N  N   . LEU B 1 81  ? -53.274 16.413  -35.497 1.00 24.97 ? 256 LEU B N   1 
ATOM   3186 C  CA  . LEU B 1 81  ? -52.555 17.100  -36.605 1.00 25.13 ? 256 LEU B CA  1 
ATOM   3187 C  C   . LEU B 1 81  ? -53.220 16.906  -37.938 1.00 24.55 ? 256 LEU B C   1 
ATOM   3188 O  O   . LEU B 1 81  ? -53.320 17.826  -38.750 1.00 24.58 ? 256 LEU B O   1 
ATOM   3189 C  CB  . LEU B 1 81  ? -51.085 16.639  -36.674 1.00 24.51 ? 256 LEU B CB  1 
ATOM   3190 C  CG  . LEU B 1 81  ? -50.232 16.690  -35.418 1.00 25.03 ? 256 LEU B CG  1 
ATOM   3191 C  CD1 . LEU B 1 81  ? -48.849 16.099  -35.712 1.00 25.17 ? 256 LEU B CD1 1 
ATOM   3192 C  CD2 . LEU B 1 81  ? -50.103 18.093  -34.753 1.00 28.41 ? 256 LEU B CD2 1 
ATOM   3193 N  N   . ASN B 1 82  ? -53.783 15.724  -38.143 1.00 24.00 ? 257 ASN B N   1 
ATOM   3194 C  CA  . ASN B 1 82  ? -54.172 15.329  -39.474 1.00 23.03 ? 257 ASN B CA  1 
ATOM   3195 C  C   . ASN B 1 82  ? -55.652 15.073  -39.646 1.00 23.69 ? 257 ASN B C   1 
ATOM   3196 O  O   . ASN B 1 82  ? -56.138 14.716  -40.759 1.00 22.06 ? 257 ASN B O   1 
ATOM   3197 C  CB  . ASN B 1 82  ? -53.376 14.085  -39.858 1.00 21.55 ? 257 ASN B CB  1 
ATOM   3198 C  CG  . ASN B 1 82  ? -53.495 13.748  -41.347 1.00 25.46 ? 257 ASN B CG  1 
ATOM   3199 O  OD1 . ASN B 1 82  ? -53.121 14.583  -42.216 1.00 24.33 ? 257 ASN B OD1 1 
ATOM   3200 N  ND2 . ASN B 1 82  ? -54.014 12.529  -41.664 1.00 21.59 ? 257 ASN B ND2 1 
ATOM   3201 N  N   . GLY B 1 83  ? -56.370 15.219  -38.530 1.00 24.66 ? 258 GLY B N   1 
ATOM   3202 C  CA  . GLY B 1 83  ? -57.799 14.988  -38.508 1.00 24.57 ? 258 GLY B CA  1 
ATOM   3203 C  C   . GLY B 1 83  ? -58.161 13.541  -38.224 1.00 26.15 ? 258 GLY B C   1 
ATOM   3204 O  O   . GLY B 1 83  ? -57.384 12.605  -38.493 1.00 25.46 ? 258 GLY B O   1 
ATOM   3205 N  N   . LEU B 1 84  ? -59.357 13.341  -37.687 1.00 25.35 ? 259 LEU B N   1 
ATOM   3206 C  CA  . LEU B 1 84  ? -59.870 12.004  -37.446 1.00 25.16 ? 259 LEU B CA  1 
ATOM   3207 C  C   . LEU B 1 84  ? -60.076 11.232  -38.766 1.00 24.45 ? 259 LEU B C   1 
ATOM   3208 O  O   . LEU B 1 84  ? -60.323 11.812  -39.824 1.00 23.11 ? 259 LEU B O   1 
ATOM   3209 C  CB  . LEU B 1 84  ? -61.185 12.074  -36.606 1.00 26.23 ? 259 LEU B CB  1 
ATOM   3210 C  CG  . LEU B 1 84  ? -61.103 12.381  -35.094 1.00 26.38 ? 259 LEU B CG  1 
ATOM   3211 C  CD1 . LEU B 1 84  ? -62.496 12.511  -34.549 1.00 31.43 ? 259 LEU B CD1 1 
ATOM   3212 C  CD2 . LEU B 1 84  ? -60.360 11.220  -34.369 1.00 29.80 ? 259 LEU B CD2 1 
ATOM   3213 N  N   . PRO B 1 85  ? -59.943 9.902   -38.717 1.00 24.46 ? 260 PRO B N   1 
ATOM   3214 C  CA  . PRO B 1 85  ? -60.203 9.122   -39.922 1.00 24.91 ? 260 PRO B CA  1 
ATOM   3215 C  C   . PRO B 1 85  ? -61.647 9.363   -40.370 1.00 26.54 ? 260 PRO B C   1 
ATOM   3216 O  O   . PRO B 1 85  ? -62.519 9.563   -39.522 1.00 26.47 ? 260 PRO B O   1 
ATOM   3217 C  CB  . PRO B 1 85  ? -60.072 7.675   -39.452 1.00 24.57 ? 260 PRO B CB  1 
ATOM   3218 C  CG  . PRO B 1 85  ? -59.459 7.698   -38.102 1.00 24.43 ? 260 PRO B CG  1 
ATOM   3219 C  CD  . PRO B 1 85  ? -59.464 9.102   -37.576 1.00 24.03 ? 260 PRO B CD  1 
ATOM   3220 N  N   . SER B 1 86  ? -61.916 9.320   -41.658 1.00 26.54 ? 261 SER B N   1 
ATOM   3221 C  CA  . SER B 1 86  ? -63.291 9.385   -42.091 1.00 29.82 ? 261 SER B CA  1 
ATOM   3222 C  C   . SER B 1 86  ? -63.286 8.862   -43.511 1.00 30.90 ? 261 SER B C   1 
ATOM   3223 O  O   . SER B 1 86  ? -62.214 8.436   -44.022 1.00 31.30 ? 261 SER B O   1 
ATOM   3224 C  CB  . SER B 1 86  ? -63.859 10.815  -41.999 1.00 29.26 ? 261 SER B CB  1 
ATOM   3225 O  OG  . SER B 1 86  ? -63.285 11.677  -42.969 1.00 30.03 ? 261 SER B OG  1 
ATOM   3226 N  N   . GLU B 1 87  ? -64.450 8.900   -44.164 1.00 32.51 ? 262 GLU B N   1 
ATOM   3227 C  CA  . GLU B 1 87  ? -64.519 8.569   -45.591 1.00 32.89 ? 262 GLU B CA  1 
ATOM   3228 C  C   . GLU B 1 87  ? -63.808 9.585   -46.491 1.00 32.41 ? 262 GLU B C   1 
ATOM   3229 O  O   . GLU B 1 87  ? -63.507 9.296   -47.638 1.00 32.14 ? 262 GLU B O   1 
ATOM   3230 C  CB  . GLU B 1 87  ? -65.960 8.383   -46.063 1.00 34.86 ? 262 GLU B CB  1 
ATOM   3231 C  CG  . GLU B 1 87  ? -66.807 7.473   -45.179 1.00 38.67 ? 262 GLU B CG  1 
ATOM   3232 C  CD  . GLU B 1 87  ? -67.522 8.243   -44.054 1.00 45.98 ? 262 GLU B CD  1 
ATOM   3233 O  OE1 . GLU B 1 87  ? -67.105 9.403   -43.722 1.00 46.25 ? 262 GLU B OE1 1 
ATOM   3234 O  OE2 . GLU B 1 87  ? -68.517 7.684   -43.500 1.00 49.27 ? 262 GLU B OE2 1 
ATOM   3235 N  N   . THR B 1 88  ? -63.542 10.793  -46.011 1.00 31.81 ? 263 THR B N   1 
ATOM   3236 C  CA  . THR B 1 88  ? -62.781 11.704  -46.830 1.00 32.26 ? 263 THR B CA  1 
ATOM   3237 C  C   . THR B 1 88  ? -61.357 11.869  -46.289 1.00 31.64 ? 263 THR B C   1 
ATOM   3238 O  O   . THR B 1 88  ? -60.549 12.576  -46.903 1.00 33.86 ? 263 THR B O   1 
ATOM   3239 C  CB  . THR B 1 88  ? -63.418 13.107  -46.874 1.00 32.52 ? 263 THR B CB  1 
ATOM   3240 O  OG1 . THR B 1 88  ? -63.951 13.406  -45.589 1.00 34.24 ? 263 THR B OG1 1 
ATOM   3241 C  CG2 . THR B 1 88  ? -64.559 13.158  -47.881 1.00 35.54 ? 263 THR B CG2 1 
ATOM   3242 N  N   . ASN B 1 89  ? -61.061 11.267  -45.133 1.00 28.65 ? 264 ASN B N   1 
ATOM   3243 C  CA  . ASN B 1 89  ? -59.719 11.356  -44.570 1.00 26.68 ? 264 ASN B CA  1 
ATOM   3244 C  C   . ASN B 1 89  ? -59.196 9.932   -44.306 1.00 24.80 ? 264 ASN B C   1 
ATOM   3245 O  O   . ASN B 1 89  ? -59.098 9.511   -43.163 1.00 24.85 ? 264 ASN B O   1 
ATOM   3246 C  CB  . ASN B 1 89  ? -59.729 12.143  -43.269 1.00 26.48 ? 264 ASN B CB  1 
ATOM   3247 C  CG  . ASN B 1 89  ? -58.349 12.657  -42.872 1.00 26.11 ? 264 ASN B CG  1 
ATOM   3248 O  OD1 . ASN B 1 89  ? -58.075 12.902  -41.671 1.00 30.87 ? 264 ASN B OD1 1 
ATOM   3249 N  ND2 . ASN B 1 89  ? -57.471 12.806  -43.840 1.00 25.88 ? 264 ASN B ND2 1 
ATOM   3250 N  N   . PRO B 1 90  ? -58.895 9.194   -45.373 1.00 23.39 ? 265 PRO B N   1 
ATOM   3251 C  CA  . PRO B 1 90  ? -58.550 7.784   -45.200 1.00 22.48 ? 265 PRO B CA  1 
ATOM   3252 C  C   . PRO B 1 90  ? -57.127 7.572   -44.659 1.00 21.33 ? 265 PRO B C   1 
ATOM   3253 O  O   . PRO B 1 90  ? -56.242 8.427   -44.881 1.00 19.05 ? 265 PRO B O   1 
ATOM   3254 C  CB  . PRO B 1 90  ? -58.748 7.155   -46.598 1.00 22.88 ? 265 PRO B CB  1 
ATOM   3255 C  CG  . PRO B 1 90  ? -59.097 8.324   -47.524 1.00 25.23 ? 265 PRO B CG  1 
ATOM   3256 C  CD  . PRO B 1 90  ? -58.904 9.634   -46.769 1.00 22.23 ? 265 PRO B CD  1 
ATOM   3257 N  N   . TYR B 1 91  ? -56.945 6.443   -43.941 1.00 20.56 ? 266 TYR B N   1 
ATOM   3258 C  CA  . TYR B 1 91  ? -55.622 6.048   -43.366 1.00 19.65 ? 266 TYR B CA  1 
ATOM   3259 C  C   . TYR B 1 91  ? -55.162 4.653   -43.728 1.00 19.76 ? 266 TYR B C   1 
ATOM   3260 O  O   . TYR B 1 91  ? -55.982 3.728   -43.874 1.00 20.35 ? 266 TYR B O   1 
ATOM   3261 C  CB  . TYR B 1 91  ? -55.603 6.082   -41.841 1.00 17.91 ? 266 TYR B CB  1 
ATOM   3262 C  CG  . TYR B 1 91  ? -55.456 7.450   -41.189 1.00 19.61 ? 266 TYR B CG  1 
ATOM   3263 C  CD1 . TYR B 1 91  ? -56.550 8.295   -41.084 1.00 18.28 ? 266 TYR B CD1 1 
ATOM   3264 C  CD2 . TYR B 1 91  ? -54.260 7.868   -40.640 1.00 21.86 ? 266 TYR B CD2 1 
ATOM   3265 C  CE1 . TYR B 1 91  ? -56.436 9.574   -40.468 1.00 18.60 ? 266 TYR B CE1 1 
ATOM   3266 C  CE2 . TYR B 1 91  ? -54.135 9.149   -40.017 1.00 20.02 ? 266 TYR B CE2 1 
ATOM   3267 C  CZ  . TYR B 1 91  ? -55.244 9.979   -39.941 1.00 20.99 ? 266 TYR B CZ  1 
ATOM   3268 O  OH  . TYR B 1 91  ? -55.186 11.215  -39.327 1.00 20.41 ? 266 TYR B OH  1 
ATOM   3269 N  N   . ILE B 1 92  ? -53.840 4.497   -43.756 1.00 18.59 ? 267 ILE B N   1 
ATOM   3270 C  CA  . ILE B 1 92  ? -53.233 3.155   -43.766 1.00 18.95 ? 267 ILE B CA  1 
ATOM   3271 C  C   . ILE B 1 92  ? -52.263 3.099   -42.635 1.00 17.26 ? 267 ILE B C   1 
ATOM   3272 O  O   . ILE B 1 92  ? -51.341 3.949   -42.540 1.00 14.91 ? 267 ILE B O   1 
ATOM   3273 C  CB  . ILE B 1 92  ? -52.338 2.922   -45.022 1.00 20.66 ? 267 ILE B CB  1 
ATOM   3274 C  CG1 . ILE B 1 92  ? -53.026 3.364   -46.293 1.00 24.32 ? 267 ILE B CG1 1 
ATOM   3275 C  CG2 . ILE B 1 92  ? -51.702 1.465   -45.059 1.00 18.16 ? 267 ILE B CG2 1 
ATOM   3276 C  CD1 . ILE B 1 92  ? -53.983 2.518   -46.753 1.00 30.68 ? 267 ILE B CD1 1 
ATOM   3277 N  N   . PHE B 1 93  ? -52.423 2.120   -41.759 1.00 16.35 ? 268 PHE B N   1 
ATOM   3278 C  CA  . PHE B 1 93  ? -51.401 1.997   -40.712 1.00 16.31 ? 268 PHE B CA  1 
ATOM   3279 C  C   . PHE B 1 93  ? -50.610 0.736   -41.031 1.00 17.78 ? 268 PHE B C   1 
ATOM   3280 O  O   . PHE B 1 93  ? -51.183 -0.351  -41.096 1.00 18.87 ? 268 PHE B O   1 
ATOM   3281 C  CB  . PHE B 1 93  ? -51.920 1.976   -39.275 1.00 16.66 ? 268 PHE B CB  1 
ATOM   3282 C  CG  . PHE B 1 93  ? -52.305 3.342   -38.723 1.00 17.57 ? 268 PHE B CG  1 
ATOM   3283 C  CD1 . PHE B 1 93  ? -53.498 3.937   -39.109 1.00 16.50 ? 268 PHE B CD1 1 
ATOM   3284 C  CD2 . PHE B 1 93  ? -51.511 3.969   -37.813 1.00 18.20 ? 268 PHE B CD2 1 
ATOM   3285 C  CE1 . PHE B 1 93  ? -53.865 5.167   -38.610 1.00 18.18 ? 268 PHE B CE1 1 
ATOM   3286 C  CE2 . PHE B 1 93  ? -51.888 5.218   -37.297 1.00 21.55 ? 268 PHE B CE2 1 
ATOM   3287 C  CZ  . PHE B 1 93  ? -53.061 5.808   -37.724 1.00 17.78 ? 268 PHE B CZ  1 
ATOM   3288 N  N   . ASN B 1 94  ? -49.297 0.913   -41.217 1.00 17.36 ? 269 ASN B N   1 
ATOM   3289 C  CA  . ASN B 1 94  ? -48.446 -0.100  -41.878 1.00 18.68 ? 269 ASN B CA  1 
ATOM   3290 C  C   . ASN B 1 94  ? -47.753 -1.011  -40.855 1.00 17.09 ? 269 ASN B C   1 
ATOM   3291 O  O   . ASN B 1 94  ? -46.540 -1.019  -40.761 1.00 17.86 ? 269 ASN B O   1 
ATOM   3292 C  CB  . ASN B 1 94  ? -47.396 0.616   -42.757 1.00 17.86 ? 269 ASN B CB  1 
ATOM   3293 C  CG  . ASN B 1 94  ? -46.661 -0.337  -43.702 1.00 19.61 ? 269 ASN B CG  1 
ATOM   3294 O  OD1 . ASN B 1 94  ? -47.205 -1.392  -44.120 1.00 18.19 ? 269 ASN B OD1 1 
ATOM   3295 N  ND2 . ASN B 1 94  ? -45.422 0.046   -44.069 1.00 17.17 ? 269 ASN B ND2 1 
ATOM   3296 N  N   . GLY B 1 95  ? -48.549 -1.640  -39.993 1.00 18.05 ? 270 GLY B N   1 
ATOM   3297 C  CA  . GLY B 1 95  ? -48.059 -2.598  -38.964 1.00 17.70 ? 270 GLY B CA  1 
ATOM   3298 C  C   . GLY B 1 95  ? -47.405 -2.087  -37.701 1.00 18.95 ? 270 GLY B C   1 
ATOM   3299 O  O   . GLY B 1 95  ? -47.229 -0.872  -37.509 1.00 19.48 ? 270 GLY B O   1 
ATOM   3300 N  N   . ASP B 1 96  ? -46.989 -3.024  -36.823 1.00 16.96 ? 271 ASP B N   1 
ATOM   3301 C  CA  . ASP B 1 96  ? -46.301 -2.704  -35.596 1.00 17.12 ? 271 ASP B CA  1 
ATOM   3302 C  C   . ASP B 1 96  ? -47.045 -1.677  -34.730 1.00 17.53 ? 271 ASP B C   1 
ATOM   3303 O  O   . ASP B 1 96  ? -46.472 -0.624  -34.321 1.00 15.85 ? 271 ASP B O   1 
ATOM   3304 C  CB  . ASP B 1 96  ? -44.851 -2.277  -35.822 1.00 15.49 ? 271 ASP B CB  1 
ATOM   3305 C  CG  . ASP B 1 96  ? -43.896 -3.494  -36.104 1.00 16.06 ? 271 ASP B CG  1 
ATOM   3306 O  OD1 . ASP B 1 96  ? -44.362 -4.604  -36.415 1.00 13.93 ? 271 ASP B OD1 1 
ATOM   3307 O  OD2 . ASP B 1 96  ? -42.669 -3.287  -35.975 1.00 11.69 ? 271 ASP B OD2 1 
ATOM   3308 N  N   . PHE B 1 97  ? -48.326 -1.970  -34.536 1.00 18.42 ? 272 PHE B N   1 
ATOM   3309 C  CA  . PHE B 1 97  ? -49.220 -1.164  -33.644 1.00 19.85 ? 272 PHE B CA  1 
ATOM   3310 C  C   . PHE B 1 97  ? -48.958 -1.462  -32.174 1.00 19.43 ? 272 PHE B C   1 
ATOM   3311 O  O   . PHE B 1 97  ? -49.210 -0.609  -31.280 1.00 19.33 ? 272 PHE B O   1 
ATOM   3312 C  CB  . PHE B 1 97  ? -50.691 -1.526  -33.912 1.00 19.50 ? 272 PHE B CB  1 
ATOM   3313 C  CG  . PHE B 1 97  ? -50.997 -1.883  -35.350 1.00 20.05 ? 272 PHE B CG  1 
ATOM   3314 C  CD1 . PHE B 1 97  ? -50.898 -0.908  -36.366 1.00 18.66 ? 272 PHE B CD1 1 
ATOM   3315 C  CD2 . PHE B 1 97  ? -51.461 -3.171  -35.676 1.00 19.05 ? 272 PHE B CD2 1 
ATOM   3316 C  CE1 . PHE B 1 97  ? -51.185 -1.222  -37.722 1.00 17.73 ? 272 PHE B CE1 1 
ATOM   3317 C  CE2 . PHE B 1 97  ? -51.747 -3.507  -37.009 1.00 21.73 ? 272 PHE B CE2 1 
ATOM   3318 C  CZ  . PHE B 1 97  ? -51.622 -2.508  -38.059 1.00 19.04 ? 272 PHE B CZ  1 
ATOM   3319 N  N   . VAL B 1 98  ? -48.469 -2.675  -31.903 1.00 19.11 ? 273 VAL B N   1 
ATOM   3320 C  CA  . VAL B 1 98  ? -48.238 -3.077  -30.523 1.00 19.00 ? 273 VAL B CA  1 
ATOM   3321 C  C   . VAL B 1 98  ? -46.793 -3.431  -30.218 1.00 21.28 ? 273 VAL B C   1 
ATOM   3322 O  O   . VAL B 1 98  ? -45.938 -3.446  -31.163 1.00 20.83 ? 273 VAL B O   1 
ATOM   3323 C  CB  . VAL B 1 98  ? -49.112 -4.283  -30.145 1.00 19.79 ? 273 VAL B CB  1 
ATOM   3324 C  CG1 . VAL B 1 98  ? -50.590 -3.929  -30.344 1.00 19.52 ? 273 VAL B CG1 1 
ATOM   3325 C  CG2 . VAL B 1 98  ? -48.724 -5.540  -30.996 1.00 16.02 ? 273 VAL B CG2 1 
ATOM   3326 N  N   . ASP B 1 99  ? -46.556 -3.758  -28.919 1.00 19.64 ? 274 ASP B N   1 
ATOM   3327 C  CA  . ASP B 1 99  ? -45.235 -4.063  -28.323 1.00 21.87 ? 274 ASP B CA  1 
ATOM   3328 C  C   . ASP B 1 99  ? -44.422 -2.798  -28.064 1.00 21.41 ? 274 ASP B C   1 
ATOM   3329 O  O   . ASP B 1 99  ? -44.631 -1.780  -28.733 1.00 22.03 ? 274 ASP B O   1 
ATOM   3330 C  CB  . ASP B 1 99  ? -44.363 -5.038  -29.180 1.00 19.76 ? 274 ASP B CB  1 
ATOM   3331 C  CG  . ASP B 1 99  ? -44.832 -6.492  -29.109 1.00 23.78 ? 274 ASP B CG  1 
ATOM   3332 O  OD1 . ASP B 1 99  ? -45.609 -6.822  -28.190 1.00 20.74 ? 274 ASP B OD1 1 
ATOM   3333 O  OD2 . ASP B 1 99  ? -44.461 -7.298  -30.025 1.00 24.00 ? 274 ASP B OD2 1 
ATOM   3334 N  N   . ARG B 1 100 ? -43.498 -2.908  -27.120 1.00 23.00 ? 275 ARG B N   1 
ATOM   3335 C  CA  . ARG B 1 100 ? -42.575 -1.874  -26.683 1.00 25.46 ? 275 ARG B CA  1 
ATOM   3336 C  C   . ARG B 1 100 ? -43.262 -0.752  -25.883 1.00 25.67 ? 275 ARG B C   1 
ATOM   3337 O  O   . ARG B 1 100 ? -42.962 -0.594  -24.707 1.00 27.14 ? 275 ARG B O   1 
ATOM   3338 C  CB  . ARG B 1 100 ? -41.752 -1.339  -27.839 1.00 26.63 ? 275 ARG B CB  1 
ATOM   3339 C  CG  . ARG B 1 100 ? -40.940 -2.457  -28.520 1.00 30.22 ? 275 ARG B CG  1 
ATOM   3340 C  CD  . ARG B 1 100 ? -39.489 -2.016  -28.705 1.00 33.52 ? 275 ARG B CD  1 
ATOM   3341 N  NE  . ARG B 1 100 ? -38.658 -3.042  -29.338 1.00 35.27 ? 275 ARG B NE  1 
ATOM   3342 C  CZ  . ARG B 1 100 ? -38.841 -3.491  -30.581 1.00 35.99 ? 275 ARG B CZ  1 
ATOM   3343 N  NH1 . ARG B 1 100 ? -39.844 -3.026  -31.329 1.00 37.60 ? 275 ARG B NH1 1 
ATOM   3344 N  NH2 . ARG B 1 100 ? -38.030 -4.422  -31.084 1.00 36.98 ? 275 ARG B NH2 1 
ATOM   3345 N  N   . GLY B 1 101 ? -44.198 -0.031  -26.479 1.00 24.84 ? 276 GLY B N   1 
ATOM   3346 C  CA  . GLY B 1 101 ? -44.896 1.023   -25.742 1.00 25.44 ? 276 GLY B CA  1 
ATOM   3347 C  C   . GLY B 1 101 ? -45.928 0.386   -24.827 1.00 25.14 ? 276 GLY B C   1 
ATOM   3348 O  O   . GLY B 1 101 ? -46.469 -0.669  -25.122 1.00 24.29 ? 276 GLY B O   1 
ATOM   3349 N  N   . SER B 1 102 ? -46.282 1.084   -23.766 1.00 25.72 ? 277 SER B N   1 
ATOM   3350 C  CA  . SER B 1 102 ? -47.066 0.451   -22.705 1.00 26.46 ? 277 SER B CA  1 
ATOM   3351 C  C   . SER B 1 102 ? -48.516 0.815   -22.778 1.00 25.96 ? 277 SER B C   1 
ATOM   3352 O  O   . SER B 1 102 ? -49.271 0.525   -21.843 1.00 26.60 ? 277 SER B O   1 
ATOM   3353 C  CB  . SER B 1 102 ? -46.475 0.789   -21.324 1.00 26.31 ? 277 SER B CB  1 
ATOM   3354 O  OG  . SER B 1 102 ? -45.215 0.123   -21.144 1.00 30.69 ? 277 SER B OG  1 
ATOM   3355 N  N   . PHE B 1 103 ? -48.913 1.444   -23.888 1.00 23.65 ? 278 PHE B N   1 
ATOM   3356 C  CA  . PHE B 1 103 ? -50.319 1.659   -24.164 1.00 22.61 ? 278 PHE B CA  1 
ATOM   3357 C  C   . PHE B 1 103 ? -50.759 0.893   -25.393 1.00 20.98 ? 278 PHE B C   1 
ATOM   3358 O  O   . PHE B 1 103 ? -51.583 1.357   -26.187 1.00 20.58 ? 278 PHE B O   1 
ATOM   3359 C  CB  . PHE B 1 103 ? -50.606 3.153   -24.262 1.00 21.61 ? 278 PHE B CB  1 
ATOM   3360 C  CG  . PHE B 1 103 ? -49.938 3.959   -23.159 1.00 24.76 ? 278 PHE B CG  1 
ATOM   3361 C  CD1 . PHE B 1 103 ? -50.533 4.085   -21.889 1.00 24.02 ? 278 PHE B CD1 1 
ATOM   3362 C  CD2 . PHE B 1 103 ? -48.742 4.598   -23.383 1.00 21.25 ? 278 PHE B CD2 1 
ATOM   3363 C  CE1 . PHE B 1 103 ? -49.916 4.836   -20.897 1.00 20.77 ? 278 PHE B CE1 1 
ATOM   3364 C  CE2 . PHE B 1 103 ? -48.109 5.348   -22.372 1.00 20.95 ? 278 PHE B CE2 1 
ATOM   3365 C  CZ  . PHE B 1 103 ? -48.701 5.457   -21.121 1.00 22.42 ? 278 PHE B CZ  1 
ATOM   3366 N  N   . SER B 1 104 ? -50.160 -0.280  -25.581 1.00 21.00 ? 279 SER B N   1 
ATOM   3367 C  CA  . SER B 1 104 ? -50.484 -1.121  -26.764 1.00 19.84 ? 279 SER B CA  1 
ATOM   3368 C  C   . SER B 1 104 ? -51.927 -1.487  -26.884 1.00 18.60 ? 279 SER B C   1 
ATOM   3369 O  O   . SER B 1 104 ? -52.478 -1.511  -27.974 1.00 17.70 ? 279 SER B O   1 
ATOM   3370 C  CB  . SER B 1 104 ? -49.633 -2.413  -26.842 1.00 19.32 ? 279 SER B CB  1 
ATOM   3371 O  OG  . SER B 1 104 ? -48.270 -2.098  -27.047 1.00 19.73 ? 279 SER B OG  1 
ATOM   3372 N  N   . VAL B 1 105 ? -52.570 -1.822  -25.764 1.00 20.52 ? 280 VAL B N   1 
ATOM   3373 C  CA  . VAL B 1 105 ? -53.989 -2.248  -25.847 1.00 19.42 ? 280 VAL B CA  1 
ATOM   3374 C  C   . VAL B 1 105 ? -54.840 -1.058  -26.274 1.00 18.99 ? 280 VAL B C   1 
ATOM   3375 O  O   . VAL B 1 105 ? -55.809 -1.213  -26.987 1.00 18.33 ? 280 VAL B O   1 
ATOM   3376 C  CB  . VAL B 1 105 ? -54.537 -2.829  -24.462 1.00 19.43 ? 280 VAL B CB  1 
ATOM   3377 C  CG1 . VAL B 1 105 ? -56.111 -2.742  -24.425 1.00 20.96 ? 280 VAL B CG1 1 
ATOM   3378 C  CG2 . VAL B 1 105 ? -54.002 -4.225  -24.184 1.00 19.99 ? 280 VAL B CG2 1 
ATOM   3379 N  N   . GLU B 1 106 ? -54.470 0.148   -25.816 1.00 20.63 ? 281 GLU B N   1 
ATOM   3380 C  CA  . GLU B 1 106 ? -55.245 1.345   -26.166 1.00 21.42 ? 281 GLU B CA  1 
ATOM   3381 C  C   . GLU B 1 106 ? -55.092 1.669   -27.666 1.00 20.86 ? 281 GLU B C   1 
ATOM   3382 O  O   . GLU B 1 106 ? -56.079 1.886   -28.381 1.00 21.64 ? 281 GLU B O   1 
ATOM   3383 C  CB  . GLU B 1 106 ? -54.844 2.526   -25.265 1.00 22.23 ? 281 GLU B CB  1 
ATOM   3384 C  CG  . GLU B 1 106 ? -55.327 2.351   -23.802 1.00 25.43 ? 281 GLU B CG  1 
ATOM   3385 C  CD  . GLU B 1 106 ? -54.454 1.390   -23.003 1.00 31.58 ? 281 GLU B CD  1 
ATOM   3386 O  OE1 . GLU B 1 106 ? -53.400 0.922   -23.539 1.00 29.47 ? 281 GLU B OE1 1 
ATOM   3387 O  OE2 . GLU B 1 106 ? -54.793 1.117   -21.816 1.00 35.99 ? 281 GLU B OE2 1 
ATOM   3388 N  N   . VAL B 1 107 ? -53.849 1.658   -28.145 1.00 19.97 ? 282 VAL B N   1 
ATOM   3389 C  CA  . VAL B 1 107 ? -53.630 1.781   -29.607 1.00 18.96 ? 282 VAL B CA  1 
ATOM   3390 C  C   . VAL B 1 107 ? -54.487 0.771   -30.398 1.00 17.62 ? 282 VAL B C   1 
ATOM   3391 O  O   . VAL B 1 107 ? -55.211 1.130   -31.328 1.00 17.65 ? 282 VAL B O   1 
ATOM   3392 C  CB  . VAL B 1 107 ? -52.103 1.614   -30.035 1.00 17.72 ? 282 VAL B CB  1 
ATOM   3393 C  CG1 . VAL B 1 107 ? -52.004 1.517   -31.559 1.00 15.79 ? 282 VAL B CG1 1 
ATOM   3394 C  CG2 . VAL B 1 107 ? -51.223 2.754   -29.507 1.00 17.53 ? 282 VAL B CG2 1 
ATOM   3395 N  N   . ILE B 1 108 ? -54.390 -0.520  -30.072 1.00 19.49 ? 283 ILE B N   1 
ATOM   3396 C  CA  . ILE B 1 108 ? -54.991 -1.534  -30.961 1.00 19.60 ? 283 ILE B CA  1 
ATOM   3397 C  C   . ILE B 1 108 ? -56.553 -1.506  -31.069 1.00 20.02 ? 283 ILE B C   1 
ATOM   3398 O  O   . ILE B 1 108 ? -57.113 -1.659  -32.124 1.00 21.13 ? 283 ILE B O   1 
ATOM   3399 C  CB  . ILE B 1 108 ? -54.413 -2.996  -30.657 1.00 19.15 ? 283 ILE B CB  1 
ATOM   3400 C  CG1 . ILE B 1 108 ? -54.570 -3.955  -31.855 1.00 18.92 ? 283 ILE B CG1 1 
ATOM   3401 C  CG2 . ILE B 1 108 ? -54.957 -3.559  -29.336 1.00 20.08 ? 283 ILE B CG2 1 
ATOM   3402 C  CD1 . ILE B 1 108 ? -54.055 -3.393  -33.285 1.00 17.78 ? 283 ILE B CD1 1 
ATOM   3403 N  N   . LEU B 1 109 ? -57.252 -1.358  -29.959 1.00 21.49 ? 284 LEU B N   1 
ATOM   3404 C  CA  . LEU B 1 109 ? -58.697 -1.326  -29.976 1.00 20.95 ? 284 LEU B CA  1 
ATOM   3405 C  C   . LEU B 1 109 ? -59.194 -0.007  -30.581 1.00 20.65 ? 284 LEU B C   1 
ATOM   3406 O  O   . LEU B 1 109 ? -60.222 0.013   -31.266 1.00 21.47 ? 284 LEU B O   1 
ATOM   3407 C  CB  . LEU B 1 109 ? -59.228 -1.533  -28.534 1.00 21.23 ? 284 LEU B CB  1 
ATOM   3408 C  CG  . LEU B 1 109 ? -59.053 -2.956  -27.958 1.00 21.04 ? 284 LEU B CG  1 
ATOM   3409 C  CD1 . LEU B 1 109 ? -59.429 -3.056  -26.444 1.00 21.23 ? 284 LEU B CD1 1 
ATOM   3410 C  CD2 . LEU B 1 109 ? -59.849 -3.969  -28.775 1.00 27.06 ? 284 LEU B CD2 1 
ATOM   3411 N  N   . THR B 1 110 ? -58.446 1.085   -30.371 1.00 20.47 ? 285 THR B N   1 
ATOM   3412 C  CA  . THR B 1 110 ? -58.755 2.321   -31.105 1.00 19.79 ? 285 THR B CA  1 
ATOM   3413 C  C   . THR B 1 110 ? -58.665 2.097   -32.615 1.00 19.56 ? 285 THR B C   1 
ATOM   3414 O  O   . THR B 1 110 ? -59.566 2.489   -33.364 1.00 17.51 ? 285 THR B O   1 
ATOM   3415 C  CB  . THR B 1 110 ? -57.808 3.460   -30.698 1.00 18.54 ? 285 THR B CB  1 
ATOM   3416 O  OG1 . THR B 1 110 ? -57.934 3.678   -29.288 1.00 21.58 ? 285 THR B OG1 1 
ATOM   3417 C  CG2 . THR B 1 110 ? -58.154 4.765   -31.473 1.00 20.55 ? 285 THR B CG2 1 
ATOM   3418 N  N   . LEU B 1 111 ? -57.559 1.462   -33.060 1.00 19.22 ? 286 LEU B N   1 
ATOM   3419 C  CA  . LEU B 1 111 ? -57.411 1.174   -34.496 1.00 18.23 ? 286 LEU B CA  1 
ATOM   3420 C  C   . LEU B 1 111 ? -58.472 0.257   -35.006 1.00 18.58 ? 286 LEU B C   1 
ATOM   3421 O  O   . LEU B 1 111 ? -59.027 0.491   -36.088 1.00 18.86 ? 286 LEU B O   1 
ATOM   3422 C  CB  . LEU B 1 111 ? -56.008 0.590   -34.820 1.00 16.90 ? 286 LEU B CB  1 
ATOM   3423 C  CG  . LEU B 1 111 ? -54.836 1.552   -34.590 1.00 18.15 ? 286 LEU B CG  1 
ATOM   3424 C  CD1 . LEU B 1 111 ? -53.469 0.828   -34.960 1.00 17.79 ? 286 LEU B CD1 1 
ATOM   3425 C  CD2 . LEU B 1 111 ? -55.053 2.868   -35.383 1.00 14.80 ? 286 LEU B CD2 1 
ATOM   3426 N  N   . PHE B 1 112 ? -58.734 -0.815  -34.254 1.00 19.82 ? 287 PHE B N   1 
ATOM   3427 C  CA  . PHE B 1 112 ? -59.760 -1.771  -34.684 1.00 21.28 ? 287 PHE B CA  1 
ATOM   3428 C  C   . PHE B 1 112 ? -61.145 -1.081  -34.680 1.00 21.54 ? 287 PHE B C   1 
ATOM   3429 O  O   . PHE B 1 112 ? -61.991 -1.329  -35.540 1.00 21.10 ? 287 PHE B O   1 
ATOM   3430 C  CB  . PHE B 1 112 ? -59.799 -2.980  -33.692 1.00 21.68 ? 287 PHE B CB  1 
ATOM   3431 C  CG  . PHE B 1 112 ? -58.719 -4.034  -33.924 1.00 23.50 ? 287 PHE B CG  1 
ATOM   3432 C  CD1 . PHE B 1 112 ? -57.984 -4.083  -35.120 1.00 26.16 ? 287 PHE B CD1 1 
ATOM   3433 C  CD2 . PHE B 1 112 ? -58.455 -5.010  -32.948 1.00 21.03 ? 287 PHE B CD2 1 
ATOM   3434 C  CE1 . PHE B 1 112 ? -57.022 -5.093  -35.327 1.00 21.23 ? 287 PHE B CE1 1 
ATOM   3435 C  CE2 . PHE B 1 112 ? -57.500 -5.985  -33.160 1.00 19.92 ? 287 PHE B CE2 1 
ATOM   3436 C  CZ  . PHE B 1 112 ? -56.766 -6.015  -34.325 1.00 21.08 ? 287 PHE B CZ  1 
ATOM   3437 N  N   . GLY B 1 113 ? -61.397 -0.233  -33.675 1.00 22.93 ? 288 GLY B N   1 
ATOM   3438 C  CA  . GLY B 1 113 ? -62.686 0.495   -33.690 1.00 22.46 ? 288 GLY B CA  1 
ATOM   3439 C  C   . GLY B 1 113 ? -62.835 1.334   -34.959 1.00 22.46 ? 288 GLY B C   1 
ATOM   3440 O  O   . GLY B 1 113 ? -63.869 1.314   -35.585 1.00 23.14 ? 288 GLY B O   1 
ATOM   3441 N  N   . PHE B 1 114 ? -61.794 2.076   -35.359 1.00 22.52 ? 289 PHE B N   1 
ATOM   3442 C  CA  . PHE B 1 114 ? -61.889 2.845   -36.602 1.00 22.94 ? 289 PHE B CA  1 
ATOM   3443 C  C   . PHE B 1 114 ? -61.986 1.950   -37.813 1.00 22.43 ? 289 PHE B C   1 
ATOM   3444 O  O   . PHE B 1 114 ? -62.559 2.353   -38.788 1.00 23.23 ? 289 PHE B O   1 
ATOM   3445 C  CB  . PHE B 1 114 ? -60.702 3.840   -36.767 1.00 22.37 ? 289 PHE B CB  1 
ATOM   3446 C  CG  . PHE B 1 114 ? -60.907 5.106   -36.062 1.00 23.23 ? 289 PHE B CG  1 
ATOM   3447 C  CD1 . PHE B 1 114 ? -62.023 5.883   -36.361 1.00 23.92 ? 289 PHE B CD1 1 
ATOM   3448 C  CD2 . PHE B 1 114 ? -60.029 5.511   -35.064 1.00 25.50 ? 289 PHE B CD2 1 
ATOM   3449 C  CE1 . PHE B 1 114 ? -62.237 7.071   -35.697 1.00 25.74 ? 289 PHE B CE1 1 
ATOM   3450 C  CE2 . PHE B 1 114 ? -60.235 6.696   -34.374 1.00 25.53 ? 289 PHE B CE2 1 
ATOM   3451 C  CZ  . PHE B 1 114 ? -61.346 7.475   -34.693 1.00 26.65 ? 289 PHE B CZ  1 
ATOM   3452 N  N   . LYS B 1 115 ? -61.370 0.754   -37.789 1.00 22.67 ? 290 LYS B N   1 
ATOM   3453 C  CA  . LYS B 1 115 ? -61.490 -0.177  -38.923 1.00 23.28 ? 290 LYS B CA  1 
ATOM   3454 C  C   . LYS B 1 115 ? -62.964 -0.639  -39.105 1.00 24.55 ? 290 LYS B C   1 
ATOM   3455 O  O   . LYS B 1 115 ? -63.476 -0.700  -40.214 1.00 23.26 ? 290 LYS B O   1 
ATOM   3456 C  CB  . LYS B 1 115 ? -60.563 -1.392  -38.719 1.00 23.36 ? 290 LYS B CB  1 
ATOM   3457 C  CG  . LYS B 1 115 ? -60.603 -2.476  -39.806 1.00 26.80 ? 290 LYS B CG  1 
ATOM   3458 C  CD  . LYS B 1 115 ? -60.729 -1.907  -41.206 1.00 28.70 ? 290 LYS B CD  1 
ATOM   3459 C  CE  . LYS B 1 115 ? -60.444 -2.929  -42.325 1.00 29.30 ? 290 LYS B CE  1 
ATOM   3460 N  NZ  . LYS B 1 115 ? -60.341 -2.230  -43.657 1.00 30.51 ? 290 LYS B NZ  1 
ATOM   3461 N  N   . LEU B 1 116 ? -63.636 -0.962  -37.990 1.00 25.26 ? 291 LEU B N   1 
ATOM   3462 C  CA  . LEU B 1 116 ? -65.072 -1.296  -38.027 1.00 27.20 ? 291 LEU B CA  1 
ATOM   3463 C  C   . LEU B 1 116 ? -65.917 -0.064  -38.452 1.00 28.21 ? 291 LEU B C   1 
ATOM   3464 O  O   . LEU B 1 116 ? -66.851 -0.200  -39.240 1.00 29.30 ? 291 LEU B O   1 
ATOM   3465 C  CB  . LEU B 1 116 ? -65.533 -1.790  -36.646 1.00 26.78 ? 291 LEU B CB  1 
ATOM   3466 C  CG  . LEU B 1 116 ? -64.935 -3.104  -36.161 1.00 25.51 ? 291 LEU B CG  1 
ATOM   3467 C  CD1 . LEU B 1 116 ? -65.330 -3.373  -34.701 1.00 27.02 ? 291 LEU B CD1 1 
ATOM   3468 C  CD2 . LEU B 1 116 ? -65.417 -4.198  -37.093 1.00 27.66 ? 291 LEU B CD2 1 
ATOM   3469 N  N   . LEU B 1 117 ? -65.563 1.129   -37.976 1.00 28.31 ? 292 LEU B N   1 
ATOM   3470 C  CA  . LEU B 1 117 ? -66.321 2.354   -38.387 1.00 29.60 ? 292 LEU B CA  1 
ATOM   3471 C  C   . LEU B 1 117 ? -66.185 2.716   -39.860 1.00 29.69 ? 292 LEU B C   1 
ATOM   3472 O  O   . LEU B 1 117 ? -67.185 2.964   -40.544 1.00 29.09 ? 292 LEU B O   1 
ATOM   3473 C  CB  . LEU B 1 117 ? -65.955 3.556   -37.519 1.00 28.41 ? 292 LEU B CB  1 
ATOM   3474 C  CG  . LEU B 1 117 ? -66.784 4.841   -37.590 1.00 31.72 ? 292 LEU B CG  1 
ATOM   3475 C  CD1 . LEU B 1 117 ? -68.297 4.595   -37.330 1.00 32.58 ? 292 LEU B CD1 1 
ATOM   3476 C  CD2 . LEU B 1 117 ? -66.231 5.882   -36.616 1.00 30.30 ? 292 LEU B CD2 1 
ATOM   3477 N  N   . TYR B 1 118 ? -64.962 2.753   -40.375 1.00 29.86 ? 293 TYR B N   1 
ATOM   3478 C  CA  . TYR B 1 118 ? -64.780 3.010   -41.792 1.00 30.81 ? 293 TYR B CA  1 
ATOM   3479 C  C   . TYR B 1 118 ? -64.015 1.865   -42.461 1.00 32.48 ? 293 TYR B C   1 
ATOM   3480 O  O   . TYR B 1 118 ? -62.850 2.048   -42.849 1.00 32.39 ? 293 TYR B O   1 
ATOM   3481 C  CB  . TYR B 1 118 ? -64.001 4.326   -41.997 1.00 30.43 ? 293 TYR B CB  1 
ATOM   3482 C  CG  . TYR B 1 118 ? -64.564 5.484   -41.215 1.00 30.77 ? 293 TYR B CG  1 
ATOM   3483 C  CD1 . TYR B 1 118 ? -65.721 6.134   -41.633 1.00 33.35 ? 293 TYR B CD1 1 
ATOM   3484 C  CD2 . TYR B 1 118 ? -63.954 5.925   -40.068 1.00 30.70 ? 293 TYR B CD2 1 
ATOM   3485 C  CE1 . TYR B 1 118 ? -66.244 7.182   -40.910 1.00 34.14 ? 293 TYR B CE1 1 
ATOM   3486 C  CE2 . TYR B 1 118 ? -64.470 6.970   -39.333 1.00 34.63 ? 293 TYR B CE2 1 
ATOM   3487 C  CZ  . TYR B 1 118 ? -65.626 7.598   -39.773 1.00 34.38 ? 293 TYR B CZ  1 
ATOM   3488 O  OH  . TYR B 1 118 ? -66.145 8.646   -39.050 1.00 37.57 ? 293 TYR B OH  1 
ATOM   3489 N  N   . PRO B 1 119 ? -64.664 0.701   -42.648 1.00 33.20 ? 294 PRO B N   1 
ATOM   3490 C  CA  . PRO B 1 119 ? -64.004 -0.476  -43.294 1.00 33.73 ? 294 PRO B CA  1 
ATOM   3491 C  C   . PRO B 1 119 ? -63.368 -0.214  -44.684 1.00 34.59 ? 294 PRO B C   1 
ATOM   3492 O  O   . PRO B 1 119 ? -62.307 -0.789  -45.012 1.00 34.93 ? 294 PRO B O   1 
ATOM   3493 C  CB  . PRO B 1 119 ? -65.148 -1.518  -43.395 1.00 35.06 ? 294 PRO B CB  1 
ATOM   3494 C  CG  . PRO B 1 119 ? -66.439 -0.701  -43.276 1.00 32.45 ? 294 PRO B CG  1 
ATOM   3495 C  CD  . PRO B 1 119 ? -66.125 0.523   -42.487 1.00 32.49 ? 294 PRO B CD  1 
ATOM   3496 N  N   . ASP B 1 120 ? -63.958 0.682   -45.476 1.00 34.43 ? 295 ASP B N   1 
ATOM   3497 C  CA  . ASP B 1 120 ? -63.357 1.044   -46.779 1.00 35.55 ? 295 ASP B CA  1 
ATOM   3498 C  C   . ASP B 1 120 ? -62.316 2.178   -46.833 1.00 33.91 ? 295 ASP B C   1 
ATOM   3499 O  O   . ASP B 1 120 ? -61.750 2.459   -47.881 1.00 34.15 ? 295 ASP B O   1 
ATOM   3500 C  CB  . ASP B 1 120 ? -64.444 1.321   -47.805 1.00 36.70 ? 295 ASP B CB  1 
ATOM   3501 C  CG  . ASP B 1 120 ? -65.238 0.095   -48.107 1.00 41.93 ? 295 ASP B CG  1 
ATOM   3502 O  OD1 . ASP B 1 120 ? -64.628 -0.900  -48.581 1.00 47.06 ? 295 ASP B OD1 1 
ATOM   3503 O  OD2 . ASP B 1 120 ? -66.456 0.116   -47.831 1.00 48.79 ? 295 ASP B OD2 1 
ATOM   3504 N  N   . HIS B 1 121 ? -62.050 2.847   -45.734 1.00 32.80 ? 296 HIS B N   1 
ATOM   3505 C  CA  . HIS B 1 121 ? -61.106 3.954   -45.819 1.00 31.25 ? 296 HIS B CA  1 
ATOM   3506 C  C   . HIS B 1 121 ? -60.128 3.914   -44.677 1.00 29.78 ? 296 HIS B C   1 
ATOM   3507 O  O   . HIS B 1 121 ? -59.423 4.876   -44.428 1.00 29.95 ? 296 HIS B O   1 
ATOM   3508 C  CB  . HIS B 1 121 ? -61.873 5.285   -45.820 1.00 31.62 ? 296 HIS B CB  1 
ATOM   3509 C  CG  . HIS B 1 121 ? -62.819 5.407   -46.971 1.00 32.95 ? 296 HIS B CG  1 
ATOM   3510 N  ND1 . HIS B 1 121 ? -64.109 4.940   -46.923 1.00 35.39 ? 296 HIS B ND1 1 
ATOM   3511 C  CD2 . HIS B 1 121 ? -62.640 5.894   -48.219 1.00 34.00 ? 296 HIS B CD2 1 
ATOM   3512 C  CE1 . HIS B 1 121 ? -64.695 5.152   -48.086 1.00 36.40 ? 296 HIS B CE1 1 
ATOM   3513 N  NE2 . HIS B 1 121 ? -63.822 5.731   -48.890 1.00 37.41 ? 296 HIS B NE2 1 
ATOM   3514 N  N   . PHE B 1 122 ? -60.131 2.822   -43.926 1.00 28.15 ? 297 PHE B N   1 
ATOM   3515 C  CA  . PHE B 1 122 ? -59.269 2.736   -42.781 1.00 26.45 ? 297 PHE B CA  1 
ATOM   3516 C  C   . PHE B 1 122 ? -58.632 1.361   -42.882 1.00 25.66 ? 297 PHE B C   1 
ATOM   3517 O  O   . PHE B 1 122 ? -59.326 0.337   -42.781 1.00 25.80 ? 297 PHE B O   1 
ATOM   3518 C  CB  . PHE B 1 122 ? -59.991 2.924   -41.450 1.00 25.17 ? 297 PHE B CB  1 
ATOM   3519 C  CG  . PHE B 1 122 ? -59.046 3.180   -40.295 1.00 25.49 ? 297 PHE B CG  1 
ATOM   3520 C  CD1 . PHE B 1 122 ? -58.603 4.473   -40.025 1.00 24.63 ? 297 PHE B CD1 1 
ATOM   3521 C  CD2 . PHE B 1 122 ? -58.575 2.131   -39.488 1.00 22.30 ? 297 PHE B CD2 1 
ATOM   3522 C  CE1 . PHE B 1 122 ? -57.714 4.727   -38.989 1.00 21.98 ? 297 PHE B CE1 1 
ATOM   3523 C  CE2 . PHE B 1 122 ? -57.705 2.390   -38.445 1.00 18.47 ? 297 PHE B CE2 1 
ATOM   3524 C  CZ  . PHE B 1 122 ? -57.264 3.656   -38.183 1.00 22.28 ? 297 PHE B CZ  1 
ATOM   3525 N  N   . HIS B 1 123 ? -57.321 1.365   -43.093 1.00 23.30 ? 298 HIS B N   1 
ATOM   3526 C  CA  . HIS B 1 123 ? -56.579 0.159   -43.452 1.00 22.53 ? 298 HIS B CA  1 
ATOM   3527 C  C   . HIS B 1 123 ? -55.459 -0.096  -42.496 1.00 21.11 ? 298 HIS B C   1 
ATOM   3528 O  O   . HIS B 1 123 ? -54.704 0.847   -42.101 1.00 19.93 ? 298 HIS B O   1 
ATOM   3529 C  CB  . HIS B 1 123 ? -55.996 0.255   -44.862 1.00 22.71 ? 298 HIS B CB  1 
ATOM   3530 C  CG  . HIS B 1 123 ? -57.014 0.530   -45.932 1.00 24.51 ? 298 HIS B CG  1 
ATOM   3531 N  ND1 . HIS B 1 123 ? -57.205 1.783   -46.497 1.00 29.05 ? 298 HIS B ND1 1 
ATOM   3532 C  CD2 . HIS B 1 123 ? -57.917 -0.280  -46.517 1.00 21.52 ? 298 HIS B CD2 1 
ATOM   3533 C  CE1 . HIS B 1 123 ? -58.142 1.709   -47.424 1.00 24.27 ? 298 HIS B CE1 1 
ATOM   3534 N  NE2 . HIS B 1 123 ? -58.601 0.471   -47.443 1.00 27.70 ? 298 HIS B NE2 1 
ATOM   3535 N  N   . LEU B 1 124 ? -55.363 -1.383  -42.127 1.00 19.37 ? 299 LEU B N   1 
ATOM   3536 C  CA  . LEU B 1 124 ? -54.371 -1.879  -41.222 1.00 19.09 ? 299 LEU B CA  1 
ATOM   3537 C  C   . LEU B 1 124 ? -53.622 -2.997  -41.923 1.00 19.76 ? 299 LEU B C   1 
ATOM   3538 O  O   . LEU B 1 124 ? -54.247 -3.897  -42.505 1.00 21.14 ? 299 LEU B O   1 
ATOM   3539 C  CB  . LEU B 1 124 ? -55.020 -2.423  -39.949 1.00 19.27 ? 299 LEU B CB  1 
ATOM   3540 C  CG  . LEU B 1 124 ? -55.958 -1.378  -39.324 1.00 19.70 ? 299 LEU B CG  1 
ATOM   3541 C  CD1 . LEU B 1 124 ? -56.821 -2.095  -38.280 1.00 17.79 ? 299 LEU B CD1 1 
ATOM   3542 C  CD2 . LEU B 1 124 ? -55.055 -0.239  -38.685 1.00 14.16 ? 299 LEU B CD2 1 
ATOM   3543 N  N   . LEU B 1 125 ? -52.293 -2.930  -41.909 1.00 18.43 ? 300 LEU B N   1 
ATOM   3544 C  CA  . LEU B 1 125 ? -51.490 -3.964  -42.559 1.00 18.48 ? 300 LEU B CA  1 
ATOM   3545 C  C   . LEU B 1 125 ? -50.731 -4.641  -41.470 1.00 16.77 ? 300 LEU B C   1 
ATOM   3546 O  O   . LEU B 1 125 ? -50.365 -4.029  -40.521 1.00 17.55 ? 300 LEU B O   1 
ATOM   3547 C  CB  . LEU B 1 125 ? -50.450 -3.360  -43.541 1.00 18.51 ? 300 LEU B CB  1 
ATOM   3548 C  CG  . LEU B 1 125 ? -51.046 -2.535  -44.659 1.00 20.55 ? 300 LEU B CG  1 
ATOM   3549 C  CD1 . LEU B 1 125 ? -49.969 -2.166  -45.724 1.00 19.68 ? 300 LEU B CD1 1 
ATOM   3550 C  CD2 . LEU B 1 125 ? -52.232 -3.218  -45.329 1.00 22.49 ? 300 LEU B CD2 1 
ATOM   3551 N  N   . ARG B 1 126 ? -50.460 -5.925  -41.613 1.00 17.36 ? 301 ARG B N   1 
ATOM   3552 C  CA  . ARG B 1 126 ? -49.729 -6.640  -40.589 1.00 17.49 ? 301 ARG B CA  1 
ATOM   3553 C  C   . ARG B 1 126 ? -48.250 -6.256  -40.448 1.00 17.40 ? 301 ARG B C   1 
ATOM   3554 O  O   . ARG B 1 126 ? -47.554 -6.087  -41.433 1.00 18.44 ? 301 ARG B O   1 
ATOM   3555 C  CB  . ARG B 1 126 ? -49.847 -8.151  -40.845 1.00 15.65 ? 301 ARG B CB  1 
ATOM   3556 C  CG  . ARG B 1 126 ? -49.581 -8.922  -39.608 1.00 16.75 ? 301 ARG B CG  1 
ATOM   3557 C  CD  . ARG B 1 126 ? -49.864 -10.417 -39.851 1.00 21.99 ? 301 ARG B CD  1 
ATOM   3558 N  NE  . ARG B 1 126 ? -49.633 -11.225 -38.641 1.00 18.38 ? 301 ARG B NE  1 
ATOM   3559 C  CZ  . ARG B 1 126 ? -49.776 -12.559 -38.606 1.00 20.23 ? 301 ARG B CZ  1 
ATOM   3560 N  NH1 . ARG B 1 126 ? -50.193 -13.186 -39.681 1.00 17.66 ? 301 ARG B NH1 1 
ATOM   3561 N  NH2 . ARG B 1 126 ? -49.540 -13.251 -37.485 1.00 20.72 ? 301 ARG B NH2 1 
ATOM   3562 N  N   . GLY B 1 127 ? -47.773 -6.132  -39.222 1.00 16.80 ? 302 GLY B N   1 
ATOM   3563 C  CA  . GLY B 1 127 ? -46.344 -5.939  -38.972 1.00 18.41 ? 302 GLY B CA  1 
ATOM   3564 C  C   . GLY B 1 127 ? -45.738 -7.210  -38.369 1.00 18.55 ? 302 GLY B C   1 
ATOM   3565 O  O   . GLY B 1 127 ? -46.492 -8.102  -37.954 1.00 18.96 ? 302 GLY B O   1 
ATOM   3566 N  N   . ASN B 1 128 ? -44.402 -7.284  -38.304 1.00 18.64 ? 303 ASN B N   1 
ATOM   3567 C  CA  . ASN B 1 128 ? -43.753 -8.404  -37.627 1.00 18.54 ? 303 ASN B CA  1 
ATOM   3568 C  C   . ASN B 1 128 ? -44.114 -8.524  -36.127 1.00 20.20 ? 303 ASN B C   1 
ATOM   3569 O  O   . ASN B 1 128 ? -44.045 -9.630  -35.560 1.00 19.75 ? 303 ASN B O   1 
ATOM   3570 C  CB  . ASN B 1 128 ? -42.215 -8.484  -37.849 1.00 16.71 ? 303 ASN B CB  1 
ATOM   3571 C  CG  . ASN B 1 128 ? -41.474 -7.265  -37.309 1.00 14.93 ? 303 ASN B CG  1 
ATOM   3572 O  OD1 . ASN B 1 128 ? -41.875 -6.107  -37.577 1.00 16.40 ? 303 ASN B OD1 1 
ATOM   3573 N  ND2 . ASN B 1 128 ? -40.400 -7.504  -36.554 1.00 15.29 ? 303 ASN B ND2 1 
ATOM   3574 N  N   . HIS B 1 129 ? -44.515 -7.411  -35.506 1.00 19.45 ? 304 HIS B N   1 
ATOM   3575 C  CA  . HIS B 1 129 ? -44.959 -7.451  -34.110 1.00 21.54 ? 304 HIS B CA  1 
ATOM   3576 C  C   . HIS B 1 129 ? -46.433 -7.839  -33.947 1.00 22.21 ? 304 HIS B C   1 
ATOM   3577 O  O   . HIS B 1 129 ? -46.931 -7.902  -32.829 1.00 23.96 ? 304 HIS B O   1 
ATOM   3578 C  CB  . HIS B 1 129 ? -44.645 -6.129  -33.360 1.00 19.58 ? 304 HIS B CB  1 
ATOM   3579 C  CG  . HIS B 1 129 ? -43.213 -6.011  -32.953 1.00 18.31 ? 304 HIS B CG  1 
ATOM   3580 N  ND1 . HIS B 1 129 ? -42.756 -6.326  -31.691 1.00 19.14 ? 304 HIS B ND1 1 
ATOM   3581 C  CD2 . HIS B 1 129 ? -42.124 -5.630  -33.664 1.00 18.97 ? 304 HIS B CD2 1 
ATOM   3582 C  CE1 . HIS B 1 129 ? -41.449 -6.139  -31.638 1.00 21.40 ? 304 HIS B CE1 1 
ATOM   3583 N  NE2 . HIS B 1 129 ? -41.041 -5.714  -32.822 1.00 21.41 ? 304 HIS B NE2 1 
ATOM   3584 N  N   . GLU B 1 130 ? -47.156 -8.035  -35.031 1.00 21.27 ? 305 GLU B N   1 
ATOM   3585 C  CA  . GLU B 1 130 ? -48.490 -8.610  -34.863 1.00 21.76 ? 305 GLU B CA  1 
ATOM   3586 C  C   . GLU B 1 130 ? -48.430 -10.138 -34.961 1.00 20.25 ? 305 GLU B C   1 
ATOM   3587 O  O   . GLU B 1 130 ? -49.124 -10.751 -35.739 1.00 20.83 ? 305 GLU B O   1 
ATOM   3588 C  CB  . GLU B 1 130 ? -49.489 -8.045  -35.844 1.00 20.44 ? 305 GLU B CB  1 
ATOM   3589 C  CG  . GLU B 1 130 ? -50.022 -6.638  -35.435 1.00 24.57 ? 305 GLU B CG  1 
ATOM   3590 C  CD  . GLU B 1 130 ? -48.919 -5.559  -35.520 1.00 28.52 ? 305 GLU B CD  1 
ATOM   3591 O  OE1 . GLU B 1 130 ? -48.176 -5.526  -36.551 1.00 27.56 ? 305 GLU B OE1 1 
ATOM   3592 O  OE2 . GLU B 1 130 ? -48.790 -4.776  -34.527 1.00 28.76 ? 305 GLU B OE2 1 
ATOM   3593 N  N   . THR B 1 131 ? -47.607 -10.728 -34.122 1.00 21.64 ? 306 THR B N   1 
ATOM   3594 C  CA  . THR B 1 131 ? -47.397 -12.179 -34.133 1.00 22.61 ? 306 THR B CA  1 
ATOM   3595 C  C   . THR B 1 131 ? -47.122 -12.649 -32.672 1.00 23.31 ? 306 THR B C   1 
ATOM   3596 O  O   . THR B 1 131 ? -46.676 -11.853 -31.819 1.00 23.15 ? 306 THR B O   1 
ATOM   3597 C  CB  . THR B 1 131 ? -46.153 -12.545 -35.019 1.00 23.37 ? 306 THR B CB  1 
ATOM   3598 O  OG1 . THR B 1 131 ? -45.009 -11.971 -34.395 1.00 22.46 ? 306 THR B OG1 1 
ATOM   3599 C  CG2 . THR B 1 131 ? -46.266 -12.047 -36.469 1.00 19.52 ? 306 THR B CG2 1 
ATOM   3600 N  N   . ASP B 1 132 ? -47.356 -13.935 -32.387 1.00 24.34 ? 307 ASP B N   1 
ATOM   3601 C  CA  . ASP B 1 132 ? -47.178 -14.486 -31.018 1.00 25.01 ? 307 ASP B CA  1 
ATOM   3602 C  C   . ASP B 1 132 ? -45.770 -14.403 -30.448 1.00 26.01 ? 307 ASP B C   1 
ATOM   3603 O  O   . ASP B 1 132 ? -45.534 -13.891 -29.346 1.00 26.17 ? 307 ASP B O   1 
ATOM   3604 C  CB  . ASP B 1 132 ? -47.658 -15.947 -30.972 1.00 25.40 ? 307 ASP B CB  1 
ATOM   3605 C  CG  . ASP B 1 132 ? -49.109 -16.065 -31.296 1.00 28.83 ? 307 ASP B CG  1 
ATOM   3606 O  OD1 . ASP B 1 132 ? -49.750 -14.983 -31.432 1.00 27.73 ? 307 ASP B OD1 1 
ATOM   3607 O  OD2 . ASP B 1 132 ? -49.611 -17.212 -31.462 1.00 30.69 ? 307 ASP B OD2 1 
ATOM   3608 N  N   . ASN B 1 133 ? -44.804 -14.942 -31.187 1.00 26.31 ? 308 ASN B N   1 
ATOM   3609 C  CA  . ASN B 1 133 ? -43.420 -14.866 -30.781 1.00 26.87 ? 308 ASN B CA  1 
ATOM   3610 C  C   . ASN B 1 133 ? -43.010 -13.509 -30.269 1.00 25.87 ? 308 ASN B C   1 
ATOM   3611 O  O   . ASN B 1 133 ? -42.388 -13.387 -29.208 1.00 24.79 ? 308 ASN B O   1 
ATOM   3612 C  CB  . ASN B 1 133 ? -42.521 -15.164 -32.002 1.00 28.25 ? 308 ASN B CB  1 
ATOM   3613 C  CG  . ASN B 1 133 ? -42.234 -16.606 -32.123 1.00 34.11 ? 308 ASN B CG  1 
ATOM   3614 O  OD1 . ASN B 1 133 ? -42.553 -17.371 -31.195 1.00 39.42 ? 308 ASN B OD1 1 
ATOM   3615 N  ND2 . ASN B 1 133 ? -41.610 -17.023 -33.249 1.00 36.29 ? 308 ASN B ND2 1 
ATOM   3616 N  N   . MET B 1 134 ? -43.288 -12.481 -31.079 1.00 24.47 ? 309 MET B N   1 
ATOM   3617 C  CA  . MET B 1 134 ? -42.884 -11.128 -30.724 1.00 24.37 ? 309 MET B CA  1 
ATOM   3618 C  C   . MET B 1 134 ? -43.710 -10.614 -29.510 1.00 23.88 ? 309 MET B C   1 
ATOM   3619 O  O   . MET B 1 134 ? -43.178 -9.941  -28.646 1.00 23.20 ? 309 MET B O   1 
ATOM   3620 C  CB  . MET B 1 134 ? -43.046 -10.176 -31.928 1.00 24.08 ? 309 MET B CB  1 
ATOM   3621 C  CG  . MET B 1 134 ? -42.053 -10.506 -33.112 1.00 24.79 ? 309 MET B CG  1 
ATOM   3622 S  SD  . MET B 1 134 ? -40.362 -10.175 -32.647 1.00 28.28 ? 309 MET B SD  1 
ATOM   3623 C  CE  . MET B 1 134 ? -39.744 -11.808 -32.489 1.00 24.02 ? 309 MET B CE  1 
ATOM   3624 N  N   . ASN B 1 135 ? -44.996 -10.928 -29.493 1.00 23.26 ? 310 ASN B N   1 
ATOM   3625 C  CA  . ASN B 1 135 ? -45.870 -10.451 -28.428 1.00 25.95 ? 310 ASN B CA  1 
ATOM   3626 C  C   . ASN B 1 135 ? -45.403 -10.965 -27.071 1.00 26.74 ? 310 ASN B C   1 
ATOM   3627 O  O   . ASN B 1 135 ? -45.496 -10.247 -26.061 1.00 28.06 ? 310 ASN B O   1 
ATOM   3628 C  CB  . ASN B 1 135 ? -47.353 -10.816 -28.659 1.00 23.88 ? 310 ASN B CB  1 
ATOM   3629 C  CG  . ASN B 1 135 ? -47.996 -10.022 -29.774 1.00 24.55 ? 310 ASN B CG  1 
ATOM   3630 O  OD1 . ASN B 1 135 ? -49.096 -10.379 -30.233 1.00 25.59 ? 310 ASN B OD1 1 
ATOM   3631 N  ND2 . ASN B 1 135 ? -47.322 -8.943  -30.242 1.00 21.00 ? 310 ASN B ND2 1 
ATOM   3632 N  N   . GLN B 1 136 ? -44.904 -12.203 -27.063 1.00 28.58 ? 311 GLN B N   1 
ATOM   3633 C  CA  . GLN B 1 136 ? -44.502 -12.884 -25.830 1.00 29.43 ? 311 GLN B CA  1 
ATOM   3634 C  C   . GLN B 1 136 ? -43.299 -12.156 -25.226 1.00 29.02 ? 311 GLN B C   1 
ATOM   3635 O  O   . GLN B 1 136 ? -43.191 -12.017 -24.015 1.00 29.80 ? 311 GLN B O   1 
ATOM   3636 C  CB  . GLN B 1 136 ? -44.182 -14.404 -26.056 1.00 29.69 ? 311 GLN B CB  1 
ATOM   3637 C  CG  . GLN B 1 136 ? -45.009 -15.164 -27.151 1.00 37.57 ? 311 GLN B CG  1 
ATOM   3638 C  CD  . GLN B 1 136 ? -46.439 -15.617 -26.719 1.00 44.38 ? 311 GLN B CD  1 
ATOM   3639 O  OE1 . GLN B 1 136 ? -46.658 -15.988 -25.551 1.00 49.11 ? 311 GLN B OE1 1 
ATOM   3640 N  NE2 . GLN B 1 136 ? -47.408 -15.559 -27.648 1.00 42.38 ? 311 GLN B NE2 1 
ATOM   3641 N  N   . ILE B 1 137 ? -42.397 -11.679 -26.067 1.00 27.14 ? 312 ILE B N   1 
ATOM   3642 C  CA  . ILE B 1 137 ? -41.180 -11.040 -25.608 1.00 27.27 ? 312 ILE B CA  1 
ATOM   3643 C  C   . ILE B 1 137 ? -41.322 -9.536  -25.370 1.00 26.60 ? 312 ILE B C   1 
ATOM   3644 O  O   . ILE B 1 137 ? -40.766 -9.014  -24.405 1.00 25.53 ? 312 ILE B O   1 
ATOM   3645 C  CB  . ILE B 1 137 ? -40.027 -11.228 -26.659 1.00 27.64 ? 312 ILE B CB  1 
ATOM   3646 C  CG1 . ILE B 1 137 ? -39.783 -12.709 -26.949 1.00 29.88 ? 312 ILE B CG1 1 
ATOM   3647 C  CG2 . ILE B 1 137 ? -38.745 -10.489 -26.231 1.00 28.31 ? 312 ILE B CG2 1 
ATOM   3648 C  CD1 . ILE B 1 137 ? -38.705 -12.935 -28.086 1.00 33.04 ? 312 ILE B CD1 1 
ATOM   3649 N  N   . TYR B 1 138 ? -42.071 -8.840  -26.241 1.00 25.88 ? 313 TYR B N   1 
ATOM   3650 C  CA  . TYR B 1 138 ? -41.947 -7.383  -26.292 1.00 25.34 ? 313 TYR B CA  1 
ATOM   3651 C  C   . TYR B 1 138 ? -43.079 -6.581  -25.624 1.00 25.33 ? 313 TYR B C   1 
ATOM   3652 O  O   . TYR B 1 138 ? -43.180 -5.359  -25.798 1.00 24.57 ? 313 TYR B O   1 
ATOM   3653 C  CB  . TYR B 1 138 ? -41.751 -6.943  -27.734 1.00 25.07 ? 313 TYR B CB  1 
ATOM   3654 C  CG  . TYR B 1 138 ? -40.362 -7.268  -28.200 1.00 27.10 ? 313 TYR B CG  1 
ATOM   3655 C  CD1 . TYR B 1 138 ? -39.277 -6.513  -27.752 1.00 27.56 ? 313 TYR B CD1 1 
ATOM   3656 C  CD2 . TYR B 1 138 ? -40.120 -8.366  -29.052 1.00 25.43 ? 313 TYR B CD2 1 
ATOM   3657 C  CE1 . TYR B 1 138 ? -37.978 -6.803  -28.181 1.00 30.21 ? 313 TYR B CE1 1 
ATOM   3658 C  CE2 . TYR B 1 138 ? -38.837 -8.675  -29.484 1.00 25.58 ? 313 TYR B CE2 1 
ATOM   3659 C  CZ  . TYR B 1 138 ? -37.772 -7.880  -29.047 1.00 31.15 ? 313 TYR B CZ  1 
ATOM   3660 O  OH  . TYR B 1 138 ? -36.478 -8.157  -29.417 1.00 33.07 ? 313 TYR B OH  1 
ATOM   3661 N  N   . GLY B 1 139 ? -43.918 -7.251  -24.837 1.00 25.38 ? 314 GLY B N   1 
ATOM   3662 C  CA  . GLY B 1 139 ? -44.771 -6.501  -23.953 1.00 25.28 ? 314 GLY B CA  1 
ATOM   3663 C  C   . GLY B 1 139 ? -46.244 -6.801  -24.088 1.00 26.08 ? 314 GLY B C   1 
ATOM   3664 O  O   . GLY B 1 139 ? -46.962 -6.832  -23.078 1.00 26.71 ? 314 GLY B O   1 
ATOM   3665 N  N   . PHE B 1 140 ? -46.708 -7.039  -25.310 1.00 24.78 ? 315 PHE B N   1 
ATOM   3666 C  CA  . PHE B 1 140 ? -48.148 -7.042  -25.587 1.00 23.87 ? 315 PHE B CA  1 
ATOM   3667 C  C   . PHE B 1 140 ? -48.929 -8.200  -24.982 1.00 24.84 ? 315 PHE B C   1 
ATOM   3668 O  O   . PHE B 1 140 ? -50.092 -8.023  -24.606 1.00 24.81 ? 315 PHE B O   1 
ATOM   3669 C  CB  . PHE B 1 140 ? -48.436 -6.990  -27.102 1.00 23.51 ? 315 PHE B CB  1 
ATOM   3670 C  CG  . PHE B 1 140 ? -49.895 -6.876  -27.433 1.00 20.73 ? 315 PHE B CG  1 
ATOM   3671 C  CD1 . PHE B 1 140 ? -50.617 -5.776  -27.003 1.00 20.17 ? 315 PHE B CD1 1 
ATOM   3672 C  CD2 . PHE B 1 140 ? -50.546 -7.872  -28.151 1.00 20.97 ? 315 PHE B CD2 1 
ATOM   3673 C  CE1 . PHE B 1 140 ? -51.992 -5.639  -27.302 1.00 19.70 ? 315 PHE B CE1 1 
ATOM   3674 C  CE2 . PHE B 1 140 ? -51.886 -7.766  -28.453 1.00 21.12 ? 315 PHE B CE2 1 
ATOM   3675 C  CZ  . PHE B 1 140 ? -52.633 -6.633  -28.022 1.00 21.04 ? 315 PHE B CZ  1 
ATOM   3676 N  N   . GLU B 1 141 ? -48.372 -9.410  -25.010 1.00 25.46 ? 316 GLU B N   1 
ATOM   3677 C  CA  . GLU B 1 141 ? -49.046 -10.531 -24.347 1.00 27.18 ? 316 GLU B CA  1 
ATOM   3678 C  C   . GLU B 1 141 ? -49.255 -10.251 -22.871 1.00 26.70 ? 316 GLU B C   1 
ATOM   3679 O  O   . GLU B 1 141 ? -50.366 -10.480 -22.368 1.00 27.55 ? 316 GLU B O   1 
ATOM   3680 C  CB  . GLU B 1 141 ? -48.299 -11.857 -24.489 1.00 27.49 ? 316 GLU B CB  1 
ATOM   3681 C  CG  . GLU B 1 141 ? -49.009 -13.036 -23.790 1.00 33.03 ? 316 GLU B CG  1 
ATOM   3682 C  CD  . GLU B 1 141 ? -48.151 -14.320 -23.831 1.00 40.40 ? 316 GLU B CD  1 
ATOM   3683 O  OE1 . GLU B 1 141 ? -46.920 -14.186 -23.998 1.00 44.66 ? 316 GLU B OE1 1 
ATOM   3684 O  OE2 . GLU B 1 141 ? -48.679 -15.444 -23.682 1.00 40.32 ? 316 GLU B OE2 1 
ATOM   3685 N  N   . GLY B 1 142 ? -48.160 -9.812  -22.239 1.00 26.65 ? 317 GLY B N   1 
ATOM   3686 C  CA  . GLY B 1 142 ? -48.079 -9.303  -20.872 1.00 27.50 ? 317 GLY B CA  1 
ATOM   3687 C  C   . GLY B 1 142 ? -49.115 -8.229  -20.604 1.00 28.35 ? 317 GLY B C   1 
ATOM   3688 O  O   . GLY B 1 142 ? -49.853 -8.328  -19.629 1.00 27.04 ? 317 GLY B O   1 
ATOM   3689 N  N   . GLU B 1 143 ? -49.200 -7.227  -21.491 1.00 27.07 ? 318 GLU B N   1 
ATOM   3690 C  CA  . GLU B 1 143 ? -50.214 -6.188  -21.352 1.00 27.21 ? 318 GLU B CA  1 
ATOM   3691 C  C   . GLU B 1 143 ? -51.652 -6.687  -21.350 1.00 27.98 ? 318 GLU B C   1 
ATOM   3692 O  O   . GLU B 1 143 ? -52.422 -6.290  -20.470 1.00 27.03 ? 318 GLU B O   1 
ATOM   3693 C  CB  . GLU B 1 143 ? -50.021 -5.043  -22.367 1.00 26.97 ? 318 GLU B CB  1 
ATOM   3694 C  CG  . GLU B 1 143 ? -50.921 -3.810  -22.099 1.00 27.84 ? 318 GLU B CG  1 
ATOM   3695 C  CD  . GLU B 1 143 ? -50.606 -2.576  -23.008 1.00 28.73 ? 318 GLU B CD  1 
ATOM   3696 O  OE1 . GLU B 1 143 ? -49.459 -2.494  -23.608 1.00 27.76 ? 318 GLU B OE1 1 
ATOM   3697 O  OE2 . GLU B 1 143 ? -51.512 -1.681  -23.084 1.00 25.30 ? 318 GLU B OE2 1 
ATOM   3698 N  N   . VAL B 1 144 ? -52.031 -7.516  -22.327 1.00 28.23 ? 319 VAL B N   1 
ATOM   3699 C  CA  . VAL B 1 144 ? -53.376 -8.054  -22.425 1.00 29.79 ? 319 VAL B CA  1 
ATOM   3700 C  C   . VAL B 1 144 ? -53.699 -8.991  -21.232 1.00 31.55 ? 319 VAL B C   1 
ATOM   3701 O  O   . VAL B 1 144 ? -54.826 -8.992  -20.707 1.00 30.18 ? 319 VAL B O   1 
ATOM   3702 C  CB  . VAL B 1 144 ? -53.566 -8.803  -23.751 1.00 29.72 ? 319 VAL B CB  1 
ATOM   3703 C  CG1 . VAL B 1 144 ? -54.977 -9.373  -23.919 1.00 28.93 ? 319 VAL B CG1 1 
ATOM   3704 C  CG2 . VAL B 1 144 ? -53.189 -7.898  -24.931 1.00 29.39 ? 319 VAL B CG2 1 
ATOM   3705 N  N   . LYS B 1 145 ? -52.715 -9.786  -20.814 1.00 33.33 ? 320 LYS B N   1 
ATOM   3706 C  CA  . LYS B 1 145 ? -52.924 -10.624 -19.614 1.00 35.96 ? 320 LYS B CA  1 
ATOM   3707 C  C   . LYS B 1 145 ? -53.169 -9.768  -18.342 1.00 36.88 ? 320 LYS B C   1 
ATOM   3708 O  O   . LYS B 1 145 ? -54.019 -10.115 -17.510 1.00 37.45 ? 320 LYS B O   1 
ATOM   3709 C  CB  . LYS B 1 145 ? -51.760 -11.600 -19.417 1.00 36.39 ? 320 LYS B CB  1 
ATOM   3710 C  CG  . LYS B 1 145 ? -51.753 -12.641 -20.517 1.00 36.94 ? 320 LYS B CG  1 
ATOM   3711 C  CD  . LYS B 1 145 ? -50.631 -13.659 -20.386 1.00 37.95 ? 320 LYS B CD  1 
ATOM   3712 C  CE  . LYS B 1 145 ? -50.910 -14.796 -21.372 1.00 41.11 ? 320 LYS B CE  1 
ATOM   3713 N  NZ  . LYS B 1 145 ? -49.793 -15.762 -21.467 1.00 41.77 ? 320 LYS B NZ  1 
ATOM   3714 N  N   . ALA B 1 146 ? -52.451 -8.641  -18.223 1.00 37.15 ? 321 ALA B N   1 
ATOM   3715 C  CA  . ALA B 1 146 ? -52.552 -7.762  -17.078 1.00 36.71 ? 321 ALA B CA  1 
ATOM   3716 C  C   . ALA B 1 146 ? -53.836 -6.940  -17.065 1.00 36.98 ? 321 ALA B C   1 
ATOM   3717 O  O   . ALA B 1 146 ? -54.386 -6.683  -15.994 1.00 37.83 ? 321 ALA B O   1 
ATOM   3718 C  CB  . ALA B 1 146 ? -51.351 -6.866  -16.995 1.00 37.39 ? 321 ALA B CB  1 
ATOM   3719 N  N   . LYS B 1 147 ? -54.320 -6.535  -18.241 1.00 36.04 ? 322 LYS B N   1 
ATOM   3720 C  CA  . LYS B 1 147 ? -55.575 -5.809  -18.366 1.00 34.32 ? 322 LYS B CA  1 
ATOM   3721 C  C   . LYS B 1 147 ? -56.795 -6.717  -18.555 1.00 34.84 ? 322 LYS B C   1 
ATOM   3722 O  O   . LYS B 1 147 ? -57.928 -6.358  -18.205 1.00 33.19 ? 322 LYS B O   1 
ATOM   3723 C  CB  . LYS B 1 147 ? -55.499 -4.810  -19.532 1.00 33.62 ? 322 LYS B CB  1 
ATOM   3724 C  CG  . LYS B 1 147 ? -54.569 -3.675  -19.236 1.00 33.19 ? 322 LYS B CG  1 
ATOM   3725 C  CD  . LYS B 1 147 ? -54.314 -2.764  -20.420 1.00 29.66 ? 322 LYS B CD  1 
ATOM   3726 C  CE  . LYS B 1 147 ? -53.303 -1.722  -19.946 1.00 30.88 ? 322 LYS B CE  1 
ATOM   3727 N  NZ  . LYS B 1 147 ? -52.854 -0.745  -21.005 1.00 33.11 ? 322 LYS B NZ  1 
ATOM   3728 N  N   . TYR B 1 148 ? -56.595 -7.866  -19.178 1.00 34.46 ? 323 TYR B N   1 
ATOM   3729 C  CA  . TYR B 1 148 ? -57.715 -8.748  -19.405 1.00 34.99 ? 323 TYR B CA  1 
ATOM   3730 C  C   . TYR B 1 148 ? -57.310 -10.156 -19.024 1.00 35.17 ? 323 TYR B C   1 
ATOM   3731 O  O   . TYR B 1 148 ? -56.905 -10.386 -17.894 1.00 35.50 ? 323 TYR B O   1 
ATOM   3732 C  CB  . TYR B 1 148 ? -58.191 -8.693  -20.845 1.00 34.82 ? 323 TYR B CB  1 
ATOM   3733 C  CG  . TYR B 1 148 ? -58.697 -7.337  -21.291 1.00 35.06 ? 323 TYR B CG  1 
ATOM   3734 C  CD1 . TYR B 1 148 ? -59.945 -6.890  -20.881 1.00 31.58 ? 323 TYR B CD1 1 
ATOM   3735 C  CD2 . TYR B 1 148 ? -57.933 -6.509  -22.142 1.00 31.56 ? 323 TYR B CD2 1 
ATOM   3736 C  CE1 . TYR B 1 148 ? -60.439 -5.675  -21.266 1.00 33.18 ? 323 TYR B CE1 1 
ATOM   3737 C  CE2 . TYR B 1 148 ? -58.436 -5.260  -22.554 1.00 33.12 ? 323 TYR B CE2 1 
ATOM   3738 C  CZ  . TYR B 1 148 ? -59.690 -4.857  -22.110 1.00 34.86 ? 323 TYR B CZ  1 
ATOM   3739 O  OH  . TYR B 1 148 ? -60.228 -3.638  -22.486 1.00 34.54 ? 323 TYR B OH  1 
ATOM   3740 N  N   . THR B 1 149 ? -57.382 -11.087 -19.961 1.00 36.23 ? 324 THR B N   1 
ATOM   3741 C  CA  . THR B 1 149 ? -57.042 -12.493 -19.668 1.00 37.31 ? 324 THR B CA  1 
ATOM   3742 C  C   . THR B 1 149 ? -56.220 -13.167 -20.773 1.00 38.04 ? 324 THR B C   1 
ATOM   3743 O  O   . THR B 1 149 ? -56.008 -12.591 -21.822 1.00 37.90 ? 324 THR B O   1 
ATOM   3744 C  CB  . THR B 1 149 ? -58.323 -13.314 -19.505 1.00 36.74 ? 324 THR B CB  1 
ATOM   3745 O  OG1 . THR B 1 149 ? -59.018 -13.330 -20.751 1.00 33.68 ? 324 THR B OG1 1 
ATOM   3746 C  CG2 . THR B 1 149 ? -59.238 -12.699 -18.439 1.00 37.27 ? 324 THR B CG2 1 
ATOM   3747 N  N   . ALA B 1 150 ? -55.777 -14.399 -20.530 1.00 39.17 ? 325 ALA B N   1 
ATOM   3748 C  CA  . ALA B 1 150 ? -55.106 -15.203 -21.558 1.00 38.89 ? 325 ALA B CA  1 
ATOM   3749 C  C   . ALA B 1 150 ? -56.061 -15.451 -22.712 1.00 39.51 ? 325 ALA B C   1 
ATOM   3750 O  O   . ALA B 1 150 ? -55.668 -15.388 -23.886 1.00 39.30 ? 325 ALA B O   1 
ATOM   3751 C  CB  . ALA B 1 150 ? -54.631 -16.526 -20.971 1.00 39.38 ? 325 ALA B CB  1 
ATOM   3752 N  N   . GLN B 1 151 ? -57.326 -15.734 -22.408 1.00 38.64 ? 326 GLN B N   1 
ATOM   3753 C  CA  . GLN B 1 151 ? -58.316 -15.919 -23.471 1.00 38.90 ? 326 GLN B CA  1 
ATOM   3754 C  C   . GLN B 1 151 ? -58.487 -14.686 -24.401 1.00 38.11 ? 326 GLN B C   1 
ATOM   3755 O  O   . GLN B 1 151 ? -58.753 -14.822 -25.625 1.00 38.33 ? 326 GLN B O   1 
ATOM   3756 C  CB  . GLN B 1 151 ? -59.670 -16.280 -22.877 1.00 40.24 ? 326 GLN B CB  1 
ATOM   3757 C  CG  . GLN B 1 151 ? -59.779 -17.733 -22.386 1.00 46.20 ? 326 GLN B CG  1 
ATOM   3758 C  CD  . GLN B 1 151 ? -61.225 -18.140 -22.111 1.00 54.23 ? 326 GLN B CD  1 
ATOM   3759 O  OE1 . GLN B 1 151 ? -61.725 -17.978 -20.985 1.00 59.27 ? 326 GLN B OE1 1 
ATOM   3760 N  NE2 . GLN B 1 151 ? -61.912 -18.673 -23.146 1.00 56.99 ? 326 GLN B NE2 1 
ATOM   3761 N  N   . MET B 1 152 ? -58.385 -13.495 -23.823 1.00 35.57 ? 327 MET B N   1 
ATOM   3762 C  CA  . MET B 1 152 ? -58.455 -12.273 -24.618 1.00 34.19 ? 327 MET B CA  1 
ATOM   3763 C  C   . MET B 1 152 ? -57.178 -12.192 -25.470 1.00 32.23 ? 327 MET B C   1 
ATOM   3764 O  O   . MET B 1 152 ? -57.236 -11.812 -26.628 1.00 31.95 ? 327 MET B O   1 
ATOM   3765 C  CB  . MET B 1 152 ? -58.567 -11.030 -23.720 1.00 33.97 ? 327 MET B CB  1 
ATOM   3766 C  CG  . MET B 1 152 ? -58.882 -9.716  -24.476 1.00 34.66 ? 327 MET B CG  1 
ATOM   3767 S  SD  . MET B 1 152 ? -60.561 -9.691  -25.142 1.00 37.24 ? 327 MET B SD  1 
ATOM   3768 C  CE  . MET B 1 152 ? -61.452 -8.862  -23.797 1.00 39.51 ? 327 MET B CE  1 
ATOM   3769 N  N   . TYR B 1 153 ? -56.038 -12.518 -24.877 1.00 31.23 ? 328 TYR B N   1 
ATOM   3770 C  CA  . TYR B 1 153 ? -54.802 -12.564 -25.642 1.00 31.47 ? 328 TYR B CA  1 
ATOM   3771 C  C   . TYR B 1 153 ? -54.893 -13.482 -26.897 1.00 32.21 ? 328 TYR B C   1 
ATOM   3772 O  O   . TYR B 1 153 ? -54.528 -13.042 -27.997 1.00 31.10 ? 328 TYR B O   1 
ATOM   3773 C  CB  . TYR B 1 153 ? -53.534 -12.822 -24.817 1.00 31.26 ? 328 TYR B CB  1 
ATOM   3774 C  CG  . TYR B 1 153 ? -52.364 -12.841 -25.767 1.00 33.28 ? 328 TYR B CG  1 
ATOM   3775 C  CD1 . TYR B 1 153 ? -51.927 -11.655 -26.366 1.00 32.85 ? 328 TYR B CD1 1 
ATOM   3776 C  CD2 . TYR B 1 153 ? -51.793 -14.056 -26.190 1.00 34.47 ? 328 TYR B CD2 1 
ATOM   3777 C  CE1 . TYR B 1 153 ? -50.902 -11.659 -27.308 1.00 33.65 ? 328 TYR B CE1 1 
ATOM   3778 C  CE2 . TYR B 1 153 ? -50.758 -14.074 -27.120 1.00 34.61 ? 328 TYR B CE2 1 
ATOM   3779 C  CZ  . TYR B 1 153 ? -50.324 -12.879 -27.694 1.00 35.11 ? 328 TYR B CZ  1 
ATOM   3780 O  OH  . TYR B 1 153 ? -49.312 -12.879 -28.641 1.00 34.83 ? 328 TYR B OH  1 
ATOM   3781 N  N   . GLU B 1 154 ? -55.416 -14.716 -26.751 1.00 31.56 ? 329 GLU B N   1 
ATOM   3782 C  CA  . GLU B 1 154 ? -55.524 -15.640 -27.865 1.00 31.93 ? 329 GLU B CA  1 
ATOM   3783 C  C   . GLU B 1 154 ? -56.475 -15.112 -28.919 1.00 31.17 ? 329 GLU B C   1 
ATOM   3784 O  O   . GLU B 1 154 ? -56.287 -15.352 -30.120 1.00 29.87 ? 329 GLU B O   1 
ATOM   3785 C  CB  . GLU B 1 154 ? -55.978 -17.065 -27.433 1.00 33.70 ? 329 GLU B CB  1 
ATOM   3786 C  CG  . GLU B 1 154 ? -55.407 -17.557 -26.106 1.00 38.09 ? 329 GLU B CG  1 
ATOM   3787 C  CD  . GLU B 1 154 ? -53.863 -17.528 -26.004 1.00 43.99 ? 329 GLU B CD  1 
ATOM   3788 O  OE1 . GLU B 1 154 ? -53.183 -17.754 -27.047 1.00 45.91 ? 329 GLU B OE1 1 
ATOM   3789 O  OE2 . GLU B 1 154 ? -53.341 -17.269 -24.867 1.00 45.71 ? 329 GLU B OE2 1 
ATOM   3790 N  N   . LEU B 1 155 ? -57.523 -14.404 -28.490 1.00 29.60 ? 330 LEU B N   1 
ATOM   3791 C  CA  . LEU B 1 155 ? -58.377 -13.760 -29.465 1.00 28.78 ? 330 LEU B CA  1 
ATOM   3792 C  C   . LEU B 1 155 ? -57.604 -12.683 -30.311 1.00 26.60 ? 330 LEU B C   1 
ATOM   3793 O  O   . LEU B 1 155 ? -57.719 -12.694 -31.528 1.00 23.47 ? 330 LEU B O   1 
ATOM   3794 C  CB  . LEU B 1 155 ? -59.632 -13.187 -28.804 1.00 30.33 ? 330 LEU B CB  1 
ATOM   3795 C  CG  . LEU B 1 155 ? -60.712 -12.593 -29.702 1.00 33.18 ? 330 LEU B CG  1 
ATOM   3796 C  CD1 . LEU B 1 155 ? -61.141 -13.523 -30.907 1.00 36.51 ? 330 LEU B CD1 1 
ATOM   3797 C  CD2 . LEU B 1 155 ? -61.915 -12.141 -28.833 1.00 35.37 ? 330 LEU B CD2 1 
ATOM   3798 N  N   . PHE B 1 156 ? -56.835 -11.796 -29.666 1.00 25.76 ? 331 PHE B N   1 
ATOM   3799 C  CA  . PHE B 1 156 ? -56.021 -10.815 -30.420 1.00 26.24 ? 331 PHE B CA  1 
ATOM   3800 C  C   . PHE B 1 156 ? -55.166 -11.568 -31.455 1.00 27.33 ? 331 PHE B C   1 
ATOM   3801 O  O   . PHE B 1 156 ? -55.145 -11.219 -32.632 1.00 26.65 ? 331 PHE B O   1 
ATOM   3802 C  CB  . PHE B 1 156 ? -55.095 -10.019 -29.507 1.00 25.81 ? 331 PHE B CB  1 
ATOM   3803 C  CG  . PHE B 1 156 ? -55.738 -8.764  -28.926 1.00 26.07 ? 331 PHE B CG  1 
ATOM   3804 C  CD1 . PHE B 1 156 ? -56.109 -7.729  -29.753 1.00 24.84 ? 331 PHE B CD1 1 
ATOM   3805 C  CD2 . PHE B 1 156 ? -55.944 -8.630  -27.551 1.00 23.67 ? 331 PHE B CD2 1 
ATOM   3806 C  CE1 . PHE B 1 156 ? -56.714 -6.573  -29.227 1.00 23.89 ? 331 PHE B CE1 1 
ATOM   3807 C  CE2 . PHE B 1 156 ? -56.557 -7.462  -26.996 1.00 26.64 ? 331 PHE B CE2 1 
ATOM   3808 C  CZ  . PHE B 1 156 ? -56.930 -6.435  -27.850 1.00 25.31 ? 331 PHE B CZ  1 
ATOM   3809 N  N   . SER B 1 157 ? -54.483 -12.621 -30.996 1.00 27.39 ? 332 SER B N   1 
ATOM   3810 C  CA  . SER B 1 157 ? -53.646 -13.457 -31.865 1.00 28.14 ? 332 SER B CA  1 
ATOM   3811 C  C   . SER B 1 157 ? -54.361 -13.876 -33.133 1.00 27.91 ? 332 SER B C   1 
ATOM   3812 O  O   . SER B 1 157 ? -53.854 -13.672 -34.266 1.00 27.16 ? 332 SER B O   1 
ATOM   3813 C  CB  . SER B 1 157 ? -53.112 -14.679 -31.078 1.00 28.70 ? 332 SER B CB  1 
ATOM   3814 O  OG  . SER B 1 157 ? -52.344 -15.534 -31.943 1.00 32.40 ? 332 SER B OG  1 
ATOM   3815 N  N   . GLU B 1 158 ? -55.554 -14.453 -32.976 1.00 27.72 ? 333 GLU B N   1 
ATOM   3816 C  CA  . GLU B 1 158 ? -56.356 -14.880 -34.119 1.00 27.37 ? 333 GLU B CA  1 
ATOM   3817 C  C   . GLU B 1 158 ? -56.811 -13.747 -35.043 1.00 26.24 ? 333 GLU B C   1 
ATOM   3818 O  O   . GLU B 1 158 ? -56.966 -13.939 -36.247 1.00 24.54 ? 333 GLU B O   1 
ATOM   3819 C  CB  . GLU B 1 158 ? -57.611 -15.625 -33.644 1.00 28.94 ? 333 GLU B CB  1 
ATOM   3820 C  CG  . GLU B 1 158 ? -57.315 -16.976 -33.043 1.00 35.26 ? 333 GLU B CG  1 
ATOM   3821 C  CD  . GLU B 1 158 ? -58.488 -17.508 -32.210 1.00 43.09 ? 333 GLU B CD  1 
ATOM   3822 O  OE1 . GLU B 1 158 ? -59.598 -16.893 -32.229 1.00 44.56 ? 333 GLU B OE1 1 
ATOM   3823 O  OE2 . GLU B 1 158 ? -58.285 -18.539 -31.531 1.00 48.91 ? 333 GLU B OE2 1 
ATOM   3824 N  N   . VAL B 1 159 ? -57.080 -12.572 -34.465 1.00 25.70 ? 334 VAL B N   1 
ATOM   3825 C  CA  . VAL B 1 159 ? -57.512 -11.461 -35.278 1.00 25.14 ? 334 VAL B CA  1 
ATOM   3826 C  C   . VAL B 1 159 ? -56.294 -10.949 -36.081 1.00 22.78 ? 334 VAL B C   1 
ATOM   3827 O  O   . VAL B 1 159 ? -56.453 -10.628 -37.244 1.00 21.90 ? 334 VAL B O   1 
ATOM   3828 C  CB  . VAL B 1 159 ? -58.116 -10.311 -34.434 1.00 26.19 ? 334 VAL B CB  1 
ATOM   3829 C  CG1 . VAL B 1 159 ? -58.484 -9.162  -35.343 1.00 26.27 ? 334 VAL B CG1 1 
ATOM   3830 C  CG2 . VAL B 1 159 ? -59.342 -10.835 -33.653 1.00 28.17 ? 334 VAL B CG2 1 
ATOM   3831 N  N   . PHE B 1 160 ? -55.109 -10.916 -35.453 1.00 22.81 ? 335 PHE B N   1 
ATOM   3832 C  CA  . PHE B 1 160 ? -53.848 -10.444 -36.127 1.00 22.85 ? 335 PHE B CA  1 
ATOM   3833 C  C   . PHE B 1 160 ? -53.542 -11.269 -37.401 1.00 22.74 ? 335 PHE B C   1 
ATOM   3834 O  O   . PHE B 1 160 ? -53.105 -10.741 -38.459 1.00 20.82 ? 335 PHE B O   1 
ATOM   3835 C  CB  . PHE B 1 160 ? -52.630 -10.487 -35.163 1.00 23.12 ? 335 PHE B CB  1 
ATOM   3836 C  CG  . PHE B 1 160 ? -52.587 -9.369  -34.136 1.00 21.66 ? 335 PHE B CG  1 
ATOM   3837 C  CD1 . PHE B 1 160 ? -53.450 -8.278  -34.209 1.00 22.27 ? 335 PHE B CD1 1 
ATOM   3838 C  CD2 . PHE B 1 160 ? -51.715 -9.462  -33.045 1.00 23.75 ? 335 PHE B CD2 1 
ATOM   3839 C  CE1 . PHE B 1 160 ? -53.404 -7.245  -33.234 1.00 17.87 ? 335 PHE B CE1 1 
ATOM   3840 C  CE2 . PHE B 1 160 ? -51.640 -8.453  -32.045 1.00 23.00 ? 335 PHE B CE2 1 
ATOM   3841 C  CZ  . PHE B 1 160 ? -52.518 -7.319  -32.132 1.00 17.39 ? 335 PHE B CZ  1 
ATOM   3842 N  N   . GLU B 1 161 ? -53.822 -12.579 -37.309 1.00 21.56 ? 336 GLU B N   1 
ATOM   3843 C  CA  . GLU B 1 161 ? -53.686 -13.530 -38.434 1.00 21.99 ? 336 GLU B CA  1 
ATOM   3844 C  C   . GLU B 1 161 ? -54.465 -13.171 -39.701 1.00 21.02 ? 336 GLU B C   1 
ATOM   3845 O  O   . GLU B 1 161 ? -54.081 -13.537 -40.839 1.00 20.81 ? 336 GLU B O   1 
ATOM   3846 C  CB  . GLU B 1 161 ? -54.081 -14.950 -37.944 1.00 21.26 ? 336 GLU B CB  1 
ATOM   3847 C  CG  . GLU B 1 161 ? -52.973 -15.546 -37.125 1.00 21.16 ? 336 GLU B CG  1 
ATOM   3848 C  CD  . GLU B 1 161 ? -53.345 -16.942 -36.558 1.00 28.99 ? 336 GLU B CD  1 
ATOM   3849 O  OE1 . GLU B 1 161 ? -54.454 -17.452 -36.883 1.00 28.98 ? 336 GLU B OE1 1 
ATOM   3850 O  OE2 . GLU B 1 161 ? -52.521 -17.501 -35.790 1.00 30.29 ? 336 GLU B OE2 1 
ATOM   3851 N  N   . TRP B 1 162 ? -55.575 -12.474 -39.524 1.00 19.77 ? 337 TRP B N   1 
ATOM   3852 C  CA  . TRP B 1 162 ? -56.313 -12.003 -40.697 1.00 19.74 ? 337 TRP B CA  1 
ATOM   3853 C  C   . TRP B 1 162 ? -55.893 -10.658 -41.316 1.00 18.54 ? 337 TRP B C   1 
ATOM   3854 O  O   . TRP B 1 162 ? -56.375 -10.320 -42.384 1.00 19.63 ? 337 TRP B O   1 
ATOM   3855 C  CB  . TRP B 1 162 ? -57.827 -12.069 -40.438 1.00 19.97 ? 337 TRP B CB  1 
ATOM   3856 C  CG  . TRP B 1 162 ? -58.308 -13.551 -40.448 1.00 24.87 ? 337 TRP B CG  1 
ATOM   3857 C  CD1 . TRP B 1 162 ? -58.712 -14.314 -39.376 1.00 29.02 ? 337 TRP B CD1 1 
ATOM   3858 C  CD2 . TRP B 1 162 ? -58.398 -14.406 -41.597 1.00 26.63 ? 337 TRP B CD2 1 
ATOM   3859 N  NE1 . TRP B 1 162 ? -59.059 -15.586 -39.801 1.00 24.49 ? 337 TRP B NE1 1 
ATOM   3860 C  CE2 . TRP B 1 162 ? -58.893 -15.656 -41.157 1.00 27.22 ? 337 TRP B CE2 1 
ATOM   3861 C  CE3 . TRP B 1 162 ? -58.105 -14.234 -42.958 1.00 29.56 ? 337 TRP B CE3 1 
ATOM   3862 C  CZ2 . TRP B 1 162 ? -59.107 -16.712 -42.023 1.00 27.49 ? 337 TRP B CZ2 1 
ATOM   3863 C  CZ3 . TRP B 1 162 ? -58.332 -15.287 -43.824 1.00 30.82 ? 337 TRP B CZ3 1 
ATOM   3864 C  CH2 . TRP B 1 162 ? -58.831 -16.510 -43.352 1.00 29.58 ? 337 TRP B CH2 1 
ATOM   3865 N  N   . LEU B 1 163 ? -55.038 -9.899  -40.653 1.00 18.72 ? 338 LEU B N   1 
ATOM   3866 C  CA  . LEU B 1 163 ? -54.501 -8.602  -41.193 1.00 19.47 ? 338 LEU B CA  1 
ATOM   3867 C  C   . LEU B 1 163 ? -53.885 -8.815  -42.569 1.00 19.83 ? 338 LEU B C   1 
ATOM   3868 O  O   . LEU B 1 163 ? -53.051 -9.744  -42.741 1.00 20.45 ? 338 LEU B O   1 
ATOM   3869 C  CB  . LEU B 1 163 ? -53.429 -8.047  -40.231 1.00 18.66 ? 338 LEU B CB  1 
ATOM   3870 C  CG  . LEU B 1 163 ? -53.983 -7.504  -38.907 1.00 18.63 ? 338 LEU B CG  1 
ATOM   3871 C  CD1 . LEU B 1 163 ? -52.905 -7.035  -37.967 1.00 18.83 ? 338 LEU B CD1 1 
ATOM   3872 C  CD2 . LEU B 1 163 ? -54.946 -6.326  -39.252 1.00 17.96 ? 338 LEU B CD2 1 
ATOM   3873 N  N   . PRO B 1 164 ? -54.304 -8.023  -43.570 1.00 19.82 ? 339 PRO B N   1 
ATOM   3874 C  CA  . PRO B 1 164 ? -53.633 -8.130  -44.898 1.00 19.73 ? 339 PRO B CA  1 
ATOM   3875 C  C   . PRO B 1 164 ? -52.088 -7.881  -44.840 1.00 16.93 ? 339 PRO B C   1 
ATOM   3876 O  O   . PRO B 1 164 ? -51.618 -7.333  -43.880 1.00 17.80 ? 339 PRO B O   1 
ATOM   3877 C  CB  . PRO B 1 164 ? -54.318 -7.055  -45.733 1.00 19.45 ? 339 PRO B CB  1 
ATOM   3878 C  CG  . PRO B 1 164 ? -55.703 -6.871  -45.073 1.00 20.81 ? 339 PRO B CG  1 
ATOM   3879 C  CD  . PRO B 1 164 ? -55.430 -7.064  -43.577 1.00 20.87 ? 339 PRO B CD  1 
ATOM   3880 N  N   . LEU B 1 165 ? -51.327 -8.292  -45.849 1.00 17.46 ? 340 LEU B N   1 
ATOM   3881 C  CA  . LEU B 1 165 ? -49.877 -8.196  -45.778 1.00 16.98 ? 340 LEU B CA  1 
ATOM   3882 C  C   . LEU B 1 165 ? -49.330 -7.008  -46.581 1.00 17.13 ? 340 LEU B C   1 
ATOM   3883 O  O   . LEU B 1 165 ? -48.200 -6.548  -46.336 1.00 18.37 ? 340 LEU B O   1 
ATOM   3884 C  CB  . LEU B 1 165 ? -49.225 -9.521  -46.195 1.00 18.14 ? 340 LEU B CB  1 
ATOM   3885 C  CG  . LEU B 1 165 ? -49.645 -10.804 -45.458 1.00 18.70 ? 340 LEU B CG  1 
ATOM   3886 C  CD1 . LEU B 1 165 ? -48.903 -12.039 -46.049 1.00 15.48 ? 340 LEU B CD1 1 
ATOM   3887 C  CD2 . LEU B 1 165 ? -49.395 -10.625 -43.925 1.00 21.54 ? 340 LEU B CD2 1 
ATOM   3888 N  N   . ALA B 1 166 ? -50.114 -6.513  -47.521 1.00 16.97 ? 341 ALA B N   1 
ATOM   3889 C  CA  . ALA B 1 166 ? -49.668 -5.406  -48.409 1.00 17.82 ? 341 ALA B CA  1 
ATOM   3890 C  C   . ALA B 1 166 ? -50.837 -4.672  -49.063 1.00 18.61 ? 341 ALA B C   1 
ATOM   3891 O  O   . ALA B 1 166 ? -51.915 -5.234  -49.235 1.00 20.04 ? 341 ALA B O   1 
ATOM   3892 C  CB  . ALA B 1 166 ? -48.676 -5.936  -49.520 1.00 15.93 ? 341 ALA B CB  1 
ATOM   3893 N  N   . GLN B 1 167 ? -50.616 -3.423  -49.481 1.00 18.45 ? 342 GLN B N   1 
ATOM   3894 C  CA  . GLN B 1 167 ? -51.655 -2.648  -50.086 1.00 18.81 ? 342 GLN B CA  1 
ATOM   3895 C  C   . GLN B 1 167 ? -51.025 -1.971  -51.298 1.00 20.28 ? 342 GLN B C   1 
ATOM   3896 O  O   . GLN B 1 167 ? -49.861 -1.533  -51.233 1.00 19.17 ? 342 GLN B O   1 
ATOM   3897 C  CB  . GLN B 1 167 ? -52.230 -1.598  -49.126 1.00 18.22 ? 342 GLN B CB  1 
ATOM   3898 C  CG  . GLN B 1 167 ? -53.434 -0.815  -49.675 1.00 17.87 ? 342 GLN B CG  1 
ATOM   3899 C  CD  . GLN B 1 167 ? -54.264 -0.263  -48.513 1.00 24.59 ? 342 GLN B CD  1 
ATOM   3900 O  OE1 . GLN B 1 167 ? -53.959 -0.547  -47.349 1.00 23.94 ? 342 GLN B OE1 1 
ATOM   3901 N  NE2 . GLN B 1 167 ? -55.272 0.562   -48.808 1.00 21.33 ? 342 GLN B NE2 1 
ATOM   3902 N  N   . CYS B 1 168 ? -51.772 -1.951  -52.406 1.00 19.33 ? 343 CYS B N   1 
ATOM   3903 C  CA  . CYS B 1 168 ? -51.283 -1.351  -53.635 1.00 21.85 ? 343 CYS B CA  1 
ATOM   3904 C  C   . CYS B 1 168 ? -52.251 -0.236  -53.988 1.00 22.15 ? 343 CYS B C   1 
ATOM   3905 O  O   . CYS B 1 168 ? -53.476 -0.455  -54.008 1.00 24.46 ? 343 CYS B O   1 
ATOM   3906 C  CB  . CYS B 1 168 ? -51.208 -2.371  -54.775 1.00 21.09 ? 343 CYS B CB  1 
ATOM   3907 S  SG  . CYS B 1 168 ? -50.366 -1.688  -56.246 1.00 26.52 ? 343 CYS B SG  1 
ATOM   3908 N  N   . ILE B 1 169 ? -51.729 0.961   -54.215 1.00 21.81 ? 344 ILE B N   1 
ATOM   3909 C  CA  . ILE B 1 169 ? -52.550 2.137   -54.582 1.00 23.10 ? 344 ILE B CA  1 
ATOM   3910 C  C   . ILE B 1 169 ? -52.341 2.423   -56.067 1.00 23.84 ? 344 ILE B C   1 
ATOM   3911 O  O   . ILE B 1 169 ? -51.174 2.616   -56.514 1.00 23.93 ? 344 ILE B O   1 
ATOM   3912 C  CB  . ILE B 1 169 ? -52.079 3.429   -53.845 1.00 23.60 ? 344 ILE B CB  1 
ATOM   3913 C  CG1 . ILE B 1 169 ? -51.853 3.220   -52.338 1.00 26.27 ? 344 ILE B CG1 1 
ATOM   3914 C  CG2 . ILE B 1 169 ? -53.020 4.639   -54.083 1.00 23.05 ? 344 ILE B CG2 1 
ATOM   3915 C  CD1 . ILE B 1 169 ? -53.118 2.958   -51.520 1.00 32.20 ? 344 ILE B CD1 1 
ATOM   3916 N  N   . ASN B 1 170 ? -53.451 2.449   -56.825 1.00 22.91 ? 345 ASN B N   1 
ATOM   3917 C  CA  . ASN B 1 170 ? -53.473 2.777   -58.265 1.00 23.49 ? 345 ASN B CA  1 
ATOM   3918 C  C   . ASN B 1 170 ? -52.528 1.953   -59.111 1.00 23.43 ? 345 ASN B C   1 
ATOM   3919 O  O   . ASN B 1 170 ? -52.080 2.424   -60.147 1.00 23.70 ? 345 ASN B O   1 
ATOM   3920 C  CB  . ASN B 1 170 ? -53.250 4.274   -58.521 1.00 23.95 ? 345 ASN B CB  1 
ATOM   3921 C  CG  . ASN B 1 170 ? -54.374 5.113   -57.974 1.00 24.59 ? 345 ASN B CG  1 
ATOM   3922 O  OD1 . ASN B 1 170 ? -55.238 4.609   -57.290 1.00 28.89 ? 345 ASN B OD1 1 
ATOM   3923 N  ND2 . ASN B 1 170 ? -54.353 6.389   -58.240 1.00 25.33 ? 345 ASN B ND2 1 
ATOM   3924 N  N   . GLY B 1 171 ? -52.254 0.717   -58.683 1.00 22.70 ? 346 GLY B N   1 
ATOM   3925 C  CA  . GLY B 1 171 ? -51.273 -0.140  -59.354 1.00 21.55 ? 346 GLY B CA  1 
ATOM   3926 C  C   . GLY B 1 171 ? -49.867 0.438   -59.454 1.00 20.80 ? 346 GLY B C   1 
ATOM   3927 O  O   . GLY B 1 171 ? -49.065 0.018   -60.296 1.00 21.74 ? 346 GLY B O   1 
ATOM   3928 N  N   . LYS B 1 172 ? -49.560 1.429   -58.633 1.00 20.84 ? 347 LYS B N   1 
ATOM   3929 C  CA  . LYS B 1 172 ? -48.276 2.166   -58.735 1.00 20.58 ? 347 LYS B CA  1 
ATOM   3930 C  C   . LYS B 1 172 ? -47.427 2.215   -57.466 1.00 19.65 ? 347 LYS B C   1 
ATOM   3931 O  O   . LYS B 1 172 ? -46.205 2.304   -57.548 1.00 19.92 ? 347 LYS B O   1 
ATOM   3932 C  CB  . LYS B 1 172 ? -48.548 3.598   -59.178 1.00 22.03 ? 347 LYS B CB  1 
ATOM   3933 C  CG  . LYS B 1 172 ? -49.002 3.667   -60.635 1.00 23.98 ? 347 LYS B CG  1 
ATOM   3934 C  CD  . LYS B 1 172 ? -47.900 3.058   -61.485 1.00 30.76 ? 347 LYS B CD  1 
ATOM   3935 C  CE  . LYS B 1 172 ? -48.381 2.786   -62.883 1.00 34.47 ? 347 LYS B CE  1 
ATOM   3936 N  NZ  . LYS B 1 172 ? -47.194 2.385   -63.696 1.00 39.67 ? 347 LYS B NZ  1 
ATOM   3937 N  N   . VAL B 1 173 ? -48.088 2.257   -56.318 1.00 18.96 ? 348 VAL B N   1 
ATOM   3938 C  CA  . VAL B 1 173 ? -47.410 2.277   -55.004 1.00 19.77 ? 348 VAL B CA  1 
ATOM   3939 C  C   . VAL B 1 173 ? -47.766 1.028   -54.171 1.00 19.36 ? 348 VAL B C   1 
ATOM   3940 O  O   . VAL B 1 173 ? -48.960 0.777   -53.842 1.00 20.17 ? 348 VAL B O   1 
ATOM   3941 C  CB  . VAL B 1 173 ? -47.662 3.570   -54.179 1.00 20.59 ? 348 VAL B CB  1 
ATOM   3942 C  CG1 . VAL B 1 173 ? -46.784 3.517   -52.870 1.00 19.93 ? 348 VAL B CG1 1 
ATOM   3943 C  CG2 . VAL B 1 173 ? -47.357 4.851   -55.040 1.00 21.47 ? 348 VAL B CG2 1 
ATOM   3944 N  N   . LEU B 1 174 ? -46.743 0.258   -53.849 1.00 17.97 ? 349 LEU B N   1 
ATOM   3945 C  CA  . LEU B 1 174 ? -46.899 -0.933  -52.964 1.00 18.03 ? 349 LEU B CA  1 
ATOM   3946 C  C   . LEU B 1 174 ? -46.422 -0.607  -51.554 1.00 16.80 ? 349 LEU B C   1 
ATOM   3947 O  O   . LEU B 1 174 ? -45.299 -0.113  -51.340 1.00 16.13 ? 349 LEU B O   1 
ATOM   3948 C  CB  . LEU B 1 174 ? -46.124 -2.153  -53.551 1.00 17.05 ? 349 LEU B CB  1 
ATOM   3949 C  CG  . LEU B 1 174 ? -46.373 -3.491  -52.839 1.00 18.02 ? 349 LEU B CG  1 
ATOM   3950 C  CD1 . LEU B 1 174 ? -47.886 -3.923  -52.948 1.00 16.99 ? 349 LEU B CD1 1 
ATOM   3951 C  CD2 . LEU B 1 174 ? -45.557 -4.563  -53.489 1.00 19.60 ? 349 LEU B CD2 1 
ATOM   3952 N  N   . ILE B 1 175 ? -47.262 -0.944  -50.584 1.00 16.18 ? 350 ILE B N   1 
ATOM   3953 C  CA  . ILE B 1 175 ? -46.998 -0.704  -49.191 1.00 15.57 ? 350 ILE B CA  1 
ATOM   3954 C  C   . ILE B 1 175 ? -46.983 -2.013  -48.376 1.00 14.56 ? 350 ILE B C   1 
ATOM   3955 O  O   . ILE B 1 175 ? -47.898 -2.781  -48.491 1.00 15.25 ? 350 ILE B O   1 
ATOM   3956 C  CB  . ILE B 1 175 ? -48.134 0.224   -48.595 1.00 14.90 ? 350 ILE B CB  1 
ATOM   3957 C  CG1 . ILE B 1 175 ? -48.305 1.455   -49.509 1.00 15.98 ? 350 ILE B CG1 1 
ATOM   3958 C  CG2 . ILE B 1 175 ? -47.868 0.541   -47.066 1.00 14.64 ? 350 ILE B CG2 1 
ATOM   3959 C  CD1 . ILE B 1 175 ? -49.616 2.205   -49.244 1.00 19.62 ? 350 ILE B CD1 1 
ATOM   3960 N  N   . MET B 1 176 ? -45.957 -2.208  -47.564 1.00 14.48 ? 351 MET B N   1 
ATOM   3961 C  CA  . MET B 1 176 ? -45.822 -3.387  -46.710 1.00 14.91 ? 351 MET B CA  1 
ATOM   3962 C  C   . MET B 1 176 ? -45.002 -2.991  -45.526 1.00 14.35 ? 351 MET B C   1 
ATOM   3963 O  O   . MET B 1 176 ? -44.196 -2.012  -45.605 1.00 14.91 ? 351 MET B O   1 
ATOM   3964 C  CB  . MET B 1 176 ? -45.193 -4.585  -47.483 1.00 14.68 ? 351 MET B CB  1 
ATOM   3965 C  CG  . MET B 1 176 ? -43.679 -4.473  -47.572 1.00 15.53 ? 351 MET B CG  1 
ATOM   3966 S  SD  . MET B 1 176 ? -43.198 -3.395  -48.950 1.00 24.11 ? 351 MET B SD  1 
ATOM   3967 C  CE  . MET B 1 176 ? -43.679 -4.450  -50.269 1.00 20.56 ? 351 MET B CE  1 
ATOM   3968 N  N   . HIS B 1 177 ? -45.129 -3.731  -44.401 1.00 13.25 ? 352 HIS B N   1 
ATOM   3969 C  CA  . HIS B 1 177 ? -44.358 -3.376  -43.209 1.00 13.35 ? 352 HIS B CA  1 
ATOM   3970 C  C   . HIS B 1 177 ? -42.802 -3.421  -43.386 1.00 13.06 ? 352 HIS B C   1 
ATOM   3971 O  O   . HIS B 1 177 ? -42.074 -2.456  -43.079 1.00 11.64 ? 352 HIS B O   1 
ATOM   3972 C  CB  . HIS B 1 177 ? -44.775 -4.213  -41.952 1.00 11.46 ? 352 HIS B CB  1 
ATOM   3973 C  CG  . HIS B 1 177 ? -43.949 -3.904  -40.710 1.00 13.28 ? 352 HIS B CG  1 
ATOM   3974 N  ND1 . HIS B 1 177 ? -44.054 -2.727  -39.990 1.00 8.55  ? 352 HIS B ND1 1 
ATOM   3975 C  CD2 . HIS B 1 177 ? -42.979 -4.615  -40.114 1.00 10.13 ? 352 HIS B CD2 1 
ATOM   3976 C  CE1 . HIS B 1 177 ? -43.182 -2.724  -39.008 1.00 13.33 ? 352 HIS B CE1 1 
ATOM   3977 N  NE2 . HIS B 1 177 ? -42.536 -3.887  -39.023 1.00 11.50 ? 352 HIS B NE2 1 
ATOM   3978 N  N   . GLY B 1 178 ? -42.287 -4.564  -43.792 1.00 12.77 ? 353 GLY B N   1 
ATOM   3979 C  CA  . GLY B 1 178 ? -40.856 -4.754  -43.814 1.00 14.46 ? 353 GLY B CA  1 
ATOM   3980 C  C   . GLY B 1 178 ? -40.300 -4.447  -45.209 1.00 16.32 ? 353 GLY B C   1 
ATOM   3981 O  O   . GLY B 1 178 ? -39.611 -3.439  -45.411 1.00 16.08 ? 353 GLY B O   1 
ATOM   3982 N  N   . GLY B 1 179 ? -40.545 -5.306  -46.199 1.00 16.25 ? 354 GLY B N   1 
ATOM   3983 C  CA  . GLY B 1 179 ? -39.941 -4.957  -47.498 1.00 17.29 ? 354 GLY B CA  1 
ATOM   3984 C  C   . GLY B 1 179 ? -40.077 -6.007  -48.597 1.00 17.85 ? 354 GLY B C   1 
ATOM   3985 O  O   . GLY B 1 179 ? -41.080 -6.700  -48.645 1.00 17.64 ? 354 GLY B O   1 
ATOM   3986 N  N   . LEU B 1 180 ? -39.049 -6.132  -49.430 1.00 15.17 ? 355 LEU B N   1 
ATOM   3987 C  CA  . LEU B 1 180 ? -39.108 -6.997  -50.629 1.00 17.34 ? 355 LEU B CA  1 
ATOM   3988 C  C   . LEU B 1 180 ? -38.566 -8.408  -50.297 1.00 17.05 ? 355 LEU B C   1 
ATOM   3989 O  O   . LEU B 1 180 ? -38.456 -8.779  -49.110 1.00 17.70 ? 355 LEU B O   1 
ATOM   3990 C  CB  . LEU B 1 180 ? -38.382 -6.354  -51.829 1.00 14.40 ? 355 LEU B CB  1 
ATOM   3991 C  CG  . LEU B 1 180 ? -39.159 -5.085  -52.249 1.00 16.77 ? 355 LEU B CG  1 
ATOM   3992 C  CD1 . LEU B 1 180 ? -38.486 -4.405  -53.458 1.00 12.56 ? 355 LEU B CD1 1 
ATOM   3993 C  CD2 . LEU B 1 180 ? -40.642 -5.355  -52.584 1.00 16.93 ? 355 LEU B CD2 1 
ATOM   3994 N  N   . PHE B 1 181 ? -38.189 -9.176  -51.310 1.00 16.56 ? 356 PHE B N   1 
ATOM   3995 C  CA  . PHE B 1 181 ? -38.091 -10.632 -51.093 1.00 15.77 ? 356 PHE B CA  1 
ATOM   3996 C  C   . PHE B 1 181 ? -36.697 -11.165 -51.104 1.00 16.63 ? 356 PHE B C   1 
ATOM   3997 O  O   . PHE B 1 181 ? -35.753 -10.498 -51.542 1.00 16.18 ? 356 PHE B O   1 
ATOM   3998 C  CB  . PHE B 1 181 ? -39.031 -11.344 -52.083 1.00 16.52 ? 356 PHE B CB  1 
ATOM   3999 C  CG  . PHE B 1 181 ? -40.447 -10.875 -51.938 1.00 17.13 ? 356 PHE B CG  1 
ATOM   4000 C  CD1 . PHE B 1 181 ? -41.255 -11.444 -50.967 1.00 20.04 ? 356 PHE B CD1 1 
ATOM   4001 C  CD2 . PHE B 1 181 ? -40.927 -9.776  -52.666 1.00 17.89 ? 356 PHE B CD2 1 
ATOM   4002 C  CE1 . PHE B 1 181 ? -42.542 -10.987 -50.743 1.00 20.54 ? 356 PHE B CE1 1 
ATOM   4003 C  CE2 . PHE B 1 181 ? -42.216 -9.299  -52.460 1.00 20.54 ? 356 PHE B CE2 1 
ATOM   4004 C  CZ  . PHE B 1 181 ? -43.045 -9.910  -51.482 1.00 19.62 ? 356 PHE B CZ  1 
ATOM   4005 N  N   . SER B 1 182 ? -36.535 -12.372 -50.593 1.00 15.16 ? 357 SER B N   1 
ATOM   4006 C  CA  . SER B 1 182 ? -35.205 -12.942 -50.574 1.00 16.72 ? 357 SER B CA  1 
ATOM   4007 C  C   . SER B 1 182 ? -34.950 -13.739 -51.854 1.00 16.49 ? 357 SER B C   1 
ATOM   4008 O  O   . SER B 1 182 ? -33.883 -14.302 -52.040 1.00 17.32 ? 357 SER B O   1 
ATOM   4009 C  CB  . SER B 1 182 ? -34.978 -13.727 -49.276 0.50 15.31 ? 357 SER B CB  1 
ATOM   4010 O  OG  . SER B 1 182 ? -35.847 -14.789 -49.326 0.50 17.47 ? 357 SER B OG  1 
ATOM   4011 N  N   . GLU B 1 183 ? -35.924 -13.746 -52.746 1.00 17.25 ? 358 GLU B N   1 
ATOM   4012 C  CA  . GLU B 1 183 ? -35.791 -14.418 -54.042 1.00 20.26 ? 358 GLU B CA  1 
ATOM   4013 C  C   . GLU B 1 183 ? -36.300 -13.428 -55.052 1.00 19.79 ? 358 GLU B C   1 
ATOM   4014 O  O   . GLU B 1 183 ? -37.233 -12.707 -54.751 1.00 18.63 ? 358 GLU B O   1 
ATOM   4015 C  CB  . GLU B 1 183 ? -36.668 -15.740 -54.123 1.00 20.77 ? 358 GLU B CB  1 
ATOM   4016 C  CG  . GLU B 1 183 ? -36.858 -16.619 -52.698 1.00 26.91 ? 358 GLU B CG  1 
ATOM   4017 C  CD  . GLU B 1 183 ? -38.309 -16.508 -51.876 1.00 43.20 ? 358 GLU B CD  1 
ATOM   4018 O  OE1 . GLU B 1 183 ? -38.408 -15.869 -50.732 1.00 42.69 ? 358 GLU B OE1 1 
ATOM   4019 O  OE2 . GLU B 1 183 ? -39.346 -17.120 -52.349 1.00 43.28 ? 358 GLU B OE2 1 
ATOM   4020 N  N   . ASP B 1 184 ? -35.708 -13.439 -56.255 1.00 20.60 ? 359 ASP B N   1 
ATOM   4021 C  CA  . ASP B 1 184 ? -36.219 -12.722 -57.421 1.00 22.70 ? 359 ASP B CA  1 
ATOM   4022 C  C   . ASP B 1 184 ? -37.473 -13.342 -58.033 1.00 22.23 ? 359 ASP B C   1 
ATOM   4023 O  O   . ASP B 1 184 ? -37.746 -14.543 -57.866 1.00 21.73 ? 359 ASP B O   1 
ATOM   4024 C  CB  . ASP B 1 184 ? -35.148 -12.599 -58.511 1.00 23.32 ? 359 ASP B CB  1 
ATOM   4025 C  CG  . ASP B 1 184 ? -34.010 -11.658 -58.095 1.00 28.43 ? 359 ASP B CG  1 
ATOM   4026 O  OD1 . ASP B 1 184 ? -34.254 -10.640 -57.364 1.00 33.14 ? 359 ASP B OD1 1 
ATOM   4027 O  OD2 . ASP B 1 184 ? -32.861 -11.943 -58.490 1.00 31.93 ? 359 ASP B OD2 1 
ATOM   4028 N  N   . GLY B 1 185 ? -38.231 -12.482 -58.694 1.00 19.45 ? 360 GLY B N   1 
ATOM   4029 C  CA  . GLY B 1 185 ? -39.375 -12.881 -59.479 1.00 21.12 ? 360 GLY B CA  1 
ATOM   4030 C  C   . GLY B 1 185 ? -40.702 -12.937 -58.738 1.00 19.86 ? 360 GLY B C   1 
ATOM   4031 O  O   . GLY B 1 185 ? -41.648 -13.422 -59.266 1.00 21.32 ? 360 GLY B O   1 
ATOM   4032 N  N   . VAL B 1 186 ? -40.795 -12.466 -57.517 1.00 19.29 ? 361 VAL B N   1 
ATOM   4033 C  CA  . VAL B 1 186 ? -42.103 -12.472 -56.870 1.00 18.72 ? 361 VAL B CA  1 
ATOM   4034 C  C   . VAL B 1 186 ? -43.015 -11.418 -57.528 1.00 19.42 ? 361 VAL B C   1 
ATOM   4035 O  O   . VAL B 1 186 ? -42.588 -10.309 -57.787 1.00 19.44 ? 361 VAL B O   1 
ATOM   4036 C  CB  . VAL B 1 186 ? -41.976 -12.241 -55.330 1.00 18.80 ? 361 VAL B CB  1 
ATOM   4037 C  CG1 . VAL B 1 186 ? -43.381 -12.035 -54.599 1.00 16.18 ? 361 VAL B CG1 1 
ATOM   4038 C  CG2 . VAL B 1 186 ? -41.080 -13.299 -54.697 1.00 16.79 ? 361 VAL B CG2 1 
ATOM   4039 N  N   . THR B 1 187 ? -44.281 -11.751 -57.751 1.00 19.02 ? 362 THR B N   1 
ATOM   4040 C  CA  . THR B 1 187 ? -45.234 -10.851 -58.393 1.00 20.14 ? 362 THR B CA  1 
ATOM   4041 C  C   . THR B 1 187 ? -46.355 -10.449 -57.431 1.00 20.24 ? 362 THR B C   1 
ATOM   4042 O  O   . THR B 1 187 ? -46.558 -11.070 -56.364 1.00 20.37 ? 362 THR B O   1 
ATOM   4043 C  CB  . THR B 1 187 ? -45.897 -11.520 -59.634 1.00 20.04 ? 362 THR B CB  1 
ATOM   4044 O  OG1 . THR B 1 187 ? -46.676 -12.632 -59.170 1.00 21.07 ? 362 THR B OG1 1 
ATOM   4045 C  CG2 . THR B 1 187 ? -44.850 -12.074 -60.661 1.00 22.64 ? 362 THR B CG2 1 
ATOM   4046 N  N   . LEU B 1 188 ? -47.118 -9.439  -57.832 1.00 20.74 ? 363 LEU B N   1 
ATOM   4047 C  CA  . LEU B 1 188 ? -48.269 -9.014  -57.068 1.00 21.22 ? 363 LEU B CA  1 
ATOM   4048 C  C   . LEU B 1 188 ? -49.258 -10.180 -56.942 1.00 23.20 ? 363 LEU B C   1 
ATOM   4049 O  O   . LEU B 1 188 ? -49.952 -10.310 -55.926 1.00 22.48 ? 363 LEU B O   1 
ATOM   4050 C  CB  . LEU B 1 188 ? -48.942 -7.839  -57.758 1.00 21.18 ? 363 LEU B CB  1 
ATOM   4051 C  CG  . LEU B 1 188 ? -48.188 -6.528  -57.746 1.00 23.52 ? 363 LEU B CG  1 
ATOM   4052 C  CD1 . LEU B 1 188 ? -49.010 -5.416  -58.509 1.00 25.62 ? 363 LEU B CD1 1 
ATOM   4053 C  CD2 . LEU B 1 188 ? -47.859 -6.127  -56.293 1.00 24.45 ? 363 LEU B CD2 1 
ATOM   4054 N  N   . ASP B 1 189 ? -49.334 -11.026 -57.973 1.00 23.32 ? 364 ASP B N   1 
ATOM   4055 C  CA  . ASP B 1 189 ? -50.310 -12.084 -57.883 1.00 24.64 ? 364 ASP B CA  1 
ATOM   4056 C  C   . ASP B 1 189 ? -49.826 -13.130 -56.870 1.00 23.84 ? 364 ASP B C   1 
ATOM   4057 O  O   . ASP B 1 189 ? -50.636 -13.687 -56.138 1.00 23.15 ? 364 ASP B O   1 
ATOM   4058 C  CB  . ASP B 1 189 ? -50.687 -12.694 -59.240 1.00 24.24 ? 364 ASP B CB  1 
ATOM   4059 C  CG  . ASP B 1 189 ? -51.967 -13.566 -59.137 1.00 31.03 ? 364 ASP B CG  1 
ATOM   4060 O  OD1 . ASP B 1 189 ? -53.033 -13.049 -58.660 1.00 33.54 ? 364 ASP B OD1 1 
ATOM   4061 O  OD2 . ASP B 1 189 ? -51.891 -14.778 -59.482 1.00 34.45 ? 364 ASP B OD2 1 
ATOM   4062 N  N   . ASP B 1 190 ? -48.514 -13.322 -56.763 1.00 24.27 ? 365 ASP B N   1 
ATOM   4063 C  CA  . ASP B 1 190 ? -47.959 -14.186 -55.694 1.00 24.30 ? 365 ASP B CA  1 
ATOM   4064 C  C   . ASP B 1 190 ? -48.350 -13.657 -54.300 1.00 24.24 ? 365 ASP B C   1 
ATOM   4065 O  O   . ASP B 1 190 ? -48.657 -14.475 -53.394 1.00 22.10 ? 365 ASP B O   1 
ATOM   4066 C  CB  . ASP B 1 190 ? -46.433 -14.315 -55.734 1.00 24.63 ? 365 ASP B CB  1 
ATOM   4067 C  CG  . ASP B 1 190 ? -45.930 -14.983 -56.984 1.00 30.51 ? 365 ASP B CG  1 
ATOM   4068 O  OD1 . ASP B 1 190 ? -46.706 -15.791 -57.551 1.00 27.77 ? 365 ASP B OD1 1 
ATOM   4069 O  OD2 . ASP B 1 190 ? -44.753 -14.693 -57.405 1.00 31.64 ? 365 ASP B OD2 1 
ATOM   4070 N  N   . ILE B 1 191 ? -48.310 -12.320 -54.122 1.00 21.72 ? 366 ILE B N   1 
ATOM   4071 C  CA  . ILE B 1 191 ? -48.656 -11.739 -52.825 1.00 23.15 ? 366 ILE B CA  1 
ATOM   4072 C  C   . ILE B 1 191 ? -50.123 -12.013 -52.515 1.00 23.22 ? 366 ILE B C   1 
ATOM   4073 O  O   . ILE B 1 191 ? -50.457 -12.458 -51.414 1.00 22.44 ? 366 ILE B O   1 
ATOM   4074 C  CB  . ILE B 1 191 ? -48.315 -10.221 -52.723 1.00 22.58 ? 366 ILE B CB  1 
ATOM   4075 C  CG1 . ILE B 1 191 ? -46.822 -10.039 -52.991 1.00 24.01 ? 366 ILE B CG1 1 
ATOM   4076 C  CG2 . ILE B 1 191 ? -48.668 -9.644  -51.371 1.00 22.54 ? 366 ILE B CG2 1 
ATOM   4077 C  CD1 . ILE B 1 191 ? -46.404 -8.533  -53.119 1.00 27.97 ? 366 ILE B CD1 1 
ATOM   4078 N  N   . ARG B 1 192 ? -50.955 -11.798 -53.526 1.00 24.61 ? 367 ARG B N   1 
ATOM   4079 C  CA  . ARG B 1 192 ? -52.415 -11.936 -53.461 1.00 28.12 ? 367 ARG B CA  1 
ATOM   4080 C  C   . ARG B 1 192 ? -52.782 -13.351 -53.011 1.00 29.32 ? 367 ARG B C   1 
ATOM   4081 O  O   . ARG B 1 192 ? -53.737 -13.562 -52.241 1.00 30.29 ? 367 ARG B O   1 
ATOM   4082 C  CB  . ARG B 1 192 ? -52.992 -11.603 -54.865 1.00 28.43 ? 367 ARG B CB  1 
ATOM   4083 C  CG  . ARG B 1 192 ? -54.469 -11.280 -54.935 1.00 33.19 ? 367 ARG B CG  1 
ATOM   4084 C  CD  . ARG B 1 192 ? -54.782 -10.193 -55.973 1.00 35.58 ? 367 ARG B CD  1 
ATOM   4085 N  NE  . ARG B 1 192 ? -54.096 -10.458 -57.210 1.00 39.37 ? 367 ARG B NE  1 
ATOM   4086 C  CZ  . ARG B 1 192 ? -53.604 -9.547  -58.043 1.00 37.74 ? 367 ARG B CZ  1 
ATOM   4087 N  NH1 . ARG B 1 192 ? -53.719 -8.251  -57.805 1.00 37.91 ? 367 ARG B NH1 1 
ATOM   4088 N  NH2 . ARG B 1 192 ? -52.990 -9.961  -59.143 1.00 38.20 ? 367 ARG B NH2 1 
ATOM   4089 N  N   . LYS B 1 193 ? -51.988 -14.312 -53.459 1.00 29.31 ? 368 LYS B N   1 
ATOM   4090 C  CA  . LYS B 1 193 ? -52.249 -15.692 -53.213 1.00 30.65 ? 368 LYS B CA  1 
ATOM   4091 C  C   . LYS B 1 193 ? -51.679 -16.212 -51.903 1.00 30.12 ? 368 LYS B C   1 
ATOM   4092 O  O   . LYS B 1 193 ? -51.993 -17.327 -51.548 1.00 31.67 ? 368 LYS B O   1 
ATOM   4093 C  CB  . LYS B 1 193 ? -51.672 -16.519 -54.377 1.00 31.06 ? 368 LYS B CB  1 
ATOM   4094 C  CG  . LYS B 1 193 ? -52.447 -16.344 -55.653 1.00 33.20 ? 368 LYS B CG  1 
ATOM   4095 C  CD  . LYS B 1 193 ? -51.914 -17.273 -56.731 1.00 38.96 ? 368 LYS B CD  1 
ATOM   4096 C  CE  . LYS B 1 193 ? -53.011 -17.560 -57.750 1.00 45.83 ? 368 LYS B CE  1 
ATOM   4097 N  NZ  . LYS B 1 193 ? -53.383 -16.421 -58.674 1.00 47.89 ? 368 LYS B NZ  1 
ATOM   4098 N  N   . ILE B 1 194 ? -50.847 -15.459 -51.184 1.00 28.55 ? 369 ILE B N   1 
ATOM   4099 C  CA  . ILE B 1 194 ? -50.358 -15.940 -49.899 1.00 27.55 ? 369 ILE B CA  1 
ATOM   4100 C  C   . ILE B 1 194 ? -51.523 -16.227 -48.964 1.00 28.94 ? 369 ILE B C   1 
ATOM   4101 O  O   . ILE B 1 194 ? -52.504 -15.459 -48.885 1.00 27.74 ? 369 ILE B O   1 
ATOM   4102 C  CB  . ILE B 1 194 ? -49.388 -14.970 -49.205 1.00 27.92 ? 369 ILE B CB  1 
ATOM   4103 C  CG1 . ILE B 1 194 ? -48.056 -14.908 -49.968 1.00 25.40 ? 369 ILE B CG1 1 
ATOM   4104 C  CG2 . ILE B 1 194 ? -49.150 -15.396 -47.734 1.00 27.03 ? 369 ILE B CG2 1 
ATOM   4105 C  CD1 . ILE B 1 194 ? -47.205 -13.682 -49.584 1.00 24.67 ? 369 ILE B CD1 1 
ATOM   4106 N  N   . GLU B 1 195 ? -51.418 -17.360 -48.271 1.00 28.91 ? 370 GLU B N   1 
ATOM   4107 C  CA  . GLU B 1 195 ? -52.462 -17.787 -47.377 1.00 30.12 ? 370 GLU B CA  1 
ATOM   4108 C  C   . GLU B 1 195 ? -51.924 -17.385 -45.983 1.00 28.70 ? 370 GLU B C   1 
ATOM   4109 O  O   . GLU B 1 195 ? -51.037 -18.018 -45.378 1.00 26.45 ? 370 GLU B O   1 
ATOM   4110 C  CB  . GLU B 1 195 ? -52.759 -19.275 -47.705 1.00 32.42 ? 370 GLU B CB  1 
ATOM   4111 C  CG  . GLU B 1 195 ? -53.196 -20.247 -46.648 1.00 38.81 ? 370 GLU B CG  1 
ATOM   4112 C  CD  . GLU B 1 195 ? -53.404 -21.688 -47.283 1.00 47.19 ? 370 GLU B CD  1 
ATOM   4113 O  OE1 . GLU B 1 195 ? -53.808 -21.777 -48.480 1.00 44.26 ? 370 GLU B OE1 1 
ATOM   4114 O  OE2 . GLU B 1 195 ? -53.149 -22.720 -46.584 1.00 52.39 ? 370 GLU B OE2 1 
ATOM   4115 N  N   . ARG B 1 196 ? -52.447 -16.245 -45.523 1.00 26.19 ? 371 ARG B N   1 
ATOM   4116 C  CA  . ARG B 1 196 ? -51.781 -15.468 -44.499 1.00 24.92 ? 371 ARG B CA  1 
ATOM   4117 C  C   . ARG B 1 196 ? -52.308 -15.761 -43.089 1.00 25.09 ? 371 ARG B C   1 
ATOM   4118 O  O   . ARG B 1 196 ? -51.737 -15.292 -42.119 1.00 23.97 ? 371 ARG B O   1 
ATOM   4119 C  CB  . ARG B 1 196 ? -51.980 -13.991 -44.808 1.00 24.51 ? 371 ARG B CB  1 
ATOM   4120 C  CG  . ARG B 1 196 ? -53.418 -13.514 -44.573 1.00 22.66 ? 371 ARG B CG  1 
ATOM   4121 C  CD  . ARG B 1 196 ? -53.552 -12.049 -44.998 1.00 22.44 ? 371 ARG B CD  1 
ATOM   4122 N  NE  . ARG B 1 196 ? -54.862 -11.498 -44.653 1.00 21.54 ? 371 ARG B NE  1 
ATOM   4123 C  CZ  . ARG B 1 196 ? -55.977 -11.623 -45.376 1.00 23.96 ? 371 ARG B CZ  1 
ATOM   4124 N  NH1 . ARG B 1 196 ? -55.959 -12.283 -46.535 1.00 21.80 ? 371 ARG B NH1 1 
ATOM   4125 N  NH2 . ARG B 1 196 ? -57.132 -11.073 -44.940 1.00 24.65 ? 371 ARG B NH2 1 
ATOM   4126 N  N   . ASN B 1 197 ? -53.397 -16.527 -42.947 1.00 26.40 ? 372 ASN B N   1 
ATOM   4127 C  CA  . ASN B 1 197 ? -53.998 -16.703 -41.598 1.00 26.82 ? 372 ASN B CA  1 
ATOM   4128 C  C   . ASN B 1 197 ? -53.234 -17.705 -40.771 1.00 26.90 ? 372 ASN B C   1 
ATOM   4129 O  O   . ASN B 1 197 ? -53.678 -18.857 -40.539 1.00 27.33 ? 372 ASN B O   1 
ATOM   4130 C  CB  . ASN B 1 197 ? -55.476 -17.108 -41.702 1.00 27.34 ? 372 ASN B CB  1 
ATOM   4131 C  CG  . ASN B 1 197 ? -55.695 -18.233 -42.729 1.00 30.42 ? 372 ASN B CG  1 
ATOM   4132 O  OD1 . ASN B 1 197 ? -55.052 -18.254 -43.797 1.00 31.22 ? 372 ASN B OD1 1 
ATOM   4133 N  ND2 . ASN B 1 197 ? -56.596 -19.190 -42.397 1.00 32.03 ? 372 ASN B ND2 1 
ATOM   4134 N  N   . ARG B 1 198 ? -52.092 -17.264 -40.283 1.00 26.57 ? 373 ARG B N   1 
ATOM   4135 C  CA  . ARG B 1 198 ? -51.135 -18.127 -39.683 1.00 26.23 ? 373 ARG B CA  1 
ATOM   4136 C  C   . ARG B 1 198 ? -50.115 -17.237 -39.009 1.00 25.51 ? 373 ARG B C   1 
ATOM   4137 O  O   . ARG B 1 198 ? -50.110 -16.021 -39.224 1.00 25.42 ? 373 ARG B O   1 
ATOM   4138 C  CB  . ARG B 1 198 ? -50.448 -18.981 -40.758 1.00 26.78 ? 373 ARG B CB  1 
ATOM   4139 C  CG  . ARG B 1 198 ? -49.759 -18.181 -41.879 1.00 26.83 ? 373 ARG B CG  1 
ATOM   4140 C  CD  . ARG B 1 198 ? -48.916 -19.112 -42.793 1.00 28.42 ? 373 ARG B CD  1 
ATOM   4141 N  NE  . ARG B 1 198 ? -47.796 -19.752 -42.051 1.00 30.00 ? 373 ARG B NE  1 
ATOM   4142 C  CZ  . ARG B 1 198 ? -47.040 -20.742 -42.542 1.00 31.13 ? 373 ARG B CZ  1 
ATOM   4143 N  NH1 . ARG B 1 198 ? -47.263 -21.197 -43.781 1.00 29.00 ? 373 ARG B NH1 1 
ATOM   4144 N  NH2 . ARG B 1 198 ? -46.051 -21.261 -41.818 1.00 27.33 ? 373 ARG B NH2 1 
ATOM   4145 N  N   . GLN B 1 199 ? -49.283 -17.847 -38.175 1.00 24.67 ? 374 GLN B N   1 
ATOM   4146 C  CA  . GLN B 1 199 ? -48.067 -17.247 -37.700 1.00 25.05 ? 374 GLN B CA  1 
ATOM   4147 C  C   . GLN B 1 199 ? -47.091 -17.405 -38.869 1.00 25.45 ? 374 GLN B C   1 
ATOM   4148 O  O   . GLN B 1 199 ? -47.085 -18.460 -39.517 1.00 24.60 ? 374 GLN B O   1 
ATOM   4149 C  CB  . GLN B 1 199 ? -47.585 -17.985 -36.460 1.00 24.93 ? 374 GLN B CB  1 
ATOM   4150 C  CG  . GLN B 1 199 ? -48.603 -17.877 -35.312 1.00 24.67 ? 374 GLN B CG  1 
ATOM   4151 C  CD  . GLN B 1 199 ? -48.873 -16.403 -34.934 1.00 19.37 ? 374 GLN B CD  1 
ATOM   4152 O  OE1 . GLN B 1 199 ? -47.974 -15.711 -34.473 1.00 23.83 ? 374 GLN B OE1 1 
ATOM   4153 N  NE2 . GLN B 1 199 ? -50.105 -15.958 -35.098 1.00 20.00 ? 374 GLN B NE2 1 
ATOM   4154 N  N   . PRO B 1 200 ? -46.315 -16.354 -39.180 1.00 25.10 ? 375 PRO B N   1 
ATOM   4155 C  CA  . PRO B 1 200 ? -45.526 -16.440 -40.428 1.00 25.57 ? 375 PRO B CA  1 
ATOM   4156 C  C   . PRO B 1 200 ? -44.510 -17.584 -40.356 1.00 25.70 ? 375 PRO B C   1 
ATOM   4157 O  O   . PRO B 1 200 ? -44.074 -17.917 -39.277 1.00 24.98 ? 375 PRO B O   1 
ATOM   4158 C  CB  . PRO B 1 200 ? -44.766 -15.104 -40.454 1.00 25.13 ? 375 PRO B CB  1 
ATOM   4159 C  CG  . PRO B 1 200 ? -44.902 -14.527 -39.074 1.00 26.81 ? 375 PRO B CG  1 
ATOM   4160 C  CD  . PRO B 1 200 ? -46.149 -15.069 -38.483 1.00 25.06 ? 375 PRO B CD  1 
ATOM   4161 N  N   . PRO B 1 201 ? -44.093 -18.141 -41.498 1.00 26.24 ? 376 PRO B N   1 
ATOM   4162 C  CA  . PRO B 1 201 ? -42.984 -19.120 -41.439 1.00 26.82 ? 376 PRO B CA  1 
ATOM   4163 C  C   . PRO B 1 201 ? -41.610 -18.467 -41.219 1.00 27.78 ? 376 PRO B C   1 
ATOM   4164 O  O   . PRO B 1 201 ? -41.489 -17.210 -41.278 1.00 26.28 ? 376 PRO B O   1 
ATOM   4165 C  CB  . PRO B 1 201 ? -43.044 -19.812 -42.819 1.00 26.54 ? 376 PRO B CB  1 
ATOM   4166 C  CG  . PRO B 1 201 ? -43.631 -18.838 -43.697 1.00 26.84 ? 376 PRO B CG  1 
ATOM   4167 C  CD  . PRO B 1 201 ? -44.583 -17.952 -42.866 1.00 26.73 ? 376 PRO B CD  1 
ATOM   4168 N  N   . ASP B 1 202 ? -40.607 -19.319 -40.967 1.00 28.05 ? 377 ASP B N   1 
ATOM   4169 C  CA  . ASP B 1 202 ? -39.206 -18.935 -40.790 1.00 30.87 ? 377 ASP B CA  1 
ATOM   4170 C  C   . ASP B 1 202 ? -38.606 -18.271 -42.052 1.00 29.12 ? 377 ASP B C   1 
ATOM   4171 O  O   . ASP B 1 202 ? -37.597 -17.578 -41.968 1.00 28.54 ? 377 ASP B O   1 
ATOM   4172 C  CB  . ASP B 1 202 ? -38.326 -20.179 -40.424 1.00 32.58 ? 377 ASP B CB  1 
ATOM   4173 C  CG  . ASP B 1 202 ? -38.644 -20.759 -38.997 1.00 40.17 ? 377 ASP B CG  1 
ATOM   4174 O  OD1 . ASP B 1 202 ? -39.346 -20.090 -38.176 1.00 45.05 ? 377 ASP B OD1 1 
ATOM   4175 O  OD2 . ASP B 1 202 ? -38.195 -21.910 -38.689 1.00 48.07 ? 377 ASP B OD2 1 
ATOM   4176 N  N   . SER B 1 203 ? -39.221 -18.507 -43.202 1.00 29.08 ? 378 SER B N   1 
ATOM   4177 C  CA  . SER B 1 203 ? -38.676 -18.077 -44.481 1.00 28.75 ? 378 SER B CA  1 
ATOM   4178 C  C   . SER B 1 203 ? -39.800 -18.043 -45.544 1.00 28.22 ? 378 SER B C   1 
ATOM   4179 O  O   . SER B 1 203 ? -40.899 -18.538 -45.317 1.00 28.13 ? 378 SER B O   1 
ATOM   4180 C  CB  . SER B 1 203 ? -37.608 -19.101 -44.918 1.00 30.07 ? 378 SER B CB  1 
ATOM   4181 O  OG  . SER B 1 203 ? -38.281 -20.278 -45.433 1.00 31.64 ? 378 SER B OG  1 
ATOM   4182 N  N   . GLY B 1 204 ? -39.521 -17.465 -46.715 1.00 26.76 ? 379 GLY B N   1 
ATOM   4183 C  CA  . GLY B 1 204 ? -40.538 -17.321 -47.729 1.00 24.95 ? 379 GLY B CA  1 
ATOM   4184 C  C   . GLY B 1 204 ? -41.099 -15.902 -47.775 1.00 24.64 ? 379 GLY B C   1 
ATOM   4185 O  O   . GLY B 1 204 ? -40.726 -15.040 -46.962 1.00 23.22 ? 379 GLY B O   1 
ATOM   4186 N  N   . PRO B 1 205 ? -41.954 -15.645 -48.778 1.00 24.97 ? 380 PRO B N   1 
ATOM   4187 C  CA  . PRO B 1 205 ? -42.566 -14.333 -49.085 1.00 23.61 ? 380 PRO B CA  1 
ATOM   4188 C  C   . PRO B 1 205 ? -43.288 -13.683 -47.899 1.00 21.83 ? 380 PRO B C   1 
ATOM   4189 O  O   . PRO B 1 205 ? -43.119 -12.468 -47.664 1.00 19.68 ? 380 PRO B O   1 
ATOM   4190 C  CB  . PRO B 1 205 ? -43.563 -14.623 -50.206 1.00 23.99 ? 380 PRO B CB  1 
ATOM   4191 C  CG  . PRO B 1 205 ? -43.494 -16.139 -50.479 1.00 25.97 ? 380 PRO B CG  1 
ATOM   4192 C  CD  . PRO B 1 205 ? -42.182 -16.640 -49.837 1.00 25.06 ? 380 PRO B CD  1 
ATOM   4193 N  N   . MET B 1 206 ? -44.119 -14.456 -47.194 1.00 20.42 ? 381 MET B N   1 
ATOM   4194 C  CA  . MET B 1 206 ? -44.786 -13.917 -45.964 1.00 20.68 ? 381 MET B CA  1 
ATOM   4195 C  C   . MET B 1 206 ? -43.791 -13.406 -44.899 1.00 19.82 ? 381 MET B C   1 
ATOM   4196 O  O   . MET B 1 206 ? -43.997 -12.309 -44.321 1.00 19.97 ? 381 MET B O   1 
ATOM   4197 C  CB  . MET B 1 206 ? -45.777 -14.911 -45.342 1.00 18.92 ? 381 MET B CB  1 
ATOM   4198 C  CG  . MET B 1 206 ? -46.370 -14.379 -44.047 1.00 22.25 ? 381 MET B CG  1 
ATOM   4199 S  SD  . MET B 1 206 ? -47.795 -15.453 -43.521 1.00 24.98 ? 381 MET B SD  1 
ATOM   4200 C  CE  . MET B 1 206 ? -48.443 -14.501 -42.118 1.00 19.40 ? 381 MET B CE  1 
ATOM   4201 N  N   . CYS B 1 207 ? -42.729 -14.184 -44.637 1.00 16.89 ? 382 CYS B N   1 
ATOM   4202 C  CA  . CYS B 1 207 ? -41.708 -13.787 -43.721 1.00 17.97 ? 382 CYS B CA  1 
ATOM   4203 C  C   . CYS B 1 207 ? -41.023 -12.445 -44.237 1.00 17.07 ? 382 CYS B C   1 
ATOM   4204 O  O   . CYS B 1 207 ? -40.903 -11.480 -43.506 1.00 15.02 ? 382 CYS B O   1 
ATOM   4205 C  CB  . CYS B 1 207 ? -40.638 -14.887 -43.634 1.00 20.05 ? 382 CYS B CB  1 
ATOM   4206 S  SG  . CYS B 1 207 ? -39.237 -14.478 -42.635 1.00 26.12 ? 382 CYS B SG  1 
ATOM   4207 N  N   . ASP B 1 208 ? -40.589 -12.440 -45.487 1.00 16.70 ? 383 ASP B N   1 
ATOM   4208 C  CA  . ASP B 1 208 ? -39.921 -11.251 -46.062 1.00 17.47 ? 383 ASP B CA  1 
ATOM   4209 C  C   . ASP B 1 208 ? -40.784 -9.979  -45.950 1.00 17.09 ? 383 ASP B C   1 
ATOM   4210 O  O   . ASP B 1 208 ? -40.270 -8.900  -45.627 1.00 19.39 ? 383 ASP B O   1 
ATOM   4211 C  CB  . ASP B 1 208 ? -39.590 -11.506 -47.541 1.00 16.29 ? 383 ASP B CB  1 
ATOM   4212 C  CG  . ASP B 1 208 ? -38.519 -12.618 -47.742 1.00 17.58 ? 383 ASP B CG  1 
ATOM   4213 O  OD1 . ASP B 1 208 ? -37.647 -12.837 -46.885 1.00 20.45 ? 383 ASP B OD1 1 
ATOM   4214 O  OD2 . ASP B 1 208 ? -38.527 -13.257 -48.789 1.00 17.80 ? 383 ASP B OD2 1 
ATOM   4215 N  N   . LEU B 1 209 ? -42.058 -10.071 -46.313 1.00 17.47 ? 384 LEU B N   1 
ATOM   4216 C  CA  . LEU B 1 209 ? -42.973 -8.931  -46.236 1.00 18.19 ? 384 LEU B CA  1 
ATOM   4217 C  C   . LEU B 1 209 ? -42.951 -8.259  -44.863 1.00 18.04 ? 384 LEU B C   1 
ATOM   4218 O  O   . LEU B 1 209 ? -42.988 -7.028  -44.773 1.00 19.02 ? 384 LEU B O   1 
ATOM   4219 C  CB  . LEU B 1 209 ? -44.428 -9.338  -46.605 1.00 17.72 ? 384 LEU B CB  1 
ATOM   4220 C  CG  . LEU B 1 209 ? -44.713 -9.596  -48.086 1.00 20.40 ? 384 LEU B CG  1 
ATOM   4221 C  CD1 . LEU B 1 209 ? -46.003 -10.399 -48.356 1.00 19.58 ? 384 LEU B CD1 1 
ATOM   4222 C  CD2 . LEU B 1 209 ? -44.730 -8.291  -48.923 1.00 25.08 ? 384 LEU B CD2 1 
ATOM   4223 N  N   . LEU B 1 210 ? -42.915 -9.064  -43.796 1.00 16.39 ? 385 LEU B N   1 
ATOM   4224 C  CA  . LEU B 1 210 ? -42.906 -8.585  -42.412 1.00 16.76 ? 385 LEU B CA  1 
ATOM   4225 C  C   . LEU B 1 210 ? -41.566 -8.115  -41.858 1.00 14.32 ? 385 LEU B C   1 
ATOM   4226 O  O   . LEU B 1 210 ? -41.530 -7.293  -40.916 1.00 15.82 ? 385 LEU B O   1 
ATOM   4227 C  CB  . LEU B 1 210 ? -43.458 -9.712  -41.475 1.00 17.51 ? 385 LEU B CB  1 
ATOM   4228 C  CG  . LEU B 1 210 ? -44.915 -10.029 -41.810 1.00 19.48 ? 385 LEU B CG  1 
ATOM   4229 C  CD1 . LEU B 1 210 ? -45.464 -11.103 -40.882 1.00 22.61 ? 385 LEU B CD1 1 
ATOM   4230 C  CD2 . LEU B 1 210 ? -45.765 -8.744  -41.728 1.00 18.89 ? 385 LEU B CD2 1 
ATOM   4231 N  N   . TRP B 1 211 ? -40.497 -8.706  -42.373 1.00 11.69 ? 386 TRP B N   1 
ATOM   4232 C  CA  . TRP B 1 211 ? -39.168 -8.655  -41.756 1.00 14.57 ? 386 TRP B CA  1 
ATOM   4233 C  C   . TRP B 1 211 ? -37.945 -8.026  -42.494 1.00 12.53 ? 386 TRP B C   1 
ATOM   4234 O  O   . TRP B 1 211 ? -36.919 -7.737  -41.871 1.00 14.36 ? 386 TRP B O   1 
ATOM   4235 C  CB  . TRP B 1 211 ? -38.753 -10.100 -41.400 1.00 13.13 ? 386 TRP B CB  1 
ATOM   4236 C  CG  . TRP B 1 211 ? -39.460 -10.597 -40.080 1.00 14.49 ? 386 TRP B CG  1 
ATOM   4237 C  CD1 . TRP B 1 211 ? -40.581 -11.366 -39.968 1.00 17.33 ? 386 TRP B CD1 1 
ATOM   4238 C  CD2 . TRP B 1 211 ? -39.040 -10.307 -38.747 1.00 17.94 ? 386 TRP B CD2 1 
ATOM   4239 N  NE1 . TRP B 1 211 ? -40.865 -11.621 -38.634 1.00 16.62 ? 386 TRP B NE1 1 
ATOM   4240 C  CE2 . TRP B 1 211 ? -39.949 -10.953 -37.864 1.00 16.35 ? 386 TRP B CE2 1 
ATOM   4241 C  CE3 . TRP B 1 211 ? -37.957 -9.597  -38.209 1.00 20.73 ? 386 TRP B CE3 1 
ATOM   4242 C  CZ2 . TRP B 1 211 ? -39.801 -10.905 -36.478 1.00 18.25 ? 386 TRP B CZ2 1 
ATOM   4243 C  CZ3 . TRP B 1 211 ? -37.816 -9.541  -36.824 1.00 21.56 ? 386 TRP B CZ3 1 
ATOM   4244 C  CH2 . TRP B 1 211 ? -38.734 -10.205 -35.976 1.00 18.31 ? 386 TRP B CH2 1 
ATOM   4245 N  N   . SER B 1 212 ? -38.026 -7.861  -43.804 1.00 15.47 ? 387 SER B N   1 
ATOM   4246 C  CA  . SER B 1 212 ? -36.827 -7.540  -44.558 1.00 15.67 ? 387 SER B CA  1 
ATOM   4247 C  C   . SER B 1 212 ? -36.493 -6.074  -44.479 1.00 15.51 ? 387 SER B C   1 
ATOM   4248 O  O   . SER B 1 212 ? -37.369 -5.271  -44.158 1.00 12.76 ? 387 SER B O   1 
ATOM   4249 C  CB  . SER B 1 212 ? -36.924 -8.074  -45.986 1.00 16.36 ? 387 SER B CB  1 
ATOM   4250 O  OG  . SER B 1 212 ? -37.786 -7.291  -46.757 1.00 17.67 ? 387 SER B OG  1 
ATOM   4251 N  N   . ASP B 1 213 ? -35.230 -5.710  -44.735 1.00 13.91 ? 388 ASP B N   1 
ATOM   4252 C  CA  . ASP B 1 213 ? -34.862 -4.300  -44.746 1.00 15.49 ? 388 ASP B CA  1 
ATOM   4253 C  C   . ASP B 1 213 ? -34.045 -3.942  -46.009 1.00 14.98 ? 388 ASP B C   1 
ATOM   4254 O  O   . ASP B 1 213 ? -33.296 -4.793  -46.468 1.00 15.75 ? 388 ASP B O   1 
ATOM   4255 C  CB  . ASP B 1 213 ? -33.881 -4.012  -43.592 1.00 14.90 ? 388 ASP B CB  1 
ATOM   4256 C  CG  . ASP B 1 213 ? -34.494 -4.234  -42.195 1.00 17.78 ? 388 ASP B CG  1 
ATOM   4257 O  OD1 . ASP B 1 213 ? -35.291 -3.374  -41.765 1.00 15.20 ? 388 ASP B OD1 1 
ATOM   4258 O  OD2 . ASP B 1 213 ? -34.084 -5.194  -41.518 1.00 20.16 ? 388 ASP B OD2 1 
ATOM   4259 N  N   . PRO B 1 214 ? -34.152 -2.695  -46.520 1.00 15.70 ? 389 PRO B N   1 
ATOM   4260 C  CA  . PRO B 1 214 ? -33.287 -2.257  -47.678 1.00 14.94 ? 389 PRO B CA  1 
ATOM   4261 C  C   . PRO B 1 214 ? -31.891 -2.061  -47.201 1.00 16.13 ? 389 PRO B C   1 
ATOM   4262 O  O   . PRO B 1 214 ? -31.693 -1.740  -46.019 1.00 15.75 ? 389 PRO B O   1 
ATOM   4263 C  CB  . PRO B 1 214 ? -33.856 -0.899  -48.042 1.00 15.62 ? 389 PRO B CB  1 
ATOM   4264 C  CG  . PRO B 1 214 ? -34.352 -0.342  -46.667 1.00 15.85 ? 389 PRO B CG  1 
ATOM   4265 C  CD  . PRO B 1 214 ? -35.049 -1.603  -46.059 1.00 15.22 ? 389 PRO B CD  1 
ATOM   4266 N  N   . GLN B 1 215 ? -30.905 -2.294  -48.083 1.00 15.33 ? 390 GLN B N   1 
ATOM   4267 C  CA  . GLN B 1 215 ? -29.553 -1.878  -47.816 1.00 14.85 ? 390 GLN B CA  1 
ATOM   4268 C  C   . GLN B 1 215 ? -29.097 -1.006  -48.999 1.00 14.04 ? 390 GLN B C   1 
ATOM   4269 O  O   . GLN B 1 215 ? -29.676 -1.060  -50.096 1.00 12.25 ? 390 GLN B O   1 
ATOM   4270 C  CB  . GLN B 1 215 ? -28.606 -3.117  -47.626 1.00 14.65 ? 390 GLN B CB  1 
ATOM   4271 C  CG  . GLN B 1 215 ? -28.651 -4.016  -48.887 1.00 14.67 ? 390 GLN B CG  1 
ATOM   4272 C  CD  . GLN B 1 215 ? -27.620 -5.161  -48.890 1.00 17.74 ? 390 GLN B CD  1 
ATOM   4273 O  OE1 . GLN B 1 215 ? -27.316 -5.714  -47.861 1.00 18.72 ? 390 GLN B OE1 1 
ATOM   4274 N  NE2 . GLN B 1 215 ? -27.075 -5.487  -50.063 1.00 16.21 ? 390 GLN B NE2 1 
ATOM   4275 N  N   . PRO B 1 216 ? -28.025 -0.210  -48.780 1.00 15.98 ? 391 PRO B N   1 
ATOM   4276 C  CA  . PRO B 1 216 ? -27.557 0.697   -49.851 1.00 16.88 ? 391 PRO B CA  1 
ATOM   4277 C  C   . PRO B 1 216 ? -26.823 -0.016  -51.009 1.00 17.14 ? 391 PRO B C   1 
ATOM   4278 O  O   . PRO B 1 216 ? -26.875 0.448   -52.122 1.00 17.50 ? 391 PRO B O   1 
ATOM   4279 C  CB  . PRO B 1 216 ? -26.586 1.676   -49.122 1.00 15.58 ? 391 PRO B CB  1 
ATOM   4280 C  CG  . PRO B 1 216 ? -26.174 1.017   -47.870 1.00 16.50 ? 391 PRO B CG  1 
ATOM   4281 C  CD  . PRO B 1 216 ? -27.298 -0.026  -47.512 1.00 14.96 ? 391 PRO B CD  1 
ATOM   4282 N  N   . GLN B 1 217 ? -26.149 -1.114  -50.754 1.00 19.29 ? 392 GLN B N   1 
ATOM   4283 C  CA  . GLN B 1 217 ? -25.296 -1.676  -51.833 1.00 19.63 ? 392 GLN B CA  1 
ATOM   4284 C  C   . GLN B 1 217 ? -26.113 -2.736  -52.563 1.00 19.44 ? 392 GLN B C   1 
ATOM   4285 O  O   . GLN B 1 217 ? -27.038 -3.357  -51.956 1.00 17.94 ? 392 GLN B O   1 
ATOM   4286 C  CB  . GLN B 1 217 ? -24.006 -2.253  -51.254 1.00 21.92 ? 392 GLN B CB  1 
ATOM   4287 C  CG  . GLN B 1 217 ? -24.201 -3.549  -50.454 1.00 21.60 ? 392 GLN B CG  1 
ATOM   4288 C  CD  . GLN B 1 217 ? -24.612 -3.354  -48.978 1.00 28.86 ? 392 GLN B CD  1 
ATOM   4289 O  OE1 . GLN B 1 217 ? -25.319 -2.401  -48.601 1.00 26.30 ? 392 GLN B OE1 1 
ATOM   4290 N  NE2 . GLN B 1 217 ? -24.205 -4.312  -48.144 1.00 30.40 ? 392 GLN B NE2 1 
ATOM   4291 N  N   . ASN B 1 218 ? -25.811 -2.931  -53.851 1.00 17.19 ? 393 ASN B N   1 
ATOM   4292 C  CA  . ASN B 1 218 ? -26.461 -3.971  -54.647 1.00 17.48 ? 393 ASN B CA  1 
ATOM   4293 C  C   . ASN B 1 218 ? -26.308 -5.336  -54.040 1.00 17.55 ? 393 ASN B C   1 
ATOM   4294 O  O   . ASN B 1 218 ? -25.326 -5.601  -53.395 1.00 18.73 ? 393 ASN B O   1 
ATOM   4295 C  CB  . ASN B 1 218 ? -25.919 -3.999  -56.077 1.00 18.26 ? 393 ASN B CB  1 
ATOM   4296 C  CG  . ASN B 1 218 ? -26.398 -2.821  -56.892 1.00 22.54 ? 393 ASN B CG  1 
ATOM   4297 O  OD1 . ASN B 1 218 ? -27.517 -2.378  -56.758 1.00 22.53 ? 393 ASN B OD1 1 
ATOM   4298 N  ND2 . ASN B 1 218 ? -25.534 -2.307  -57.747 1.00 27.18 ? 393 ASN B ND2 1 
ATOM   4299 N  N   . GLY B 1 219 ? -27.321 -6.194  -54.234 1.00 18.55 ? 394 GLY B N   1 
ATOM   4300 C  CA  . GLY B 1 219 ? -27.271 -7.581  -53.809 1.00 16.33 ? 394 GLY B CA  1 
ATOM   4301 C  C   . GLY B 1 219 ? -28.345 -7.860  -52.752 1.00 16.83 ? 394 GLY B C   1 
ATOM   4302 O  O   . GLY B 1 219 ? -29.355 -7.124  -52.641 1.00 16.46 ? 394 GLY B O   1 
ATOM   4303 N  N   . ARG B 1 220 ? -28.126 -8.955  -52.050 1.00 15.72 ? 395 ARG B N   1 
ATOM   4304 C  CA  . ARG B 1 220 ? -28.844 -9.308  -50.836 1.00 16.15 ? 395 ARG B CA  1 
ATOM   4305 C  C   . ARG B 1 220 ? -27.846 -9.767  -49.808 1.00 17.79 ? 395 ARG B C   1 
ATOM   4306 O  O   . ARG B 1 220 ? -26.803 -10.420 -50.165 1.00 15.28 ? 395 ARG B O   1 
ATOM   4307 C  CB  . ARG B 1 220 ? -29.811 -10.449 -51.133 1.00 15.18 ? 395 ARG B CB  1 
ATOM   4308 C  CG  . ARG B 1 220 ? -30.969 -10.086 -52.032 1.00 14.80 ? 395 ARG B CG  1 
ATOM   4309 C  CD  . ARG B 1 220 ? -31.904 -11.285 -52.153 1.00 11.87 ? 395 ARG B CD  1 
ATOM   4310 N  NE  . ARG B 1 220 ? -33.176 -10.968 -52.796 1.00 12.58 ? 395 ARG B NE  1 
ATOM   4311 C  CZ  . ARG B 1 220 ? -33.391 -10.899 -54.116 1.00 14.04 ? 395 ARG B CZ  1 
ATOM   4312 N  NH1 . ARG B 1 220 ? -32.385 -11.055 -55.019 1.00 12.76 ? 395 ARG B NH1 1 
ATOM   4313 N  NH2 . ARG B 1 220 ? -34.610 -10.567 -54.548 1.00 12.11 ? 395 ARG B NH2 1 
ATOM   4314 N  N   . SER B 1 221 ? -28.138 -9.438  -48.540 1.00 16.89 ? 396 SER B N   1 
ATOM   4315 C  CA  . SER B 1 221 ? -27.367 -9.900  -47.400 1.00 18.01 ? 396 SER B CA  1 
ATOM   4316 C  C   . SER B 1 221 ? -28.278 -10.619 -46.431 1.00 19.15 ? 396 SER B C   1 
ATOM   4317 O  O   . SER B 1 221 ? -29.497 -10.323 -46.313 1.00 17.32 ? 396 SER B O   1 
ATOM   4318 C  CB  . SER B 1 221 ? -26.650 -8.726  -46.681 1.00 19.43 ? 396 SER B CB  1 
ATOM   4319 O  OG  . SER B 1 221 ? -25.741 -8.038  -47.577 1.00 22.04 ? 396 SER B OG  1 
ATOM   4320 N  N   . ILE B 1 222 ? -27.675 -11.553 -45.716 1.00 20.66 ? 397 ILE B N   1 
ATOM   4321 C  CA  . ILE B 1 222 ? -28.332 -12.251 -44.610 1.00 22.91 ? 397 ILE B CA  1 
ATOM   4322 C  C   . ILE B 1 222 ? -28.711 -11.197 -43.566 1.00 22.76 ? 397 ILE B C   1 
ATOM   4323 O  O   . ILE B 1 222 ? -27.906 -10.372 -43.222 1.00 20.90 ? 397 ILE B O   1 
ATOM   4324 C  CB  . ILE B 1 222 ? -27.361 -13.252 -44.055 1.00 23.77 ? 397 ILE B CB  1 
ATOM   4325 C  CG1 . ILE B 1 222 ? -27.280 -14.463 -45.005 1.00 24.97 ? 397 ILE B CG1 1 
ATOM   4326 C  CG2 . ILE B 1 222 ? -27.728 -13.679 -42.625 1.00 28.54 ? 397 ILE B CG2 1 
ATOM   4327 C  CD1 . ILE B 1 222 ? -25.957 -15.213 -44.804 1.00 34.66 ? 397 ILE B CD1 1 
ATOM   4328 N  N   . SER B 1 223 ? -29.952 -11.177 -43.103 1.00 23.27 ? 398 SER B N   1 
ATOM   4329 C  CA  . SER B 1 223 ? -30.356 -10.033 -42.273 1.00 24.09 ? 398 SER B CA  1 
ATOM   4330 C  C   . SER B 1 223 ? -29.661 -10.008 -40.899 1.00 24.75 ? 398 SER B C   1 
ATOM   4331 O  O   . SER B 1 223 ? -29.560 -11.032 -40.193 1.00 23.37 ? 398 SER B O   1 
ATOM   4332 C  CB  . SER B 1 223 ? -31.879 -9.990  -42.082 1.00 24.33 ? 398 SER B CB  1 
ATOM   4333 O  OG  . SER B 1 223 ? -32.206 -9.177  -40.977 1.00 23.97 ? 398 SER B OG  1 
ATOM   4334 N  N   . LYS B 1 224 ? -29.232 -8.830  -40.482 1.00 26.14 ? 399 LYS B N   1 
ATOM   4335 C  CA  . LYS B 1 224 ? -28.707 -8.732  -39.117 1.00 28.12 ? 399 LYS B CA  1 
ATOM   4336 C  C   . LYS B 1 224 ? -29.799 -8.977  -38.030 1.00 27.45 ? 399 LYS B C   1 
ATOM   4337 O  O   . LYS B 1 224 ? -29.488 -9.217  -36.880 1.00 28.37 ? 399 LYS B O   1 
ATOM   4338 C  CB  . LYS B 1 224 ? -27.872 -7.458  -38.914 1.00 29.77 ? 399 LYS B CB  1 
ATOM   4339 C  CG  . LYS B 1 224 ? -28.547 -6.202  -39.354 1.00 33.27 ? 399 LYS B CG  1 
ATOM   4340 C  CD  . LYS B 1 224 ? -27.537 -5.146  -39.674 1.00 41.78 ? 399 LYS B CD  1 
ATOM   4341 C  CE  . LYS B 1 224 ? -27.715 -3.952  -38.747 1.00 47.01 ? 399 LYS B CE  1 
ATOM   4342 N  NZ  . LYS B 1 224 ? -28.868 -3.057  -39.189 1.00 49.04 ? 399 LYS B NZ  1 
ATOM   4343 N  N   . ARG B 1 225 ? -31.067 -9.032  -38.411 1.00 25.97 ? 400 ARG B N   1 
ATOM   4344 C  CA  . ARG B 1 225 ? -32.095 -9.426  -37.451 1.00 24.99 ? 400 ARG B CA  1 
ATOM   4345 C  C   . ARG B 1 225 ? -32.183 -10.929 -37.183 1.00 25.21 ? 400 ARG B C   1 
ATOM   4346 O  O   . ARG B 1 225 ? -32.927 -11.353 -36.302 1.00 23.85 ? 400 ARG B O   1 
ATOM   4347 C  CB  . ARG B 1 225 ? -33.454 -8.988  -37.955 1.00 24.38 ? 400 ARG B CB  1 
ATOM   4348 C  CG  . ARG B 1 225 ? -33.579 -7.423  -38.085 1.00 24.41 ? 400 ARG B CG  1 
ATOM   4349 C  CD  . ARG B 1 225 ? -34.925 -7.156  -38.638 1.00 20.65 ? 400 ARG B CD  1 
ATOM   4350 N  NE  . ARG B 1 225 ? -35.178 -5.762  -39.027 1.00 21.55 ? 400 ARG B NE  1 
ATOM   4351 C  CZ  . ARG B 1 225 ? -35.763 -4.832  -38.262 1.00 18.47 ? 400 ARG B CZ  1 
ATOM   4352 N  NH1 . ARG B 1 225 ? -36.145 -5.114  -37.045 1.00 18.76 ? 400 ARG B NH1 1 
ATOM   4353 N  NH2 . ARG B 1 225 ? -35.993 -3.608  -38.738 1.00 17.45 ? 400 ARG B NH2 1 
ATOM   4354 N  N   . GLY B 1 226 ? -31.512 -11.749 -38.001 1.00 24.55 ? 401 GLY B N   1 
ATOM   4355 C  CA  . GLY B 1 226 ? -31.683 -13.184 -37.871 1.00 25.28 ? 401 GLY B CA  1 
ATOM   4356 C  C   . GLY B 1 226 ? -32.829 -13.779 -38.640 1.00 24.59 ? 401 GLY B C   1 
ATOM   4357 O  O   . GLY B 1 226 ? -33.127 -14.954 -38.492 1.00 25.45 ? 401 GLY B O   1 
ATOM   4358 N  N   . VAL B 1 227 ? -33.504 -12.988 -39.466 1.00 24.55 ? 402 VAL B N   1 
ATOM   4359 C  CA  . VAL B 1 227 ? -34.600 -13.530 -40.243 1.00 23.85 ? 402 VAL B CA  1 
ATOM   4360 C  C   . VAL B 1 227 ? -34.752 -12.700 -41.511 1.00 22.15 ? 402 VAL B C   1 
ATOM   4361 O  O   . VAL B 1 227 ? -34.533 -11.508 -41.453 1.00 22.04 ? 402 VAL B O   1 
ATOM   4362 C  CB  . VAL B 1 227 ? -35.928 -13.540 -39.388 1.00 24.17 ? 402 VAL B CB  1 
ATOM   4363 C  CG1 . VAL B 1 227 ? -35.871 -12.450 -38.370 1.00 25.62 ? 402 VAL B CG1 1 
ATOM   4364 C  CG2 . VAL B 1 227 ? -37.119 -13.369 -40.182 1.00 23.30 ? 402 VAL B CG2 1 
ATOM   4365 N  N   . SER B 1 228 ? -35.135 -13.338 -42.619 1.00 20.33 ? 403 SER B N   1 
ATOM   4366 C  CA  . SER B 1 228 ? -35.253 -12.668 -43.928 1.00 20.03 ? 403 SER B CA  1 
ATOM   4367 C  C   . SER B 1 228 ? -33.854 -12.093 -44.338 1.00 18.67 ? 403 SER B C   1 
ATOM   4368 O  O   . SER B 1 228 ? -32.832 -12.614 -43.871 1.00 17.10 ? 403 SER B O   1 
ATOM   4369 C  CB  . SER B 1 228 ? -36.353 -11.562 -43.870 1.00 19.01 ? 403 SER B CB  1 
ATOM   4370 O  OG  . SER B 1 228 ? -36.658 -11.069 -45.154 1.00 22.03 ? 403 SER B OG  1 
ATOM   4371 N  N   . CYS B 1 229 ? -33.828 -10.993 -45.116 1.00 17.32 ? 404 CYS B N   1 
ATOM   4372 C  CA  . CYS B 1 229 ? -32.583 -10.529 -45.740 1.00 17.45 ? 404 CYS B CA  1 
ATOM   4373 C  C   . CYS B 1 229 ? -32.584 -9.008  -45.775 1.00 17.88 ? 404 CYS B C   1 
ATOM   4374 O  O   . CYS B 1 229 ? -33.616 -8.374  -45.513 1.00 17.36 ? 404 CYS B O   1 
ATOM   4375 C  CB  . CYS B 1 229 ? -32.436 -11.068 -47.230 1.00 16.23 ? 404 CYS B CB  1 
ATOM   4376 S  SG  . CYS B 1 229 ? -33.573 -10.363 -48.479 1.00 20.21 ? 404 CYS B SG  1 
ATOM   4377 N  N   . GLN B 1 230 ? -31.436 -8.425  -46.108 1.00 16.92 ? 405 GLN B N   1 
ATOM   4378 C  CA  . GLN B 1 230 ? -31.412 -7.068  -46.563 1.00 16.96 ? 405 GLN B CA  1 
ATOM   4379 C  C   . GLN B 1 230 ? -31.361 -7.068  -48.131 1.00 15.99 ? 405 GLN B C   1 
ATOM   4380 O  O   . GLN B 1 230 ? -30.707 -7.927  -48.704 1.00 14.17 ? 405 GLN B O   1 
ATOM   4381 C  CB  . GLN B 1 230 ? -30.184 -6.412  -45.956 1.00 19.37 ? 405 GLN B CB  1 
ATOM   4382 C  CG  . GLN B 1 230 ? -30.209 -6.382  -44.471 1.00 24.63 ? 405 GLN B CG  1 
ATOM   4383 C  CD  . GLN B 1 230 ? -28.807 -6.335  -43.925 1.00 34.61 ? 405 GLN B CD  1 
ATOM   4384 O  OE1 . GLN B 1 230 ? -28.431 -7.177  -43.098 1.00 41.41 ? 405 GLN B OE1 1 
ATOM   4385 N  NE2 . GLN B 1 230 ? -27.995 -5.396  -44.427 1.00 30.66 ? 405 GLN B NE2 1 
ATOM   4386 N  N   . PHE B 1 231 ? -32.041 -6.132  -48.799 1.00 13.12 ? 406 PHE B N   1 
ATOM   4387 C  CA  . PHE B 1 231 ? -32.132 -6.143  -50.290 1.00 14.07 ? 406 PHE B CA  1 
ATOM   4388 C  C   . PHE B 1 231 ? -31.596 -4.815  -50.840 1.00 14.31 ? 406 PHE B C   1 
ATOM   4389 O  O   . PHE B 1 231 ? -31.953 -3.714  -50.314 1.00 13.40 ? 406 PHE B O   1 
ATOM   4390 C  CB  . PHE B 1 231 ? -33.546 -6.414  -50.823 1.00 13.10 ? 406 PHE B CB  1 
ATOM   4391 C  CG  . PHE B 1 231 ? -34.615 -5.431  -50.273 1.00 16.13 ? 406 PHE B CG  1 
ATOM   4392 C  CD1 . PHE B 1 231 ? -35.224 -5.672  -49.020 1.00 15.21 ? 406 PHE B CD1 1 
ATOM   4393 C  CD2 . PHE B 1 231 ? -34.996 -4.304  -50.991 1.00 12.10 ? 406 PHE B CD2 1 
ATOM   4394 C  CE1 . PHE B 1 231 ? -36.174 -4.770  -48.481 1.00 9.21  ? 406 PHE B CE1 1 
ATOM   4395 C  CE2 . PHE B 1 231 ? -36.033 -3.395  -50.480 1.00 11.70 ? 406 PHE B CE2 1 
ATOM   4396 C  CZ  . PHE B 1 231 ? -36.586 -3.637  -49.233 1.00 14.40 ? 406 PHE B CZ  1 
ATOM   4397 N  N   . GLY B 1 232 ? -30.722 -4.897  -51.848 1.00 14.50 ? 407 GLY B N   1 
ATOM   4398 C  CA  . GLY B 1 232 ? -30.138 -3.652  -52.408 1.00 14.57 ? 407 GLY B CA  1 
ATOM   4399 C  C   . GLY B 1 232 ? -31.037 -2.977  -53.457 1.00 13.95 ? 407 GLY B C   1 
ATOM   4400 O  O   . GLY B 1 232 ? -32.128 -3.467  -53.802 1.00 13.11 ? 407 GLY B O   1 
ATOM   4401 N  N   . PRO B 1 233 ? -30.590 -1.825  -53.982 1.00 15.06 ? 408 PRO B N   1 
ATOM   4402 C  CA  . PRO B 1 233 ? -31.451 -1.078  -54.943 1.00 14.94 ? 408 PRO B CA  1 
ATOM   4403 C  C   . PRO B 1 233 ? -31.689 -1.794  -56.266 1.00 14.09 ? 408 PRO B C   1 
ATOM   4404 O  O   . PRO B 1 233 ? -32.670 -1.493  -56.951 1.00 13.73 ? 408 PRO B O   1 
ATOM   4405 C  CB  . PRO B 1 233 ? -30.701 0.251   -55.192 1.00 16.38 ? 408 PRO B CB  1 
ATOM   4406 C  CG  . PRO B 1 233 ? -29.349 0.152   -54.531 1.00 17.28 ? 408 PRO B CG  1 
ATOM   4407 C  CD  . PRO B 1 233 ? -29.283 -1.183  -53.709 1.00 16.01 ? 408 PRO B CD  1 
ATOM   4408 N  N   . ASP B 1 234 ? -30.794 -2.711  -56.639 1.00 13.33 ? 409 ASP B N   1 
ATOM   4409 C  CA  . ASP B 1 234 ? -31.028 -3.536  -57.834 1.00 15.24 ? 409 ASP B CA  1 
ATOM   4410 C  C   . ASP B 1 234 ? -32.231 -4.472  -57.640 1.00 14.43 ? 409 ASP B C   1 
ATOM   4411 O  O   . ASP B 1 234 ? -32.993 -4.712  -58.558 1.00 15.58 ? 409 ASP B O   1 
ATOM   4412 C  CB  . ASP B 1 234 ? -29.764 -4.366  -58.193 1.00 15.50 ? 409 ASP B CB  1 
ATOM   4413 C  CG  . ASP B 1 234 ? -29.175 -5.194  -56.993 1.00 16.46 ? 409 ASP B CG  1 
ATOM   4414 O  OD1 . ASP B 1 234 ? -29.479 -5.050  -55.755 1.00 18.51 ? 409 ASP B OD1 1 
ATOM   4415 O  OD2 . ASP B 1 234 ? -28.257 -5.997  -57.298 1.00 20.24 ? 409 ASP B OD2 1 
ATOM   4416 N  N   . VAL B 1 235 ? -32.407 -4.995  -56.427 1.00 13.97 ? 410 VAL B N   1 
ATOM   4417 C  CA  . VAL B 1 235 ? -33.549 -5.868  -56.134 1.00 13.96 ? 410 VAL B CA  1 
ATOM   4418 C  C   . VAL B 1 235 ? -34.811 -5.039  -56.292 1.00 14.59 ? 410 VAL B C   1 
ATOM   4419 O  O   . VAL B 1 235 ? -35.790 -5.506  -56.883 1.00 14.98 ? 410 VAL B O   1 
ATOM   4420 C  CB  . VAL B 1 235 ? -33.474 -6.462  -54.640 1.00 13.43 ? 410 VAL B CB  1 
ATOM   4421 C  CG1 . VAL B 1 235 ? -34.855 -7.090  -54.181 1.00 12.94 ? 410 VAL B CG1 1 
ATOM   4422 C  CG2 . VAL B 1 235 ? -32.300 -7.475  -54.469 1.00 10.76 ? 410 VAL B CG2 1 
ATOM   4423 N  N   . THR B 1 236 ? -34.795 -3.808  -55.759 1.00 14.20 ? 411 THR B N   1 
ATOM   4424 C  CA  . THR B 1 236 ? -36.012 -2.987  -55.767 1.00 15.25 ? 411 THR B CA  1 
ATOM   4425 C  C   . THR B 1 236 ? -36.385 -2.617  -57.211 1.00 15.65 ? 411 THR B C   1 
ATOM   4426 O  O   . THR B 1 236 ? -37.535 -2.666  -57.623 1.00 15.08 ? 411 THR B O   1 
ATOM   4427 C  CB  . THR B 1 236 ? -35.825 -1.669  -54.961 1.00 13.81 ? 411 THR B CB  1 
ATOM   4428 O  OG1 . THR B 1 236 ? -35.466 -1.991  -53.648 1.00 15.77 ? 411 THR B OG1 1 
ATOM   4429 C  CG2 . THR B 1 236 ? -37.163 -0.859  -54.904 1.00 14.76 ? 411 THR B CG2 1 
ATOM   4430 N  N   . LYS B 1 237 ? -35.377 -2.229  -57.993 1.00 15.74 ? 412 LYS B N   1 
ATOM   4431 C  CA  . LYS B 1 237 ? -35.636 -1.882  -59.404 1.00 17.47 ? 412 LYS B CA  1 
ATOM   4432 C  C   . LYS B 1 237 ? -36.190 -3.048  -60.228 1.00 17.24 ? 412 LYS B C   1 
ATOM   4433 O  O   . LYS B 1 237 ? -37.147 -2.928  -60.979 1.00 16.89 ? 412 LYS B O   1 
ATOM   4434 C  CB  . LYS B 1 237 ? -34.312 -1.367  -60.013 1.00 19.68 ? 412 LYS B CB  1 
ATOM   4435 C  CG  . LYS B 1 237 ? -34.537 -0.674  -61.342 1.00 26.39 ? 412 LYS B CG  1 
ATOM   4436 C  CD  . LYS B 1 237 ? -33.243 0.114   -61.757 1.00 38.26 ? 412 LYS B CD  1 
ATOM   4437 C  CE  . LYS B 1 237 ? -33.285 0.530   -63.264 1.00 42.71 ? 412 LYS B CE  1 
ATOM   4438 N  NZ  . LYS B 1 237 ? -33.522 -0.668  -64.160 1.00 46.35 ? 412 LYS B NZ  1 
ATOM   4439 N  N   . ALA B 1 238 ? -35.619 -4.222  -60.077 1.00 16.31 ? 413 ALA B N   1 
ATOM   4440 C  CA  . ALA B 1 238 ? -36.180 -5.354  -60.760 1.00 15.65 ? 413 ALA B CA  1 
ATOM   4441 C  C   . ALA B 1 238 ? -37.625 -5.678  -60.343 1.00 15.13 ? 413 ALA B C   1 
ATOM   4442 O  O   . ALA B 1 238 ? -38.455 -5.998  -61.173 1.00 15.79 ? 413 ALA B O   1 
ATOM   4443 C  CB  . ALA B 1 238 ? -35.256 -6.622  -60.586 1.00 15.30 ? 413 ALA B CB  1 
ATOM   4444 N  N   . PHE B 1 239 ? -37.917 -5.611  -59.062 1.00 16.71 ? 414 PHE B N   1 
ATOM   4445 C  CA  . PHE B 1 239 ? -39.272 -5.925  -58.575 1.00 15.70 ? 414 PHE B CA  1 
ATOM   4446 C  C   . PHE B 1 239 ? -40.289 -4.919  -59.144 1.00 16.01 ? 414 PHE B C   1 
ATOM   4447 O  O   . PHE B 1 239 ? -41.350 -5.301  -59.626 1.00 15.38 ? 414 PHE B O   1 
ATOM   4448 C  CB  . PHE B 1 239 ? -39.283 -5.900  -57.015 1.00 16.07 ? 414 PHE B CB  1 
ATOM   4449 C  CG  . PHE B 1 239 ? -40.634 -6.125  -56.440 1.00 14.93 ? 414 PHE B CG  1 
ATOM   4450 C  CD1 . PHE B 1 239 ? -41.106 -7.430  -56.258 1.00 14.36 ? 414 PHE B CD1 1 
ATOM   4451 C  CD2 . PHE B 1 239 ? -41.467 -5.045  -56.141 1.00 14.66 ? 414 PHE B CD2 1 
ATOM   4452 C  CE1 . PHE B 1 239 ? -42.411 -7.687  -55.736 1.00 13.80 ? 414 PHE B CE1 1 
ATOM   4453 C  CE2 . PHE B 1 239 ? -42.769 -5.275  -55.594 1.00 17.04 ? 414 PHE B CE2 1 
ATOM   4454 C  CZ  . PHE B 1 239 ? -43.246 -6.608  -55.393 1.00 15.06 ? 414 PHE B CZ  1 
ATOM   4455 N  N   . LEU B 1 240 ? -39.957 -3.625  -59.026 1.00 15.48 ? 415 LEU B N   1 
ATOM   4456 C  CA  . LEU B 1 240 ? -40.789 -2.552  -59.527 1.00 16.85 ? 415 LEU B CA  1 
ATOM   4457 C  C   . LEU B 1 240 ? -41.039 -2.653  -61.066 1.00 18.01 ? 415 LEU B C   1 
ATOM   4458 O  O   . LEU B 1 240 ? -42.194 -2.506  -61.504 1.00 18.45 ? 415 LEU B O   1 
ATOM   4459 C  CB  . LEU B 1 240 ? -40.201 -1.181  -59.160 1.00 16.75 ? 415 LEU B CB  1 
ATOM   4460 C  CG  . LEU B 1 240 ? -40.107 -0.807  -57.671 1.00 15.51 ? 415 LEU B CG  1 
ATOM   4461 C  CD1 . LEU B 1 240 ? -39.336 0.498   -57.574 1.00 13.81 ? 415 LEU B CD1 1 
ATOM   4462 C  CD2 . LEU B 1 240 ? -41.515 -0.642  -57.079 1.00 15.65 ? 415 LEU B CD2 1 
ATOM   4463 N  N   . GLU B 1 241 ? -39.984 -2.918  -61.833 1.00 17.62 ? 416 GLU B N   1 
ATOM   4464 C  CA  . GLU B 1 241 ? -40.102 -3.084  -63.305 1.00 20.77 ? 416 GLU B CA  1 
ATOM   4465 C  C   . GLU B 1 241 ? -41.036 -4.242  -63.690 1.00 21.48 ? 416 GLU B C   1 
ATOM   4466 O  O   . GLU B 1 241 ? -41.983 -4.075  -64.480 1.00 22.09 ? 416 GLU B O   1 
ATOM   4467 C  CB  . GLU B 1 241 ? -38.699 -3.259  -63.941 0.50 19.09 ? 416 GLU B CB  1 
ATOM   4468 C  CG  . GLU B 1 241 ? -37.838 -1.989  -63.776 0.50 25.78 ? 416 GLU B CG  1 
ATOM   4469 C  CD  . GLU B 1 241 ? -36.379 -2.110  -64.241 0.50 30.68 ? 416 GLU B CD  1 
ATOM   4470 O  OE1 . GLU B 1 241 ? -35.778 -3.212  -64.148 0.50 34.28 ? 416 GLU B OE1 1 
ATOM   4471 O  OE2 . GLU B 1 241 ? -35.822 -1.074  -64.680 0.50 30.47 ? 416 GLU B OE2 1 
ATOM   4472 N  N   . GLU B 1 242 ? -40.772 -5.417  -63.145 1.00 23.03 ? 417 GLU B N   1 
ATOM   4473 C  CA  . GLU B 1 242 ? -41.658 -6.596  -63.382 1.00 22.96 ? 417 GLU B CA  1 
ATOM   4474 C  C   . GLU B 1 242 ? -43.108 -6.325  -62.994 1.00 22.81 ? 417 GLU B C   1 
ATOM   4475 O  O   . GLU B 1 242 ? -44.039 -6.890  -63.567 1.00 20.94 ? 417 GLU B O   1 
ATOM   4476 C  CB  . GLU B 1 242 ? -41.184 -7.773  -62.525 1.00 23.75 ? 417 GLU B CB  1 
ATOM   4477 C  CG  . GLU B 1 242 ? -41.108 -9.052  -63.271 1.00 29.86 ? 417 GLU B CG  1 
ATOM   4478 C  CD  . GLU B 1 242 ? -41.227 -10.338 -62.422 1.00 36.39 ? 417 GLU B CD  1 
ATOM   4479 O  OE1 . GLU B 1 242 ? -41.979 -11.240 -62.870 1.00 37.91 ? 417 GLU B OE1 1 
ATOM   4480 O  OE2 . GLU B 1 242 ? -40.545 -10.500 -61.374 1.00 37.80 ? 417 GLU B OE2 1 
ATOM   4481 N  N   . ASN B 1 243 ? -43.310 -5.523  -61.949 1.00 21.05 ? 418 ASN B N   1 
ATOM   4482 C  CA  . ASN B 1 243 ? -44.664 -5.395  -61.431 1.00 20.52 ? 418 ASN B CA  1 
ATOM   4483 C  C   . ASN B 1 243 ? -45.388 -4.137  -61.908 1.00 20.94 ? 418 ASN B C   1 
ATOM   4484 O  O   . ASN B 1 243 ? -46.524 -3.852  -61.537 1.00 20.82 ? 418 ASN B O   1 
ATOM   4485 C  CB  . ASN B 1 243 ? -44.647 -5.569  -59.916 1.00 18.73 ? 418 ASN B CB  1 
ATOM   4486 C  CG  . ASN B 1 243 ? -44.438 -7.031  -59.550 1.00 19.00 ? 418 ASN B CG  1 
ATOM   4487 O  OD1 . ASN B 1 243 ? -45.355 -7.832  -59.790 1.00 18.77 ? 418 ASN B OD1 1 
ATOM   4488 N  ND2 . ASN B 1 243 ? -43.219 -7.415  -59.062 1.00 18.02 ? 418 ASN B ND2 1 
ATOM   4489 N  N   . ASN B 1 244 ? -44.686 -3.412  -62.752 1.00 22.01 ? 419 ASN B N   1 
ATOM   4490 C  CA  . ASN B 1 244 ? -45.108 -2.107  -63.190 1.00 23.37 ? 419 ASN B CA  1 
ATOM   4491 C  C   . ASN B 1 244 ? -45.410 -1.069  -62.117 1.00 21.85 ? 419 ASN B C   1 
ATOM   4492 O  O   . ASN B 1 244 ? -46.375 -0.348  -62.248 1.00 20.68 ? 419 ASN B O   1 
ATOM   4493 C  CB  . ASN B 1 244 ? -46.343 -2.233  -64.050 1.00 25.81 ? 419 ASN B CB  1 
ATOM   4494 C  CG  . ASN B 1 244 ? -46.036 -1.835  -65.413 1.00 31.85 ? 419 ASN B CG  1 
ATOM   4495 O  OD1 . ASN B 1 244 ? -46.071 -0.613  -65.749 1.00 33.99 ? 419 ASN B OD1 1 
ATOM   4496 N  ND2 . ASN B 1 244 ? -45.521 -2.815  -66.190 1.00 35.39 ? 419 ASN B ND2 1 
ATOM   4497 N  N   . LEU B 1 245 ? -44.551 -0.975  -61.119 1.00 20.50 ? 420 LEU B N   1 
ATOM   4498 C  CA  . LEU B 1 245 ? -44.775 -0.116  -59.962 1.00 20.74 ? 420 LEU B CA  1 
ATOM   4499 C  C   . LEU B 1 245 ? -43.820 1.056   -60.038 1.00 19.71 ? 420 LEU B C   1 
ATOM   4500 O  O   . LEU B 1 245 ? -42.773 0.930   -60.636 1.00 18.84 ? 420 LEU B O   1 
ATOM   4501 C  CB  . LEU B 1 245 ? -44.549 -0.905  -58.662 1.00 20.17 ? 420 LEU B CB  1 
ATOM   4502 C  CG  . LEU B 1 245 ? -45.530 -2.057  -58.363 1.00 22.32 ? 420 LEU B CG  1 
ATOM   4503 C  CD1 . LEU B 1 245 ? -44.927 -2.907  -57.195 1.00 17.32 ? 420 LEU B CD1 1 
ATOM   4504 C  CD2 . LEU B 1 245 ? -47.006 -1.518  -58.017 1.00 16.82 ? 420 LEU B CD2 1 
ATOM   4505 N  N   . ASP B 1 246 ? -44.199 2.177   -59.424 1.00 20.15 ? 421 ASP B N   1 
ATOM   4506 C  CA  . ASP B 1 246 ? -43.322 3.357   -59.246 1.00 19.49 ? 421 ASP B CA  1 
ATOM   4507 C  C   . ASP B 1 246 ? -42.392 3.286   -58.057 1.00 18.52 ? 421 ASP B C   1 
ATOM   4508 O  O   . ASP B 1 246 ? -41.241 3.570   -58.227 1.00 15.18 ? 421 ASP B O   1 
ATOM   4509 C  CB  . ASP B 1 246 ? -44.163 4.640   -59.123 1.00 21.17 ? 421 ASP B CB  1 
ATOM   4510 C  CG  . ASP B 1 246 ? -44.849 5.007   -60.433 1.00 25.89 ? 421 ASP B CG  1 
ATOM   4511 O  OD1 . ASP B 1 246 ? -44.341 4.665   -61.537 1.00 31.18 ? 421 ASP B OD1 1 
ATOM   4512 O  OD2 . ASP B 1 246 ? -45.902 5.635   -60.363 1.00 31.39 ? 421 ASP B OD2 1 
ATOM   4513 N  N   . TYR B 1 247 ? -42.881 2.930   -56.847 1.00 16.25 ? 422 TYR B N   1 
ATOM   4514 C  CA  . TYR B 1 247 ? -42.024 2.776   -55.684 1.00 15.96 ? 422 TYR B CA  1 
ATOM   4515 C  C   . TYR B 1 247 ? -42.746 2.004   -54.556 1.00 15.98 ? 422 TYR B C   1 
ATOM   4516 O  O   . TYR B 1 247 ? -43.983 1.706   -54.656 1.00 18.50 ? 422 TYR B O   1 
ATOM   4517 C  CB  . TYR B 1 247 ? -41.508 4.123   -55.127 1.00 14.06 ? 422 TYR B CB  1 
ATOM   4518 C  CG  . TYR B 1 247 ? -42.591 5.029   -54.577 1.00 17.75 ? 422 TYR B CG  1 
ATOM   4519 C  CD1 . TYR B 1 247 ? -43.430 5.797   -55.436 1.00 18.21 ? 422 TYR B CD1 1 
ATOM   4520 C  CD2 . TYR B 1 247 ? -42.772 5.155   -53.208 1.00 18.24 ? 422 TYR B CD2 1 
ATOM   4521 C  CE1 . TYR B 1 247 ? -44.420 6.686   -54.905 1.00 19.41 ? 422 TYR B CE1 1 
ATOM   4522 C  CE2 . TYR B 1 247 ? -43.747 6.001   -52.663 1.00 19.14 ? 422 TYR B CE2 1 
ATOM   4523 C  CZ  . TYR B 1 247 ? -44.572 6.757   -53.504 1.00 19.08 ? 422 TYR B CZ  1 
ATOM   4524 O  OH  . TYR B 1 247 ? -45.514 7.555   -52.892 1.00 19.19 ? 422 TYR B OH  1 
ATOM   4525 N  N   . ILE B 1 248 ? -41.995 1.724   -53.495 1.00 16.02 ? 423 ILE B N   1 
ATOM   4526 C  CA  . ILE B 1 248 ? -42.580 1.054   -52.310 1.00 15.73 ? 423 ILE B CA  1 
ATOM   4527 C  C   . ILE B 1 248 ? -42.492 1.965   -51.101 1.00 14.24 ? 423 ILE B C   1 
ATOM   4528 O  O   . ILE B 1 248 ? -41.591 2.765   -50.991 1.00 15.26 ? 423 ILE B O   1 
ATOM   4529 C  CB  . ILE B 1 248 ? -41.964 -0.303  -52.047 1.00 15.60 ? 423 ILE B CB  1 
ATOM   4530 C  CG1 . ILE B 1 248 ? -40.520 -0.199  -51.556 1.00 19.44 ? 423 ILE B CG1 1 
ATOM   4531 C  CG2 . ILE B 1 248 ? -42.126 -1.245  -53.310 1.00 17.92 ? 423 ILE B CG2 1 
ATOM   4532 C  CD1 . ILE B 1 248 ? -39.950 -1.573  -50.942 1.00 20.66 ? 423 ILE B CD1 1 
ATOM   4533 N  N   . ILE B 1 249 ? -43.446 1.845   -50.205 1.00 14.00 ? 424 ILE B N   1 
ATOM   4534 C  CA  . ILE B 1 249 ? -43.387 2.481   -48.910 1.00 12.57 ? 424 ILE B CA  1 
ATOM   4535 C  C   . ILE B 1 249 ? -43.392 1.351   -47.868 1.00 13.01 ? 424 ILE B C   1 
ATOM   4536 O  O   . ILE B 1 249 ? -44.223 0.450   -47.915 1.00 13.08 ? 424 ILE B O   1 
ATOM   4537 C  CB  . ILE B 1 249 ? -44.629 3.344   -48.675 1.00 14.47 ? 424 ILE B CB  1 
ATOM   4538 C  CG1 . ILE B 1 249 ? -44.706 4.491   -49.706 1.00 12.88 ? 424 ILE B CG1 1 
ATOM   4539 C  CG2 . ILE B 1 249 ? -44.565 3.899   -47.296 1.00 12.88 ? 424 ILE B CG2 1 
ATOM   4540 C  CD1 . ILE B 1 249 ? -46.094 5.189   -49.766 1.00 10.70 ? 424 ILE B CD1 1 
ATOM   4541 N  N   . ARG B 1 250 ? -42.456 1.404   -46.933 1.00 12.95 ? 425 ARG B N   1 
ATOM   4542 C  CA  . ARG B 1 250 ? -42.384 0.349   -45.911 1.00 14.04 ? 425 ARG B CA  1 
ATOM   4543 C  C   . ARG B 1 250 ? -42.111 1.038   -44.596 1.00 12.40 ? 425 ARG B C   1 
ATOM   4544 O  O   . ARG B 1 250 ? -41.922 2.279   -44.580 1.00 12.08 ? 425 ARG B O   1 
ATOM   4545 C  CB  . ARG B 1 250 ? -41.401 -0.788  -46.322 1.00 13.98 ? 425 ARG B CB  1 
ATOM   4546 C  CG  . ARG B 1 250 ? -40.082 -0.273  -46.908 1.00 16.10 ? 425 ARG B CG  1 
ATOM   4547 C  CD  . ARG B 1 250 ? -39.178 0.158   -45.728 1.00 14.62 ? 425 ARG B CD  1 
ATOM   4548 N  NE  . ARG B 1 250 ? -38.682 -1.003  -44.976 1.00 13.23 ? 425 ARG B NE  1 
ATOM   4549 C  CZ  . ARG B 1 250 ? -37.665 -1.030  -44.102 1.00 10.00 ? 425 ARG B CZ  1 
ATOM   4550 N  NH1 . ARG B 1 250 ? -36.989 0.057   -43.818 1.00 11.33 ? 425 ARG B NH1 1 
ATOM   4551 N  NH2 . ARG B 1 250 ? -37.330 -2.175  -43.472 1.00 9.63  ? 425 ARG B NH2 1 
ATOM   4552 N  N   . SER B 1 251 ? -42.089 0.313   -43.485 1.00 12.46 ? 426 SER B N   1 
ATOM   4553 C  CA  . SER B 1 251 ? -41.796 0.935   -42.186 1.00 14.80 ? 426 SER B CA  1 
ATOM   4554 C  C   . SER B 1 251 ? -40.691 0.207   -41.467 1.00 14.90 ? 426 SER B C   1 
ATOM   4555 O  O   . SER B 1 251 ? -39.604 0.129   -42.002 1.00 16.66 ? 426 SER B O   1 
ATOM   4556 C  CB  . SER B 1 251 ? -43.054 1.020   -41.311 1.00 12.97 ? 426 SER B CB  1 
ATOM   4557 O  OG  . SER B 1 251 ? -43.970 1.784   -42.058 1.00 14.28 ? 426 SER B OG  1 
ATOM   4558 N  N   . HIS B 1 252 ? -40.957 -0.316  -40.276 1.00 16.65 ? 427 HIS B N   1 
ATOM   4559 C  CA  . HIS B 1 252 ? -40.073 -1.369  -39.673 1.00 16.33 ? 427 HIS B CA  1 
ATOM   4560 C  C   . HIS B 1 252 ? -38.744 -0.922  -39.104 1.00 17.56 ? 427 HIS B C   1 
ATOM   4561 O  O   . HIS B 1 252 ? -38.243 -1.559  -38.203 1.00 18.08 ? 427 HIS B O   1 
ATOM   4562 C  CB  . HIS B 1 252 ? -39.931 -2.508  -40.730 1.00 17.14 ? 427 HIS B CB  1 
ATOM   4563 C  CG  . HIS B 1 252 ? -39.275 -3.795  -40.289 1.00 17.08 ? 427 HIS B CG  1 
ATOM   4564 N  ND1 . HIS B 1 252 ? -39.606 -4.488  -39.143 1.00 12.21 ? 427 HIS B ND1 1 
ATOM   4565 C  CD2 . HIS B 1 252 ? -38.366 -4.584  -40.949 1.00 18.26 ? 427 HIS B CD2 1 
ATOM   4566 C  CE1 . HIS B 1 252 ? -38.935 -5.634  -39.094 1.00 18.49 ? 427 HIS B CE1 1 
ATOM   4567 N  NE2 . HIS B 1 252 ? -38.178 -5.726  -40.197 1.00 16.34 ? 427 HIS B NE2 1 
ATOM   4568 N  N   . GLU B 1 253 ? -38.186 0.195   -39.547 1.00 18.22 ? 428 GLU B N   1 
ATOM   4569 C  CA  . GLU B 1 253 ? -36.999 0.748   -38.909 1.00 19.84 ? 428 GLU B CA  1 
ATOM   4570 C  C   . GLU B 1 253 ? -37.206 2.173   -38.441 1.00 20.48 ? 428 GLU B C   1 
ATOM   4571 O  O   . GLU B 1 253 ? -37.742 3.013   -39.216 1.00 19.65 ? 428 GLU B O   1 
ATOM   4572 C  CB  . GLU B 1 253 ? -35.786 0.768   -39.865 1.00 19.92 ? 428 GLU B CB  1 
ATOM   4573 C  CG  . GLU B 1 253 ? -35.313 -0.571  -40.344 1.00 22.05 ? 428 GLU B CG  1 
ATOM   4574 C  CD  . GLU B 1 253 ? -34.184 -0.415  -41.403 1.00 24.01 ? 428 GLU B CD  1 
ATOM   4575 O  OE1 . GLU B 1 253 ? -34.499 -0.166  -42.595 1.00 21.14 ? 428 GLU B OE1 1 
ATOM   4576 O  OE2 . GLU B 1 253 ? -33.001 -0.560  -41.022 1.00 28.71 ? 428 GLU B OE2 1 
ATOM   4577 N  N   . VAL B 1 254 ? -36.782 2.438   -37.191 1.00 21.98 ? 429 VAL B N   1 
ATOM   4578 C  CA  . VAL B 1 254 ? -36.772 3.815   -36.654 1.00 23.08 ? 429 VAL B CA  1 
ATOM   4579 C  C   . VAL B 1 254 ? -35.841 4.725   -37.466 1.00 22.51 ? 429 VAL B C   1 
ATOM   4580 O  O   . VAL B 1 254 ? -34.741 4.350   -37.885 1.00 22.43 ? 429 VAL B O   1 
ATOM   4581 C  CB  . VAL B 1 254 ? -36.426 3.878   -35.116 1.00 25.56 ? 429 VAL B CB  1 
ATOM   4582 C  CG1 . VAL B 1 254 ? -35.147 3.064   -34.770 1.00 27.02 ? 429 VAL B CG1 1 
ATOM   4583 C  CG2 . VAL B 1 254 ? -36.238 5.363   -34.636 1.00 23.51 ? 429 VAL B CG2 1 
ATOM   4584 N  N   . LYS B 1 255 ? -36.307 5.922   -37.719 1.00 20.94 ? 430 LYS B N   1 
ATOM   4585 C  CA  . LYS B 1 255 ? -35.536 6.875   -38.480 1.00 20.94 ? 430 LYS B CA  1 
ATOM   4586 C  C   . LYS B 1 255 ? -35.517 8.175   -37.672 1.00 20.93 ? 430 LYS B C   1 
ATOM   4587 O  O   . LYS B 1 255 ? -36.575 8.621   -37.196 1.00 20.76 ? 430 LYS B O   1 
ATOM   4588 C  CB  . LYS B 1 255 ? -36.187 7.114   -39.870 1.00 19.74 ? 430 LYS B CB  1 
ATOM   4589 C  CG  . LYS B 1 255 ? -36.180 5.844   -40.842 1.00 19.22 ? 430 LYS B CG  1 
ATOM   4590 C  CD  . LYS B 1 255 ? -34.760 5.416   -41.135 1.00 19.29 ? 430 LYS B CD  1 
ATOM   4591 C  CE  . LYS B 1 255 ? -34.644 4.066   -41.882 1.00 18.48 ? 430 LYS B CE  1 
ATOM   4592 N  NZ  . LYS B 1 255 ? -33.182 3.729   -42.079 1.00 16.84 ? 430 LYS B NZ  1 
ATOM   4593 N  N   . ALA B 1 256 ? -34.343 8.782   -37.517 1.00 21.77 ? 431 ALA B N   1 
ATOM   4594 C  CA  . ALA B 1 256 ? -34.218 10.057  -36.766 1.00 22.39 ? 431 ALA B CA  1 
ATOM   4595 C  C   . ALA B 1 256 ? -35.182 11.163  -37.210 1.00 23.14 ? 431 ALA B C   1 
ATOM   4596 O  O   . ALA B 1 256 ? -35.706 11.920  -36.362 1.00 24.22 ? 431 ALA B O   1 
ATOM   4597 C  CB  . ALA B 1 256 ? -32.702 10.598  -36.756 1.00 23.95 ? 431 ALA B CB  1 
ATOM   4598 N  N   . GLU B 1 257 ? -35.424 11.275  -38.517 1.00 21.02 ? 432 GLU B N   1 
ATOM   4599 C  CA  . GLU B 1 257 ? -36.309 12.305  -39.042 1.00 20.53 ? 432 GLU B CA  1 
ATOM   4600 C  C   . GLU B 1 257 ? -37.708 11.798  -39.272 1.00 18.32 ? 432 GLU B C   1 
ATOM   4601 O  O   . GLU B 1 257 ? -38.522 12.525  -39.858 1.00 17.56 ? 432 GLU B O   1 
ATOM   4602 C  CB  . GLU B 1 257 ? -35.781 12.918  -40.375 1.00 21.60 ? 432 GLU B CB  1 
ATOM   4603 C  CG  . GLU B 1 257 ? -34.458 13.627  -40.198 1.00 28.10 ? 432 GLU B CG  1 
ATOM   4604 C  CD  . GLU B 1 257 ? -34.583 14.794  -39.198 1.00 37.35 ? 432 GLU B CD  1 
ATOM   4605 O  OE1 . GLU B 1 257 ? -35.492 15.653  -39.372 1.00 39.30 ? 432 GLU B OE1 1 
ATOM   4606 O  OE2 . GLU B 1 257 ? -33.802 14.809  -38.218 1.00 41.43 ? 432 GLU B OE2 1 
ATOM   4607 N  N   . GLY B 1 258 ? -37.974 10.530  -38.899 1.00 17.24 ? 433 GLY B N   1 
ATOM   4608 C  CA  . GLY B 1 258 ? -39.305 9.954   -39.126 1.00 16.66 ? 433 GLY B CA  1 
ATOM   4609 C  C   . GLY B 1 258 ? -39.505 9.288   -40.457 1.00 15.76 ? 433 GLY B C   1 
ATOM   4610 O  O   . GLY B 1 258 ? -40.578 8.689   -40.747 1.00 16.41 ? 433 GLY B O   1 
ATOM   4611 N  N   . TYR B 1 259 ? -38.536 9.471   -41.350 1.00 15.98 ? 434 TYR B N   1 
ATOM   4612 C  CA  . TYR B 1 259 ? -38.659 8.935   -42.703 1.00 15.58 ? 434 TYR B CA  1 
ATOM   4613 C  C   . TYR B 1 259 ? -37.249 8.819   -43.333 1.00 16.14 ? 434 TYR B C   1 
ATOM   4614 O  O   . TYR B 1 259 ? -36.313 9.431   -42.848 1.00 16.87 ? 434 TYR B O   1 
ATOM   4615 C  CB  . TYR B 1 259 ? -39.602 9.764   -43.624 1.00 15.68 ? 434 TYR B CB  1 
ATOM   4616 C  CG  . TYR B 1 259 ? -39.003 11.097  -44.046 1.00 18.99 ? 434 TYR B CG  1 
ATOM   4617 C  CD1 . TYR B 1 259 ? -39.006 12.203  -43.148 1.00 20.65 ? 434 TYR B CD1 1 
ATOM   4618 C  CD2 . TYR B 1 259 ? -38.409 11.256  -45.296 1.00 16.53 ? 434 TYR B CD2 1 
ATOM   4619 C  CE1 . TYR B 1 259 ? -38.437 13.435  -43.513 1.00 21.81 ? 434 TYR B CE1 1 
ATOM   4620 C  CE2 . TYR B 1 259 ? -37.844 12.484  -45.664 1.00 19.84 ? 434 TYR B CE2 1 
ATOM   4621 C  CZ  . TYR B 1 259 ? -37.860 13.552  -44.787 1.00 24.53 ? 434 TYR B CZ  1 
ATOM   4622 O  OH  . TYR B 1 259 ? -37.259 14.734  -45.169 1.00 23.60 ? 434 TYR B OH  1 
ATOM   4623 N  N   . GLU B 1 260 ? -37.195 8.119   -44.458 1.00 17.15 ? 435 GLU B N   1 
ATOM   4624 C  CA  . GLU B 1 260 ? -36.020 7.964   -45.299 1.00 18.11 ? 435 GLU B CA  1 
ATOM   4625 C  C   . GLU B 1 260 ? -36.454 7.598   -46.715 1.00 18.17 ? 435 GLU B C   1 
ATOM   4626 O  O   . GLU B 1 260 ? -37.492 6.912   -46.935 1.00 18.65 ? 435 GLU B O   1 
ATOM   4627 C  CB  . GLU B 1 260 ? -34.980 6.959   -44.701 1.00 18.54 ? 435 GLU B CB  1 
ATOM   4628 C  CG  . GLU B 1 260 ? -33.812 6.638   -45.662 1.00 23.58 ? 435 GLU B CG  1 
ATOM   4629 C  CD  . GLU B 1 260 ? -32.663 5.849   -45.001 1.00 27.79 ? 435 GLU B CD  1 
ATOM   4630 O  OE1 . GLU B 1 260 ? -31.945 5.084   -45.722 1.00 25.64 ? 435 GLU B OE1 1 
ATOM   4631 O  OE2 . GLU B 1 260 ? -32.466 6.032   -43.782 1.00 27.95 ? 435 GLU B OE2 1 
ATOM   4632 N  N   . VAL B 1 261 ? -35.704 8.102   -47.725 1.00 17.34 ? 436 VAL B N   1 
ATOM   4633 C  CA  . VAL B 1 261 ? -36.015 7.749   -49.108 1.00 16.66 ? 436 VAL B CA  1 
ATOM   4634 C  C   . VAL B 1 261 ? -34.744 7.107   -49.646 1.00 17.26 ? 436 VAL B C   1 
ATOM   4635 O  O   . VAL B 1 261 ? -33.723 7.793   -49.828 1.00 17.15 ? 436 VAL B O   1 
ATOM   4636 C  CB  . VAL B 1 261 ? -36.494 8.959   -49.980 1.00 17.03 ? 436 VAL B CB  1 
ATOM   4637 C  CG1 . VAL B 1 261 ? -36.937 8.470   -51.355 1.00 19.09 ? 436 VAL B CG1 1 
ATOM   4638 C  CG2 . VAL B 1 261 ? -37.675 9.669   -49.300 1.00 16.85 ? 436 VAL B CG2 1 
ATOM   4639 N  N   . ALA B 1 262 ? -34.782 5.785   -49.843 1.00 15.66 ? 437 ALA B N   1 
ATOM   4640 C  CA  . ALA B 1 262 ? -33.574 5.045   -50.234 1.00 15.43 ? 437 ALA B CA  1 
ATOM   4641 C  C   . ALA B 1 262 ? -33.674 4.590   -51.685 1.00 14.33 ? 437 ALA B C   1 
ATOM   4642 O  O   . ALA B 1 262 ? -34.682 4.846   -52.306 1.00 13.88 ? 437 ALA B O   1 
ATOM   4643 C  CB  . ALA B 1 262 ? -33.381 3.821   -49.307 1.00 14.25 ? 437 ALA B CB  1 
ATOM   4644 N  N   . HIS B 1 263 ? -32.615 3.940   -52.233 1.00 14.43 ? 438 HIS B N   1 
ATOM   4645 C  CA  . HIS B 1 263 ? -32.697 3.259   -53.551 1.00 14.30 ? 438 HIS B CA  1 
ATOM   4646 C  C   . HIS B 1 263 ? -33.067 4.243   -54.666 1.00 14.69 ? 438 HIS B C   1 
ATOM   4647 O  O   . HIS B 1 263 ? -33.846 3.979   -55.615 1.00 13.30 ? 438 HIS B O   1 
ATOM   4648 C  CB  . HIS B 1 263 ? -33.670 2.064   -53.478 1.00 15.68 ? 438 HIS B CB  1 
ATOM   4649 C  CG  . HIS B 1 263 ? -33.174 0.961   -52.605 1.00 13.93 ? 438 HIS B CG  1 
ATOM   4650 N  ND1 . HIS B 1 263 ? -33.819 -0.260  -52.514 1.00 15.35 ? 438 HIS B ND1 1 
ATOM   4651 C  CD2 . HIS B 1 263 ? -32.087 0.884   -51.805 1.00 16.02 ? 438 HIS B CD2 1 
ATOM   4652 C  CE1 . HIS B 1 263 ? -33.143 -1.034  -51.679 1.00 13.51 ? 438 HIS B CE1 1 
ATOM   4653 N  NE2 . HIS B 1 263 ? -32.084 -0.369  -51.243 1.00 14.84 ? 438 HIS B NE2 1 
ATOM   4654 N  N   . GLY B 1 264 ? -32.462 5.420   -54.532 1.00 16.33 ? 439 GLY B N   1 
ATOM   4655 C  CA  . GLY B 1 264 ? -32.772 6.533   -55.403 1.00 17.07 ? 439 GLY B CA  1 
ATOM   4656 C  C   . GLY B 1 264 ? -34.190 7.077   -55.525 1.00 18.22 ? 439 GLY B C   1 
ATOM   4657 O  O   . GLY B 1 264 ? -34.546 7.572   -56.608 1.00 18.51 ? 439 GLY B O   1 
ATOM   4658 N  N   . GLY B 1 265 ? -35.013 6.979   -54.469 1.00 17.57 ? 440 GLY B N   1 
ATOM   4659 C  CA  . GLY B 1 265 ? -36.464 7.279   -54.580 1.00 16.75 ? 440 GLY B CA  1 
ATOM   4660 C  C   . GLY B 1 265 ? -37.393 6.042   -54.579 1.00 18.03 ? 440 GLY B C   1 
ATOM   4661 O  O   . GLY B 1 265 ? -38.606 6.158   -54.478 1.00 20.90 ? 440 GLY B O   1 
ATOM   4662 N  N   . ARG B 1 266 ? -36.850 4.856   -54.714 1.00 16.48 ? 441 ARG B N   1 
ATOM   4663 C  CA  . ARG B 1 266 ? -37.678 3.667   -54.908 1.00 16.26 ? 441 ARG B CA  1 
ATOM   4664 C  C   . ARG B 1 266 ? -38.162 2.961   -53.642 1.00 15.24 ? 441 ARG B C   1 
ATOM   4665 O  O   . ARG B 1 266 ? -39.081 2.149   -53.707 1.00 15.86 ? 441 ARG B O   1 
ATOM   4666 C  CB  . ARG B 1 266 ? -36.889 2.667   -55.715 1.00 16.88 ? 441 ARG B CB  1 
ATOM   4667 C  CG  . ARG B 1 266 ? -36.570 3.147   -57.112 1.00 20.31 ? 441 ARG B CG  1 
ATOM   4668 C  CD  . ARG B 1 266 ? -37.819 3.262   -57.992 1.00 34.07 ? 441 ARG B CD  1 
ATOM   4669 N  NE  . ARG B 1 266 ? -37.493 2.602   -59.281 1.00 42.24 ? 441 ARG B NE  1 
ATOM   4670 C  CZ  . ARG B 1 266 ? -38.283 2.355   -60.342 1.00 40.88 ? 441 ARG B CZ  1 
ATOM   4671 N  NH1 . ARG B 1 266 ? -39.626 2.741   -60.446 1.00 33.30 ? 441 ARG B NH1 1 
ATOM   4672 N  NH2 . ARG B 1 266 ? -37.653 1.714   -61.322 1.00 30.13 ? 441 ARG B NH2 1 
ATOM   4673 N  N   . CYS B 1 267 ? -37.474 3.195   -52.540 1.00 15.74 ? 442 CYS B N   1 
ATOM   4674 C  CA  . CYS B 1 267 ? -37.769 2.536   -51.266 1.00 16.78 ? 442 CYS B CA  1 
ATOM   4675 C  C   . CYS B 1 267 ? -37.897 3.584   -50.168 1.00 16.14 ? 442 CYS B C   1 
ATOM   4676 O  O   . CYS B 1 267 ? -36.908 4.093   -49.646 1.00 16.99 ? 442 CYS B O   1 
ATOM   4677 C  CB  . CYS B 1 267 ? -36.670 1.523   -50.893 1.00 16.72 ? 442 CYS B CB  1 
ATOM   4678 S  SG  . CYS B 1 267 ? -37.266 0.562   -49.426 1.00 19.42 ? 442 CYS B SG  1 
ATOM   4679 N  N   . VAL B 1 268 ? -39.122 3.944   -49.870 1.00 15.02 ? 443 VAL B N   1 
ATOM   4680 C  CA  . VAL B 1 268 ? -39.422 4.958   -48.826 1.00 14.66 ? 443 VAL B CA  1 
ATOM   4681 C  C   . VAL B 1 268 ? -39.696 4.279   -47.451 1.00 14.57 ? 443 VAL B C   1 
ATOM   4682 O  O   . VAL B 1 268 ? -40.483 3.311   -47.379 1.00 15.59 ? 443 VAL B O   1 
ATOM   4683 C  CB  . VAL B 1 268 ? -40.683 5.738   -49.261 1.00 14.66 ? 443 VAL B CB  1 
ATOM   4684 C  CG1 . VAL B 1 268 ? -41.183 6.656   -48.115 1.00 16.32 ? 443 VAL B CG1 1 
ATOM   4685 C  CG2 . VAL B 1 268 ? -40.353 6.481   -50.589 1.00 12.82 ? 443 VAL B CG2 1 
ATOM   4686 N  N   . THR B 1 269 ? -39.050 4.762   -46.388 1.00 13.73 ? 444 THR B N   1 
ATOM   4687 C  CA  . THR B 1 269 ? -39.425 4.343   -45.021 1.00 14.74 ? 444 THR B CA  1 
ATOM   4688 C  C   . THR B 1 269 ? -40.206 5.467   -44.308 1.00 15.83 ? 444 THR B C   1 
ATOM   4689 O  O   . THR B 1 269 ? -39.817 6.643   -44.349 1.00 15.40 ? 444 THR B O   1 
ATOM   4690 C  CB  . THR B 1 269 ? -38.204 3.973   -44.130 1.00 15.87 ? 444 THR B CB  1 
ATOM   4691 O  OG1 . THR B 1 269 ? -37.391 2.960   -44.747 1.00 15.27 ? 444 THR B OG1 1 
ATOM   4692 C  CG2 . THR B 1 269 ? -38.623 3.449   -42.675 1.00 15.89 ? 444 THR B CG2 1 
ATOM   4693 N  N   . VAL B 1 270 ? -41.316 5.081   -43.683 1.00 15.10 ? 445 VAL B N   1 
ATOM   4694 C  CA  . VAL B 1 270 ? -42.117 5.981   -42.841 1.00 15.50 ? 445 VAL B CA  1 
ATOM   4695 C  C   . VAL B 1 270 ? -42.264 5.306   -41.474 1.00 15.85 ? 445 VAL B C   1 
ATOM   4696 O  O   . VAL B 1 270 ? -42.541 4.115   -41.386 1.00 15.03 ? 445 VAL B O   1 
ATOM   4697 C  CB  . VAL B 1 270 ? -43.497 6.344   -43.531 1.00 15.04 ? 445 VAL B CB  1 
ATOM   4698 C  CG1 . VAL B 1 270 ? -44.353 5.072   -43.794 1.00 16.78 ? 445 VAL B CG1 1 
ATOM   4699 C  CG2 . VAL B 1 270 ? -44.320 7.398   -42.630 1.00 14.93 ? 445 VAL B CG2 1 
ATOM   4700 N  N   . PHE B 1 271 ? -41.989 6.061   -40.410 1.00 15.47 ? 446 PHE B N   1 
ATOM   4701 C  CA  . PHE B 1 271 ? -41.965 5.553   -39.084 1.00 16.67 ? 446 PHE B CA  1 
ATOM   4702 C  C   . PHE B 1 271 ? -42.746 6.516   -38.169 1.00 16.94 ? 446 PHE B C   1 
ATOM   4703 O  O   . PHE B 1 271 ? -42.403 7.710   -38.082 1.00 17.97 ? 446 PHE B O   1 
ATOM   4704 C  CB  . PHE B 1 271 ? -40.493 5.414   -38.599 1.00 16.05 ? 446 PHE B CB  1 
ATOM   4705 C  CG  . PHE B 1 271 ? -40.367 4.723   -37.309 1.00 18.30 ? 446 PHE B CG  1 
ATOM   4706 C  CD1 . PHE B 1 271 ? -40.509 3.338   -37.229 1.00 20.70 ? 446 PHE B CD1 1 
ATOM   4707 C  CD2 . PHE B 1 271 ? -40.127 5.460   -36.129 1.00 21.12 ? 446 PHE B CD2 1 
ATOM   4708 C  CE1 . PHE B 1 271 ? -40.381 2.671   -35.966 1.00 21.16 ? 446 PHE B CE1 1 
ATOM   4709 C  CE2 . PHE B 1 271 ? -40.018 4.805   -34.876 1.00 22.55 ? 446 PHE B CE2 1 
ATOM   4710 C  CZ  . PHE B 1 271 ? -40.148 3.409   -34.810 1.00 20.93 ? 446 PHE B CZ  1 
ATOM   4711 N  N   . SER B 1 272 ? -43.790 6.030   -37.499 1.00 17.28 ? 447 SER B N   1 
ATOM   4712 C  CA  . SER B 1 272 ? -44.718 6.956   -36.818 1.00 17.56 ? 447 SER B CA  1 
ATOM   4713 C  C   . SER B 1 272 ? -44.739 6.990   -35.277 1.00 16.90 ? 447 SER B C   1 
ATOM   4714 O  O   . SER B 1 272 ? -45.741 7.384   -34.666 1.00 16.62 ? 447 SER B O   1 
ATOM   4715 C  CB  . SER B 1 272 ? -46.156 6.811   -37.353 1.00 17.37 ? 447 SER B CB  1 
ATOM   4716 O  OG  . SER B 1 272 ? -46.168 7.082   -38.725 1.00 18.35 ? 447 SER B OG  1 
ATOM   4717 N  N   . ALA B 1 273 ? -43.633 6.610   -34.684 1.00 16.94 ? 448 ALA B N   1 
ATOM   4718 C  CA  . ALA B 1 273 ? -43.451 6.520   -33.201 1.00 16.70 ? 448 ALA B CA  1 
ATOM   4719 C  C   . ALA B 1 273 ? -42.382 7.523   -32.803 1.00 17.50 ? 448 ALA B C   1 
ATOM   4720 O  O   . ALA B 1 273 ? -41.158 7.191   -32.812 1.00 18.35 ? 448 ALA B O   1 
ATOM   4721 C  CB  . ALA B 1 273 ? -43.004 5.120   -32.814 1.00 15.43 ? 448 ALA B CB  1 
ATOM   4722 N  N   . PRO B 1 274 ? -42.790 8.758   -32.501 1.00 17.04 ? 449 PRO B N   1 
ATOM   4723 C  CA  . PRO B 1 274 ? -41.731 9.745   -32.134 1.00 18.35 ? 449 PRO B CA  1 
ATOM   4724 C  C   . PRO B 1 274 ? -41.095 9.459   -30.765 1.00 19.21 ? 449 PRO B C   1 
ATOM   4725 O  O   . PRO B 1 274 ? -41.694 8.830   -29.942 1.00 18.91 ? 449 PRO B O   1 
ATOM   4726 C  CB  . PRO B 1 274 ? -42.474 11.109  -32.138 1.00 17.13 ? 449 PRO B CB  1 
ATOM   4727 C  CG  . PRO B 1 274 ? -43.988 10.719  -31.845 1.00 19.05 ? 449 PRO B CG  1 
ATOM   4728 C  CD  . PRO B 1 274 ? -44.174 9.289   -32.419 1.00 17.28 ? 449 PRO B CD  1 
ATOM   4729 N  N   . ASN B 1 275 ? -39.866 9.923   -30.545 1.00 22.13 ? 450 ASN B N   1 
ATOM   4730 C  CA  . ASN B 1 275 ? -39.089 9.582   -29.362 1.00 24.57 ? 450 ASN B CA  1 
ATOM   4731 C  C   . ASN B 1 275 ? -39.321 8.109   -28.962 1.00 25.18 ? 450 ASN B C   1 
ATOM   4732 O  O   . ASN B 1 275 ? -39.677 7.762   -27.820 1.00 24.68 ? 450 ASN B O   1 
ATOM   4733 C  CB  . ASN B 1 275 ? -39.384 10.593  -28.221 1.00 25.73 ? 450 ASN B CB  1 
ATOM   4734 C  CG  . ASN B 1 275 ? -38.391 10.487  -27.051 1.00 28.11 ? 450 ASN B CG  1 
ATOM   4735 O  OD1 . ASN B 1 275 ? -37.202 10.146  -27.215 1.00 25.07 ? 450 ASN B OD1 1 
ATOM   4736 N  ND2 . ASN B 1 275 ? -38.907 10.729  -25.853 1.00 25.38 ? 450 ASN B ND2 1 
ATOM   4737 N  N   . TYR B 1 276 ? -39.101 7.242   -29.939 1.00 25.07 ? 451 TYR B N   1 
ATOM   4738 C  CA  . TYR B 1 276 ? -39.369 5.820   -29.784 1.00 25.69 ? 451 TYR B CA  1 
ATOM   4739 C  C   . TYR B 1 276 ? -38.871 5.253   -28.441 1.00 26.34 ? 451 TYR B C   1 
ATOM   4740 O  O   . TYR B 1 276 ? -37.712 5.474   -28.050 1.00 25.83 ? 451 TYR B O   1 
ATOM   4741 C  CB  . TYR B 1 276 ? -38.668 5.111   -30.932 1.00 24.49 ? 451 TYR B CB  1 
ATOM   4742 C  CG  . TYR B 1 276 ? -38.903 3.649   -31.060 1.00 24.04 ? 451 TYR B CG  1 
ATOM   4743 C  CD1 . TYR B 1 276 ? -40.189 3.102   -31.007 1.00 23.90 ? 451 TYR B CD1 1 
ATOM   4744 C  CD2 . TYR B 1 276 ? -37.834 2.792   -31.334 1.00 25.47 ? 451 TYR B CD2 1 
ATOM   4745 C  CE1 . TYR B 1 276 ? -40.384 1.713   -31.197 1.00 23.55 ? 451 TYR B CE1 1 
ATOM   4746 C  CE2 . TYR B 1 276 ? -38.031 1.412   -31.500 1.00 22.69 ? 451 TYR B CE2 1 
ATOM   4747 C  CZ  . TYR B 1 276 ? -39.304 0.892   -31.443 1.00 24.51 ? 451 TYR B CZ  1 
ATOM   4748 O  OH  . TYR B 1 276 ? -39.484 -0.471  -31.630 1.00 24.21 ? 451 TYR B OH  1 
ATOM   4749 N  N   . CYS B 1 277 ? -39.736 4.494   -27.761 1.00 26.89 ? 452 CYS B N   1 
ATOM   4750 C  CA  . CYS B 1 277 ? -39.407 3.963   -26.448 1.00 29.10 ? 452 CYS B CA  1 
ATOM   4751 C  C   . CYS B 1 277 ? -38.935 5.071   -25.425 1.00 29.35 ? 452 CYS B C   1 
ATOM   4752 O  O   . CYS B 1 277 ? -38.079 4.818   -24.593 1.00 29.29 ? 452 CYS B O   1 
ATOM   4753 C  CB  . CYS B 1 277 ? -38.328 2.853   -26.632 1.00 29.35 ? 452 CYS B CB  1 
ATOM   4754 S  SG  . CYS B 1 277 ? -38.946 1.400   -27.537 1.00 32.70 ? 452 CYS B SG  1 
ATOM   4755 N  N   . ASP B 1 278 ? -39.446 6.302   -25.523 1.00 30.25 ? 453 ASP B N   1 
ATOM   4756 C  CA  . ASP B 1 278 ? -39.067 7.376   -24.582 1.00 31.68 ? 453 ASP B CA  1 
ATOM   4757 C  C   . ASP B 1 278 ? -37.561 7.671   -24.553 1.00 33.05 ? 453 ASP B C   1 
ATOM   4758 O  O   . ASP B 1 278 ? -37.082 8.415   -23.703 1.00 32.84 ? 453 ASP B O   1 
ATOM   4759 C  CB  . ASP B 1 278 ? -39.562 7.044   -23.151 1.00 32.23 ? 453 ASP B CB  1 
ATOM   4760 C  CG  . ASP B 1 278 ? -41.094 7.054   -23.048 1.00 33.02 ? 453 ASP B CG  1 
ATOM   4761 O  OD1 . ASP B 1 278 ? -41.727 7.783   -23.838 1.00 35.08 ? 453 ASP B OD1 1 
ATOM   4762 O  OD2 . ASP B 1 278 ? -41.669 6.344   -22.196 1.00 37.28 ? 453 ASP B OD2 1 
ATOM   4763 N  N   . GLN B 1 279 ? -36.838 7.141   -25.532 1.00 33.89 ? 454 GLN B N   1 
ATOM   4764 C  CA  . GLN B 1 279 ? -35.382 7.178   -25.567 1.00 34.80 ? 454 GLN B CA  1 
ATOM   4765 C  C   . GLN B 1 279 ? -34.739 7.747   -26.848 1.00 34.18 ? 454 GLN B C   1 
ATOM   4766 O  O   . GLN B 1 279 ? -33.770 8.461   -26.771 1.00 34.69 ? 454 GLN B O   1 
ATOM   4767 C  CB  . GLN B 1 279 ? -34.899 5.750   -25.536 1.00 35.09 ? 454 GLN B CB  1 
ATOM   4768 C  CG  . GLN B 1 279 ? -34.868 5.067   -24.234 1.00 39.43 ? 454 GLN B CG  1 
ATOM   4769 C  CD  . GLN B 1 279 ? -34.191 3.724   -24.400 1.00 43.10 ? 454 GLN B CD  1 
ATOM   4770 O  OE1 . GLN B 1 279 ? -33.081 3.636   -24.937 1.00 44.40 ? 454 GLN B OE1 1 
ATOM   4771 N  NE2 . GLN B 1 279 ? -34.872 2.668   -23.994 1.00 47.42 ? 454 GLN B NE2 1 
ATOM   4772 N  N   . MET B 1 280 ? -35.232 7.393   -28.033 1.00 34.07 ? 455 MET B N   1 
ATOM   4773 C  CA  . MET B 1 280 ? -34.435 7.664   -29.248 1.00 33.67 ? 455 MET B CA  1 
ATOM   4774 C  C   . MET B 1 280 ? -34.432 9.097   -29.701 1.00 31.97 ? 455 MET B C   1 
ATOM   4775 O  O   . MET B 1 280 ? -33.599 9.489   -30.529 1.00 32.43 ? 455 MET B O   1 
ATOM   4776 C  CB  . MET B 1 280 ? -34.834 6.761   -30.404 1.00 35.05 ? 455 MET B CB  1 
ATOM   4777 C  CG  . MET B 1 280 ? -35.116 5.349   -29.987 1.00 39.89 ? 455 MET B CG  1 
ATOM   4778 S  SD  . MET B 1 280 ? -33.657 4.308   -30.032 1.00 53.41 ? 455 MET B SD  1 
ATOM   4779 C  CE  . MET B 1 280 ? -34.403 2.665   -30.020 1.00 50.07 ? 455 MET B CE  1 
ATOM   4780 N  N   . GLY B 1 281 ? -35.332 9.913   -29.174 1.00 30.33 ? 456 GLY B N   1 
ATOM   4781 C  CA  . GLY B 1 281 ? -35.329 11.328  -29.550 1.00 28.49 ? 456 GLY B CA  1 
ATOM   4782 C  C   . GLY B 1 281 ? -35.687 11.638  -31.017 1.00 27.37 ? 456 GLY B C   1 
ATOM   4783 O  O   . GLY B 1 281 ? -35.668 12.792  -31.442 1.00 28.20 ? 456 GLY B O   1 
ATOM   4784 N  N   . ASN B 1 282 ? -36.049 10.617  -31.787 1.00 25.31 ? 457 ASN B N   1 
ATOM   4785 C  CA  . ASN B 1 282 ? -36.461 10.803  -33.186 1.00 22.75 ? 457 ASN B CA  1 
ATOM   4786 C  C   . ASN B 1 282 ? -37.785 11.556  -33.398 1.00 22.14 ? 457 ASN B C   1 
ATOM   4787 O  O   . ASN B 1 282 ? -38.737 11.444  -32.597 1.00 22.47 ? 457 ASN B O   1 
ATOM   4788 C  CB  . ASN B 1 282 ? -36.592 9.418   -33.839 1.00 22.47 ? 457 ASN B CB  1 
ATOM   4789 C  CG  . ASN B 1 282 ? -37.729 8.548   -33.196 1.00 22.45 ? 457 ASN B CG  1 
ATOM   4790 O  OD1 . ASN B 1 282 ? -37.586 8.052   -32.086 1.00 22.57 ? 457 ASN B OD1 1 
ATOM   4791 N  ND2 . ASN B 1 282 ? -38.792 8.296   -33.953 1.00 22.39 ? 457 ASN B ND2 1 
ATOM   4792 N  N   . LYS B 1 283 ? -37.866 12.282  -34.503 1.00 20.50 ? 458 LYS B N   1 
ATOM   4793 C  CA  . LYS B 1 283 ? -39.130 12.727  -35.028 1.00 20.62 ? 458 LYS B CA  1 
ATOM   4794 C  C   . LYS B 1 283 ? -39.845 11.530  -35.616 1.00 19.35 ? 458 LYS B C   1 
ATOM   4795 O  O   . LYS B 1 283 ? -39.247 10.479  -35.881 1.00 18.47 ? 458 LYS B O   1 
ATOM   4796 C  CB  . LYS B 1 283 ? -38.897 13.776  -36.118 1.00 22.50 ? 458 LYS B CB  1 
ATOM   4797 C  CG  . LYS B 1 283 ? -38.114 15.017  -35.639 1.00 25.07 ? 458 LYS B CG  1 
ATOM   4798 C  CD  . LYS B 1 283 ? -38.006 16.059  -36.745 1.00 27.97 ? 458 LYS B CD  1 
ATOM   4799 C  CE  . LYS B 1 283 ? -36.754 16.980  -36.558 1.00 36.42 ? 458 LYS B CE  1 
ATOM   4800 N  NZ  . LYS B 1 283 ? -35.435 16.244  -36.307 1.00 39.07 ? 458 LYS B NZ  1 
ATOM   4801 N  N   . ALA B 1 284 ? -41.141 11.680  -35.807 1.00 19.08 ? 459 ALA B N   1 
ATOM   4802 C  CA  . ALA B 1 284 ? -41.901 10.697  -36.522 1.00 17.64 ? 459 ALA B CA  1 
ATOM   4803 C  C   . ALA B 1 284 ? -42.432 11.438  -37.764 1.00 17.59 ? 459 ALA B C   1 
ATOM   4804 O  O   . ALA B 1 284 ? -42.291 12.670  -37.876 1.00 17.25 ? 459 ALA B O   1 
ATOM   4805 C  CB  . ALA B 1 284 ? -43.046 10.130  -35.638 1.00 16.12 ? 459 ALA B CB  1 
ATOM   4806 N  N   . SER B 1 285 ? -43.005 10.694  -38.702 1.00 16.13 ? 460 SER B N   1 
ATOM   4807 C  CA  . SER B 1 285 ? -43.703 11.282  -39.796 1.00 17.21 ? 460 SER B CA  1 
ATOM   4808 C  C   . SER B 1 285 ? -44.816 10.464  -40.249 1.00 16.74 ? 460 SER B C   1 
ATOM   4809 O  O   . SER B 1 285 ? -44.959 9.304   -39.895 1.00 18.19 ? 460 SER B O   1 
ATOM   4810 C  CB  . SER B 1 285 ? -42.773 11.549  -41.023 1.00 18.23 ? 460 SER B CB  1 
ATOM   4811 O  OG  . SER B 1 285 ? -42.643 10.395  -41.783 1.00 18.96 ? 460 SER B OG  1 
ATOM   4812 N  N   . TYR B 1 286 ? -45.691 11.087  -40.994 1.00 17.79 ? 461 TYR B N   1 
ATOM   4813 C  CA  . TYR B 1 286 ? -46.627 10.329  -41.826 1.00 17.86 ? 461 TYR B CA  1 
ATOM   4814 C  C   . TYR B 1 286 ? -46.565 10.904  -43.241 1.00 18.03 ? 461 TYR B C   1 
ATOM   4815 O  O   . TYR B 1 286 ? -46.043 11.996  -43.471 1.00 18.42 ? 461 TYR B O   1 
ATOM   4816 C  CB  . TYR B 1 286 ? -48.101 10.365  -41.312 1.00 17.54 ? 461 TYR B CB  1 
ATOM   4817 C  CG  . TYR B 1 286 ? -48.627 11.768  -40.986 1.00 18.38 ? 461 TYR B CG  1 
ATOM   4818 C  CD1 . TYR B 1 286 ? -49.253 12.550  -41.959 1.00 19.92 ? 461 TYR B CD1 1 
ATOM   4819 C  CD2 . TYR B 1 286 ? -48.441 12.307  -39.730 1.00 20.57 ? 461 TYR B CD2 1 
ATOM   4820 C  CE1 . TYR B 1 286 ? -49.736 13.842  -41.641 1.00 25.92 ? 461 TYR B CE1 1 
ATOM   4821 C  CE2 . TYR B 1 286 ? -48.893 13.602  -39.407 1.00 24.74 ? 461 TYR B CE2 1 
ATOM   4822 C  CZ  . TYR B 1 286 ? -49.549 14.334  -40.363 1.00 25.92 ? 461 TYR B CZ  1 
ATOM   4823 O  OH  . TYR B 1 286 ? -49.965 15.583  -40.051 1.00 29.81 ? 461 TYR B OH  1 
ATOM   4824 N  N   . ILE B 1 287 ? -47.164 10.193  -44.176 1.00 18.19 ? 462 ILE B N   1 
ATOM   4825 C  CA  . ILE B 1 287 ? -47.077 10.568  -45.555 1.00 19.95 ? 462 ILE B CA  1 
ATOM   4826 C  C   . ILE B 1 287 ? -48.490 10.868  -46.109 1.00 20.51 ? 462 ILE B C   1 
ATOM   4827 O  O   . ILE B 1 287 ? -49.457 10.126  -45.800 1.00 20.12 ? 462 ILE B O   1 
ATOM   4828 C  CB  . ILE B 1 287 ? -46.543 9.361   -46.371 1.00 19.72 ? 462 ILE B CB  1 
ATOM   4829 C  CG1 . ILE B 1 287 ? -45.016 9.195   -46.231 1.00 18.33 ? 462 ILE B CG1 1 
ATOM   4830 C  CG2 . ILE B 1 287 ? -46.882 9.533   -47.859 1.00 20.05 ? 462 ILE B CG2 1 
ATOM   4831 C  CD1 . ILE B 1 287 ? -44.529 7.742   -46.739 1.00 20.63 ? 462 ILE B CD1 1 
ATOM   4832 N  N   . HIS B 1 288 ? -48.614 11.912  -46.922 1.00 20.27 ? 463 HIS B N   1 
ATOM   4833 C  CA  . HIS B 1 288 ? -49.806 12.095  -47.794 1.00 23.00 ? 463 HIS B CA  1 
ATOM   4834 C  C   . HIS B 1 288 ? -49.588 11.688  -49.267 1.00 23.37 ? 463 HIS B C   1 
ATOM   4835 O  O   . HIS B 1 288 ? -48.571 12.048  -49.858 1.00 22.15 ? 463 HIS B O   1 
ATOM   4836 C  CB  . HIS B 1 288 ? -50.297 13.551  -47.819 1.00 25.08 ? 463 HIS B CB  1 
ATOM   4837 C  CG  . HIS B 1 288 ? -50.997 13.987  -46.569 1.00 29.79 ? 463 HIS B CG  1 
ATOM   4838 N  ND1 . HIS B 1 288 ? -51.075 15.311  -46.192 1.00 35.54 ? 463 HIS B ND1 1 
ATOM   4839 C  CD2 . HIS B 1 288 ? -51.621 13.282  -45.593 1.00 32.99 ? 463 HIS B CD2 1 
ATOM   4840 C  CE1 . HIS B 1 288 ? -51.718 15.405  -45.037 1.00 35.22 ? 463 HIS B CE1 1 
ATOM   4841 N  NE2 . HIS B 1 288 ? -52.072 14.188  -44.659 1.00 34.39 ? 463 HIS B NE2 1 
ATOM   4842 N  N   . LEU B 1 289 ? -50.549 10.974  -49.853 1.00 23.55 ? 464 LEU B N   1 
ATOM   4843 C  CA  . LEU B 1 289 ? -50.550 10.685  -51.276 1.00 27.20 ? 464 LEU B CA  1 
ATOM   4844 C  C   . LEU B 1 289 ? -51.858 11.218  -51.808 1.00 29.54 ? 464 LEU B C   1 
ATOM   4845 O  O   . LEU B 1 289 ? -52.847 11.260  -51.054 1.00 29.83 ? 464 LEU B O   1 
ATOM   4846 C  CB  . LEU B 1 289 ? -50.497 9.184   -51.546 1.00 26.24 ? 464 LEU B CB  1 
ATOM   4847 C  CG  . LEU B 1 289 ? -49.332 8.394   -50.948 1.00 27.03 ? 464 LEU B CG  1 
ATOM   4848 C  CD1 . LEU B 1 289 ? -49.385 6.922   -51.276 1.00 30.82 ? 464 LEU B CD1 1 
ATOM   4849 C  CD2 . LEU B 1 289 ? -48.025 9.018   -51.424 1.00 27.51 ? 464 LEU B CD2 1 
ATOM   4850 N  N   . GLN B 1 290 ? -51.890 11.639  -53.078 1.00 31.92 ? 465 GLN B N   1 
ATOM   4851 C  CA  . GLN B 1 290 ? -53.197 11.921  -53.715 1.00 34.71 ? 465 GLN B CA  1 
ATOM   4852 C  C   . GLN B 1 290 ? -53.337 11.288  -55.092 1.00 34.83 ? 465 GLN B C   1 
ATOM   4853 O  O   . GLN B 1 290 ? -52.327 11.017  -55.769 1.00 34.20 ? 465 GLN B O   1 
ATOM   4854 C  CB  . GLN B 1 290 ? -53.501 13.406  -53.769 1.00 35.98 ? 465 GLN B CB  1 
ATOM   4855 C  CG  . GLN B 1 290 ? -52.285 14.260  -53.971 1.00 42.49 ? 465 GLN B CG  1 
ATOM   4856 C  CD  . GLN B 1 290 ? -52.198 15.317  -52.888 1.00 51.36 ? 465 GLN B CD  1 
ATOM   4857 O  OE1 . GLN B 1 290 ? -52.558 15.061  -51.720 1.00 54.96 ? 465 GLN B OE1 1 
ATOM   4858 N  NE2 . GLN B 1 290 ? -51.724 16.511  -53.252 1.00 53.59 ? 465 GLN B NE2 1 
ATOM   4859 N  N   . GLY B 1 291 ? -54.585 11.034  -55.497 1.00 34.39 ? 466 GLY B N   1 
ATOM   4860 C  CA  . GLY B 1 291 ? -54.866 10.370  -56.772 1.00 36.00 ? 466 GLY B CA  1 
ATOM   4861 C  C   . GLY B 1 291 ? -54.153 10.988  -57.974 1.00 37.45 ? 466 GLY B C   1 
ATOM   4862 O  O   . GLY B 1 291 ? -53.646 10.277  -58.841 1.00 37.18 ? 466 GLY B O   1 
ATOM   4863 N  N   . SER B 1 292 ? -54.078 12.318  -57.996 1.00 37.96 ? 467 SER B N   1 
ATOM   4864 C  CA  . SER B 1 292 ? -53.524 13.034  -59.128 1.00 39.42 ? 467 SER B CA  1 
ATOM   4865 C  C   . SER B 1 292 ? -52.010 13.174  -59.023 1.00 39.42 ? 467 SER B C   1 
ATOM   4866 O  O   . SER B 1 292 ? -51.364 13.684  -59.930 1.00 40.84 ? 467 SER B O   1 
ATOM   4867 C  CB  . SER B 1 292 ? -54.122 14.440  -59.199 1.00 39.54 ? 467 SER B CB  1 
ATOM   4868 O  OG  . SER B 1 292 ? -53.593 15.215  -58.126 1.00 40.38 ? 467 SER B OG  1 
ATOM   4869 N  N   . ASP B 1 293 ? -51.428 12.757  -57.916 1.00 38.53 ? 468 ASP B N   1 
ATOM   4870 C  CA  . ASP B 1 293 ? -49.978 12.727  -57.859 1.00 37.33 ? 468 ASP B CA  1 
ATOM   4871 C  C   . ASP B 1 293 ? -49.520 11.882  -56.677 1.00 35.64 ? 468 ASP B C   1 
ATOM   4872 O  O   . ASP B 1 293 ? -49.727 12.245  -55.520 1.00 35.62 ? 468 ASP B O   1 
ATOM   4873 C  CB  . ASP B 1 293 ? -49.456 14.151  -57.760 1.00 38.62 ? 468 ASP B CB  1 
ATOM   4874 C  CG  . ASP B 1 293 ? -47.952 14.225  -57.480 1.00 41.79 ? 468 ASP B CG  1 
ATOM   4875 O  OD1 . ASP B 1 293 ? -47.219 13.215  -57.570 1.00 44.52 ? 468 ASP B OD1 1 
ATOM   4876 O  OD2 . ASP B 1 293 ? -47.481 15.341  -57.172 1.00 46.14 ? 468 ASP B OD2 1 
ATOM   4877 N  N   . LEU B 1 294 ? -48.882 10.752  -56.979 1.00 34.31 ? 469 LEU B N   1 
ATOM   4878 C  CA  . LEU B 1 294 ? -48.666 9.707   -55.984 1.00 31.96 ? 469 LEU B CA  1 
ATOM   4879 C  C   . LEU B 1 294 ? -47.335 9.882   -55.335 1.00 31.03 ? 469 LEU B C   1 
ATOM   4880 O  O   . LEU B 1 294 ? -46.922 9.025   -54.597 1.00 30.96 ? 469 LEU B O   1 
ATOM   4881 C  CB  . LEU B 1 294 ? -48.791 8.329   -56.615 1.00 31.89 ? 469 LEU B CB  1 
ATOM   4882 C  CG  . LEU B 1 294 ? -50.217 7.986   -57.059 1.00 32.13 ? 469 LEU B CG  1 
ATOM   4883 C  CD1 . LEU B 1 294 ? -50.234 6.703   -57.914 1.00 33.12 ? 469 LEU B CD1 1 
ATOM   4884 C  CD2 . LEU B 1 294 ? -51.204 7.870   -55.892 1.00 34.56 ? 469 LEU B CD2 1 
ATOM   4885 N  N   . ARG B 1 295 ? -46.673 11.020  -55.561 1.00 29.61 ? 470 ARG B N   1 
ATOM   4886 C  CA  . ARG B 1 295 ? -45.369 11.254  -54.939 1.00 29.62 ? 470 ARG B CA  1 
ATOM   4887 C  C   . ARG B 1 295 ? -45.534 11.591  -53.445 1.00 28.21 ? 470 ARG B C   1 
ATOM   4888 O  O   . ARG B 1 295 ? -46.473 12.283  -53.075 1.00 27.67 ? 470 ARG B O   1 
ATOM   4889 C  CB  . ARG B 1 295 ? -44.572 12.311  -55.694 1.00 30.02 ? 470 ARG B CB  1 
ATOM   4890 C  CG  . ARG B 1 295 ? -44.175 11.844  -57.117 1.00 34.02 ? 470 ARG B CG  1 
ATOM   4891 C  CD  . ARG B 1 295 ? -43.564 12.966  -57.899 1.00 38.72 ? 470 ARG B CD  1 
ATOM   4892 N  NE  . ARG B 1 295 ? -44.417 14.143  -57.809 1.00 43.69 ? 470 ARG B NE  1 
ATOM   4893 C  CZ  . ARG B 1 295 ? -44.066 15.327  -58.314 1.00 47.14 ? 470 ARG B CZ  1 
ATOM   4894 N  NH1 . ARG B 1 295 ? -42.871 15.460  -58.905 1.00 44.44 ? 470 ARG B NH1 1 
ATOM   4895 N  NH2 . ARG B 1 295 ? -44.890 16.369  -58.219 1.00 45.13 ? 470 ARG B NH2 1 
ATOM   4896 N  N   . PRO B 1 296 ? -44.654 11.031  -52.596 1.00 26.17 ? 471 PRO B N   1 
ATOM   4897 C  CA  . PRO B 1 296 ? -44.886 11.092  -51.156 1.00 25.22 ? 471 PRO B CA  1 
ATOM   4898 C  C   . PRO B 1 296 ? -44.637 12.498  -50.585 1.00 24.55 ? 471 PRO B C   1 
ATOM   4899 O  O   . PRO B 1 296 ? -43.566 13.050  -50.796 1.00 24.16 ? 471 PRO B O   1 
ATOM   4900 C  CB  . PRO B 1 296 ? -43.845 10.104  -50.565 1.00 24.60 ? 471 PRO B CB  1 
ATOM   4901 C  CG  . PRO B 1 296 ? -42.810 9.889   -51.675 1.00 25.72 ? 471 PRO B CG  1 
ATOM   4902 C  CD  . PRO B 1 296 ? -43.461 10.233  -52.977 1.00 25.72 ? 471 PRO B CD  1 
ATOM   4903 N  N   . GLN B 1 297 ? -45.616 13.058  -49.884 1.00 22.78 ? 472 GLN B N   1 
ATOM   4904 C  CA  . GLN B 1 297 ? -45.387 14.291  -49.121 1.00 24.40 ? 472 GLN B CA  1 
ATOM   4905 C  C   . GLN B 1 297 ? -45.240 13.908  -47.636 1.00 22.45 ? 472 GLN B C   1 
ATOM   4906 O  O   . GLN B 1 297 ? -46.125 13.244  -47.069 1.00 23.22 ? 472 GLN B O   1 
ATOM   4907 C  CB  . GLN B 1 297 ? -46.527 15.318  -49.297 1.00 23.97 ? 472 GLN B CB  1 
ATOM   4908 C  CG  . GLN B 1 297 ? -47.099 15.440  -50.705 1.00 32.22 ? 472 GLN B CG  1 
ATOM   4909 C  CD  . GLN B 1 297 ? -48.415 16.236  -50.719 1.00 43.47 ? 472 GLN B CD  1 
ATOM   4910 O  OE1 . GLN B 1 297 ? -48.640 17.076  -49.836 1.00 48.21 ? 472 GLN B OE1 1 
ATOM   4911 N  NE2 . GLN B 1 297 ? -49.303 15.952  -51.697 1.00 45.55 ? 472 GLN B NE2 1 
ATOM   4912 N  N   . PHE B 1 298 ? -44.150 14.337  -47.021 1.00 20.99 ? 473 PHE B N   1 
ATOM   4913 C  CA  . PHE B 1 298 ? -43.841 13.926  -45.659 1.00 21.48 ? 473 PHE B CA  1 
ATOM   4914 C  C   . PHE B 1 298 ? -44.305 14.966  -44.648 1.00 21.92 ? 473 PHE B C   1 
ATOM   4915 O  O   . PHE B 1 298 ? -44.099 16.162  -44.872 1.00 21.73 ? 473 PHE B O   1 
ATOM   4916 C  CB  . PHE B 1 298 ? -42.363 13.606  -45.476 1.00 20.10 ? 473 PHE B CB  1 
ATOM   4917 C  CG  . PHE B 1 298 ? -41.864 12.494  -46.359 1.00 21.38 ? 473 PHE B CG  1 
ATOM   4918 C  CD1 . PHE B 1 298 ? -41.956 11.171  -45.957 1.00 17.46 ? 473 PHE B CD1 1 
ATOM   4919 C  CD2 . PHE B 1 298 ? -41.278 12.791  -47.567 1.00 19.66 ? 473 PHE B CD2 1 
ATOM   4920 C  CE1 . PHE B 1 298 ? -41.496 10.167  -46.792 1.00 19.31 ? 473 PHE B CE1 1 
ATOM   4921 C  CE2 . PHE B 1 298 ? -40.781 11.797  -48.426 1.00 20.16 ? 473 PHE B CE2 1 
ATOM   4922 C  CZ  . PHE B 1 298 ? -40.913 10.492  -48.074 1.00 18.18 ? 473 PHE B CZ  1 
ATOM   4923 N  N   . HIS B 1 299 ? -44.972 14.528  -43.586 1.00 22.00 ? 474 HIS B N   1 
ATOM   4924 C  CA  . HIS B 1 299 ? -45.370 15.438  -42.477 1.00 23.62 ? 474 HIS B CA  1 
ATOM   4925 C  C   . HIS B 1 299 ? -44.659 14.983  -41.171 1.00 22.73 ? 474 HIS B C   1 
ATOM   4926 O  O   . HIS B 1 299 ? -44.865 13.874  -40.665 1.00 22.37 ? 474 HIS B O   1 
ATOM   4927 C  CB  . HIS B 1 299 ? -46.901 15.549  -42.363 1.00 23.66 ? 474 HIS B CB  1 
ATOM   4928 C  CG  . HIS B 1 299 ? -47.562 16.179  -43.558 1.00 30.58 ? 474 HIS B CG  1 
ATOM   4929 N  ND1 . HIS B 1 299 ? -47.635 15.569  -44.799 1.00 35.69 ? 474 HIS B ND1 1 
ATOM   4930 C  CD2 . HIS B 1 299 ? -48.197 17.367  -43.697 1.00 35.25 ? 474 HIS B CD2 1 
ATOM   4931 C  CE1 . HIS B 1 299 ? -48.238 16.372  -45.656 1.00 33.38 ? 474 HIS B CE1 1 
ATOM   4932 N  NE2 . HIS B 1 299 ? -48.612 17.458  -45.009 1.00 37.76 ? 474 HIS B NE2 1 
ATOM   4933 N  N   . GLN B 1 300 ? -43.752 15.798  -40.658 1.00 21.11 ? 475 GLN B N   1 
ATOM   4934 C  CA  . GLN B 1 300 ? -42.994 15.406  -39.502 1.00 22.37 ? 475 GLN B CA  1 
ATOM   4935 C  C   . GLN B 1 300 ? -43.716 15.828  -38.190 1.00 22.33 ? 475 GLN B C   1 
ATOM   4936 O  O   . GLN B 1 300 ? -44.458 16.793  -38.191 1.00 22.57 ? 475 GLN B O   1 
ATOM   4937 C  CB  . GLN B 1 300 ? -41.591 15.994  -39.529 1.00 22.33 ? 475 GLN B CB  1 
ATOM   4938 C  CG  . GLN B 1 300 ? -40.641 15.378  -40.564 1.00 22.67 ? 475 GLN B CG  1 
ATOM   4939 C  CD  . GLN B 1 300 ? -39.331 16.126  -40.554 1.00 27.92 ? 475 GLN B CD  1 
ATOM   4940 O  OE1 . GLN B 1 300 ? -39.316 17.353  -40.734 1.00 28.22 ? 475 GLN B OE1 1 
ATOM   4941 N  NE2 . GLN B 1 300 ? -38.232 15.422  -40.258 1.00 26.24 ? 475 GLN B NE2 1 
ATOM   4942 N  N   . PHE B 1 301 ? -43.521 15.079  -37.098 1.00 22.64 ? 476 PHE B N   1 
ATOM   4943 C  CA  . PHE B 1 301 ? -44.094 15.494  -35.786 1.00 22.40 ? 476 PHE B CA  1 
ATOM   4944 C  C   . PHE B 1 301 ? -43.263 14.921  -34.678 1.00 22.56 ? 476 PHE B C   1 
ATOM   4945 O  O   . PHE B 1 301 ? -42.380 14.088  -34.916 1.00 20.82 ? 476 PHE B O   1 
ATOM   4946 C  CB  . PHE B 1 301 ? -45.597 15.138  -35.668 1.00 21.47 ? 476 PHE B CB  1 
ATOM   4947 C  CG  . PHE B 1 301 ? -45.892 13.620  -35.682 1.00 21.96 ? 476 PHE B CG  1 
ATOM   4948 C  CD1 . PHE B 1 301 ? -45.917 12.900  -36.885 1.00 20.57 ? 476 PHE B CD1 1 
ATOM   4949 C  CD2 . PHE B 1 301 ? -46.121 12.914  -34.479 1.00 20.96 ? 476 PHE B CD2 1 
ATOM   4950 C  CE1 . PHE B 1 301 ? -46.170 11.518  -36.890 1.00 22.11 ? 476 PHE B CE1 1 
ATOM   4951 C  CE2 . PHE B 1 301 ? -46.413 11.517  -34.476 1.00 15.05 ? 476 PHE B CE2 1 
ATOM   4952 C  CZ  . PHE B 1 301 ? -46.431 10.833  -35.660 1.00 22.36 ? 476 PHE B CZ  1 
ATOM   4953 N  N   . THR B 1 302 ? -43.463 15.446  -33.468 1.00 22.14 ? 477 THR B N   1 
ATOM   4954 C  CA  . THR B 1 302 ? -42.616 15.095  -32.343 1.00 22.96 ? 477 THR B CA  1 
ATOM   4955 C  C   . THR B 1 302 ? -43.538 14.574  -31.251 1.00 21.90 ? 477 THR B C   1 
ATOM   4956 O  O   . THR B 1 302 ? -44.784 14.731  -31.364 1.00 20.23 ? 477 THR B O   1 
ATOM   4957 C  CB  . THR B 1 302 ? -41.820 16.312  -31.802 1.00 23.82 ? 477 THR B CB  1 
ATOM   4958 O  OG1 . THR B 1 302 ? -42.714 17.410  -31.654 1.00 25.99 ? 477 THR B OG1 1 
ATOM   4959 C  CG2 . THR B 1 302 ? -40.767 16.752  -32.803 1.00 25.63 ? 477 THR B CG2 1 
ATOM   4960 N  N   . ALA B 1 303 ? -42.905 13.970  -30.239 1.00 21.66 ? 478 ALA B N   1 
ATOM   4961 C  CA  . ALA B 1 303 ? -43.570 13.249  -29.114 1.00 22.72 ? 478 ALA B CA  1 
ATOM   4962 C  C   . ALA B 1 303 ? -44.312 14.237  -28.227 1.00 23.20 ? 478 ALA B C   1 
ATOM   4963 O  O   . ALA B 1 303 ? -43.820 15.360  -27.980 1.00 22.38 ? 478 ALA B O   1 
ATOM   4964 C  CB  . ALA B 1 303 ? -42.560 12.481  -28.284 1.00 22.26 ? 478 ALA B CB  1 
ATOM   4965 N  N   . VAL B 1 304 ? -45.498 13.822  -27.808 1.00 22.97 ? 479 VAL B N   1 
ATOM   4966 C  CA  . VAL B 1 304 ? -46.282 14.507  -26.765 1.00 24.24 ? 479 VAL B CA  1 
ATOM   4967 C  C   . VAL B 1 304 ? -46.205 13.785  -25.380 1.00 25.98 ? 479 VAL B C   1 
ATOM   4968 O  O   . VAL B 1 304 ? -45.805 12.602  -25.327 1.00 24.86 ? 479 VAL B O   1 
ATOM   4969 C  CB  . VAL B 1 304 ? -47.721 14.644  -27.236 1.00 24.13 ? 479 VAL B CB  1 
ATOM   4970 C  CG1 . VAL B 1 304 ? -47.777 15.533  -28.496 1.00 24.15 ? 479 VAL B CG1 1 
ATOM   4971 C  CG2 . VAL B 1 304 ? -48.389 13.262  -27.385 1.00 23.24 ? 479 VAL B CG2 1 
ATOM   4972 N  N   . PRO B 1 305 ? -46.556 14.505  -24.253 1.00 27.21 ? 480 PRO B N   1 
ATOM   4973 C  CA  . PRO B 1 305 ? -46.534 13.961  -22.917 1.00 27.68 ? 480 PRO B CA  1 
ATOM   4974 C  C   . PRO B 1 305 ? -47.421 12.735  -22.779 1.00 28.01 ? 480 PRO B C   1 
ATOM   4975 O  O   . PRO B 1 305 ? -48.480 12.635  -23.394 1.00 28.32 ? 480 PRO B O   1 
ATOM   4976 C  CB  . PRO B 1 305 ? -47.088 15.125  -22.041 1.00 28.62 ? 480 PRO B CB  1 
ATOM   4977 C  CG  . PRO B 1 305 ? -46.727 16.350  -22.787 1.00 29.08 ? 480 PRO B CG  1 
ATOM   4978 C  CD  . PRO B 1 305 ? -46.953 15.931  -24.239 1.00 28.20 ? 480 PRO B CD  1 
ATOM   4979 N  N   . HIS B 1 306 ? -46.981 11.792  -21.977 1.00 27.23 ? 481 HIS B N   1 
ATOM   4980 C  CA  . HIS B 1 306 ? -47.824 10.670  -21.705 1.00 27.93 ? 481 HIS B CA  1 
ATOM   4981 C  C   . HIS B 1 306 ? -47.694 10.341  -20.232 1.00 27.30 ? 481 HIS B C   1 
ATOM   4982 O  O   . HIS B 1 306 ? -46.761 10.759  -19.617 1.00 26.66 ? 481 HIS B O   1 
ATOM   4983 C  CB  . HIS B 1 306 ? -47.460 9.447   -22.572 1.00 26.09 ? 481 HIS B CB  1 
ATOM   4984 C  CG  . HIS B 1 306 ? -46.076 8.921   -22.359 1.00 29.69 ? 481 HIS B CG  1 
ATOM   4985 N  ND1 . HIS B 1 306 ? -45.726 8.120   -21.288 1.00 29.51 ? 481 HIS B ND1 1 
ATOM   4986 C  CD2 . HIS B 1 306 ? -44.957 9.030   -23.126 1.00 32.14 ? 481 HIS B CD2 1 
ATOM   4987 C  CE1 . HIS B 1 306 ? -44.446 7.785   -21.387 1.00 30.87 ? 481 HIS B CE1 1 
ATOM   4988 N  NE2 . HIS B 1 306 ? -43.966 8.298   -22.510 1.00 30.37 ? 481 HIS B NE2 1 
ATOM   4989 N  N   . PRO B 1 307 ? -48.612 9.543   -19.700 1.00 29.21 ? 482 PRO B N   1 
ATOM   4990 C  CA  . PRO B 1 307 ? -48.522 9.174   -18.281 1.00 31.38 ? 482 PRO B CA  1 
ATOM   4991 C  C   . PRO B 1 307 ? -47.249 8.390   -18.027 1.00 33.77 ? 482 PRO B C   1 
ATOM   4992 O  O   . PRO B 1 307 ? -46.740 7.714   -18.950 1.00 33.41 ? 482 PRO B O   1 
ATOM   4993 C  CB  . PRO B 1 307 ? -49.728 8.257   -18.074 1.00 30.59 ? 482 PRO B CB  1 
ATOM   4994 C  CG  . PRO B 1 307 ? -50.684 8.677   -19.079 1.00 29.97 ? 482 PRO B CG  1 
ATOM   4995 C  CD  . PRO B 1 307 ? -49.856 9.044   -20.303 1.00 28.71 ? 482 PRO B CD  1 
ATOM   4996 N  N   . ASN B 1 308 ? -46.752 8.498   -16.793 1.00 35.37 ? 483 ASN B N   1 
ATOM   4997 C  CA  . ASN B 1 308 ? -45.515 7.874   -16.391 1.00 39.10 ? 483 ASN B CA  1 
ATOM   4998 C  C   . ASN B 1 308 ? -45.709 6.354   -16.316 1.00 40.19 ? 483 ASN B C   1 
ATOM   4999 O  O   . ASN B 1 308 ? -45.786 5.781   -15.243 1.00 40.48 ? 483 ASN B O   1 
ATOM   5000 C  CB  . ASN B 1 308 ? -45.071 8.466   -15.054 1.00 40.21 ? 483 ASN B CB  1 
ATOM   5001 C  CG  . ASN B 1 308 ? -43.745 7.929   -14.568 1.00 44.27 ? 483 ASN B CG  1 
ATOM   5002 O  OD1 . ASN B 1 308 ? -42.922 7.433   -15.356 1.00 49.60 ? 483 ASN B OD1 1 
ATOM   5003 N  ND2 . ASN B 1 308 ? -43.539 7.990   -13.254 1.00 47.47 ? 483 ASN B ND2 1 
ATOM   5004 N  N   . VAL B 1 309 ? -45.815 5.710   -17.475 1.00 41.72 ? 484 VAL B N   1 
ATOM   5005 C  CA  . VAL B 1 309 ? -45.619 4.258   -17.542 1.00 42.62 ? 484 VAL B CA  1 
ATOM   5006 C  C   . VAL B 1 309 ? -44.423 4.028   -18.455 1.00 42.69 ? 484 VAL B C   1 
ATOM   5007 O  O   . VAL B 1 309 ? -44.370 4.593   -19.556 1.00 42.09 ? 484 VAL B O   1 
ATOM   5008 C  CB  . VAL B 1 309 ? -46.846 3.510   -18.115 1.00 42.19 ? 484 VAL B CB  1 
ATOM   5009 C  CG1 . VAL B 1 309 ? -46.643 2.012   -17.963 1.00 43.32 ? 484 VAL B CG1 1 
ATOM   5010 C  CG2 . VAL B 1 309 ? -48.121 3.945   -17.404 1.00 43.14 ? 484 VAL B CG2 1 
ATOM   5011 N  N   . LYS B 1 310 ? -43.483 3.208   -18.008 1.00 42.16 ? 485 LYS B N   1 
ATOM   5012 C  CA  . LYS B 1 310 ? -42.255 2.980   -18.761 1.00 43.85 ? 485 LYS B CA  1 
ATOM   5013 C  C   . LYS B 1 310 ? -42.487 1.986   -19.918 1.00 43.17 ? 485 LYS B C   1 
ATOM   5014 O  O   . LYS B 1 310 ? -43.336 1.105   -19.813 1.00 42.02 ? 485 LYS B O   1 
ATOM   5015 C  CB  . LYS B 1 310 ? -41.148 2.482   -17.820 1.00 44.12 ? 485 LYS B CB  1 
ATOM   5016 C  CG  . LYS B 1 310 ? -40.735 3.544   -16.789 1.00 48.16 ? 485 LYS B CG  1 
ATOM   5017 C  CD  . LYS B 1 310 ? -40.546 2.972   -15.364 1.00 53.41 ? 485 LYS B CD  1 
ATOM   5018 C  CE  . LYS B 1 310 ? -39.074 2.689   -15.037 1.00 56.27 ? 485 LYS B CE  1 
ATOM   5019 N  NZ  . LYS B 1 310 ? -38.218 3.929   -15.082 1.00 57.63 ? 485 LYS B NZ  1 
ATOM   5020 N  N   . PRO B 1 311 ? -41.759 2.152   -21.034 1.00 43.78 ? 486 PRO B N   1 
ATOM   5021 C  CA  . PRO B 1 311 ? -41.862 1.166   -22.118 1.00 44.33 ? 486 PRO B CA  1 
ATOM   5022 C  C   . PRO B 1 311 ? -41.517 -0.191  -21.557 1.00 44.57 ? 486 PRO B C   1 
ATOM   5023 O  O   . PRO B 1 311 ? -40.724 -0.258  -20.632 1.00 44.37 ? 486 PRO B O   1 
ATOM   5024 C  CB  . PRO B 1 311 ? -40.759 1.603   -23.100 1.00 44.00 ? 486 PRO B CB  1 
ATOM   5025 C  CG  . PRO B 1 311 ? -40.598 3.046   -22.840 1.00 44.17 ? 486 PRO B CG  1 
ATOM   5026 C  CD  . PRO B 1 311 ? -40.772 3.197   -21.348 1.00 44.31 ? 486 PRO B CD  1 
ATOM   5027 N  N   . MET B 1 312 ? -42.102 -1.248  -22.105 1.00 45.86 ? 487 MET B N   1 
ATOM   5028 C  CA  . MET B 1 312 ? -41.807 -2.606  -21.670 1.00 47.86 ? 487 MET B CA  1 
ATOM   5029 C  C   . MET B 1 312 ? -42.278 -2.914  -20.219 1.00 48.16 ? 487 MET B C   1 
ATOM   5030 O  O   . MET B 1 312 ? -41.889 -3.926  -19.641 1.00 47.01 ? 487 MET B O   1 
ATOM   5031 C  CB  . MET B 1 312 ? -40.292 -2.864  -21.796 1.00 48.09 ? 487 MET B CB  1 
ATOM   5032 C  CG  . MET B 1 312 ? -39.941 -4.151  -22.508 1.00 52.48 ? 487 MET B CG  1 
ATOM   5033 S  SD  . MET B 1 312 ? -40.062 -3.951  -24.295 1.00 55.90 ? 487 MET B SD  1 
ATOM   5034 C  CE  . MET B 1 312 ? -39.232 -2.360  -24.416 1.00 54.65 ? 487 MET B CE  1 
ATOM   5035 N  N   . ALA B 1 313 ? -43.078 -2.033  -19.627 1.00 49.15 ? 488 ALA B N   1 
ATOM   5036 C  CA  . ALA B 1 313 ? -43.532 -2.230  -18.252 1.00 50.43 ? 488 ALA B CA  1 
ATOM   5037 C  C   . ALA B 1 313 ? -44.191 -3.597  -18.074 1.00 52.04 ? 488 ALA B C   1 
ATOM   5038 O  O   . ALA B 1 313 ? -44.130 -4.181  -16.997 1.00 51.98 ? 488 ALA B O   1 
ATOM   5039 C  CB  . ALA B 1 313 ? -44.480 -1.130  -17.831 1.00 49.66 ? 488 ALA B CB  1 
ATOM   5040 N  N   . TYR B 1 314 ? -44.826 -4.114  -19.127 1.00 53.66 ? 489 TYR B N   1 
ATOM   5041 C  CA  . TYR B 1 314 ? -45.537 -5.398  -19.023 1.00 54.79 ? 489 TYR B CA  1 
ATOM   5042 C  C   . TYR B 1 314 ? -44.772 -6.610  -19.598 1.00 55.76 ? 489 TYR B C   1 
ATOM   5043 O  O   . TYR B 1 314 ? -45.338 -7.699  -19.733 1.00 56.46 ? 489 TYR B O   1 
ATOM   5044 C  CB  . TYR B 1 314 ? -46.900 -5.320  -19.708 1.00 54.78 ? 489 TYR B CB  1 
ATOM   5045 C  CG  . TYR B 1 314 ? -47.842 -4.256  -19.184 1.00 54.61 ? 489 TYR B CG  1 
ATOM   5046 C  CD1 . TYR B 1 314 ? -48.551 -4.441  -18.006 1.00 53.75 ? 489 TYR B CD1 1 
ATOM   5047 C  CD2 . TYR B 1 314 ? -48.056 -3.085  -19.909 1.00 55.24 ? 489 TYR B CD2 1 
ATOM   5048 C  CE1 . TYR B 1 314 ? -49.434 -3.468  -17.543 1.00 54.45 ? 489 TYR B CE1 1 
ATOM   5049 C  CE2 . TYR B 1 314 ? -48.936 -2.106  -19.458 1.00 56.31 ? 489 TYR B CE2 1 
ATOM   5050 C  CZ  . TYR B 1 314 ? -49.621 -2.301  -18.274 1.00 55.70 ? 489 TYR B CZ  1 
ATOM   5051 O  OH  . TYR B 1 314 ? -50.491 -1.322  -17.856 1.00 54.71 ? 489 TYR B OH  1 
ATOM   5052 N  N   . ALA B 1 315 ? -43.514 -6.422  -19.973 1.00 56.68 ? 490 ALA B N   1 
ATOM   5053 C  CA  . ALA B 1 315 ? -42.682 -7.556  -20.347 1.00 57.65 ? 490 ALA B CA  1 
ATOM   5054 C  C   . ALA B 1 315 ? -42.002 -8.117  -19.113 1.00 58.16 ? 490 ALA B C   1 
ATOM   5055 O  O   . ALA B 1 315 ? -40.893 -8.638  -19.214 1.00 59.40 ? 490 ALA B O   1 
ATOM   5056 C  CB  . ALA B 1 315 ? -41.643 -7.173  -21.393 1.00 57.51 ? 490 ALA B CB  1 
HETATM 5057 MN MN  . MN  C 2 .   ? -26.450 -3.326  -12.305 1.00 3.94  ? 500 MN  A MN  1 
HETATM 5058 MN MN  . MN  D 2 .   ? -25.738 -0.893  -14.546 0.90 7.17  ? 501 MN  A MN  1 
HETATM 5059 MN MN  . MN  E 2 .   ? -41.277 -4.183  -37.690 1.00 4.97  ? 500 MN  B MN  1 
HETATM 5060 MN MN  . MN  F 2 .   ? -41.429 -1.765  -35.374 0.80 8.13  ? 501 MN  B MN  1 
HETATM 5061 O  O   . HOH G 3 .   ? -36.079 -16.409 0.559   1.00 25.23 ? 2   HOH A O   1 
HETATM 5062 O  O   . HOH G 3 .   ? -28.034 -3.564  -15.502 1.00 15.07 ? 3   HOH A O   1 
HETATM 5063 O  O   . HOH G 3 .   ? -17.119 -11.193 -5.788  1.00 12.36 ? 4   HOH A O   1 
HETATM 5064 O  O   . HOH G 3 .   ? -17.391 8.478   -22.254 1.00 11.84 ? 5   HOH A O   1 
HETATM 5065 O  O   . HOH G 3 .   ? -18.955 2.338   -11.213 1.00 11.95 ? 6   HOH A O   1 
HETATM 5066 O  O   . HOH G 3 .   ? -33.478 -7.988  3.190   1.00 13.51 ? 7   HOH A O   1 
HETATM 5067 O  O   . HOH G 3 .   ? -41.151 -9.884  4.873   1.00 15.11 ? 10  HOH A O   1 
HETATM 5068 O  O   . HOH G 3 .   ? -5.586  -0.332  -22.817 1.00 19.45 ? 11  HOH A O   1 
HETATM 5069 O  O   . HOH G 3 .   ? -35.992 3.765   -6.012  1.00 15.99 ? 12  HOH A O   1 
HETATM 5070 O  O   . HOH G 3 .   ? -18.896 10.843  -22.392 1.00 18.49 ? 15  HOH A O   1 
HETATM 5071 O  O   . HOH G 3 .   ? -13.893 12.098  -1.533  1.00 13.37 ? 16  HOH A O   1 
HETATM 5072 O  O   . HOH G 3 .   ? -32.776 -9.830  4.948   1.00 15.61 ? 18  HOH A O   1 
HETATM 5073 O  O   . HOH G 3 .   ? -38.656 6.869   -4.500  1.00 20.70 ? 19  HOH A O   1 
HETATM 5074 O  O   . HOH G 3 .   ? -27.244 0.381   -15.626 1.00 13.49 ? 21  HOH A O   1 
HETATM 5075 O  O   . HOH G 3 .   ? -16.225 -12.546 -13.300 1.00 17.11 ? 22  HOH A O   1 
HETATM 5076 O  O   . HOH G 3 .   ? -11.652 -1.758  -0.686  1.00 23.45 ? 23  HOH A O   1 
HETATM 5077 O  O   . HOH G 3 .   ? -18.397 0.039   9.152   1.00 16.94 ? 24  HOH A O   1 
HETATM 5078 O  O   . HOH G 3 .   ? -19.647 13.739  -17.486 1.00 19.52 ? 26  HOH A O   1 
HETATM 5079 O  O   . HOH G 3 .   ? -12.268 -2.718  -3.312  1.00 14.12 ? 28  HOH A O   1 
HETATM 5080 O  O   . HOH G 3 .   ? -22.753 3.297   -21.424 1.00 21.11 ? 29  HOH A O   1 
HETATM 5081 O  O   . HOH G 3 .   ? -34.000 10.644  -11.015 1.00 24.84 ? 30  HOH A O   1 
HETATM 5082 O  O   . HOH G 3 .   ? -19.210 -8.680  -25.363 1.00 19.97 ? 31  HOH A O   1 
HETATM 5083 O  O   . HOH G 3 .   ? 4.590   9.617   -9.132  1.00 24.07 ? 32  HOH A O   1 
HETATM 5084 O  O   . HOH G 3 .   ? -18.055 -19.691 -10.621 1.00 17.18 ? 33  HOH A O   1 
HETATM 5085 O  O   . HOH G 3 .   ? -45.068 -6.746  -3.201  1.00 18.39 ? 34  HOH A O   1 
HETATM 5086 O  O   . HOH G 3 .   ? -15.535 -7.473  7.335   1.00 25.97 ? 41  HOH A O   1 
HETATM 5087 O  O   . HOH G 3 .   ? -35.513 -7.267  5.647   1.00 15.76 ? 43  HOH A O   1 
HETATM 5088 O  O   . HOH G 3 .   ? -23.965 -1.675  12.209  1.00 16.21 ? 44  HOH A O   1 
HETATM 5089 O  O   . HOH G 3 .   ? 0.002   -4.605  -26.318 1.00 29.34 ? 45  HOH A O   1 
HETATM 5090 O  O   . HOH G 3 .   ? -16.509 -11.562 -15.943 1.00 16.79 ? 46  HOH A O   1 
HETATM 5091 O  O   . HOH G 3 .   ? -21.648 7.633   -23.460 1.00 22.40 ? 47  HOH A O   1 
HETATM 5092 O  O   . HOH G 3 .   ? -31.875 -8.274  8.559   1.00 21.58 ? 48  HOH A O   1 
HETATM 5093 O  O   . HOH G 3 .   ? -38.439 2.266   -4.991  1.00 21.30 ? 49  HOH A O   1 
HETATM 5094 O  O   . HOH G 3 .   ? -19.848 4.355   -25.382 1.00 21.11 ? 50  HOH A O   1 
HETATM 5095 O  O   . HOH G 3 .   ? -44.603 -11.198 -7.199  1.00 26.76 ? 51  HOH A O   1 
HETATM 5096 O  O   . HOH G 3 .   ? -22.799 14.335  4.611   1.00 35.27 ? 53  HOH A O   1 
HETATM 5097 O  O   . HOH G 3 .   ? -22.244 4.792   -23.581 1.00 22.40 ? 55  HOH A O   1 
HETATM 5098 O  O   . HOH G 3 .   ? -33.652 4.255   -4.332  1.00 19.45 ? 57  HOH A O   1 
HETATM 5099 O  O   . HOH G 3 .   ? -19.092 6.665   -23.564 1.00 20.91 ? 58  HOH A O   1 
HETATM 5100 O  O   . HOH G 3 .   ? -12.767 1.938   -27.507 1.00 24.01 ? 61  HOH A O   1 
HETATM 5101 O  O   . HOH G 3 .   ? -22.458 -4.957  -4.860  1.00 16.21 ? 64  HOH A O   1 
HETATM 5102 O  O   . HOH G 3 .   ? -22.315 10.007  -21.867 1.00 20.42 ? 66  HOH A O   1 
HETATM 5103 O  O   . HOH G 3 .   ? -23.948 -9.209  11.925  1.00 20.92 ? 67  HOH A O   1 
HETATM 5104 O  O   . HOH G 3 .   ? -35.863 -16.040 6.580   1.00 20.61 ? 70  HOH A O   1 
HETATM 5105 O  O   . HOH G 3 .   ? -23.058 10.966  -24.307 1.00 21.26 ? 71  HOH A O   1 
HETATM 5106 O  O   . HOH G 3 .   ? -0.534  -6.656  -5.321  1.00 20.74 ? 72  HOH A O   1 
HETATM 5107 O  O   . HOH G 3 .   ? -24.755 -16.448 -1.578  1.00 29.02 ? 74  HOH A O   1 
HETATM 5108 O  O   . HOH G 3 .   ? -26.312 14.190  -19.278 1.00 25.01 ? 75  HOH A O   1 
HETATM 5109 O  O   . HOH G 3 .   ? -3.278  -10.126 -24.357 1.00 23.35 ? 76  HOH A O   1 
HETATM 5110 O  O   . HOH G 3 .   ? -19.207 -1.853  -26.914 1.00 27.35 ? 79  HOH A O   1 
HETATM 5111 O  O   . HOH G 3 .   ? -11.030 -15.715 -9.224  1.00 22.94 ? 81  HOH A O   1 
HETATM 5112 O  O   . HOH G 3 .   ? -27.598 16.976  -1.718  1.00 26.14 ? 82  HOH A O   1 
HETATM 5113 O  O   . HOH G 3 .   ? -4.446  4.215   0.534   1.00 24.90 ? 83  HOH A O   1 
HETATM 5114 O  O   . HOH G 3 .   ? -21.682 -15.299 -15.160 1.00 22.18 ? 84  HOH A O   1 
HETATM 5115 O  O   . HOH G 3 .   ? -7.963  4.050   -25.463 1.00 24.04 ? 86  HOH A O   1 
HETATM 5116 O  O   . HOH G 3 .   ? -10.307 5.882   -25.224 1.00 23.03 ? 87  HOH A O   1 
HETATM 5117 O  O   . HOH G 3 .   ? -16.997 15.976  14.281  1.00 47.38 ? 88  HOH A O   1 
HETATM 5118 O  O   . HOH G 3 .   ? -31.392 -6.653  -16.220 1.00 29.33 ? 90  HOH A O   1 
HETATM 5119 O  O   . HOH G 3 .   ? -35.649 8.310   -13.380 1.00 24.39 ? 91  HOH A O   1 
HETATM 5120 O  O   . HOH G 3 .   ? -18.984 -18.259 -16.799 1.00 29.82 ? 93  HOH A O   1 
HETATM 5121 O  O   . HOH G 3 .   ? -13.391 13.923  -20.318 1.00 25.73 ? 95  HOH A O   1 
HETATM 5122 O  O   . HOH G 3 .   ? -14.641 15.147  -22.975 1.00 27.50 ? 98  HOH A O   1 
HETATM 5123 O  O   . HOH G 3 .   ? -16.615 1.559   11.183  1.00 26.80 ? 99  HOH A O   1 
HETATM 5124 O  O   . HOH G 3 .   ? -34.317 -8.731  7.416   1.00 24.64 ? 100 HOH A O   1 
HETATM 5125 O  O   . HOH G 3 .   ? -25.800 -7.232  12.523  1.00 28.93 ? 101 HOH A O   1 
HETATM 5126 O  O   . HOH G 3 .   ? -34.248 -7.115  -9.422  1.00 26.34 ? 103 HOH A O   1 
HETATM 5127 O  O   . HOH G 3 .   ? -33.331 10.775  -18.508 1.00 28.77 ? 104 HOH A O   1 
HETATM 5128 O  O   . HOH G 3 .   ? -11.314 4.906   2.576   1.00 28.45 ? 109 HOH A O   1 
HETATM 5129 O  O   . HOH G 3 .   ? -2.629  -8.558  -26.744 1.00 34.26 ? 111 HOH A O   1 
HETATM 5130 O  O   . HOH G 3 .   ? -45.605 -8.883  -1.358  1.00 22.54 ? 113 HOH A O   1 
HETATM 5131 O  O   . HOH G 3 .   ? -20.366 -20.853 -11.096 1.00 24.23 ? 114 HOH A O   1 
HETATM 5132 O  O   . HOH G 3 .   ? -21.460 -2.722  11.763  1.00 21.58 ? 115 HOH A O   1 
HETATM 5133 O  O   . HOH G 3 .   ? -11.646 -6.336  4.308   1.00 29.52 ? 117 HOH A O   1 
HETATM 5134 O  O   . HOH G 3 .   ? -17.509 17.729  -6.048  1.00 26.41 ? 121 HOH A O   1 
HETATM 5135 O  O   . HOH G 3 .   ? -2.440  -12.356 -8.467  1.00 27.93 ? 123 HOH A O   1 
HETATM 5136 O  O   . HOH G 3 .   ? -36.139 -14.177 -5.455  1.00 23.42 ? 124 HOH A O   1 
HETATM 5137 O  O   . HOH G 3 .   ? -43.171 0.069   5.635   1.00 22.45 ? 125 HOH A O   1 
HETATM 5138 O  O   . HOH G 3 .   ? -47.510 -0.612  0.533   1.00 25.92 ? 126 HOH A O   1 
HETATM 5139 O  O   . HOH G 3 .   ? -21.153 12.792  -24.947 1.00 23.99 ? 128 HOH A O   1 
HETATM 5140 O  O   . HOH G 3 .   ? -31.047 -13.002 11.448  1.00 23.15 ? 130 HOH A O   1 
HETATM 5141 O  O   . HOH G 3 .   ? -19.623 -2.529  9.833   1.00 29.99 ? 134 HOH A O   1 
HETATM 5142 O  O   . HOH G 3 .   ? -37.103 -4.393  -11.205 1.00 37.74 ? 135 HOH A O   1 
HETATM 5143 O  O   . HOH G 3 .   ? -41.664 -7.680  7.037   1.00 44.18 ? 136 HOH A O   1 
HETATM 5144 O  O   . HOH G 3 .   ? 2.967   7.655   -6.531  1.00 26.60 ? 137 HOH A O   1 
HETATM 5145 O  O   . HOH G 3 .   ? -13.807 -16.736 -14.186 1.00 30.24 ? 138 HOH A O   1 
HETATM 5146 O  O   . HOH G 3 .   ? -35.617 0.418   10.817  1.00 24.77 ? 139 HOH A O   1 
HETATM 5147 O  O   . HOH G 3 .   ? -10.503 -2.562  1.819   1.00 30.23 ? 140 HOH A O   1 
HETATM 5148 O  O   . HOH G 3 .   ? -22.966 7.396   -30.131 1.00 36.54 ? 141 HOH A O   1 
HETATM 5149 O  O   . HOH G 3 .   ? -4.022  11.123  -7.207  1.00 28.42 ? 142 HOH A O   1 
HETATM 5150 O  O   . HOH G 3 .   ? -25.286 19.331  -7.914  1.00 25.53 ? 143 HOH A O   1 
HETATM 5151 O  O   . HOH G 3 .   ? 3.026   -7.456  -11.679 1.00 31.10 ? 148 HOH A O   1 
HETATM 5152 O  O   . HOH G 3 .   ? -31.237 9.298   3.032   1.00 28.78 ? 149 HOH A O   1 
HETATM 5153 O  O   . HOH G 3 .   ? -14.231 15.870  -2.992  1.00 31.94 ? 150 HOH A O   1 
HETATM 5154 O  O   . HOH G 3 .   ? -38.215 -13.017 -6.850  1.00 25.84 ? 151 HOH A O   1 
HETATM 5155 O  O   . HOH G 3 .   ? -35.942 2.217   -8.204  1.00 30.36 ? 153 HOH A O   1 
HETATM 5156 O  O   . HOH G 3 .   ? 1.323   -1.474  -8.162  1.00 21.32 ? 154 HOH A O   1 
HETATM 5157 O  O   . HOH G 3 .   ? -18.311 -20.290 -15.409 1.00 28.55 ? 155 HOH A O   1 
HETATM 5158 O  O   . HOH G 3 .   ? -1.275  10.559  -25.510 1.00 30.33 ? 156 HOH A O   1 
HETATM 5159 O  O   . HOH G 3 .   ? -5.603  -6.262  0.546   1.00 31.73 ? 157 HOH A O   1 
HETATM 5160 O  O   . HOH G 3 .   ? -37.129 -16.497 4.443   1.00 25.18 ? 158 HOH A O   1 
HETATM 5161 O  O   . HOH G 3 .   ? -14.979 -14.997 -0.315  1.00 29.68 ? 160 HOH A O   1 
HETATM 5162 O  O   . HOH G 3 .   ? -20.479 8.380   -30.652 1.00 40.86 ? 162 HOH A O   1 
HETATM 5163 O  O   . HOH G 3 .   ? -6.669  14.789  -5.313  1.00 30.15 ? 163 HOH A O   1 
HETATM 5164 O  O   . HOH G 3 .   ? -32.868 -15.077 -8.244  1.00 31.14 ? 164 HOH A O   1 
HETATM 5165 O  O   . HOH G 3 .   ? -47.941 -4.092  -0.942  1.00 26.09 ? 165 HOH A O   1 
HETATM 5166 O  O   . HOH G 3 .   ? -13.374 -18.735 -15.151 1.00 30.00 ? 166 HOH A O   1 
HETATM 5167 O  O   . HOH G 3 .   ? -38.133 4.904   8.101   1.00 32.22 ? 167 HOH A O   1 
HETATM 5168 O  O   . HOH G 3 .   ? -32.136 -14.555 -4.898  1.00 25.71 ? 169 HOH A O   1 
HETATM 5169 O  O   . HOH G 3 .   ? -11.551 -17.516 -16.422 1.00 39.25 ? 170 HOH A O   1 
HETATM 5170 O  O   . HOH G 3 .   ? -38.799 1.859   -8.007  1.00 29.85 ? 175 HOH A O   1 
HETATM 5171 O  O   . HOH G 3 .   ? 0.499   9.792   -21.744 1.00 26.96 ? 491 HOH A O   1 
HETATM 5172 O  O   . HOH G 3 .   ? -20.521 6.028   -27.404 1.00 32.43 ? 492 HOH A O   1 
HETATM 5173 O  O   . HOH G 3 .   ? -31.209 1.243   13.118  1.00 33.20 ? 493 HOH A O   1 
HETATM 5174 O  O   . HOH G 3 .   ? -7.316  0.697   -24.756 1.00 31.95 ? 494 HOH A O   1 
HETATM 5175 O  O   . HOH G 3 .   ? -3.316  13.621  -7.008  1.00 31.62 ? 495 HOH A O   1 
HETATM 5176 O  O   . HOH G 3 .   ? -24.792 -11.399 -12.672 1.00 29.67 ? 496 HOH A O   1 
HETATM 5177 O  O   . HOH G 3 .   ? 0.078   -0.014  -26.907 1.00 37.65 ? 497 HOH A O   1 
HETATM 5178 O  O   . HOH G 3 .   ? -24.650 19.720  -5.415  1.00 28.31 ? 498 HOH A O   1 
HETATM 5179 O  O   . HOH G 3 .   ? -13.358 -4.997  6.308   1.00 31.47 ? 499 HOH A O   1 
HETATM 5180 O  O   . HOH G 3 .   ? -47.415 -5.481  -4.842  1.00 30.01 ? 502 HOH A O   1 
HETATM 5181 O  O   . HOH G 3 .   ? -17.743 -2.366  -24.302 1.00 30.03 ? 503 HOH A O   1 
HETATM 5182 O  O   . HOH G 3 .   ? -37.344 4.124   11.340  1.00 24.51 ? 504 HOH A O   1 
HETATM 5183 O  O   . HOH G 3 .   ? -27.419 -21.049 -9.580  1.00 27.64 ? 505 HOH A O   1 
HETATM 5184 O  O   . HOH G 3 .   ? 7.347   2.377   -7.691  1.00 34.15 ? 506 HOH A O   1 
HETATM 5185 O  O   . HOH G 3 .   ? 1.502   1.283   -6.058  1.00 38.56 ? 507 HOH A O   1 
HETATM 5186 O  O   . HOH G 3 .   ? -23.351 -16.276 4.515   1.00 26.94 ? 508 HOH A O   1 
HETATM 5187 O  O   . HOH G 3 .   ? -37.619 -12.980 -11.529 1.00 35.94 ? 509 HOH A O   1 
HETATM 5188 O  O   . HOH G 3 .   ? 7.555   3.445   -22.988 1.00 38.97 ? 510 HOH A O   1 
HETATM 5189 O  O   . HOH G 3 .   ? -20.463 17.890  -16.410 1.00 34.33 ? 511 HOH A O   1 
HETATM 5190 O  O   . HOH G 3 .   ? -32.226 -15.341 6.113   1.00 34.31 ? 512 HOH A O   1 
HETATM 5191 O  O   . HOH G 3 .   ? -19.786 12.746  -27.516 1.00 29.44 ? 513 HOH A O   1 
HETATM 5192 O  O   . HOH G 3 .   ? -11.089 12.378  3.664   1.00 28.64 ? 514 HOH A O   1 
HETATM 5193 O  O   . HOH G 3 .   ? -22.048 2.586   14.373  1.00 32.14 ? 515 HOH A O   1 
HETATM 5194 O  O   . HOH G 3 .   ? -24.675 -5.187  13.828  1.00 41.88 ? 516 HOH A O   1 
HETATM 5195 O  O   . HOH G 3 .   ? -14.095 -8.624  -30.402 1.00 28.77 ? 517 HOH A O   1 
HETATM 5196 O  O   . HOH G 3 .   ? -20.747 17.840  -0.644  1.00 41.90 ? 518 HOH A O   1 
HETATM 5197 O  O   . HOH G 3 .   ? -21.002 -18.268 0.491   1.00 32.90 ? 519 HOH A O   1 
HETATM 5198 O  O   . HOH G 3 .   ? -40.489 -3.672  8.698   1.00 22.62 ? 520 HOH A O   1 
HETATM 5199 O  O   . HOH G 3 .   ? -7.461  0.614   -27.342 1.00 31.28 ? 521 HOH A O   1 
HETATM 5200 O  O   . HOH G 3 .   ? -15.491 -19.269 -11.483 1.00 29.24 ? 522 HOH A O   1 
HETATM 5201 O  O   . HOH G 3 .   ? -36.729 -13.941 -9.491  1.00 23.71 ? 523 HOH A O   1 
HETATM 5202 O  O   . HOH G 3 .   ? -28.344 19.232  6.006   1.00 34.28 ? 524 HOH A O   1 
HETATM 5203 O  O   . HOH G 3 .   ? -26.643 -15.196 -13.599 1.00 40.34 ? 525 HOH A O   1 
HETATM 5204 O  O   . HOH G 3 .   ? -22.665 -19.948 -10.134 1.00 32.77 ? 526 HOH A O   1 
HETATM 5205 O  O   . HOH G 3 .   ? -25.413 -13.655 11.586  1.00 29.30 ? 527 HOH A O   1 
HETATM 5206 O  O   . HOH G 3 .   ? -5.893  -15.901 -25.933 1.00 31.79 ? 528 HOH A O   1 
HETATM 5207 O  O   . HOH G 3 .   ? -35.741 -6.347  12.272  1.00 24.77 ? 529 HOH A O   1 
HETATM 5208 O  O   . HOH G 3 .   ? -24.032 11.173  10.646  1.00 39.75 ? 530 HOH A O   1 
HETATM 5209 O  O   . HOH G 3 .   ? -7.212  16.560  -8.518  1.00 34.14 ? 531 HOH A O   1 
HETATM 5210 O  O   . HOH G 3 .   ? 11.274  1.271   -13.510 1.00 36.16 ? 532 HOH A O   1 
HETATM 5211 O  O   . HOH G 3 .   ? -38.610 -2.440  -8.353  1.00 38.25 ? 533 HOH A O   1 
HETATM 5212 O  O   . HOH G 3 .   ? -33.401 19.722  -14.922 1.00 43.63 ? 534 HOH A O   1 
HETATM 5213 O  O   . HOH G 3 .   ? 8.827   -1.263  -14.027 1.00 42.59 ? 535 HOH A O   1 
HETATM 5214 O  O   . HOH G 3 .   ? -33.722 -16.539 -1.786  1.00 25.75 ? 536 HOH A O   1 
HETATM 5215 O  O   . HOH G 3 .   ? -44.665 -13.437 -6.608  1.00 49.16 ? 537 HOH A O   1 
HETATM 5216 O  O   . HOH G 3 .   ? 0.023   6.085   -2.917  1.00 31.81 ? 538 HOH A O   1 
HETATM 5217 O  O   . HOH G 3 .   ? 3.074   5.236   -5.696  1.00 41.51 ? 539 HOH A O   1 
HETATM 5218 O  O   . HOH G 3 .   ? -39.012 5.066   -8.134  1.00 30.64 ? 540 HOH A O   1 
HETATM 5219 O  O   . HOH G 3 .   ? -41.933 -8.227  3.263   1.00 32.23 ? 541 HOH A O   1 
HETATM 5220 O  O   . HOH G 3 .   ? -20.506 -19.019 -2.506  1.00 39.29 ? 542 HOH A O   1 
HETATM 5221 O  O   . HOH G 3 .   ? -19.586 -9.505  -27.694 1.00 37.13 ? 543 HOH A O   1 
HETATM 5222 O  O   . HOH G 3 .   ? -18.874 2.523   -33.516 1.00 37.91 ? 544 HOH A O   1 
HETATM 5223 O  O   . HOH G 3 .   ? -6.305  15.101  -2.825  1.00 36.82 ? 545 HOH A O   1 
HETATM 5224 O  O   . HOH G 3 .   ? -10.876 -4.080  3.687   1.00 30.75 ? 546 HOH A O   1 
HETATM 5225 O  O   . HOH G 3 .   ? -9.189  10.236  4.176   1.00 35.15 ? 547 HOH A O   1 
HETATM 5226 O  O   . HOH G 3 .   ? -45.217 2.229   0.944   1.00 29.31 ? 548 HOH A O   1 
HETATM 5227 O  O   . HOH G 3 .   ? -14.861 -17.184 -16.702 1.00 37.25 ? 549 HOH A O   1 
HETATM 5228 O  O   . HOH G 3 .   ? -13.575 15.232  17.930  1.00 44.60 ? 550 HOH A O   1 
HETATM 5229 O  O   . HOH G 3 .   ? -24.387 -14.837 -21.665 1.00 35.88 ? 551 HOH A O   1 
HETATM 5230 O  O   . HOH G 3 .   ? -2.044  2.751   -28.824 1.00 33.64 ? 552 HOH A O   1 
HETATM 5231 O  O   . HOH G 3 .   ? -29.765 0.217   -15.139 1.00 38.55 ? 553 HOH A O   1 
HETATM 5232 O  O   . HOH G 3 .   ? -13.884 -9.102  8.382   1.00 39.04 ? 554 HOH A O   1 
HETATM 5233 O  O   . HOH G 3 .   ? -19.251 -1.108  13.199  1.00 34.28 ? 555 HOH A O   1 
HETATM 5234 O  O   . HOH G 3 .   ? -20.561 18.298  -9.597  1.00 34.38 ? 556 HOH A O   1 
HETATM 5235 O  O   . HOH G 3 .   ? -21.964 -15.609 -24.005 1.00 50.74 ? 557 HOH A O   1 
HETATM 5236 O  O   . HOH G 3 .   ? -19.815 10.960  -30.172 1.00 41.29 ? 558 HOH A O   1 
HETATM 5237 O  O   . HOH G 3 .   ? -21.286 -17.903 -16.051 1.00 34.88 ? 559 HOH A O   1 
HETATM 5238 O  O   . HOH G 3 .   ? -28.914 -14.877 9.227   1.00 35.76 ? 560 HOH A O   1 
HETATM 5239 O  O   . HOH G 3 .   ? -17.149 -21.351 0.846   1.00 41.77 ? 561 HOH A O   1 
HETATM 5240 O  O   . HOH G 3 .   ? -2.788  -5.983  -27.520 1.00 44.16 ? 562 HOH A O   1 
HETATM 5241 O  O   . HOH G 3 .   ? -40.694 4.443   4.020   1.00 33.67 ? 563 HOH A O   1 
HETATM 5242 O  O   . HOH G 3 .   ? 8.768   -1.899  -6.358  1.00 38.06 ? 564 HOH A O   1 
HETATM 5243 O  O   . HOH G 3 .   ? -2.584  -7.097  -0.124  1.00 46.93 ? 565 HOH A O   1 
HETATM 5244 O  O   . HOH G 3 .   ? -22.413 -17.805 -3.238  1.00 44.25 ? 566 HOH A O   1 
HETATM 5245 O  O   . HOH G 3 .   ? -16.287 -19.418 -14.123 1.00 36.97 ? 567 HOH A O   1 
HETATM 5246 O  O   . HOH G 3 .   ? -1.712  11.261  -3.274  1.00 48.15 ? 568 HOH A O   1 
HETATM 5247 O  O   . HOH G 3 .   ? -11.081 4.253   -27.928 1.00 30.79 ? 569 HOH A O   1 
HETATM 5248 O  O   . HOH G 3 .   ? -8.883  16.735  -11.024 1.00 40.36 ? 570 HOH A O   1 
HETATM 5249 O  O   . HOH G 3 .   ? -40.835 1.994   6.715   1.00 44.53 ? 571 HOH A O   1 
HETATM 5250 O  O   . HOH G 3 .   ? -29.870 13.824  1.421   1.00 31.62 ? 572 HOH A O   1 
HETATM 5251 O  O   . HOH G 3 .   ? -44.600 -0.640  -7.680  1.00 50.77 ? 573 HOH A O   1 
HETATM 5252 O  O   . HOH G 3 .   ? -13.485 11.398  14.569  1.00 37.98 ? 574 HOH A O   1 
HETATM 5253 O  O   . HOH G 3 .   ? -23.516 -14.951 10.347  1.00 49.83 ? 575 HOH A O   1 
HETATM 5254 O  O   . HOH G 3 .   ? -24.312 -17.007 6.578   1.00 41.16 ? 576 HOH A O   1 
HETATM 5255 O  O   . HOH G 3 .   ? -8.117  -13.897 -28.605 1.00 38.13 ? 577 HOH A O   1 
HETATM 5256 O  O   . HOH G 3 .   ? 5.328   8.661   -6.343  1.00 36.87 ? 578 HOH A O   1 
HETATM 5257 O  O   . HOH G 3 .   ? -20.026 7.579   -16.300 1.00 34.25 ? 579 HOH A O   1 
HETATM 5258 O  O   . HOH G 3 .   ? -32.464 0.772   -15.247 1.00 38.27 ? 580 HOH A O   1 
HETATM 5259 O  O   . HOH G 3 .   ? -8.089  14.535  -16.041 1.00 45.92 ? 581 HOH A O   1 
HETATM 5260 O  O   . HOH G 3 .   ? -12.172 -18.183 -11.736 1.00 33.62 ? 582 HOH A O   1 
HETATM 5261 O  O   . HOH G 3 .   ? -11.767 0.194   4.429   1.00 33.62 ? 583 HOH A O   1 
HETATM 5262 O  O   . HOH G 3 .   ? -27.665 16.336  3.571   1.00 42.78 ? 584 HOH A O   1 
HETATM 5263 O  O   . HOH G 3 .   ? -34.593 -2.462  15.228  1.00 58.34 ? 585 HOH A O   1 
HETATM 5264 O  O   . HOH G 3 .   ? -24.267 1.363   14.649  1.00 42.19 ? 586 HOH A O   1 
HETATM 5265 O  O   . HOH G 3 .   ? -33.611 10.721  -24.190 1.00 43.83 ? 587 HOH A O   1 
HETATM 5266 O  O   . HOH G 3 .   ? 0.513   11.217  -24.107 1.00 40.80 ? 588 HOH A O   1 
HETATM 5267 O  O   . HOH G 3 .   ? 4.442   8.312   -23.763 1.00 45.77 ? 589 HOH A O   1 
HETATM 5268 O  O   . HOH G 3 .   ? -37.186 -1.828  -10.901 1.00 42.82 ? 590 HOH A O   1 
HETATM 5269 O  O   . HOH G 3 .   ? -24.361 -8.662  -32.094 1.00 49.22 ? 591 HOH A O   1 
HETATM 5270 O  O   . HOH G 3 .   ? -5.809  -3.812  0.672   1.00 38.04 ? 592 HOH A O   1 
HETATM 5271 O  O   . HOH G 3 .   ? -3.985  13.455  0.069   1.00 41.90 ? 593 HOH A O   1 
HETATM 5272 O  O   . HOH G 3 .   ? -8.759  2.908   -28.217 1.00 34.96 ? 594 HOH A O   1 
HETATM 5273 O  O   . HOH G 3 .   ? -33.317 1.187   12.021  1.00 46.74 ? 595 HOH A O   1 
HETATM 5274 O  O   . HOH G 3 .   ? -21.413 -8.358  12.712  1.00 36.89 ? 596 HOH A O   1 
HETATM 5275 O  O   . HOH G 3 .   ? -10.992 20.035  -14.430 1.00 36.81 ? 597 HOH A O   1 
HETATM 5276 O  O   . HOH G 3 .   ? 3.385   3.412   -28.296 1.00 44.57 ? 598 HOH A O   1 
HETATM 5277 O  O   . HOH G 3 .   ? -22.630 -9.948  -30.829 1.00 53.35 ? 599 HOH A O   1 
HETATM 5278 O  O   . HOH G 3 .   ? -14.040 10.839  -32.950 1.00 34.37 ? 600 HOH A O   1 
HETATM 5279 O  O   . HOH G 3 .   ? -10.197 -11.078 4.948   1.00 42.95 ? 601 HOH A O   1 
HETATM 5280 O  O   . HOH G 3 .   ? -45.159 -6.191  -8.392  1.00 40.61 ? 602 HOH A O   1 
HETATM 5281 O  O   . HOH G 3 .   ? -42.031 -0.675  -15.359 1.00 44.25 ? 603 HOH A O   1 
HETATM 5282 O  O   . HOH G 3 .   ? -18.066 16.047  1.775   1.00 57.44 ? 604 HOH A O   1 
HETATM 5283 O  O   . HOH G 3 .   ? -14.121 -9.483  11.011  1.00 40.96 ? 605 HOH A O   1 
HETATM 5284 O  O   . HOH G 3 .   ? -36.377 5.299   -12.602 1.00 38.56 ? 606 HOH A O   1 
HETATM 5285 O  O   . HOH G 3 .   ? -6.382  13.534  -18.551 1.00 40.43 ? 607 HOH A O   1 
HETATM 5286 O  O   . HOH G 3 .   ? -34.722 -17.484 8.887   1.00 31.51 ? 608 HOH A O   1 
HETATM 5287 O  O   . HOH G 3 .   ? -16.560 10.213  12.292  1.00 37.31 ? 609 HOH A O   1 
HETATM 5288 O  O   . HOH G 3 .   ? -26.966 -13.737 -15.619 1.00 51.17 ? 610 HOH A O   1 
HETATM 5289 O  O   . HOH G 3 .   ? 7.409   5.672   -21.406 1.00 41.11 ? 611 HOH A O   1 
HETATM 5290 O  O   . HOH G 3 .   ? -10.517 -2.141  -31.115 1.00 39.69 ? 612 HOH A O   1 
HETATM 5291 O  O   . HOH G 3 .   ? -12.124 -16.617 -28.388 1.00 49.04 ? 613 HOH A O   1 
HETATM 5292 O  O   . HOH G 3 .   ? -4.993  -8.341  -29.891 1.00 49.65 ? 614 HOH A O   1 
HETATM 5293 O  O   . HOH G 3 .   ? -21.125 18.854  -19.586 1.00 38.88 ? 615 HOH A O   1 
HETATM 5294 O  O   . HOH G 3 .   ? -1.900  -9.839  -28.640 1.00 47.11 ? 616 HOH A O   1 
HETATM 5295 O  O   . HOH G 3 .   ? -22.235 7.106   -34.292 1.00 53.01 ? 617 HOH A O   1 
HETATM 5296 O  O   . HOH G 3 .   ? -27.515 -14.406 -11.512 1.00 46.96 ? 618 HOH A O   1 
HETATM 5297 O  O   . HOH G 3 .   ? -17.220 3.328   13.821  1.00 54.13 ? 619 HOH A O   1 
HETATM 5298 O  O   . HOH G 3 .   ? -39.128 -14.758 -13.129 1.00 36.56 ? 620 HOH A O   1 
HETATM 5299 O  O   . HOH G 3 .   ? -17.462 -21.700 -5.553  1.00 40.52 ? 621 HOH A O   1 
HETATM 5300 O  O   . HOH G 3 .   ? -36.549 -9.293  9.472   1.00 46.84 ? 622 HOH A O   1 
HETATM 5301 O  O   . HOH G 3 .   ? -34.924 -8.681  -18.596 1.00 43.31 ? 623 HOH A O   1 
HETATM 5302 O  O   . HOH G 3 .   ? -30.443 19.054  9.503   1.00 33.71 ? 624 HOH A O   1 
HETATM 5303 O  O   . HOH G 3 .   ? -16.032 21.399  -8.764  1.00 41.29 ? 625 HOH A O   1 
HETATM 5304 O  O   . HOH G 3 .   ? -46.352 -10.294 -5.499  1.00 48.47 ? 626 HOH A O   1 
HETATM 5305 O  O   . HOH G 3 .   ? 4.224   3.577   -12.139 1.00 46.89 ? 627 HOH A O   1 
HETATM 5306 O  O   . HOH G 3 .   ? -36.699 3.294   6.817   1.00 20.14 ? 628 HOH A O   1 
HETATM 5307 O  O   . HOH G 3 .   ? -26.366 -16.312 -3.727  1.00 52.99 ? 629 HOH A O   1 
HETATM 5308 O  O   . HOH G 3 .   ? -2.016  -10.551 -0.800  1.00 68.28 ? 630 HOH A O   1 
HETATM 5309 O  O   . HOH G 3 .   ? -23.003 -9.228  -28.235 1.00 59.25 ? 631 HOH A O   1 
HETATM 5310 O  O   . HOH G 3 .   ? -11.969 15.694  -0.087  1.00 58.63 ? 632 HOH A O   1 
HETATM 5311 O  O   . HOH G 3 .   ? -21.345 -16.193 -21.419 1.00 56.78 ? 633 HOH A O   1 
HETATM 5312 O  O   . HOH G 3 .   ? -7.364  6.967   6.897   1.00 54.55 ? 634 HOH A O   1 
HETATM 5313 O  O   . HOH G 3 .   ? -45.681 -8.868  -8.933  1.00 44.86 ? 635 HOH A O   1 
HETATM 5314 O  O   . HOH G 3 .   ? -20.076 -20.554 -13.445 1.00 42.12 ? 636 HOH A O   1 
HETATM 5315 O  O   . HOH G 3 .   ? -22.387 -19.218 -14.405 1.00 40.04 ? 637 HOH A O   1 
HETATM 5316 O  O   . HOH G 3 .   ? 2.748   7.912   -21.922 1.00 41.55 ? 638 HOH A O   1 
HETATM 5317 O  O   . HOH H 3 .   ? -39.151 -4.597  -35.075 1.00 16.54 ? 1   HOH B O   1 
HETATM 5318 O  O   . HOH H 3 .   ? -34.511 3.837   -60.197 1.00 25.70 ? 8   HOH B O   1 
HETATM 5319 O  O   . HOH H 3 .   ? -34.333 -17.232 -53.074 1.00 28.08 ? 9   HOH B O   1 
HETATM 5320 O  O   . HOH H 3 .   ? -51.852 -12.058 -41.832 1.00 20.99 ? 13  HOH B O   1 
HETATM 5321 O  O   . HOH H 3 .   ? -47.704 7.648   -25.794 1.00 16.40 ? 14  HOH B O   1 
HETATM 5322 O  O   . HOH H 3 .   ? -51.090 -13.337 -34.610 1.00 22.34 ? 17  HOH B O   1 
HETATM 5323 O  O   . HOH H 3 .   ? -55.925 11.191  -45.336 1.00 20.33 ? 20  HOH B O   1 
HETATM 5324 O  O   . HOH H 3 .   ? -42.634 2.376   -28.152 1.00 21.82 ? 25  HOH B O   1 
HETATM 5325 O  O   . HOH H 3 .   ? -48.775 1.348   -36.994 1.00 17.20 ? 27  HOH B O   1 
HETATM 5326 O  O   . HOH H 3 .   ? -36.255 -16.877 -58.092 1.00 25.43 ? 35  HOH B O   1 
HETATM 5327 O  O   . HOH H 3 .   ? -53.672 5.089   -21.417 1.00 32.29 ? 36  HOH B O   1 
HETATM 5328 O  O   . HOH H 3 .   ? -49.015 -2.719  -61.149 1.00 18.95 ? 37  HOH B O   1 
HETATM 5329 O  O   . HOH H 3 .   ? -45.350 -16.214 -34.029 1.00 21.66 ? 38  HOH B O   1 
HETATM 5330 O  O   . HOH H 3 .   ? -58.881 -1.177  -22.665 1.00 23.27 ? 39  HOH B O   1 
HETATM 5331 O  O   . HOH H 3 .   ? -34.232 -7.813  -42.067 1.00 20.11 ? 40  HOH B O   1 
HETATM 5332 O  O   . HOH H 3 .   ? -36.291 -8.190  -57.157 1.00 16.47 ? 42  HOH B O   1 
HETATM 5333 O  O   . HOH H 3 .   ? -57.165 -3.769  -43.158 1.00 17.68 ? 52  HOH B O   1 
HETATM 5334 O  O   . HOH H 3 .   ? -33.507 3.042   -46.011 1.00 23.98 ? 54  HOH B O   1 
HETATM 5335 O  O   . HOH H 3 .   ? -58.158 -2.693  -45.787 1.00 24.71 ? 56  HOH B O   1 
HETATM 5336 O  O   . HOH H 3 .   ? -46.681 12.892  -31.159 1.00 21.01 ? 59  HOH B O   1 
HETATM 5337 O  O   . HOH H 3 .   ? -37.804 -8.864  -54.234 1.00 17.56 ? 60  HOH B O   1 
HETATM 5338 O  O   . HOH H 3 .   ? -50.057 -12.254 -31.885 1.00 22.99 ? 62  HOH B O   1 
HETATM 5339 O  O   . HOH H 3 .   ? -30.705 -10.878 -57.611 1.00 16.30 ? 63  HOH B O   1 
HETATM 5340 O  O   . HOH H 3 .   ? -49.004 -10.335 -60.860 1.00 21.20 ? 65  HOH B O   1 
HETATM 5341 O  O   . HOH H 3 .   ? -31.078 6.057   -47.984 1.00 20.89 ? 68  HOH B O   1 
HETATM 5342 O  O   . HOH H 3 .   ? -41.551 -13.616 -62.117 1.00 25.88 ? 69  HOH B O   1 
HETATM 5343 O  O   . HOH H 3 .   ? -49.658 -20.635 -37.532 1.00 23.93 ? 73  HOH B O   1 
HETATM 5344 O  O   . HOH H 3 .   ? -39.861 13.495  -30.862 1.00 25.95 ? 77  HOH B O   1 
HETATM 5345 O  O   . HOH H 3 .   ? -46.031 10.165  -26.096 1.00 31.90 ? 78  HOH B O   1 
HETATM 5346 O  O   . HOH H 3 .   ? -45.159 -9.687  -23.165 1.00 23.33 ? 80  HOH B O   1 
HETATM 5347 O  O   . HOH H 3 .   ? -38.809 -10.693 -55.907 1.00 19.48 ? 85  HOH B O   1 
HETATM 5348 O  O   . HOH H 3 .   ? -39.827 -0.521  -34.646 1.00 16.74 ? 89  HOH B O   1 
HETATM 5349 O  O   . HOH H 3 .   ? -56.334 -8.075  -54.425 1.00 33.49 ? 92  HOH B O   1 
HETATM 5350 O  O   . HOH H 3 .   ? -24.678 -12.200 -46.559 1.00 32.73 ? 94  HOH B O   1 
HETATM 5351 O  O   . HOH H 3 .   ? -32.195 7.688   -38.828 1.00 24.08 ? 96  HOH B O   1 
HETATM 5352 O  O   . HOH H 3 .   ? -36.011 3.325   -47.059 1.00 20.80 ? 97  HOH B O   1 
HETATM 5353 O  O   . HOH H 3 .   ? -43.411 6.725   -26.013 1.00 29.01 ? 102 HOH B O   1 
HETATM 5354 O  O   . HOH H 3 .   ? -34.441 -17.448 -56.340 1.00 28.87 ? 105 HOH B O   1 
HETATM 5355 O  O   . HOH H 3 .   ? -53.933 -1.052  -56.898 1.00 25.29 ? 106 HOH B O   1 
HETATM 5356 O  O   . HOH H 3 .   ? -29.089 -0.646  -58.851 1.00 27.30 ? 107 HOH B O   1 
HETATM 5357 O  O   . HOH H 3 .   ? -38.026 -9.753  -58.320 1.00 25.57 ? 108 HOH B O   1 
HETATM 5358 O  O   . HOH H 3 .   ? -31.133 -8.767  -60.041 1.00 36.70 ? 110 HOH B O   1 
HETATM 5359 O  O   . HOH H 3 .   ? -29.889 4.240   -44.457 1.00 28.07 ? 112 HOH B O   1 
HETATM 5360 O  O   . HOH H 3 .   ? -31.305 1.449   -47.445 1.00 23.57 ? 116 HOH B O   1 
HETATM 5361 O  O   . HOH H 3 .   ? -40.522 -9.249  -59.308 1.00 25.33 ? 118 HOH B O   1 
HETATM 5362 O  O   . HOH H 3 .   ? -36.462 -17.526 -49.514 1.00 22.83 ? 119 HOH B O   1 
HETATM 5363 O  O   . HOH H 3 .   ? -43.064 9.062   -27.333 1.00 23.25 ? 120 HOH B O   1 
HETATM 5364 O  O   . HOH H 3 .   ? -24.849 -9.757  -52.478 1.00 24.60 ? 122 HOH B O   1 
HETATM 5365 O  O   . HOH H 3 .   ? -22.634 -4.976  -53.715 1.00 28.92 ? 127 HOH B O   1 
HETATM 5366 O  O   . HOH H 3 .   ? -31.974 -4.381  -61.162 1.00 26.67 ? 129 HOH B O   1 
HETATM 5367 O  O   . HOH H 3 .   ? -52.122 13.022  -27.013 1.00 28.31 ? 131 HOH B O   1 
HETATM 5368 O  O   . HOH H 3 .   ? -51.565 16.807  -41.867 1.00 31.18 ? 132 HOH B O   1 
HETATM 5369 O  O   . HOH H 3 .   ? -43.358 18.544  -41.849 1.00 24.46 ? 133 HOH B O   1 
HETATM 5370 O  O   . HOH H 3 .   ? -34.222 10.032  -40.699 1.00 26.20 ? 144 HOH B O   1 
HETATM 5371 O  O   . HOH H 3 .   ? -47.966 10.115  -14.642 1.00 35.43 ? 145 HOH B O   1 
HETATM 5372 O  O   . HOH H 3 .   ? -41.835 10.229  -25.157 1.00 29.51 ? 146 HOH B O   1 
HETATM 5373 O  O   . HOH H 3 .   ? -47.021 -5.926  -44.201 1.00 22.55 ? 147 HOH B O   1 
HETATM 5374 O  O   . HOH H 3 .   ? -42.612 3.693   -25.683 1.00 29.11 ? 152 HOH B O   1 
HETATM 5375 O  O   . HOH H 3 .   ? -46.888 -3.486  -23.944 1.00 33.24 ? 159 HOH B O   1 
HETATM 5376 O  O   . HOH H 3 .   ? -31.792 -14.733 -42.713 1.00 22.37 ? 161 HOH B O   1 
HETATM 5377 O  O   . HOH H 3 .   ? -29.674 -9.152  -56.489 1.00 28.15 ? 168 HOH B O   1 
HETATM 5378 O  O   . HOH H 3 .   ? -45.985 5.804   -25.154 1.00 27.76 ? 171 HOH B O   1 
HETATM 5379 O  O   . HOH H 3 .   ? -40.055 8.312   -53.669 1.00 33.20 ? 172 HOH B O   1 
HETATM 5380 O  O   . HOH H 3 .   ? -43.731 1.666   -15.285 1.00 33.88 ? 173 HOH B O   1 
HETATM 5381 O  O   . HOH H 3 .   ? -37.488 -15.457 -46.269 1.00 33.02 ? 174 HOH B O   1 
HETATM 5382 O  O   . HOH H 3 .   ? -65.803 -13.097 -35.777 1.00 34.16 ? 491 HOH B O   1 
HETATM 5383 O  O   . HOH H 3 .   ? -30.671 1.267   -59.192 1.00 35.14 ? 492 HOH B O   1 
HETATM 5384 O  O   . HOH H 3 .   ? -42.342 16.041  -48.349 1.00 27.90 ? 493 HOH B O   1 
HETATM 5385 O  O   . HOH H 3 .   ? -30.330 -13.594 -40.746 1.00 37.99 ? 494 HOH B O   1 
HETATM 5386 O  O   . HOH H 3 .   ? -55.406 -19.449 -35.570 1.00 39.13 ? 495 HOH B O   1 
HETATM 5387 O  O   . HOH H 3 .   ? -43.360 -14.683 -35.656 1.00 32.67 ? 496 HOH B O   1 
HETATM 5388 O  O   . HOH H 3 .   ? -67.934 -7.600  -38.563 1.00 47.58 ? 497 HOH B O   1 
HETATM 5389 O  O   . HOH H 3 .   ? -47.533 -22.135 -37.641 1.00 30.47 ? 498 HOH B O   1 
HETATM 5390 O  O   . HOH H 3 .   ? -59.385 -7.314  -50.500 1.00 35.01 ? 499 HOH B O   1 
HETATM 5391 O  O   . HOH H 3 .   ? -58.511 -16.579 -19.791 1.00 41.38 ? 502 HOH B O   1 
HETATM 5392 O  O   . HOH H 3 .   ? -23.652 -1.350  -54.947 1.00 31.61 ? 503 HOH B O   1 
HETATM 5393 O  O   . HOH H 3 .   ? -59.510 3.721   -48.813 1.00 29.26 ? 504 HOH B O   1 
HETATM 5394 O  O   . HOH H 3 .   ? -51.592 1.398   -62.789 1.00 39.58 ? 505 HOH B O   1 
HETATM 5395 O  O   . HOH H 3 .   ? -71.254 6.655   -36.408 1.00 40.86 ? 506 HOH B O   1 
HETATM 5396 O  O   . HOH H 3 .   ? -51.844 -20.190 -35.648 1.00 25.48 ? 507 HOH B O   1 
HETATM 5397 O  O   . HOH H 3 .   ? -43.420 12.032  -24.026 1.00 26.30 ? 508 HOH B O   1 
HETATM 5398 O  O   . HOH H 3 .   ? -33.092 1.446   -43.797 1.00 36.18 ? 509 HOH B O   1 
HETATM 5399 O  O   . HOH H 3 .   ? -52.800 -3.229  -57.664 1.00 33.01 ? 510 HOH B O   1 
HETATM 5400 O  O   . HOH H 3 .   ? -31.087 -5.865  -41.337 1.00 40.62 ? 511 HOH B O   1 
HETATM 5401 O  O   . HOH H 3 .   ? -57.051 -0.318  -21.470 1.00 40.24 ? 512 HOH B O   1 
HETATM 5402 O  O   . HOH H 3 .   ? -60.267 1.841   -53.711 1.00 33.38 ? 513 HOH B O   1 
HETATM 5403 O  O   . HOH H 3 .   ? -24.880 -7.508  -50.204 1.00 29.79 ? 514 HOH B O   1 
HETATM 5404 O  O   . HOH H 3 .   ? -51.340 -9.344  -60.941 1.00 37.46 ? 515 HOH B O   1 
HETATM 5405 O  O   . HOH H 3 .   ? -51.422 -3.562  -60.001 1.00 30.27 ? 516 HOH B O   1 
HETATM 5406 O  O   . HOH H 3 .   ? -55.537 14.864  -43.829 1.00 36.05 ? 517 HOH B O   1 
HETATM 5407 O  O   . HOH H 3 .   ? -44.974 3.472   -23.656 1.00 33.24 ? 518 HOH B O   1 
HETATM 5408 O  O   . HOH H 3 .   ? -47.680 17.435  -39.492 1.00 42.28 ? 519 HOH B O   1 
HETATM 5409 O  O   . HOH H 3 .   ? -56.038 18.724  -40.222 1.00 44.15 ? 520 HOH B O   1 
HETATM 5410 O  O   . HOH H 3 .   ? -57.593 18.452  -35.347 1.00 36.91 ? 521 HOH B O   1 
HETATM 5411 O  O   . HOH H 3 .   ? -65.561 3.069   -44.873 1.00 44.90 ? 522 HOH B O   1 
HETATM 5412 O  O   . HOH H 3 .   ? -60.702 15.828  -37.046 1.00 31.57 ? 523 HOH B O   1 
HETATM 5413 O  O   . HOH H 3 .   ? -45.994 -20.792 -39.404 1.00 37.04 ? 524 HOH B O   1 
HETATM 5414 O  O   . HOH H 3 .   ? -53.527 -19.828 -32.215 1.00 37.84 ? 525 HOH B O   1 
HETATM 5415 O  O   . HOH H 3 .   ? -40.276 -16.003 -36.174 1.00 57.91 ? 526 HOH B O   1 
HETATM 5416 O  O   . HOH H 3 .   ? -30.785 5.662   -58.265 1.00 26.71 ? 527 HOH B O   1 
HETATM 5417 O  O   . HOH H 3 .   ? -58.492 -5.381  -52.405 1.00 37.13 ? 528 HOH B O   1 
HETATM 5418 O  O   . HOH H 3 .   ? -60.062 11.259  -49.789 1.00 38.56 ? 529 HOH B O   1 
HETATM 5419 O  O   . HOH H 3 .   ? -31.177 -13.723 -45.514 1.00 30.28 ? 530 HOH B O   1 
HETATM 5420 O  O   . HOH H 3 .   ? -49.446 -19.222 -49.158 1.00 27.84 ? 531 HOH B O   1 
HETATM 5421 O  O   . HOH H 3 .   ? -72.085 3.817   -37.026 1.00 55.62 ? 532 HOH B O   1 
HETATM 5422 O  O   . HOH H 3 .   ? -39.745 -16.133 -56.564 1.00 37.33 ? 533 HOH B O   1 
HETATM 5423 O  O   . HOH H 3 .   ? -22.470 -6.362  -49.661 1.00 38.42 ? 534 HOH B O   1 
HETATM 5424 O  O   . HOH H 3 .   ? -41.293 -15.592 -28.183 1.00 36.49 ? 535 HOH B O   1 
HETATM 5425 O  O   . HOH H 3 .   ? -50.425 14.050  -24.485 1.00 34.12 ? 536 HOH B O   1 
HETATM 5426 O  O   . HOH H 3 .   ? -54.653 -18.204 -30.367 1.00 36.25 ? 537 HOH B O   1 
HETATM 5427 O  O   . HOH H 3 .   ? -42.608 7.608   -18.118 1.00 35.26 ? 538 HOH B O   1 
HETATM 5428 O  O   . HOH H 3 .   ? -50.698 1.190   -19.646 1.00 32.35 ? 539 HOH B O   1 
HETATM 5429 O  O   . HOH H 3 .   ? -65.154 8.733   -22.189 1.00 32.57 ? 540 HOH B O   1 
HETATM 5430 O  O   . HOH H 3 .   ? -58.433 14.101  -30.092 1.00 44.48 ? 541 HOH B O   1 
HETATM 5431 O  O   . HOH H 3 .   ? -37.755 -7.098  -63.744 1.00 32.76 ? 542 HOH B O   1 
HETATM 5432 O  O   . HOH H 3 .   ? -51.754 -18.359 -31.106 1.00 44.20 ? 543 HOH B O   1 
HETATM 5433 O  O   . HOH H 3 .   ? -56.215 0.037   -58.444 1.00 40.20 ? 544 HOH B O   1 
HETATM 5434 O  O   . HOH H 3 .   ? -45.088 -17.627 -47.584 1.00 37.06 ? 545 HOH B O   1 
HETATM 5435 O  O   . HOH H 3 .   ? -61.227 1.499   -16.122 1.00 37.63 ? 546 HOH B O   1 
HETATM 5436 O  O   . HOH H 3 .   ? -43.528 -10.124 -20.602 1.00 52.67 ? 547 HOH B O   1 
HETATM 5437 O  O   . HOH H 3 .   ? -25.793 1.244   -54.309 1.00 34.92 ? 548 HOH B O   1 
HETATM 5438 O  O   . HOH H 3 .   ? -57.479 -16.589 -37.082 1.00 40.03 ? 549 HOH B O   1 
HETATM 5439 O  O   . HOH H 3 .   ? -43.470 -15.620 -59.200 1.00 37.25 ? 550 HOH B O   1 
HETATM 5440 O  O   . HOH H 3 .   ? -66.150 2.666   -14.849 1.00 43.96 ? 551 HOH B O   1 
HETATM 5441 O  O   . HOH H 3 .   ? -30.055 -3.313  -44.096 1.00 45.08 ? 552 HOH B O   1 
HETATM 5442 O  O   . HOH H 3 .   ? -26.974 -2.247  -44.347 1.00 35.91 ? 553 HOH B O   1 
HETATM 5443 O  O   . HOH H 3 .   ? -35.646 -15.950 -43.046 1.00 36.30 ? 554 HOH B O   1 
HETATM 5444 O  O   . HOH H 3 .   ? -30.226 1.018   -45.051 1.00 37.19 ? 555 HOH B O   1 
HETATM 5445 O  O   . HOH H 3 .   ? -40.456 13.960  -59.026 1.00 41.87 ? 556 HOH B O   1 
HETATM 5446 O  O   . HOH H 3 .   ? -46.127 17.020  -32.553 1.00 47.52 ? 557 HOH B O   1 
HETATM 5447 O  O   . HOH H 3 .   ? -43.119 -17.079 -45.943 1.00 43.96 ? 558 HOH B O   1 
HETATM 5448 O  O   . HOH H 3 .   ? -70.179 -8.446  -31.538 1.00 55.17 ? 559 HOH B O   1 
HETATM 5449 O  O   . HOH H 3 .   ? -40.988 12.948  -51.673 1.00 40.60 ? 560 HOH B O   1 
HETATM 5450 O  O   . HOH H 3 .   ? -49.747 8.238   -14.190 1.00 35.43 ? 561 HOH B O   1 
HETATM 5451 O  O   . HOH H 3 .   ? -45.184 -2.964  -22.151 1.00 37.55 ? 562 HOH B O   1 
HETATM 5452 O  O   . HOH H 3 .   ? -64.409 10.301  -20.090 1.00 40.46 ? 563 HOH B O   1 
HETATM 5453 O  O   . HOH H 3 .   ? -35.224 -7.169  -35.012 1.00 34.36 ? 564 HOH B O   1 
HETATM 5454 O  O   . HOH H 3 .   ? -58.659 0.592   -15.107 1.00 51.44 ? 565 HOH B O   1 
HETATM 5455 O  O   . HOH H 3 .   ? -35.840 3.089   -63.212 1.00 33.01 ? 566 HOH B O   1 
HETATM 5456 O  O   . HOH H 3 .   ? -56.398 3.115   -20.775 1.00 41.51 ? 567 HOH B O   1 
HETATM 5457 O  O   . HOH H 3 .   ? -44.166 11.815  -21.275 1.00 35.16 ? 568 HOH B O   1 
HETATM 5458 O  O   . HOH H 3 .   ? -58.051 -20.962 -30.965 1.00 48.09 ? 569 HOH B O   1 
HETATM 5459 O  O   . HOH H 3 .   ? -47.183 -8.449  -61.594 1.00 38.26 ? 570 HOH B O   1 
HETATM 5460 O  O   . HOH H 3 .   ? -47.611 -16.944 -53.295 1.00 39.38 ? 571 HOH B O   1 
HETATM 5461 O  O   . HOH H 3 .   ? -61.834 9.127   -49.767 1.00 38.85 ? 572 HOH B O   1 
HETATM 5462 O  O   . HOH H 3 .   ? -62.463 9.506   -18.684 1.00 41.72 ? 573 HOH B O   1 
HETATM 5463 O  O   . HOH H 3 .   ? -70.191 -9.389  -26.088 1.00 43.71 ? 574 HOH B O   1 
HETATM 5464 O  O   . HOH H 3 .   ? -61.039 -11.104 -20.572 1.00 38.68 ? 575 HOH B O   1 
HETATM 5465 O  O   . HOH H 3 .   ? -42.735 -1.665  -65.628 1.00 44.52 ? 576 HOH B O   1 
HETATM 5466 O  O   . HOH H 3 .   ? -23.341 -14.136 -45.645 1.00 50.45 ? 577 HOH B O   1 
HETATM 5467 O  O   . HOH H 3 .   ? -36.545 -1.478  -32.477 1.00 50.36 ? 578 HOH B O   1 
HETATM 5468 O  O   . HOH H 3 .   ? -76.266 4.146   -33.574 1.00 42.92 ? 579 HOH B O   1 
HETATM 5469 O  O   . HOH H 3 .   ? -64.407 -7.055  -45.088 1.00 44.31 ? 580 HOH B O   1 
HETATM 5470 O  O   . HOH H 3 .   ? -48.955 -9.606  -17.387 1.00 38.69 ? 581 HOH B O   1 
HETATM 5471 O  O   . HOH H 3 .   ? -58.420 16.100  -35.188 1.00 41.39 ? 582 HOH B O   1 
HETATM 5472 O  O   . HOH H 3 .   ? -30.031 -2.320  -61.186 1.00 44.76 ? 583 HOH B O   1 
HETATM 5473 O  O   . HOH H 3 .   ? -56.400 -0.248  -18.493 1.00 39.06 ? 584 HOH B O   1 
HETATM 5474 O  O   . HOH H 3 .   ? -54.732 2.262   -18.024 1.00 40.59 ? 585 HOH B O   1 
HETATM 5475 O  O   . HOH H 3 .   ? -69.445 0.773   -40.938 1.00 44.55 ? 586 HOH B O   1 
HETATM 5476 O  O   . HOH H 3 .   ? -33.248 9.588   -33.173 1.00 44.54 ? 587 HOH B O   1 
HETATM 5477 O  O   . HOH H 3 .   ? -35.285 11.635  -25.993 1.00 37.28 ? 588 HOH B O   1 
HETATM 5478 O  O   . HOH H 3 .   ? -43.034 -12.221 -36.949 1.00 38.53 ? 589 HOH B O   1 
HETATM 5479 O  O   . HOH H 3 .   ? -34.191 14.326  -35.299 1.00 48.04 ? 590 HOH B O   1 
HETATM 5480 O  O   . HOH H 3 .   ? -30.863 3.517   -56.547 1.00 38.60 ? 591 HOH B O   1 
HETATM 5481 O  O   . HOH H 3 .   ? -63.893 -4.512  -45.276 1.00 46.16 ? 592 HOH B O   1 
HETATM 5482 O  O   . HOH H 3 .   ? -59.761 14.131  -27.760 1.00 44.72 ? 593 HOH B O   1 
HETATM 5483 O  O   . HOH H 3 .   ? -53.467 -17.800 -33.048 1.00 39.29 ? 594 HOH B O   1 
HETATM 5484 O  O   . HOH H 3 .   ? -45.536 -18.616 -33.117 1.00 41.06 ? 595 HOH B O   1 
HETATM 5485 O  O   . HOH H 3 .   ? -33.166 2.143   -37.665 1.00 40.89 ? 596 HOH B O   1 
HETATM 5486 O  O   . HOH H 3 .   ? -51.307 -20.221 -33.334 1.00 41.25 ? 597 HOH B O   1 
HETATM 5487 O  O   . HOH H 3 .   ? -52.500 2.901   -48.293 1.00 40.48 ? 598 HOH B O   1 
HETATM 5488 O  O   . HOH H 3 .   ? -41.820 0.265   -63.061 1.00 42.94 ? 599 HOH B O   1 
HETATM 5489 O  O   . HOH H 3 .   ? -35.445 2.253   -58.513 1.00 25.28 ? 600 HOH B O   1 
HETATM 5490 O  O   . HOH H 3 .   ? -22.793 -9.480  -48.521 1.00 54.83 ? 601 HOH B O   1 
HETATM 5491 O  O   . HOH H 3 .   ? -48.506 -0.959  -65.112 1.00 52.81 ? 602 HOH B O   1 
HETATM 5492 O  O   . HOH H 3 .   ? -59.436 0.246   -50.843 1.00 42.71 ? 603 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
5057 MN MN . MN C . ? 0.1496 0.0000 0.0000 0.0000 0.0000 0.0000 500 MN A MN 
5058 MN MN . MN D . ? 0.2722 0.0000 0.0000 0.0000 0.0000 0.0000 501 MN A MN 
5059 MN MN . MN E . ? 0.1887 0.0000 0.0000 0.0000 0.0000 0.0000 500 MN B MN 
5060 MN MN . MN F . ? 0.3087 0.0000 0.0000 0.0000 0.0000 0.0000 501 MN B MN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   TYR 1   176 176 TYR TYR A . n 
A 1 2   SER 2   177 177 SER SER A . n 
A 1 3   GLY 3   178 178 GLY GLY A . n 
A 1 4   PRO 4   179 179 PRO PRO A . n 
A 1 5   LYS 5   180 180 LYS LYS A . n 
A 1 6   LEU 6   181 181 LEU LEU A . n 
A 1 7   GLU 7   182 182 GLU GLU A . n 
A 1 8   ASP 8   183 183 ASP ASP A . n 
A 1 9   GLY 9   184 184 GLY GLY A . n 
A 1 10  LYS 10  185 185 LYS LYS A . n 
A 1 11  VAL 11  186 186 VAL VAL A . n 
A 1 12  THR 12  187 187 THR THR A . n 
A 1 13  ILE 13  188 188 ILE ILE A . n 
A 1 14  SER 14  189 189 SER SER A . n 
A 1 15  PHE 15  190 190 PHE PHE A . n 
A 1 16  MET 16  191 191 MET MET A . n 
A 1 17  LYS 17  192 192 LYS LYS A . n 
A 1 18  GLU 18  193 193 GLU GLU A . n 
A 1 19  LEU 19  194 194 LEU LEU A . n 
A 1 20  MET 20  195 195 MET MET A . n 
A 1 21  GLN 21  196 196 GLN GLN A . n 
A 1 22  TRP 22  197 197 TRP TRP A . n 
A 1 23  TYR 23  198 198 TYR TYR A . n 
A 1 24  LYS 24  199 199 LYS LYS A . n 
A 1 25  ASP 25  200 200 ASP ASP A . n 
A 1 26  GLN 26  201 201 GLN GLN A . n 
A 1 27  LYS 27  202 202 LYS LYS A . n 
A 1 28  LYS 28  203 203 LYS LYS A . n 
A 1 29  LEU 29  204 204 LEU LEU A . n 
A 1 30  HIS 30  205 205 HIS HIS A . n 
A 1 31  ARG 31  206 206 ARG ARG A . n 
A 1 32  LYS 32  207 207 LYS LYS A . n 
A 1 33  CYS 33  208 208 CYS CYS A . n 
A 1 34  ALA 34  209 209 ALA ALA A . n 
A 1 35  TYR 35  210 210 TYR TYR A . n 
A 1 36  GLN 36  211 211 GLN GLN A . n 
A 1 37  ILE 37  212 212 ILE ILE A . n 
A 1 38  LEU 38  213 213 LEU LEU A . n 
A 1 39  VAL 39  214 214 VAL VAL A . n 
A 1 40  GLN 40  215 215 GLN GLN A . n 
A 1 41  VAL 41  216 216 VAL VAL A . n 
A 1 42  LYS 42  217 217 LYS LYS A . n 
A 1 43  GLU 43  218 218 GLU GLU A . n 
A 1 44  VAL 44  219 219 VAL VAL A . n 
A 1 45  LEU 45  220 220 LEU LEU A . n 
A 1 46  SER 46  221 221 SER SER A . n 
A 1 47  LYS 47  222 222 LYS LYS A . n 
A 1 48  LEU 48  223 223 LEU LEU A . n 
A 1 49  SER 49  224 224 SER SER A . n 
A 1 50  THR 50  225 225 THR THR A . n 
A 1 51  LEU 51  226 226 LEU LEU A . n 
A 1 52  VAL 52  227 227 VAL VAL A . n 
A 1 53  GLU 53  228 228 GLU GLU A . n 
A 1 54  THR 54  229 229 THR THR A . n 
A 1 55  THR 55  230 230 THR THR A . n 
A 1 56  LEU 56  231 231 LEU LEU A . n 
A 1 57  LYS 57  232 232 LYS LYS A . n 
A 1 58  GLU 58  233 233 GLU GLU A . n 
A 1 59  THR 59  234 234 THR THR A . n 
A 1 60  GLU 60  235 235 GLU GLU A . n 
A 1 61  LYS 61  236 236 LYS LYS A . n 
A 1 62  ILE 62  237 237 ILE ILE A . n 
A 1 63  THR 63  238 238 THR THR A . n 
A 1 64  VAL 64  239 239 VAL VAL A . n 
A 1 65  CYS 65  240 240 CYS CYS A . n 
A 1 66  GLY 66  241 241 GLY GLY A . n 
A 1 67  ASP 67  242 242 ASP ASP A . n 
A 1 68  THR 68  243 243 THR THR A . n 
A 1 69  HIS 69  244 244 HIS HIS A . n 
A 1 70  GLY 70  245 245 GLY GLY A . n 
A 1 71  GLN 71  246 246 GLN GLN A . n 
A 1 72  PHE 72  247 247 PHE PHE A . n 
A 1 73  TYR 73  248 248 TYR TYR A . n 
A 1 74  ASP 74  249 249 ASP ASP A . n 
A 1 75  LEU 75  250 250 LEU LEU A . n 
A 1 76  LEU 76  251 251 LEU LEU A . n 
A 1 77  ASN 77  252 252 ASN ASN A . n 
A 1 78  ILE 78  253 253 ILE ILE A . n 
A 1 79  PHE 79  254 254 PHE PHE A . n 
A 1 80  GLU 80  255 255 GLU GLU A . n 
A 1 81  LEU 81  256 256 LEU LEU A . n 
A 1 82  ASN 82  257 257 ASN ASN A . n 
A 1 83  GLY 83  258 258 GLY GLY A . n 
A 1 84  LEU 84  259 259 LEU LEU A . n 
A 1 85  PRO 85  260 260 PRO PRO A . n 
A 1 86  SER 86  261 261 SER SER A . n 
A 1 87  GLU 87  262 262 GLU GLU A . n 
A 1 88  THR 88  263 263 THR THR A . n 
A 1 89  ASN 89  264 264 ASN ASN A . n 
A 1 90  PRO 90  265 265 PRO PRO A . n 
A 1 91  TYR 91  266 266 TYR TYR A . n 
A 1 92  ILE 92  267 267 ILE ILE A . n 
A 1 93  PHE 93  268 268 PHE PHE A . n 
A 1 94  ASN 94  269 269 ASN ASN A . n 
A 1 95  GLY 95  270 270 GLY GLY A . n 
A 1 96  ASP 96  271 271 ASP ASP A . n 
A 1 97  PHE 97  272 272 PHE PHE A . n 
A 1 98  VAL 98  273 273 VAL VAL A . n 
A 1 99  ASP 99  274 274 ASP ASP A . n 
A 1 100 ARG 100 275 275 ARG ARG A . n 
A 1 101 GLY 101 276 276 GLY GLY A . n 
A 1 102 SER 102 277 277 SER SER A . n 
A 1 103 PHE 103 278 278 PHE PHE A . n 
A 1 104 SER 104 279 279 SER SER A . n 
A 1 105 VAL 105 280 280 VAL VAL A . n 
A 1 106 GLU 106 281 281 GLU GLU A . n 
A 1 107 VAL 107 282 282 VAL VAL A . n 
A 1 108 ILE 108 283 283 ILE ILE A . n 
A 1 109 LEU 109 284 284 LEU LEU A . n 
A 1 110 THR 110 285 285 THR THR A . n 
A 1 111 LEU 111 286 286 LEU LEU A . n 
A 1 112 PHE 112 287 287 PHE PHE A . n 
A 1 113 GLY 113 288 288 GLY GLY A . n 
A 1 114 PHE 114 289 289 PHE PHE A . n 
A 1 115 LYS 115 290 290 LYS LYS A . n 
A 1 116 LEU 116 291 291 LEU LEU A . n 
A 1 117 LEU 117 292 292 LEU LEU A . n 
A 1 118 TYR 118 293 293 TYR TYR A . n 
A 1 119 PRO 119 294 294 PRO PRO A . n 
A 1 120 ASP 120 295 295 ASP ASP A . n 
A 1 121 HIS 121 296 296 HIS HIS A . n 
A 1 122 PHE 122 297 297 PHE PHE A . n 
A 1 123 HIS 123 298 298 HIS HIS A . n 
A 1 124 LEU 124 299 299 LEU LEU A . n 
A 1 125 LEU 125 300 300 LEU LEU A . n 
A 1 126 ARG 126 301 301 ARG ARG A . n 
A 1 127 GLY 127 302 302 GLY GLY A . n 
A 1 128 ASN 128 303 303 ASN ASN A . n 
A 1 129 HIS 129 304 304 HIS HIS A . n 
A 1 130 GLU 130 305 305 GLU GLU A . n 
A 1 131 THR 131 306 306 THR THR A . n 
A 1 132 ASP 132 307 307 ASP ASP A . n 
A 1 133 ASN 133 308 308 ASN ASN A . n 
A 1 134 MET 134 309 309 MET MET A . n 
A 1 135 ASN 135 310 310 ASN ASN A . n 
A 1 136 GLN 136 311 311 GLN GLN A . n 
A 1 137 ILE 137 312 312 ILE ILE A . n 
A 1 138 TYR 138 313 313 TYR TYR A . n 
A 1 139 GLY 139 314 314 GLY GLY A . n 
A 1 140 PHE 140 315 315 PHE PHE A . n 
A 1 141 GLU 141 316 316 GLU GLU A . n 
A 1 142 GLY 142 317 317 GLY GLY A . n 
A 1 143 GLU 143 318 318 GLU GLU A . n 
A 1 144 VAL 144 319 319 VAL VAL A . n 
A 1 145 LYS 145 320 320 LYS LYS A . n 
A 1 146 ALA 146 321 321 ALA ALA A . n 
A 1 147 LYS 147 322 322 LYS LYS A . n 
A 1 148 TYR 148 323 323 TYR TYR A . n 
A 1 149 THR 149 324 324 THR THR A . n 
A 1 150 ALA 150 325 325 ALA ALA A . n 
A 1 151 GLN 151 326 326 GLN GLN A . n 
A 1 152 MET 152 327 327 MET MET A . n 
A 1 153 TYR 153 328 328 TYR TYR A . n 
A 1 154 GLU 154 329 329 GLU GLU A . n 
A 1 155 LEU 155 330 330 LEU LEU A . n 
A 1 156 PHE 156 331 331 PHE PHE A . n 
A 1 157 SER 157 332 332 SER SER A . n 
A 1 158 GLU 158 333 333 GLU GLU A . n 
A 1 159 VAL 159 334 334 VAL VAL A . n 
A 1 160 PHE 160 335 335 PHE PHE A . n 
A 1 161 GLU 161 336 336 GLU GLU A . n 
A 1 162 TRP 162 337 337 TRP TRP A . n 
A 1 163 LEU 163 338 338 LEU LEU A . n 
A 1 164 PRO 164 339 339 PRO PRO A . n 
A 1 165 LEU 165 340 340 LEU LEU A . n 
A 1 166 ALA 166 341 341 ALA ALA A . n 
A 1 167 GLN 167 342 342 GLN GLN A . n 
A 1 168 CYS 168 343 343 CYS CYS A . n 
A 1 169 ILE 169 344 344 ILE ILE A . n 
A 1 170 ASN 170 345 345 ASN ASN A . n 
A 1 171 GLY 171 346 346 GLY GLY A . n 
A 1 172 LYS 172 347 347 LYS LYS A . n 
A 1 173 VAL 173 348 348 VAL VAL A . n 
A 1 174 LEU 174 349 349 LEU LEU A . n 
A 1 175 ILE 175 350 350 ILE ILE A . n 
A 1 176 MET 176 351 351 MET MET A . n 
A 1 177 HIS 177 352 352 HIS HIS A . n 
A 1 178 GLY 178 353 353 GLY GLY A . n 
A 1 179 GLY 179 354 354 GLY GLY A . n 
A 1 180 LEU 180 355 355 LEU LEU A . n 
A 1 181 PHE 181 356 356 PHE PHE A . n 
A 1 182 SER 182 357 357 SER SER A . n 
A 1 183 GLU 183 358 358 GLU GLU A . n 
A 1 184 ASP 184 359 359 ASP ASP A . n 
A 1 185 GLY 185 360 360 GLY GLY A . n 
A 1 186 VAL 186 361 361 VAL VAL A . n 
A 1 187 THR 187 362 362 THR THR A . n 
A 1 188 LEU 188 363 363 LEU LEU A . n 
A 1 189 ASP 189 364 364 ASP ASP A . n 
A 1 190 ASP 190 365 365 ASP ASP A . n 
A 1 191 ILE 191 366 366 ILE ILE A . n 
A 1 192 ARG 192 367 367 ARG ARG A . n 
A 1 193 LYS 193 368 368 LYS LYS A . n 
A 1 194 ILE 194 369 369 ILE ILE A . n 
A 1 195 GLU 195 370 370 GLU GLU A . n 
A 1 196 ARG 196 371 371 ARG ARG A . n 
A 1 197 ASN 197 372 372 ASN ASN A . n 
A 1 198 ARG 198 373 373 ARG ARG A . n 
A 1 199 GLN 199 374 374 GLN GLN A . n 
A 1 200 PRO 200 375 375 PRO PRO A . n 
A 1 201 PRO 201 376 376 PRO PRO A . n 
A 1 202 ASP 202 377 377 ASP ASP A . n 
A 1 203 SER 203 378 378 SER SER A . n 
A 1 204 GLY 204 379 379 GLY GLY A . n 
A 1 205 PRO 205 380 380 PRO PRO A . n 
A 1 206 MET 206 381 381 MET MET A . n 
A 1 207 CYS 207 382 382 CYS CYS A . n 
A 1 208 ASP 208 383 383 ASP ASP A . n 
A 1 209 LEU 209 384 384 LEU LEU A . n 
A 1 210 LEU 210 385 385 LEU LEU A . n 
A 1 211 TRP 211 386 386 TRP TRP A . n 
A 1 212 SER 212 387 387 SER SER A . n 
A 1 213 ASP 213 388 388 ASP ASP A . n 
A 1 214 PRO 214 389 389 PRO PRO A . n 
A 1 215 GLN 215 390 390 GLN GLN A . n 
A 1 216 PRO 216 391 391 PRO PRO A . n 
A 1 217 GLN 217 392 392 GLN GLN A . n 
A 1 218 ASN 218 393 393 ASN ASN A . n 
A 1 219 GLY 219 394 394 GLY GLY A . n 
A 1 220 ARG 220 395 395 ARG ARG A . n 
A 1 221 SER 221 396 396 SER SER A . n 
A 1 222 ILE 222 397 397 ILE ILE A . n 
A 1 223 SER 223 398 398 SER SER A . n 
A 1 224 LYS 224 399 399 LYS LYS A . n 
A 1 225 ARG 225 400 400 ARG ARG A . n 
A 1 226 GLY 226 401 401 GLY GLY A . n 
A 1 227 VAL 227 402 402 VAL VAL A . n 
A 1 228 SER 228 403 403 SER SER A . n 
A 1 229 CYS 229 404 404 CYS CYS A . n 
A 1 230 GLN 230 405 405 GLN GLN A . n 
A 1 231 PHE 231 406 406 PHE PHE A . n 
A 1 232 GLY 232 407 407 GLY GLY A . n 
A 1 233 PRO 233 408 408 PRO PRO A . n 
A 1 234 ASP 234 409 409 ASP ASP A . n 
A 1 235 VAL 235 410 410 VAL VAL A . n 
A 1 236 THR 236 411 411 THR THR A . n 
A 1 237 LYS 237 412 412 LYS LYS A . n 
A 1 238 ALA 238 413 413 ALA ALA A . n 
A 1 239 PHE 239 414 414 PHE PHE A . n 
A 1 240 LEU 240 415 415 LEU LEU A . n 
A 1 241 GLU 241 416 416 GLU GLU A . n 
A 1 242 GLU 242 417 417 GLU GLU A . n 
A 1 243 ASN 243 418 418 ASN ASN A . n 
A 1 244 ASN 244 419 419 ASN ASN A . n 
A 1 245 LEU 245 420 420 LEU LEU A . n 
A 1 246 ASP 246 421 421 ASP ASP A . n 
A 1 247 TYR 247 422 422 TYR TYR A . n 
A 1 248 ILE 248 423 423 ILE ILE A . n 
A 1 249 ILE 249 424 424 ILE ILE A . n 
A 1 250 ARG 250 425 425 ARG ARG A . n 
A 1 251 SER 251 426 426 SER SER A . n 
A 1 252 HIS 252 427 427 HIS HIS A . n 
A 1 253 GLU 253 428 428 GLU GLU A . n 
A 1 254 VAL 254 429 429 VAL VAL A . n 
A 1 255 LYS 255 430 430 LYS LYS A . n 
A 1 256 ALA 256 431 431 ALA ALA A . n 
A 1 257 GLU 257 432 432 GLU GLU A . n 
A 1 258 GLY 258 433 433 GLY GLY A . n 
A 1 259 TYR 259 434 434 TYR TYR A . n 
A 1 260 GLU 260 435 435 GLU GLU A . n 
A 1 261 VAL 261 436 436 VAL VAL A . n 
A 1 262 ALA 262 437 437 ALA ALA A . n 
A 1 263 HIS 263 438 438 HIS HIS A . n 
A 1 264 GLY 264 439 439 GLY GLY A . n 
A 1 265 GLY 265 440 440 GLY GLY A . n 
A 1 266 ARG 266 441 441 ARG ARG A . n 
A 1 267 CYS 267 442 442 CYS CYS A . n 
A 1 268 VAL 268 443 443 VAL VAL A . n 
A 1 269 THR 269 444 444 THR THR A . n 
A 1 270 VAL 270 445 445 VAL VAL A . n 
A 1 271 PHE 271 446 446 PHE PHE A . n 
A 1 272 SER 272 447 447 SER SER A . n 
A 1 273 ALA 273 448 448 ALA ALA A . n 
A 1 274 PRO 274 449 449 PRO PRO A . n 
A 1 275 ASN 275 450 450 ASN ASN A . n 
A 1 276 TYR 276 451 451 TYR TYR A . n 
A 1 277 CYS 277 452 452 CYS CYS A . n 
A 1 278 ASP 278 453 453 ASP ASP A . n 
A 1 279 GLN 279 454 454 GLN GLN A . n 
A 1 280 MET 280 455 455 MET MET A . n 
A 1 281 GLY 281 456 456 GLY GLY A . n 
A 1 282 ASN 282 457 457 ASN ASN A . n 
A 1 283 LYS 283 458 458 LYS LYS A . n 
A 1 284 ALA 284 459 459 ALA ALA A . n 
A 1 285 SER 285 460 460 SER SER A . n 
A 1 286 TYR 286 461 461 TYR TYR A . n 
A 1 287 ILE 287 462 462 ILE ILE A . n 
A 1 288 HIS 288 463 463 HIS HIS A . n 
A 1 289 LEU 289 464 464 LEU LEU A . n 
A 1 290 GLN 290 465 465 GLN GLN A . n 
A 1 291 GLY 291 466 466 GLY GLY A . n 
A 1 292 SER 292 467 467 SER SER A . n 
A 1 293 ASP 293 468 468 ASP ASP A . n 
A 1 294 LEU 294 469 469 LEU LEU A . n 
A 1 295 ARG 295 470 470 ARG ARG A . n 
A 1 296 PRO 296 471 471 PRO PRO A . n 
A 1 297 GLN 297 472 472 GLN GLN A . n 
A 1 298 PHE 298 473 473 PHE PHE A . n 
A 1 299 HIS 299 474 474 HIS HIS A . n 
A 1 300 GLN 300 475 475 GLN GLN A . n 
A 1 301 PHE 301 476 476 PHE PHE A . n 
A 1 302 THR 302 477 477 THR THR A . n 
A 1 303 ALA 303 478 478 ALA ALA A . n 
A 1 304 VAL 304 479 479 VAL VAL A . n 
A 1 305 PRO 305 480 480 PRO PRO A . n 
A 1 306 HIS 306 481 481 HIS HIS A . n 
A 1 307 PRO 307 482 482 PRO PRO A . n 
A 1 308 ASN 308 483 483 ASN ASN A . n 
A 1 309 VAL 309 484 484 VAL VAL A . n 
A 1 310 LYS 310 485 485 LYS LYS A . n 
A 1 311 PRO 311 486 486 PRO PRO A . n 
A 1 312 MET 312 487 487 MET MET A . n 
A 1 313 ALA 313 488 488 ALA ALA A . n 
A 1 314 TYR 314 489 489 TYR TYR A . n 
A 1 315 ALA 315 490 490 ALA ALA A . n 
B 1 1   TYR 1   176 176 TYR TYR B . n 
B 1 2   SER 2   177 177 SER SER B . n 
B 1 3   GLY 3   178 178 GLY GLY B . n 
B 1 4   PRO 4   179 179 PRO PRO B . n 
B 1 5   LYS 5   180 180 LYS LYS B . n 
B 1 6   LEU 6   181 181 LEU LEU B . n 
B 1 7   GLU 7   182 182 GLU GLU B . n 
B 1 8   ASP 8   183 183 ASP ASP B . n 
B 1 9   GLY 9   184 184 GLY GLY B . n 
B 1 10  LYS 10  185 185 LYS LYS B . n 
B 1 11  VAL 11  186 186 VAL VAL B . n 
B 1 12  THR 12  187 187 THR THR B . n 
B 1 13  ILE 13  188 188 ILE ILE B . n 
B 1 14  SER 14  189 189 SER SER B . n 
B 1 15  PHE 15  190 190 PHE PHE B . n 
B 1 16  MET 16  191 191 MET MET B . n 
B 1 17  LYS 17  192 192 LYS LYS B . n 
B 1 18  GLU 18  193 193 GLU GLU B . n 
B 1 19  LEU 19  194 194 LEU LEU B . n 
B 1 20  MET 20  195 195 MET MET B . n 
B 1 21  GLN 21  196 196 GLN GLN B . n 
B 1 22  TRP 22  197 197 TRP TRP B . n 
B 1 23  TYR 23  198 198 TYR TYR B . n 
B 1 24  LYS 24  199 199 LYS LYS B . n 
B 1 25  ASP 25  200 200 ASP ASP B . n 
B 1 26  GLN 26  201 201 GLN GLN B . n 
B 1 27  LYS 27  202 202 LYS LYS B . n 
B 1 28  LYS 28  203 203 LYS LYS B . n 
B 1 29  LEU 29  204 204 LEU LEU B . n 
B 1 30  HIS 30  205 205 HIS HIS B . n 
B 1 31  ARG 31  206 206 ARG ARG B . n 
B 1 32  LYS 32  207 207 LYS LYS B . n 
B 1 33  CYS 33  208 208 CYS CYS B . n 
B 1 34  ALA 34  209 209 ALA ALA B . n 
B 1 35  TYR 35  210 210 TYR TYR B . n 
B 1 36  GLN 36  211 211 GLN GLN B . n 
B 1 37  ILE 37  212 212 ILE ILE B . n 
B 1 38  LEU 38  213 213 LEU LEU B . n 
B 1 39  VAL 39  214 214 VAL VAL B . n 
B 1 40  GLN 40  215 215 GLN GLN B . n 
B 1 41  VAL 41  216 216 VAL VAL B . n 
B 1 42  LYS 42  217 217 LYS LYS B . n 
B 1 43  GLU 43  218 218 GLU GLU B . n 
B 1 44  VAL 44  219 219 VAL VAL B . n 
B 1 45  LEU 45  220 220 LEU LEU B . n 
B 1 46  SER 46  221 221 SER SER B . n 
B 1 47  LYS 47  222 222 LYS LYS B . n 
B 1 48  LEU 48  223 223 LEU LEU B . n 
B 1 49  SER 49  224 224 SER SER B . n 
B 1 50  THR 50  225 225 THR THR B . n 
B 1 51  LEU 51  226 226 LEU LEU B . n 
B 1 52  VAL 52  227 227 VAL VAL B . n 
B 1 53  GLU 53  228 228 GLU GLU B . n 
B 1 54  THR 54  229 229 THR THR B . n 
B 1 55  THR 55  230 230 THR THR B . n 
B 1 56  LEU 56  231 231 LEU LEU B . n 
B 1 57  LYS 57  232 232 LYS LYS B . n 
B 1 58  GLU 58  233 233 GLU GLU B . n 
B 1 59  THR 59  234 234 THR THR B . n 
B 1 60  GLU 60  235 235 GLU GLU B . n 
B 1 61  LYS 61  236 236 LYS LYS B . n 
B 1 62  ILE 62  237 237 ILE ILE B . n 
B 1 63  THR 63  238 238 THR THR B . n 
B 1 64  VAL 64  239 239 VAL VAL B . n 
B 1 65  CYS 65  240 240 CYS CYS B . n 
B 1 66  GLY 66  241 241 GLY GLY B . n 
B 1 67  ASP 67  242 242 ASP ASP B . n 
B 1 68  THR 68  243 243 THR THR B . n 
B 1 69  HIS 69  244 244 HIS HIS B . n 
B 1 70  GLY 70  245 245 GLY GLY B . n 
B 1 71  GLN 71  246 246 GLN GLN B . n 
B 1 72  PHE 72  247 247 PHE PHE B . n 
B 1 73  TYR 73  248 248 TYR TYR B . n 
B 1 74  ASP 74  249 249 ASP ASP B . n 
B 1 75  LEU 75  250 250 LEU LEU B . n 
B 1 76  LEU 76  251 251 LEU LEU B . n 
B 1 77  ASN 77  252 252 ASN ASN B . n 
B 1 78  ILE 78  253 253 ILE ILE B . n 
B 1 79  PHE 79  254 254 PHE PHE B . n 
B 1 80  GLU 80  255 255 GLU GLU B . n 
B 1 81  LEU 81  256 256 LEU LEU B . n 
B 1 82  ASN 82  257 257 ASN ASN B . n 
B 1 83  GLY 83  258 258 GLY GLY B . n 
B 1 84  LEU 84  259 259 LEU LEU B . n 
B 1 85  PRO 85  260 260 PRO PRO B . n 
B 1 86  SER 86  261 261 SER SER B . n 
B 1 87  GLU 87  262 262 GLU GLU B . n 
B 1 88  THR 88  263 263 THR THR B . n 
B 1 89  ASN 89  264 264 ASN ASN B . n 
B 1 90  PRO 90  265 265 PRO PRO B . n 
B 1 91  TYR 91  266 266 TYR TYR B . n 
B 1 92  ILE 92  267 267 ILE ILE B . n 
B 1 93  PHE 93  268 268 PHE PHE B . n 
B 1 94  ASN 94  269 269 ASN ASN B . n 
B 1 95  GLY 95  270 270 GLY GLY B . n 
B 1 96  ASP 96  271 271 ASP ASP B . n 
B 1 97  PHE 97  272 272 PHE PHE B . n 
B 1 98  VAL 98  273 273 VAL VAL B . n 
B 1 99  ASP 99  274 274 ASP ASP B . n 
B 1 100 ARG 100 275 275 ARG ARG B . n 
B 1 101 GLY 101 276 276 GLY GLY B . n 
B 1 102 SER 102 277 277 SER SER B . n 
B 1 103 PHE 103 278 278 PHE PHE B . n 
B 1 104 SER 104 279 279 SER SER B . n 
B 1 105 VAL 105 280 280 VAL VAL B . n 
B 1 106 GLU 106 281 281 GLU GLU B . n 
B 1 107 VAL 107 282 282 VAL VAL B . n 
B 1 108 ILE 108 283 283 ILE ILE B . n 
B 1 109 LEU 109 284 284 LEU LEU B . n 
B 1 110 THR 110 285 285 THR THR B . n 
B 1 111 LEU 111 286 286 LEU LEU B . n 
B 1 112 PHE 112 287 287 PHE PHE B . n 
B 1 113 GLY 113 288 288 GLY GLY B . n 
B 1 114 PHE 114 289 289 PHE PHE B . n 
B 1 115 LYS 115 290 290 LYS LYS B . n 
B 1 116 LEU 116 291 291 LEU LEU B . n 
B 1 117 LEU 117 292 292 LEU LEU B . n 
B 1 118 TYR 118 293 293 TYR TYR B . n 
B 1 119 PRO 119 294 294 PRO PRO B . n 
B 1 120 ASP 120 295 295 ASP ASP B . n 
B 1 121 HIS 121 296 296 HIS HIS B . n 
B 1 122 PHE 122 297 297 PHE PHE B . n 
B 1 123 HIS 123 298 298 HIS HIS B . n 
B 1 124 LEU 124 299 299 LEU LEU B . n 
B 1 125 LEU 125 300 300 LEU LEU B . n 
B 1 126 ARG 126 301 301 ARG ARG B . n 
B 1 127 GLY 127 302 302 GLY GLY B . n 
B 1 128 ASN 128 303 303 ASN ASN B . n 
B 1 129 HIS 129 304 304 HIS HIS B . n 
B 1 130 GLU 130 305 305 GLU GLU B . n 
B 1 131 THR 131 306 306 THR THR B . n 
B 1 132 ASP 132 307 307 ASP ASP B . n 
B 1 133 ASN 133 308 308 ASN ASN B . n 
B 1 134 MET 134 309 309 MET MET B . n 
B 1 135 ASN 135 310 310 ASN ASN B . n 
B 1 136 GLN 136 311 311 GLN GLN B . n 
B 1 137 ILE 137 312 312 ILE ILE B . n 
B 1 138 TYR 138 313 313 TYR TYR B . n 
B 1 139 GLY 139 314 314 GLY GLY B . n 
B 1 140 PHE 140 315 315 PHE PHE B . n 
B 1 141 GLU 141 316 316 GLU GLU B . n 
B 1 142 GLY 142 317 317 GLY GLY B . n 
B 1 143 GLU 143 318 318 GLU GLU B . n 
B 1 144 VAL 144 319 319 VAL VAL B . n 
B 1 145 LYS 145 320 320 LYS LYS B . n 
B 1 146 ALA 146 321 321 ALA ALA B . n 
B 1 147 LYS 147 322 322 LYS LYS B . n 
B 1 148 TYR 148 323 323 TYR TYR B . n 
B 1 149 THR 149 324 324 THR THR B . n 
B 1 150 ALA 150 325 325 ALA ALA B . n 
B 1 151 GLN 151 326 326 GLN GLN B . n 
B 1 152 MET 152 327 327 MET MET B . n 
B 1 153 TYR 153 328 328 TYR TYR B . n 
B 1 154 GLU 154 329 329 GLU GLU B . n 
B 1 155 LEU 155 330 330 LEU LEU B . n 
B 1 156 PHE 156 331 331 PHE PHE B . n 
B 1 157 SER 157 332 332 SER SER B . n 
B 1 158 GLU 158 333 333 GLU GLU B . n 
B 1 159 VAL 159 334 334 VAL VAL B . n 
B 1 160 PHE 160 335 335 PHE PHE B . n 
B 1 161 GLU 161 336 336 GLU GLU B . n 
B 1 162 TRP 162 337 337 TRP TRP B . n 
B 1 163 LEU 163 338 338 LEU LEU B . n 
B 1 164 PRO 164 339 339 PRO PRO B . n 
B 1 165 LEU 165 340 340 LEU LEU B . n 
B 1 166 ALA 166 341 341 ALA ALA B . n 
B 1 167 GLN 167 342 342 GLN GLN B . n 
B 1 168 CYS 168 343 343 CYS CYS B . n 
B 1 169 ILE 169 344 344 ILE ILE B . n 
B 1 170 ASN 170 345 345 ASN ASN B . n 
B 1 171 GLY 171 346 346 GLY GLY B . n 
B 1 172 LYS 172 347 347 LYS LYS B . n 
B 1 173 VAL 173 348 348 VAL VAL B . n 
B 1 174 LEU 174 349 349 LEU LEU B . n 
B 1 175 ILE 175 350 350 ILE ILE B . n 
B 1 176 MET 176 351 351 MET MET B . n 
B 1 177 HIS 177 352 352 HIS HIS B . n 
B 1 178 GLY 178 353 353 GLY GLY B . n 
B 1 179 GLY 179 354 354 GLY GLY B . n 
B 1 180 LEU 180 355 355 LEU LEU B . n 
B 1 181 PHE 181 356 356 PHE PHE B . n 
B 1 182 SER 182 357 357 SER SER B . n 
B 1 183 GLU 183 358 358 GLU GLU B . n 
B 1 184 ASP 184 359 359 ASP ASP B . n 
B 1 185 GLY 185 360 360 GLY GLY B . n 
B 1 186 VAL 186 361 361 VAL VAL B . n 
B 1 187 THR 187 362 362 THR THR B . n 
B 1 188 LEU 188 363 363 LEU LEU B . n 
B 1 189 ASP 189 364 364 ASP ASP B . n 
B 1 190 ASP 190 365 365 ASP ASP B . n 
B 1 191 ILE 191 366 366 ILE ILE B . n 
B 1 192 ARG 192 367 367 ARG ARG B . n 
B 1 193 LYS 193 368 368 LYS LYS B . n 
B 1 194 ILE 194 369 369 ILE ILE B . n 
B 1 195 GLU 195 370 370 GLU GLU B . n 
B 1 196 ARG 196 371 371 ARG ARG B . n 
B 1 197 ASN 197 372 372 ASN ASN B . n 
B 1 198 ARG 198 373 373 ARG ARG B . n 
B 1 199 GLN 199 374 374 GLN GLN B . n 
B 1 200 PRO 200 375 375 PRO PRO B . n 
B 1 201 PRO 201 376 376 PRO PRO B . n 
B 1 202 ASP 202 377 377 ASP ASP B . n 
B 1 203 SER 203 378 378 SER SER B . n 
B 1 204 GLY 204 379 379 GLY GLY B . n 
B 1 205 PRO 205 380 380 PRO PRO B . n 
B 1 206 MET 206 381 381 MET MET B . n 
B 1 207 CYS 207 382 382 CYS CYS B . n 
B 1 208 ASP 208 383 383 ASP ASP B . n 
B 1 209 LEU 209 384 384 LEU LEU B . n 
B 1 210 LEU 210 385 385 LEU LEU B . n 
B 1 211 TRP 211 386 386 TRP TRP B . n 
B 1 212 SER 212 387 387 SER SER B . n 
B 1 213 ASP 213 388 388 ASP ASP B . n 
B 1 214 PRO 214 389 389 PRO PRO B . n 
B 1 215 GLN 215 390 390 GLN GLN B . n 
B 1 216 PRO 216 391 391 PRO PRO B . n 
B 1 217 GLN 217 392 392 GLN GLN B . n 
B 1 218 ASN 218 393 393 ASN ASN B . n 
B 1 219 GLY 219 394 394 GLY GLY B . n 
B 1 220 ARG 220 395 395 ARG ARG B . n 
B 1 221 SER 221 396 396 SER SER B . n 
B 1 222 ILE 222 397 397 ILE ILE B . n 
B 1 223 SER 223 398 398 SER SER B . n 
B 1 224 LYS 224 399 399 LYS LYS B . n 
B 1 225 ARG 225 400 400 ARG ARG B . n 
B 1 226 GLY 226 401 401 GLY GLY B . n 
B 1 227 VAL 227 402 402 VAL VAL B . n 
B 1 228 SER 228 403 403 SER SER B . n 
B 1 229 CYS 229 404 404 CYS CYS B . n 
B 1 230 GLN 230 405 405 GLN GLN B . n 
B 1 231 PHE 231 406 406 PHE PHE B . n 
B 1 232 GLY 232 407 407 GLY GLY B . n 
B 1 233 PRO 233 408 408 PRO PRO B . n 
B 1 234 ASP 234 409 409 ASP ASP B . n 
B 1 235 VAL 235 410 410 VAL VAL B . n 
B 1 236 THR 236 411 411 THR THR B . n 
B 1 237 LYS 237 412 412 LYS LYS B . n 
B 1 238 ALA 238 413 413 ALA ALA B . n 
B 1 239 PHE 239 414 414 PHE PHE B . n 
B 1 240 LEU 240 415 415 LEU LEU B . n 
B 1 241 GLU 241 416 416 GLU GLU B . n 
B 1 242 GLU 242 417 417 GLU GLU B . n 
B 1 243 ASN 243 418 418 ASN ASN B . n 
B 1 244 ASN 244 419 419 ASN ASN B . n 
B 1 245 LEU 245 420 420 LEU LEU B . n 
B 1 246 ASP 246 421 421 ASP ASP B . n 
B 1 247 TYR 247 422 422 TYR TYR B . n 
B 1 248 ILE 248 423 423 ILE ILE B . n 
B 1 249 ILE 249 424 424 ILE ILE B . n 
B 1 250 ARG 250 425 425 ARG ARG B . n 
B 1 251 SER 251 426 426 SER SER B . n 
B 1 252 HIS 252 427 427 HIS HIS B . n 
B 1 253 GLU 253 428 428 GLU GLU B . n 
B 1 254 VAL 254 429 429 VAL VAL B . n 
B 1 255 LYS 255 430 430 LYS LYS B . n 
B 1 256 ALA 256 431 431 ALA ALA B . n 
B 1 257 GLU 257 432 432 GLU GLU B . n 
B 1 258 GLY 258 433 433 GLY GLY B . n 
B 1 259 TYR 259 434 434 TYR TYR B . n 
B 1 260 GLU 260 435 435 GLU GLU B . n 
B 1 261 VAL 261 436 436 VAL VAL B . n 
B 1 262 ALA 262 437 437 ALA ALA B . n 
B 1 263 HIS 263 438 438 HIS HIS B . n 
B 1 264 GLY 264 439 439 GLY GLY B . n 
B 1 265 GLY 265 440 440 GLY GLY B . n 
B 1 266 ARG 266 441 441 ARG ARG B . n 
B 1 267 CYS 267 442 442 CYS CYS B . n 
B 1 268 VAL 268 443 443 VAL VAL B . n 
B 1 269 THR 269 444 444 THR THR B . n 
B 1 270 VAL 270 445 445 VAL VAL B . n 
B 1 271 PHE 271 446 446 PHE PHE B . n 
B 1 272 SER 272 447 447 SER SER B . n 
B 1 273 ALA 273 448 448 ALA ALA B . n 
B 1 274 PRO 274 449 449 PRO PRO B . n 
B 1 275 ASN 275 450 450 ASN ASN B . n 
B 1 276 TYR 276 451 451 TYR TYR B . n 
B 1 277 CYS 277 452 452 CYS CYS B . n 
B 1 278 ASP 278 453 453 ASP ASP B . n 
B 1 279 GLN 279 454 454 GLN GLN B . n 
B 1 280 MET 280 455 455 MET MET B . n 
B 1 281 GLY 281 456 456 GLY GLY B . n 
B 1 282 ASN 282 457 457 ASN ASN B . n 
B 1 283 LYS 283 458 458 LYS LYS B . n 
B 1 284 ALA 284 459 459 ALA ALA B . n 
B 1 285 SER 285 460 460 SER SER B . n 
B 1 286 TYR 286 461 461 TYR TYR B . n 
B 1 287 ILE 287 462 462 ILE ILE B . n 
B 1 288 HIS 288 463 463 HIS HIS B . n 
B 1 289 LEU 289 464 464 LEU LEU B . n 
B 1 290 GLN 290 465 465 GLN GLN B . n 
B 1 291 GLY 291 466 466 GLY GLY B . n 
B 1 292 SER 292 467 467 SER SER B . n 
B 1 293 ASP 293 468 468 ASP ASP B . n 
B 1 294 LEU 294 469 469 LEU LEU B . n 
B 1 295 ARG 295 470 470 ARG ARG B . n 
B 1 296 PRO 296 471 471 PRO PRO B . n 
B 1 297 GLN 297 472 472 GLN GLN B . n 
B 1 298 PHE 298 473 473 PHE PHE B . n 
B 1 299 HIS 299 474 474 HIS HIS B . n 
B 1 300 GLN 300 475 475 GLN GLN B . n 
B 1 301 PHE 301 476 476 PHE PHE B . n 
B 1 302 THR 302 477 477 THR THR B . n 
B 1 303 ALA 303 478 478 ALA ALA B . n 
B 1 304 VAL 304 479 479 VAL VAL B . n 
B 1 305 PRO 305 480 480 PRO PRO B . n 
B 1 306 HIS 306 481 481 HIS HIS B . n 
B 1 307 PRO 307 482 482 PRO PRO B . n 
B 1 308 ASN 308 483 483 ASN ASN B . n 
B 1 309 VAL 309 484 484 VAL VAL B . n 
B 1 310 LYS 310 485 485 LYS LYS B . n 
B 1 311 PRO 311 486 486 PRO PRO B . n 
B 1 312 MET 312 487 487 MET MET B . n 
B 1 313 ALA 313 488 488 ALA ALA B . n 
B 1 314 TYR 314 489 489 TYR TYR B . n 
B 1 315 ALA 315 490 490 ALA ALA B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? A ASP 67 ? A ASP 242 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD2 ? A ASP 96  ? A ASP 271 ? 1_555 98.0  ? 
2 OD2 ? A ASP 67 ? A ASP 242 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O   ? G HOH .   ? A HOH 21  ? 1_555 92.5  ? 
3 OD2 ? A ASP 96 ? A ASP 271 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O   ? G HOH .   ? A HOH 21  ? 1_555 166.1 ? 
4 OD2 ? A ASP 96 ? A ASP 271 ? 1_555 MN ? C MN . ? A MN 500 ? 1_555 OD1 ? A ASN 128 ? A ASN 303 ? 1_555 95.4  ? 
5 OD2 ? B ASP 67 ? B ASP 242 ? 1_555 MN ? F MN . ? B MN 501 ? 1_555 OD2 ? B ASP 96  ? B ASP 271 ? 1_555 93.5  ? 
6 OD2 ? B ASP 67 ? B ASP 242 ? 1_555 MN ? F MN . ? B MN 501 ? 1_555 O   ? H HOH .   ? B HOH 89  ? 1_555 97.2  ? 
7 OD2 ? B ASP 96 ? B ASP 271 ? 1_555 MN ? F MN . ? B MN 501 ? 1_555 O   ? H HOH .   ? B HOH 89  ? 1_555 167.4 ? 
8 OD2 ? B ASP 96 ? B ASP 271 ? 1_555 MN ? E MN . ? B MN 500 ? 1_555 OD1 ? B ASN 128 ? B ASN 303 ? 1_555 98.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-29 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum  ? 1 
MOLREP phasing           .        ? 2 
REFMAC refinement        5.4.0067 ? 3 
MOSFLM 'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CG  A ARG 441 ? ? O   A HOH 628 ? ? 1.89 
2 1 CG  B ARG 441 ? ? O   B HOH 600 ? ? 2.01 
3 1 OE1 A GLN 311 ? ? OE1 A GLU 316 ? ? 2.04 
4 1 NE  A ARG 441 ? ? O   A HOH 628 ? ? 2.08 
5 1 CG1 B ILE 267 ? ? O   B HOH 598 ? ? 2.12 
6 1 CD1 B ILE 267 ? ? O   B HOH 598 ? ? 2.17 
7 1 OD2 A ASP 364 ? ? NZ  A LYS 368 ? ? 2.19 
8 1 O   B HOH 525 ? ? O   B HOH 594 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A GLU 358 ? ? CG  A GLU 358 ? ? 1.655 1.517 0.138  0.019 N 
2 1 CG A GLU 358 ? ? CD  A GLU 358 ? ? 1.681 1.515 0.166  0.015 N 
3 1 CB A GLU 370 ? ? CG  A GLU 370 ? ? 1.631 1.517 0.114  0.019 N 
4 1 CG A GLU 370 ? ? CD  A GLU 370 ? ? 1.613 1.515 0.098  0.015 N 
5 1 CB A VAL 402 ? ? CG2 A VAL 402 ? ? 1.396 1.524 -0.128 0.021 N 
6 1 CB B GLU 358 ? ? CG  B GLU 358 ? ? 1.685 1.517 0.168  0.019 N 
7 1 CG B GLU 358 ? ? CD  B GLU 358 ? ? 1.671 1.515 0.156  0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 371 ? ? CZ A ARG 371 ? ? NH1 A ARG 371 ? ? 123.45 120.30 3.15  0.50 N 
2 1 NE A ARG 371 ? ? CZ A ARG 371 ? ? NH2 A ARG 371 ? ? 117.29 120.30 -3.01 0.50 N 
3 1 C  A GLY 379 ? ? N  A PRO 380 ? ? CA  A PRO 380 ? ? 128.40 119.30 9.10  1.50 Y 
4 1 NE A ARG 441 ? ? CZ A ARG 441 ? ? NH1 A ARG 441 ? ? 126.52 120.30 6.22  0.50 N 
5 1 NE A ARG 441 ? ? CZ A ARG 441 ? ? NH2 A ARG 441 ? ? 112.93 120.30 -7.37 0.50 N 
6 1 CB B ASP 409 ? ? CG B ASP 409 ? ? OD1 B ASP 409 ? ? 126.06 118.30 7.76  0.90 N 
7 1 NE B ARG 441 ? ? CZ B ARG 441 ? ? NH1 B ARG 441 ? ? 124.79 120.30 4.49  0.50 N 
8 1 NE B ARG 441 ? ? CZ B ARG 441 ? ? NH2 B ARG 441 ? ? 113.04 120.30 -7.26 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 269 ? ? -96.01  58.17   
2  1 ASP A 274 ? ? 81.57   151.60  
3  1 ARG A 275 ? ? 70.12   -61.41  
4  1 GLU A 305 ? ? -98.42  53.54   
5  1 TYR A 323 ? ? -134.48 -111.00 
6  1 LEU A 355 ? ? -97.21  -158.87 
7  1 SER A 403 ? ? 60.79   -151.81 
8  1 SER A 426 ? ? -126.91 -124.40 
9  1 HIS A 427 ? ? 81.12   -22.31  
10 1 ASP A 468 ? ? -166.81 96.17   
11 1 ASP B 183 ? ? 73.15   44.61   
12 1 ASN B 269 ? ? -95.44  55.48   
13 1 ASP B 274 ? ? 77.36   155.95  
14 1 ARG B 275 ? ? 71.39   -61.60  
15 1 GLU B 305 ? ? -91.20  56.10   
16 1 TYR B 323 ? ? -133.92 -121.21 
17 1 SER B 403 ? ? 60.41   -150.70 
18 1 SER B 426 ? ? -127.75 -120.32 
19 1 HIS B 427 ? ? 75.18   -24.04  
20 1 ASN B 450 ? ? 37.63   53.99   
21 1 ASP B 453 ? ? 58.13   12.89   
22 1 ASP B 468 ? ? -164.80 113.51  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   500 500 MN  MN  A . 
D 2 MN  1   501 501 MN  MN  A . 
E 2 MN  1   500 500 MN  MN  B . 
F 2 MN  1   501 501 MN  MN  B . 
G 3 HOH 1   2   2   HOH HOH A . 
G 3 HOH 2   3   3   HOH HOH A . 
G 3 HOH 3   4   4   HOH HOH A . 
G 3 HOH 4   5   5   HOH HOH A . 
G 3 HOH 5   6   6   HOH HOH A . 
G 3 HOH 6   7   7   HOH HOH A . 
G 3 HOH 7   10  10  HOH HOH A . 
G 3 HOH 8   11  11  HOH HOH A . 
G 3 HOH 9   12  12  HOH HOH A . 
G 3 HOH 10  15  15  HOH HOH A . 
G 3 HOH 11  16  16  HOH HOH A . 
G 3 HOH 12  18  18  HOH HOH A . 
G 3 HOH 13  19  19  HOH HOH A . 
G 3 HOH 14  21  21  HOH HOH A . 
G 3 HOH 15  22  22  HOH HOH A . 
G 3 HOH 16  23  23  HOH HOH A . 
G 3 HOH 17  24  24  HOH HOH A . 
G 3 HOH 18  26  26  HOH HOH A . 
G 3 HOH 19  28  28  HOH HOH A . 
G 3 HOH 20  29  29  HOH HOH A . 
G 3 HOH 21  30  30  HOH HOH A . 
G 3 HOH 22  31  31  HOH HOH A . 
G 3 HOH 23  32  32  HOH HOH A . 
G 3 HOH 24  33  33  HOH HOH A . 
G 3 HOH 25  34  34  HOH HOH A . 
G 3 HOH 26  41  41  HOH HOH A . 
G 3 HOH 27  43  43  HOH HOH A . 
G 3 HOH 28  44  44  HOH HOH A . 
G 3 HOH 29  45  45  HOH HOH A . 
G 3 HOH 30  46  46  HOH HOH A . 
G 3 HOH 31  47  47  HOH HOH A . 
G 3 HOH 32  48  48  HOH HOH A . 
G 3 HOH 33  49  49  HOH HOH A . 
G 3 HOH 34  50  50  HOH HOH A . 
G 3 HOH 35  51  51  HOH HOH A . 
G 3 HOH 36  53  53  HOH HOH A . 
G 3 HOH 37  55  55  HOH HOH A . 
G 3 HOH 38  57  57  HOH HOH A . 
G 3 HOH 39  58  58  HOH HOH A . 
G 3 HOH 40  61  61  HOH HOH A . 
G 3 HOH 41  64  64  HOH HOH A . 
G 3 HOH 42  66  66  HOH HOH A . 
G 3 HOH 43  67  67  HOH HOH A . 
G 3 HOH 44  70  70  HOH HOH A . 
G 3 HOH 45  71  71  HOH HOH A . 
G 3 HOH 46  72  72  HOH HOH A . 
G 3 HOH 47  74  74  HOH HOH A . 
G 3 HOH 48  75  75  HOH HOH A . 
G 3 HOH 49  76  76  HOH HOH A . 
G 3 HOH 50  79  79  HOH HOH A . 
G 3 HOH 51  81  81  HOH HOH A . 
G 3 HOH 52  82  82  HOH HOH A . 
G 3 HOH 53  83  83  HOH HOH A . 
G 3 HOH 54  84  84  HOH HOH A . 
G 3 HOH 55  86  86  HOH HOH A . 
G 3 HOH 56  87  87  HOH HOH A . 
G 3 HOH 57  88  88  HOH HOH A . 
G 3 HOH 58  90  90  HOH HOH A . 
G 3 HOH 59  91  91  HOH HOH A . 
G 3 HOH 60  93  93  HOH HOH A . 
G 3 HOH 61  95  95  HOH HOH A . 
G 3 HOH 62  98  98  HOH HOH A . 
G 3 HOH 63  99  99  HOH HOH A . 
G 3 HOH 64  100 100 HOH HOH A . 
G 3 HOH 65  101 101 HOH HOH A . 
G 3 HOH 66  103 103 HOH HOH A . 
G 3 HOH 67  104 104 HOH HOH A . 
G 3 HOH 68  109 109 HOH HOH A . 
G 3 HOH 69  111 111 HOH HOH A . 
G 3 HOH 70  113 113 HOH HOH A . 
G 3 HOH 71  114 114 HOH HOH A . 
G 3 HOH 72  115 115 HOH HOH A . 
G 3 HOH 73  117 117 HOH HOH A . 
G 3 HOH 74  121 121 HOH HOH A . 
G 3 HOH 75  123 123 HOH HOH A . 
G 3 HOH 76  124 124 HOH HOH A . 
G 3 HOH 77  125 125 HOH HOH A . 
G 3 HOH 78  126 126 HOH HOH A . 
G 3 HOH 79  128 128 HOH HOH A . 
G 3 HOH 80  130 130 HOH HOH A . 
G 3 HOH 81  134 134 HOH HOH A . 
G 3 HOH 82  135 135 HOH HOH A . 
G 3 HOH 83  136 136 HOH HOH A . 
G 3 HOH 84  137 137 HOH HOH A . 
G 3 HOH 85  138 138 HOH HOH A . 
G 3 HOH 86  139 139 HOH HOH A . 
G 3 HOH 87  140 140 HOH HOH A . 
G 3 HOH 88  141 141 HOH HOH A . 
G 3 HOH 89  142 142 HOH HOH A . 
G 3 HOH 90  143 143 HOH HOH A . 
G 3 HOH 91  148 148 HOH HOH A . 
G 3 HOH 92  149 149 HOH HOH A . 
G 3 HOH 93  150 150 HOH HOH A . 
G 3 HOH 94  151 151 HOH HOH A . 
G 3 HOH 95  153 153 HOH HOH A . 
G 3 HOH 96  154 154 HOH HOH A . 
G 3 HOH 97  155 155 HOH HOH A . 
G 3 HOH 98  156 156 HOH HOH A . 
G 3 HOH 99  157 157 HOH HOH A . 
G 3 HOH 100 158 158 HOH HOH A . 
G 3 HOH 101 160 160 HOH HOH A . 
G 3 HOH 102 162 162 HOH HOH A . 
G 3 HOH 103 163 163 HOH HOH A . 
G 3 HOH 104 164 164 HOH HOH A . 
G 3 HOH 105 165 165 HOH HOH A . 
G 3 HOH 106 166 166 HOH HOH A . 
G 3 HOH 107 167 167 HOH HOH A . 
G 3 HOH 108 169 169 HOH HOH A . 
G 3 HOH 109 170 170 HOH HOH A . 
G 3 HOH 110 175 175 HOH HOH A . 
G 3 HOH 111 491 176 HOH HOH A . 
G 3 HOH 112 492 179 HOH HOH A . 
G 3 HOH 113 493 182 HOH HOH A . 
G 3 HOH 114 494 183 HOH HOH A . 
G 3 HOH 115 495 185 HOH HOH A . 
G 3 HOH 116 496 186 HOH HOH A . 
G 3 HOH 117 497 188 HOH HOH A . 
G 3 HOH 118 498 190 HOH HOH A . 
G 3 HOH 119 499 191 HOH HOH A . 
G 3 HOH 120 502 194 HOH HOH A . 
G 3 HOH 121 503 195 HOH HOH A . 
G 3 HOH 122 504 196 HOH HOH A . 
G 3 HOH 123 505 199 HOH HOH A . 
G 3 HOH 124 506 200 HOH HOH A . 
G 3 HOH 125 507 202 HOH HOH A . 
G 3 HOH 126 508 203 HOH HOH A . 
G 3 HOH 127 509 204 HOH HOH A . 
G 3 HOH 128 510 205 HOH HOH A . 
G 3 HOH 129 511 207 HOH HOH A . 
G 3 HOH 130 512 208 HOH HOH A . 
G 3 HOH 131 513 211 HOH HOH A . 
G 3 HOH 132 514 212 HOH HOH A . 
G 3 HOH 133 515 214 HOH HOH A . 
G 3 HOH 134 516 216 HOH HOH A . 
G 3 HOH 135 517 217 HOH HOH A . 
G 3 HOH 136 518 218 HOH HOH A . 
G 3 HOH 137 519 219 HOH HOH A . 
G 3 HOH 138 520 221 HOH HOH A . 
G 3 HOH 139 521 223 HOH HOH A . 
G 3 HOH 140 522 224 HOH HOH A . 
G 3 HOH 141 523 225 HOH HOH A . 
G 3 HOH 142 524 226 HOH HOH A . 
G 3 HOH 143 525 228 HOH HOH A . 
G 3 HOH 144 526 229 HOH HOH A . 
G 3 HOH 145 527 231 HOH HOH A . 
G 3 HOH 146 528 232 HOH HOH A . 
G 3 HOH 147 529 233 HOH HOH A . 
G 3 HOH 148 530 234 HOH HOH A . 
G 3 HOH 149 531 235 HOH HOH A . 
G 3 HOH 150 532 238 HOH HOH A . 
G 3 HOH 151 533 241 HOH HOH A . 
G 3 HOH 152 534 242 HOH HOH A . 
G 3 HOH 153 535 243 HOH HOH A . 
G 3 HOH 154 536 246 HOH HOH A . 
G 3 HOH 155 537 249 HOH HOH A . 
G 3 HOH 156 538 251 HOH HOH A . 
G 3 HOH 157 539 252 HOH HOH A . 
G 3 HOH 158 540 253 HOH HOH A . 
G 3 HOH 159 541 255 HOH HOH A . 
G 3 HOH 160 542 256 HOH HOH A . 
G 3 HOH 161 543 257 HOH HOH A . 
G 3 HOH 162 544 258 HOH HOH A . 
G 3 HOH 163 545 261 HOH HOH A . 
G 3 HOH 164 546 262 HOH HOH A . 
G 3 HOH 165 547 266 HOH HOH A . 
G 3 HOH 166 548 269 HOH HOH A . 
G 3 HOH 167 549 271 HOH HOH A . 
G 3 HOH 168 550 273 HOH HOH A . 
G 3 HOH 169 551 274 HOH HOH A . 
G 3 HOH 170 552 275 HOH HOH A . 
G 3 HOH 171 553 280 HOH HOH A . 
G 3 HOH 172 554 283 HOH HOH A . 
G 3 HOH 173 555 284 HOH HOH A . 
G 3 HOH 174 556 285 HOH HOH A . 
G 3 HOH 175 557 286 HOH HOH A . 
G 3 HOH 176 558 289 HOH HOH A . 
G 3 HOH 177 559 291 HOH HOH A . 
G 3 HOH 178 560 292 HOH HOH A . 
G 3 HOH 179 561 293 HOH HOH A . 
G 3 HOH 180 562 294 HOH HOH A . 
G 3 HOH 181 563 297 HOH HOH A . 
G 3 HOH 182 564 298 HOH HOH A . 
G 3 HOH 183 565 299 HOH HOH A . 
G 3 HOH 184 566 300 HOH HOH A . 
G 3 HOH 185 567 301 HOH HOH A . 
G 3 HOH 186 568 304 HOH HOH A . 
G 3 HOH 187 569 305 HOH HOH A . 
G 3 HOH 188 570 311 HOH HOH A . 
G 3 HOH 189 571 314 HOH HOH A . 
G 3 HOH 190 572 315 HOH HOH A . 
G 3 HOH 191 573 316 HOH HOH A . 
G 3 HOH 192 574 319 HOH HOH A . 
G 3 HOH 193 575 320 HOH HOH A . 
G 3 HOH 194 576 321 HOH HOH A . 
G 3 HOH 195 577 324 HOH HOH A . 
G 3 HOH 196 578 325 HOH HOH A . 
G 3 HOH 197 579 326 HOH HOH A . 
G 3 HOH 198 580 331 HOH HOH A . 
G 3 HOH 199 581 333 HOH HOH A . 
G 3 HOH 200 582 337 HOH HOH A . 
G 3 HOH 201 583 341 HOH HOH A . 
G 3 HOH 202 584 342 HOH HOH A . 
G 3 HOH 203 585 343 HOH HOH A . 
G 3 HOH 204 586 346 HOH HOH A . 
G 3 HOH 205 587 347 HOH HOH A . 
G 3 HOH 206 588 348 HOH HOH A . 
G 3 HOH 207 589 351 HOH HOH A . 
G 3 HOH 208 590 352 HOH HOH A . 
G 3 HOH 209 591 356 HOH HOH A . 
G 3 HOH 210 592 357 HOH HOH A . 
G 3 HOH 211 593 358 HOH HOH A . 
G 3 HOH 212 594 359 HOH HOH A . 
G 3 HOH 213 595 360 HOH HOH A . 
G 3 HOH 214 596 361 HOH HOH A . 
G 3 HOH 215 597 364 HOH HOH A . 
G 3 HOH 216 598 365 HOH HOH A . 
G 3 HOH 217 599 368 HOH HOH A . 
G 3 HOH 218 600 369 HOH HOH A . 
G 3 HOH 219 601 370 HOH HOH A . 
G 3 HOH 220 602 372 HOH HOH A . 
G 3 HOH 221 603 373 HOH HOH A . 
G 3 HOH 222 604 374 HOH HOH A . 
G 3 HOH 223 605 375 HOH HOH A . 
G 3 HOH 224 606 376 HOH HOH A . 
G 3 HOH 225 607 377 HOH HOH A . 
G 3 HOH 226 608 380 HOH HOH A . 
G 3 HOH 227 609 383 HOH HOH A . 
G 3 HOH 228 610 385 HOH HOH A . 
G 3 HOH 229 611 387 HOH HOH A . 
G 3 HOH 230 612 388 HOH HOH A . 
G 3 HOH 231 613 390 HOH HOH A . 
G 3 HOH 232 614 392 HOH HOH A . 
G 3 HOH 233 615 393 HOH HOH A . 
G 3 HOH 234 616 397 HOH HOH A . 
G 3 HOH 235 617 400 HOH HOH A . 
G 3 HOH 236 618 402 HOH HOH A . 
G 3 HOH 237 619 404 HOH HOH A . 
G 3 HOH 238 620 405 HOH HOH A . 
G 3 HOH 239 621 407 HOH HOH A . 
G 3 HOH 240 622 410 HOH HOH A . 
G 3 HOH 241 623 412 HOH HOH A . 
G 3 HOH 242 624 413 HOH HOH A . 
G 3 HOH 243 625 416 HOH HOH A . 
G 3 HOH 244 626 417 HOH HOH A . 
G 3 HOH 245 627 419 HOH HOH A . 
G 3 HOH 246 628 420 HOH HOH A . 
G 3 HOH 247 629 421 HOH HOH A . 
G 3 HOH 248 630 422 HOH HOH A . 
G 3 HOH 249 631 423 HOH HOH A . 
G 3 HOH 250 632 426 HOH HOH A . 
G 3 HOH 251 633 427 HOH HOH A . 
G 3 HOH 252 634 428 HOH HOH A . 
G 3 HOH 253 635 429 HOH HOH A . 
G 3 HOH 254 636 430 HOH HOH A . 
G 3 HOH 255 637 432 HOH HOH A . 
G 3 HOH 256 638 433 HOH HOH A . 
H 3 HOH 1   1   1   HOH HOH B . 
H 3 HOH 2   8   8   HOH HOH B . 
H 3 HOH 3   9   9   HOH HOH B . 
H 3 HOH 4   13  13  HOH HOH B . 
H 3 HOH 5   14  14  HOH HOH B . 
H 3 HOH 6   17  17  HOH HOH B . 
H 3 HOH 7   20  20  HOH HOH B . 
H 3 HOH 8   25  25  HOH HOH B . 
H 3 HOH 9   27  27  HOH HOH B . 
H 3 HOH 10  35  35  HOH HOH B . 
H 3 HOH 11  36  36  HOH HOH B . 
H 3 HOH 12  37  37  HOH HOH B . 
H 3 HOH 13  38  38  HOH HOH B . 
H 3 HOH 14  39  39  HOH HOH B . 
H 3 HOH 15  40  40  HOH HOH B . 
H 3 HOH 16  42  42  HOH HOH B . 
H 3 HOH 17  52  52  HOH HOH B . 
H 3 HOH 18  54  54  HOH HOH B . 
H 3 HOH 19  56  56  HOH HOH B . 
H 3 HOH 20  59  59  HOH HOH B . 
H 3 HOH 21  60  60  HOH HOH B . 
H 3 HOH 22  62  62  HOH HOH B . 
H 3 HOH 23  63  63  HOH HOH B . 
H 3 HOH 24  65  65  HOH HOH B . 
H 3 HOH 25  68  68  HOH HOH B . 
H 3 HOH 26  69  69  HOH HOH B . 
H 3 HOH 27  73  73  HOH HOH B . 
H 3 HOH 28  77  77  HOH HOH B . 
H 3 HOH 29  78  78  HOH HOH B . 
H 3 HOH 30  80  80  HOH HOH B . 
H 3 HOH 31  85  85  HOH HOH B . 
H 3 HOH 32  89  89  HOH HOH B . 
H 3 HOH 33  92  92  HOH HOH B . 
H 3 HOH 34  94  94  HOH HOH B . 
H 3 HOH 35  96  96  HOH HOH B . 
H 3 HOH 36  97  97  HOH HOH B . 
H 3 HOH 37  102 102 HOH HOH B . 
H 3 HOH 38  105 105 HOH HOH B . 
H 3 HOH 39  106 106 HOH HOH B . 
H 3 HOH 40  107 107 HOH HOH B . 
H 3 HOH 41  108 108 HOH HOH B . 
H 3 HOH 42  110 110 HOH HOH B . 
H 3 HOH 43  112 112 HOH HOH B . 
H 3 HOH 44  116 116 HOH HOH B . 
H 3 HOH 45  118 118 HOH HOH B . 
H 3 HOH 46  119 119 HOH HOH B . 
H 3 HOH 47  120 120 HOH HOH B . 
H 3 HOH 48  122 122 HOH HOH B . 
H 3 HOH 49  127 127 HOH HOH B . 
H 3 HOH 50  129 129 HOH HOH B . 
H 3 HOH 51  131 131 HOH HOH B . 
H 3 HOH 52  132 132 HOH HOH B . 
H 3 HOH 53  133 133 HOH HOH B . 
H 3 HOH 54  144 144 HOH HOH B . 
H 3 HOH 55  145 145 HOH HOH B . 
H 3 HOH 56  146 146 HOH HOH B . 
H 3 HOH 57  147 147 HOH HOH B . 
H 3 HOH 58  152 152 HOH HOH B . 
H 3 HOH 59  159 159 HOH HOH B . 
H 3 HOH 60  161 161 HOH HOH B . 
H 3 HOH 61  168 168 HOH HOH B . 
H 3 HOH 62  171 171 HOH HOH B . 
H 3 HOH 63  172 172 HOH HOH B . 
H 3 HOH 64  173 173 HOH HOH B . 
H 3 HOH 65  174 174 HOH HOH B . 
H 3 HOH 66  491 177 HOH HOH B . 
H 3 HOH 67  492 178 HOH HOH B . 
H 3 HOH 68  493 180 HOH HOH B . 
H 3 HOH 69  494 181 HOH HOH B . 
H 3 HOH 70  495 184 HOH HOH B . 
H 3 HOH 71  496 187 HOH HOH B . 
H 3 HOH 72  497 189 HOH HOH B . 
H 3 HOH 73  498 192 HOH HOH B . 
H 3 HOH 74  499 193 HOH HOH B . 
H 3 HOH 75  502 197 HOH HOH B . 
H 3 HOH 76  503 198 HOH HOH B . 
H 3 HOH 77  504 201 HOH HOH B . 
H 3 HOH 78  505 206 HOH HOH B . 
H 3 HOH 79  506 209 HOH HOH B . 
H 3 HOH 80  507 210 HOH HOH B . 
H 3 HOH 81  508 213 HOH HOH B . 
H 3 HOH 82  509 215 HOH HOH B . 
H 3 HOH 83  510 220 HOH HOH B . 
H 3 HOH 84  511 222 HOH HOH B . 
H 3 HOH 85  512 227 HOH HOH B . 
H 3 HOH 86  513 230 HOH HOH B . 
H 3 HOH 87  514 236 HOH HOH B . 
H 3 HOH 88  515 237 HOH HOH B . 
H 3 HOH 89  516 239 HOH HOH B . 
H 3 HOH 90  517 240 HOH HOH B . 
H 3 HOH 91  518 244 HOH HOH B . 
H 3 HOH 92  519 245 HOH HOH B . 
H 3 HOH 93  520 247 HOH HOH B . 
H 3 HOH 94  521 248 HOH HOH B . 
H 3 HOH 95  522 250 HOH HOH B . 
H 3 HOH 96  523 254 HOH HOH B . 
H 3 HOH 97  524 259 HOH HOH B . 
H 3 HOH 98  525 260 HOH HOH B . 
H 3 HOH 99  526 263 HOH HOH B . 
H 3 HOH 100 527 264 HOH HOH B . 
H 3 HOH 101 528 265 HOH HOH B . 
H 3 HOH 102 529 267 HOH HOH B . 
H 3 HOH 103 530 268 HOH HOH B . 
H 3 HOH 104 531 270 HOH HOH B . 
H 3 HOH 105 532 272 HOH HOH B . 
H 3 HOH 106 533 276 HOH HOH B . 
H 3 HOH 107 534 277 HOH HOH B . 
H 3 HOH 108 535 278 HOH HOH B . 
H 3 HOH 109 536 279 HOH HOH B . 
H 3 HOH 110 537 281 HOH HOH B . 
H 3 HOH 111 538 282 HOH HOH B . 
H 3 HOH 112 539 287 HOH HOH B . 
H 3 HOH 113 540 288 HOH HOH B . 
H 3 HOH 114 541 290 HOH HOH B . 
H 3 HOH 115 542 295 HOH HOH B . 
H 3 HOH 116 543 296 HOH HOH B . 
H 3 HOH 117 544 302 HOH HOH B . 
H 3 HOH 118 545 303 HOH HOH B . 
H 3 HOH 119 546 306 HOH HOH B . 
H 3 HOH 120 547 307 HOH HOH B . 
H 3 HOH 121 548 308 HOH HOH B . 
H 3 HOH 122 549 309 HOH HOH B . 
H 3 HOH 123 550 310 HOH HOH B . 
H 3 HOH 124 551 312 HOH HOH B . 
H 3 HOH 125 552 313 HOH HOH B . 
H 3 HOH 126 553 317 HOH HOH B . 
H 3 HOH 127 554 318 HOH HOH B . 
H 3 HOH 128 555 322 HOH HOH B . 
H 3 HOH 129 556 323 HOH HOH B . 
H 3 HOH 130 557 327 HOH HOH B . 
H 3 HOH 131 558 328 HOH HOH B . 
H 3 HOH 132 559 329 HOH HOH B . 
H 3 HOH 133 560 330 HOH HOH B . 
H 3 HOH 134 561 332 HOH HOH B . 
H 3 HOH 135 562 334 HOH HOH B . 
H 3 HOH 136 563 335 HOH HOH B . 
H 3 HOH 137 564 336 HOH HOH B . 
H 3 HOH 138 565 338 HOH HOH B . 
H 3 HOH 139 566 339 HOH HOH B . 
H 3 HOH 140 567 340 HOH HOH B . 
H 3 HOH 141 568 344 HOH HOH B . 
H 3 HOH 142 569 345 HOH HOH B . 
H 3 HOH 143 570 349 HOH HOH B . 
H 3 HOH 144 571 350 HOH HOH B . 
H 3 HOH 145 572 353 HOH HOH B . 
H 3 HOH 146 573 354 HOH HOH B . 
H 3 HOH 147 574 355 HOH HOH B . 
H 3 HOH 148 575 362 HOH HOH B . 
H 3 HOH 149 576 363 HOH HOH B . 
H 3 HOH 150 577 366 HOH HOH B . 
H 3 HOH 151 578 367 HOH HOH B . 
H 3 HOH 152 579 371 HOH HOH B . 
H 3 HOH 153 580 378 HOH HOH B . 
H 3 HOH 154 581 379 HOH HOH B . 
H 3 HOH 155 582 381 HOH HOH B . 
H 3 HOH 156 583 382 HOH HOH B . 
H 3 HOH 157 584 384 HOH HOH B . 
H 3 HOH 158 585 386 HOH HOH B . 
H 3 HOH 159 586 389 HOH HOH B . 
H 3 HOH 160 587 391 HOH HOH B . 
H 3 HOH 161 588 394 HOH HOH B . 
H 3 HOH 162 589 395 HOH HOH B . 
H 3 HOH 163 590 396 HOH HOH B . 
H 3 HOH 164 591 398 HOH HOH B . 
H 3 HOH 165 592 399 HOH HOH B . 
H 3 HOH 166 593 401 HOH HOH B . 
H 3 HOH 167 594 406 HOH HOH B . 
H 3 HOH 168 595 408 HOH HOH B . 
H 3 HOH 169 596 409 HOH HOH B . 
H 3 HOH 170 597 411 HOH HOH B . 
H 3 HOH 171 598 414 HOH HOH B . 
H 3 HOH 172 599 415 HOH HOH B . 
H 3 HOH 173 600 418 HOH HOH B . 
H 3 HOH 174 601 424 HOH HOH B . 
H 3 HOH 175 602 425 HOH HOH B . 
H 3 HOH 176 603 431 HOH HOH B . 
#